3AA1B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from ckip-1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa1B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa1B02
3AAAA 3LK2B 3AA7A 5AFUK 1IZNA 2KZ7B 5AFUL 3LK2A 5ADXK 4AKRB 2KZ7A 3LK3B 3AAEB 3AA0B 5ADXL 3AA1B 4AKRA 3LK41 3LK3A 3AA6B 2KXPB 3LK42 3AA0A 3AAEA 3AA1A 3AAAB 3AA6A 2KXPA 3AA7B 1IZNB
chains in the Genus database with same CATH superfamily
1EZ3A 2XQ7A 1IZNA 5E0OA 2G0UA 5LB7B 1BH3A 2DWKA 1KNRA 2PG8A 4EZ4A 4B6XA 2VKDA 2N9DA 1BR2A 4B3TT 3QNUA 4NXMT 4IDZA 1WR0A 2X9YA 3KZIO 2V26A 4LFAT 4X64T 6PRNA 3LK3B 5HEOA 2M67A 4AIUA 2VB6A 4WBNE 4AKRA 2RA1A 2V7JA 4C91A 3ZC0A 1D0ZA 4YJ2E 1J5WA 3H3AA 3AA6A 2NR4A 2VK9A 3LFMA 4BJMA 4OHFA 2QA7A 3HI2A 4J2CA 2E2AA 2X9HA 1WCRA 3PV0F 3EMNX 4YTPA 3PGRA 4EAHA 3HKBE 4DR6T 4U2ZA 3ONLC 2CHNA 2OV9A 1BR0A 2LOSA 2WY2A 4NXNT 4LSEA 4QH1A 1S35A 4FT6A 3BK9A 3AVSA 2PBIA 3ZJ2A 2LHRA 4U7YA 3CQCB 2XMXA 2X9WA 4EOZB 5AQVB 1L0VA 3FBZA 2ZMAA 4I55E 4ZI7E 3C64A 5LHGB 1ZHXA 2XTRA 2N2NA 5HCJA 1XZYA 1ZOYA 3ZSTA 2Q9QB 3K19A 2LSIA 4HTEA 5DL5A 3BQIA 3POQA 4H9QC 4RLCA 3RC8A 2ERVA 3RIFA 5AQLB 3SYBA 4IE4A 5D5DA 2Y48B 4KHPT 1J5ET 1IBMT 2H3RA 4AFKA 1OSMA 4DUZT 1XMOT 4ZZBA 1VCTA 3ZMUB 3UUNA 2DLRA 5FY1A 4B3RT 2FJEA 4AYMC 3BS0A 3UU5A 2XQAA 2EHOD 5DQWA 3UPGA 2JMMA 1KNPA 3FXDB 1YW0A 2LSKA 3EABA 4QXCB 5JDQA 2J1NA 3ANWB 3H37A 2MHLA 3NZPA 1ZKEA 4CN1A 3L09A 3JCUO 1FMVA 4FI5A 1WYCA 3OKQA 4WYVA 3KINB 4L0RA 2CXFA 4E1TA 4HFCA 3UULA 2YOEA 1P4TA 5AQTB 3AB3B 2W66A 3BQLA 5GONE 3BRZA 4OX9T 3WI4A 3AAEA 4ZI3C 5LCYA 4Q25A 2HN1A 2WJQA 3U78A 4MBQA 4CI3B 1MMNA 5ABHA 1HNXT 4FUVA 5H6QB 3SZVA 3ZT6A 4PR7A 2JQQA 3AA1B 4ILUA 4H9RC 3FB2A 4UF0A 1N34T 3PQUA 3UU4A 3ZN1B 2RPAA 4IDPA 2V7LA 3O1IA 4AZLA 1BT9A 4RL9A 1D0XA 3NKZA 3JTYA 3B13A 4XAXB 4Z91A 3VU7H 3POUA 5ABFA 1FIOA 2JRKA 2UXXB 3ABVA 3AEEA 1MIWA 4A5XA 4P0BA 4I50E 4E7ZA 2XPKA 4JI1T 1X9BA 3AE5A 2QGSA 3CK6A 2XZEA 3PUQA 4E1SA 4XBFB 2Y0HA 3LSVA 4QX7B 2GK9A 3MACA 4HWFA 5JDGA 1UURA 2ODUA 3DZMA 4FZMA 2BKOA 1HXUA 4O2BE 3CPZA 3KVAA 3UTKA 5LOVE 2QRXA 5LJNA 3P4QA 5G39A 4CXWA 2CXDA 2Y7SA 1HNWT 1THQA 3UT5E 3I0OA 2W2UA 2B1EA 2X51A 4UR9A 2E9XD 4KMCA 3ETVA 3PDYA 5G38A 4X65T 3ETUA 1YD8G 3ONXA 2WMNA 4X20E 3AAAA 2BBJA 4IE0A 3NRXA 2D2SA 3VE2A 1GQEA 3AE1A 3OTOT 4UB8O 1HX1B 5ETWA 4K0UA 4A56A 2ACZA 4O8SA 4D64A 3D0TA 5LNKA 4ANJA 3JAFA 4DVDA 1W0BA 2XAGB 2DWGA 4QXBB 2N2LA 1MMAA 1Q9GA 3P4WA 5JDPA 2CWOA 1JNRA 4UXNB 4AUIA 5L3BB 5HWXA 2CBIA 3HOLA 4A97A 5J2TE 3A8YC 2X0YA 4IT4A 3E0ZA 2V5DA 2C0SA 3QK6A 3C5OA 4DIDB 3SYSA 4IE7A 3L8RA 1U5PA 3DA3A 1UX4A 5FP3A 2IIUA 4DR3T 3JADA 5HXHA 5DL7A 5LBQB 3AEFA 2LRKA 2YEVC 1LVFA 5AQMB 3EAMA 2BS4A 2CM0A 1YS5A 2PFVA 4U2YA 4KRAA 3JC6D 4ILAA 4IREA 4DV6T 3ZYLA 5F5WA 4OK0A 1V9DA 2FJBA 3AE8A 5HEUA 4FJOA 1MMDA 2E8IA 1KF6A 1WR6A 2XE3A 3LG7A 2H7OA 4EB6E 2YNKA 5C2TA 4GKJT 2NW7A 2KZ7B 2AXTO 2YU2A 3OJAA 5LYJE 2F1TA 4AQGA 4LF7T 4FSOA 3JAEA 2UU9T 4IE5A 2UXNB 3VZUX 3ZJ1A 3Q5DA 2X9KA 5L4HA 3F2EA 3VZTX 3OYZA 5JRCA 4DV0T 2FGQX 2WAUA 5AFUL 1PRNA 4DR7T 2IC6A 2IHR1 2X9XA 2UXBT 2VL0A 5AQKB 5ADXL 4Z8XA 5LA6E 4C4VB 8PRNA 3N9MA 4L5GA 3FZHB 4NUVA 5HWYA 3RQWA 2IAKA 3AE4A 4U3CA 1MIVA 3QOFA 4Z90A 3DP7A 4PW8A 3PTRB 2L9QA 3DA4A 1WLXA 1IJ6A 2P9BA 5EK2A 5CJ5A 3NBXX 2R88A 5ABGA 3AXJA 2WDQA 2KLQA 3ONJA 1OEDB 2NTYA 1GFNA 3NZQA 3UFGA 2LSJA 1Y01A 4F6RC 4N74A 1ZEEA 3VY8X 4OFZA 1N33T 3RH3A 1Z8UA 3SFDA 4ZI3D 4QXHB 2DI4A 2YINA 4BAYB 1HXXA 2CLYB 5ABEA 1MM4A 1N32T 1XNQT 5FVNA 3C4ZA 3ZKRA 1WYBA 3SY7A 5AQUB 4HGAA 1HF8A 1YKEB 3RIAA 2UXDT 3EI0A 3ZMZB 1HG5A 2XQ5A 3UUBA 2H89A 3LK3A 2XM2A 2HHHT 2V1DB 3WI5A 4F8HA 5FXWA 4QH4A 1QUUA 5AQGB 3RHWA 4IE6A 1MNEA 4GCSA 3EHZA 4TWDA 3WAKA 3AA0B 1NWMX 4HFVA 2CPTA 2IW5B 2XTQA 3RYFE 2V6XA 4ZS2A 2BZBA 4DV5T 4TWHA 5C8YE 2XUEA 3LDQB 5DABA 4CN4A 4D5UA 3U3IA 1D1BA 4UIGA 5L2LA 4YFSA 1XMQT 2K3WA 3FYXA 1S5LO 2PRNA 2KXPB 4YSXA 5HAXA 4JV5T 5LGTB 1ORMA 1Q9FA 4DNDA 5FXZA 3IA3A 5AQOB 3ZYMA 2X66A 2W0GA 3O1HA 4UVCB 1T16A 3AVRA 3H3MA 1GFMA 1M7KA 4LMLA 4LFBT 2VQFT 2ZM8A 3T24A 3HL6A 2Q9QA 4KX6A 3VKHA 3SY9A 4MHCA 4CI2B 4K3CA 3PJAA 4I43B 2QVAA 4CZZB 4LMKA 3NVOA 1G8XA 3UU2A 3KVBA 3I9YA 4U33A 4LMJA 4ISSA 5LJMA 4L9IA 1OEDE 5F3JA 4CXXA 3BRYA 2YKSA 2XQ3A 3ZEFB 4PK6A 3GMIA 3OPCA 3AA7B 2ODJA 5CA0E 4AKHA 1OPFA 3RPUA 4CN6A 5JREA 4PAGA 3IBPA 1MNDA 4KHZF 2X68A 2LFUA 1J1JA 2ES0A 1LKXA 4ADZA 5LMUT 3N9NA 1D1CA 2L3LA 3RKGA 3CMLA 1ZHYA 3ANWA 3AAIA 3K8PC 3GN5B 3PURA 3PUGA 2XE1A 3IEEA 5AFUK 1OWAA 4TWFA 3ZT7A 5FL0A 1AJ3A 4GYSA 4TUYE 3AE9A 5ADXK 5J2UE 3PUWF 2Q9QC 1KFYA 1HG2A 4U9CA 4O49A 1QLBA 2FBWA 2WWUA 2WQYA 3HKCE 5JDLA 2I0MA 1HNZT 5B66O 5IYZE 2IWWA 4BUMX 3PUZF 1E54A 3CQGB 5KXJA 2CRBA 4LFCT 2JQYA 3W15B 5FNVE 2JQHA 3AA1A 3KV4A 1T1LA 3A0BO 1UX5A 4TV8E 3RF1A 3CQXC 1D0YA 4G76A 4O3YA 5TISO 5L3GB 5FVKA 3L39A 2C5JA 3CWZB 3N2GE 4N75A 2XHEB 4LF4T 1IAPA 3PQSA 4AISA 1KK7A 4JYAT 1JNZA 3QC9A 5J1GA 4B3ST 4DMVA 4GCPA 3P4RA 3TLTA 4PUXA 4JEHB 3TLWA 3WU2O 3NSGA 2AE9A 1CUNA 3PUAA 1HXTA 2N2MA 3P50A 3N2OA 3HOEA 2V7KA 4EEBA 3O4XE 2WDRA 1Y64B 1UUSA 4NPPA 3FZFB 4B61A 4GOUA 1PHOA 2J47A 5C3JA 4CXYA 3QUJA 3LK42 3K1SA 4GK5E 3ZYKA 2KWHA 4KR8A 2VKJA 2R4NA 1SA0E 4HFIA 5JR9B 4CQIA 3MK7C 2GE4A 4ZI2C 3RIUA 4X62T 2D9DA 3VKGA 4PJJA 2L8KA 2K24A 4F4BA 2DHRA 2K4TA 4CI1B 5KMGP 5JR9C 3K3OA 4IL6O 4TNWA 2A9UA 4GHBA 2M6BA 3JCFA 1H7CA 2KSRA 4G2AA 3AE7A 5IHYA 4DO0A 2HPJA 2LKHA 2BVMA 4FRTA 4JEUB 5IWAT 2Y0LA 5E79O 3ZMTB 2X0HA 2M6IA 2KDYA 3CKDA 3N2KE 4O4JE 4EXTA 2I6HA 2YDQA 1FEWA 5IUXA 3KV6A 1HS7A 2XM1A 3HR0A 4LSHA 4HFHA 3NJTA 2O4VA 3R84B 4ZEYA 1UGOA 2CEAA 4FMSA 2XQ8A 4TV9E 1IJ5A 1QJ8A 4PJMA 4ISTA 4JI4T 4X1YE 4AKGA 5AQPB 3RIUC 4PJLA 2PJQA 2WMOA 2Y2XA 4ZS3A 3LBXB 1G90A 5JH7E 2J4UP 2V6YB 4O4LE 1LVKA 2FJDA 1W9RA 2Y8DA 4AKMA 4COFA 2XQ4A 1IBLT 2BS3A 2XE5A 4DR4T 2KWIB 5JTGA 4JUYA 2K48A 4GF4A 4UV9B 4DV7T 2XAHB 1YQ4A 4QWNB 3S4UA 1CHUA 1QJPA 4FQEA 2KINB 2KZ7A 3OYXA 3ZCJA 3V5UA 2J4GA 4UV8B 3ZLIA 4IDOA 3DTOA 1HR0T 3RLFF 2CA5A 4BJNA 1DU2A 2LSGA 2XQ6A 3V8UA 1N36T 2CBJA 4X1KE 2EHOB 4H63V 1GFPA 5M4YA 3TZGA 5LMNT 3UFEA 2LT3A 2WM9A 1UCUA 4UVAB 5FL1A 4JI2T 5L3EB 3FZMB 4C4VA 4HWDA 3WI3A 5L3DB 3SFEA 3N9OA 1S94A 4YLHA 3E08A 2HPLA 3FZKB 4JI7T 4EYYR 2BG9B 2M07A 2JQKA 2LJLA 2LKGA 2YDSA 4IDQA 3LK2A 3T1YT 5EZYE 3ZMSB 4AKIA 4DMWA 3T1HT 4EGWA 4O2AE 4AYDC 4G75A 2BBHA 4UB6O 2WU2A 3VRBA 4ZXLA 3V5SA 2OMFA 3OVUA 5DL6A 4CTDA 4OYKA 3O1JA 2XTLA 3J9X1 4DV1T 5FXVA 1OEDA 5LXTE 2LOPA 4O4IE 2M06A 5FY7A 2IMLA 4V1Av 3MA9A 4K3BA 5H2FO 5FKYA 5BMVE 2J62A 1US7B 4I0UA 3AE2A 3A0HO 3OBVE 4ZZCA 5GTIO 3ZSSA 2FGRA 4I4TE 5DL8A 3TLSA 1I94T 3PU3A 2PORA 1OXZA 2XQ9A 1ZHZA 2K5BB 5CA1E 2W4XA 5G3AA 4HWIB 2LSYA 2MBGA 4WBOA 1E7PA 3UUMA 3EUHA 3NWIA 2VASA 4BA9A 2XJ7A 3T0SA 2W00A 2YDRA 3FXEB 5AQSB 3RYHE 3RRWA 4GKKT 2F4VT 3UU8A 4UEMA 3O9XA 3AE3A 1YKHB 4EIWA 1W09A 3AA0A 2MYSA 4DR2T 5JRCB 1OEDC 4AYID 5F8PA 4LSFA 3MXZA 2JJ9A 5LGNB 4LF6T 4WW0A 2XY8B 3KBTA 1I6ZA 3B57A 4NIQA 5JDHA 3KBUA 2E9XB 4P0AA 3IF8B 2CLYC 2KXPA 1GFOA 2LLYA 5BR8T 2W81C 3G7GA 4PFPA 1T8BA 2ZLYA 3ESLA 3FHNA 4U72A 3EVYA 2JQ9A 2VWAA 2IC9A 5CFBA 1WRDA 3PUYF 3POXA 1R8IA 2BG9E 2YU1A 5DJQC 4H9PC 2JPFA 1NEKA 1FMWA 4FRXA 5B5EO 1LRZA 3FZLB 2KNDA 5AQNB 4ZI2D 1IBKT 1HFAA 3P8CD 2WZIA 4GIWA 4H9SE 2CWYA 5CGMA 1FJGT 4DV4T 2R6GF 5TAOA 5KDMC 4PJ0O 2UXCT 3UQ4A 1ZHWA 2R4PA 3T20A 2ACXA 3AA7A 5AQFB 5FMNA 3PUSA 2NTXA 1W0AA 2JMKA 4AKLA 3VE1A 2WU5A 5HXCA 3PF1A 4K0KT 2R8AA 3N9LA 4TZ4C 3AEBA 2IUBA 3UUXB 3C98B 4AQYT 1BXWA 2BDEA 2VQET 4DBQA 1MIYA 1IZNB 2ZLDA 5JDFA 4P09A 5HCMA 5JDNA 4TX5A 5FXXA 5KX5E 3KVDD 4FZLA 3GN5A 3QRCA 1BR4A 3RGLA 5HEHA 4OYJA 1ZHTA 3R6NA 1NENA 4JLEA 2IDOB 2OLTA 4HFBA 4FSPA 2WWVA 3RRCA 2F1CX 2ZM2A 1X79A 4O3ZA 4IL4A 2A2FX 3RKOA 3RC3A 2FJAA 3N9QA 4DV3T 2KC0A 2LRLA 3C50A 4U7IA 1Z0PA 4ZHQE 2WP9A 2BKPA 4YJ3E 2XE2A 5L3CB 4AKRB 5LGUB 3JC6C 2LEHA 4D65A 3AA6B 3AE6A 3ZMVB 3VR8A 3CX7B 5LG4A 2CMRA 2R89A 1VOMA 5LBMA 4YTNA 5EE2A 1SUMB 3UU6A 2R4OA 4X1IE 3HW9A 2WDVA 3RQUA 5IYUA 4O4XA 2C5IT 4M1PA 3GWHA 5L4EA 3DWNA 4GCQA 2NW8A 3EDUA 5JDMA 4HWCA 4O3XB 1E1HB 4HWHA 3Q2MA 4IL9A 4KR4A 2MOZA 3A7MA 1ZV4X 2QYWA 1KEYA 1BR1A 4JBWF 4LSIA 3RI5A 3PE0A 3PORA 2LHNA 2XSBA 1SE7A 4A98A 1U4QA 1T98A 4XZCA 4IHJE 2PTFA 2X0LB 4DV2T 2WJRA 3I9WA 4KI0F 1VCSA 4PK5A 4N58A 2ZM6T 4QHOA 2YPVA 3UU3A 4FESA 5HYAA 2XASB 4C69X 2CXLA 4ZOLE 2K0LA 4B3MT 4WNKA 4IGUA 2C5KT 4FOZA 3KFWX 3AEAA 2NW9A 2XAFB 3F31A 2V7IA 1T7SA 3CX6B 2W67A 2BVLA 4YT0A 5CB4E 2H88A 2KT9A 5JR9A 1XDOA 4O4HE 2I59A 3AECA 3A2SX 4ILBA 5HXSA 3HKDE 4YSZA 3MJXA 3RX6A 2A72A 1D1AA 4LF8T 3I1AA 2VVSA 4GYRA 3AEGA 3FBLA 5JVDE 4HFDA 3C51A 4QKNA 4UELA 2XSAA 3NRYA 3N5LA 2IWVA 5FVLA 5AQJB 4NUUA 2RP4A 1HTJF 4QQ1A 4ILCA 3MKDA 1ZHCA 4ERRA 2V5CA 3PGUA 5EK3A 2VL8A 4IDNA 3M65A 2YK0A 2CCQA 4EZHA 2DNXA 3Q5EA 2ODVA 5HXEA 1WFDA 3UQ7A 5LP6E 5AQIB 2J1DG 4AQFA 4LF5T 4YTMA 3TLUA 3AAEB 3GA8A 1YXRA 3KV9A 3VRAA 2DCFA 5A1LA 3PU8A 2VVNA 4MFRA 1SHZC 4LF9T 4JI5T 3HWBA 3SZDA 1XNRT 3K3QC 2BS2A 2AXDS 3UAQA 4DUYT 3SS1A 5JQGE 5H6RB 4MALA 2R4LA 2UUAT 5HXRA 4UF0B 4YHJA 4XNKA 1T72A 4JI6T 1MMGA 4JI0T 3LBXA 2E5VA 2V6YA 3SRZA 3M3ZB 4Z3TA 2D0UA 4YXDA 2DL1A 3T8OA 5ABFB 3P7IA 3C4XA 2QTKA 1GFQA 3IHRA 2WS3A 4HN9A 4AI6A 1E2AA 4U74A 4YSYA 4RJXA 4H9NC 1MM5A 5GV0A 3ZC1A 4X5TA 1G73A 2YN6A 2B76A 4AQFC 4HE8A 4E7SA 3QB5K 1HX8A 2D5UA 2EHOA 3QRAA 5L47A 4AXPA 3RBHA 4C90A 3ZN0B 2MNHA 2D0TA 3DJBA 2SPCA 4JI8T 2VURA 2X67A 5KAIO 3PGSA 2NOXA 4EEDA 2XAQB 4HKAA 4YHHT 2E5LT 3LJCA 1MPFA 3P4PA 2WSSV 2HN2A 3X1DA 3CVRA 4TNVA 4H63H 2BG9A 1QJ9A 3VR9A 4QX8B 3VY9X 1VRBA 4ASKA 2WCAA 4WZXA 3AAAB 2FUPA 3HA4A 4RLBA 4QH5A 2Y0KA 3Q9DA 3O0EA 4AYNA 2WVPA 3SOLA 2CHOA 2W80C 1KNZA 5HEGA 4RJWA 1M62A 3HKEE 3AEDA 3RYCE 2MPKA 4EV6A 2NP9A 4C00A 3PUXF 5EK4A 4FZNA 3KDSE 2V8SV 3B5MA 3VHLA 3SWHA 3KV5A 2F1VA 5FYMA 2N1GA 5AQQB 1QSDA 2EHOC 1YQ3A 4EYUA 3EDVA 2X27X 4AYEC 5LHHB 2WBLA 3K3NA 4U31A 2UUBT 2MAWA 2W63A 4PJNA 3CX8B 5GTHO 3J7Yq 2MTQA 3Q5XA 4O3WA 3WAJA 1UK5A 4JFBA 2JMHA 2BG9C 2XQYA 2Q9QD 2LHFA 2W61A 1H6S1 2LM2A 4O4UA 3VZWX 2Y6XA 3DWOX 3ZPOA 2A3DA 5J0ZA 2ZM0A 3C4WA 2OA5A 2BKNA 4GK0E 4KBMB 4MLKA 2CE7A 5G26A 5PRNA 5LG3A 3N9PA 4X66T 2VKHA 3F57A 4TN7B 2JIWA 3G06A 2UUCT 1HCIA 4P1NA 4PNIA 3TKLB 3RYIE 5AQHB 3GP6A 2H7VC 2XAJB 2WZHA 5DQVA 3BQKA 2KMFA 5T5FA 2E9XA 3L3PA 2LM9A 4KP3C 1B7TA 2HH7A 3LK2B 5LHIB 1O3XA 3ZT5A 3P4SA 4PK4A 3MZKB 4HEAA 2NWBA 4JI3T 3LK41 2Z6EA 5AQRB 4XNLA 2V7MA 2VKOA 3PRNA 3ZCIA 1NAFA 1XDPA 4PFOA 4G63A 4N78D 5KAFO 3Q5WA 3I0QA 2K9AA 5FY0A 3QB5A 2ZFGA 5L3FB 3A5XA 4DR5T 4DBRA 4H9OC 2WB5A 4DR1T 4KUMB 7PRNA 4N59A 3PUVF 4UVBB 2XG6A 4YY3T 5HEJA 4HFEA 4JCHA 3E22E 3AXJB 2LE8A 3PJAJ 3CIRA 3TLVA 1XWMA 2E9XC 2W62A 1ZP0A 4IIJE
chains in the Genus database with same CATH topology
1EZ3A 1WR6A 4CI1B 5KMGP 2XE3A 3LG7A 2H7OA 2MOZA 3K3OA 1ZV4X 4EB6E 5JR9C 1IZNA 4KR4A 2YNKA 2NW7A 5E0OA 2KZ7B 2YU2A 4GHBA 1BR1A 3OJAA 5LYJE 2F1TA 4AQGA 2G0UA 4LSIA 3PE0A 1BH3A 3PORA 2DWKA 1H7CA 2PG8A 4FSOA 2LHNA 4EZ4A 4B6XA 2VKDA 1U4QA 4G2AA 5IHYA 4DO0A 2HPJA 4IE5A 1T98A 2UXNB 2N9DA 4XZCA 3VZUX 4IHJE 2BVMA 3ZJ1A 1BR2A 2X0LB 4FRTA 3I9WA 4JEUB 4PK5A 2Y0LA 3F2EA 3VZTX 4IDZA 3OYZA 3ZMTB 4N58A 5JRCA 2KDYA 3CKDA 3N2KE 2X9YA 4QHOA 4O4JE 2V26A 2FGQX 2WAUA 5AFUL 4EXTA 1PRNA 2YPVA 1FEWA 6PRNA 4FESA 5HYAA 3KV6A 2IC6A 3LK3B 2X9XA 1HS7A 2XASB 4C69X 3HR0A 5ADXL 2M67A 2CXLA 2VB6A 4ZOLE 4Z8XA 5LA6E 3N9MA 4WBNE 2RA1A 2K0LA 4AKRA 2V7JA 4IGUA 4L5GA 4WNKA 4C91A 4LSHA 2C5KT 4NUVA 5HWYA 3ZC0A 2O4VA 4FOZA 2IAKA 3R84B 1D0ZA 4YJ2E 3H3AA 2CEAA 3AA6A 1MIVA 4FMSA 3KFWX 2NW9A 2VK9A 4TV9E 3DP7A 2XAFB 3F31A 4PW8A 2V7IA 3CX6B 3PTRB 1IJ5A 3LFMA 2L9QA 4BJMA 1WLXA 1QJ8A 3DA4A 4PJMA 2BVLA 4ISTA 4OHFA 4X1YE 2QA7A 5CB4E 4AKGA 2KT9A 5JR9A 3HI2A 1IJ6A 4O4HE 2P9BA 4J2CA 2I59A 2X9HA 4PJLA 5EK2A 2PJQA 2WMOA 3A2SX 5HXSA 2Y2XA 3EMNX 4ZS3A 3HKDE 3LBXB 1G90A 5JH7E 2J4UP 3MJXA 4O4LE 3RX6A 3NBXX 4EAHA 2A72A 1D1AA 1LVKA 2Y8DA 2KLQA 3HKBE 3I1AA 4AKMA 4GYRA 2XE5A 1BR0A 2LOSA 3FBLA 2KWIB 2NTYA 5JVDE 4JUYA 3C51A 2K48A 4QKNA 4LSEA 4UELA 3NRYA 3N5LA 1S35A 4GF4A 4UV9B 4FT6A 1GFNA 2XAHB 3NZQA 3BK9A 2LSJA 4NUUA 3AVSA 4QWNB 2RP4A 3S4UA 2PBIA 1HTJF 3ZJ2A 4F6RC 1QJPA 4QQ1A 2LHRA 3MKDA 1ZHCA 1ZEEA 4ERRA 3VY8X 4OFZA 2KINB 2KZ7A 3OYXA 3RH3A 5EK3A 2VL8A 3ZCJA 3M65A 4ZI3D 3CQCB 4QXHB 2XMXA 3V5UA 2DI4A 4UV8B 2X9WA 2YINA 2YK0A 4EOZB 4BAYB 2CCQA 3ZLIA 1HXXA 4EZHA 3DTOA 2CLYB 3FBZA 2DNXA 1MM4A 2CA5A 2ZMAA 4I55E 4BJNA 4ZI7E 2LSGA 3V8UA 3C64A 5FVNA 5LHGB 4X1KE 3C4ZA 2ODVA 5HXEA 1ZHXA 2XTRA 1WYBA 2EHOB 3SY7A 5LP6E 4H63V 2N2NA 2J1DG 1GFPA 4HGAA 4AQFA 5M4YA 1HF8A 1YKEB 3TZGA 2Q9QB 3K19A 2LSIA 4HTEA 5DL5A 3ZMZB 3UFEA 3AAEB 1HG5A 2LT3A 2WM9A 3BQIA 3GA8A 3KV9A 3POQA 1UCUA 4UVAB 2DCFA 5A1LA 3LK3A 3PU8A 4H9QC 5L3EB 4MFRA 1SHZC 3HWBA 4RLCA 3RC8A 2V1DB 3SZDA 2ERVA 3WI3A 5L3DB 3N9OA 3SYBA 3K3QC 3WI5A 1S94A 5FXWA 4YLHA 3E08A 2HPLA 1QUUA 3UAQA 4EYYR 2M07A 4IE6A 1MNEA 2LJLA 4IE4A 3SS1A 4GCSA 5JQGE 5D5DA 5H6RB 4MALA 3LK2A 5EZYE 3ZMSB 4AKIA 4DMWA 2Y48B 2H3RA 3WAKA 4O2AE 1OSMA 4AFKA 3AA0B 5HXRA 4G75A 4AYDC 4UF0B 4YHJA 1NWMX 4XNKA 4HFVA 1MMGA 3LBXA 3V5SA 3ZMUB 2OMFA 2IW5B 3UUNA 2DLRA 5FY1A 3SRZA 5DL6A 4Z3TA 4AYMC 2XTQA 4OYKA 3O1JA 3RYFE 4ZS2A 2D0UA 2BZBA 2XTLA 2EHOD 5DQWA 3J9X1 3UPGA 2JMMA 5FXVA 5C8YE 2XUEA 5LXTE 2LOPA 3T8OA 4O4IE 5DABA 3P7IA 2M06A 3C4XA 4D5UA 2QTKA 3U3IA 3FXDB 5FY7A 1D1BA 1YW0A 3IHRA 4UIGA 1GFQA 4V1Av 4HN9A 4AI6A 2LSKA 3MA9A 5L2LA 4YFSA 5JDQA 4QXCB 2J1NA 4U74A 3ANWB 3FYXA 3H37A 5BMVE 3NZPA 2MHLA 1US7B 2PRNA 2KXPB 4RJXA 4H9NC 1ZKEA 5HAXA 3L09A 1MM5A 3OBVE 5LGTB 1ORMA 1Q9FA 4DNDA 1FMVA 4FI5A 5FXZA 3ZC1A 5GV0A 2FGRA 4I4TE 3ZYMA 2X66A 1WYCA 1G73A 2W0GA 3O1HA 3OKQA 4UVCB 5DL8A 4AQFC 3KINB 4HE8A 3AVRA 4E7SA 3PU3A 1GFMA 2PORA 1OXZA 4L0RA 2CXFA 1ZHZA 2K5BB 1HX8A 2D5UA 2EHOA 4E1TA 3QRAA 3UULA 4AXPA 3RBHA 4C90A 5CA1E 1P4TA 3ZN0B 3AB3B 2ZM8A 3BQLA 2MNHA 5GONE 3HL6A 2Q9QA 2D0TA 3T24A 3DJBA 3VKHA 2SPCA 3SY9A 4MHCA 3WI4A 2LSYA 3AAEA 4ZI3C 2MBGA 4CI2B 5LCYA 4WBOA 2X67A 4I43B 2NOXA 2XAQB 4CZZB 4HKAA 3UUMA 3EUHA 2VASA 3LJCA 1MPFA 4BA9A 2WSSV 3U78A 1G8XA 3T0SA 2W00A 3UU2A 3KVBA 3I9YA 3FXEB 4MBQA 4CI3B 1MMNA 4ISSA 3RYHE 3RRWA 5H6QB 3CVRA 5LJMA 4FUVA 4H63H 4L9IA 3SZVA 1QJ9A 5F3JA 4CXXA 4UEMA 2JQQA 3O9XA 1YKHB 4QX8B 3AA1B 4EIWA 4ILUA 4H9RC 3FB2A 3ZEFB 3VY9X 4PK6A 1VRBA 3AA0A 4ASKA 4UF0A 3PQUA 2MYSA 3ZN1B 3AAAB 3GMIA 5JRCB 2V7LA 3AA7B 2ODJA 5CA0E 4AKHA 3O1IA 4AZLA 3HA4A 1OPFA 4AYID 3RPUA 5F8PA 4RLBA 2Y0KA 1BT9A 3Q9DA 3O0EA 4LSFA 4AYNA 3MXZA 4RL9A 2JJ9A 1D0XA 3SOLA 5JREA 5LGNB 3JTYA 3B13A 4PAGA 4XAXB 4WW0A 2W80C 3VU7H 1KNZA 3POUA 4RJWA 1FIOA 3KBTA 2JRKA 3IBPA 1MNDA 3B57A 2UXXB 2X68A 2LFUA 1MIWA 2ES0A 1LKXA 4P0BA 4ADZA 3HKEE 3N9NA 5JDHA 3KBUA 4I50E 1D1CA 2E9XB 2L3LA 3RYCE 4E7ZA 3CMLA 2NP9A 4P0AA 1ZHYA 3ANWA 3IF8B 5EK4A 4FZNA 2CLYC 3KDSE 2KXPA 3AAIA 1GFOA 3K8PC 3VHLA 2QGSA 2W81C 3SWHA 3KV5A 2F1VA 3GN5B 3PURA 5FYMA 3PUGA 3PUQA 2XE1A 2N1GA 3IEEA 4XBFB 3G7GA 1OWAA 2Y0HA 4E1SA 5AFUK 4QX7B 1QSDA 2EHOC 2GK9A 3MACA 8PRNA 4PFPA 4EYUA 1AJ3A 3EDVA 5JDGA 2ODUA 4GYSA 4TUYE 2X27X 4AYEC 5LHHB 2WBLA 4FZMA 5ADXK 2ZLYA 5J2UE 2Q9QC 3ESLA 3FHNA 3K3NA 4O2BE 1HG2A 4U72A 1HXUA 4O49A 4U9CA 3CPZA 3EVYA 2VWAA 2IC9A 3KVAA 3UTKA 5LOVE 1WRDA 3POXA 2W63A 4PJNA 2YU1A 3CX8B 2WWUA 5LJNA 5DJQC 4H9PC 2JPFA 3HKCE 2MTQA 3Q5XA 4CXWA 1FMWA 5JDLA 3J7Yq 4O3WA 2CXDA 3WAJA 2Y7SA 4FRXA 1LRZA 5IYZE 4BUMX 2KNDA 4ZI2D 1HFAA 3P8CD 4JFBA 2JMHA 4GIWA 4H9SE 1E54A 3CQGB 1THQA 3UT5E 2CWYA 2XQYA 2Q9QD 3I0OA 2W61A 2LHFA 1H6S1 4O4UA 3VZWX 3W15B 2B1EA 2X51A 5FNVE 2Y6XA 2E9XD 4KMCA 5TAOA 3ZPOA 5KDMC 3ETVA 3PDYA 2A3DA 4IIJE 3AA1A 2ZM0A 3C4WA 2OA5A 3ETUA 4GK0E 1YD8G 1ZHWA 3ONXA 4KBMB 3KV4A 2WMNA 4MLKA 2CE7A 5G26A 4X20E 5PRNA 3T20A 3N9PA 3AAAA 1UX5A 2VKHA 2ACXA 4TV8E 3F57A 4IE0A 4TN7B 3AA7A 5FMNA 3PUSA 3NRXA 2NTXA 3CQXC 2D2SA 2JMKA 4AKLA 3VE1A 3VE2A 1D0YA 5HXCA 1HCIA 4G76A 4O3YA 4PNIA 3TKLB 3N9LA 3RYIE 4TZ4C 5L3GB 5ETWA 3GP6A 2H7VC 4K0UA 4A56A 4O8SA 3UUXB 4D64A 3D0TA 2XAJB 5DQVA 5LNKA 3C98B 4ANJA 3BQKA 2KMFA 5T5FA 2E9XA 3L3PA 2LM9A 4DVDA 4KP3C 2BDEA 1B7TA 4DBQA 1BXWA 1MIYA 1IZNB 2HH7A 2C5JA 2ZLDA 5JDFA 3CWZB 4P09A 3LK2B 3N2GE 5JDNA 4TX5A 5LHIB 5FXXA 1O3XA 5KX5E 2XAGB 2DWGA 3KVDD 4FZLA 3GN5A 2XHEB 4QXBB 1IAPA 1BR4A 4PK4A 3PQSA 3QRCA 4OYJA 2N2LA 1MMAA 1ZHTA 1KK7A 3MZKB 3QC9A 4HEAA 3R6NA 2NWBA 4JLEA 5J1GA 1Q9GA 5JDPA 4DMVA 4FSPA 4GCPA 2CWOA 4AUIA 4UXNB 2Z6EA 3LK41 4PUXA 3RRCA 5L3BB 4XNLA 5HWXA 2ZM2A 1X79A 4JEHB 4O3ZA 2V7MA 2VKOA 3NSGA 1CUNA 3PRNA 3PUAA 1HXTA 2N2MA 5J2TE 2A2FX 3HOLA 3ZCIA 1NAFA 3RKOA 3RC3A 3N9QA 2KC0A 3C50A 3E0ZA 4PFOA 1Z0PA 2C0SA 3QK6A 3N2OA 3C5OA 3HOEA 4ZHQE 3SYSA 4IE7A 1U5PA 4YJ3E 2V7KA 5L3CB 4AKRB 1UX4A 4G63A 2XE2A 3DA3A 4N78D 3O4XE 3Q5WA 1Y64B 5LGUB 3I0QA 3JC6C 2LEHA 5FP3A 4B61A 4GOUA 1PHOA 2K9AA 4D65A 3AA6B 5FY0A 3ZMVB 4CXYA 3QUJA 5HXHA 3CX7B 3LK42 5LG4A 4GK5E 2ZFGA 3ZYKA 2KWHA 4KR8A 5DL7A 2CMRA 2VKJA 5LBQB 1VOMA 5LBMA 5L3FB 3A5XA 5EE2A 4DBRA 4H9OC 2YEVC 1LVFA 1SA0E 2CM0A 4KUMB 7PRNA 5JR9B 1YS5A 4N59A 4CQIA 2PFVA 4X1IE 3HW9A 4UVBB 3MK7C 2XG6A 2GE4A 4ZI2C 4KRAA 3JC6D 4O4XA 5IYUA 2C5IT 4JCHA 4M1PA 3GWHA 3VKGA 3E22E 4GCQA 3ZYLA 2NW8A 4PJJA 2L8KA 2LE8A 2K24A 3EDUA 5JDMA 4O3XB 2E9XC 1E1HB 4OK0A 1V9DA 4F4BA 2W62A 2DHRA 3Q2MA 1MMDA 2E8IA 4FJOA 2K4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAA A;  3LK2 B;  3AA7 A;  5AFU K;  1IZN A;  2KZ7 B;  5AFU L;  3LK2 A;  5ADX K;  4AKR B;  2KZ7 A;  3LK3 B;  3AAE B;  3AA0 B;  5ADX L;  3AA1 B;  4AKR A;  3LK4 1;  3LK3 A;  3AA6 B;  2KXP B;  3LK4 2;  3AA0 A;  3AAE A;  3AA1 A;  3AAA B;  3AA6 A;  2KXP A;  3AA7 B;  1IZN B; 
#chains in the Genus database with same CATH topology
 1EZ3 A;  2XQ7 A;  1IZN A;  5E0O A;  2G0U A;  5LB7 B;  1BH3 A;  2DWK A;  1KNR A;  2PG8 A;  4EZ4 A;  4B6X A;  2VKD A;  2N9D A;  1BR2 A;  4B3T T;  3QNU A;  4NXM T;  4IDZ A;  1WR0 A;  2X9Y A;  3KZI O;  2V26 A;  4LFA T;  4X64 T;  6PRN A;  3LK3 B;  5HEO A;  2M67 A;  4AIU A;  2VB6 A;  4WBN E;  4AKR A;  2RA1 A;  2V7J A;  4C91 A;  3ZC0 A;  1D0Z A;  4YJ2 E;  1J5W A;  3H3A A;  3AA6 A;  2NR4 A;  2VK9 A;  3LFM A;  4BJM A;  4OHF A;  2QA7 A;  3HI2 A;  4J2C A;  2E2A A;  2X9H A;  1WCR A;  3PV0 F;  3EMN X;  4YTP A;  3PGR A;  4EAH A;  3HKB E;  4DR6 T;  4U2Z A;  3ONL C;  2CHN A;  2OV9 A;  1BR0 A;  2LOS A;  2WY2 A;  4NXN T;  4LSE A;  4QH1 A;  1S35 A;  4FT6 A;  3BK9 A;  3AVS A;  2PBI A;  3ZJ2 A;  2LHR A;  4U7Y A;  3CQC B;  2XMX A;  2X9W A;  4EOZ B;  5AQV B;  1L0V A;  3FBZ A;  2ZMA A;  4I55 E;  4ZI7 E;  3C64 A;  5LHG B;  1ZHX A;  2XTR A;  2N2N A;  5HCJ A;  1XZY A;  1ZOY A;  3ZST A;  2Q9Q B;  3K19 A;  2LSI A;  4HTE A;  5DL5 A;  3BQI A;  3POQ A;  4H9Q C;  4RLC A;  3RC8 A;  2ERV A;  3RIF A;  5AQL B;  3SYB A;  4IE4 A;  5D5D A;  2Y48 B;  4KHP T;  1J5E T;  1IBM T;  2H3R A;  4AFK A;  1OSM A;  4DUZ T;  1XMO T;  4ZZB A;  1VCT A;  3ZMU B;  3UUN A;  2DLR A;  5FY1 A;  4B3R T;  2FJE A;  4AYM C;  3BS0 A;  3UU5 A;  2XQA A;  2EHO D;  5DQW A;  3UPG A;  2JMM A;  1KNP A;  3FXD B;  1YW0 A;  2LSK A;  3EAB A;  4QXC B;  5JDQ A;  2J1N A;  3ANW B;  3H37 A;  2MHL A;  3NZP A;  1ZKE A;  4CN1 A;  3L09 A;  3JCU O;  1FMV A;  4FI5 A;  1WYC A;  3OKQ A;  4WYV A;  3KIN B;  4L0R A;  2CXF A;  4E1T A;  4HFC A;  3UUL A;  2YOE A;  1P4T A;  5AQT B;  3AB3 B;  2W66 A;  3BQL A;  5GON E;  3BRZ A;  4OX9 T;  3WI4 A;  3AAE A;  4ZI3 C;  5LCY A;  4Q25 A;  2HN1 A;  2WJQ A;  3U78 A;  4MBQ A;  4CI3 B;  1MMN A;  5ABH A;  1HNX T;  4FUV A;  5H6Q B;  3SZV A;  3ZT6 A;  4PR7 A;  2JQQ A;  3AA1 B;  4ILU A;  4H9R C;  3FB2 A;  4UF0 A;  1N34 T;  3PQU A;  3UU4 A;  3ZN1 B;  2RPA A;  4IDP A;  2V7L A;  3O1I A;  4AZL A;  1BT9 A;  4RL9 A;  1D0X A;  3NKZ A;  3JTY A;  3B13 A;  4XAX B;  4Z91 A;  3VU7 H;  3POU A;  5ABF A;  1FIO A;  2JRK A;  2UXX B;  3ABV A;  3AEE A;  1MIW A;  4A5X A;  4P0B A;  4I50 E;  4E7Z A;  2XPK A;  4JI1 T;  1X9B A;  3AE5 A;  2QGS A;  3CK6 A;  2XZE A;  3PUQ A;  4E1S A;  4XBF B;  2Y0H A;  3LSV A;  4QX7 B;  2GK9 A;  3MAC A;  4HWF A;  5JDG A;  1UUR A;  2ODU A;  3DZM A;  4FZM A;  2BKO A;  1HXU A;  4O2B E;  3CPZ A;  3KVA A;  3UTK A;  5LOV E;  2QRX A;  5LJN A;  3P4Q A;  5G39 A;  4CXW A;  2CXD A;  2Y7S A;  1HNW T;  1THQ A;  3UT5 E;  3I0O A;  2W2U A;  2B1E A;  2X51 A;  4UR9 A;  2E9X D;  4KMC A;  3ETV A;  3PDY A;  5G38 A;  4X65 T;  3ETU A;  1YD8 G;  3ONX A;  2WMN A;  4X20 E;  3AAA A;  2BBJ A;  4IE0 A;  3NRX A;  2D2S A;  3VE2 A;  1GQE A;  3AE1 A;  3OTO T;  4UB8 O;  1HX1 B;  5ETW A;  4K0U A;  4A56 A;  2ACZ A;  4O8S A;  4D64 A;  3D0T A;  5LNK A;  4ANJ A;  3JAF A;  4DVD A;  1W0B A;  2XAG B;  2DWG A;  4QXB B;  2N2L A;  1MMA A;  1Q9G A;  3P4W A;  5JDP A;  2CWO A;  1JNR A;  4UXN B;  4AUI A;  5L3B B;  5HWX A;  2CBI A;  3HOL A;  4A97 A;  5J2T E;  3A8Y C;  2X0Y A;  4IT4 A;  3E0Z A;  2V5D A;  2C0S A;  3QK6 A;  3C5O A;  4DID B;  3SYS A;  4IE7 A;  3L8R A;  1U5P A;  3DA3 A;  1UX4 A;  5FP3 A;  2IIU A;  4DR3 T;  3JAD A;  5HXH A;  5DL7 A;  5LBQ B;  3AEF A;  2LRK A;  2YEV C;  1LVF A;  5AQM B;  3EAM A;  2BS4 A;  2CM0 A;  1YS5 A;  2PFV A;  4U2Y A;  4KRA A;  3JC6 D;  4ILA A;  4IRE A;  4DV6 T;  3ZYL A;  5F5W A;  4OK0 A;  1V9D A;  2FJB A;  3AE8 A;  5HEU A;  4FJO A;  1MMD A;  2E8I A;  1KF6 A;  1WR6 A;  2XE3 A;  3LG7 A;  2H7O A;  4EB6 E;  2YNK A;  5C2T A;  4GKJ T;  2NW7 A;  2KZ7 B;  2AXT O;  2YU2 A;  3OJA A;  5LYJ E;  2F1T A;  4AQG A;  4LF7 T;  4FSO A;  3JAE A;  2UU9 T;  4IE5 A;  2UXN B;  3VZU X;  3ZJ1 A;  3Q5D A;  2X9K A;  5L4H A;  3F2E A;  3VZT X;  3OYZ A;  5JRC A;  4DV0 T;  2FGQ X;  2WAU A;  5AFU L;  1PRN A;  4DR7 T;  2IC6 A;  2IHR 1;  2X9X A;  2UXB T;  2VL0 A;  5AQK B;  5ADX L;  4Z8X A;  5LA6 E;  4C4V B;  8PRN A;  3N9M A;  4L5G A;  3FZH B;  4NUV A;  5HWY A;  3RQW A;  2IAK A;  3AE4 A;  4U3C A;  1MIV A;  3QOF A;  4Z90 A;  3DP7 A;  4PW8 A;  3PTR B;  2L9Q A;  3DA4 A;  1WLX A;  1IJ6 A;  2P9B A;  5EK2 A;  5CJ5 A;  3NBX X;  2R88 A;  5ABG A;  3AXJ A;  2WDQ A;  2KLQ A;  3ONJ A;  1OED B;  2NTY A;  1GFN A;  3NZQ A;  3UFG A;  2LSJ A;  1Y01 A;  4F6R C;  4N74 A;  1ZEE A;  3VY8 X;  4OFZ A;  1N33 T;  3RH3 A;  1Z8U A;  3SFD A;  4ZI3 D;  4QXH B;  2DI4 A;  2YIN A;  4BAY B;  1HXX A;  2CLY B;  5ABE A;  1MM4 A;  1N32 T;  1XNQ T;  5FVN A;  3C4Z A;  3ZKR A;  1WYB A;  3SY7 A;  5AQU B;  4HGA A;  1HF8 A;  1YKE B;  3RIA A;  2UXD T;  3EI0 A;  3ZMZ B;  1HG5 A;  2XQ5 A;  3UUB A;  2H89 A;  3LK3 A;  2XM2 A;  2HHH T;  2V1D B;  3WI5 A;  4F8H A;  5FXW A;  4QH4 A;  1QUU A;  5AQG B;  3RHW A;  4IE6 A;  1MNE A;  4GCS A;  3EHZ A;  4TWD A;  3WAK A;  3AA0 B;  1NWM X;  4HFV A;  2CPT A;  2IW5 B;  2XTQ A;  3RYF E;  2V6X A;  4ZS2 A;  2BZB A;  4DV5 T;  4TWH A;  5C8Y E;  2XUE A;  3LDQ B;  5DAB A;  4CN4 A;  4D5U A;  3U3I A;  1D1B A;  4UIG A;  5L2L A;  4YFS A;  1XMQ T;  2K3W A;  3FYX A;  1S5L O;  2PRN A;  2KXP B;  4YSX A;  5HAX A;  4JV5 T;  5LGT B;  1ORM A;  1Q9F A;  4DND A;  5FXZ A;  3IA3 A;  5AQO B;  3ZYM A;  2X66 A;  2W0G A;  3O1H A;  4UVC B;  1T16 A;  3AVR A;  3H3M A;  1GFM A;  1M7K A;  4LML A;  4LFB T;  2VQF T;  2ZM8 A;  3T24 A;  3HL6 A;  2Q9Q A;  4KX6 A;  3VKH A;  3SY9 A;  4MHC A;  4CI2 B;  4K3C A;  3PJA A;  4I43 B;  2QVA A;  4CZZ B;  4LMK A;  3NVO A;  1G8X A;  3UU2 A;  3KVB A;  3I9Y A;  4U33 A;  4LMJ A;  4ISS A;  5LJM A;  4L9I A;  1OED E;  5F3J A;  4CXX A;  3BRY A;  2YKS A;  2XQ3 A;  3ZEF B;  4PK6 A;  3GMI A;  3OPC A;  3AA7 B;  2ODJ A;  5CA0 E;  4AKH A;  1OPF A;  3RPU A;  4CN6 A;  5JRE A;  4PAG A;  3IBP A;  1MND A;  4KHZ F;  2X68 A;  2LFU A;  1J1J A;  2ES0 A;  1LKX A;  4ADZ A;  5LMU T;  3N9N A;  1D1C A;  2L3L A;  3RKG A;  3CML A;  1ZHY A;  3ANW A;  3AAI A;  3K8P C;  3GN5 B;  3PUR A;  3PUG A;  2XE1 A;  3IEE A;  5AFU K;  1OWA A;  4TWF A;  3ZT7 A;  5FL0 A;  1AJ3 A;  4GYS A;  4TUY E;  3AE9 A;  5ADX K;  5J2U E;  3PUW F;  2Q9Q C;  1KFY A;  1HG2 A;  4U9C A;  4O49 A;  1QLB A;  2FBW A;  2WWU A;  2WQY A;  3HKC E;  5JDL A;  2I0M A;  1HNZ T;  5B66 O;  5IYZ E;  2IWW A;  4BUM X;  3PUZ F;  1E54 A;  3CQG B;  5KXJ A;  2CRB A;  4LFC T;  2JQY A;  3W15 B;  5FNV E;  2JQH A;  3AA1 A;  3KV4 A;  1T1L A;  3A0B O;  1UX5 A;  4TV8 E;  3RF1 A;  3CQX C;  1D0Y A;  4G76 A;  4O3Y A;  5TIS O;  5L3G B;  5FVK A;  3L39 A;  2C5J A;  3CWZ B;  3N2G E;  4N75 A;  2XHE B;  4LF4 T;  1IAP A;  3PQS A;  4AIS A;  1KK7 A;  4JYA T;  1JNZ A;  3QC9 A;  5J1G A;  4B3S T;  4DMV A;  4GCP A;  3P4R A;  3TLT A;  4PUX A;  4JEH B;  3TLW A;  3WU2 O;  3NSG A;  2AE9 A;  1CUN A;  3PUA A;  1HXT A;  2N2M A;  3P50 A;  3N2O A;  3HOE A;  2V7K A;  4EEB A;  3O4X E;  2WDR A;  1Y64 B;  1UUS A;  4NPP A;  3FZF B;  4B61 A;  4GOU A;  1PHO A;  2J47 A;  5C3J A;  4CXY A;  3QUJ A;  3LK4 2;  3K1S A;  4GK5 E;  3ZYK A;  2KWH A;  4KR8 A;  2VKJ A;  2R4N A;  1SA0 E;  4HFI A;  5JR9 B;  4CQI A;  3MK7 C;  2GE4 A;  4ZI2 C;  3RIU A;  4X62 T;  2D9D A;  3VKG A;  4PJJ A;  2L8K A;  2K24 A;  4F4B A;  2DHR A;  2K4T A;  4CI1 B;  5KMG P;  5JR9 C;  3K3O A;  4IL6 O;  4TNW A;  2A9U A;  4GHB A;  2M6B A;  3JCF A;  1H7C A;  2KSR A;  4G2A A;  3AE7 A;  5IHY A;  4DO0 A;  2HPJ A;  2LKH A;  2BVM A;  4FRT A;  4JEU B;  5IWA T;  2Y0L A;  5E79 O;  3ZMT B;  2X0H A;  2M6I A;  2KDY A;  3CKD A;  3N2K E;  4O4J E;  4EXT A;  2I6H A;  2YDQ A;  1FEW A;  5IUX A;  3KV6 A;  1HS7 A;  2XM1 A;  3HR0 A;  4LSH A;  4HFH A;  3NJT A;  2O4V A;  3R84 B;  4ZEY A;  1UGO A;  2CEA A;  4FMS A;  2XQ8 A;  4TV9 E;  1IJ5 A;  1QJ8 A;  4PJM A;  4IST A;  4JI4 T;  4X1Y E;  4AKG A;  5AQP B;  3RIU C;  4PJL A;  2PJQ A;  2WMO A;  2Y2X A;  4ZS3 A;  3LBX B;  1G90 A;  5JH7 E;  2J4U P;  2V6Y B;  4O4L E;  1LVK A;  2FJD A;  1W9R A;  2Y8D A;  4AKM A;  4COF A;  2XQ4 A;  1IBL T;  2BS3 A;  2XE5 A;  4DR4 T;  2KWI B;  5JTG A;  4JUY A;  2K48 A;  4GF4 A;  4UV9 B;  4DV7 T;  2XAH B;  1YQ4 A;  4QWN B;  3S4U A;  1CHU A;  1QJP A;  4FQE A;  2KIN B;  2KZ7 A;  3OYX A;  3ZCJ A;  3V5U A;  2J4G A;  4UV8 B;  3ZLI A;  4IDO A;  3DTO A;  1HR0 T;  3RLF F;  2CA5 A;  4BJN A;  1DU2 A;  2LSG A;  2XQ6 A;  3V8U A;  1N36 T;  2CBJ A;  4X1K E;  2EHO B;  4H63 V;  1GFP A;  5M4Y A;  3TZG A;  5LMN T;  3UFE A;  2LT3 A;  2WM9 A;  1UCU A;  4UVA B;  5FL1 A;  4JI2 T;  5L3E B;  3FZM B;  4C4V A;  4HWD A;  3WI3 A;  5L3D B;  3SFE A;  3N9O A;  1S94 A;  4YLH A;  3E08 A;  2HPL A;  3FZK B;  4JI7 T;  4EYY R;  2BG9 B;  2M07 A;  2JQK A;  2LJL A;  2LKG A;  2YDS A;  4IDQ A;  3LK2 A;  3T1Y T;  5EZY E;  3ZMS B;  4AKI A;  4DMW A;  3T1H T;  4EGW A;  4O2A E;  4AYD C;  4G75 A;  2BBH A;  4UB6 O;  2WU2 A;  3VRB A;  4ZXL A;  3V5S A;  2OMF A;  3OVU A;  5DL6 A;  4CTD A;  4OYK A;  3O1J A;  2XTL A;  3J9X 1;  4DV1 T;  5FXV A;  1OED A;  5LXT E;  2LOP A;  4O4I E;  2M06 A;  5FY7 A;  2IML A;  4V1A v;  3MA9 A;  4K3B A;  5H2F O;  5FKY A;  5BMV E;  2J62 A;  1US7 B;  4I0U A;  3AE2 A;  3A0H O;  3OBV E;  4ZZC A;  5GTI O;  3ZSS A;  2FGR A;  4I4T E;  5DL8 A;  3TLS A;  1I94 T;  3PU3 A;  2POR A;  1OXZ A;  2XQ9 A;  1ZHZ A;  2K5B B;  5CA1 E;  2W4X A;  5G3A A;  4HWI B;  2LSY A;  2MBG A;  4WBO A;  1E7P A;  3UUM A;  3EUH A;  3NWI A;  2VAS A;  4BA9 A;  2XJ7 A;  3T0S A;  2W00 A;  2YDR A;  3FXE B;  5AQS B;  3RYH E;  3RRW A;  4GKK T;  2F4V T;  3UU8 A;  4UEM A;  3O9X A;  3AE3 A;  1YKH B;  4EIW A;  1W09 A;  3AA0 A;  2MYS A;  4DR2 T;  5JRC B;  1OED C;  4AYI D;  5F8P A;  4LSF A;  3MXZ A;  2JJ9 A;  5LGN B;  4LF6 T;  4WW0 A;  2XY8 B;  3KBT A;  1I6Z A;  3B57 A;  4NIQ A;  5JDH A;  3KBU A;  2E9X B;  4P0A A;  3IF8 B;  2CLY C;  2KXP A;  1GFO A;  2LLY A;  5BR8 T;  2W81 C;  3G7G A;  4PFP A;  1T8B A;  2ZLY A;  3ESL A;  3FHN A;  4U72 A;  3EVY A;  2JQ9 A;  2VWA A;  2IC9 A;  5CFB A;  1WRD A;  3PUY F;  3POX A;  1R8I A;  2BG9 E;  2YU1 A;  5DJQ C;  4H9P C;  2JPF A;  1NEK A;  1FMW A;  4FRX A;  5B5E O;  1LRZ A;  3FZL B;  2KND A;  5AQN B;  4ZI2 D;  1IBK T;  1HFA A;  3P8C D;  2WZI A;  4GIW A;  4H9S E;  2CWY A;  5CGM A;  1FJG T;  4DV4 T;  2R6G F;  5TAO A;  5KDM C;  4PJ0 O;  2UXC T;  3UQ4 A;  1ZHW A;  2R4P A;  3T20 A;  2ACX A;  3AA7 A;  5AQF B;  5FMN A;  3PUS A;  2NTX A;  1W0A A;  2JMK A;  4AKL A;  3VE1 A;  2WU5 A;  5HXC A;  3PF1 A;  4K0K T;  2R8A A;  3N9L A;  4TZ4 C;  3AEB A;  2IUB A;  3UUX B;  3C98 B;  4AQY T;  1BXW A;  2BDE A;  2VQE T;  4DBQ A;  1MIY A;  1IZN B;  2ZLD A;  5JDF A;  4P09 A;  5HCM A;  5JDN A;  4TX5 A;  5FXX A;  5KX5 E;  3KVD D;  4FZL A;  3GN5 A;  3QRC A;  1BR4 A;  3RGL A;  5HEH A;  4OYJ A;  1ZHT A;  3R6N A;  1NEN A;  4JLE A;  2IDO B;  2OLT A;  4HFB A;  4FSP A;  2WWV A;  3RRC A;  2F1C X;  2ZM2 A;  1X79 A;  4O3Z A;  4IL4 A;  2A2F X;  3RKO A;  3RC3 A;  2FJA A;  3N9Q A;  4DV3 T;  2KC0 A;  2LRL A;  3C50 A;  4U7I A;  1Z0P A;  4ZHQ E;  2WP9 A;  2BKP A;  4YJ3 E;  2XE2 A;  5L3C B;  4AKR B;  5LGU B;  3JC6 C;  2LEH A;  4D65 A;  3AA6 B;  3AE6 A;  3ZMV B;  3VR8 A;  3CX7 B;  5LG4 A;  2CMR A;  2R89 A;  1VOM A;  5LBM A;  4YTN A;  5EE2 A;  1SUM B;  3UU6 A;  2R4O A;  4X1I E;  3HW9 A;  2WDV A;  3RQU A;  5IYU A;  4O4X A;  2C5I T;  4M1P A;  3GWH A;  5L4E A;  3DWN A;  4GCQ A;  2NW8 A;  3EDU A;  5JDM A;  4HWC A;  4O3X B;  1E1H B;  4HWH A;  3Q2M A;  4IL9 A;  4KR4 A;  2MOZ A;  3A7M A;  1ZV4 X;  2QYW A;  1KEY A;  1BR1 A;  4JBW F;  4LSI A;  3RI5 A;  3PE0 A;  3POR A;  2LHN A;  2XSB A;  1SE7 A;  4A98 A;  1U4Q A;  1T98 A;  4XZC A;  4IHJ E;  2PTF A;  2X0L B;  4DV2 T;  2WJR A;  3I9W A;  4KI0 F;  1VCS A;  4PK5 A;  4N58 A;  2ZM6 T;  4QHO A;  2YPV A;  3UU3 A;  4FES A;  5HYA A;  2XAS B;  4C69 X;  2CXL A;  4ZOL E;  2K0L A;  4B3M T;  4WNK A;  4IGU A;  2C5K T;  4FOZ A;  3KFW X;  3AEA A;  2NW9 A;  2XAF B;  3F31 A;  2V7I A;  1T7S A;  3CX6 B;  2W67 A;  2BVL A;  4YT0 A;  5CB4 E;  2H88 A;  2KT9 A;  5JR9 A;  1XDO A;  4O4H E;  2I59 A;  3AEC A;  3A2S X;  4ILB A;  5HXS A;  3HKD E;  4YSZ A;  3MJX A;  3RX6 A;  2A72 A;  1D1A A;  4LF8 T;  3I1A A;  2VVS A;  4GYR A;  3AEG A;  3FBL A;  5JVD E;  4HFD A;  3C51 A;  4QKN A;  4UEL A;  2XSA A;  3NRY A;  3N5L A;  2IWV A;  5FVL A;  5AQJ B;  4NUU A;  2RP4 A;  1HTJ F;  4QQ1 A;  4ILC A;  3MKD A;  1ZHC A;  4ERR A;  2V5C A;  3PGU A;  5EK3 A;  2VL8 A;  4IDN A;  3M65 A;  2YK0 A;  2CCQ A;  4EZH A;  2DNX A;  3Q5E A;  2ODV A;  5HXE A;  1WFD A;  3UQ7 A;  5LP6 E;  5AQI B;  2J1D G;  4AQF A;  4LF5 T;  4YTM A;  3TLU A;  3AAE B;  3GA8 A;  1YXR A;  3KV9 A;  3VRA A;  2DCF A;  5A1L A;  3PU8 A;  2VVN A;  4MFR A;  1SHZ C;  4LF9 T;  4JI5 T;  3HWB A;  3SZD A;  1XNR T;  3K3Q C;  2BS2 A;  2AXD S;  3UAQ A;  4DUY T;  3SS1 A;  5JQG E;  5H6R B;  4MAL A;  2R4L A;  2UUA T;  5HXR A;  4UF0 B;  4YHJ A;  4XNK A;  1T72 A;  4JI6 T;  1MMG A;  4JI0 T;  3LBX A;  2E5V A;  2V6Y A;  3SRZ A;  3M3Z B;  4Z3T A;  2D0U A;  4YXD A;  2DL1 A;  3T8O A;  5ABF B;  3P7I A;  3C4X A;  2QTK A;  1GFQ A;  3IHR A;  2WS3 A;  4HN9 A;  4AI6 A;  1E2A A;  4U74 A;  4YSY A;  4RJX A;  4H9N C;  1MM5 A;  5GV0 A;  3ZC1 A;  4X5T A;  1G73 A;  2YN6 A;  2B76 A;  4AQF C;  4HE8 A;  4E7S A;  3QB5 K;  1HX8 A;  2D5U A;  2EHO A;  3QRA A;  5L47 A;  4AXP A;  3RBH A;  4C90 A;  3ZN0 B;  2MNH A;  2D0T A;  3DJB A;  2SPC A;  4JI8 T;  2VUR A;  2X67 A;  5KAI O;  3PGS A;  2NOX A;  4EED A;  2XAQ B;  4HKA A;  4YHH T;  2E5L T;  3LJC A;  1MPF A;  3P4P A;  2WSS V;  2HN2 A;  3X1D A;  3CVR A;  4TNV A;  4H63 H;  2BG9 A;  1QJ9 A;  3VR9 A;  4QX8 B;  3VY9 X;  1VRB A;  4ASK A;  2WCA A;  4WZX A;  3AAA B;  2FUP A;  3HA4 A;  4RLB A;  4QH5 A;  2Y0K A;  3Q9D A;  3O0E A;  4AYN A;  2WVP A;  3SOL A;  2CHO A;  2W80 C;  1KNZ A;  5HEG A;  4RJW A;  1M62 A;  3HKE E;  3AED A;  3RYC E;  2MPK A;  4EV6 A;  2NP9 A;  4C00 A;  3PUX F;  5EK4 A;  4FZN A;  3KDS E;  2V8S V;  3B5M A;  3VHL A;  3SWH A;  3KV5 A;  2F1V A;  5FYM A;  2N1G A;  5AQQ B;  1QSD A;  2EHO C;  1YQ3 A;  4EYU A;  3EDV A;  2X27 X;  4AYE C;  5LHH B;  2WBL A;  3K3N A;  4U31 A;  2UUB T;  2MAW A;  2W63 A;  4PJN A;  3CX8 B;  5GTH O;  3J7Y q;  2MTQ A;  3Q5X A;  4O3W A;  3WAJ A;  1UK5 A;  4JFB A;  2JMH A;  2BG9 C;  2XQY A;  2Q9Q D;  2LHF A;  2W61 A;  1H6S 1;  2LM2 A;  4O4U A;  3VZW X;  2Y6X A;  3DWO X;  3ZPO A;  2A3D A;  5J0Z A;  2ZM0 A;  3C4W A;  2OA5 A;  2BKN A;  4GK0 E;  4KBM B;  4MLK A;  2CE7 A;  5G26 A;  5PRN A;  5LG3 A;  3N9P A;  4X66 T;  2VKH A;  3F57 A;  4TN7 B;  2JIW A;  3G06 A;  2UUC T;  1HCI A;  4P1N A;  4PNI A;  3TKL B;  3RYI E;  5AQH B;  3GP6 A;  2H7V C;  2XAJ B;  2WZH A;  5DQV A;  3BQK A;  2KMF A;  5T5F A;  2E9X A;  3L3P A;  2LM9 A;  4KP3 C;  1B7T A;  2HH7 A;  3LK2 B;  5LHI B;  1O3X A;  3ZT5 A;  3P4S A;  4PK4 A;  3MZK B;  4HEA A;  2NWB A;  4JI3 T;  3LK4 1;  2Z6E A;  5AQR B;  4XNL A;  2V7M A;  2VKO A;  3PRN A;  3ZCI A;  1NAF A;  1XDP A;  4PFO A;  4G63 A;  4N78 D;  5KAF O;  3Q5W A;  3I0Q A;  2K9A A;  5FY0 A;  3QB5 A;  2ZFG A;  5L3F B;  3A5X A;  4DR5 T;  4DBR A;  4H9O C;  2WB5 A;  4DR1 T;  4KUM B;  7PRN A;  4N59 A;  3PUV F;  4UVB B;  2XG6 A;  4YY3 T;  5HEJ A;  4HFE A;  4JCH A;  3E22 E;  3AXJ B;  2LE8 A;  3PJA J;  3CIR A;  3TLV A;  1XWM A;  2E9X C;  2W62 A;  1ZP0 A;  4IIJ E; 
#chains in the Genus database with same CATH homology
 1EZ3 A;  1WR6 A;  4CI1 B;  5KMG P;  2XE3 A;  3LG7 A;  2H7O A;  2MOZ A;  3K3O A;  1ZV4 X;  4EB6 E;  5JR9 C;  1IZN A;  4KR4 A;  2YNK A;  2NW7 A;  5E0O A;  2KZ7 B;  2YU2 A;  4GHB A;  1BR1 A;  3OJA A;  5LYJ E;  2F1T A;  4AQG A;  2G0U A;  4LSI A;  3PE0 A;  1BH3 A;  3POR A;  2DWK A;  1H7C A;  2PG8 A;  4FSO A;  2LHN A;  4EZ4 A;  4B6X A;  2VKD A;  1U4Q A;  4G2A A;  5IHY A;  4DO0 A;  2HPJ A;  4IE5 A;  1T98 A;  2UXN B;  2N9D A;  4XZC A;  3VZU X;  4IHJ E;  2BVM A;  3ZJ1 A;  1BR2 A;  2X0L B;  4FRT A;  3I9W A;  4JEU B;  4PK5 A;  2Y0L A;  3F2E A;  3VZT X;  4IDZ A;  3OYZ A;  3ZMT B;  4N58 A;  5JRC A;  2KDY A;  3CKD A;  3N2K E;  2X9Y A;  4QHO A;  4O4J E;  2V26 A;  2FGQ X;  2WAU A;  5AFU L;  4EXT A;  1PRN A;  2YPV A;  1FEW A;  6PRN A;  4FES A;  5HYA A;  3KV6 A;  2IC6 A;  3LK3 B;  2X9X A;  1HS7 A;  2XAS B;  4C69 X;  3HR0 A;  5ADX L;  2M67 A;  2CXL A;  2VB6 A;  4ZOL E;  4Z8X A;  5LA6 E;  3N9M A;  4WBN E;  2RA1 A;  2K0L A;  4AKR A;  2V7J A;  4IGU A;  4L5G A;  4WNK A;  4C91 A;  4LSH A;  2C5K T;  4NUV A;  5HWY A;  3ZC0 A;  2O4V A;  4FOZ A;  2IAK A;  3R84 B;  1D0Z A;  4YJ2 E;  3H3A A;  2CEA A;  3AA6 A;  1MIV A;  4FMS A;  3KFW X;  2NW9 A;  2VK9 A;  4TV9 E;  3DP7 A;  2XAF B;  3F31 A;  4PW8 A;  2V7I A;  3CX6 B;  3PTR B;  1IJ5 A;  3LFM A;  2L9Q A;  4BJM A;  1WLX A;  1QJ8 A;  3DA4 A;  4PJM A;  2BVL A;  4IST A;  4OHF A;  4X1Y E;  2QA7 A;  5CB4 E;  4AKG A;  2KT9 A;  5JR9 A;  3HI2 A;  1IJ6 A;  4O4H E;  2P9B A;  4J2C A;  2I59 A;  2X9H A;  4PJL A;  5EK2 A;  2PJQ A;  2WMO A;  3A2S X;  5HXS A;  2Y2X A;  3EMN X;  4ZS3 A;  3HKD E;  3LBX B;  1G90 A;  5JH7 E;  2J4U P;  3MJX A;  4O4L E;  3RX6 A;  3NBX X;  4EAH A;  2A72 A;  1D1A A;  1LVK A;  2Y8D A;  2KLQ A;  3HKB E;  3I1A A;  4AKM A;  4GYR A;  2XE5 A;  1BR0 A;  2LOS A;  3FBL A;  2KWI B;  2NTY A;  5JVD E;  4JUY A;  3C51 A;  2K48 A;  4QKN A;  4LSE A;  4UEL A;  3NRY A;  3N5L A;  1S35 A;  4GF4 A;  4UV9 B;  4FT6 A;  1GFN A;  2XAH B;  3NZQ A;  3BK9 A;  2LSJ A;  4NUU A;  3AVS A;  4QWN B;  2RP4 A;  3S4U A;  2PBI A;  1HTJ F;  3ZJ2 A;  4F6R C;  1QJP A;  4QQ1 A;  2LHR A;  3MKD A;  1ZHC A;  1ZEE A;  4ERR A;  3VY8 X;  4OFZ A;  2KIN B;  2KZ7 A;  3OYX A;  3RH3 A;  5EK3 A;  2VL8 A;  3ZCJ A;  3M65 A;  4ZI3 D;  3CQC B;  4QXH B;  2XMX A;  3V5U A;  2DI4 A;  4UV8 B;  2X9W A;  2YIN A;  2YK0 A;  4EOZ B;  4BAY B;  2CCQ A;  3ZLI A;  1HXX A;  4EZH A;  3DTO A;  2CLY B;  3FBZ A;  2DNX A;  1MM4 A;  2CA5 A;  2ZMA A;  4I55 E;  4BJN A;  4ZI7 E;  2LSG A;  3V8U A;  3C64 A;  5FVN A;  5LHG B;  4X1K E;  3C4Z A;  2ODV A;  5HXE A;  1ZHX A;  2XTR A;  1WYB A;  2EHO B;  3SY7 A;  5LP6 E;  4H63 V;  2N2N A;  2J1D G;  1GFP A;  4HGA A;  4AQF A;  5M4Y A;  1HF8 A;  1YKE B;  3TZG A;  2Q9Q B;  3K19 A;  2LSI A;  4HTE A;  5DL5 A;  3ZMZ B;  3UFE A;  3AAE B;  1HG5 A;  2LT3 A;  2WM9 A;  3BQI A;  3GA8 A;  3KV9 A;  3POQ A;  1UCU A;  4UVA B;  2DCF A;  5A1L A;  3LK3 A;  3PU8 A;  4H9Q C;  5L3E B;  4MFR A;  1SHZ C;  3HWB A;  4RLC A;  3RC8 A;  2V1D B;  3SZD A;  2ERV A;  3WI3 A;  5L3D B;  3N9O A;  3SYB A;  3K3Q C;  3WI5 A;  1S94 A;  5FXW A;  4YLH A;  3E08 A;  2HPL A;  1QUU A;  3UAQ A;  4EYY R;  2M07 A;  4IE6 A;  1MNE A;  2LJL A;  4IE4 A;  3SS1 A;  4GCS A;  5JQG E;  5D5D A;  5H6R B;  4MAL A;  3LK2 A;  5EZY E;  3ZMS B;  4AKI A;  4DMW A;  2Y48 B;  2H3R A;  3WAK A;  4O2A E;  1OSM A;  4AFK A;  3AA0 B;  5HXR A;  4G75 A;  4AYD C;  4UF0 B;  4YHJ A;  1NWM X;  4XNK A;  4HFV A;  1MMG A;  3LBX A;  3V5S A;  3ZMU B;  2OMF A;  2IW5 B;  3UUN A;  2DLR A;  5FY1 A;  3SRZ A;  5DL6 A;  4Z3T A;  4AYM C;  2XTQ A;  4OYK A;  3O1J A;  3RYF E;  4ZS2 A;  2D0U A;  2BZB A;  2XTL A;  2EHO D;  5DQW A;  3J9X 1;  3UPG A;  2JMM A;  5FXV A;  5C8Y E;  2XUE A;  5LXT E;  2LOP A;  3T8O A;  4O4I E;  5DAB A;  3P7I A;  2M06 A;  3C4X A;  4D5U A;  2QTK A;  3U3I A;  3FXD B;  5FY7 A;  1D1B A;  1YW0 A;  3IHR A;  4UIG A;  1GFQ A;  4V1A v;  4HN9 A;  4AI6 A;  2LSK A;  3MA9 A;  5L2L A;  4YFS A;  5JDQ A;  4QXC B;  2J1N A;  4U74 A;  3ANW B;  3FYX A;  3H37 A;  5BMV E;  3NZP A;  2MHL A;  1US7 B;  2PRN A;  2KXP B;  4RJX A;  4H9N C;  1ZKE A;  5HAX A;  3L09 A;  1MM5 A;  3OBV E;  5LGT B;  1ORM A;  1Q9F A;  4DND A;  1FMV A;  4FI5 A;  5FXZ A;  3ZC1 A;  5GV0 A;  2FGR A;  4I4T E;  3ZYM A;  2X66 A;  1WYC A;  1G73 A;  2W0G A;  3O1H A;  3OKQ A;  4UVC B;  5DL8 A;  4AQF C;  3KIN B;  4HE8 A;  3AVR A;  4E7S A;  3PU3 A;  1GFM A;  2POR A;  1OXZ A;  4L0R A;  2CXF A;  1ZHZ A;  2K5B B;  1HX8 A;  2D5U A;  2EHO A;  4E1T A;  3QRA A;  3UUL A;  4AXP A;  3RBH A;  4C90 A;  5CA1 E;  1P4T A;  3ZN0 B;  3AB3 B;  2ZM8 A;  3BQL A;  2MNH A;  5GON E;  3HL6 A;  2Q9Q A;  2D0T A;  3T24 A;  3DJB A;  3VKH A;  2SPC A;  3SY9 A;  4MHC A;  3WI4 A;  2LSY A;  3AAE A;  4ZI3 C;  2MBG A;  4CI2 B;  5LCY A;  4WBO A;  2X67 A;  4I43 B;  2NOX A;  2XAQ B;  4CZZ B;  4HKA A;  3UUM A;  3EUH A;  2VAS A;  3LJC A;  1MPF A;  4BA9 A;  2WSS V;  3U78 A;  1G8X A;  3T0S A;  2W00 A;  3UU2 A;  3KVB A;  3I9Y A;  3FXE B;  4MBQ A;  4CI3 B;  1MMN A;  4ISS A;  3RYH E;  3RRW A;  5H6Q B;  3CVR A;  5LJM A;  4FUV A;  4H63 H;  4L9I A;  3SZV A;  1QJ9 A;  5F3J A;  4CXX A;  4UEM A;  2JQQ A;  3O9X A;  1YKH B;  4QX8 B;  3AA1 B;  4EIW A;  4ILU A;  4H9R C;  3FB2 A;  3ZEF B;  3VY9 X;  4PK6 A;  1VRB A;  3AA0 A;  4ASK A;  4UF0 A;  3PQU A;  2MYS A;  3ZN1 B;  3AAA B;  3GMI A;  5JRC B;  2V7L A;  3AA7 B;  2ODJ A;  5CA0 E;  4AKH A;  3O1I A;  4AZL A;  3HA4 A;  1OPF A;  4AYI D;  3RPU A;  5F8P A;  4RLB A;  2Y0K A;  1BT9 A;  3Q9D A;  3O0E A;  4LSF A;  4AYN A;  3MXZ A;  4RL9 A;  2JJ9 A;  1D0X A;  3SOL A;  5JRE A;  5LGN B;  3JTY A;  3B13 A;  4PAG A;  4XAX B;  4WW0 A;  2W80 C;  3VU7 H;  1KNZ A;  3POU A;  4RJW A;  1FIO A;  3KBT A;  2JRK A;  3IBP A;  1MND A;  3B57 A;  2UXX B;  2X68 A;  2LFU A;  1MIW A;  2ES0 A;  1LKX A;  4P0B A;  4ADZ A;  3HKE E;  3N9N A;  5JDH A;  3KBU A;  4I50 E;  1D1C A;  2E9X B;  2L3L A;  3RYC E;  4E7Z A;  3CML A;  2NP9 A;  4P0A A;  1ZHY A;  3ANW A;  3IF8 B;  5EK4 A;  4FZN A;  2CLY C;  3KDS E;  2KXP A;  3AAI A;  1GFO A;  3K8P C;  3VHL A;  2QGS A;  2W81 C;  3SWH A;  3KV5 A;  2F1V A;  3GN5 B;  3PUR A;  5FYM A;  3PUG A;  3PUQ A;  2XE1 A;  2N1G A;  3IEE A;  4XBF B;  3G7G A;  1OWA A;  2Y0H A;  4E1S A;  5AFU K;  4QX7 B;  1QSD A;  2EHO C;  2GK9 A;  3MAC A;  8PRN A;  4PFP A;  4EYU A;  1AJ3 A;  3EDV A;  5JDG A;  2ODU A;  4GYS A;  4TUY E;  2X27 X;  4AYE C;  5LHH B;  2WBL A;  4FZM A;  5ADX K;  2ZLY A;  5J2U E;  2Q9Q C;  3ESL A;  3FHN A;  3K3N A;  4O2B E;  1HG2 A;  4U72 A;  1HXU A;  4O49 A;  4U9C A;  3CPZ A;  3EVY A;  2VWA A;  2IC9 A;  3KVA A;  3UTK A;  5LOV E;  1WRD A;  3POX A;  2W63 A;  4PJN A;  2YU1 A;  3CX8 B;  2WWU A;  5LJN A;  5DJQ C;  4H9P C;  2JPF A;  3HKC E;  2MTQ A;  3Q5X A;  4CXW A;  1FMW A;  5JDL A;  3J7Y q;  4O3W A;  2CXD A;  3WAJ A;  2Y7S A;  4FRX A;  1LRZ A;  5IYZ E;  4BUM X;  2KND A;  4ZI2 D;  1HFA A;  3P8C D;  4JFB A;  2JMH A;  4GIW A;  4H9S E;  1E54 A;  3CQG B;  1THQ A;  3UT5 E;  2CWY A;  2XQY A;  2Q9Q D;  3I0O A;  2W61 A;  2LHF A;  1H6S 1;  4O4U A;  3VZW X;  3W15 B;  2B1E A;  2X51 A;  5FNV E;  2Y6X A;  2E9X D;  4KMC A;  5TAO A;  3ZPO A;  5KDM C;  3ETV A;  3PDY A;  2A3D A;  4IIJ E;  3AA1 A;  2ZM0 A;  3C4W A;  2OA5 A;  3ETU A;  4GK0 E;  1YD8 G;  1ZHW A;  3ONX A;  4KBM B;  3KV4 A;  2WMN A;  4MLK A;  2CE7 A;  5G26 A;  4X20 E;  5PRN A;  3T20 A;  3N9P A;  3AAA A;  1UX5 A;  2VKH A;  2ACX A;  4TV8 E;  3F57 A;  4IE0 A;  4TN7 B;  3AA7 A;  5FMN A;  3PUS A;  3NRX A;  2NTX A;  3CQX C;  2D2S A;  2JMK A;  4AKL A;  3VE1 A;  3VE2 A;  1D0Y A;  5HXC A;  1HCI A;  4G76 A;  4O3Y A;  4PNI A;  3TKL B;  3N9L A;  3RYI E;  4TZ4 C;  5L3G B;  5ETW A;  3GP6 A;  2H7V C;  4K0U A;  4A56 A;  4O8S A;  3UUX B;  4D64 A;  3D0T A;  2XAJ B;  5DQV A;  5LNK A;  3C98 B;  4ANJ A;  3BQK A;  2KMF A;  5T5F A;  2E9X A;  3L3P A;  2LM9 A;  4DVD A;  4KP3 C;  2BDE A;  1B7T A;  4DBQ A;  1BXW A;  1MIY A;  1IZN B;  2HH7 A;  2C5J A;  2ZLD A;  5JDF A;  3CWZ B;  4P09 A;  3LK2 B;  3N2G E;  5JDN A;  4TX5 A;  5LHI B;  5FXX A;  1O3X A;  5KX5 E;  2XAG B;  2DWG A;  3KVD D;  4FZL A;  3GN5 A;  2XHE B;  4QXB B;  1IAP A;  1BR4 A;  4PK4 A;  3PQS A;  3QRC A;  4OYJ A;  2N2L A;  1MMA A;  1ZHT A;  1KK7 A;  3MZK B;  3QC9 A;  4HEA A;  3R6N A;  2NWB A;  4JLE A;  5J1G A;  1Q9G A;  5JDP A;  4DMV A;  4FSP A;  4GCP A;  2CWO A;  4AUI A;  4UXN B;  2Z6E A;  3LK4 1;  4PUX A;  3RRC A;  5L3B B;  4XNL A;  5HWX A;  2ZM2 A;  1X79 A;  4JEH B;  4O3Z A;  2V7M A;  2VKO A;  3NSG A;  1CUN A;  3PRN A;  3PUA A;  1HXT A;  2N2M A;  5J2T E;  2A2F X;  3HOL A;  3ZCI A;  1NAF A;  3RKO A;  3RC3 A;  3N9Q A;  2KC0 A;  3C50 A;  3E0Z A;  4PFO A;  1Z0P A;  2C0S A;  3QK6 A;  3N2O A;  3C5O A;  3HOE A;  4ZHQ E;  3SYS A;  4IE7 A;  1U5P A;  4YJ3 E;  2V7K A;  5L3C B;  4AKR B;  1UX4 A;  4G63 A;  2XE2 A;  3DA3 A;  4N78 D;  3O4X E;  3Q5W A;  1Y64 B;  5LGU B;  3I0Q A;  3JC6 C;  2LEH A;  5FP3 A;  4B61 A;  4GOU A;  1PHO A;  2K9A A;  4D65 A;  3AA6 B;  5FY0 A;  3ZMV B;  4CXY A;  3QUJ A;  5HXH A;  3CX7 B;  3LK4 2;  5LG4 A;  4GK5 E;  2ZFG A;  3ZYK A;  2KWH A;  4KR8 A;  5DL7 A;  2CMR A;  2VKJ A;  5LBQ B;  1VOM A;  5LBM A;  5L3F B;  3A5X A;  5EE2 A;  4DBR A;  4H9O C;  2YEV C;  1LVF A;  1SA0 E;  2CM0 A;  4KUM B;  7PRN A;  5JR9 B;  1YS5 A;  4N59 A;  4CQI A;  2PFV A;  4X1I E;  3HW9 A;  4UVB B;  3MK7 C;  2XG6 A;  2GE4 A;  4ZI2 C;  4KRA A;  3JC6 D;  4O4X A;  5IYU A;  2C5I T;  4JCH A;  4M1P A;  3GWH A;  3VKG A;  3E22 E;  4GCQ A;  3ZYL A;  2NW8 A;  4PJJ A;  2L8K A;  2LE8 A;  2K24 A;  3EDU A;  5JDM A;  4O3X B;  2E9X C;  1E1H B;  4OK0 A;  1V9D A;  4F4B A;  2W62 A;  2DHR A;  3Q2M A;  1MMD A;  2E8I A;  4FJO A;  2K4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...