3AA1B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from ckip-1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa1B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa1B02
3LK3B 3AAEA 3AA1B 3LK2B 4AKRB 2KZ7A 3AA6B 2KXPA 3AA7B 3AA0B 3LK41 3AAAA 5AFUL 3AAEB 5ADXL 1IZNA 3LK2A 2KZ7B 3LK3A 3AA1A 2KXPB 4AKRA 5AFUK 5ADXK 3AA6A 3AAAB 3AA7A 3AA0A 3LK42 1IZNB
chains in the Genus database with same CATH superfamily
3HA4A 2LSIA 4RLCA 2CBIA 2WSSV 2W0GA 2NW9A 3BS0A 2BBHA 4BAYB 5HXHA 2ODUA 3EVYA 5TISO 4X1KE 5ABEA 4UVCB 1LRZA 3T1YT 2JPFA 3FZLB 3OVUA 3AE4A 4QX7B 3PUZF 3NJTA 3FXDB 2WZIA 2Q9QA 2VK9A 4IDPA 4U33A 2Y0KA 2BKPA 2VQFT 4FMSA 1Q9GA 3LSVA 4JI0T 3ZN0B 1W0BA 2UUCT 4MHCA 5L2LA 5GTHO 5CGMA 2SPCA 5ADXK 4L5GA 2CXLA 3RI5A 2XQ3A 2B1EA 5AQKB 2V7JA 3AXJB 3CKDA 1OXZA 4CN1A 4B3TT 1LVFA 4YY3T 5AQHB 5L3BB 5JDNA 1MM5A 2LSJA 4JFBA 2MOZA 1ZKEA 4EGWA 5KAIO 3OBVE 3P4PA 1MIVA 2IWWA 1HX1B 2WM9A 4TZ4C 5LNKA 2J1DG 1MPFA 4UXNB 2V7MA 2KXPA 4EB6E 4QKNA 4B6XA 5IUXA 3RYIE 1HXXA 4JEHB 4XNLA 3QB5K 4HFEA 3AECA 3EMNX 3CPZA 1WR6A 4FI5A 1WRDA 2W62A 3OJAA 3WI5A 4IDZA 4JBWF 2E9XC 4PK4A 4CN6A 4FQEA 2CRBA 4ZI7E 5IYUA 2BG9B 4PAGA 5LXTE 1WCRA 1AJ3A 3MKDA 3JAEA 4IDNA 5FKYA 1GFNA 4YLHA 2VKOA 2HPJA 2G0UA 2K48A 4IE0A 3J7Yq 4C91A 2E9XD 5LJMA 4GCQA 4N58A 2VKJA 4DBRA 2UXXB 2FJEA 2M07A 3WAJA 4JUYA 2LM9A 1OEDA 3AAEA 2UXCT 2WWVA 1MIYA 5J1GA 2YDQA 4AQFC 4O2AE 1HS7A 2R89A 2L3LA 4TV9E 2XUEA 3H3MA 3FZFB 2ZM0A 3QOFA 2D0TA 5JDPA 5JREA 1BR4A 2XTRA 2IC6A 2YU1A 5JQGE 4D64A 4RJWA 1WYCA 3UU5A 2NWBA 3GN5A 1T8BA 4ZS2A 4C00A 3N9PA 4F8HA 3ZYLA 3AVRA 4QXHB 5LCYA 3UU3A 1CHUA 2E9XA 4YJ2E 3AAIA 4LSHA 5E0OA 5AQQB 4PW8A 3CWZB 4EYYR 3K3OA 2E5VA 2AE9A 5LGTB 1KNRA 4HWCA 5FVLA 5JRCA 1XDOA 2WDVA 1G90A 2M6BA 1BXWA 2J62A 2M06A 1PRNA 3SRZA 5L3CB 2WJRA 3TZGA 3VZTX 3LK2A 3FB2A 3NBXX 5AQPB 4AZLA 3MK7C 4QWNB 4TN7B 3UFGA 2OLTA 5E79O 2O4VA 3PQUA 3RYFE 3VKHA 3E08A 2VASA 2LE8A 5LGUB 2LKHA 4CZZB 2XG6A 1ZHTA 5JR9A 5LYJE 4YT0A 3CX7B 5CJ5A 3RH3A 3RQWA 3ZMTB 2YPVA 4KP3C 4TNWA 3RHWA 1M7KA 3ZJ2A 2LOPA 2LJLA 3AE2A 4XAXB 1JNZA 4HFCA 4B3RT 4Z8XA 5L3GB 3K1SA 5BR8T 3PUAA 3LBXA 1WLXA 3ANWB 4CI2B 3PUQA 2FJDA 3N2OA 2EHOD 4N74A 4UB6O 2K5BB 4MALA 2XAHB 2WU5A 3E0ZA 3FBLA 4LF4T 4DIDB 1N33T 3M3ZB 4I43B 4LSFA 5CFBA 3HKCE 3AA7B 5CB4E 1UK5A 4YSYA 4U7YA 5HEUA 2WB5A 1HNZT 1HR0T 2GE4A 4LFAT 5HEJA 3LJCA 2F1TA 2IWVA 2BDEA 4O4UA 1SE7A 5FXVA 2V7IA 2XE3A 4LFBT 1GFMA 5JH7E 5HCJA 4AXPA 1T7SA 1XNRT 1BH3A 3UFEA 1DU2A 3LK3A 1T72A 3WAKA 4EOZB 5B66O 2UU9T 4HFIA 1MMDA 2VURA 1ZHXA 2EHOA 1IZNB 3PQSA 2YNKA 1QSDA 3GWHA 5L4HA 5FL1A 4ILCA 3T1HT 4AKMA 3NKZA 1ZEEA 2CEAA 4F4BA 1US7B 2XY8B 2LHNA 1ZHZA 2HN1A 3EDVA 1HFAA 3AEBA 4JI2T 1E54A 3RGLA 4YSXA 3VKGA 4JI3T 4IREA 5AQOB 4C90A 3PGUA 4LMKA 4J2CA 3TLVA 4AKLA 4IDQA 1BR0A 3IHRA 4HKAA 3HKDE 3NRYA 1FJGT 3HW9A 4ZI3C 4LSEA 2J1NA 5KDMC 4LSIA 3K3NA 4JI1T 4U9CA 3EABA 4G2AA 4NUVA 4JYAT 4N59A 4QX8B 1KFYA 2DI4A 3C5OA 4PJ0O 1QJ8A 2NTYA 2BG9C 1YW0A 2XMXA 4FT6A 4G75A 4K3BA 3ZYMA 4HWFA 3JAFA 2HPLA 5J2TE 3JCUO 3NZPA 4NUUA 2QA7A 3AE5A 5HEOA 2WS3A 2F4VT 1E2AA 3BQIA 1SHZC 1UCUA 3PUSA 4HGAA 2X68A 3AXJA 3UQ7A 3OPCA 5AQIB 1BR1A 2KMFA 3G7GA 1FIOA 3KV4A 5JDFA 2LHRA 2XQ6A 2Y48B 2V6YB 3RYHE 4DV7T 3AEDA 1HXTA 5HCMA 3VU7H 2X66A 2VB6A 3EI0A 1P4TA 4LF7T 5ABHA 3P8CD 2XSBA 3PU8A 4YTMA 2R4NA 3UULA 4O49A 2XQYA 5HEGA 3AA0A 3CIRA 3DA3A 1UX5A 5EK3A 4HEAA 2IDOB 4ANJA 3KDSE 2E5LT 2BS3A 3AA1A 4PK6A 4IE5A 2XTLA 1QJPA 4FOZA 5LG4A 4N75A 5HWYA 2XE5A 2OA5A 3L09A 1YQ3A 1T16A 4P0BA 1J5ET 4OYJA 2IMLA 1NAFA 3UU4A 3SZDA 2J47A 3RKGA 2N2NA 3V5SA 4UF0A 4RLBA 3ZEFB 4DMVA 1IJ6A 1BR2A 4E7SA 3AA6B 1R8IA 2NP9A 2WAUA 4U74A 5HAXA 1N34T 2FUPA 1VOMA 2CM0A 3PURA 4FJOA 4ISSA 3LK42 2ZLDA 5LBQB 1MM4A 4PK5A 4WBOA 2N2LA 3BQKA 2LSGA 2H7OA 3UPGA 1HG2A 5G26A 4X5TA 4A56A 2IC9A 4AYDC 1XMQT 1Y01A 3ZC0A 4OX9T 2H3RA 5AQLB 4OK0A 2A3DA 2V5CA 4QHOA 3RX6A 3K8PC 3TLUA 1ZP0A 2YU2A 4ILUA 3OTOT 2IHR1 1YD8G 2D0UA 3M65A 2X9KA 2W63A 4NXNT 2JQQA 1GFOA 5JDLA 5GONE 4PJMA 2XQ4A 4EZ4A 2PFVA 3RIAA 5H6RB 4QQ1A 5LBMA 3ZCJA 3ZT5A 3S4UA 4LFCT 2R88A 1X79A 4L0RA 2B76A 4HN9A 1NENA 3ZMSB 4IGUA 3C51A 3ZC1A 4C4VA 3E22E 1XMOT 2XASB 2XJ7A 4DNDA 2JQHA 4P1NA 3RRCA 3DZMA 1IBLT 4X64T 5LB7B 3IBPA 3UU8A 4DR2T 3POQA 1O3XA 4HWIB 3DWOX 2C5IT 3JC6C 3MZKB 3HKEE 3C64A 4PJLA 4TV8E 2DCFA 5GTIO 8PRNA 3JADA 4QH1A 3AE3A 5HXRA 1XWMA 4YJ3E 4AKRA 4X20E 3POXA 2WQYA 4HFBA 3EHZA 4BJMA 1UGOA 1KEYA 4YHJA 4G76A 2ODJA 7PRNA 4Z3TA 2ACZA 2W00A 3RIUC 2LM2A 4U2YA 2WCAA 5FXZA 3ZSTA 2A9UA 4DMWA 4P09A 1U4QA 5EK4A 5EK2A 5ABGA 5FY1A 4O4JE 3AEFA 2LOSA 4EZHA 4KR4A 3VHLA 5FVKA 1XNQT 5AQNB 2MYSA 3L39A 2XAJB 5L47A 3PUXF 4CXWA 2XQ7A 2DL1A 2DWGA 2HH7A 5JDGA 4ZZCA 3FZHB 2IUBA 2WY2A 5A1LA 3NSGA 1W0AA 4L9IA 3KV5A 4GK0E 4DR1T 5F3JA 4UV8B 3SYBA 3AB3B 1MMNA 4Z91A 3ZYKA 2ZM2A 2XTQA 2KXPB 2KINB 3PJAJ 4DO0A 2WZHA 4CN4A 2CLYB 3A8YC 3UQ4A 5LA6E 2WDQA 1ZOYA 2XE2A 2CWOA 4IHJE 3KVDD 4YTNA 4ZEYA 4GKJT 4HTEA 2V26A 2XZEA 3ETVA 1SUMB 1IJ5A 5CA1E 1OSMA 4HFDA 5AFUL 1XZYA 4LMLA 3BRZA 2ZMAA 3OKQA 1IAPA 1OPFA 1HX8A 4A5XA 3ESLA 2NW8A 4TWHA 2JQYA 3T20A 1ZV4X 2RP4A 4EEBA 4HE8A 4AQFA 5HEHA 2C0SA 3AE1A 3P4SA 3I0OA 3GA8A 4WZXA 3EDUA 3I9YA 4KR8A 5L4EA 3H37A 5DABA 2WDRA 3Q5WA 2IAKA 3ZMUB 4KI0F 3A0HO 4LF9T 5G38A 2NTXA 2KNDA 1HNXT 2JIWA 1OEDB 3AEGA 3AAEB 3OYZA 5ADXL 4JV5T 4AKHA 2AXTO 3ONXA 5T5FA 3PGSA 3B57A 4XNKA 4PFPA 3RQUA 5DL7A 4I0UA 5LG3A 4G63A 4UVAB 2KDYA 2BBJA 2OV9A 3P4QA 2ODVA 3K19A 3J9X1 2FGRA 4YTPA 4AISA 4K3CA 1ORMA 3GN5B 5G3AA 2MPKA 3UAQA 3QUJA 2QYWA 4DV3T 3ZJ1A 3QRCA 1GQEA 4IL9A 5FVNA 2L8KA 2W66A 2E9XB 3VE2A 3PUYF 2Y8DA 2M67A 3R84B 2X67A 4DV2T 1MNEA 5LJNA 2N9DA 3ONLC 2QGSA 2J4UP 3A7MA 3N2GE 2C5JA 1M62A 3LDQB 4ZI2C 3LK41 3QNUA 3RC3A 3PORA 4ILAA 4O3YA 1HNWT 3P7IA 2X9WA 5C8YE 1VCTA 3C4XA 2RPAA 2Y0HA 2V6YA 2KZ7B 5JRCB 4DV6T 2W61A 4WW0A 2JRKA 4IT4A 4B3ST 4XZCA 2WMNA 2YK0A 3MACA 3HOEA 2XQ8A 3O1JA 3AVSA 3KVBA 4U2ZA 2I6HA 5DL6A 3AAAA 2W2UA 3FZKB 4X66T 3SY7A 2PJQA 2KSRA 3A0BO 3RKOA 3KINB 2V7LA 2XAFB 4JI5T 2PBIA 2JMMA 5JR9B 3ABVA 3UTKA 2WU2A 1UX4A 1IBMT 4I55E 4PFOA 5LMUT 3PE0A 4IIJE 2VWAA 3MJXA 4KBMB 3KV6A 2WMOA 2KWIB 4O3WA 2KT9A 4MBQA 5FYMA 3N9MA 4ZOLE 2K9AA 2RA1A 2A72A 4ZS3A 4BA9A 1NWMX 4H9RC 3T8OA 3LG7A 4H9SE 4IE6A 3AEEA 5J0ZA 5LGNB 2R4LA 2VVSA 2X51A 4AYEC 1J5WA 5H2FO 2H89A 4AYMC 2MTQA 4OHFA 1MIWA 3HWBA 3RBHA 4ZI3D 3SFEA 4HWHA 4E7ZA 5HXSA 2WBLA 4DVDA 1WYBA 4CXYA 1CUNA 1B7TA 1THQA 3AE8A 1D1AA 2Y2XA 3DP7A 4ZXLA 3IF8B 2XAQB 4DV4T 3O9XA 2HHHT 3L3PA 5KXJA 1PHOA 2YN6A 1YKEB 2LRLA 3UT5E 2CHNA 4FZMA 2H88A 3MXZA 3GP6A 4YSZA 2UUBT 2CPTA 2ES0A 3OYXA 4ASKA 1D0XA 4GKKT 4GHBA 4GIWA 5LOVE 5HWXA 4WNKA 4XBFB 4P0AA 5ETWA 3N9QA 5FY0A 4CI3B 4FSPA 3C4ZA 2CXFA 3SY9A 3AEAA 2BS2A 1OEDE 1XDPA 3QC9A 3CQCB 4LF8T 2ACXA 3LK3B 3N9NA 4NIQA 1YQ4A 1S94A 2QTKA 2EHOB 4NPPA 3BK9A 5DL5A 4KUMB 3UUXB 4FUVA 5B5EO 4JI8T 1VRBA 5ABFB 1KF6A 1KNPA 3Q5EA 3CMLA 3FZMB 4JI7T 3RIFA 4OYKA 2KC0A 3WU2O 4EYUA 3QB5A 4YXDA 4JI6T 3UUBA 5IWAT 3CK6A 2BG9A 5FY7A 3HOLA 4CXXA 4DV1T 2CLYC 2FGQX 2JMHA 2BVMA 4UELA 5DQWA 5CA0E 4UR9A 3SFDA 2JQKA 1Z8UA 3VRBA 3I1AA 2V7KA 1ZHCA 4KRAA 5F8PA 2E8IA 1BT9A 1FEWA 3SS1A 3I0QA 4MFRA 1Y64B 3ETUA 4EEDA 3ZLIA 4KHPT 5DL8A 1JNRA 2XM2A 2L9QA 4U72A 2XHEB 4B3MT 3C50A 2IIUA 1OWAA 4ISTA 4GF4A 2A2FX 4UVBB 5LHGB 4HWDA 4EV6A 4CQIA 2XQAA 2CE7A 2XQ9A 3UU2A 4EXTA 4UEMA 5PRNA 4E1SA 2X27X 3PRNA 2XM1A 3ZPOA 2K4TA 2D9DA 4UIGA 1H6S1 4FRXA 4H63H 2Y6XA 1OEDC 4PNIA 3W15B 2VVNA 4OFZA 4DR3T 3H3AA 4B61A 4FESA 5AQTB 3AE7A 4JI4T 2V8SV 1QUUA 3V5UA 4ADZA 4DR4T 2FJAA 1WFDA 2X9XA 4KX6A 5GV0A 5JVDE 1YS5A 4DBQA 3KFWX 3O1HA 2VQET 3CQXC 5D5DA 3AA0B 3RLFF 2CBJA 5KMGP 3IA3A 4O4LE 2XAGB 3I9WA 3Q5DA 1H7CA 2DNXA 4GK5E 1MMGA 2YKSA 2V5DA 2W67A 2X0YA 5JDMA 4PUXA 2F1VA 2ZM8A 3JTYA 2PRNA 3HKBE 4IL6O 4DR5T 2YOEA 2BKOA 1D0YA 3AA1B 3PUWF 3PJAA 1IBKT 4AIUA 3VY9X 4A97A 2MBGA 3QRAA 4BUMX 1HTJF 2WJQA 3ZT6A 3MA9A 3VE1A 2YDSA 2Y7SA 5EE2A 4IDOA 2CWYA 2VKDA 4KMCA 5J2UE 3DA4A 2C5KT 4E1TA 4UF0B 5DQVA 3LFMA 3K3QC 4AKGA 5IHYA 3JC6D 2NR4A 5L3DB 3JCFA 4DUZT 2Q9QB 3A5XA 3WI4A 2WP9A 4AQYT 2K0LA 3N9OA 2MHLA 3A2SX 3RF1A 1LVKA 2D5UA 2QRXA 5C3JA 4ILBA 3F57A 4AFKA 4ZHQE 2NOXA 4FZNA 2Y0LA 2Z6EA 3B5MA 1E1HB 1S35A 1HCIA 1S5LO 4NXMT 1Q9FA 1KK7A 3ANWA 2PTFA 5AQFB 5JR9C 4JLEA 5C2TA 3SZVA 4GYSA 4C69X 3T0SA 4AYID 3HI2A 5G39A 3ZKRA 4FSOA 5KX5E 2XSAA 2VL8A 4F6RC 4O4XA 3PUVF 3QK6A 2F1CX 5BMVE 3AA7A 4IE4A 2OMFA 4O4IE 5AQGB 2LSKA 2LSYA 3RPUA 1VCSA 3TKLB 3FYXA 3ZSSA 1D1CA 4WYVA 1D0ZA 1J1JA 4C4VB 2E2AA 4D5UA 1UURA 3P50A 1D1BA 2UUAT 2V6XA 5AQUB 5L3FB 3Q9DA 4PJJA 1U5PA 3FBZA 1ZHYA 5L3EB 2M6IA 2ZLYA 3RIUA 2VKHA 2KZ7A 2W80C 2YEVC 3DTOA 3DWNA 4O2BE 3VR8A 5FL0A 2CA5A 4HFVA 4PJNA 4O3ZA 2MNHA 4H9PC 1IZNA 2P9BA 4O3XB 4DR6T 4AYNA 1YKHB 3TLSA 1X9BA 4QXCB 4JCHA 4DV0T 3RRWA 1QLBA 5HXEA 3VZWX 4TNVA 2LT3A 3P4RA 4AKRB 5FXWA 4FZLA 3L8RA 3O4XE 5JDQA 1N32T 4O4HE 2PG8A 4HFHA 1E7PA 1T98A 4U7IA 4UV9B 2CHOA 1W9RA 4Q25A 1G73A 3AE6A 2EHOC 4CTDA 3GMIA 3AE9A 4KHZF 3FHNA 1V9DA 5M4YA 3C98B 2WVPA 4K0KT 5HXCA 2UXBT 4U31A 3TLTA 4QXBB 3BRYA 2JMKA 4DR7T 2JQ9A 4EIWA 5F5WA 5FNVE 2V1DB 1MMAA 5LMNT 3X1DA 4TX5A 2XE1A 3VZUX 4X1IE 3CX6B 5LP6E 3NZQA 2LHFA 5AQMB 2N2MA 1EZ3A 2K24A 1GFPA 3Q2MA 1HF8A 2R6GF 5FP3A 3NVOA 4GCSA 2H7VC 5JTGA 1L0VA 2R8AA 2KWHA 2BS4A 2BG9E 4X62T 1WR0A 4A98A 1HG5A 1KNZA 3O0EA 3RC8A 3KBTA 3IEEA 2X9HA 4IE7A 5FXXA 4V1Av 3UUMA 4I50E 2D2SA 2CXDA 2KLQA 3LK2B 1ZHWA 2AXDS 4K0UA 2IW5B 2W81C 1I94T 5H6QB 3D0TA 2ZM6T 4ZI2D 4QH4A 3VY8X 4JEUB 4TWFA 2R4PA 3F2EA 5DJQC 4RL9A 4H9OC 2LRKA 4H9NC 3V8UA 2CMRA 2JJ9A 3PU3A 3PGRA 1T1LA 4IL4A 4U3CA 3P4WA 3VRAA 4X1YE 2DWKA 3Q5XA 3UU6A 2YDRA 5AQJB 5ABFA 4D65A 2BVLA 3SYSA 2LEHA 4TWDA 2BKNA 4WBNE 3VR9A 3KZIO 2X0HA 3B13A 3CX8B 3ZT7A 4COFA 4DV5T 2LLYA 3F31A 2XQ5A 3G06A 4H9QC 4I4TE 5FMNA 4RJXA 4LMJA 2UXDT 3T24A 5IYZE 4EAHA 4M1PA 2BZBA 3POUA 4O8SA 3LBXB 3PUGA 4X65T 3CQGB 4H63V 2UXNB 3PF1A 3AA6A 2ZFGA 3HR0A 2I59A 1G8XA 4YFSA 4LF5T 2WWUA 2XPKA 2X9YA 3C4WA 1QJ9A 3O1IA 3BQLA 2DHRA 4N78D 4PR7A 1NEKA 4ZZBA 6PRNA 3HL6A 5KAFO 5TAOA 5JDHA 3ZMZB 3ZMVB 1Z0PA 1GFQA 1UUSA 5AQRB 2R4OA 3TLWA 5EZYE 3EAMA 1HXUA 2LFUA 4BJNA 3PDYA 3KBUA 5LHHB 2X0LB 1FMVA 4CI1B 1FMWA 3PV0F 2J4GA 2Q9QC 4DUYT 3ZCIA 4Z90A 3N5LA 5HYAA 4MLKA 3KVAA 3N2KE 4GYRA 4GOUA 2W4XA 3UUNA 4AKIA 2ERVA 5AQSB 1I6ZA 3ONJA 3CVRA 1SA0E 4FRTA 2PORA 4AUIA 2FBWA 1YXRA 2QVAA 2Q9QD 4GCPA 3FXEB 1MNDA 2N1GA 2MAWA 1W09A 5AQVB 3DJBA 4TUYE 3SWHA 3AAAB 4AI6A 3PTRB 3NWIA 2YINA 2DLRA 2VL0A 2I0MA 2HN2A 4UB8O 2CCQA 3SOLA 2K3WA 3NRXA 2LKGA 1LKXA 3RYCE 2NW7A 1N36T 4YHHT 4QH5A 2GK9A 3N9LA 3EUHA 3WI3A 4ERRA 3ZN1B 3KV9A 4LF6T 5AFUK 3U78A 3R6NA 5LHIB 3U3IA 4AQGA 2FJBA
chains in the Genus database with same CATH topology
5EE2A 4C90A 2CWYA 2IAKA 2LSIA 3HA4A 3Q5WA 3ZMUB 2VKDA 4KMCA 5J2UE 4RLCA 3DA4A 4J2CA 2C5KT 4E1TA 2NTXA 4UF0B 4AKLA 5DQVA 3LFMA 2WSSV 2W0GA 3K3QC 3IHRA 2KNDA 5IHYA 2NW9A 3JC6D 4HKAA 5L3DB 4BAYB 1BR0A 5HXHA 2ODUA 3AAEB 3EVYA 3HKDE 3OYZA 4X1KE 5ADXL 3NRYA 4UVCB 4AKHA 1LRZA 2Q9QB 3A5XA 3ONXA 5T5FA 2JPFA 3HW9A 3WI4A 4ZI3C 3B57A 4LSEA 2J1NA 2K0LA 4XNKA 5KDMC 3N9OA 2MHLA 4QX7B 4PFPA 3A2SX 4LSIA 1LVKA 3K3NA 5DL7A 2D5UA 3FXDB 4U9CA 2Q9QA 2VK9A 4G2AA 3F57A 4NUVA 2Y0KA 4AFKA 4ZHQE 2NOXA 4FZNA 2Y0LA 4N59A 2Z6EA 4FMSA 1E1HB 1Q9GA 1S35A 4QX8B 1HCIA 2DI4A 3C5OA 3ZN0B 4G63A 1QJ8A 2NTYA 4UVAB 1YW0A 1Q9FA 4MHCA 5L2LA 2XMXA 1KK7A 3ANWA 4FT6A 2SPCA 4G75A 4L5GA 5JR9C 5ADXK 4JLEA 2KDYA 3SZVA 3ZYMA 2CXLA 4GYSA 2ODVA 4C69X 2HPLA 3T0SA 4AYID 3K19A 2B1EA 3J9X1 2V7JA 5J2TE 2FGRA 3NZPA 1ORMA 3CKDA 3GN5B 3UAQA 4NUUA 1OXZA 3HI2A 2QA7A 3QUJA 1LVFA 4FSOA 5KX5E 5L3BB 3ZJ1A 3BQIA 2VL8A 1SHZC 1UCUA 3PUSA 4HGAA 4F6RC 5JDNA 2LSJA 1MM5A 4JFBA 2MOZA 5FVNA 2L8KA 1ZKEA 2X68A 4O4XA 2E9XB 3QK6A 3VE2A 3OBVE 1BR1A 5BMVE 3AA7A 1MIVA 2KMFA 2Y8DA 4IE4A 2M67A 3G7GA 3R84B 1FIOA 4O4IE 3KV4A 2OMFA 2X67A 5JDFA 2WM9A 5LNKA 4TZ4C 2LSKA 2LHRA 2J1DG 2Y48B 2LSYA 1MNEA 3RYHE 5LJNA 2N9DA 1MPFA 4UXNB 2V7MA 3RPUA 2QGSA 1HXTA 2J4UP 3VU7H 2X66A 3N2GE 2C5JA 2VB6A 3TKLB 2KXPA 3FYXA 1D1CA 4ZI2C 1P4TA 4EB6E 3P8CD 4QKNA 3LK41 3RC3A 4B6XA 3PORA 4O3YA 3PU8A 3P7IA 2X9WA 3RYIE 3UULA 5C8YE 3C4XA 1HXXA 4O49A 1D0ZA 2Y0HA 4JEHB 4XNLA 2KZ7B 2XQYA 5JRCB 2W61A 4WW0A 4D5UA 1D1BA 2JRKA 4XZCA 2WMNA 3AA0A 2YK0A 5L3FB 3Q9DA 3DA3A 3MACA 4PJJA 3EMNX 3CPZA 1U5PA 3FBZA 1ZHYA 3HOEA 3O1JA 1WR6A 4FI5A 3AVSA 5L3EB 1WRDA 2ZLYA 1UX5A 2VKHA 3KVBA 2KZ7A 2W80C 2W62A 2YEVC 3DTOA 3OJAA 5EK3A 4O2BE 3WI5A 4IDZA 5DL6A 2CA5A 4HEAA 4HFVA 2E9XC 4PJNA 4PK4A 3AAAA 4O3ZA 2MNHA 4H9PC 4ANJA 3KDSE 3SY7A 1IZNA 2P9BA 4O3XB 2PJQA 3RKOA 3AA1A 4AYNA 3KINB 4PK6A 4IE5A 4ZI7E 1YKHB 2XTLA 1QJPA 4FOZA 4QXCB 4JCHA 5IYUA 5LG4A 2V7LA 5HWYA 2XE5A 4PAGA 3RRWA 2XAFB 5HXEA 3VZWX 2OA5A 3L09A 2PBIA 2LT3A 5LXTE 1AJ3A 3MKDA 2JMMA 5JR9B 4AKRB 1GFNA 5FXWA 3UTKA 4YLHA 2VKOA 1UX4A 4P0BA 4FZLA 3O4XE 4I55E 4OYJA 5JDQA 2HPJA 2G0UA 2K48A 2PG8A 4O4HE 4PFOA 1NAFA 3SZDA 3PE0A 4IIJE 4IE0A 2VWAA 3MJXA 4C91A 2E9XD 5LJMA 3J7Yq 1T98A 4GCQA 4KBMB 2N2NA 3KV6A 2WMOA 2KWIB 3V5SA 2KT9A 4N58A 4MBQA 5FYMA 4O3WA 3N9MA 4ZOLE 4UV9B 4P0AA 2VKJA 4DBRA 2UXXB 2K9AA 2RA1A 2M07A 4UF0A 3WAJA 4RLBA 3ZEFB 2A72A 4ZS3A 4DMVA 1G73A 4JUYA 2LM9A 1IJ6A 1BR2A 4BA9A 2EHOC 3AAEA 4E7SA 1NWMX 4H9RC 3AA6B 3GMIA 2NP9A 3T8OA 2WAUA 3FHNA 1V9DA 3LG7A 4H9SE 4U74A 5HAXA 4IE6A 5M4YA 3C98B 1MIYA 5J1GA 5LGNB 4AQFC 4O2AE 5HXCA 1HS7A 2X51A 4AYEC 4QXBB 2JMKA 1VOMA 2CM0A 2L3LA 3PURA 4FJOA 4TV9E 4AYMC 2XUEA 4EIWA 3QRCA 5FNVE 2MTQA 4ISSA 1MIWA 2V1DB 2ZM0A 4OHFA 3LK42 3HWBA 3RBHA 1MMAA 4ZI3D 2ZLDA 2D0TA 5LBQB 1MM4A 5JDPA 4E7ZA 5HXSA 5JREA 2WBLA 4TX5A 1BR4A 4DVDA 4PK5A 1WYBA 4WBOA 4CXYA 2N2LA 1CUNA 3BQKA 2LSGA 1B7TA 2H7OA 2XE1A 2IC6A 2XTRA 1HG2A 1THQA 5G26A 3UPGA 3VZUX 1D1AA 4A56A 2Y2XA 3DP7A 2IC9A 4AYDC 2YU1A 4X1IE 3CX6B 5JQGE 3ZC0A 4RJWA 4D64A 5LP6E 3NZQA 3IF8B 2LHFA 2H3RA 2XAQB 4OK0A 2A3DA 4QHOA 1WYCA 3O9XA 3RX6A 2N2MA 2NWBA 3GN5A 3K8PC 3L3PA 1EZ3A 2K24A 1PHOA 4ZS2A 1YKEB 1GFPA 2YU2A 3Q2MA 4ILUA 1HF8A 3UT5E 1YD8G 2D0UA 3M65A 5FP3A 4FZMA 4GCSA 2H7VC 3MXZA 3N9PA 3GP6A 2W63A 3ZYLA 2JQQA 3AVRA 1GFOA 4QXHB 2KWHA 5LCYA 5JDLA 2ES0A 4ASKA 3OYXA 5GONE 2E9XA 1D0XA 4YJ2E 4PJMA 4GHBA 3AAIA 4GIWA 1HG5A 5LOVE 5HWXA 1KNZA 3O0EA 4LSHA 3RC8A 4EZ4A 2PFVA 3KBTA 4WNKA 4XBFB 3IEEA 5ETWA 3N9QA 2X9HA 4IE7A 5E0OA 5FY0A 5H6RB 5LBMA 3ZCJA 4QQ1A 5FXXA 4CI3B 3C4ZA 4FSPA 2CXFA 4V1Av 3UUMA 3SY9A 4I50E 4PW8A 3CWZB 3S4UA 2D2SA 1X79A 4L0RA 2CXDA 4EYYR 3QC9A 3K3OA 3CQCB 4HN9A 2ACXA 2KLQA 3ZMSB 3LK3B 4IGUA 3LK2B 1ZHWA 5LGTB 4K0UA 3C51A 2IW5B 3ZC1A 3N9NA 2W81C 3E22E 5JRCA 1G90A 2XASB 1BXWA 1S94A 4DNDA 2QTKA 2M06A 2EHOB 1PRNA 3BK9A 3SRZA 3RRCA 5H6QB 5DL5A 5L3CB 3D0TA 4KUMB 3UUXB 4FUVA 3TZGA 4ZI2D 3VZTX 1VRBA 3FB2A 3LK2A 4JEUB 3VY8X 3NBXX 3F2EA 5DJQC 4RL9A 4H9OC 4AZLA 3MK7C 3V8UA 4H9NC 3IBPA 2CMRA 4QWNB 2JJ9A 3CMLA 4TN7B 3PU3A 4OYKA 3POQA 2KC0A 4X1YE 2DWKA 2O4VA 3PQUA 4EYUA 3Q5XA 3RYFE 4D65A 1O3XA 3VKHA 2C5IT 2BVLA 3E08A 3JC6C 3MZKB 3SYSA 2LEHA 2VASA 3HKEE 3C64A 2LE8A 4PJLA 5LGUB 4TV8E 4WBNE 2DCFA 5FY7A 3HOLA 8PRNA 4CZZB 4CXXA 2XG6A 2CLYC 1ZHTA 2FGQX 5HXRA 5JR9A 4YJ3E 2JMHA 2BVMA 5LYJE 3CX7B 4X20E 3POXA 4AKRA 4UELA 5DQWA 3B13A 3CX8B 3RH3A 5CA0E 4BJMA 3F31A 4H9QC 4I4TE 4YHJA 4G76A 3ZMTB 2YPVA 3I1AA 2ODJA 4KP3C 7PRNA 2V7KA 4Z3TA 1ZHCA 2W00A 4KRAA 5FMNA 5F8PA 2E8IA 3ZJ2A 4RJXA 2LOPA 1BT9A 1FEWA 3T24A 3SS1A 3I0QA 2LJLA 4MFRA 5IYZE 1Y64B 3ETUA 3ZLIA 5FXZA 4EAHA 4M1PA 2BZBA 5DL8A 3POUA 4O8SA 3LBXB 3PUGA 4XAXB 3CQGB 4H63V 2UXNB 4DMWA 4P09A 1U4QA 2L9QA 4U72A 2XHEB 4Z8XA 3C50A 3AA6A 2ZFGA 1OWAA 5EK4A 5EK2A 5L3GB 3HR0A 4ISTA 4GF4A 2I59A 1G8XA 4YFSA 5FY1A 4O4JE 2A2FX 2LOSA 2WWUA 4EZHA 4UVBB 2X9YA 3PUAA 4KR4A 3C4WA 3LBXA 1WLXA 3ANWB 4CI2B 3O1IA 5LHGB 1QJ9A 3BQLA 3VHLA 3PUQA 2DHRA 4N78D 4CQIA 2CE7A 3N2OA 2EHOD 2MYSA 4EXTA 3UU2A 2K5BB 4UEMA 5PRNA 4E1SA 4MALA 2XAJB 6PRNA 3HL6A 2XAHB 2X27X 3E0ZA 4CXWA 3PRNA 3FBLA 5TAOA 3ZPOA 5JDHA 3ZMZB 2DWGA 3ZMVB 2HH7A 1Z0PA 5JDGA 2K4TA 4UIGA 1GFQA 1H6S1 4FRXA 4H63H 4I43B 2LFUA 5EZYE 1HXUA 4LSFA 4BJNA 3PDYA 2Y6XA 3KBUA 5LHHB 2X0LB 5A1LA 4PNIA 1FMVA 3HKCE 3W15B 4CI1B 3NSGA 1FMWA 3AA7B 4L9IA 4OFZA 4AKGA 3H3AA 3KV5A 4B61A 2Q9QC 4FESA 4GK0E 5CB4E 3ZCIA 5F3JA 4UV8B 3SYBA 3AB3B 1QUUA 3V5UA 4ADZA 1MMNA 3N5LA 3ZYKA 2ZM2A 5HYAA 2XTQA 4MLKA 2KXPB 2KINB 3KVAA 4DO0A 3N2KE 4GYRA 2GE4A 2X9XA 4GOUA 2CLYB 3LJCA 3UUNA 4AKIA 2F1TA 2BDEA 5LA6E 5GV0A 4O4UA 5JVDE 2ERVA 2XE2A 1YS5A 5FXVA 2CWOA 2V7IA 3CVRA 4IHJE 4DBQA 3KFWX 2XE3A 1SA0E 3KVDD 3O1HA 3CQXC 5D5DA 4FRTA 3AA0B 1GFMA 2PORA 4HTEA 2V26A 3ETVA 4AXPA 5JH7E 5KMGP 4AUIA 1IJ5A 5CA1E 4O4LE 2XAGB 3I9WA 1OSMA 1H7CA 1BH3A 3UFEA 2DNXA 5AFUL 2Q9QD 4GK5E 1MMGA 4GCPA 3FXEB 1MNDA 3LK3A 2N1GA 3WAKA 2ZMAA 3DJBA 3OKQA 4TUYE 4EOZB 5JDMA 3SWHA 4PUXA 1IAPA 3AAAB 4AI6A 2ZM8A 1OPFA 3PTRB 1HX8A 3HKBE 1MMDA 2F1VA 2PRNA 3JTYA 1ZHXA 2EHOA 3ESLA 2NW8A 2YINA 2DLRA 1IZNB 1D0YA 3PQSA 3AA1B 2YNKA 3T20A 2CCQA 3SOLA 1QSDA 1ZV4X 3GWHA 2RP4A 3NRXA 1LKXA 3RYCE 4AKMA 4HE8A 1ZEEA 2CEAA 4F4BA 1US7B 2NW7A 4AQFA 3VY9X 2GK9A 3N9LA 2C0SA 3EUHA 2MBGA 3WI3A 4ERRA 2LHNA 3ZN1B 3KV9A 1ZHZA 3I0OA 5AFUK 3QRAA 3U78A 3EDVA 1HFAA 3GA8A 1HTJF 3R6NA 5LHIB 4BUMX 1E54A 3MA9A 3VE1A 3U3IA 3VKGA 3EDUA 3I9YA 4KR8A 3H37A 4AQGA 5DABA 2Y7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK3 B;  3AAE A;  3AA1 B;  3LK2 B;  4AKR B;  2KZ7 A;  3AA6 B;  2KXP A;  3AA7 B;  3AA0 B;  3LK4 1;  3AAA A;  5AFU L;  3AAE B;  5ADX L;  1IZN A;  3LK2 A;  2KZ7 B;  3LK3 A;  3AA1 A;  2KXP B;  4AKR A;  5AFU K;  5ADX K;  3AA6 A;  3AAA B;  3AA7 A;  3AA0 A;  3LK4 2;  1IZN B; 
#chains in the Genus database with same CATH topology
 3HA4 A;  2LSI A;  4RLC A;  2CBI A;  2WSS V;  2W0G A;  2NW9 A;  3BS0 A;  2BBH A;  4BAY B;  5HXH A;  2ODU A;  3EVY A;  5TIS O;  4X1K E;  5ABE A;  4UVC B;  1LRZ A;  3T1Y T;  2JPF A;  3FZL B;  3OVU A;  3AE4 A;  4QX7 B;  3PUZ F;  3NJT A;  3FXD B;  2WZI A;  2Q9Q A;  2VK9 A;  4IDP A;  4U33 A;  2Y0K A;  2BKP A;  2VQF T;  4FMS A;  1Q9G A;  3LSV A;  4JI0 T;  3ZN0 B;  1W0B A;  2UUC T;  4MHC A;  5L2L A;  5GTH O;  5CGM A;  2SPC A;  5ADX K;  4L5G A;  2CXL A;  3RI5 A;  2XQ3 A;  2B1E A;  5AQK B;  2V7J A;  3AXJ B;  3CKD A;  1OXZ A;  4CN1 A;  4B3T T;  1LVF A;  4YY3 T;  5AQH B;  5L3B B;  5JDN A;  1MM5 A;  2LSJ A;  4JFB A;  2MOZ A;  1ZKE A;  4EGW A;  5KAI O;  3OBV E;  3P4P A;  1MIV A;  2IWW A;  1HX1 B;  2WM9 A;  4TZ4 C;  5LNK A;  2J1D G;  1MPF A;  4UXN B;  2V7M A;  2KXP A;  4EB6 E;  4QKN A;  4B6X A;  5IUX A;  3RYI E;  1HXX A;  4JEH B;  4XNL A;  3QB5 K;  4HFE A;  3AEC A;  3EMN X;  3CPZ A;  1WR6 A;  4FI5 A;  1WRD A;  2W62 A;  3OJA A;  3WI5 A;  4IDZ A;  4JBW F;  2E9X C;  4PK4 A;  4CN6 A;  4FQE A;  2CRB A;  4ZI7 E;  5IYU A;  2BG9 B;  4PAG A;  5LXT E;  1WCR A;  1AJ3 A;  3MKD A;  3JAE A;  4IDN A;  5FKY A;  1GFN A;  4YLH A;  2VKO A;  2HPJ A;  2G0U A;  2K48 A;  4IE0 A;  3J7Y q;  4C91 A;  2E9X D;  5LJM A;  4GCQ A;  4N58 A;  2VKJ A;  4DBR A;  2UXX B;  2FJE A;  2M07 A;  3WAJ A;  4JUY A;  2LM9 A;  1OED A;  3AAE A;  2UXC T;  2WWV A;  1MIY A;  5J1G A;  2YDQ A;  4AQF C;  4O2A E;  1HS7 A;  2R89 A;  2L3L A;  4TV9 E;  2XUE A;  3H3M A;  3FZF B;  2ZM0 A;  3QOF A;  2D0T A;  5JDP A;  5JRE A;  1BR4 A;  2XTR A;  2IC6 A;  2YU1 A;  5JQG E;  4D64 A;  4RJW A;  1WYC A;  3UU5 A;  2NWB A;  3GN5 A;  1T8B A;  4ZS2 A;  4C00 A;  3N9P A;  4F8H A;  3ZYL A;  3AVR A;  4QXH B;  5LCY A;  3UU3 A;  1CHU A;  2E9X A;  4YJ2 E;  3AAI A;  4LSH A;  5E0O A;  5AQQ B;  4PW8 A;  3CWZ B;  4EYY R;  3K3O A;  2E5V A;  2AE9 A;  5LGT B;  1KNR A;  4HWC A;  5FVL A;  5JRC A;  1XDO A;  2WDV A;  1G90 A;  2M6B A;  1BXW A;  2J62 A;  2M06 A;  1PRN A;  3SRZ A;  5L3C B;  2WJR A;  3TZG A;  3VZT X;  3LK2 A;  3FB2 A;  3NBX X;  5AQP B;  4AZL A;  3MK7 C;  4QWN B;  4TN7 B;  3UFG A;  2OLT A;  5E79 O;  2O4V A;  3PQU A;  3RYF E;  3VKH A;  3E08 A;  2VAS A;  2LE8 A;  5LGU B;  2LKH A;  4CZZ B;  2XG6 A;  1ZHT A;  5JR9 A;  5LYJ E;  4YT0 A;  3CX7 B;  5CJ5 A;  3RH3 A;  3RQW A;  3ZMT B;  2YPV A;  4KP3 C;  4TNW A;  3RHW A;  1M7K A;  3ZJ2 A;  2LOP A;  2LJL A;  3AE2 A;  4XAX B;  1JNZ A;  4HFC A;  4B3R T;  4Z8X A;  5L3G B;  3K1S A;  5BR8 T;  3PUA A;  3LBX A;  1WLX A;  3ANW B;  4CI2 B;  3PUQ A;  2FJD A;  3N2O A;  2EHO D;  4N74 A;  4UB6 O;  2K5B B;  4MAL A;  2XAH B;  2WU5 A;  3E0Z A;  3FBL A;  4LF4 T;  4DID B;  1N33 T;  3M3Z B;  4I43 B;  4LSF A;  5CFB A;  3HKC E;  3AA7 B;  5CB4 E;  1UK5 A;  4YSY A;  4U7Y A;  5HEU A;  2WB5 A;  1HNZ T;  1HR0 T;  2GE4 A;  4LFA T;  5HEJ A;  3LJC A;  2F1T A;  2IWV A;  2BDE A;  4O4U A;  1SE7 A;  5FXV A;  2V7I A;  2XE3 A;  4LFB T;  1GFM A;  5JH7 E;  5HCJ A;  4AXP A;  1T7S A;  1XNR T;  1BH3 A;  3UFE A;  1DU2 A;  3LK3 A;  1T72 A;  3WAK A;  4EOZ B;  5B66 O;  2UU9 T;  4HFI A;  1MMD A;  2VUR A;  1ZHX A;  2EHO A;  1IZN B;  3PQS A;  2YNK A;  1QSD A;  3GWH A;  5L4H A;  5FL1 A;  4ILC A;  3T1H T;  4AKM A;  3NKZ A;  1ZEE A;  2CEA A;  4F4B A;  1US7 B;  2XY8 B;  2LHN A;  1ZHZ A;  2HN1 A;  3EDV A;  1HFA A;  3AEB A;  4JI2 T;  1E54 A;  3RGL A;  4YSX A;  3VKG A;  4JI3 T;  4IRE A;  5AQO B;  4C90 A;  3PGU A;  4LMK A;  4J2C A;  3TLV A;  4AKL A;  4IDQ A;  1BR0 A;  3IHR A;  4HKA A;  3HKD E;  3NRY A;  1FJG T;  3HW9 A;  4ZI3 C;  4LSE A;  2J1N A;  5KDM C;  4LSI A;  3K3N A;  4JI1 T;  4U9C A;  3EAB A;  4G2A A;  4NUV A;  4JYA T;  4N59 A;  4QX8 B;  1KFY A;  2DI4 A;  3C5O A;  4PJ0 O;  1QJ8 A;  2NTY A;  2BG9 C;  1YW0 A;  2XMX A;  4FT6 A;  4G75 A;  4K3B A;  3ZYM A;  4HWF A;  3JAF A;  2HPL A;  5J2T E;  3JCU O;  3NZP A;  4NUU A;  2QA7 A;  3AE5 A;  5HEO A;  2WS3 A;  2F4V T;  1E2A A;  3BQI A;  1SHZ C;  1UCU A;  3PUS A;  4HGA A;  2X68 A;  3AXJ A;  3UQ7 A;  3OPC A;  5AQI B;  1BR1 A;  2KMF A;  3G7G A;  1FIO A;  3KV4 A;  5JDF A;  2LHR A;  2XQ6 A;  2Y48 B;  2V6Y B;  3RYH E;  4DV7 T;  3AED A;  1HXT A;  5HCM A;  3VU7 H;  2X66 A;  2VB6 A;  3EI0 A;  1P4T A;  4LF7 T;  5ABH A;  3P8C D;  2XSB A;  3PU8 A;  4YTM A;  2R4N A;  3UUL A;  4O49 A;  2XQY A;  5HEG A;  3AA0 A;  3CIR A;  3DA3 A;  1UX5 A;  5EK3 A;  4HEA A;  2IDO B;  4ANJ A;  3KDS E;  2E5L T;  2BS3 A;  3AA1 A;  4PK6 A;  4IE5 A;  2XTL A;  1QJP A;  4FOZ A;  5LG4 A;  4N75 A;  5HWY A;  2XE5 A;  2OA5 A;  3L09 A;  1YQ3 A;  1T16 A;  4P0B A;  1J5E T;  4OYJ A;  2IML A;  1NAF A;  3UU4 A;  3SZD A;  2J47 A;  3RKG A;  2N2N A;  3V5S A;  4UF0 A;  4RLB A;  3ZEF B;  4DMV A;  1IJ6 A;  1BR2 A;  4E7S A;  3AA6 B;  1R8I A;  2NP9 A;  2WAU A;  4U74 A;  5HAX A;  1N34 T;  2FUP A;  1VOM A;  2CM0 A;  3PUR A;  4FJO A;  4ISS A;  3LK4 2;  2ZLD A;  5LBQ B;  1MM4 A;  4PK5 A;  4WBO A;  2N2L A;  3BQK A;  2LSG A;  2H7O A;  3UPG A;  1HG2 A;  5G26 A;  4X5T A;  4A56 A;  2IC9 A;  4AYD C;  1XMQ T;  1Y01 A;  3ZC0 A;  4OX9 T;  2H3R A;  5AQL B;  4OK0 A;  2A3D A;  2V5C A;  4QHO A;  3RX6 A;  3K8P C;  3TLU A;  1ZP0 A;  2YU2 A;  4ILU A;  3OTO T;  2IHR 1;  1YD8 G;  2D0U A;  3M65 A;  2X9K A;  2W63 A;  4NXN T;  2JQQ A;  1GFO A;  5JDL A;  5GON E;  4PJM A;  2XQ4 A;  4EZ4 A;  2PFV A;  3RIA A;  5H6R B;  4QQ1 A;  5LBM A;  3ZCJ A;  3ZT5 A;  3S4U A;  4LFC T;  2R88 A;  1X79 A;  4L0R A;  2B76 A;  4HN9 A;  1NEN A;  3ZMS B;  4IGU A;  3C51 A;  3ZC1 A;  4C4V A;  3E22 E;  1XMO T;  2XAS B;  2XJ7 A;  4DND A;  2JQH A;  4P1N A;  3RRC A;  3DZM A;  1IBL T;  4X64 T;  5LB7 B;  3IBP A;  3UU8 A;  4DR2 T;  3POQ A;  1O3X A;  4HWI B;  3DWO X;  2C5I T;  3JC6 C;  3MZK B;  3HKE E;  3C64 A;  4PJL A;  4TV8 E;  2DCF A;  5GTI O;  8PRN A;  3JAD A;  4QH1 A;  3AE3 A;  5HXR A;  1XWM A;  4YJ3 E;  4AKR A;  4X20 E;  3POX A;  2WQY A;  4HFB A;  3EHZ A;  4BJM A;  1UGO A;  1KEY A;  4YHJ A;  4G76 A;  2ODJ A;  7PRN A;  4Z3T A;  2ACZ A;  2W00 A;  3RIU C;  2LM2 A;  4U2Y A;  2WCA A;  5FXZ A;  3ZST A;  2A9U A;  4DMW A;  4P09 A;  1U4Q A;  5EK4 A;  5EK2 A;  5ABG A;  5FY1 A;  4O4J E;  3AEF A;  2LOS A;  4EZH A;  4KR4 A;  3VHL A;  5FVK A;  1XNQ T;  5AQN B;  2MYS A;  3L39 A;  2XAJ B;  5L47 A;  3PUX F;  4CXW A;  2XQ7 A;  2DL1 A;  2DWG A;  2HH7 A;  5JDG A;  4ZZC A;  3FZH B;  2IUB A;  2WY2 A;  5A1L A;  3NSG A;  1W0A A;  4L9I A;  3KV5 A;  4GK0 E;  4DR1 T;  5F3J A;  4UV8 B;  3SYB A;  3AB3 B;  1MMN A;  4Z91 A;  3ZYK A;  2ZM2 A;  2XTQ A;  2KXP B;  2KIN B;  3PJA J;  4DO0 A;  2WZH A;  4CN4 A;  2CLY B;  3A8Y C;  3UQ4 A;  5LA6 E;  2WDQ A;  1ZOY A;  2XE2 A;  2CWO A;  4IHJ E;  3KVD D;  4YTN A;  4ZEY A;  4GKJ T;  4HTE A;  2V26 A;  2XZE A;  3ETV A;  1SUM B;  1IJ5 A;  5CA1 E;  1OSM A;  4HFD A;  5AFU L;  1XZY A;  4LML A;  3BRZ A;  2ZMA A;  3OKQ A;  1IAP A;  1OPF A;  1HX8 A;  4A5X A;  3ESL A;  2NW8 A;  4TWH A;  2JQY A;  3T20 A;  1ZV4 X;  2RP4 A;  4EEB A;  4HE8 A;  4AQF A;  5HEH A;  2C0S A;  3AE1 A;  3P4S A;  3I0O A;  3GA8 A;  4WZX A;  3EDU A;  3I9Y A;  4KR8 A;  5L4E A;  3H37 A;  5DAB A;  2WDR A;  3Q5W A;  2IAK A;  3ZMU B;  4KI0 F;  3A0H O;  4LF9 T;  5G38 A;  2NTX A;  2KND A;  1HNX T;  2JIW A;  1OED B;  3AEG A;  3AAE B;  3OYZ A;  5ADX L;  4JV5 T;  4AKH A;  2AXT O;  3ONX A;  5T5F A;  3PGS A;  3B57 A;  4XNK A;  4PFP A;  3RQU A;  5DL7 A;  4I0U A;  5LG3 A;  4G63 A;  4UVA B;  2KDY A;  2BBJ A;  2OV9 A;  3P4Q A;  2ODV A;  3K19 A;  3J9X 1;  2FGR A;  4YTP A;  4AIS A;  4K3C A;  1ORM A;  3GN5 B;  5G3A A;  2MPK A;  3UAQ A;  3QUJ A;  2QYW A;  4DV3 T;  3ZJ1 A;  3QRC A;  1GQE A;  4IL9 A;  5FVN A;  2L8K A;  2W66 A;  2E9X B;  3VE2 A;  3PUY F;  2Y8D A;  2M67 A;  3R84 B;  2X67 A;  4DV2 T;  1MNE A;  5LJN A;  2N9D A;  3ONL C;  2QGS A;  2J4U P;  3A7M A;  3N2G E;  2C5J A;  1M62 A;  3LDQ B;  4ZI2 C;  3LK4 1;  3QNU A;  3RC3 A;  3POR A;  4ILA A;  4O3Y A;  1HNW T;  3P7I A;  2X9W A;  5C8Y E;  1VCT A;  3C4X A;  2RPA A;  2Y0H A;  2V6Y A;  2KZ7 B;  5JRC B;  4DV6 T;  2W61 A;  4WW0 A;  2JRK A;  4IT4 A;  4B3S T;  4XZC A;  2WMN A;  2YK0 A;  3MAC A;  3HOE A;  2XQ8 A;  3O1J A;  3AVS A;  3KVB A;  4U2Z A;  2I6H A;  5DL6 A;  3AAA A;  2W2U A;  3FZK B;  4X66 T;  3SY7 A;  2PJQ A;  2KSR A;  3A0B O;  3RKO A;  3KIN B;  2V7L A;  2XAF B;  4JI5 T;  2PBI A;  2JMM A;  5JR9 B;  3ABV A;  3UTK A;  2WU2 A;  1UX4 A;  1IBM T;  4I55 E;  4PFO A;  5LMU T;  3PE0 A;  4IIJ E;  2VWA A;  3MJX A;  4KBM B;  3KV6 A;  2WMO A;  2KWI B;  4O3W A;  2KT9 A;  4MBQ A;  5FYM A;  3N9M A;  4ZOL E;  2K9A A;  2RA1 A;  2A72 A;  4ZS3 A;  4BA9 A;  1NWM X;  4H9R C;  3T8O A;  3LG7 A;  4H9S E;  4IE6 A;  3AEE A;  5J0Z A;  5LGN B;  2R4L A;  2VVS A;  2X51 A;  4AYE C;  1J5W A;  5H2F O;  2H89 A;  4AYM C;  2MTQ A;  4OHF A;  1MIW A;  3HWB A;  3RBH A;  4ZI3 D;  3SFE A;  4HWH A;  4E7Z A;  5HXS A;  2WBL A;  4DVD A;  1WYB A;  4CXY A;  1CUN A;  1B7T A;  1THQ A;  3AE8 A;  1D1A A;  2Y2X A;  3DP7 A;  4ZXL A;  3IF8 B;  2XAQ B;  4DV4 T;  3O9X A;  2HHH T;  3L3P A;  5KXJ A;  1PHO A;  2YN6 A;  1YKE B;  2LRL A;  3UT5 E;  2CHN A;  4FZM A;  2H88 A;  3MXZ A;  3GP6 A;  4YSZ A;  2UUB T;  2CPT A;  2ES0 A;  3OYX A;  4ASK A;  1D0X A;  4GKK T;  4GHB A;  4GIW A;  5LOV E;  5HWX A;  4WNK A;  4XBF B;  4P0A A;  5ETW A;  3N9Q A;  5FY0 A;  4CI3 B;  4FSP A;  3C4Z A;  2CXF A;  3SY9 A;  3AEA A;  2BS2 A;  1OED E;  1XDP A;  3QC9 A;  3CQC B;  4LF8 T;  2ACX A;  3LK3 B;  3N9N A;  4NIQ A;  1YQ4 A;  1S94 A;  2QTK A;  2EHO B;  4NPP A;  3BK9 A;  5DL5 A;  4KUM B;  3UUX B;  4FUV A;  5B5E O;  4JI8 T;  1VRB A;  5ABF B;  1KF6 A;  1KNP A;  3Q5E A;  3CML A;  3FZM B;  4JI7 T;  3RIF A;  4OYK A;  2KC0 A;  3WU2 O;  4EYU A;  3QB5 A;  4YXD A;  4JI6 T;  3UUB A;  5IWA T;  3CK6 A;  2BG9 A;  5FY7 A;  3HOL A;  4CXX A;  4DV1 T;  2CLY C;  2FGQ X;  2JMH A;  2BVM A;  4UEL A;  5DQW A;  5CA0 E;  4UR9 A;  3SFD A;  2JQK A;  1Z8U A;  3VRB A;  3I1A A;  2V7K A;  1ZHC A;  4KRA A;  5F8P A;  2E8I A;  1BT9 A;  1FEW A;  3SS1 A;  3I0Q A;  4MFR A;  1Y64 B;  3ETU A;  4EED A;  3ZLI A;  4KHP T;  5DL8 A;  1JNR A;  2XM2 A;  2L9Q A;  4U72 A;  2XHE B;  4B3M T;  3C50 A;  2IIU A;  1OWA A;  4IST A;  4GF4 A;  2A2F X;  4UVB B;  5LHG B;  4HWD A;  4EV6 A;  4CQI A;  2XQA A;  2CE7 A;  2XQ9 A;  3UU2 A;  4EXT A;  4UEM A;  5PRN A;  4E1S A;  2X27 X;  3PRN A;  2XM1 A;  3ZPO A;  2K4T A;  2D9D A;  4UIG A;  1H6S 1;  4FRX A;  4H63 H;  2Y6X A;  1OED C;  4PNI A;  3W15 B;  2VVN A;  4OFZ A;  4DR3 T;  3H3A A;  4B61 A;  4FES A;  5AQT B;  3AE7 A;  4JI4 T;  2V8S V;  1QUU A;  3V5U A;  4ADZ A;  4DR4 T;  2FJA A;  1WFD A;  2X9X A;  4KX6 A;  5GV0 A;  5JVD E;  1YS5 A;  4DBQ A;  3KFW X;  3O1H A;  2VQE T;  3CQX C;  5D5D A;  3AA0 B;  3RLF F;  2CBJ A;  5KMG P;  3IA3 A;  4O4L E;  2XAG B;  3I9W A;  3Q5D A;  1H7C A;  2DNX A;  4GK5 E;  1MMG A;  2YKS A;  2V5D A;  2W67 A;  2X0Y A;  5JDM A;  4PUX A;  2F1V A;  2ZM8 A;  3JTY A;  2PRN A;  3HKB E;  4IL6 O;  4DR5 T;  2YOE A;  2BKO A;  1D0Y A;  3AA1 B;  3PUW F;  3PJA A;  1IBK T;  4AIU A;  3VY9 X;  4A97 A;  2MBG A;  3QRA A;  4BUM X;  1HTJ F;  2WJQ A;  3ZT6 A;  3MA9 A;  3VE1 A;  2YDS A;  2Y7S A;  5EE2 A;  4IDO A;  2CWY A;  2VKD A;  4KMC A;  5J2U E;  3DA4 A;  2C5K T;  4E1T A;  4UF0 B;  5DQV A;  3LFM A;  3K3Q C;  4AKG A;  5IHY A;  3JC6 D;  2NR4 A;  5L3D B;  3JCF A;  4DUZ T;  2Q9Q B;  3A5X A;  3WI4 A;  2WP9 A;  4AQY T;  2K0L A;  3N9O A;  2MHL A;  3A2S X;  3RF1 A;  1LVK A;  2D5U A;  2QRX A;  5C3J A;  4ILB A;  3F57 A;  4AFK A;  4ZHQ E;  2NOX A;  4FZN A;  2Y0L A;  2Z6E A;  3B5M A;  1E1H B;  1S35 A;  1HCI A;  1S5L O;  4NXM T;  1Q9F A;  1KK7 A;  3ANW A;  2PTF A;  5AQF B;  5JR9 C;  4JLE A;  5C2T A;  3SZV A;  4GYS A;  4C69 X;  3T0S A;  4AYI D;  3HI2 A;  5G39 A;  3ZKR A;  4FSO A;  5KX5 E;  2XSA A;  2VL8 A;  4F6R C;  4O4X A;  3PUV F;  3QK6 A;  2F1C X;  5BMV E;  3AA7 A;  4IE4 A;  2OMF A;  4O4I E;  5AQG B;  2LSK A;  2LSY A;  3RPU A;  1VCS A;  3TKL B;  3FYX A;  3ZSS A;  1D1C A;  4WYV A;  1D0Z A;  1J1J A;  4C4V B;  2E2A A;  4D5U A;  1UUR A;  3P50 A;  1D1B A;  2UUA T;  2V6X A;  5AQU B;  5L3F B;  3Q9D A;  4PJJ A;  1U5P A;  3FBZ A;  1ZHY A;  5L3E B;  2M6I A;  2ZLY A;  3RIU A;  2VKH A;  2KZ7 A;  2W80 C;  2YEV C;  3DTO A;  3DWN A;  4O2B E;  3VR8 A;  5FL0 A;  2CA5 A;  4HFV A;  4PJN A;  4O3Z A;  2MNH A;  4H9P C;  1IZN A;  2P9B A;  4O3X B;  4DR6 T;  4AYN A;  1YKH B;  3TLS A;  1X9B A;  4QXC B;  4JCH A;  4DV0 T;  3RRW A;  1QLB A;  5HXE A;  3VZW X;  4TNV A;  2LT3 A;  3P4R A;  4AKR B;  5FXW A;  4FZL A;  3L8R A;  3O4X E;  5JDQ A;  1N32 T;  4O4H E;  2PG8 A;  4HFH A;  1E7P A;  1T98 A;  4U7I A;  4UV9 B;  2CHO A;  1W9R A;  4Q25 A;  1G73 A;  3AE6 A;  2EHO C;  4CTD A;  3GMI A;  3AE9 A;  4KHZ F;  3FHN A;  1V9D A;  5M4Y A;  3C98 B;  2WVP A;  4K0K T;  5HXC A;  2UXB T;  4U31 A;  3TLT A;  4QXB B;  3BRY A;  2JMK A;  4DR7 T;  2JQ9 A;  4EIW A;  5F5W A;  5FNV E;  2V1D B;  1MMA A;  5LMN T;  3X1D A;  4TX5 A;  2XE1 A;  3VZU X;  4X1I E;  3CX6 B;  5LP6 E;  3NZQ A;  2LHF A;  5AQM B;  2N2M A;  1EZ3 A;  2K24 A;  1GFP A;  3Q2M A;  1HF8 A;  2R6G F;  5FP3 A;  3NVO A;  4GCS A;  2H7V C;  5JTG A;  1L0V A;  2R8A A;  2KWH A;  2BS4 A;  2BG9 E;  4X62 T;  1WR0 A;  4A98 A;  1HG5 A;  1KNZ A;  3O0E A;  3RC8 A;  3KBT A;  3IEE A;  2X9H A;  4IE7 A;  5FXX A;  4V1A v;  3UUM A;  4I50 E;  2D2S A;  2CXD A;  2KLQ A;  3LK2 B;  1ZHW A;  2AXD S;  4K0U A;  2IW5 B;  2W81 C;  1I94 T;  5H6Q B;  3D0T A;  2ZM6 T;  4ZI2 D;  4QH4 A;  3VY8 X;  4JEU B;  4TWF A;  2R4P A;  3F2E A;  5DJQ C;  4RL9 A;  4H9O C;  2LRK A;  4H9N C;  3V8U A;  2CMR A;  2JJ9 A;  3PU3 A;  3PGR A;  1T1L A;  4IL4 A;  4U3C A;  3P4W A;  3VRA A;  4X1Y E;  2DWK A;  3Q5X A;  3UU6 A;  2YDR A;  5AQJ B;  5ABF A;  4D65 A;  2BVL A;  3SYS A;  2LEH A;  4TWD A;  2BKN A;  4WBN E;  3VR9 A;  3KZI O;  2X0H A;  3B13 A;  3CX8 B;  3ZT7 A;  4COF A;  4DV5 T;  2LLY A;  3F31 A;  2XQ5 A;  3G06 A;  4H9Q C;  4I4T E;  5FMN A;  4RJX A;  4LMJ A;  2UXD T;  3T24 A;  5IYZ E;  4EAH A;  4M1P A;  2BZB A;  3POU A;  4O8S A;  3LBX B;  3PUG A;  4X65 T;  3CQG B;  4H63 V;  2UXN B;  3PF1 A;  3AA6 A;  2ZFG A;  3HR0 A;  2I59 A;  1G8X A;  4YFS A;  4LF5 T;  2WWU A;  2XPK A;  2X9Y A;  3C4W A;  1QJ9 A;  3O1I A;  3BQL A;  2DHR A;  4N78 D;  4PR7 A;  1NEK A;  4ZZB A;  6PRN A;  3HL6 A;  5KAF O;  5TAO A;  5JDH A;  3ZMZ B;  3ZMV B;  1Z0P A;  1GFQ A;  1UUS A;  5AQR B;  2R4O A;  3TLW A;  5EZY E;  3EAM A;  1HXU A;  2LFU A;  4BJN A;  3PDY A;  3KBU A;  5LHH B;  2X0L B;  1FMV A;  4CI1 B;  1FMW A;  3PV0 F;  2J4G A;  2Q9Q C;  4DUY T;  3ZCI A;  4Z90 A;  3N5L A;  5HYA A;  4MLK A;  3KVA A;  3N2K E;  4GYR A;  4GOU A;  2W4X A;  3UUN A;  4AKI A;  2ERV A;  5AQS B;  1I6Z A;  3ONJ A;  3CVR A;  1SA0 E;  4FRT A;  2POR A;  4AUI A;  2FBW A;  1YXR A;  2QVA A;  2Q9Q D;  4GCP A;  3FXE B;  1MND A;  2N1G A;  2MAW A;  1W09 A;  5AQV B;  3DJB A;  4TUY E;  3SWH A;  3AAA B;  4AI6 A;  3PTR B;  3NWI A;  2YIN A;  2DLR A;  2VL0 A;  2I0M A;  2HN2 A;  4UB8 O;  2CCQ A;  3SOL A;  2K3W A;  3NRX A;  2LKG A;  1LKX A;  3RYC E;  2NW7 A;  1N36 T;  4YHH T;  4QH5 A;  2GK9 A;  3N9L A;  3EUH A;  3WI3 A;  4ERR A;  3ZN1 B;  3KV9 A;  4LF6 T;  5AFU K;  3U78 A;  3R6N A;  5LHI B;  3U3I A;  4AQG A;  2FJB A; 
#chains in the Genus database with same CATH homology
 5EE2 A;  4C90 A;  2CWY A;  2IAK A;  2LSI A;  3HA4 A;  3Q5W A;  3ZMU B;  2VKD A;  4KMC A;  5J2U E;  4RLC A;  3DA4 A;  4J2C A;  2C5K T;  4E1T A;  2NTX A;  4UF0 B;  4AKL A;  5DQV A;  3LFM A;  2WSS V;  2W0G A;  3K3Q C;  3IHR A;  2KND A;  5IHY A;  2NW9 A;  3JC6 D;  4HKA A;  5L3D B;  4BAY B;  1BR0 A;  5HXH A;  2ODU A;  3AAE B;  3EVY A;  3HKD E;  3OYZ A;  4X1K E;  5ADX L;  3NRY A;  4UVC B;  4AKH A;  1LRZ A;  2Q9Q B;  3A5X A;  3ONX A;  5T5F A;  2JPF A;  3HW9 A;  3WI4 A;  4ZI3 C;  3B57 A;  4LSE A;  2J1N A;  2K0L A;  4XNK A;  5KDM C;  3N9O A;  2MHL A;  4QX7 B;  4PFP A;  3A2S X;  4LSI A;  1LVK A;  3K3N A;  5DL7 A;  2D5U A;  3FXD B;  4U9C A;  2Q9Q A;  2VK9 A;  4G2A A;  3F57 A;  4NUV A;  2Y0K A;  4AFK A;  4ZHQ E;  2NOX A;  4FZN A;  2Y0L A;  4N59 A;  2Z6E A;  4FMS A;  1E1H B;  1Q9G A;  1S35 A;  4QX8 B;  1HCI A;  2DI4 A;  3C5O A;  3ZN0 B;  4G63 A;  1QJ8 A;  2NTY A;  4UVA B;  1YW0 A;  1Q9F A;  4MHC A;  5L2L A;  2XMX A;  1KK7 A;  3ANW A;  4FT6 A;  2SPC A;  4G75 A;  4L5G A;  5JR9 C;  5ADX K;  4JLE A;  2KDY A;  3SZV A;  3ZYM A;  2CXL A;  4GYS A;  2ODV A;  4C69 X;  2HPL A;  3T0S A;  4AYI D;  3K19 A;  2B1E A;  3J9X 1;  2V7J A;  5J2T E;  2FGR A;  3NZP A;  1ORM A;  3CKD A;  3GN5 B;  3UAQ A;  4NUU A;  1OXZ A;  3HI2 A;  2QA7 A;  3QUJ A;  1LVF A;  4FSO A;  5KX5 E;  5L3B B;  3ZJ1 A;  3BQI A;  2VL8 A;  1SHZ C;  1UCU A;  3PUS A;  4HGA A;  4F6R C;  5JDN A;  2LSJ A;  1MM5 A;  4JFB A;  2MOZ A;  5FVN A;  2L8K A;  1ZKE A;  2X68 A;  4O4X A;  2E9X B;  3QK6 A;  3VE2 A;  3OBV E;  1BR1 A;  5BMV E;  3AA7 A;  1MIV A;  2KMF A;  2Y8D A;  4IE4 A;  2M67 A;  3G7G A;  3R84 B;  1FIO A;  4O4I E;  3KV4 A;  2OMF A;  2X67 A;  5JDF A;  2WM9 A;  5LNK A;  4TZ4 C;  2LSK A;  2LHR A;  2J1D G;  2Y48 B;  2LSY A;  1MNE A;  3RYH E;  5LJN A;  2N9D A;  1MPF A;  4UXN B;  2V7M A;  3RPU A;  2QGS A;  1HXT A;  2J4U P;  3VU7 H;  2X66 A;  3N2G E;  2C5J A;  2VB6 A;  3TKL B;  2KXP A;  3FYX A;  1D1C A;  4ZI2 C;  1P4T A;  4EB6 E;  3P8C D;  4QKN A;  3LK4 1;  3RC3 A;  4B6X A;  3POR A;  4O3Y A;  3PU8 A;  3P7I A;  2X9W A;  3RYI E;  3UUL A;  5C8Y E;  3C4X A;  1HXX A;  4O49 A;  1D0Z A;  2Y0H A;  4JEH B;  4XNL A;  2KZ7 B;  2XQY A;  5JRC B;  2W61 A;  4WW0 A;  4D5U A;  1D1B A;  2JRK A;  4XZC A;  2WMN A;  3AA0 A;  2YK0 A;  5L3F B;  3Q9D A;  3DA3 A;  3MAC A;  4PJJ A;  3EMN X;  3CPZ A;  1U5P A;  3FBZ A;  1ZHY A;  3HOE A;  3O1J A;  1WR6 A;  4FI5 A;  3AVS A;  5L3E B;  1WRD A;  2ZLY A;  1UX5 A;  2VKH A;  3KVB A;  2KZ7 A;  2W80 C;  2W62 A;  2YEV C;  3DTO A;  3OJA A;  5EK3 A;  4O2B E;  3WI5 A;  4IDZ A;  5DL6 A;  2CA5 A;  4HEA A;  4HFV A;  2E9X C;  4PJN A;  4PK4 A;  3AAA A;  4O3Z A;  2MNH A;  4H9P C;  4ANJ A;  3KDS E;  3SY7 A;  1IZN A;  2P9B A;  4O3X B;  2PJQ A;  3RKO A;  3AA1 A;  4AYN A;  3KIN B;  4PK6 A;  4IE5 A;  4ZI7 E;  1YKH B;  2XTL A;  1QJP A;  4FOZ A;  4QXC B;  4JCH A;  5IYU A;  5LG4 A;  2V7L A;  5HWY A;  2XE5 A;  4PAG A;  3RRW A;  2XAF B;  5HXE A;  3VZW X;  2OA5 A;  3L09 A;  2PBI A;  2LT3 A;  5LXT E;  1AJ3 A;  3MKD A;  2JMM A;  5JR9 B;  4AKR B;  1GFN A;  5FXW A;  3UTK A;  4YLH A;  2VKO A;  1UX4 A;  4P0B A;  4FZL A;  3O4X E;  4I55 E;  4OYJ A;  5JDQ A;  2HPJ A;  2G0U A;  2K48 A;  2PG8 A;  4O4H E;  4PFO A;  1NAF A;  3SZD A;  3PE0 A;  4IIJ E;  4IE0 A;  2VWA A;  3MJX A;  4C91 A;  2E9X D;  5LJM A;  3J7Y q;  1T98 A;  4GCQ A;  4KBM B;  2N2N A;  3KV6 A;  2WMO A;  2KWI B;  3V5S A;  2KT9 A;  4N58 A;  4MBQ A;  5FYM A;  4O3W A;  3N9M A;  4ZOL E;  4UV9 B;  4P0A A;  2VKJ A;  4DBR A;  2UXX B;  2K9A A;  2RA1 A;  2M07 A;  4UF0 A;  3WAJ A;  4RLB A;  3ZEF B;  2A72 A;  4ZS3 A;  4DMV A;  1G73 A;  4JUY A;  2LM9 A;  1IJ6 A;  1BR2 A;  4BA9 A;  2EHO C;  3AAE A;  4E7S A;  1NWM X;  4H9R C;  3AA6 B;  3GMI A;  2NP9 A;  3T8O A;  2WAU A;  3FHN A;  1V9D A;  3LG7 A;  4H9S E;  4U74 A;  5HAX A;  4IE6 A;  5M4Y A;  3C98 B;  1MIY A;  5J1G A;  5LGN B;  4AQF C;  4O2A E;  5HXC A;  1HS7 A;  2X51 A;  4AYE C;  4QXB B;  2JMK A;  1VOM A;  2CM0 A;  2L3L A;  3PUR A;  4FJO A;  4TV9 E;  4AYM C;  2XUE A;  4EIW A;  3QRC A;  5FNV E;  2MTQ A;  4ISS A;  1MIW A;  2V1D B;  2ZM0 A;  4OHF A;  3LK4 2;  3HWB A;  3RBH A;  1MMA A;  4ZI3 D;  2ZLD A;  2D0T A;  5LBQ B;  1MM4 A;  5JDP A;  4E7Z A;  5HXS A;  5JRE A;  2WBL A;  4TX5 A;  1BR4 A;  4DVD A;  4PK5 A;  1WYB A;  4WBO A;  4CXY A;  2N2L A;  1CUN A;  3BQK A;  2LSG A;  1B7T A;  2H7O A;  2XE1 A;  2IC6 A;  2XTR A;  1HG2 A;  1THQ A;  5G26 A;  3UPG A;  3VZU X;  1D1A A;  4A56 A;  2Y2X A;  3DP7 A;  2IC9 A;  4AYD C;  2YU1 A;  4X1I E;  3CX6 B;  5JQG E;  3ZC0 A;  4RJW A;  4D64 A;  5LP6 E;  3NZQ A;  3IF8 B;  2LHF A;  2H3R A;  2XAQ B;  4OK0 A;  2A3D A;  4QHO A;  1WYC A;  3O9X A;  3RX6 A;  2N2M A;  2NWB A;  3GN5 A;  3K8P C;  3L3P A;  1EZ3 A;  2K24 A;  1PHO A;  4ZS2 A;  1YKE B;  1GFP A;  2YU2 A;  3Q2M A;  4ILU A;  1HF8 A;  3UT5 E;  1YD8 G;  2D0U A;  3M65 A;  5FP3 A;  4FZM A;  4GCS A;  2H7V C;  3MXZ A;  3N9P A;  3GP6 A;  2W63 A;  3ZYL A;  2JQQ A;  3AVR A;  1GFO A;  4QXH B;  2KWH A;  5LCY A;  5JDL A;  2ES0 A;  4ASK A;  3OYX A;  5GON E;  2E9X A;  1D0X A;  4YJ2 E;  4PJM A;  4GHB A;  3AAI A;  4GIW A;  1HG5 A;  5LOV E;  5HWX A;  1KNZ A;  3O0E A;  4LSH A;  3RC8 A;  4EZ4 A;  2PFV A;  3KBT A;  4WNK A;  4XBF B;  3IEE A;  5ETW A;  3N9Q A;  2X9H A;  4IE7 A;  5E0O A;  5FY0 A;  5H6R B;  5LBM A;  3ZCJ A;  4QQ1 A;  5FXX A;  4CI3 B;  3C4Z A;  4FSP A;  2CXF A;  4V1A v;  3UUM A;  3SY9 A;  4I50 E;  4PW8 A;  3CWZ B;  3S4U A;  2D2S A;  1X79 A;  4L0R A;  2CXD A;  4EYY R;  3QC9 A;  3K3O A;  3CQC B;  4HN9 A;  2ACX A;  2KLQ A;  3ZMS B;  3LK3 B;  4IGU A;  3LK2 B;  1ZHW A;  5LGT B;  4K0U A;  3C51 A;  2IW5 B;  3ZC1 A;  3N9N A;  2W81 C;  3E22 E;  5JRC A;  1G90 A;  2XAS B;  1BXW A;  1S94 A;  4DND A;  2QTK A;  2M06 A;  2EHO B;  1PRN A;  3BK9 A;  3SRZ A;  3RRC A;  5H6Q B;  5DL5 A;  5L3C B;  3D0T A;  4KUM B;  3UUX B;  4FUV A;  3TZG A;  4ZI2 D;  3VZT X;  1VRB A;  3FB2 A;  3LK2 A;  4JEU B;  3VY8 X;  3NBX X;  3F2E A;  5DJQ C;  4RL9 A;  4H9O C;  4AZL A;  3MK7 C;  3V8U A;  4H9N C;  3IBP A;  2CMR A;  4QWN B;  2JJ9 A;  3CML A;  4TN7 B;  3PU3 A;  4OYK A;  3POQ A;  2KC0 A;  4X1Y E;  2DWK A;  2O4V A;  3PQU A;  4EYU A;  3Q5X A;  3RYF E;  4D65 A;  1O3X A;  3VKH A;  2C5I T;  2BVL A;  3E08 A;  3JC6 C;  3MZK B;  3SYS A;  2LEH A;  2VAS A;  3HKE E;  3C64 A;  2LE8 A;  4PJL A;  5LGU B;  4TV8 E;  4WBN E;  2DCF A;  5FY7 A;  3HOL A;  8PRN A;  4CZZ B;  4CXX A;  2XG6 A;  2CLY C;  1ZHT A;  2FGQ X;  5HXR A;  5JR9 A;  4YJ3 E;  2JMH A;  2BVM A;  5LYJ E;  3CX7 B;  4X20 E;  3POX A;  4AKR A;  4UEL A;  5DQW A;  3B13 A;  3CX8 B;  3RH3 A;  5CA0 E;  4BJM A;  3F31 A;  4H9Q C;  4I4T E;  4YHJ A;  4G76 A;  3ZMT B;  2YPV A;  3I1A A;  2ODJ A;  4KP3 C;  7PRN A;  2V7K A;  4Z3T A;  1ZHC A;  2W00 A;  4KRA A;  5FMN A;  5F8P A;  2E8I A;  3ZJ2 A;  4RJX A;  2LOP A;  1BT9 A;  1FEW A;  3T24 A;  3SS1 A;  3I0Q A;  2LJL A;  4MFR A;  5IYZ E;  1Y64 B;  3ETU A;  3ZLI A;  5FXZ A;  4EAH A;  4M1P A;  2BZB A;  5DL8 A;  3POU A;  4O8S A;  3LBX B;  3PUG A;  4XAX B;  3CQG B;  4H63 V;  2UXN B;  4DMW A;  4P09 A;  1U4Q A;  2L9Q A;  4U72 A;  2XHE B;  4Z8X A;  3C50 A;  3AA6 A;  2ZFG A;  1OWA A;  5EK4 A;  5EK2 A;  5L3G B;  3HR0 A;  4IST A;  4GF4 A;  2I59 A;  1G8X A;  4YFS A;  5FY1 A;  4O4J E;  2A2F X;  2LOS A;  2WWU A;  4EZH A;  4UVB B;  2X9Y A;  3PUA A;  4KR4 A;  3C4W A;  3LBX A;  1WLX A;  3ANW B;  4CI2 B;  3O1I A;  5LHG B;  1QJ9 A;  3BQL A;  3VHL A;  3PUQ A;  2DHR A;  4N78 D;  4CQI A;  2CE7 A;  3N2O A;  2EHO D;  2MYS A;  4EXT A;  3UU2 A;  2K5B B;  4UEM A;  5PRN A;  4E1S A;  4MAL A;  2XAJ B;  6PRN A;  3HL6 A;  2XAH B;  2X27 X;  3E0Z A;  4CXW A;  3PRN A;  3FBL A;  5TAO A;  3ZPO A;  5JDH A;  3ZMZ B;  2DWG A;  3ZMV B;  2HH7 A;  1Z0P A;  5JDG A;  2K4T A;  4UIG A;  1GFQ A;  1H6S 1;  4FRX A;  4H63 H;  4I43 B;  2LFU A;  5EZY E;  1HXU A;  4LSF A;  4BJN A;  3PDY A;  2Y6X A;  3KBU A;  5LHH B;  2X0L B;  5A1L A;  4PNI A;  1FMV A;  3HKC E;  3W15 B;  4CI1 B;  3NSG A;  1FMW A;  3AA7 B;  4L9I A;  4OFZ A;  4AKG A;  3H3A A;  3KV5 A;  4B61 A;  2Q9Q C;  4FES A;  4GK0 E;  5CB4 E;  3ZCI A;  5F3J A;  4UV8 B;  3SYB A;  3AB3 B;  1QUU A;  3V5U A;  4ADZ A;  1MMN A;  3N5L A;  3ZYK A;  2ZM2 A;  5HYA A;  2XTQ A;  4MLK A;  2KXP B;  2KIN B;  3KVA A;  4DO0 A;  3N2K E;  4GYR A;  2GE4 A;  2X9X A;  4GOU A;  2CLY B;  3LJC A;  3UUN A;  4AKI A;  2F1T A;  2BDE A;  5LA6 E;  5GV0 A;  4O4U A;  5JVD E;  2ERV A;  2XE2 A;  1YS5 A;  5FXV A;  2CWO A;  2V7I A;  3CVR A;  4IHJ E;  4DBQ A;  3KFW X;  2XE3 A;  1SA0 E;  3KVD D;  3O1H A;  3CQX C;  5D5D A;  4FRT A;  3AA0 B;  1GFM A;  2POR A;  4HTE A;  2V26 A;  3ETV A;  4AXP A;  5JH7 E;  5KMG P;  4AUI A;  1IJ5 A;  5CA1 E;  4O4L E;  2XAG B;  3I9W A;  1OSM A;  1H7C A;  1BH3 A;  3UFE A;  2DNX A;  5AFU L;  2Q9Q D;  4GK5 E;  1MMG A;  4GCP A;  3FXE B;  1MND A;  3LK3 A;  2N1G A;  3WAK A;  2ZMA A;  3DJB A;  3OKQ A;  4TUY E;  4EOZ B;  5JDM A;  3SWH A;  4PUX A;  1IAP A;  3AAA B;  4AI6 A;  2ZM8 A;  1OPF A;  3PTR B;  1HX8 A;  3HKB E;  1MMD A;  2F1V A;  2PRN A;  3JTY A;  1ZHX A;  2EHO A;  3ESL A;  2NW8 A;  2YIN A;  2DLR A;  1IZN B;  1D0Y A;  3PQS A;  3AA1 B;  2YNK A;  3T20 A;  2CCQ A;  3SOL A;  1QSD A;  1ZV4 X;  3GWH A;  2RP4 A;  3NRX A;  1LKX A;  3RYC E;  4AKM A;  4HE8 A;  1ZEE A;  2CEA A;  4F4B A;  1US7 B;  2NW7 A;  4AQF A;  3VY9 X;  2GK9 A;  3N9L A;  2C0S A;  3EUH A;  2MBG A;  3WI3 A;  4ERR A;  2LHN A;  3ZN1 B;  3KV9 A;  1ZHZ A;  3I0O A;  5AFU K;  3QRA A;  3U78 A;  3EDV A;  1HFA A;  3GA8 A;  1HTJ F;  3R6N A;  5LHI B;  4BUM X;  1E54 A;  3MA9 A;  3VE1 A;  3U3I A;  3VKG A;  3EDU A;  3I9Y A;  4KR8 A;  3H37 A;  4AQG A;  5DAB A;  2Y7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...