3AA1B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from ckip-1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa1B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa1B02
3AA6B 3AAEB 3LK2B 5AFUL 5ADXL 2KXPA 2KZ7A 3AA1A 2KXPB 3LK42 3AA6A 5AFUK 5ADXK 3AAEA 3LK2A 3AAAA 1IZNA 3LK3B 3AA7A 1IZNB 3LK41 4AKRA 3AA7B 3AA0A 3LK3A 3AA0B 4AKRB 3AA1B 2KZ7B 3AAAB
chains in the Genus database with same CATH superfamily
4RLCA 2V7IA 8PRNA 2UXBT 2BS3A 4RJXA 4JLEA 3ZJ2A 4DIDB 5G3AA 3E0ZA 5LJMA 4AKGA 4LFAT 3G7GA 1BR1A 2M6BA 5PRNA 2ODJA 3SZVA 3A7MA 3FZKB 3N9MA 4PR7A 5HXHA 5L4EA 3SYSA 5DABA 2YINA 1NAFA 2ZM8A 4PJMA 4JEUB 3PUAA 2V6XA 3DWNA 3WI4A 2GK9A 3C5OA 1Z8UA 2DI4A 3RIUA 1T7SA 1EZ3A 3AEDA 5CA0E 2UUAT 2Y2XA 4G2AA 3ZYKA 3IBPA 5GV0A 4AQGA 3T24A 2BS4A 1G90A 2BG9C 5L3BB 4PJLA 2VVSA 4AKRA 3RIUC 3AA0A 1QJ8A 3PV0F 4WBOA 1YKHB 3BS0A 2LSJA 2VQFT 1MIYA 2ZLDA 2HN2A 4A5XA 5DQWA 3ZKRA 6PRNA 4QH4A 3EVYA 1XZYA 5AQFB 3NVOA 2CHOA 4EV6A 2D0UA 1THQA 3P8CD 5JDLA 2WU2A 4H9RC 3FXDB 5JDGA 5EK2A 4DR2T 2HHHT 2YU2A 4O4UA 3CK6A 3KVBA 2NOXA 4ILCA 4AI6A 4NUVA 1U5PA 2JQ9A 5G26A 4HTEA 3RPUA 1GFOA 3PUZF 1ZEEA 3NSGA 3RC8A 4Z3TA 4IL6O 1HG5A 4GK0E 5C8YE 3RRWA 5ABFB 4TV9E 4CXXA 3NKZA 4MALA 2N9DA 2WDRA 3AAEA 2V1DB 3T8OA 2CHNA 2SPCA 4HN9A 5FMNA 4B6XA 5L3EB 4YLHA 3POXA 3N5LA 4AIUA 1HX8A 4UR9A 3C98B 3FBLA 2Z6EA 1W9RA 3M65A 5H6QB 5KAFO 2V8SV 4IE7A 3BQIA 1VOMA 2EHOB 1JNZA 1GFQA 4YT0A 4HFVA 2E9XC 2YNKA 1XMQT 3QRAA 3T1YT 5FYMA 2Y0KA 4DV7T 2WU5A 3BRYA 1UK5A 1Y64B 4LF8T 2ZFGA 2BKPA 3GN5A 4A56A 2XE1A 4FT6A 3VE1A 2PTFA 5AQTB 4CXWA 3DP7A 3K3OA 1HS7A 4DV4T 3F57A 3PUYF 2W81C 4GYSA 3UFEA 3KBTA 3N2GE 2KZ7B 4UB8O 3ZT5A 4YSXA 3FZMB 4OK0A 3QB5A 2XQ7A 2K3WA 5FXXA 4QX8B 3PORA 2UUBT 2E9XD 3ZC1A 2NW8A 4Z91A 4O3WA 5CA1E 3KVDD 2WZHA 2XE2A 3K3QC 4X1YE 3RQUA 4FI5A 5GTIO 4L9IA 5JH7E 1T16A 2JMKA 3MACA 3ETUA 3OPCA 4JI7T 3AVRA 4XBFB 3A0BO 1UX4A 5HEJA 2CM0A 2XQ5A 3ANWA 1I94T 4CN4A 4ZS3A 2LHNA 4EOZB 2C5JA 4PJNA 2MTQA 3U78A 2KLQA 1MM5A 1HXUA 1H6S1 2CEAA 5LHHB 4AKLA 1Y01A 4RJWA 2L3LA 4PK5A 3ZSTA 4QXBB 3SY7A 4GK5E 1XNQT 3LG7A 2XQYA 4GIWA 3UU4A 5AQLB 4LF9T 3HOEA 3VZTX 3O1HA 1S5LO 4UEMA 3UUXB 4P0AA 5CGMA 1ZP0A 4M1PA 2YOEA 5JRCB 4DV0T 1ORMA 4YHHT 2H7VC 3MZKB 3ZN0B 2LHRA 1UGOA 4CN1A 4QX7B 2K5BB 2ZMAA 5D5DA 3TKLB 4O3ZA 2ODUA 4KHZF 5FL1A 4HFBA 4X20E 1IBLT 2FGQX 1MMGA 2R4NA 5JR9A 3QOFA 3RLFF 2CA5A 2J62A 2BBJA 1GFNA 5FY1A 3ESLA 4U2ZA 5J2UE 2LM9A 5HXSA 2AE9A 4YSYA 3F31A 2R4PA 2YKSA 3KBUA 3EDUA 4YTNA 4UIGA 2X9KA 1KNPA 2BZBA 1KFYA 4HE8A 3TZGA 2W67A 3NWIA 3CMLA 4EYUA 5KDMC 2E8IA 2XE3A 3X1DA 2X9WA 1G73A 2MNHA 2CWOA 4X64T 4B3ST 4ILBA 2JMHA 4TV8E 1T98A 2C5KT 4O4HE 3VZUX 2V6YB 4UXNB 5ADXK 4JI8T 3QB5K 5CJ5A 2V6YA 5A1LA 2E5VA 3QUJA 1V9DA 3PGSA 5EK3A 1X79A 3PUGA 2UXDT 3VRAA 5LYJE 1DU2A 4C4VA 3UQ4A 4HFIA 4PW8A 4E1TA 4AQFC 4JYAT 3AE7A 4DV5T 5FNVE 2IHR1 5HEGA 1R8IA 5ABHA 4DR5T 2MOZA 4JI1T 4C00A 3DA3A 3ZEFB 1B7TA 4I55E 4TWFA 1E7PA 4I0UA 3N9PA 4K3CA 1QSDA 4KX6A 2Y0LA 4DBRA 4QWNB 1MNDA 4RLBA 3L09A 4DR3T 3KINB 3MK7C 3AA1A 5HYAA 2VQET 2DCFA 2FUPA 3C4ZA 4ZI2C 4DUYT 3AEEA 4PJ0O 4P0BA 5JR9C 4HKAA 4JI2T 2M67A 1WR6A 2CPTA 3KV5A 3FZHB 2MPKA 3KV6A 3N9QA 4IDPA 2XPKA 1ZHWA 3PUSA 4FQEA 3RYHE 5F8PA 1LVFA 3PGUA 1PRNA 3I0OA 3JTYA 1VCSA 2VKOA 2LT3A 4IE6A 5LCYA 4ANJA 2R4OA 3E08A 4N78D 5H2FO 3PUXF 3CQCB 3FHNA 2CXFA 3L8RA 4HEAA 4X65T 2M07A 4UVBB 3DZMA 3UU6A 4ASKA 3Q5DA 4ZI3C 5T5FA 2MBGA 2X68A 2EHOD 2JQHA 3RKOA 4QQ1A 1UCUA 5LGTB 4G76A 2CBJA 3SFEA 4CTDA 4ZI7E 2XAGB 4K0KT 3LDQB 2XHEB 2WSSV 5GONE 1E1HB 3F2EA 3ZMVB 1UURA 2XSAA 1OWAA 3O4XE 5ADXL 2X9XA 4KBMB 5LHIB 2WJRA 3UPGA 4ZOLE 5CB4E 5DQVA 3SOLA 3ZCJA 3CWZB 3SYBA 1CUNA 3CX7B 2JQKA 2BG9E 3CPZA 4CZZB 3LK41 2XE5A 1WR0A 3CIRA 3IF8B 1QJPA 3AXJB 4IGUA 1MMDA 3FXEB 2B76A 2XQ8A 4COFA 1BR4A 4LSEA 1E2AA 4FMSA 3AAAA 2MHLA 4EYYR 5LXTE 4F6RC 2VK9A 5FXZA 1MPFA 4UF0A 3OVUA 3GP6A 3FZLB 5JVDE 4H9SE 4FUVA 4EZ4A 5F5WA 1Q9GA 3AAEB 5EZYE 3VHLA 4D64A 4DV3T 2VKJA 2WQYA 3O9XA 4QKNA 5L3GB 1HNWT 1LKXA 4UVCB 4DNDA 1J1JA 4CI1B 5JR9B 4TWDA 1W0BA 3JAEA 3H37A 2KXPB 2W0GA 4OFZA 2WP9A 4FRTA 4O49A 3Q5EA 4FRXA 4NUUA 4XNKA 3VR9A 3ZLIA 5IUXA 4LF5T 4FSOA 5AQQB 1QJ9A 2W63A 3KV9A 2BVLA 2UUCT 1ZKEA 1WCRA 2YN6A 3AAIA 3AA7B 2KC0A 2KDYA 3J7Yq 2H3RA 4BJNA 5FXVA 4BUMX 3CX6B 4D5UA 2Y0HA 2BDEA 2D9DA 3A5XA 5ABFA 4DVDA 1PHOA 3I9YA 4FSPA 4C4VB 4AFKA 2PG8A 4BAYB 2WCAA 4TUYE 3RRCA 2K4TA 5H6RB 2ES0A 3AAAB 3SY9A 1IBMT 5FY7A 3SZDA 4IE4A 4Z90A 3OJAA 2K24A 4P1NA 3TLVA 1NWMX 2FBWA 3FBZA 1YW0A 3GA8A 4LMKA 2J1DG 4IL9A 2CCQA 4IDNA 5LNKA 3ZCIA 4O2AE 3Q2MA 4AUIA 1S94A 1XMOT 2BS2A 3WAKA 5FY0A 2ERVA 4U7YA 1AJ3A 1GFMA 3BRZA 3B57A 4PJJA 1ZV4X 1ZOYA 2LKGA 2ZM6T 1YKEB 4X1IE 2XASB 2HH7A 4G75A 1KNZA 3UTKA 2I59A 2J1NA 1J5ET 3AE2A 3ZC0A 3T1HT 2RPAA 4CN6A 4GYRA 1FMVA 2LJLA 4JUYA 4AKRB 2UXNB 3PURA 2NWBA 1WYCA 4F8HA 3EABA 1D0YA 4IDZA 2NR4A 3AEFA 4WZXA 2NP9A 2B1EA 5JRCA 2WJQA 4N58A 2Q9QD 4EEBA 2XQ4A 2XZEA 4TWHA 2HN1A 2XG6A 4ZZCA 4PNIA 1E54A 4O3YA 5KX5E 3GN5B 3HR0A 2KMFA 5CFBA 1OSMA 2XUEA 2KT9A 3OTOT 2JMMA 3N2KE 4FZMA 2WVPA 1ZHZA 1KF6A 1YS5A 2NTXA 4U72A 3WAJA 5HEUA 3JCFA 5AQUB 2XTQA 5B66O 2QRXA 4JI3T 2LSIA 3DJBA 3RF1A 2X27X 1LVKA 4HFDA 3ZMTB 1UX5A 3KV4A 2Y7SA 1IZNB 3GMIA 5HEOA 4EB6E 2CMRA 4EZHA 3VKGA 4GKJT 3JCUO 2D5UA 2LOPA 2MYSA 2RP4A 4YJ3E 1CHUA 2WMOA 2IDOB 4EEDA 3IEEA 2YDSA 5FP3A 3IHRA 3VR8A 4YXDA 4EGWA 2LE8A 4HFCA 3G06A 1HXTA 3RKGA 3RYIE 2ACXA 3AEGA 2WY2A 1W09A 4ZEYA 2OA5A 5AQIB 3H3AA 4JBWF 1D1BA 2X0HA 4QH1A 4BJMA 2C5IT 3O1IA 3AA7A 2N2LA 4C90A 2LSGA 3HI2A 3UAQA 2J4GA 3AE6A 5HWXA 2X9HA 4LF7T 3A2SX 3UQ7A 4IDQA 2LSYA 1G8XA 1IAPA 4AISA 2RA1A 2FJDA 4CI3B 2LSKA 4ISTA 4KMCA 1OEDE 2WWUA 2YU1A 3AA0B 2XQ9A 2EHOA 1D1AA 4QXCB 5AQVB 2Y6XA 3KDSE 3PRNA 4O4JE 2AXDS 2XAJB 2QGSA 3R6NA 4LSHA 3UU5A 4XZCA 3AE1A 2V7MA 4GCQA 3FZFB 4JI5T 3ONJA 1QUUA 3WI5A 5LGNB 2F4VT 4FZNA 2N2NA 5G38A 2R8AA 4I50E 1T72A 5B5EO 1T1LA 1N36T 5HCJA 2NW9A 2YK0A 5LA6E 4YFSA 2V7KA 2UXXB 3QC9A 3TLUA 1MIWA 2MAWA 2LKHA 3AXJA 3KZIO 2W66A 3ETVA 4PK4A 2AXTO 2XTRA 3SS1A 1M7KA 3P4QA 4X1KE 3RQWA 4FJOA 2LRKA 1GQEA 5JDFA 3B5MA 4DBQA 2Q9QC 4DMVA 4YY3T 3ONXA 5IWAT 1OEDA 4KRAA 5KAIO 3PUWF 2W2UA 5E0OA 3PQUA 4H63V 3EDVA 5JDPA 3ANWB 1YXRA 5FVKA 4JV5T 3K19A 1QLBA 4YSZA 2VASA 1ZHYA 4X62T 3POQA 2XQ6A 5LBMA 2WZIA 1NENA 3VY9X 2V7JA 4FOZA 4YJ2E 3RYFE 5AQOB 2CLYC 3MKDA 4UVAB 3GWHA 2W80C 3D0TA 3RBHA 3L39A 3EMNX 2VL0A 3PDYA 2JJ9A 5AQMB 2LFUA 5HAXA 3UUBA 4DR1T 2R89A 1HF8A 3NRXA 4DUZT 4IIJE 2CWYA 2EHOC 4LMLA 1YQ4A 4ZI3D 2Y8DA 3U3IA 3AEBA 4GHBA 4LSIA 5J0ZA 4QH5A 4U7IA 3HWBA 2K0LA 2KXPA 3L3PA 3ZN1B 4DR7T 4HWHA 1IJ6A 5LHGB 2YDQA 5LG3A 5FXWA 5LP6E 1UUSA 4TX5A 4LF4T 3P4PA 2J47A 4KP3C 5JDQA 1BR0A 3ZJ1A 5LB7B 3ONLC 4XNLA 2G0UA 1IJ5A 3OKQA 2ZLYA 3N9OA 4FZLA 1HFAA 5EK4A 4QXHB 4MHCA 3P4SA 5IYZE 5KMGP 2PORA 4O3XB 2LOSA 4P09A 4KI0F 5LBQB 2YEVC 5AQGB 4OYKA 4C91A 4O8SA 4JFBA 1WRDA 1LRZA 1D0ZA 4ILUA 2KSRA 3PTRB 3EAMA 1MM4A 2XSBA 2KWHA 3UULA 3VZWX 2XQAA 4ILAA 4IREA 5TISO 3RX6A 4O4LE 2H88A 4YHJA 4E7ZA 4LF6T 1WFDA 3RGLA 2E9XB 2D2SA 1IZNA 3LFMA 2JRKA 3ZSSA 2I0MA 4U74A 5ABGA 5LJNA 4G63A 2WDQA 2D0TA 1HCIA 4YTMA 1L0VA 3IA3A 3J9X1 3MXZA 4N75A 1YD8G 2R6GF 3Q5WA 4ZXLA 2OLTA 4AYDC 3ZT7A 2IUBA 5AQRB 4AQFA 5LG4A 1VCTA 3I0QA 3T20A 5JREA 2LLYA 4YTPA 3M3ZB 4DR4T 3CX8B 4DO0A 5HXEA 4HWCA 4TN7B 1ZHTA 2XAHB 3HOLA 1JNRA 1H7CA 3JAFA 4CXYA 3V5SA 2O4VA 5LMUT 4GCPA 2W00A 4GF4A 5FVLA 4NIQA 4AKHA 3EHZA 4UV9B 1FJGT 1Q9FA 4EAHA 4U33A 3OYZA 1SUMB 2YDRA 2LEHA 4X66T 2IWWA 1WYBA 4U2YA 2A9UA 2XAFB 4LFBT 3UUMA 2L9QA 5ABEA 4WNKA 4AYID 4MLKA 3HKEE 3LJCA 3A0HO 2FGRA 3ZPOA 4PAGA 3AE9A 2XY8B 1WLXA 4KUMB 3MJXA 3N9LA 1IBKT 3P7IA 4JCHA 4LMJA 2H89A 3C4XA 2CE7A 2WS3A 2VB6A 2DL1A 2CRBA 4O4IE 3V8UA 4ZS2A 3UU8A 3LBXA 5FKYA 5F3JA 4CI2B 1D0XA 5L47A 2QA7A 3HKCE 3ZMSB 3OBVE 5AQPB 4TNVA 3QRCA 4HWDA 4B3RT 3FB2A 3PJAJ 1ZHCA 2V5DA 4H9NC 2K48A 2LRLA 4HWIB 3O1JA 4B3TT 2ZM0A 1MNEA 2E2AA 4X5TA 4I43B 2Q9QA 3B13A 4H9PC 4L0RA 2PRNA 4J2CA 3AA1B 4NXMT 4CQIA 3QNUA 3PF1A 3RYCE 4JEHB 3P50A 2GE4A 3JC6C 5AQHB 3KFWX 3JC6D 1OXZA 4DMWA 5HWYA 4KR4A 3RIFA 4IDOA 2L8KA 3CKDA 2Y48B 3P4RA 2V7LA 2M6IA 4HFHA 3LK2B 4O2BE 1D1CA 2M06A 4Q25A 4I4TE 3LK2A 4AYEC 3HA4A 3C64A 3I1AA 2W62A 5DL5A 3RI5A 1MMNA 3C50A 3VKHA 4OHFA 4Z8XA 2WB5A 2YPVA 3V5UA 4N59A 2H7OA 3PU8A 2IC6A 2N2MA 3RHWA 2IWVA 5DL8A 2KZ7A 5KXJA 1OPFA 2LHFA 3TLWA 2C0SA 2JQQA 2VVNA 2DWGA 2Q9QB 5HXCA 2W4XA 1BR2A 2UU9T 3AVSA 3WU2O 4IL4A 3JADA 4ZZBA 4C69X 4AYNA 3N9NA 2NW7A 3DTOA 2VKHA 1O3XA 4UV8B 4JI0T 4NPPA 3LK42 1SHZC 4HWFA 2A3DA 3PQSA 3SRZA 5HXRA 4PFOA 3ZMUB 5BR8T 4PK6A 4U9CA 4MFRA 5M4YA 2KNDA 3LBXB 2CLYB 4IT4A 3AE3A 2N1GA 2OMFA 1M62A 4KR8A 3BQKA 2BG9B 3T0SA 2FJEA 1BXWA 3NZPA 1U4QA 3VU7H 5ETWA 4WBNE 4MBQA 2UXCT 4H63H 4H9OC 3O0EA 4GOUA 2XM1A 1X9BA 2IIUA 4A98A 2KINB 2XM2A 3W15B 1GFPA 2QYWA 4GKKT 5G39A 3VY8X 3UFGA 4F4BA 4ISSA 4O4XA 1OEDC 2A2FX 2XAQB 5C2TA 1YQ3A 1FIOA 5LOVE 3FYXA 1HR0T 4B61A 3TLSA 3BK9A 3HL6A 2DHRA 4EXTA 5AQJB 2J4UP 3AECA 5TAOA 3SWHA 2QVAA 4AKIA 4LSFA 3EI0A 4ADZA 2BG9A 4JI6T 1HTJF 4AYMC 5HCMA 2IW5B 2R4LA 3RIAA 1HXXA 4IE0A 1VRBA 4ZI2D 3NZQA 3ZT6A 2ACZA 1MIVA 4OX9T 4E7SA 2ZM2A 3PUQA 3K1SA 5L3DB 4IHJE 4ERRA 1FMWA 2V5CA 1ZHXA 1XWMA 4EIWA 3C4WA 3AE5A 2PJQA 5JDMA 2F1CX 4D65A 7PRNA 4K0UA 2FJBA 1N34T 4UB6O 4AQYT 1XNRT 3UUNA 2CBIA 5BMVE 5AFUL 2JPFA 3ZYMA 1N32T 4TZ4C 1MMAA 2JIWA 3KVAA 2WM9A 2X66A 4ZHQE 4E1SA 4GCSA 2X0YA 3CQGB 1I6ZA 3Q5XA 1T8BA 1KNRA 5FVNA 3P4WA 3MA9A 1BT9A 1US7B 2BBHA 5DL6A 2A72A 3AB3B 5AFUK 3OYXA 5LGUB 3C51A 2VURA 2CXDA 1BH3A 2BKNA 2V26A 3NJTA 2IC9A 5L2LA 4DR6T 2NTYA 2FJAA 4UELA 3LK3A 3N2OA 2X67A 3NRYA 2WWVA 4AXPA 3CVRA 4AZLA 2F1VA 5GTHO 3AE8A 2OV9A 4N74A 2F1TA 1OEDB 5L4HA 2K9AA 1SE7A 3HW9A 3A8YC 4A97A 3DA4A 3POUA 4H9QC 3SFDA 4BA9A 1SA0E 2WMNA 5EE2A 4WW0A 2X51A 2CXLA 2E5LT 4QHOA 3VE2A 2HPJA 3PGRA 2XTLA 5JDNA 3UU2A 3VRBA 2DLRA 4V1Av 3LK3B 5AQSB 4JI4T 2IAKA 3HKDE 1HNZT 2XMXA 4UF0B 4PUXA 4HGAA 1Z0PA 2P9BA 3UU3A 3ZMZB 2DWKA 4DV1T 2WBLA 5FL0A 3TLTA 5C3JA 3K3NA 5HEHA 2VWAA 5DL7A 2VKDA 4DV6T 4LFCT 3E22E 3WI3A 2W61A 2I6HA 2PFVA 3Q9DA 5J1GA 2X9YA 2VL8A 1HNXT 5DJQC 1NEKA 2WAUA 1W0AA 3AA6B 2HPLA 3PE0A 3UT5E 3PU3A 1XDOA 2BVMA 2ODVA 3K8PC 2LM2A 2QTKA 4NXNT 4K3BA 4RL9A 2BKOA 2KWIB 1P4TA 1N33T 5JTGA 5AQKB 2X0LB 4TNWA 3RH3A 1KK7A 3CQXC 3RC3A 5IHYA 3LSVA 1S35A 3H3MA 2R88A 3EUHA 5JDHA 2E9XA 5LMNT 1J5WA 4HFEA 5AQNB 4L5GA 4AKMA 3AA6A 3DWOX 2XQ3A 3PUVF 4OYJA 4U3CA 3ABVA 3S4UA 3NBXX 2XJ7A 4KHPT 5L3CB 3QK6A 4IE5A 1KEYA 3R84B 4DV2T 5L3FB 3BQLA 4FESA 3PJAA 4WYVA 5IYUA 4B3MT 2JQYA 1HG2A 2IMLA 5JQGE 4PFPA 3AEAA 2PBIA 2DNXA 3HKBE 5J2TE 3ZYLA 1XDPA 3AE4A 1HX1B 1FEWA 5E79O 4XAXB 3I9WA 2WDVA 4U31A
chains in the Genus database with same CATH topology
3MK7C 3LK2B 4RLCA 2V7IA 4O2BE 8PRNA 3AA1A 1D1CA 5HYAA 2XAJB 3WI5A 2M06A 2DCFA 2QGSA 4I4TE 4RJXA 3C4ZA 4ZI2C 3LK2A 3HA4A 4JLEA 3R6NA 3ZJ2A 4LSHA 4AYEC 4P0BA 3C64A 4XZCA 5JR9C 4HKAA 2M67A 3E0ZA 3I1AA 5LJMA 2V7MA 2W62A 4GCQA 5DL5A 1MMNA 1WR6A 4AKGA 3C50A 3VKHA 3KV5A 3G7GA 1BR1A 1QUUA 3KV6A 4OHFA 4Z8XA 5LGNB 2YPVA 2ODJA 5PRNA 3N9QA 3V5UA 3SZVA 4FZNA 4N59A 2N2NA 4QXCB 2H7OA 3N9MA 5HXHA 1ZHWA 3PU8A 3PUSA 2IC6A 2N2MA 3RYHE 3SYSA 4I50E 5F8PA 1LVFA 5DABA 2NW9A 2YK0A 5DL8A 2YINA 5LA6E 2KZ7A 1NAFA 1OPFA 1PRNA 2LHFA 3I0OA 2ZM8A 4PJMA 2C0SA 2V7KA 4YFSA 3JTYA 2UXXB 2LT3A 2VKOA 2JQQA 3PUAA 4IE6A 4JEUB 5LCYA 3QC9A 1MIWA 2DWGA 2Q9QB 4ANJA 5HXCA 3E08A 4N78D 3WI4A 1BR2A 3ETVA 2GK9A 4PK4A 2XTRA 3CQCB 3SS1A 3FHNA 4X1KE 3AVSA 2CXFA 3C5OA 4HEAA 2DI4A 2M07A 4FJOA 4UVBB 4C69X 5JDFA 4AYNA 3N9NA 4ASKA 2NW7A 3HWBA 4ZI3C 1EZ3A 3DTOA 5CA0E 5T5FA 2MBGA 2VKHA 1O3XA 2EHOD 2Q9QC 2X68A 4G2AA 4UV8B 3LK42 3RKOA 4QQ1A 1SHZC 4DMVA 2A3DA 1UCUA 3ONXA 3ZYKA 3IBPA 5LGTB 4AQGA 4G76A 5GV0A 4KRAA 3T24A 3PQSA 1G90A 3SRZA 5HXRA 4PFOA 5L3BB 4ZI7E 5E0OA 3ZMUB 3PQUA 4H63V 2XAGB 4PJLA 4PK6A 3EDVA 4AKRA 4U9CA 4MFRA 5JDPA 5M4YA 3AA0A 2KNDA 3LBXB 3ANWB 1QJ8A 2XHEB 2CLYB 2WSSV 5GONE 3K19A 1E1HB 3F2EA 3ZMVB 2VASA 1ZHYA 4WBOA 1YKHB 2N1GA 1OWAA 2LSJA 3O4XE 5ADXL 1MIYA 2OMFA 3POQA 2ZLDA 4KR8A 5G26A 2X9XA 3BQKA 4KBMB 5LBMA 5LHIB 3T0SA 5DQWA 6PRNA 3UPGA 4ZOLE 5CB4E 5DQVA 3VY9X 3SOLA 2V7JA 3EVYA 3NZPA 3ZCJA 1BXWA 3CWZB 4FOZA 3SYBA 1CUNA 3RYFE 4YJ2E 1U4QA 2CLYC 3CX7B 3VU7H 3MKDA 5ETWA 4UVAB 4WBNE 4MBQA 3CPZA 4CZZB 3LK41 2XE5A 3IF8B 4H63H 1QJPA 3GWHA 2D0UA 4H9OC 3O0EA 4IGUA 1MMDA 3FXEB 4GOUA 1THQA 2W80C 3D0TA 3RBHA 3P8CD 3EMNX 1BR4A 4LSEA 2KINB 3W15B 5JDLA 1GFPA 4H9RC 3FXDB 5JDGA 4FMSA 3AAAA 5EK2A 2YU2A 2MHLA 4O4UA 3KVBA 2NOXA 4EYYR 5LXTE 3VY8X 3PDYA 2JJ9A 4F6RC 2VK9A 4AI6A 2LFUA 4F4BA 5FXZA 5HAXA 1MPFA 4ISSA 1U5PA 4NUVA 4UF0A 4O4XA 1HF8A 4HTEA 2A2FX 2XAQB 3NRXA 4IIJE 3RPUA 1GFOA 3GP6A 1ZEEA 2CWYA 2EHOC 5JVDE 4ZI3D 4H9SE 3NSGA 2Y8DA 3U3IA 4FUVA 4GHBA 4LSIA 4EZ4A 1FIOA 5LOVE 3RC8A 3FYXA 1Q9GA 4Z3TA 1HG5A 4GK0E 5C8YE 3RRWA 2K0LA 3AAEB 3L3PA 5EZYE 3VHLA 3ZN1B 2KXPA 4B61A 4TV9E 4CXXA 4MALA 4D64A 1IJ6A 2N9DA 3BK9A 3HL6A 5LHGB 2DHRA 2V1DB 4EXTA 3T8OA 3AAEA 2SPCA 2VKJA 5FXWA 4HN9A 5LP6E 5FMNA 4TX5A 4B6XA 5L3EB 4YLHA 4KP3C 3O9XA 3POXA 4QKNA 5L3GB 5JDQA 5TAOA 3SWHA 2J4UP 1LKXA 4UVCB 4AKIA 4DNDA 4CI1B 1BR0A 3ZJ1A 3N5LA 4LSFA 5JR9B 1HX8A 4XNLA 3C98B 3FBLA 2G0UA 1IJ5A 2Z6EA 4ADZA 5H6QB 3M65A 3OKQA 1HTJF 2KXPB 2ZLYA 3H37A 2W0GA 4IE7A 4OFZA 4FRTA 3N9OA 4O49A 4AYMC 3BQIA 2IW5B 4FRXA 4NUUA 1VOMA 4FZLA 1HXXA 4XNKA 3ZLIA 4IE0A 1VRBA 4ZI2D 3NZQA 2EHOB 4FSOA 1HFAA 1GFQA 5EK4A 1QJ9A 1MIVA 4HFVA 2E9XC 2W63A 2ZM2A 3PUQA 3KV9A 2BVLA 4QXHB 4E7SA 2YNKA 1ZKEA 3QRAA 4MHCA 3AAIA 3AA7B 4IHJE 5IYZE 5L3DB 4ERRA 2KC0A 1FMWA 5FYMA 1ZHXA 2Y0KA 4EIWA 3C4WA 1Y64B 5KMGP 2KDYA 3J7Yq 2PORA 2PJQA 2H3RA 5JDMA 4O3XB 2ZFGA 2LOSA 4D65A 4BJNA 3GN5A 4P09A 4A56A 7PRNA 2XE1A 4FT6A 3VE1A 5FXVA 5LBQB 4BUMX 3CX6B 4CXWA 2YEVC 4K0UA 4D5UA 3DP7A 3K3OA 4OYKA 2Y0HA 2BDEA 4C91A 3A5XA 1HS7A 4DVDA 1PHOA 4O8SA 3I9YA 4FSPA 4JFBA 1WRDA 1LRZA 4AFKA 2PG8A 4BAYB 1D0ZA 3F57A 2W81C 4ILUA 4TUYE 4GYSA 3RRCA 2K4TA 3UFEA 5H6RB 3KBTA 3PTRB 2ES0A 3N2GE 2KZ7B 3UUNA 1MM4A 2KWHA 5BMVE 4OK0A 3AAAB 3UULA 3SY9A 3VZWX 5AFUL 2JPFA 3ZYMA 5FY7A 3SZDA 4IE4A 4TZ4C 3RX6A 4O4LE 1MMAA 3OJAA 5FXXA 4YHJA 4QX8B 4E7ZA 3PORA 2K24A 2E9XD 3ZC1A 2E9XB 2NW8A 2WM9A 1NWMX 2X66A 3KVAA 2D2SA 4ZHQE 4O3WA 5CA1E 3KVDD 3KINB 1IZNA 3FBZA 4E1SA 1YW0A 3GA8A 4GCSA 2J1DG 3LFMA 2XE2A 2JRKA 2CCQA 3CQGB 5LNKA 4U74A 3K3QC 3ZCIA 4O2AE 5LJNA 4G63A 3Q2MA 3Q5XA 4X1YE 2D0TA 4AUIA 1S94A 4FI5A 1HCIA 5FVNA 3WAKA 5FY0A 4L9IA 2ERVA 3MA9A 3J9X1 5JH7E 1BT9A 1US7B 1AJ3A 2JMKA 3MACA 3MXZA 1GFMA 5DL6A 3ETUA 3B57A 4PJJA 2A72A 1ZV4X 3AB3B 5AFUK 3OYXA 1YKEB 3AVRA 4X1IE 1UX4A 1YD8G 3Q5WA 5LGUB 4XBFB 3C51A 2CM0A 2CXDA 2XASB 2HH7A 1BH3A 4AYDC 4G75A 1KNZA 3UTKA 3ANWA 4AQFA 2V26A 2IC9A 2I59A 4ZS3A 2J1NA 3ZC0A 5L2LA 2LHNA 2NTYA 4UELA 4EOZB 5LG4A 3LK3A 3N2OA 2X67A 4GYRA 3NRYA 1FMVA 2LJLA 3I0QA 2C5JA 4JUYA 4PJNA 4AKRB 4AXPA 2UXNB 3T20A 2MTQA 3CVRA 3U78A 3PURA 4AZLA 2KLQA 1MM5A 2F1VA 1HXUA 2NWBA 5JREA 1H6S1 2F1TA 2CEAA 1WYCA 5LHHB 4AKLA 2K9AA 3HW9A 4RJWA 2L3LA 4PK5A 1D0YA 3DA4A 4QXBB 3POUA 4GK5E 3SY7A 4IDZA 3LG7A 2XQYA 4GIWA 2NP9A 2B1EA 3CX8B 4DO0A 5HXEA 4H9QC 5JRCA 4TN7B 1ZHTA 4N58A 2XAHB 4BA9A 1SA0E 3HOLA 1H7CA 2Q9QD 4CXYA 2WMNA 5EE2A 3V5SA 2O4VA 4WW0A 2X51A 2CXLA 3PRNA 4GCPA 3UAQA 2W00A 4QHOA 2XG6A 3VE2A 4PNIA 4GF4A 2HPJA 1E54A 4AKHA 2XTLA 4O3YA 5JDNA 3HOEA 3UU2A 4UV9B 2DLRA 3VZTX 3O1HA 3GN5B 5KX5E 4UEMA 3HR0A 4V1Av 3LK3B 4EAHA 3UUXB 1Q9FA 2KMFA 3OYZA 1OSMA 2IAKA 2LEHA 2XUEA 4P0AA 3HKDE 4M1PA 2KT9A 1WYBA 5JRCB 2JMMA 1ORMA 3N2KE 2XMXA 2XAFB 4FZMA 1ZHZA 1YS5A 4UF0B 4PUXA 4HGAA 1Z0PA 2H7VC 3UUMA 2NTXA 2P9BA 4U72A 3WAJA 2L9QA 3ZMZB 3MZKB 2DWKA 4WNKA 3ZN0B 4AYID 2LHRA 2XTQA 4MLKA 2WBLA 3K3NA 3HKEE 2LSIA 3DJBA 4QX7B 2K5BB 2VWAA 2ZMAA 3LJCA 2VKDA 5DL7A 5D5DA 3TKLB 4O3ZA 3E22E 2ODUA 3WI3A 2X27X 2FGRA 3ZPOA 2W61A 1LVKA 4X20E 2PFVA 4PAGA 3ZMTB 2FGQX 4KUMB 1UX5A 1WLXA 3MJXA 1MMGA 3N9LA 3KV4A 3P7IA 5JR9A 1IZNB 2Y7SA 3Q9DA 4JCHA 3GMIA 5J1GA 4EB6E 2CMRA 4EZHA 3VKGA 2X9YA 2VL8A 2CA5A 3C4XA 5DJQC 2D5UA 2LOPA 1GFNA 2MYSA 2RP4A 2WAUA 2CE7A 4YJ3E 5FY1A 3AA6B 2HPLA 3PE0A 3ESLA 2VB6A 5HXSA 2LM9A 5J2UE 3UT5E 3F31A 3PU3A 2WMOA 2BVMA 3KBUA 2ODVA 3K8PC 3IEEA 5FP3A 3EDUA 2QTKA 4UIGA 4O4IE 3IHRA 2BZBA 4RL9A 3V8UA 4ZS2A 2KWIB 4HE8A 1P4TA 2LE8A 3TZGA 3CMLA 4EYUA 3LBXA 2X0LB 4DBQA 5KDMC 3RH3A 1KK7A 2E8IA 1HXTA 3CQXC 3RYIE 2XE3A 2X9WA 3RC3A 5IHYA 5F3JA 1S35A 4CI2B 1D0XA 2ACXA 1G73A 3EUHA 2MNHA 2CWOA 5JDHA 2QA7A 2E9XA 2JMHA 4TV8E 3HKCE 1T98A 2C5KT 3ZMSB 4O4HE 3VZUX 4L5GA 3OBVE 4AKMA 4UXNB 3AA6A 5ADXK 3QRCA 2OA5A 3FB2A 4OYJA 3H3AA 1ZHCA 3QUJA 5A1LA 1V9DA 1D1BA 4BJMA 4H9NC 2C5IT 2K48A 3S4UA 3O1IA 3AA7A 5EK3A 3O1JA 3NBXX 1X79A 3PUGA 2Y2XA 2ZM0A 1MNEA 2N2LA 4C90A 5LYJE 3QK6A 4IE5A 5L3CB 4I43B 3R84B 2Q9QA 3B13A 2LSGA 3HI2A 4H9PC 4L0RA 4PW8A 5L3FB 2PRNA 4J2CA 3BQLA 4FESA 4E1TA 5IYUA 5HWXA 3AA1B 4AQFC 2X9HA 1HG2A 4CQIA 3A2SX 5JQGE 4PFPA 3RYCE 2LSYA 1G8XA 1IAPA 4JEHB 5FNVE 2PBIA 2MOZA 2DNXA 2GE4A 3JC6C 3HKBE 2RA1A 5J2TE 3KFWX 3ZYLA 3JC6D 1OXZA 4DMWA 5HWYA 4CI3B 2LSKA 3DA3A 3ZEFB 4KR4A 1B7TA 4I55E 4ISTA 4KMCA 1FEWA 2L8KA 2WWUA 3CKDA 2YU1A 3N9PA 4XAXB 3AA0B 3I9WA 1QSDA 2Y0LA 2EHOA 4DBRA 4QWNB 2Y48B 1MNDA 4RLBA 1D1AA 2V7LA 3L09A 2Y6XA 3KDSE 4O4JE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA6 B;  3AAE B;  3LK2 B;  5AFU L;  5ADX L;  2KXP A;  2KZ7 A;  3AA1 A;  2KXP B;  3LK4 2;  3AA6 A;  5AFU K;  5ADX K;  3AAE A;  3LK2 A;  3AAA A;  1IZN A;  3LK3 B;  3AA7 A;  1IZN B;  3LK4 1;  4AKR A;  3AA7 B;  3AA0 A;  3LK3 A;  3AA0 B;  4AKR B;  3AA1 B;  2KZ7 B;  3AAA B; 
#chains in the Genus database with same CATH topology
 4RLC A;  2V7I A;  8PRN A;  2UXB T;  2BS3 A;  4RJX A;  4JLE A;  3ZJ2 A;  4DID B;  5G3A A;  3E0Z A;  5LJM A;  4AKG A;  4LFA T;  3G7G A;  1BR1 A;  2M6B A;  5PRN A;  2ODJ A;  3SZV A;  3A7M A;  3FZK B;  3N9M A;  4PR7 A;  5HXH A;  5L4E A;  3SYS A;  5DAB A;  2YIN A;  1NAF A;  2ZM8 A;  4PJM A;  4JEU B;  3PUA A;  2V6X A;  3DWN A;  3WI4 A;  2GK9 A;  3C5O A;  1Z8U A;  2DI4 A;  3RIU A;  1T7S A;  1EZ3 A;  3AED A;  5CA0 E;  2UUA T;  2Y2X A;  4G2A A;  3ZYK A;  3IBP A;  5GV0 A;  4AQG A;  3T24 A;  2BS4 A;  1G90 A;  2BG9 C;  5L3B B;  4PJL A;  2VVS A;  4AKR A;  3RIU C;  3AA0 A;  1QJ8 A;  3PV0 F;  4WBO A;  1YKH B;  3BS0 A;  2LSJ A;  2VQF T;  1MIY A;  2ZLD A;  2HN2 A;  4A5X A;  5DQW A;  3ZKR A;  6PRN A;  4QH4 A;  3EVY A;  1XZY A;  5AQF B;  3NVO A;  2CHO A;  4EV6 A;  2D0U A;  1THQ A;  3P8C D;  5JDL A;  2WU2 A;  4H9R C;  3FXD B;  5JDG A;  5EK2 A;  4DR2 T;  2HHH T;  2YU2 A;  4O4U A;  3CK6 A;  3KVB A;  2NOX A;  4ILC A;  4AI6 A;  4NUV A;  1U5P A;  2JQ9 A;  5G26 A;  4HTE A;  3RPU A;  1GFO A;  3PUZ F;  1ZEE A;  3NSG A;  3RC8 A;  4Z3T A;  4IL6 O;  1HG5 A;  4GK0 E;  5C8Y E;  3RRW A;  5ABF B;  4TV9 E;  4CXX A;  3NKZ A;  4MAL A;  2N9D A;  2WDR A;  3AAE A;  2V1D B;  3T8O A;  2CHN A;  2SPC A;  4HN9 A;  5FMN A;  4B6X A;  5L3E B;  4YLH A;  3POX A;  3N5L A;  4AIU A;  1HX8 A;  4UR9 A;  3C98 B;  3FBL A;  2Z6E A;  1W9R A;  3M65 A;  5H6Q B;  5KAF O;  2V8S V;  4IE7 A;  3BQI A;  1VOM A;  2EHO B;  1JNZ A;  1GFQ A;  4YT0 A;  4HFV A;  2E9X C;  2YNK A;  1XMQ T;  3QRA A;  3T1Y T;  5FYM A;  2Y0K A;  4DV7 T;  2WU5 A;  3BRY A;  1UK5 A;  1Y64 B;  4LF8 T;  2ZFG A;  2BKP A;  3GN5 A;  4A56 A;  2XE1 A;  4FT6 A;  3VE1 A;  2PTF A;  5AQT B;  4CXW A;  3DP7 A;  3K3O A;  1HS7 A;  4DV4 T;  3F57 A;  3PUY F;  2W81 C;  4GYS A;  3UFE A;  3KBT A;  3N2G E;  2KZ7 B;  4UB8 O;  3ZT5 A;  4YSX A;  3FZM B;  4OK0 A;  3QB5 A;  2XQ7 A;  2K3W A;  5FXX A;  4QX8 B;  3POR A;  2UUB T;  2E9X D;  3ZC1 A;  2NW8 A;  4Z91 A;  4O3W A;  5CA1 E;  3KVD D;  2WZH A;  2XE2 A;  3K3Q C;  4X1Y E;  3RQU A;  4FI5 A;  5GTI O;  4L9I A;  5JH7 E;  1T16 A;  2JMK A;  3MAC A;  3ETU A;  3OPC A;  4JI7 T;  3AVR A;  4XBF B;  3A0B O;  1UX4 A;  5HEJ A;  2CM0 A;  2XQ5 A;  3ANW A;  1I94 T;  4CN4 A;  4ZS3 A;  2LHN A;  4EOZ B;  2C5J A;  4PJN A;  2MTQ A;  3U78 A;  2KLQ A;  1MM5 A;  1HXU A;  1H6S 1;  2CEA A;  5LHH B;  4AKL A;  1Y01 A;  4RJW A;  2L3L A;  4PK5 A;  3ZST A;  4QXB B;  3SY7 A;  4GK5 E;  1XNQ T;  3LG7 A;  2XQY A;  4GIW A;  3UU4 A;  5AQL B;  4LF9 T;  3HOE A;  3VZT X;  3O1H A;  1S5L O;  4UEM A;  3UUX B;  4P0A A;  5CGM A;  1ZP0 A;  4M1P A;  2YOE A;  5JRC B;  4DV0 T;  1ORM A;  4YHH T;  2H7V C;  3MZK B;  3ZN0 B;  2LHR A;  1UGO A;  4CN1 A;  4QX7 B;  2K5B B;  2ZMA A;  5D5D A;  3TKL B;  4O3Z A;  2ODU A;  4KHZ F;  5FL1 A;  4HFB A;  4X20 E;  1IBL T;  2FGQ X;  1MMG A;  2R4N A;  5JR9 A;  3QOF A;  3RLF F;  2CA5 A;  2J62 A;  2BBJ A;  1GFN A;  5FY1 A;  3ESL A;  4U2Z A;  5J2U E;  2LM9 A;  5HXS A;  2AE9 A;  4YSY A;  3F31 A;  2R4P A;  2YKS A;  3KBU A;  3EDU A;  4YTN A;  4UIG A;  2X9K A;  1KNP A;  2BZB A;  1KFY A;  4HE8 A;  3TZG A;  2W67 A;  3NWI A;  3CML A;  4EYU A;  5KDM C;  2E8I A;  2XE3 A;  3X1D A;  2X9W A;  1G73 A;  2MNH A;  2CWO A;  4X64 T;  4B3S T;  4ILB A;  2JMH A;  4TV8 E;  1T98 A;  2C5K T;  4O4H E;  3VZU X;  2V6Y B;  4UXN B;  5ADX K;  4JI8 T;  3QB5 K;  5CJ5 A;  2V6Y A;  5A1L A;  2E5V A;  3QUJ A;  1V9D A;  3PGS A;  5EK3 A;  1X79 A;  3PUG A;  2UXD T;  3VRA A;  5LYJ E;  1DU2 A;  4C4V A;  3UQ4 A;  4HFI A;  4PW8 A;  4E1T A;  4AQF C;  4JYA T;  3AE7 A;  4DV5 T;  5FNV E;  2IHR 1;  5HEG A;  1R8I A;  5ABH A;  4DR5 T;  2MOZ A;  4JI1 T;  4C00 A;  3DA3 A;  3ZEF B;  1B7T A;  4I55 E;  4TWF A;  1E7P A;  4I0U A;  3N9P A;  4K3C A;  1QSD A;  4KX6 A;  2Y0L A;  4DBR A;  4QWN B;  1MND A;  4RLB A;  3L09 A;  4DR3 T;  3KIN B;  3MK7 C;  3AA1 A;  5HYA A;  2VQE T;  2DCF A;  2FUP A;  3C4Z A;  4ZI2 C;  4DUY T;  3AEE A;  4PJ0 O;  4P0B A;  5JR9 C;  4HKA A;  4JI2 T;  2M67 A;  1WR6 A;  2CPT A;  3KV5 A;  3FZH B;  2MPK A;  3KV6 A;  3N9Q A;  4IDP A;  2XPK A;  1ZHW A;  3PUS A;  4FQE A;  3RYH E;  5F8P A;  1LVF A;  3PGU A;  1PRN A;  3I0O A;  3JTY A;  1VCS A;  2VKO A;  2LT3 A;  4IE6 A;  5LCY A;  4ANJ A;  2R4O A;  3E08 A;  4N78 D;  5H2F O;  3PUX F;  3CQC B;  3FHN A;  2CXF A;  3L8R A;  4HEA A;  4X65 T;  2M07 A;  4UVB B;  3DZM A;  3UU6 A;  4ASK A;  3Q5D A;  4ZI3 C;  5T5F A;  2MBG A;  2X68 A;  2EHO D;  2JQH A;  3RKO A;  4QQ1 A;  1UCU A;  5LGT B;  4G76 A;  2CBJ A;  3SFE A;  4CTD A;  4ZI7 E;  2XAG B;  4K0K T;  3LDQ B;  2XHE B;  2WSS V;  5GON E;  1E1H B;  3F2E A;  3ZMV B;  1UUR A;  2XSA A;  1OWA A;  3O4X E;  5ADX L;  2X9X A;  4KBM B;  5LHI B;  2WJR A;  3UPG A;  4ZOL E;  5CB4 E;  5DQV A;  3SOL A;  3ZCJ A;  3CWZ B;  3SYB A;  1CUN A;  3CX7 B;  2JQK A;  2BG9 E;  3CPZ A;  4CZZ B;  3LK4 1;  2XE5 A;  1WR0 A;  3CIR A;  3IF8 B;  1QJP A;  3AXJ B;  4IGU A;  1MMD A;  3FXE B;  2B76 A;  2XQ8 A;  4COF A;  1BR4 A;  4LSE A;  1E2A A;  4FMS A;  3AAA A;  2MHL A;  4EYY R;  5LXT E;  4F6R C;  2VK9 A;  5FXZ A;  1MPF A;  4UF0 A;  3OVU A;  3GP6 A;  3FZL B;  5JVD E;  4H9S E;  4FUV A;  4EZ4 A;  5F5W A;  1Q9G A;  3AAE B;  5EZY E;  3VHL A;  4D64 A;  4DV3 T;  2VKJ A;  2WQY A;  3O9X A;  4QKN A;  5L3G B;  1HNW T;  1LKX A;  4UVC B;  4DND A;  1J1J A;  4CI1 B;  5JR9 B;  4TWD A;  1W0B A;  3JAE A;  3H37 A;  2KXP B;  2W0G A;  4OFZ A;  2WP9 A;  4FRT A;  4O49 A;  3Q5E A;  4FRX A;  4NUU A;  4XNK A;  3VR9 A;  3ZLI A;  5IUX A;  4LF5 T;  4FSO A;  5AQQ B;  1QJ9 A;  2W63 A;  3KV9 A;  2BVL A;  2UUC T;  1ZKE A;  1WCR A;  2YN6 A;  3AAI A;  3AA7 B;  2KC0 A;  2KDY A;  3J7Y q;  2H3R A;  4BJN A;  5FXV A;  4BUM X;  3CX6 B;  4D5U A;  2Y0H A;  2BDE A;  2D9D A;  3A5X A;  5ABF A;  4DVD A;  1PHO A;  3I9Y A;  4FSP A;  4C4V B;  4AFK A;  2PG8 A;  4BAY B;  2WCA A;  4TUY E;  3RRC A;  2K4T A;  5H6R B;  2ES0 A;  3AAA B;  3SY9 A;  1IBM T;  5FY7 A;  3SZD A;  4IE4 A;  4Z90 A;  3OJA A;  2K24 A;  4P1N A;  3TLV A;  1NWM X;  2FBW A;  3FBZ A;  1YW0 A;  3GA8 A;  4LMK A;  2J1D G;  4IL9 A;  2CCQ A;  4IDN A;  5LNK A;  3ZCI A;  4O2A E;  3Q2M A;  4AUI A;  1S94 A;  1XMO T;  2BS2 A;  3WAK A;  5FY0 A;  2ERV A;  4U7Y A;  1AJ3 A;  1GFM A;  3BRZ A;  3B57 A;  4PJJ A;  1ZV4 X;  1ZOY A;  2LKG A;  2ZM6 T;  1YKE B;  4X1I E;  2XAS B;  2HH7 A;  4G75 A;  1KNZ A;  3UTK A;  2I59 A;  2J1N A;  1J5E T;  3AE2 A;  3ZC0 A;  3T1H T;  2RPA A;  4CN6 A;  4GYR A;  1FMV A;  2LJL A;  4JUY A;  4AKR B;  2UXN B;  3PUR A;  2NWB A;  1WYC A;  4F8H A;  3EAB A;  1D0Y A;  4IDZ A;  2NR4 A;  3AEF A;  4WZX A;  2NP9 A;  2B1E A;  5JRC A;  2WJQ A;  4N58 A;  2Q9Q D;  4EEB A;  2XQ4 A;  2XZE A;  4TWH A;  2HN1 A;  2XG6 A;  4ZZC A;  4PNI A;  1E54 A;  4O3Y A;  5KX5 E;  3GN5 B;  3HR0 A;  2KMF A;  5CFB A;  1OSM A;  2XUE A;  2KT9 A;  3OTO T;  2JMM A;  3N2K E;  4FZM A;  2WVP A;  1ZHZ A;  1KF6 A;  1YS5 A;  2NTX A;  4U72 A;  3WAJ A;  5HEU A;  3JCF A;  5AQU B;  2XTQ A;  5B66 O;  2QRX A;  4JI3 T;  2LSI A;  3DJB A;  3RF1 A;  2X27 X;  1LVK A;  4HFD A;  3ZMT B;  1UX5 A;  3KV4 A;  2Y7S A;  1IZN B;  3GMI A;  5HEO A;  4EB6 E;  2CMR A;  4EZH A;  3VKG A;  4GKJ T;  3JCU O;  2D5U A;  2LOP A;  2MYS A;  2RP4 A;  4YJ3 E;  1CHU A;  2WMO A;  2IDO B;  4EED A;  3IEE A;  2YDS A;  5FP3 A;  3IHR A;  3VR8 A;  4YXD A;  4EGW A;  2LE8 A;  4HFC A;  3G06 A;  1HXT A;  3RKG A;  3RYI E;  2ACX A;  3AEG A;  2WY2 A;  1W09 A;  4ZEY A;  2OA5 A;  5AQI B;  3H3A A;  4JBW F;  1D1B A;  2X0H A;  4QH1 A;  4BJM A;  2C5I T;  3O1I A;  3AA7 A;  2N2L A;  4C90 A;  2LSG A;  3HI2 A;  3UAQ A;  2J4G A;  3AE6 A;  5HWX A;  2X9H A;  4LF7 T;  3A2S X;  3UQ7 A;  4IDQ A;  2LSY A;  1G8X A;  1IAP A;  4AIS A;  2RA1 A;  2FJD A;  4CI3 B;  2LSK A;  4IST A;  4KMC A;  1OED E;  2WWU A;  2YU1 A;  3AA0 B;  2XQ9 A;  2EHO A;  1D1A A;  4QXC B;  5AQV B;  2Y6X A;  3KDS E;  3PRN A;  4O4J E;  2AXD S;  2XAJ B;  2QGS A;  3R6N A;  4LSH A;  3UU5 A;  4XZC A;  3AE1 A;  2V7M A;  4GCQ A;  3FZF B;  4JI5 T;  3ONJ A;  1QUU A;  3WI5 A;  5LGN B;  2F4V T;  4FZN A;  2N2N A;  5G38 A;  2R8A A;  4I50 E;  1T72 A;  5B5E O;  1T1L A;  1N36 T;  5HCJ A;  2NW9 A;  2YK0 A;  5LA6 E;  4YFS A;  2V7K A;  2UXX B;  3QC9 A;  3TLU A;  1MIW A;  2MAW A;  2LKH A;  3AXJ A;  3KZI O;  2W66 A;  3ETV A;  4PK4 A;  2AXT O;  2XTR A;  3SS1 A;  1M7K A;  3P4Q A;  4X1K E;  3RQW A;  4FJO A;  2LRK A;  1GQE A;  5JDF A;  3B5M A;  4DBQ A;  2Q9Q C;  4DMV A;  4YY3 T;  3ONX A;  5IWA T;  1OED A;  4KRA A;  5KAI O;  3PUW F;  2W2U A;  5E0O A;  3PQU A;  4H63 V;  3EDV A;  5JDP A;  3ANW B;  1YXR A;  5FVK A;  4JV5 T;  3K19 A;  1QLB A;  4YSZ A;  2VAS A;  1ZHY A;  4X62 T;  3POQ A;  2XQ6 A;  5LBM A;  2WZI A;  1NEN A;  3VY9 X;  2V7J A;  4FOZ A;  4YJ2 E;  3RYF E;  5AQO B;  2CLY C;  3MKD A;  4UVA B;  3GWH A;  2W80 C;  3D0T A;  3RBH A;  3L39 A;  3EMN X;  2VL0 A;  3PDY A;  2JJ9 A;  5AQM B;  2LFU A;  5HAX A;  3UUB A;  4DR1 T;  2R89 A;  1HF8 A;  3NRX A;  4DUZ T;  4IIJ E;  2CWY A;  2EHO C;  4LML A;  1YQ4 A;  4ZI3 D;  2Y8D A;  3U3I A;  3AEB A;  4GHB A;  4LSI A;  5J0Z A;  4QH5 A;  4U7I A;  3HWB A;  2K0L A;  2KXP A;  3L3P A;  3ZN1 B;  4DR7 T;  4HWH A;  1IJ6 A;  5LHG B;  2YDQ A;  5LG3 A;  5FXW A;  5LP6 E;  1UUS A;  4TX5 A;  4LF4 T;  3P4P A;  2J47 A;  4KP3 C;  5JDQ A;  1BR0 A;  3ZJ1 A;  5LB7 B;  3ONL C;  4XNL A;  2G0U A;  1IJ5 A;  3OKQ A;  2ZLY A;  3N9O A;  4FZL A;  1HFA A;  5EK4 A;  4QXH B;  4MHC A;  3P4S A;  5IYZ E;  5KMG P;  2POR A;  4O3X B;  2LOS A;  4P09 A;  4KI0 F;  5LBQ B;  2YEV C;  5AQG B;  4OYK A;  4C91 A;  4O8S A;  4JFB A;  1WRD A;  1LRZ A;  1D0Z A;  4ILU A;  2KSR A;  3PTR B;  3EAM A;  1MM4 A;  2XSB A;  2KWH A;  3UUL A;  3VZW X;  2XQA A;  4ILA A;  4IRE A;  5TIS O;  3RX6 A;  4O4L E;  2H88 A;  4YHJ A;  4E7Z A;  4LF6 T;  1WFD A;  3RGL A;  2E9X B;  2D2S A;  1IZN A;  3LFM A;  2JRK A;  3ZSS A;  2I0M A;  4U74 A;  5ABG A;  5LJN A;  4G63 A;  2WDQ A;  2D0T A;  1HCI A;  4YTM A;  1L0V A;  3IA3 A;  3J9X 1;  3MXZ A;  4N75 A;  1YD8 G;  2R6G F;  3Q5W A;  4ZXL A;  2OLT A;  4AYD C;  3ZT7 A;  2IUB A;  5AQR B;  4AQF A;  5LG4 A;  1VCT A;  3I0Q A;  3T20 A;  5JRE A;  2LLY A;  4YTP A;  3M3Z B;  4DR4 T;  3CX8 B;  4DO0 A;  5HXE A;  4HWC A;  4TN7 B;  1ZHT A;  2XAH B;  3HOL A;  1JNR A;  1H7C A;  3JAF A;  4CXY A;  3V5S A;  2O4V A;  5LMU T;  4GCP A;  2W00 A;  4GF4 A;  5FVL A;  4NIQ A;  4AKH A;  3EHZ A;  4UV9 B;  1FJG T;  1Q9F A;  4EAH A;  4U33 A;  3OYZ A;  1SUM B;  2YDR A;  2LEH A;  4X66 T;  2IWW A;  1WYB A;  4U2Y A;  2A9U A;  2XAF B;  4LFB T;  3UUM A;  2L9Q A;  5ABE A;  4WNK A;  4AYI D;  4MLK A;  3HKE E;  3LJC A;  3A0H O;  2FGR A;  3ZPO A;  4PAG A;  3AE9 A;  2XY8 B;  1WLX A;  4KUM B;  3MJX A;  3N9L A;  1IBK T;  3P7I A;  4JCH A;  4LMJ A;  2H89 A;  3C4X A;  2CE7 A;  2WS3 A;  2VB6 A;  2DL1 A;  2CRB A;  4O4I E;  3V8U A;  4ZS2 A;  3UU8 A;  3LBX A;  5FKY A;  5F3J A;  4CI2 B;  1D0X A;  5L47 A;  2QA7 A;  3HKC E;  3ZMS B;  3OBV E;  5AQP B;  4TNV A;  3QRC A;  4HWD A;  4B3R T;  3FB2 A;  3PJA J;  1ZHC A;  2V5D A;  4H9N C;  2K48 A;  2LRL A;  4HWI B;  3O1J A;  4B3T T;  2ZM0 A;  1MNE A;  2E2A A;  4X5T A;  4I43 B;  2Q9Q A;  3B13 A;  4H9P C;  4L0R A;  2PRN A;  4J2C A;  3AA1 B;  4NXM T;  4CQI A;  3QNU A;  3PF1 A;  3RYC E;  4JEH B;  3P50 A;  2GE4 A;  3JC6 C;  5AQH B;  3KFW X;  3JC6 D;  1OXZ A;  4DMW A;  5HWY A;  4KR4 A;  3RIF A;  4IDO A;  2L8K A;  3CKD A;  2Y48 B;  3P4R A;  2V7L A;  2M6I A;  4HFH A;  3LK2 B;  4O2B E;  1D1C A;  2M06 A;  4Q25 A;  4I4T E;  3LK2 A;  4AYE C;  3HA4 A;  3C64 A;  3I1A A;  2W62 A;  5DL5 A;  3RI5 A;  1MMN A;  3C50 A;  3VKH A;  4OHF A;  4Z8X A;  2WB5 A;  2YPV A;  3V5U A;  4N59 A;  2H7O A;  3PU8 A;  2IC6 A;  2N2M A;  3RHW A;  2IWV A;  5DL8 A;  2KZ7 A;  5KXJ A;  1OPF A;  2LHF A;  3TLW A;  2C0S A;  2JQQ A;  2VVN A;  2DWG A;  2Q9Q B;  5HXC A;  2W4X A;  1BR2 A;  2UU9 T;  3AVS A;  3WU2 O;  4IL4 A;  3JAD A;  4ZZB A;  4C69 X;  4AYN A;  3N9N A;  2NW7 A;  3DTO A;  2VKH A;  1O3X A;  4UV8 B;  4JI0 T;  4NPP A;  3LK4 2;  1SHZ C;  4HWF A;  2A3D A;  3PQS A;  3SRZ A;  5HXR A;  4PFO A;  3ZMU B;  5BR8 T;  4PK6 A;  4U9C A;  4MFR A;  5M4Y A;  2KND A;  3LBX B;  2CLY B;  4IT4 A;  3AE3 A;  2N1G A;  2OMF A;  1M62 A;  4KR8 A;  3BQK A;  2BG9 B;  3T0S A;  2FJE A;  1BXW A;  3NZP A;  1U4Q A;  3VU7 H;  5ETW A;  4WBN E;  4MBQ A;  2UXC T;  4H63 H;  4H9O C;  3O0E A;  4GOU A;  2XM1 A;  1X9B A;  2IIU A;  4A98 A;  2KIN B;  2XM2 A;  3W15 B;  1GFP A;  2QYW A;  4GKK T;  5G39 A;  3VY8 X;  3UFG A;  4F4B A;  4ISS A;  4O4X A;  1OED C;  2A2F X;  2XAQ B;  5C2T A;  1YQ3 A;  1FIO A;  5LOV E;  3FYX A;  1HR0 T;  4B61 A;  3TLS A;  3BK9 A;  3HL6 A;  2DHR A;  4EXT A;  5AQJ B;  2J4U P;  3AEC A;  5TAO A;  3SWH A;  2QVA A;  4AKI A;  4LSF A;  3EI0 A;  4ADZ A;  2BG9 A;  4JI6 T;  1HTJ F;  4AYM C;  5HCM A;  2IW5 B;  2R4L A;  3RIA A;  1HXX A;  4IE0 A;  1VRB A;  4ZI2 D;  3NZQ A;  3ZT6 A;  2ACZ A;  1MIV A;  4OX9 T;  4E7S A;  2ZM2 A;  3PUQ A;  3K1S A;  5L3D B;  4IHJ E;  4ERR A;  1FMW A;  2V5C A;  1ZHX A;  1XWM A;  4EIW A;  3C4W A;  3AE5 A;  2PJQ A;  5JDM A;  2F1C X;  4D65 A;  7PRN A;  4K0U A;  2FJB A;  1N34 T;  4UB6 O;  4AQY T;  1XNR T;  3UUN A;  2CBI A;  5BMV E;  5AFU L;  2JPF A;  3ZYM A;  1N32 T;  4TZ4 C;  1MMA A;  2JIW A;  3KVA A;  2WM9 A;  2X66 A;  4ZHQ E;  4E1S A;  4GCS A;  2X0Y A;  3CQG B;  1I6Z A;  3Q5X A;  1T8B A;  1KNR A;  5FVN A;  3P4W A;  3MA9 A;  1BT9 A;  1US7 B;  2BBH A;  5DL6 A;  2A72 A;  3AB3 B;  5AFU K;  3OYX A;  5LGU B;  3C51 A;  2VUR A;  2CXD A;  1BH3 A;  2BKN A;  2V26 A;  3NJT A;  2IC9 A;  5L2L A;  4DR6 T;  2NTY A;  2FJA A;  4UEL A;  3LK3 A;  3N2O A;  2X67 A;  3NRY A;  2WWV A;  4AXP A;  3CVR A;  4AZL A;  2F1V A;  5GTH O;  3AE8 A;  2OV9 A;  4N74 A;  2F1T A;  1OED B;  5L4H A;  2K9A A;  1SE7 A;  3HW9 A;  3A8Y C;  4A97 A;  3DA4 A;  3POU A;  4H9Q C;  3SFD A;  4BA9 A;  1SA0 E;  2WMN A;  5EE2 A;  4WW0 A;  2X51 A;  2CXL A;  2E5L T;  4QHO A;  3VE2 A;  2HPJ A;  3PGR A;  2XTL A;  5JDN A;  3UU2 A;  3VRB A;  2DLR A;  4V1A v;  3LK3 B;  5AQS B;  4JI4 T;  2IAK A;  3HKD E;  1HNZ T;  2XMX A;  4UF0 B;  4PUX A;  4HGA A;  1Z0P A;  2P9B A;  3UU3 A;  3ZMZ B;  2DWK A;  4DV1 T;  2WBL A;  5FL0 A;  3TLT A;  5C3J A;  3K3N A;  5HEH A;  2VWA A;  5DL7 A;  2VKD A;  4DV6 T;  4LFC T;  3E22 E;  3WI3 A;  2W61 A;  2I6H A;  2PFV A;  3Q9D A;  5J1G A;  2X9Y A;  2VL8 A;  1HNX T;  5DJQ C;  1NEK A;  2WAU A;  1W0A A;  3AA6 B;  2HPL A;  3PE0 A;  3UT5 E;  3PU3 A;  1XDO A;  2BVM A;  2ODV A;  3K8P C;  2LM2 A;  2QTK A;  4NXN T;  4K3B A;  4RL9 A;  2BKO A;  2KWI B;  1P4T A;  1N33 T;  5JTG A;  5AQK B;  2X0L B;  4TNW A;  3RH3 A;  1KK7 A;  3CQX C;  3RC3 A;  5IHY A;  3LSV A;  1S35 A;  3H3M A;  2R88 A;  3EUH A;  5JDH A;  2E9X A;  5LMN T;  1J5W A;  4HFE A;  5AQN B;  4L5G A;  4AKM A;  3AA6 A;  3DWO X;  2XQ3 A;  3PUV F;  4OYJ A;  4U3C A;  3ABV A;  3S4U A;  3NBX X;  2XJ7 A;  4KHP T;  5L3C B;  3QK6 A;  4IE5 A;  1KEY A;  3R84 B;  4DV2 T;  5L3F B;  3BQL A;  4FES A;  3PJA A;  4WYV A;  5IYU A;  4B3M T;  2JQY A;  1HG2 A;  2IML A;  5JQG E;  4PFP A;  3AEA A;  2PBI A;  2DNX A;  3HKB E;  5J2T E;  3ZYL A;  1XDP A;  3AE4 A;  1HX1 B;  1FEW A;  5E79 O;  4XAX B;  3I9W A;  2WDV A;  4U31 A; 
#chains in the Genus database with same CATH homology
 3MK7 C;  3LK2 B;  4RLC A;  2V7I A;  4O2B E;  8PRN A;  3AA1 A;  1D1C A;  5HYA A;  2XAJ B;  3WI5 A;  2M06 A;  2DCF A;  2QGS A;  4I4T E;  4RJX A;  3C4Z A;  4ZI2 C;  3LK2 A;  3HA4 A;  4JLE A;  3R6N A;  3ZJ2 A;  4LSH A;  4AYE C;  4P0B A;  3C64 A;  4XZC A;  5JR9 C;  4HKA A;  2M67 A;  3E0Z A;  3I1A A;  5LJM A;  2V7M A;  2W62 A;  4GCQ A;  5DL5 A;  1MMN A;  1WR6 A;  4AKG A;  3C50 A;  3VKH A;  3KV5 A;  3G7G A;  1BR1 A;  1QUU A;  3KV6 A;  4OHF A;  4Z8X A;  5LGN B;  2YPV A;  2ODJ A;  5PRN A;  3N9Q A;  3V5U A;  3SZV A;  4FZN A;  4N59 A;  2N2N A;  4QXC B;  2H7O A;  3N9M A;  5HXH A;  1ZHW A;  3PU8 A;  3PUS A;  2IC6 A;  2N2M A;  3RYH E;  3SYS A;  4I50 E;  5F8P A;  1LVF A;  5DAB A;  2NW9 A;  2YK0 A;  5DL8 A;  2YIN A;  5LA6 E;  2KZ7 A;  1NAF A;  1OPF A;  1PRN A;  2LHF A;  3I0O A;  2ZM8 A;  4PJM A;  2C0S A;  2V7K A;  4YFS A;  3JTY A;  2UXX B;  2LT3 A;  2VKO A;  2JQQ A;  3PUA A;  4IE6 A;  4JEU B;  5LCY A;  3QC9 A;  1MIW A;  2DWG A;  2Q9Q B;  4ANJ A;  5HXC A;  3E08 A;  4N78 D;  3WI4 A;  1BR2 A;  3ETV A;  2GK9 A;  4PK4 A;  2XTR A;  3CQC B;  3SS1 A;  3FHN A;  4X1K E;  3AVS A;  2CXF A;  3C5O A;  4HEA A;  2DI4 A;  2M07 A;  4FJO A;  4UVB B;  4C69 X;  5JDF A;  4AYN A;  3N9N A;  4ASK A;  2NW7 A;  3HWB A;  4ZI3 C;  1EZ3 A;  3DTO A;  5CA0 E;  5T5F A;  2MBG A;  2VKH A;  1O3X A;  2EHO D;  2Q9Q C;  2X68 A;  4G2A A;  4UV8 B;  3LK4 2;  3RKO A;  4QQ1 A;  1SHZ C;  4DMV A;  2A3D A;  1UCU A;  3ONX A;  3ZYK A;  3IBP A;  5LGT B;  4AQG A;  4G76 A;  5GV0 A;  4KRA A;  3T24 A;  3PQS A;  1G90 A;  3SRZ A;  5HXR A;  4PFO A;  5L3B B;  4ZI7 E;  5E0O A;  3ZMU B;  3PQU A;  4H63 V;  2XAG B;  4PJL A;  4PK6 A;  3EDV A;  4AKR A;  4U9C A;  4MFR A;  5JDP A;  5M4Y A;  3AA0 A;  2KND A;  3LBX B;  3ANW B;  1QJ8 A;  2XHE B;  2CLY B;  2WSS V;  5GON E;  3K19 A;  1E1H B;  3F2E A;  3ZMV B;  2VAS A;  1ZHY A;  4WBO A;  1YKH B;  2N1G A;  1OWA A;  2LSJ A;  3O4X E;  5ADX L;  1MIY A;  2OMF A;  3POQ A;  2ZLD A;  4KR8 A;  5G26 A;  2X9X A;  3BQK A;  4KBM B;  5LBM A;  5LHI B;  3T0S A;  5DQW A;  6PRN A;  3UPG A;  4ZOL E;  5CB4 E;  5DQV A;  3VY9 X;  3SOL A;  2V7J A;  3EVY A;  3NZP A;  3ZCJ A;  1BXW A;  3CWZ B;  4FOZ A;  3SYB A;  1CUN A;  3RYF E;  4YJ2 E;  1U4Q A;  2CLY C;  3CX7 B;  3VU7 H;  3MKD A;  5ETW A;  4UVA B;  4WBN E;  4MBQ A;  3CPZ A;  4CZZ B;  3LK4 1;  2XE5 A;  3IF8 B;  4H63 H;  1QJP A;  3GWH A;  2D0U A;  4H9O C;  3O0E A;  4IGU A;  1MMD A;  3FXE B;  4GOU A;  1THQ A;  2W80 C;  3D0T A;  3RBH A;  3P8C D;  3EMN X;  1BR4 A;  4LSE A;  2KIN B;  3W15 B;  5JDL A;  1GFP A;  4H9R C;  3FXD B;  5JDG A;  4FMS A;  3AAA A;  5EK2 A;  2YU2 A;  2MHL A;  4O4U A;  3KVB A;  2NOX A;  4EYY R;  5LXT E;  3VY8 X;  3PDY A;  2JJ9 A;  4F6R C;  2VK9 A;  4AI6 A;  2LFU A;  4F4B A;  5FXZ A;  5HAX A;  1MPF A;  4ISS A;  1U5P A;  4NUV A;  4UF0 A;  4O4X A;  1HF8 A;  4HTE A;  2A2F X;  2XAQ B;  3NRX A;  4IIJ E;  3RPU A;  1GFO A;  3GP6 A;  1ZEE A;  2CWY A;  2EHO C;  5JVD E;  4ZI3 D;  4H9S E;  3NSG A;  2Y8D A;  3U3I A;  4FUV A;  4GHB A;  4LSI A;  4EZ4 A;  1FIO A;  5LOV E;  3RC8 A;  3FYX A;  1Q9G A;  4Z3T A;  1HG5 A;  4GK0 E;  5C8Y E;  3RRW A;  2K0L A;  3AAE B;  3L3P A;  5EZY E;  3VHL A;  3ZN1 B;  2KXP A;  4B61 A;  4TV9 E;  4CXX A;  4MAL A;  4D64 A;  1IJ6 A;  2N9D A;  3BK9 A;  3HL6 A;  5LHG B;  2DHR A;  2V1D B;  4EXT A;  3T8O A;  3AAE A;  2SPC A;  2VKJ A;  5FXW A;  4HN9 A;  5LP6 E;  5FMN A;  4TX5 A;  4B6X A;  5L3E B;  4YLH A;  4KP3 C;  3O9X A;  3POX A;  4QKN A;  5L3G B;  5JDQ A;  5TAO A;  3SWH A;  2J4U P;  1LKX A;  4UVC B;  4AKI A;  4DND A;  4CI1 B;  1BR0 A;  3ZJ1 A;  3N5L A;  4LSF A;  5JR9 B;  1HX8 A;  4XNL A;  3C98 B;  3FBL A;  2G0U A;  1IJ5 A;  2Z6E A;  4ADZ A;  5H6Q B;  3M65 A;  3OKQ A;  1HTJ F;  2KXP B;  2ZLY A;  3H37 A;  2W0G A;  4IE7 A;  4OFZ A;  4FRT A;  3N9O A;  4O49 A;  4AYM C;  3BQI A;  2IW5 B;  4FRX A;  4NUU A;  1VOM A;  4FZL A;  1HXX A;  4XNK A;  3ZLI A;  4IE0 A;  1VRB A;  4ZI2 D;  3NZQ A;  2EHO B;  4FSO A;  1HFA A;  1GFQ A;  5EK4 A;  1QJ9 A;  1MIV A;  4HFV A;  2E9X C;  2W63 A;  2ZM2 A;  3PUQ A;  3KV9 A;  2BVL A;  4QXH B;  4E7S A;  2YNK A;  1ZKE A;  3QRA A;  4MHC A;  3AAI A;  3AA7 B;  4IHJ E;  5IYZ E;  5L3D B;  4ERR A;  2KC0 A;  1FMW A;  5FYM A;  1ZHX A;  2Y0K A;  4EIW A;  3C4W A;  1Y64 B;  5KMG P;  2KDY A;  3J7Y q;  2POR A;  2PJQ A;  2H3R A;  5JDM A;  4O3X B;  2ZFG A;  2LOS A;  4D65 A;  4BJN A;  3GN5 A;  4P09 A;  4A56 A;  7PRN A;  2XE1 A;  4FT6 A;  3VE1 A;  5FXV A;  5LBQ B;  4BUM X;  3CX6 B;  4CXW A;  2YEV C;  4K0U A;  4D5U A;  3DP7 A;  3K3O A;  4OYK A;  2Y0H A;  2BDE A;  4C91 A;  3A5X A;  1HS7 A;  4DVD A;  1PHO A;  4O8S A;  3I9Y A;  4FSP A;  4JFB A;  1WRD A;  1LRZ A;  4AFK A;  2PG8 A;  4BAY B;  1D0Z A;  3F57 A;  2W81 C;  4ILU A;  4TUY E;  4GYS A;  3RRC A;  2K4T A;  3UFE A;  5H6R B;  3KBT A;  3PTR B;  2ES0 A;  3N2G E;  2KZ7 B;  3UUN A;  1MM4 A;  2KWH A;  5BMV E;  4OK0 A;  3AAA B;  3UUL A;  3SY9 A;  3VZW X;  5AFU L;  2JPF A;  3ZYM A;  5FY7 A;  3SZD A;  4IE4 A;  4TZ4 C;  3RX6 A;  4O4L E;  1MMA A;  3OJA A;  5FXX A;  4YHJ A;  4QX8 B;  4E7Z A;  3POR A;  2K24 A;  2E9X D;  3ZC1 A;  2E9X B;  2NW8 A;  2WM9 A;  1NWM X;  2X66 A;  3KVA A;  2D2S A;  4ZHQ E;  4O3W A;  5CA1 E;  3KVD D;  3KIN B;  1IZN A;  3FBZ A;  4E1S A;  1YW0 A;  3GA8 A;  4GCS A;  2J1D G;  3LFM A;  2XE2 A;  2JRK A;  2CCQ A;  3CQG B;  5LNK A;  4U74 A;  3K3Q C;  3ZCI A;  4O2A E;  5LJN A;  4G63 A;  3Q2M A;  3Q5X A;  4X1Y E;  2D0T A;  4AUI A;  1S94 A;  4FI5 A;  1HCI A;  5FVN A;  3WAK A;  5FY0 A;  4L9I A;  2ERV A;  3MA9 A;  3J9X 1;  5JH7 E;  1BT9 A;  1US7 B;  1AJ3 A;  2JMK A;  3MAC A;  3MXZ A;  1GFM A;  5DL6 A;  3ETU A;  3B57 A;  4PJJ A;  2A72 A;  1ZV4 X;  3AB3 B;  5AFU K;  3OYX A;  1YKE B;  3AVR A;  4X1I E;  1UX4 A;  1YD8 G;  3Q5W A;  5LGU B;  4XBF B;  3C51 A;  2CM0 A;  2CXD A;  2XAS B;  2HH7 A;  1BH3 A;  4AYD C;  4G75 A;  1KNZ A;  3UTK A;  3ANW A;  4AQF A;  2V26 A;  2IC9 A;  2I59 A;  4ZS3 A;  2J1N A;  3ZC0 A;  5L2L A;  2LHN A;  2NTY A;  4UEL A;  4EOZ B;  5LG4 A;  3LK3 A;  3N2O A;  2X67 A;  4GYR A;  3NRY A;  1FMV A;  2LJL A;  3I0Q A;  2C5J A;  4JUY A;  4PJN A;  4AKR B;  4AXP A;  2UXN B;  3T20 A;  2MTQ A;  3CVR A;  3U78 A;  3PUR A;  4AZL A;  2KLQ A;  1MM5 A;  2F1V A;  1HXU A;  2NWB A;  5JRE A;  1H6S 1;  2F1T A;  2CEA A;  1WYC A;  5LHH B;  4AKL A;  2K9A A;  3HW9 A;  4RJW A;  2L3L A;  4PK5 A;  1D0Y A;  3DA4 A;  4QXB B;  3POU A;  4GK5 E;  3SY7 A;  4IDZ A;  3LG7 A;  2XQY A;  4GIW A;  2NP9 A;  2B1E A;  3CX8 B;  4DO0 A;  5HXE A;  4H9Q C;  5JRC A;  4TN7 B;  1ZHT A;  4N58 A;  2XAH B;  4BA9 A;  1SA0 E;  3HOL A;  1H7C A;  2Q9Q D;  4CXY A;  2WMN A;  5EE2 A;  3V5S A;  2O4V A;  4WW0 A;  2X51 A;  2CXL A;  3PRN A;  4GCP A;  3UAQ A;  2W00 A;  4QHO A;  2XG6 A;  3VE2 A;  4PNI A;  4GF4 A;  2HPJ A;  1E54 A;  4AKH A;  2XTL A;  4O3Y A;  5JDN A;  3HOE A;  3UU2 A;  4UV9 B;  2DLR A;  3VZT X;  3O1H A;  3GN5 B;  5KX5 E;  4UEM A;  3HR0 A;  4V1A v;  3LK3 B;  4EAH A;  3UUX B;  1Q9F A;  2KMF A;  3OYZ A;  1OSM A;  2IAK A;  2LEH A;  2XUE A;  4P0A A;  3HKD E;  4M1P A;  2KT9 A;  1WYB A;  5JRC B;  2JMM A;  1ORM A;  3N2K E;  2XMX A;  2XAF B;  4FZM A;  1ZHZ A;  1YS5 A;  4UF0 B;  4PUX A;  4HGA A;  1Z0P A;  2H7V C;  3UUM A;  2NTX A;  2P9B A;  4U72 A;  3WAJ A;  2L9Q A;  3ZMZ B;  3MZK B;  2DWK A;  4WNK A;  3ZN0 B;  4AYI D;  2LHR A;  2XTQ A;  4MLK A;  2WBL A;  3K3N A;  3HKE E;  2LSI A;  3DJB A;  4QX7 B;  2K5B B;  2VWA A;  2ZMA A;  3LJC A;  2VKD A;  5DL7 A;  5D5D A;  3TKL B;  4O3Z A;  3E22 E;  2ODU A;  3WI3 A;  2X27 X;  2FGR A;  3ZPO A;  2W61 A;  1LVK A;  4X20 E;  2PFV A;  4PAG A;  3ZMT B;  2FGQ X;  4KUM B;  1UX5 A;  1WLX A;  3MJX A;  1MMG A;  3N9L A;  3KV4 A;  3P7I A;  5JR9 A;  1IZN B;  2Y7S A;  3Q9D A;  4JCH A;  3GMI A;  5J1G A;  4EB6 E;  2CMR A;  4EZH A;  3VKG A;  2X9Y A;  2VL8 A;  2CA5 A;  3C4X A;  5DJQ C;  2D5U A;  2LOP A;  1GFN A;  2MYS A;  2RP4 A;  2WAU A;  2CE7 A;  4YJ3 E;  5FY1 A;  3AA6 B;  2HPL A;  3PE0 A;  3ESL A;  2VB6 A;  5HXS A;  2LM9 A;  5J2U E;  3UT5 E;  3F31 A;  3PU3 A;  2WMO A;  2BVM A;  3KBU A;  2ODV A;  3K8P C;  3IEE A;  5FP3 A;  3EDU A;  2QTK A;  4UIG A;  4O4I E;  3IHR A;  2BZB A;  4RL9 A;  3V8U A;  4ZS2 A;  2KWI B;  4HE8 A;  1P4T A;  2LE8 A;  3TZG A;  3CML A;  4EYU A;  3LBX A;  2X0L B;  4DBQ A;  5KDM C;  3RH3 A;  1KK7 A;  2E8I A;  1HXT A;  3CQX C;  3RYI E;  2XE3 A;  2X9W A;  3RC3 A;  5IHY A;  5F3J A;  1S35 A;  4CI2 B;  1D0X A;  2ACX A;  1G73 A;  3EUH A;  2MNH A;  2CWO A;  5JDH A;  2QA7 A;  2E9X A;  2JMH A;  4TV8 E;  3HKC E;  1T98 A;  2C5K T;  3ZMS B;  4O4H E;  3VZU X;  4L5G A;  3OBV E;  4AKM A;  4UXN B;  3AA6 A;  5ADX K;  3QRC A;  2OA5 A;  3FB2 A;  4OYJ A;  3H3A A;  1ZHC A;  3QUJ A;  5A1L A;  1V9D A;  1D1B A;  4BJM A;  4H9N C;  2C5I T;  2K48 A;  3S4U A;  3O1I A;  3AA7 A;  5EK3 A;  3O1J A;  3NBX X;  1X79 A;  3PUG A;  2Y2X A;  2ZM0 A;  1MNE A;  2N2L A;  4C90 A;  5LYJ E;  3QK6 A;  4IE5 A;  5L3C B;  4I43 B;  3R84 B;  2Q9Q A;  3B13 A;  2LSG A;  3HI2 A;  4H9P C;  4L0R A;  4PW8 A;  5L3F B;  2PRN A;  4J2C A;  3BQL A;  4FES A;  4E1T A;  5IYU A;  5HWX A;  3AA1 B;  4AQF C;  2X9H A;  1HG2 A;  4CQI A;  3A2S X;  5JQG E;  4PFP A;  3RYC E;  2LSY A;  1G8X A;  1IAP A;  4JEH B;  5FNV E;  2PBI A;  2MOZ A;  2DNX A;  2GE4 A;  3JC6 C;  3HKB E;  2RA1 A;  5J2T E;  3KFW X;  3ZYL A;  3JC6 D;  1OXZ A;  4DMW A;  5HWY A;  4CI3 B;  2LSK A;  3DA3 A;  3ZEF B;  4KR4 A;  1B7T A;  4I55 E;  4IST A;  4KMC A;  1FEW A;  2L8K A;  2WWU A;  3CKD A;  2YU1 A;  3N9P A;  4XAX B;  3AA0 B;  3I9W A;  1QSD A;  2Y0L A;  2EHO A;  4DBR A;  4QWN B;  2Y48 B;  1MND A;  4RLB A;  1D1A A;  2V7L A;  3L09 A;  2Y6X A;  3KDS E;  4O4J E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...