3AA1B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from ckip-1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa1B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa1B02
3AAEB 3LK41 3AA6B 5ADXK 2KXPB 3LK3A 3AA0A 5ADXL 3AAAB 3AA0B 5AFUL 3AAAA 3AAEA 3LK42 3LK3B 3AA6A 2KXPA 4AKRB 3LK2A 3AA1B 5AFUK 3AA7B 1IZNB 3LK2B 1IZNA 2KZ7A 2KZ7B 3AA7A 3AA1A 4AKRA
chains in the Genus database with same CATH superfamily
1KEYA 2GK9A 2CWYA 3K3NA 2O4VA 3LK3A 4CI1B 2D9DA 3AE2A 3RRWA 3DWNA 3UUNA 3ZYKA 2V6XA 1HNXT 4E1SA 2XM2A 3DJBA 1HFAA 3LBXB 2H3RA 1ZHZA 5GV0A 2W61A 4WNKA 2DI4A 3D0TA 3QK6A 2YU2A 5LCYA 3KDSE 2B1EA 2XE2A 2H89A 4DNDA 3JTYA 2E5LT 1QSDA 3RC3A 2CXDA 4IE0A 4HEAA 4O3WA 4GOUA 5IUXA 3ZYLA 4HFCA 2BVMA 2ZM8A 5AQPB 2UXNB 5F3JA 3RKGA 3W15B 2FJEA 3I0OA 3VZTX 5IYZE 3BRYA 3C64A 3KV5A 3CX7B 3PURA 1X79A 3RPUA 5L3BB 4I50E 2ZFGA 3AA6B 4FQEA 4PK4A 5KXJA 3AXJA 3UTKA 3POXA 4U7YA 3HKEE 3AE7A 4YT0A 3AECA 4UIGA 4E1TA 3B5MA 3K3QC 2CWOA 5LMUT 1LRZA 4UV8B 2F1CX 2LFUA 4XBFB 5AQKB 2K4TA 2LHFA 2SPCA 5JREA 3X1DA 2BKOA 3L8RA 2UU9T 5GTIO 4U31A 2L9QA 4UR9A 2Q9QD 5FNVE 2MNHA 5G38A 5AQQB 4KBMB 5FY0A 2IDOB 5L3EB 2QTKA 2UXCT 3P50A 3B13A 4TUYE 3U3IA 3VU7H 4O4XA 3WI4A 1G73A 3I1AA 3KV4A 3AAAA 2CLYB 3OPCA 4QXBB 4GCSA 2DLRA 2E2AA 1HCIA 2BKPA 2BS2A 4IGUA 4PJLA 3PQUA 4N59A 3NSGA 3T24A 1BR0A 4WW0A 3VZUX 1ZV4X 2A72A 2CCQA 3DZMA 5JDPA 3KV6A 4O49A 4EYYR 2BKNA 4GYRA 1X9BA 4CN4A 1PRNA 5JH7E 3C4XA 3KV9A 4IE7A 3LBXA 3CMLA 1GFQA 5FXZA 5L4EA 3FYXA 1GFPA 3ZMTB 2JPFA 3ZSTA 3ZPOA 4ILCA 3IHRA 2YPVA 2Q9QA 2K3WA 3HA4A 3ZLIA 2UUCT 3SRZA 3ZT5A 2CA5A 4IE6A 3QB5A 3SYSA 1ZHXA 2ODUA 4IREA 1BR2A 1Z0PA 1YQ3A 2LSKA 2XUEA 4C00A 5DJQC 5G26A 2H88A 5LHHB 2M6IA 1D1AA 3ANWB 3NKZA 2E5VA 3H3AA 3RBHA 2X9XA 5LG3A 3ZMUB 2F1TA 4YTNA 1KFYA 5AQNB 3UU8A 3NWIA 5G39A 2HN1A 4O4HE 2X9KA 4AQFA 1JNZA 3PUVF 2V6YB 2QGSA 2WWVA 1OWAA 3I0QA 4AQFC 3UU3A 4BUMX 2K48A 1IBLT 2CPTA 4DV2T 1J5WA 5JQGE 3Q5EA 3G7GA 3PTRB 5FP3A 2HN2A 4LMJA 4A56A 2N2LA 5AFUL 2E9XA 5AQSB 1XMQT 3B57A 2VVNA 3AEBA 3RF1A 5B5EO 3P4QA 4ZOLE 2XE1A 2YDSA 1P4TA 2KWHA 2L8KA 3EHZA 2Y8DA 4YJ3E 3ONJA 5B66O 3ANWA 4NIQA 3VE2A 1O3XA 4I55E 1HG2A 1NWMX 1YD8G 2I0MA 3GWHA 4RLBA 5IWAT 3SY7A 4MALA 4TWHA 3LK3B 1D0ZA 3NBXX 4JFBA 1UK5A 5AFUK 4TN7B 1QUUA 2R4LA 2PRNA 2LM2A 2LSYA 2XG6A 2WAUA 4YSXA 5HWXA 4QH5A 3MACA 3K19A 4FMSA 3C50A 3GMIA 5JDGA 3ZT7A 2FJDA 4O4UA 1BH3A 2MAWA 2P9BA 2XPKA 5DQWA 3RIUA 2R4OA 2W81C 4O4LE 3NZQA 5KDMC 2A3DA 3F31A 1KF6A 3RIUC 1ZHWA 2IMLA 3VZWX 1BR4A 4B3ST 3N5LA 3NVOA 5CA1E 2D5UA 4PFPA 3V5SA 4JYAT 4GK5E 5FXVA 2XTLA 2LE8A 5AQRB 1VCSA 2X27X 1YW0A 1R8IA 5BR8T 1EZ3A 4U9CA 1ZEEA 2CHOA 2WS3A 3RHWA 5AQJB 2PJQA 3HR0A 2YU1A 2KC0A 2R88A 4UVAB 3POQA 4TNWA 2XAHB 3ETVA 4RL9A 3GA8A 2BG9C 2J1DG 2FGQX 2WMOA 2VL8A 1SHZC 4LF7T 4PW8A 2WVPA 5HXRA 1HX1B 1WCRA 2VWAA 2VVSA 1BR1A 1M62A 2KXPB 1IBKT 3P7IA 5CJ5A 3BRZA 5LA6E 4KI0F 5L2LA 4FT6A 1T16A 5LHIB 3AE4A 4QH4A 4EEDA 2GE4A 4Z8XA 3V5UA 4ILAA 4LSHA 4B3TT 5FKYA 2XAQB 4FZMA 3LG7A 2WDQA 3ZEFB 5LG4A 4AYEC 4ANJA 3PJAA 4QQ1A 4NPPA 4X20E 4ERRA 2PFVA 3OKQA 4FZLA 3M65A 1G90A 5LGNB 5HAXA 3PUSA 5AQGB 2ODVA 4QXCB 3VR8A 1NEKA 3AAAB 2DNXA 4AKMA 3S4UA 3I9WA 5L47A 5L3FB 4AYID 3CVRA 4FI5A 2Z6EA 2OV9A 5KMGP 4J2CA 4O2BE 4DV3T 3BQKA 5CGMA 2CM0A 3WAKA 1XDOA 3RLFF 3TLWA 5EK3A 4HWDA 3NJTA 3LDQB 4ASKA 3A7MA 3SS1A 1XNRT 2KNDA 2XTQA 1IAPA 4U33A 4DR4T 4DR1T 2K9AA 4LSFA 3NRXA 3FXEB 3RH3A 4CN1A 4P0BA 5JR9B 2V7KA 2BVLA 2Q9QB 4C4VA 3AA0A 3RYCE 4MHCA 3DP7A 2XM1A 4C90A 3IA3A 3N9QA 3AA6A 3AE8A 2XQ9A 2M07A 3G06A 2XTRA 2IHR1 4KR8A 2R89A 3AEDA 2WU5A 4IDOA 2RA1A 3ONLC 4AI6A 5TAOA 1XWMA 3RGLA 3FXDB 1W09A 4EV6A 2NOXA 1MMDA 5AQUB 1U4QA 4A98A 3A8YC 4COFA 5JRCA 2V7IA 4KRAA 2LKHA 5AQOB 3ZN1B 3AA1A 1KNPA 3RKOA 1GFNA 2CE7A 4KHPT 3LJCA 5FXXA 1GFOA 2M6BA 1US7B 4PNIA 3P8CD 2DCFA 3E0ZA 3N2KE 3AE5A 4EEBA 4EZHA 3O0EA 3TZGA 2LOPA 3NZPA 5EZYE 3ZJ1A 3UFGA 3J7Yq 1HNZT 4EB6E 4IL4A 4EZ4A 5J2UE 2W4XA 4YXDA 1CHUA 2FJAA 3C4WA 3ZJ2A 3ETUA 1U5PA 2VASA 2E9XC 2Y0HA 4QKNA 4JUYA 3AB3B 2LHRA 4LMLA 4ZZCA 4GK0E 2H7VC 4PR7A 2X9HA 1B7TA 4H9PC 5FMNA 1OEDE 4KX6A 3A2SX 3E22E 3JADA 2XQ6A 5ABHA 2YKSA 2I59A 2JQ9A 2C5JA 2IC6A 2JQHA 3A5XA 1MM4A 2KMFA 1NAFA 4HFBA 5FL0A 1E1HB 3FHNA 4JI8T 1VOMA 4ZS3A 4UVCB 4PUXA 2BG9E 3AA7A 4U2ZA 2WBLA 1YKHB 2WY2A 7PRNA 2W0GA 2W66A 3HKDE 1ZKEA 2LHNA 3C51A 5HXSA 1V9DA 4AKRB 3PRNA 5JR9A 3PUWF 1ORMA 4IT4A 4XNLA 1HF8A 2XE3A 4AFKA 3CIRA 3JCFA 2C0SA 4DV6T 3POUA 1W9RA 1QJPA 2VK9A 3T8OA 4HFDA 3AXJB 3AAIA 4WZXA 1HNWT 5LJMA 1WLXA 4L5GA 4H9NC 3O1IA 2VL0A 3FZHB 4AKLA 3TLSA 3CQGB 5ETWA 3N9PA 2XAJB 3PUGA 3UQ7A 4UV9B 3IBPA 4AKIA 2LOSA 4ILBA 3AE6A 1WFDA 3PUZF 4TX5A 3PF1A 1UX4A 1MM5A 3K1SA 3LK42 2XQ3A 1WYCA 5H6RB 4YLHA 3P4SA 4HFEA 2XQ7A 1IZNB 2BZBA 3EDVA 3PUAA 3UUXB 3OYXA 5CFBA 5IYUA 5JRCB 1UUSA 4I43B 4AIUA 5M4YA 2XQ5A 3MZKB 4H9SE 2XJ7A 2WCAA 2ODJA 3GP6A 1J1JA 4AXPA 2J47A 3SZDA 1AJ3A 2N9DA 4U7IA 3J9X1 2FUPA 4YFSA 5AQVB 3TLUA 3UQ4A 5EK4A 2CBIA 2LSIA 2X0LB 2NW7A 2F1VA 5LBMA 1N33T 3N9NA 4X66T 5F8PA 2OA5A 4D5UA 2NTYA 4PJJA 4AKHA 2VB6A 3PU3A 2X0HA 3PUQA 2DHRA 4ZS2A 2JMHA 4DV1T 5G3AA 4B6XA 3KBUA 3P4RA 1CUNA 4IL6O 3F2EA 3V8UA 2X66A 2UUAT 2UUBT 4DBQA 1MMGA 2LT3A 1BT9A 2QA7A 4OX9T 3UAQA 2PTFA 4X1YE 5HEOA 2JQQA 4BJNA 5AQFB 3VY9X 2AXDS 3ZMVB 4UB6O 2CBJA 3AVRA 4KP3C 3DWOX 2K24A 3AA0B 2ES0A 2CLYC 4D65A 4DMVA 2DL1A 3K3OA 4C4VB 5JVDE 1MPFA 1I94T 2LEHA 3ZCIA 5H2FO 1OEDB 2WJQA 5L3CB 2L3LA 4CI2B 3BS0A 3SY9A 3FZFB 3VR9A 2IWWA 2Y48B 3C98B 2MBGA 2JMKA 4FOZA 4NUVA 1LVKA 1BXWA 3RC8A 4GYSA 5HYAA 5LMNT 4JEUB 3EAMA 3EI0A 3N2GE 2N2MA 4JLEA 5LJNA 4IE4A 4O3YA 3MJXA 2A2FX 4E7ZA 4XNKA 1DU2A 1UX5A 4H63V 3QB5K 2BG9A 2JMMA 4P0AA 1M7KA 1MIVA 5E0OA 2MHLA 4O2AE 2MPKA 4KMCA 3AEAA 3AEFA 1ZHCA 2LJLA 3UULA 1FMVA 1MMAA 3ZN0B 4CXXA 1GFMA 4AYDC 1JNRA 4K3CA 2WB5A 5AQTB 4YHJA 4F8HA 2WDRA 1W0BA 2ZLYA 4HN9A 3OJAA 4HWFA 4GCQA 3KVDD 3AAEA 4JI1T 3R84B 4ZI3C 4UF0A 5AQLB 2JQKA 2IAKA 2ACZA 4K0UA 2JIWA 3U78A 4YY3T 5J1GA 4HTEA 3JC6D 4EOZB 2WJRA 5GONE 1OPFA 5KAFO 3AEEA 3ZMSB 2VQET 3PU8A 4FUVA 3RYHE 4YSZA 1YQ4A 2ZM2A 4NUUA 4DV5T 5LGTB 2NW9A 4DR7T 2KINB 1ZP0A 4O4IE 5PRNA 5C3JA 2V1DB 3NRYA 5KAIO 3ESLA 4DUYT 2E9XB 2Y0LA 1WYBA 2HH7A 4CN6A 2QVAA 4FRTA 1Y01A 5HCMA 3AA1B 2V7MA 1H7CA 4TV9E 2CEAA 2XHEB 4EXTA 1I6ZA 5LNKA 2YNKA 1N34T 5JR9C 2KT9A 4OFZA 1D0XA 5JDFA 3MKDA 4YTPA 2Q9QC 4EYUA 4TWDA 4QXHB 5TISO 4F6RC 4IDNA 4FJOA 3WI5A 2C5KT 2ZMAA 5DL7A 2G0UA 3MK7C 4FESA 2NR4A 4LF5T 3TKLB 2E8IA 5FY7A 4HGAA 5HEGA 5FY1A 4L0RA 3PGRA 3HOEA 4MBQA 3DA3A 5LBQB 4JI7T 3VRAA 2A9UA 2QRXA 2J1NA 1MMNA 3BQLA 5KX5E 2HPLA 5L3GB 2LSGA 1SE7A 5ABFB 4DO0A 1OXZA 4JEHB 2V7JA 4I0UA 1HXTA 2AXTO 3PGUA 1HX8A 3IF8B 1FEWA 3JAFA 2WQYA 4O3ZA 1ZHTA 2XQ4A 2LLYA 2XQAA 2XMXA 2D2SA 3SFEA 3RIFA 2Y0KA 3O1JA 2VURA 3VKHA 1G8XA 1OSMA 5EE2A 5ABGA 4H9QC 2NP9A 2N2NA 3UU5A 8PRNA 1T7SA 3ABVA 2J62A 1YXRA 2VKDA 4JI2T 1IJ6A 4JV5T 5FVKA 4DR6T 2IIUA 2VQFT 3HW9A 3VKGA 3P4PA 2VKOA 2FBWA 1YS5A 2RPAA 2XQYA 2EHOD 5HEJA 2ZM6T 2V6YA 1GQEA 3MA9A 4AZLA 3FZMB 4PK5A 4A5XA 3K8PC 2FJBA 4ZI3D 4U3CA 3SYBA 5JDLA 3AAEB 2VKHA 4EAHA 5AQIB 2R4PA 4FSPA 4QX7B 2WWUA 4L9IA 1KNRA 4KHZF 2R8AA 2J4GA 4XZCA 1N36T 3PUYF 3CX6B 5JDMA 4CI3B 4G2AA 1UCUA 2EHOB 2JRKA 2HPJA 1E7PA 2YDQA 4TZ4C 3RYFE 3CPZA 2WZHA 4EGWA 2XQ8A 2ZM0A 1LKXA 4RLCA 2M67A 4UXNB 3O9XA 4IHJE 5JDHA 3JCUO 4NXNT 4O8SA 2XSBA 1D1CA 4DUZT 3KVBA 1XMOT 2V8SV 4AYNA 2V5CA 1E2AA 3Q9DA 3N9LA 3KBTA 3O1HA 4MLKA 3EUHA 2UXDT 2WSSV 3AVSA 1YKEB 1D0YA 4ZHQE 3HWBA 5H6QB 2K5BB 4GHBA 2C5IT 3LFMA 3RRCA 4LSIA 4G63A 5E79O 4JI6T 1UGOA 3Q5XA 5JTGA 1T98A 3PORA 3Q5WA 2BBJA 1MNEA 3Q2MA 3VHLA 5DABA 2Y7SA 4O3XB 1HXUA 2XZEA 4ZI7E 1WR6A 4HFHA 4C69X 3FBZA 1XZYA 4B3RT 2X51A 3UFEA 3QRCA 2YOEA 2AE9A 5BMVE 3EABA 1D1BA 2KWIB 1FIOA 3AE1A 4JI3T 5ABEA 4WBNE 4ZEYA 4LFBT 2UXBT 4PAGA 4RJWA 4EIWA 4QH1A 4B3MT 2EHOC 3ZMZB 5L4HA 4BAYB 3PDYA 3WU2O 1Z8UA 4UELA 1QJ9A 2KXPA 3OTOT 4ZI2D 2YDRA 1THQA 2EHOA 3P4WA 2CRBA 3MXZA 2YINA 3O4XE 2X67A 4LF6T 2RP4A 3AE3A 3SZVA 3TLTA 4UF0B 4YSYA 2ACXA 2YN6A 3JAEA 3UU2A 3CK6A 1N32T 4IDQA 4DR2T 2X0YA 3HKBE 4MFRA 4TV8E 3QRAA 2CHNA 4KUMB 4N75A 3AE9A 2CXFA 3OVUA 3DTOA 3FB2A 1L0VA 4H9OC 4AQGA 3VRBA 5CA0E 5L3DB 3L39A 4F4BA 4PK6A 4D64A 3WAJA 1J5ET 3L09A 4ISSA 2V5DA 3R6NA 3PE0A 4DVDA 4K0KT 4HFIA 3CX8B 4OHFA 3ZCJA 1IBMT 4OYKA 3PQSA 2WMNA 4A97A 3RQUA 4HKAA 3VE1A 4CXYA 4LFAT 3ZSSA 3T0SA 2FGRA 4YTMA 3DA4A 4G75A 4B61A 5HCJA 2JQYA 4CXWA 5DL5A 4M1PA 3TLVA 2R6GF 4E7SA 3WI3A 3F57A 5IHYA 4DV0T 2PORA 1QJ8A 3EMNX 4PJMA 5LYJE 2LRLA 1S94A 4AISA 2ZLDA 5FL1A 4QX8B 1HS7A 2DWGA 4HFVA 4U2YA 3I9YA 5LHGB 3LSVA 5AQHB 2BS4A 2BG9B 4WBOA 3H37A 5HEHA 2F4VT 3EVYA 5C2TA 3H3MA 1UURA 4IE5A 5HWYA 5D5DA 2X9YA 3VY8X 5FYMA 2XASB 3OBVE 2E9XD 2J4UP 1FMWA 5FXWA 3RQWA 2H7OA 3UU6A 5LGUB 3QUJA 4JI4T 1IJ5A 4RJXA 4Z3TA 2WZIA 1T1LA 3UU4A 2ERVA 3RIAA 3UUMA 4WYVA 3UT5E 4O4JE 3CQXC 4ZI2C 4UB8O 1Q9GA 4N74A 3N9OA 4KR4A 4PJNA 2W67A 3ONXA 3ZYMA 1E54A 4AQYT 3C4ZA 6PRNA 4GKKT 4Z91A 1MIYA 5HXHA 3JC6C 1NENA 4DR5T 3AA7B 1MIWA 1ZOYA 2R4NA 4H63H 1OEDC 2IC9A 4GCPA 4JCHA 2LKGA 4JBWF 3T1YT 3ZKRA 3SWHA 4IL9A 4HWHA 1QLBA 2CXLA 4N58A 1Y64B 2VKJA 1LVFA 2W2UA 4DR3T 3QNUA 3M3ZB 4V1Av 1MNDA 1ZHYA 4LSEA 2KZ7B 3LK41 4QHOA 2W80C 2IUBA 5DL6A 3ZC1A 5AQMB 4JI5T 2HHHT 2LSJA 2MOZA 3FBLA 2W63A 2IW5B 5T5FA 2BS3A 2WU2A 3A0BO 2KSRA 4OYJA 2XY8B 5C8YE 5FVNA 4LF9T 4TWFA 4X62T 4DMWA 1W0AA 4CQIA 2UXXB 4K3BA 2XSAA 2OLTA 4AKGA 2IWVA 4OK0A 2D0UA 4I4TE 2Y2XA 4GF4A 1S5LO 2QYWA 4C91A 2W00A 4DBRA 2I6HA 2YEVC 1T72A 5CB4E 4ISTA 4FSOA 2WDVA 3PV0F 2PBIA 2MYSA 2V7LA 5JDQA 3QC9A 3RYIE 4HWIB 3Q5DA 2Y6XA 5JDNA 2BDEA 1KNZA 3HOLA 1WR0A 4PJ0O 3T20A 1PHOA 4X64T 4DIDB 2WP9A 3A0HO 3BK9A 3PJAJ 3FZKB 1H6S1 3KVAA 4ZXLA 1Q9FA 4FRXA 2OMFA 2DWKA 4AUIA 4DV4T 5EK2A 4UEMA 3E08A 3PGSA 3LK2B 1KK7A 2NW8A 4GIWA 3IEEA 5ADXK 2W62A 3UPGA 2XAGB 3FZLB 3N9MA 5FVLA 1XDPA 5ADXL 4BJMA 4YJ2E 2N1GA 4CTDA 3GN5B 2D0TA 5DQVA 2NTXA 2V26A 5J0ZA 3N2OA 4QWNB 2PG8A 1OEDA 4LFCT 3CKDA 4X5TA 3ZT6A 1IZNA 4P1NA 4X65T 5LOVE 3KZIO 3CWZB 4X1IE 3KINB 4LMKA 4IDZA 4X1KE 2XAFB 5LP6E 4ILUA 2NWBA 2M06A 3OYZA 4XAXB 3CQCB 4IDPA 2B76A 3UUBA 4JI0T 4U72A 3KFWX 3RI5A 4GKJT 3L3PA 4NXMT 1WRDA 5LB7B 3RX6A 5J2TE 4DV7T 2MTQA 1XNQT 5HXEA 1HXXA 3T1HT 4LF4T 3BQIA 3HKCE 4AYMC 4PFOA 4LF8T 2K0LA 3GN5A 5HXCA 3HI2A 4HWCA 4ZZBA 1HR0T 1HTJF 1SUMB 5ABFA 1VRBA 4HE8A 2CMRA 1FJGT 3LK2A 2JJ9A 4U74A 3C5OA 3ZC0A 4YHHT 4ADZA 3PUXF 1T8BA 4H9RC 4Q25A 2KLQA 5A1LA 3SFDA 1VCTA 4Z90A 4G76A 1HG5A 5DL8A 2X68A 1S35A 3HL6A 1SA0E 5GTHO 3QOFA 2KZ7A 4TNVA 2YK0A 4UVBB 4AKRA 2XE5A 2LM9A 5LXTE 4N78D 2WM9A 4BA9A 4P09A 4CZZB 3EDUA 5HEUA 4IIJE 2BBHA 4FZNA 3SOLA 2LRKA 5F5WA 2KDYA 3AEGA 2X9WA
chains in the Genus database with same CATH topology
3ZCIA 3FB2A 2XAQB 4FZMA 5L3CB 2GK9A 3LG7A 2L3LA 2CWYA 4CI2B 3K3NA 2O4VA 3LK3A 4RLBA 3SY9A 4CI1B 3ZEFB 2Y48B 3C98B 3RRWA 2MBGA 5LG4A 4H9OC 4AYEC 4AQGA 5CA0E 5L3DB 3UUNA 4ANJA 4F4BA 2JMKA 4PK6A 4FOZA 4NUVA 3ZYKA 1LVKA 4QQ1A 3WAJA 4D64A 3L09A 4ISSA 3R6NA 4X20E 3PE0A 4DVDA 4E1SA 1BXWA 3DJBA 3RC8A 4ERRA 1HFAA 3LBXB 2PFVA 4GYSA 3CX8B 3OKQA 4OHFA 3ZCJA 4OYKA 3M65A 4JEUB 5HYAA 4FZLA 5LGNB 1G90A 3PQSA 2WMNA 3N2GE 2N2MA 5HAXA 2H3RA 3PUSA 4JLEA 4IE4A 5LJNA 1ZHZA 4O3YA 3MJXA 2A2FX 4E7ZA 2ODVA 5GV0A 4XNKA 2W61A 4WNKA 4HKAA 3VE1A 4QXCB 2DI4A 4CXYA 3D0TA 1UX5A 3T0SA 2FGRA 4H63V 3DA4A 4G75A 4B61A 3QK6A 5DL5A 2YU2A 3AAAB 2DNXA 4M1PA 4CXWA 5LCYA 4AKMA 3S4UA 3KDSE 4E7SA 3I9WA 2JMMA 2B1EA 5L3FB 4AYID 3WI3A 4P0AA 2XE2A 3F57A 3CVRA 1MIVA 4FI5A 2Z6EA 5IHYA 4DNDA 3JTYA 2PORA 5E0OA 5KMGP 1QJ8A 3EMNX 4J2CA 4O2BE 4PJMA 2MHLA 1QSDA 3RC3A 4O2AE 3BQKA 2CXDA 4KMCA 4IE0A 5LYJE 4HEAA 1ZHCA 2LJLA 4O3WA 4GOUA 3UULA 2CM0A 1S94A 2ZLDA 1FMVA 4QX8B 1HS7A 3ZYLA 3WAKA 2DWGA 4HFVA 3I9YA 5EK3A 2BVMA 1MMAA 2ZM8A 3ZN0B 4CXXA 1GFMA 4AYDC 5LHGB 2UXNB 4ASKA 5F3JA 3SS1A 4YHJA 4WBOA 2KNDA 3W15B 2ZLYA 3H37A 2XTQA 1IAPA 4HN9A 3OJAA 3I0OA 4GCQA 3VZTX 5IYZE 2K9AA 3KVDD 3AAEA 3R84B 3C64A 3EVYA 4ZI3C 3KV5A 4LSFA 3CX7B 3NRXA 3FXEB 3PURA 4UF0A 4P0BA 3RH3A 2IAKA 1X79A 5JR9B 5HWYA 4IE5A 5D5DA 4K0UA 2X9YA 3U78A 5FYMA 2XASB 3VY8X 3RPUA 5J1GA 5L3BB 3OBVE 2V7KA 2BVLA 4HTEA 3JC6D 4I50E 2E9XD 2Q9QB 4EOZB 2ZFGA 5GONE 1OPFA 3AA6B 4PK4A 2J4UP 1FMWA 5FXWA 3UTKA 3ZMSB 3AA0A 3POXA 3HKEE 3PU8A 2H7OA 4FUVA 4UIGA 4E1TA 3RYCE 3RYHE 4MHCA 3DP7A 5LGUB 3QUJA 4C90A 1IJ5A 2ZM2A 4NUUA 4RJXA 3N9QA 4Z3TA 3K3QC 3AA6A 2CWOA 1LRZA 4UV8B 5LGTB 2LFUA 4XBFB 5DL8A 2NW9A 2K4TA 2KINB 2LHFA 4O4IE 2ERVA 5PRNA 2M07A 3UUMA 3UT5E 2SPCA 4O4JE 3CQXC 4ZI2C 2XTRA 5JREA 4KR8A 1Q9GA 3N9OA 2V1DB 3NRYA 4KR4A 3ESLA 4PJNA 3ONXA 2RA1A 4AI6A 3ZYMA 5TAOA 2L9QA 3FXDB 1E54A 2E9XB 2Q9QD 5FNVE 2MNHA 2Y0LA 1WYBA 2HH7A 2NOXA 1MMDA 3C4ZA 6PRNA 1U4QA 1MIYA 4KBMB 4FRTA 5HXHA 5JRCA 3JC6C 2V7IA 5FY0A 4KRAA 3AA1B 2V7MA 1H7CA 3AA7B 5L3EB 1MIWA 4TV9E 2CEAA 2QTKA 4H63H 2IC9A 3ZN1B 3B13A 2XHEB 3AA1A 4TUYE 4EXTA 4GCPA 4JCHA 3U3IA 3RKOA 5LNKA 1GFNA 3VU7H 2YNKA 4O4XA 5JR9C 3SWHA 2CE7A 2KT9A 2CXLA 3LJCA 4OFZA 3WI4A 4N58A 1D0XA 1G73A 5JDFA 3MKDA 5FXXA 1GFOA 2Q9QC 3I1AA 3KV4A 4EYUA 1Y64B 3AAAA 2VKJA 1LVFA 1US7B 2CLYB 3P8CD 4PNIA 4QXBB 2DCFA 4QXHB 4GCSA 4F6RC 3E0ZA 2DLRA 3N2KE 4EZHA 1HCIA 4FJOA 4V1Av 4IGUA 3O0EA 3WI5A 4PJLA 1MNDA 3TZGA 2LOPA 1ZHYA 4LSEA 3PQUA 2C5KT 2ZMAA 2KZ7B 5DL7A 2G0UA 4N59A 3LK41 3MK7C 3NZPA 3NSGA 5EZYE 4FESA 3ZJ1A 3T24A 4QHOA 3TKLB 2E8IA 5FY7A 2W80C 3J7Yq 5DL6A 3ZC1A 4EB6E 1BR0A 4WW0A 4EZ4A 2LSJA 4HGAA 3VZUX 5FY1A 5J2UE 2MOZA 3FBLA 1ZV4X 4L0RA 2A72A 2CCQA 3HOEA 2W63A 2IW5B 5JDPA 3KV6A 5T5FA 4MBQA 3DA3A 5LBQB 4O49A 4EYYR 3C4WA 2J1NA 1MMNA 4GYRA 4OYJA 3ZJ2A 3BQLA 1PRNA 3ETUA 5JH7E 3C4XA 5C8YE 5KX5E 2HPLA 3KV9A 1U5PA 4IE7A 5FVNA 3LBXA 3CMLA 2VASA 2E9XC 5FXZA 5L3GB 4DMWA 1GFQA 3FYXA 2Y0HA 1GFPA 4QKNA 3ZMTB 2JPFA 4JUYA 2LSGA 3AB3B 3ZPOA 4CQIA 2LHRA 2UXXB 3IHRA 4GK0E 4DO0A 4AKGA 1OXZA 4JEHB 2V7JA 1HXTA 2H7VC 1HX8A 2YPVA 2X9HA 4OK0A 2D0UA 4I4TE 1B7TA 3IF8B 4H9PC 2Y2XA 1FEWA 2Q9QA 5FMNA 3A2SX 3E22E 3HA4A 3ZLIA 4GF4A 4O3ZA 4C91A 2W00A 1ZHTA 3SRZA 2I59A 4DBRA 2CA5A 2YEVC 4IE6A 2XMXA 3SYSA 2D2SA 2C5JA 5CB4E 2IC6A 4ISTA 3A5XA 4FSOA 1ZHXA 2ODUA 1MM4A 2Y0KA 2KMFA 1BR2A 1Z0PA 2LSKA 2MYSA 1NAFA 2PBIA 2V7LA 5JDQA 2XUEA 3O1JA 5DJQC 3QC9A 3VKHA 1G8XA 3RYIE 5G26A 5LHHB 1E1HB 1OSMA 5EE2A 3FHNA 1D1AA 4H9QC 2NP9A 3ANWB 2N2NA 8PRNA 3H3AA 3RBHA 2VKDA 1IJ6A 2Y6XA 5JDNA 2X9XA 2BDEA 1VOMA 4ZS3A 3ZMUB 4UVCB 1KNZA 3HOLA 4PUXA 3T20A 1PHOA 2F1TA 3HW9A 3AA7A 3VKGA 2VKOA 1YS5A 2WBLA 2XQYA 1YKHB 2EHOD 3BK9A 7PRNA 4O4HE 2W0GA 4AQFA 1H6S1 3KVAA 3MA9A 1Q9FA 4FRXA 4AZLA 2QGSA 3HKDE 1ZKEA 1OWAA 2OMFA 2DWKA 2LHNA 4AUIA 3I0QA 3C51A 5HXSA 4PK5A 1V9DA 3K8PC 4AKRB 4AQFC 4ZI3D 5EK2A 3PRNA 4BUMX 4UEMA 2K48A 3E08A 5JR9A 3SYBA 3LK2B 1KK7A 1ORMA 2NW8A 5JDLA 5JQGE 4XNLA 3AAEB 2VKHA 4GIWA 1HF8A 4EAHA 4FSPA 3IEEA 2XE3A 4QX7B 2W62A 3PTRB 5FP3A 3G7GA 4AFKA 2XAGB 5ADXK 3UPGA 3N9MA 5ADXL 2WWUA 2C0SA 4BJMA 4L9IA 3POUA 4YJ2E 2N1GA 4A56A 2N2LA 5AFUL 3GN5B 2D0TA 2E9XA 4XZCA 3B57A 1QJPA 2VK9A 3T8OA 5DQVA 2NTXA 2V26A 3AAIA 3N2OA 4QWNB 2PG8A 3CX6B 5JDMA 4CI3B 3CKDA 4G2AA 5LJMA 1WLXA 4L5GA 4H9NC 3O1IA 4ZOLE 2XE1A 1IZNA 1UCUA 2EHOB 2JRKA 1P4TA 4AKLA 2KWHA 2L8KA 2HPJA 2Y8DA 4YJ3E 4TZ4C 3RYFE 3CPZA 3CQGB 5ETWA 3N9PA 3ANWA 2XAJB 3VE2A 1O3XA 2ZM0A 4I55E 1HG2A 3PUGA 1LKXA 3CWZB 5LOVE 4RLCA 4X1IE 4UV9B 2M67A 3IBPA 3KINB 4UXNB 3O9XA 4AKIA 4IHJE 1NWMX 2LOSA 5JDHA 4IDZA 4X1KE 1YD8G 3GWHA 4TX5A 2XAFB 4O8SA 1UX4A 5LP6E 3LK42 2NWBA 4ILUA 4MALA 1D1CA 3LK3B 1MM5A 1D0ZA 1WYCA 2M06A 3NBXX 3OYZA 4XAXB 3KVBA 5H6RB 4JFBA 4YLHA 4AYNA 3CQCB 5AFUK 4TN7B 3Q9DA 3N9LA 1IZNB 1QUUA 3KBTA 2BZBA 3EDVA 3PUAA 3O1HA 3UUXB 4U72A 3OYXA 2PRNA 3KFWX 4MLKA 2LSYA 3EUHA 5IYUA 2XG6A 5JRCB 3L3PA 4I43B 2WSSV 2WAUA 3AVSA 1YKEB 1WRDA 5M4YA 3RX6A 1D0YA 4ZHQE 5HWXA 5J2TE 3MZKB 4H9SE 3HWBA 3MACA 2MTQA 2K5BB 5H6QB 2ODJA 4GHBA 3K19A 2C5IT 3LFMA 3RRCA 5HXEA 4LSIA 4FMSA 1HXXA 3GP6A 3C50A 4G63A 3GMIA 5JDGA 4AXPA 3SZDA 1AJ3A 2N9DA 3Q5XA 3BQIA 1BH3A 4O4UA 2P9BA 5DQWA 3J9X1 3HKCE 4AYMC 2W81C 4O4LE 4PFOA 3NZQA 4YFSA 1T98A 3PORA 5KDMC 2A3DA 3F31A 3Q5WA 1MNEA 5EK4A 3Q2MA 3VHLA 5DABA 2K0LA 3GN5A 2LSIA 2X0LB 2NW7A 2F1VA 5LBMA 2Y7SA 4O3XB 3N9NA 5HXCA 1ZHWA 1HXUA 5F8PA 2OA5A 3VZWX 4D5UA 3HI2A 2NTYA 1BR4A 3N5LA 1HTJF 4ZI7E 5CA1E 2D5UA 4PJJA 4PFPA 4AKHA 2VB6A 1WR6A 3PU3A 3V5SA 4GK5E 5FXVA 3PUQA 1VRBA 4HE8A 2CMRA 2XTLA 4C69X 3FBZA 2DHRA 2LE8A 2X51A 4ZS2A 2JMHA 3UFEA 4B6XA 2X27X 3LK2A 3QRCA 1YW0A 3KBUA 1CUNA 2JJ9A 4U74A 3C5OA 5BMVE 1EZ3A 3F2EA 3V8UA 2X66A 4U9CA 1D1BA 2KWIB 1ZEEA 3ZC0A 1FIOA 4DBQA 2PJQA 4WBNE 1MMGA 2LT3A 4ADZA 3HR0A 2YU1A 1BT9A 2KC0A 3SY7A 2QA7A 4PAGA 4RJWA 4EIWA 3POQA 4UVAB 4H9RC 2KLQA 2EHOC 3ZMZB 2XAHB 4X1YE 4BAYB 3UAQA 3ETVA 3PDYA 5A1LA 4RL9A 3GA8A 4UELA 1QJ9A 2KXPA 2J1DG 4ZI2D 2FGQX 2WMOA 4G76A 1HG5A 2JQQA 4BJNA 1THQA 2EHOA 1S35A 2VL8A 1SA0E 1SHZC 2X68A 3HL6A 4PW8A 3MXZA 2YINA 2KZ7A 3VY9X 3O4XE 2YK0A 5HXRA 2X67A 4UVBB 4AKRA 2XE5A 2VWAA 2RP4A 2LM9A 3ZMVB 1BR1A 5LXTE 3SZVA 2KXPB 3AVRA 4UF0B 4KP3C 4N78D 2WM9A 4BA9A 3P7IA 2ACXA 4P09A 5LA6E 4CZZB 3EDUA 2K24A 3AA0B 5L2LA 2ES0A 4IIJE 2CLYC 3UU2A 4D65A 4FT6A 5LHIB 4DMVA 4FZNA 3HKBE 3K3OA 3SOLA 4MFRA 4TV8E 2GE4A 4Z8XA 5JVDE 3QRAA 4KUMB 1MPFA 3V5UA 2CXFA 4LSHA 2LEHA 2KDYA 2X9WA 3DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAE B;  3LK4 1;  3AA6 B;  5ADX K;  2KXP B;  3LK3 A;  3AA0 A;  5ADX L;  3AAA B;  3AA0 B;  5AFU L;  3AAA A;  3AAE A;  3LK4 2;  3LK3 B;  3AA6 A;  2KXP A;  4AKR B;  3LK2 A;  3AA1 B;  5AFU K;  3AA7 B;  1IZN B;  3LK2 B;  1IZN A;  2KZ7 A;  2KZ7 B;  3AA7 A;  3AA1 A;  4AKR A; 
#chains in the Genus database with same CATH topology
 1KEY A;  2GK9 A;  2CWY A;  3K3N A;  2O4V A;  3LK3 A;  4CI1 B;  2D9D A;  3AE2 A;  3RRW A;  3DWN A;  3UUN A;  3ZYK A;  2V6X A;  1HNX T;  4E1S A;  2XM2 A;  3DJB A;  1HFA A;  3LBX B;  2H3R A;  1ZHZ A;  5GV0 A;  2W61 A;  4WNK A;  2DI4 A;  3D0T A;  3QK6 A;  2YU2 A;  5LCY A;  3KDS E;  2B1E A;  2XE2 A;  2H89 A;  4DND A;  3JTY A;  2E5L T;  1QSD A;  3RC3 A;  2CXD A;  4IE0 A;  4HEA A;  4O3W A;  4GOU A;  5IUX A;  3ZYL A;  4HFC A;  2BVM A;  2ZM8 A;  5AQP B;  2UXN B;  5F3J A;  3RKG A;  3W15 B;  2FJE A;  3I0O A;  3VZT X;  5IYZ E;  3BRY A;  3C64 A;  3KV5 A;  3CX7 B;  3PUR A;  1X79 A;  3RPU A;  5L3B B;  4I50 E;  2ZFG A;  3AA6 B;  4FQE A;  4PK4 A;  5KXJ A;  3AXJ A;  3UTK A;  3POX A;  4U7Y A;  3HKE E;  3AE7 A;  4YT0 A;  3AEC A;  4UIG A;  4E1T A;  3B5M A;  3K3Q C;  2CWO A;  5LMU T;  1LRZ A;  4UV8 B;  2F1C X;  2LFU A;  4XBF B;  5AQK B;  2K4T A;  2LHF A;  2SPC A;  5JRE A;  3X1D A;  2BKO A;  3L8R A;  2UU9 T;  5GTI O;  4U31 A;  2L9Q A;  4UR9 A;  2Q9Q D;  5FNV E;  2MNH A;  5G38 A;  5AQQ B;  4KBM B;  5FY0 A;  2IDO B;  5L3E B;  2QTK A;  2UXC T;  3P50 A;  3B13 A;  4TUY E;  3U3I A;  3VU7 H;  4O4X A;  3WI4 A;  1G73 A;  3I1A A;  3KV4 A;  3AAA A;  2CLY B;  3OPC A;  4QXB B;  4GCS A;  2DLR A;  2E2A A;  1HCI A;  2BKP A;  2BS2 A;  4IGU A;  4PJL A;  3PQU A;  4N59 A;  3NSG A;  3T24 A;  1BR0 A;  4WW0 A;  3VZU X;  1ZV4 X;  2A72 A;  2CCQ A;  3DZM A;  5JDP A;  3KV6 A;  4O49 A;  4EYY R;  2BKN A;  4GYR A;  1X9B A;  4CN4 A;  1PRN A;  5JH7 E;  3C4X A;  3KV9 A;  4IE7 A;  3LBX A;  3CML A;  1GFQ A;  5FXZ A;  5L4E A;  3FYX A;  1GFP A;  3ZMT B;  2JPF A;  3ZST A;  3ZPO A;  4ILC A;  3IHR A;  2YPV A;  2Q9Q A;  2K3W A;  3HA4 A;  3ZLI A;  2UUC T;  3SRZ A;  3ZT5 A;  2CA5 A;  4IE6 A;  3QB5 A;  3SYS A;  1ZHX A;  2ODU A;  4IRE A;  1BR2 A;  1Z0P A;  1YQ3 A;  2LSK A;  2XUE A;  4C00 A;  5DJQ C;  5G26 A;  2H88 A;  5LHH B;  2M6I A;  1D1A A;  3ANW B;  3NKZ A;  2E5V A;  3H3A A;  3RBH A;  2X9X A;  5LG3 A;  3ZMU B;  2F1T A;  4YTN A;  1KFY A;  5AQN B;  3UU8 A;  3NWI A;  5G39 A;  2HN1 A;  4O4H E;  2X9K A;  4AQF A;  1JNZ A;  3PUV F;  2V6Y B;  2QGS A;  2WWV A;  1OWA A;  3I0Q A;  4AQF C;  3UU3 A;  4BUM X;  2K48 A;  1IBL T;  2CPT A;  4DV2 T;  1J5W A;  5JQG E;  3Q5E A;  3G7G A;  3PTR B;  5FP3 A;  2HN2 A;  4LMJ A;  4A56 A;  2N2L A;  5AFU L;  2E9X A;  5AQS B;  1XMQ T;  3B57 A;  2VVN A;  3AEB A;  3RF1 A;  5B5E O;  3P4Q A;  4ZOL E;  2XE1 A;  2YDS A;  1P4T A;  2KWH A;  2L8K A;  3EHZ A;  2Y8D A;  4YJ3 E;  3ONJ A;  5B66 O;  3ANW A;  4NIQ A;  3VE2 A;  1O3X A;  4I55 E;  1HG2 A;  1NWM X;  1YD8 G;  2I0M A;  3GWH A;  4RLB A;  5IWA T;  3SY7 A;  4MAL A;  4TWH A;  3LK3 B;  1D0Z A;  3NBX X;  4JFB A;  1UK5 A;  5AFU K;  4TN7 B;  1QUU A;  2R4L A;  2PRN A;  2LM2 A;  2LSY A;  2XG6 A;  2WAU A;  4YSX A;  5HWX A;  4QH5 A;  3MAC A;  3K19 A;  4FMS A;  3C50 A;  3GMI A;  5JDG A;  3ZT7 A;  2FJD A;  4O4U A;  1BH3 A;  2MAW A;  2P9B A;  2XPK A;  5DQW A;  3RIU A;  2R4O A;  2W81 C;  4O4L E;  3NZQ A;  5KDM C;  2A3D A;  3F31 A;  1KF6 A;  3RIU C;  1ZHW A;  2IML A;  3VZW X;  1BR4 A;  4B3S T;  3N5L A;  3NVO A;  5CA1 E;  2D5U A;  4PFP A;  3V5S A;  4JYA T;  4GK5 E;  5FXV A;  2XTL A;  2LE8 A;  5AQR B;  1VCS A;  2X27 X;  1YW0 A;  1R8I A;  5BR8 T;  1EZ3 A;  4U9C A;  1ZEE A;  2CHO A;  2WS3 A;  3RHW A;  5AQJ B;  2PJQ A;  3HR0 A;  2YU1 A;  2KC0 A;  2R88 A;  4UVA B;  3POQ A;  4TNW A;  2XAH B;  3ETV A;  4RL9 A;  3GA8 A;  2BG9 C;  2J1D G;  2FGQ X;  2WMO A;  2VL8 A;  1SHZ C;  4LF7 T;  4PW8 A;  2WVP A;  5HXR A;  1HX1 B;  1WCR A;  2VWA A;  2VVS A;  1BR1 A;  1M62 A;  2KXP B;  1IBK T;  3P7I A;  5CJ5 A;  3BRZ A;  5LA6 E;  4KI0 F;  5L2L A;  4FT6 A;  1T16 A;  5LHI B;  3AE4 A;  4QH4 A;  4EED A;  2GE4 A;  4Z8X A;  3V5U A;  4ILA A;  4LSH A;  4B3T T;  5FKY A;  2XAQ B;  4FZM A;  3LG7 A;  2WDQ A;  3ZEF B;  5LG4 A;  4AYE C;  4ANJ A;  3PJA A;  4QQ1 A;  4NPP A;  4X20 E;  4ERR A;  2PFV A;  3OKQ A;  4FZL A;  3M65 A;  1G90 A;  5LGN B;  5HAX A;  3PUS A;  5AQG B;  2ODV A;  4QXC B;  3VR8 A;  1NEK A;  3AAA B;  2DNX A;  4AKM A;  3S4U A;  3I9W A;  5L47 A;  5L3F B;  4AYI D;  3CVR A;  4FI5 A;  2Z6E A;  2OV9 A;  5KMG P;  4J2C A;  4O2B E;  4DV3 T;  3BQK A;  5CGM A;  2CM0 A;  3WAK A;  1XDO A;  3RLF F;  3TLW A;  5EK3 A;  4HWD A;  3NJT A;  3LDQ B;  4ASK A;  3A7M A;  3SS1 A;  1XNR T;  2KND A;  2XTQ A;  1IAP A;  4U33 A;  4DR4 T;  4DR1 T;  2K9A A;  4LSF A;  3NRX A;  3FXE B;  3RH3 A;  4CN1 A;  4P0B A;  5JR9 B;  2V7K A;  2BVL A;  2Q9Q B;  4C4V A;  3AA0 A;  3RYC E;  4MHC A;  3DP7 A;  2XM1 A;  4C90 A;  3IA3 A;  3N9Q A;  3AA6 A;  3AE8 A;  2XQ9 A;  2M07 A;  3G06 A;  2XTR A;  2IHR 1;  4KR8 A;  2R89 A;  3AED A;  2WU5 A;  4IDO A;  2RA1 A;  3ONL C;  4AI6 A;  5TAO A;  1XWM A;  3RGL A;  3FXD B;  1W09 A;  4EV6 A;  2NOX A;  1MMD A;  5AQU B;  1U4Q A;  4A98 A;  3A8Y C;  4COF A;  5JRC A;  2V7I A;  4KRA A;  2LKH A;  5AQO B;  3ZN1 B;  3AA1 A;  1KNP A;  3RKO A;  1GFN A;  2CE7 A;  4KHP T;  3LJC A;  5FXX A;  1GFO A;  2M6B A;  1US7 B;  4PNI A;  3P8C D;  2DCF A;  3E0Z A;  3N2K E;  3AE5 A;  4EEB A;  4EZH A;  3O0E A;  3TZG A;  2LOP A;  3NZP A;  5EZY E;  3ZJ1 A;  3UFG A;  3J7Y q;  1HNZ T;  4EB6 E;  4IL4 A;  4EZ4 A;  5J2U E;  2W4X A;  4YXD A;  1CHU A;  2FJA A;  3C4W A;  3ZJ2 A;  3ETU A;  1U5P A;  2VAS A;  2E9X C;  2Y0H A;  4QKN A;  4JUY A;  3AB3 B;  2LHR A;  4LML A;  4ZZC A;  4GK0 E;  2H7V C;  4PR7 A;  2X9H A;  1B7T A;  4H9P C;  5FMN A;  1OED E;  4KX6 A;  3A2S X;  3E22 E;  3JAD A;  2XQ6 A;  5ABH A;  2YKS A;  2I59 A;  2JQ9 A;  2C5J A;  2IC6 A;  2JQH A;  3A5X A;  1MM4 A;  2KMF A;  1NAF A;  4HFB A;  5FL0 A;  1E1H B;  3FHN A;  4JI8 T;  1VOM A;  4ZS3 A;  4UVC B;  4PUX A;  2BG9 E;  3AA7 A;  4U2Z A;  2WBL A;  1YKH B;  2WY2 A;  7PRN A;  2W0G A;  2W66 A;  3HKD E;  1ZKE A;  2LHN A;  3C51 A;  5HXS A;  1V9D A;  4AKR B;  3PRN A;  5JR9 A;  3PUW F;  1ORM A;  4IT4 A;  4XNL A;  1HF8 A;  2XE3 A;  4AFK A;  3CIR A;  3JCF A;  2C0S A;  4DV6 T;  3POU A;  1W9R A;  1QJP A;  2VK9 A;  3T8O A;  4HFD A;  3AXJ B;  3AAI A;  4WZX A;  1HNW T;  5LJM A;  1WLX A;  4L5G A;  4H9N C;  3O1I A;  2VL0 A;  3FZH B;  4AKL A;  3TLS A;  3CQG B;  5ETW A;  3N9P A;  2XAJ B;  3PUG A;  3UQ7 A;  4UV9 B;  3IBP A;  4AKI A;  2LOS A;  4ILB A;  3AE6 A;  1WFD A;  3PUZ F;  4TX5 A;  3PF1 A;  1UX4 A;  1MM5 A;  3K1S A;  3LK4 2;  2XQ3 A;  1WYC A;  5H6R B;  4YLH A;  3P4S A;  4HFE A;  2XQ7 A;  1IZN B;  2BZB A;  3EDV A;  3PUA A;  3UUX B;  3OYX A;  5CFB A;  5IYU A;  5JRC B;  1UUS A;  4I43 B;  4AIU A;  5M4Y A;  2XQ5 A;  3MZK B;  4H9S E;  2XJ7 A;  2WCA A;  2ODJ A;  3GP6 A;  1J1J A;  4AXP A;  2J47 A;  3SZD A;  1AJ3 A;  2N9D A;  4U7I A;  3J9X 1;  2FUP A;  4YFS A;  5AQV B;  3TLU A;  3UQ4 A;  5EK4 A;  2CBI A;  2LSI A;  2X0L B;  2NW7 A;  2F1V A;  5LBM A;  1N33 T;  3N9N A;  4X66 T;  5F8P A;  2OA5 A;  4D5U A;  2NTY A;  4PJJ A;  4AKH A;  2VB6 A;  3PU3 A;  2X0H A;  3PUQ A;  2DHR A;  4ZS2 A;  2JMH A;  4DV1 T;  5G3A A;  4B6X A;  3KBU A;  3P4R A;  1CUN A;  4IL6 O;  3F2E A;  3V8U A;  2X66 A;  2UUA T;  2UUB T;  4DBQ A;  1MMG A;  2LT3 A;  1BT9 A;  2QA7 A;  4OX9 T;  3UAQ A;  2PTF A;  4X1Y E;  5HEO A;  2JQQ A;  4BJN A;  5AQF B;  3VY9 X;  2AXD S;  3ZMV B;  4UB6 O;  2CBJ A;  3AVR A;  4KP3 C;  3DWO X;  2K24 A;  3AA0 B;  2ES0 A;  2CLY C;  4D65 A;  4DMV A;  2DL1 A;  3K3O A;  4C4V B;  5JVD E;  1MPF A;  1I94 T;  2LEH A;  3ZCI A;  5H2F O;  1OED B;  2WJQ A;  5L3C B;  2L3L A;  4CI2 B;  3BS0 A;  3SY9 A;  3FZF B;  3VR9 A;  2IWW A;  2Y48 B;  3C98 B;  2MBG A;  2JMK A;  4FOZ A;  4NUV A;  1LVK A;  1BXW A;  3RC8 A;  4GYS A;  5HYA A;  5LMN T;  4JEU B;  3EAM A;  3EI0 A;  3N2G E;  2N2M A;  4JLE A;  5LJN A;  4IE4 A;  4O3Y A;  3MJX A;  2A2F X;  4E7Z A;  4XNK A;  1DU2 A;  1UX5 A;  4H63 V;  3QB5 K;  2BG9 A;  2JMM A;  4P0A A;  1M7K A;  1MIV A;  5E0O A;  2MHL A;  4O2A E;  2MPK A;  4KMC A;  3AEA A;  3AEF A;  1ZHC A;  2LJL A;  3UUL A;  1FMV A;  1MMA A;  3ZN0 B;  4CXX A;  1GFM A;  4AYD C;  1JNR A;  4K3C A;  2WB5 A;  5AQT B;  4YHJ A;  4F8H A;  2WDR A;  1W0B A;  2ZLY A;  4HN9 A;  3OJA A;  4HWF A;  4GCQ A;  3KVD D;  3AAE A;  4JI1 T;  3R84 B;  4ZI3 C;  4UF0 A;  5AQL B;  2JQK A;  2IAK A;  2ACZ A;  4K0U A;  2JIW A;  3U78 A;  4YY3 T;  5J1G A;  4HTE A;  3JC6 D;  4EOZ B;  2WJR A;  5GON E;  1OPF A;  5KAF O;  3AEE A;  3ZMS B;  2VQE T;  3PU8 A;  4FUV A;  3RYH E;  4YSZ A;  1YQ4 A;  2ZM2 A;  4NUU A;  4DV5 T;  5LGT B;  2NW9 A;  4DR7 T;  2KIN B;  1ZP0 A;  4O4I E;  5PRN A;  5C3J A;  2V1D B;  3NRY A;  5KAI O;  3ESL A;  4DUY T;  2E9X B;  2Y0L A;  1WYB A;  2HH7 A;  4CN6 A;  2QVA A;  4FRT A;  1Y01 A;  5HCM A;  3AA1 B;  2V7M A;  1H7C A;  4TV9 E;  2CEA A;  2XHE B;  4EXT A;  1I6Z A;  5LNK A;  2YNK A;  1N34 T;  5JR9 C;  2KT9 A;  4OFZ A;  1D0X A;  5JDF A;  3MKD A;  4YTP A;  2Q9Q C;  4EYU A;  4TWD A;  4QXH B;  5TIS O;  4F6R C;  4IDN A;  4FJO A;  3WI5 A;  2C5K T;  2ZMA A;  5DL7 A;  2G0U A;  3MK7 C;  4FES A;  2NR4 A;  4LF5 T;  3TKL B;  2E8I A;  5FY7 A;  4HGA A;  5HEG A;  5FY1 A;  4L0R A;  3PGR A;  3HOE A;  4MBQ A;  3DA3 A;  5LBQ B;  4JI7 T;  3VRA A;  2A9U A;  2QRX A;  2J1N A;  1MMN A;  3BQL A;  5KX5 E;  2HPL A;  5L3G B;  2LSG A;  1SE7 A;  5ABF B;  4DO0 A;  1OXZ A;  4JEH B;  2V7J A;  4I0U A;  1HXT A;  2AXT O;  3PGU A;  1HX8 A;  3IF8 B;  1FEW A;  3JAF A;  2WQY A;  4O3Z A;  1ZHT A;  2XQ4 A;  2LLY A;  2XQA A;  2XMX A;  2D2S A;  3SFE A;  3RIF A;  2Y0K A;  3O1J A;  2VUR A;  3VKH A;  1G8X A;  1OSM A;  5EE2 A;  5ABG A;  4H9Q C;  2NP9 A;  2N2N A;  3UU5 A;  8PRN A;  1T7S A;  3ABV A;  2J62 A;  1YXR A;  2VKD A;  4JI2 T;  1IJ6 A;  4JV5 T;  5FVK A;  4DR6 T;  2IIU A;  2VQF T;  3HW9 A;  3VKG A;  3P4P A;  2VKO A;  2FBW A;  1YS5 A;  2RPA A;  2XQY A;  2EHO D;  5HEJ A;  2ZM6 T;  2V6Y A;  1GQE A;  3MA9 A;  4AZL A;  3FZM B;  4PK5 A;  4A5X A;  3K8P C;  2FJB A;  4ZI3 D;  4U3C A;  3SYB A;  5JDL A;  3AAE B;  2VKH A;  4EAH A;  5AQI B;  2R4P A;  4FSP A;  4QX7 B;  2WWU A;  4L9I A;  1KNR A;  4KHZ F;  2R8A A;  2J4G A;  4XZC A;  1N36 T;  3PUY F;  3CX6 B;  5JDM A;  4CI3 B;  4G2A A;  1UCU A;  2EHO B;  2JRK A;  2HPJ A;  1E7P A;  2YDQ A;  4TZ4 C;  3RYF E;  3CPZ A;  2WZH A;  4EGW A;  2XQ8 A;  2ZM0 A;  1LKX A;  4RLC A;  2M67 A;  4UXN B;  3O9X A;  4IHJ E;  5JDH A;  3JCU O;  4NXN T;  4O8S A;  2XSB A;  1D1C A;  4DUZ T;  3KVB A;  1XMO T;  2V8S V;  4AYN A;  2V5C A;  1E2A A;  3Q9D A;  3N9L A;  3KBT A;  3O1H A;  4MLK A;  3EUH A;  2UXD T;  2WSS V;  3AVS A;  1YKE B;  1D0Y A;  4ZHQ E;  3HWB A;  5H6Q B;  2K5B B;  4GHB A;  2C5I T;  3LFM A;  3RRC A;  4LSI A;  4G63 A;  5E79 O;  4JI6 T;  1UGO A;  3Q5X A;  5JTG A;  1T98 A;  3POR A;  3Q5W A;  2BBJ A;  1MNE A;  3Q2M A;  3VHL A;  5DAB A;  2Y7S A;  4O3X B;  1HXU A;  2XZE A;  4ZI7 E;  1WR6 A;  4HFH A;  4C69 X;  3FBZ A;  1XZY A;  4B3R T;  2X51 A;  3UFE A;  3QRC A;  2YOE A;  2AE9 A;  5BMV E;  3EAB A;  1D1B A;  2KWI B;  1FIO A;  3AE1 A;  4JI3 T;  5ABE A;  4WBN E;  4ZEY A;  4LFB T;  2UXB T;  4PAG A;  4RJW A;  4EIW A;  4QH1 A;  4B3M T;  2EHO C;  3ZMZ B;  5L4H A;  4BAY B;  3PDY A;  3WU2 O;  1Z8U A;  4UEL A;  1QJ9 A;  2KXP A;  3OTO T;  4ZI2 D;  2YDR A;  1THQ A;  2EHO A;  3P4W A;  2CRB A;  3MXZ A;  2YIN A;  3O4X E;  2X67 A;  4LF6 T;  2RP4 A;  3AE3 A;  3SZV A;  3TLT A;  4UF0 B;  4YSY A;  2ACX A;  2YN6 A;  3JAE A;  3UU2 A;  3CK6 A;  1N32 T;  4IDQ A;  4DR2 T;  2X0Y A;  3HKB E;  4MFR A;  4TV8 E;  3QRA A;  2CHN A;  4KUM B;  4N75 A;  3AE9 A;  2CXF A;  3OVU A;  3DTO A;  3FB2 A;  1L0V A;  4H9O C;  4AQG A;  3VRB A;  5CA0 E;  5L3D B;  3L39 A;  4F4B A;  4PK6 A;  4D64 A;  3WAJ A;  1J5E T;  3L09 A;  4ISS A;  2V5D A;  3R6N A;  3PE0 A;  4DVD A;  4K0K T;  4HFI A;  3CX8 B;  4OHF A;  3ZCJ A;  1IBM T;  4OYK A;  3PQS A;  2WMN A;  4A97 A;  3RQU A;  4HKA A;  3VE1 A;  4CXY A;  4LFA T;  3ZSS A;  3T0S A;  2FGR A;  4YTM A;  3DA4 A;  4G75 A;  4B61 A;  5HCJ A;  2JQY A;  4CXW A;  5DL5 A;  4M1P A;  3TLV A;  2R6G F;  4E7S A;  3WI3 A;  3F57 A;  5IHY A;  4DV0 T;  2POR A;  1QJ8 A;  3EMN X;  4PJM A;  5LYJ E;  2LRL A;  1S94 A;  4AIS A;  2ZLD A;  5FL1 A;  4QX8 B;  1HS7 A;  2DWG A;  4HFV A;  4U2Y A;  3I9Y A;  5LHG B;  3LSV A;  5AQH B;  2BS4 A;  2BG9 B;  4WBO A;  3H37 A;  5HEH A;  2F4V T;  3EVY A;  5C2T A;  3H3M A;  1UUR A;  4IE5 A;  5HWY A;  5D5D A;  2X9Y A;  3VY8 X;  5FYM A;  2XAS B;  3OBV E;  2E9X D;  2J4U P;  1FMW A;  5FXW A;  3RQW A;  2H7O A;  3UU6 A;  5LGU B;  3QUJ A;  4JI4 T;  1IJ5 A;  4RJX A;  4Z3T A;  2WZI A;  1T1L A;  3UU4 A;  2ERV A;  3RIA A;  3UUM A;  4WYV A;  3UT5 E;  4O4J E;  3CQX C;  4ZI2 C;  4UB8 O;  1Q9G A;  4N74 A;  3N9O A;  4KR4 A;  4PJN A;  2W67 A;  3ONX A;  3ZYM A;  1E54 A;  4AQY T;  3C4Z A;  6PRN A;  4GKK T;  4Z91 A;  1MIY A;  5HXH A;  3JC6 C;  1NEN A;  4DR5 T;  3AA7 B;  1MIW A;  1ZOY A;  2R4N A;  4H63 H;  1OED C;  2IC9 A;  4GCP A;  4JCH A;  2LKG A;  4JBW F;  3T1Y T;  3ZKR A;  3SWH A;  4IL9 A;  4HWH A;  1QLB A;  2CXL A;  4N58 A;  1Y64 B;  2VKJ A;  1LVF A;  2W2U A;  4DR3 T;  3QNU A;  3M3Z B;  4V1A v;  1MND A;  1ZHY A;  4LSE A;  2KZ7 B;  3LK4 1;  4QHO A;  2W80 C;  2IUB A;  5DL6 A;  3ZC1 A;  5AQM B;  4JI5 T;  2HHH T;  2LSJ A;  2MOZ A;  3FBL A;  2W63 A;  2IW5 B;  5T5F A;  2BS3 A;  2WU2 A;  3A0B O;  2KSR A;  4OYJ A;  2XY8 B;  5C8Y E;  5FVN A;  4LF9 T;  4TWF A;  4X62 T;  4DMW A;  1W0A A;  4CQI A;  2UXX B;  4K3B A;  2XSA A;  2OLT A;  4AKG A;  2IWV A;  4OK0 A;  2D0U A;  4I4T E;  2Y2X A;  4GF4 A;  1S5L O;  2QYW A;  4C91 A;  2W00 A;  4DBR A;  2I6H A;  2YEV C;  1T72 A;  5CB4 E;  4IST A;  4FSO A;  2WDV A;  3PV0 F;  2PBI A;  2MYS A;  2V7L A;  5JDQ A;  3QC9 A;  3RYI E;  4HWI B;  3Q5D A;  2Y6X A;  5JDN A;  2BDE A;  1KNZ A;  3HOL A;  1WR0 A;  4PJ0 O;  3T20 A;  1PHO A;  4X64 T;  4DID B;  2WP9 A;  3A0H O;  3BK9 A;  3PJA J;  3FZK B;  1H6S 1;  3KVA A;  4ZXL A;  1Q9F A;  4FRX A;  2OMF A;  2DWK A;  4AUI A;  4DV4 T;  5EK2 A;  4UEM A;  3E08 A;  3PGS A;  3LK2 B;  1KK7 A;  2NW8 A;  4GIW A;  3IEE A;  5ADX K;  2W62 A;  3UPG A;  2XAG B;  3FZL B;  3N9M A;  5FVL A;  1XDP A;  5ADX L;  4BJM A;  4YJ2 E;  2N1G A;  4CTD A;  3GN5 B;  2D0T A;  5DQV A;  2NTX A;  2V26 A;  5J0Z A;  3N2O A;  4QWN B;  2PG8 A;  1OED A;  4LFC T;  3CKD A;  4X5T A;  3ZT6 A;  1IZN A;  4P1N A;  4X65 T;  5LOV E;  3KZI O;  3CWZ B;  4X1I E;  3KIN B;  4LMK A;  4IDZ A;  4X1K E;  2XAF B;  5LP6 E;  4ILU A;  2NWB A;  2M06 A;  3OYZ A;  4XAX B;  3CQC B;  4IDP A;  2B76 A;  3UUB A;  4JI0 T;  4U72 A;  3KFW X;  3RI5 A;  4GKJ T;  3L3P A;  4NXM T;  1WRD A;  5LB7 B;  3RX6 A;  5J2T E;  4DV7 T;  2MTQ A;  1XNQ T;  5HXE A;  1HXX A;  3T1H T;  4LF4 T;  3BQI A;  3HKC E;  4AYM C;  4PFO A;  4LF8 T;  2K0L A;  3GN5 A;  5HXC A;  3HI2 A;  4HWC A;  4ZZB A;  1HR0 T;  1HTJ F;  1SUM B;  5ABF A;  1VRB A;  4HE8 A;  2CMR A;  1FJG T;  3LK2 A;  2JJ9 A;  4U74 A;  3C5O A;  3ZC0 A;  4YHH T;  4ADZ A;  3PUX F;  1T8B A;  4H9R C;  4Q25 A;  2KLQ A;  5A1L A;  3SFD A;  1VCT A;  4Z90 A;  4G76 A;  1HG5 A;  5DL8 A;  2X68 A;  1S35 A;  3HL6 A;  1SA0 E;  5GTH O;  3QOF A;  2KZ7 A;  4TNV A;  2YK0 A;  4UVB B;  4AKR A;  2XE5 A;  2LM9 A;  5LXT E;  4N78 D;  2WM9 A;  4BA9 A;  4P09 A;  4CZZ B;  3EDU A;  5HEU A;  4IIJ E;  2BBH A;  4FZN A;  3SOL A;  2LRK A;  5F5W A;  2KDY A;  3AEG A;  2X9W A; 
#chains in the Genus database with same CATH homology
 3ZCI A;  3FB2 A;  2XAQ B;  4FZM A;  5L3C B;  2GK9 A;  3LG7 A;  2L3L A;  2CWY A;  4CI2 B;  3K3N A;  2O4V A;  3LK3 A;  4RLB A;  3SY9 A;  4CI1 B;  3ZEF B;  2Y48 B;  3C98 B;  3RRW A;  2MBG A;  5LG4 A;  4H9O C;  4AYE C;  4AQG A;  5CA0 E;  5L3D B;  3UUN A;  4ANJ A;  4F4B A;  2JMK A;  4PK6 A;  4FOZ A;  4NUV A;  3ZYK A;  1LVK A;  4QQ1 A;  3WAJ A;  4D64 A;  3L09 A;  4ISS A;  3R6N A;  4X20 E;  3PE0 A;  4DVD A;  4E1S A;  1BXW A;  3DJB A;  3RC8 A;  4ERR A;  1HFA A;  3LBX B;  2PFV A;  4GYS A;  3CX8 B;  3OKQ A;  4OHF A;  3ZCJ A;  4OYK A;  3M65 A;  4JEU B;  5HYA A;  4FZL A;  5LGN B;  1G90 A;  3PQS A;  2WMN A;  3N2G E;  2N2M A;  5HAX A;  2H3R A;  3PUS A;  4JLE A;  4IE4 A;  5LJN A;  1ZHZ A;  4O3Y A;  3MJX A;  2A2F X;  4E7Z A;  2ODV A;  5GV0 A;  4XNK A;  2W61 A;  4WNK A;  4HKA A;  3VE1 A;  4QXC B;  2DI4 A;  4CXY A;  3D0T A;  1UX5 A;  3T0S A;  2FGR A;  4H63 V;  3DA4 A;  4G75 A;  4B61 A;  3QK6 A;  5DL5 A;  2YU2 A;  3AAA B;  2DNX A;  4M1P A;  4CXW A;  5LCY A;  4AKM A;  3S4U A;  3KDS E;  4E7S A;  3I9W A;  2JMM A;  2B1E A;  5L3F B;  4AYI D;  3WI3 A;  4P0A A;  2XE2 A;  3F57 A;  3CVR A;  1MIV A;  4FI5 A;  2Z6E A;  5IHY A;  4DND A;  3JTY A;  2POR A;  5E0O A;  5KMG P;  1QJ8 A;  3EMN X;  4J2C A;  4O2B E;  4PJM A;  2MHL A;  1QSD A;  3RC3 A;  4O2A E;  3BQK A;  2CXD A;  4KMC A;  4IE0 A;  5LYJ E;  4HEA A;  1ZHC A;  2LJL A;  4O3W A;  4GOU A;  3UUL A;  2CM0 A;  1S94 A;  2ZLD A;  1FMV A;  4QX8 B;  1HS7 A;  3ZYL A;  3WAK A;  2DWG A;  4HFV A;  3I9Y A;  5EK3 A;  2BVM A;  1MMA A;  2ZM8 A;  3ZN0 B;  4CXX A;  1GFM A;  4AYD C;  5LHG B;  2UXN B;  4ASK A;  5F3J A;  3SS1 A;  4YHJ A;  4WBO A;  2KND A;  3W15 B;  2ZLY A;  3H37 A;  2XTQ A;  1IAP A;  4HN9 A;  3OJA A;  3I0O A;  4GCQ A;  3VZT X;  5IYZ E;  2K9A A;  3KVD D;  3AAE A;  3R84 B;  3C64 A;  3EVY A;  4ZI3 C;  3KV5 A;  4LSF A;  3CX7 B;  3NRX A;  3FXE B;  3PUR A;  4UF0 A;  4P0B A;  3RH3 A;  2IAK A;  1X79 A;  5JR9 B;  5HWY A;  4IE5 A;  5D5D A;  4K0U A;  2X9Y A;  3U78 A;  5FYM A;  2XAS B;  3VY8 X;  3RPU A;  5J1G A;  5L3B B;  3OBV E;  2V7K A;  2BVL A;  4HTE A;  3JC6 D;  4I50 E;  2E9X D;  2Q9Q B;  4EOZ B;  2ZFG A;  5GON E;  1OPF A;  3AA6 B;  4PK4 A;  2J4U P;  1FMW A;  5FXW A;  3UTK A;  3ZMS B;  3AA0 A;  3POX A;  3HKE E;  3PU8 A;  2H7O A;  4FUV A;  4UIG A;  4E1T A;  3RYC E;  3RYH E;  4MHC A;  3DP7 A;  5LGU B;  3QUJ A;  4C90 A;  1IJ5 A;  2ZM2 A;  4NUU A;  4RJX A;  3N9Q A;  4Z3T A;  3K3Q C;  3AA6 A;  2CWO A;  1LRZ A;  4UV8 B;  5LGT B;  2LFU A;  4XBF B;  5DL8 A;  2NW9 A;  2K4T A;  2KIN B;  2LHF A;  4O4I E;  2ERV A;  5PRN A;  2M07 A;  3UUM A;  3UT5 E;  2SPC A;  4O4J E;  3CQX C;  4ZI2 C;  2XTR A;  5JRE A;  4KR8 A;  1Q9G A;  3N9O A;  2V1D B;  3NRY A;  4KR4 A;  3ESL A;  4PJN A;  3ONX A;  2RA1 A;  4AI6 A;  3ZYM A;  5TAO A;  2L9Q A;  3FXD B;  1E54 A;  2E9X B;  2Q9Q D;  5FNV E;  2MNH A;  2Y0L A;  1WYB A;  2HH7 A;  2NOX A;  1MMD A;  3C4Z A;  6PRN A;  1U4Q A;  1MIY A;  4KBM B;  4FRT A;  5HXH A;  5JRC A;  3JC6 C;  2V7I A;  5FY0 A;  4KRA A;  3AA1 B;  2V7M A;  1H7C A;  3AA7 B;  5L3E B;  1MIW A;  4TV9 E;  2CEA A;  2QTK A;  4H63 H;  2IC9 A;  3ZN1 B;  3B13 A;  2XHE B;  3AA1 A;  4TUY E;  4EXT A;  4GCP A;  4JCH A;  3U3I A;  3RKO A;  5LNK A;  1GFN A;  3VU7 H;  2YNK A;  4O4X A;  5JR9 C;  3SWH A;  2CE7 A;  2KT9 A;  2CXL A;  3LJC A;  4OFZ A;  3WI4 A;  4N58 A;  1D0X A;  1G73 A;  5JDF A;  3MKD A;  5FXX A;  1GFO A;  2Q9Q C;  3I1A A;  3KV4 A;  4EYU A;  1Y64 B;  3AAA A;  2VKJ A;  1LVF A;  1US7 B;  2CLY B;  3P8C D;  4PNI A;  4QXB B;  2DCF A;  4QXH B;  4GCS A;  4F6R C;  3E0Z A;  2DLR A;  3N2K E;  4EZH A;  1HCI A;  4FJO A;  4V1A v;  4IGU A;  3O0E A;  3WI5 A;  4PJL A;  1MND A;  3TZG A;  2LOP A;  1ZHY A;  4LSE A;  3PQU A;  2C5K T;  2ZMA A;  2KZ7 B;  5DL7 A;  2G0U A;  4N59 A;  3LK4 1;  3MK7 C;  3NZP A;  3NSG A;  5EZY E;  4FES A;  3ZJ1 A;  3T24 A;  4QHO A;  3TKL B;  2E8I A;  5FY7 A;  2W80 C;  3J7Y q;  5DL6 A;  3ZC1 A;  4EB6 E;  1BR0 A;  4WW0 A;  4EZ4 A;  2LSJ A;  4HGA A;  3VZU X;  5FY1 A;  5J2U E;  2MOZ A;  3FBL A;  1ZV4 X;  4L0R A;  2A72 A;  2CCQ A;  3HOE A;  2W63 A;  2IW5 B;  5JDP A;  3KV6 A;  5T5F A;  4MBQ A;  3DA3 A;  5LBQ B;  4O49 A;  4EYY R;  3C4W A;  2J1N A;  1MMN A;  4GYR A;  4OYJ A;  3ZJ2 A;  3BQL A;  1PRN A;  3ETU A;  5JH7 E;  3C4X A;  5C8Y E;  5KX5 E;  2HPL A;  3KV9 A;  1U5P A;  4IE7 A;  5FVN A;  3LBX A;  3CML A;  2VAS A;  2E9X C;  5FXZ A;  5L3G B;  4DMW A;  1GFQ A;  3FYX A;  2Y0H A;  1GFP A;  4QKN A;  3ZMT B;  2JPF A;  4JUY A;  2LSG A;  3AB3 B;  3ZPO A;  4CQI A;  2LHR A;  2UXX B;  3IHR A;  4GK0 E;  4DO0 A;  4AKG A;  1OXZ A;  4JEH B;  2V7J A;  1HXT A;  2H7V C;  1HX8 A;  2YPV A;  2X9H A;  4OK0 A;  2D0U A;  4I4T E;  1B7T A;  3IF8 B;  4H9P C;  2Y2X A;  1FEW A;  2Q9Q A;  5FMN A;  3A2S X;  3E22 E;  3HA4 A;  3ZLI A;  4GF4 A;  4O3Z A;  4C91 A;  2W00 A;  1ZHT A;  3SRZ A;  2I59 A;  4DBR A;  2CA5 A;  2YEV C;  4IE6 A;  2XMX A;  3SYS A;  2D2S A;  2C5J A;  5CB4 E;  2IC6 A;  4IST A;  3A5X A;  4FSO A;  1ZHX A;  2ODU A;  1MM4 A;  2Y0K A;  2KMF A;  1BR2 A;  1Z0P A;  2LSK A;  2MYS A;  1NAF A;  2PBI A;  2V7L A;  5JDQ A;  2XUE A;  3O1J A;  5DJQ C;  3QC9 A;  3VKH A;  1G8X A;  3RYI E;  5G26 A;  5LHH B;  1E1H B;  1OSM A;  5EE2 A;  3FHN A;  1D1A A;  4H9Q C;  2NP9 A;  3ANW B;  2N2N A;  8PRN A;  3H3A A;  3RBH A;  2VKD A;  1IJ6 A;  2Y6X A;  5JDN A;  2X9X A;  2BDE A;  1VOM A;  4ZS3 A;  3ZMU B;  4UVC B;  1KNZ A;  3HOL A;  4PUX A;  3T20 A;  1PHO A;  2F1T A;  3HW9 A;  3AA7 A;  3VKG A;  2VKO A;  1YS5 A;  2WBL A;  2XQY A;  1YKH B;  2EHO D;  3BK9 A;  7PRN A;  4O4H E;  2W0G A;  4AQF A;  1H6S 1;  3KVA A;  3MA9 A;  1Q9F A;  4FRX A;  4AZL A;  2QGS A;  3HKD E;  1ZKE A;  1OWA A;  2OMF A;  2DWK A;  2LHN A;  4AUI A;  3I0Q A;  3C51 A;  5HXS A;  4PK5 A;  1V9D A;  3K8P C;  4AKR B;  4AQF C;  4ZI3 D;  5EK2 A;  3PRN A;  4BUM X;  4UEM A;  2K48 A;  3E08 A;  5JR9 A;  3SYB A;  3LK2 B;  1KK7 A;  1ORM A;  2NW8 A;  5JDL A;  5JQG E;  4XNL A;  3AAE B;  2VKH A;  4GIW A;  1HF8 A;  4EAH A;  4FSP A;  3IEE A;  2XE3 A;  4QX7 B;  2W62 A;  3PTR B;  5FP3 A;  3G7G A;  4AFK A;  2XAG B;  5ADX K;  3UPG A;  3N9M A;  5ADX L;  2WWU A;  2C0S A;  4BJM A;  4L9I A;  3POU A;  4YJ2 E;  2N1G A;  4A56 A;  2N2L A;  5AFU L;  3GN5 B;  2D0T A;  2E9X A;  4XZC A;  3B57 A;  1QJP A;  2VK9 A;  3T8O A;  5DQV A;  2NTX A;  2V26 A;  3AAI A;  3N2O A;  4QWN B;  2PG8 A;  3CX6 B;  5JDM A;  4CI3 B;  3CKD A;  4G2A A;  5LJM A;  1WLX A;  4L5G A;  4H9N C;  3O1I A;  4ZOL E;  2XE1 A;  1IZN A;  1UCU A;  2EHO B;  2JRK A;  1P4T A;  4AKL A;  2KWH A;  2L8K A;  2HPJ A;  2Y8D A;  4YJ3 E;  4TZ4 C;  3RYF E;  3CPZ A;  3CQG B;  5ETW A;  3N9P A;  3ANW A;  2XAJ B;  3VE2 A;  1O3X A;  2ZM0 A;  4I55 E;  1HG2 A;  3PUG A;  1LKX A;  3CWZ B;  5LOV E;  4RLC A;  4X1I E;  4UV9 B;  2M67 A;  3IBP A;  3KIN B;  4UXN B;  3O9X A;  4AKI A;  4IHJ E;  1NWM X;  2LOS A;  5JDH A;  4IDZ A;  4X1K E;  1YD8 G;  3GWH A;  4TX5 A;  2XAF B;  4O8S A;  1UX4 A;  5LP6 E;  3LK4 2;  2NWB A;  4ILU A;  4MAL A;  1D1C A;  3LK3 B;  1MM5 A;  1D0Z A;  1WYC A;  2M06 A;  3NBX X;  3OYZ A;  4XAX B;  3KVB A;  5H6R B;  4JFB A;  4YLH A;  4AYN A;  3CQC B;  5AFU K;  4TN7 B;  3Q9D A;  3N9L A;  1IZN B;  1QUU A;  3KBT A;  2BZB A;  3EDV A;  3PUA A;  3O1H A;  3UUX B;  4U72 A;  3OYX A;  2PRN A;  3KFW X;  4MLK A;  2LSY A;  3EUH A;  5IYU A;  2XG6 A;  5JRC B;  3L3P A;  4I43 B;  2WSS V;  2WAU A;  3AVS A;  1YKE B;  1WRD A;  5M4Y A;  3RX6 A;  1D0Y A;  4ZHQ E;  5HWX A;  5J2T E;  3MZK B;  4H9S E;  3HWB A;  3MAC A;  2MTQ A;  2K5B B;  5H6Q B;  2ODJ A;  4GHB A;  3K19 A;  2C5I T;  3LFM A;  3RRC A;  5HXE A;  4LSI A;  4FMS A;  1HXX A;  3GP6 A;  3C50 A;  4G63 A;  3GMI A;  5JDG A;  4AXP A;  3SZD A;  1AJ3 A;  2N9D A;  3Q5X A;  3BQI A;  1BH3 A;  4O4U A;  2P9B A;  5DQW A;  3J9X 1;  3HKC E;  4AYM C;  2W81 C;  4O4L E;  4PFO A;  3NZQ A;  4YFS A;  1T98 A;  3POR A;  5KDM C;  2A3D A;  3F31 A;  3Q5W A;  1MNE A;  5EK4 A;  3Q2M A;  3VHL A;  5DAB A;  2K0L A;  3GN5 A;  2LSI A;  2X0L B;  2NW7 A;  2F1V A;  5LBM A;  2Y7S A;  4O3X B;  3N9N A;  5HXC A;  1ZHW A;  1HXU A;  5F8P A;  2OA5 A;  3VZW X;  4D5U A;  3HI2 A;  2NTY A;  1BR4 A;  3N5L A;  1HTJ F;  4ZI7 E;  5CA1 E;  2D5U A;  4PJJ A;  4PFP A;  4AKH A;  2VB6 A;  1WR6 A;  3PU3 A;  3V5S A;  4GK5 E;  5FXV A;  3PUQ A;  1VRB A;  4HE8 A;  2CMR A;  2XTL A;  4C69 X;  3FBZ A;  2DHR A;  2LE8 A;  2X51 A;  4ZS2 A;  2JMH A;  3UFE A;  4B6X A;  2X27 X;  3LK2 A;  3QRC A;  1YW0 A;  3KBU A;  1CUN A;  2JJ9 A;  4U74 A;  3C5O A;  5BMV E;  1EZ3 A;  3F2E A;  3V8U A;  2X66 A;  4U9C A;  1D1B A;  2KWI B;  1ZEE A;  3ZC0 A;  1FIO A;  4DBQ A;  2PJQ A;  4WBN E;  1MMG A;  2LT3 A;  4ADZ A;  3HR0 A;  2YU1 A;  1BT9 A;  2KC0 A;  3SY7 A;  2QA7 A;  4PAG A;  4RJW A;  4EIW A;  3POQ A;  4UVA B;  4H9R C;  2KLQ A;  2EHO C;  3ZMZ B;  2XAH B;  4X1Y E;  4BAY B;  3UAQ A;  3ETV A;  3PDY A;  5A1L A;  4RL9 A;  3GA8 A;  4UEL A;  1QJ9 A;  2KXP A;  2J1D G;  4ZI2 D;  2FGQ X;  2WMO A;  4G76 A;  1HG5 A;  2JQQ A;  4BJN A;  1THQ A;  2EHO A;  1S35 A;  2VL8 A;  1SA0 E;  1SHZ C;  2X68 A;  3HL6 A;  4PW8 A;  3MXZ A;  2YIN A;  2KZ7 A;  3VY9 X;  3O4X E;  2YK0 A;  5HXR A;  2X67 A;  4UVB B;  4AKR A;  2XE5 A;  2VWA A;  2RP4 A;  2LM9 A;  3ZMV B;  1BR1 A;  5LXT E;  3SZV A;  2KXP B;  3AVR A;  4UF0 B;  4KP3 C;  4N78 D;  2WM9 A;  4BA9 A;  3P7I A;  2ACX A;  4P09 A;  5LA6 E;  4CZZ B;  3EDU A;  2K24 A;  3AA0 B;  5L2L A;  2ES0 A;  4IIJ E;  2CLY C;  3UU2 A;  4D65 A;  4FT6 A;  5LHI B;  4DMV A;  4FZN A;  3HKB E;  3K3O A;  3SOL A;  4MFR A;  4TV8 E;  2GE4 A;  4Z8X A;  5JVD E;  3QRA A;  4KUM B;  1MPF A;  3V5U A;  2CXF A;  4LSH A;  2LEH A;  2KDY A;  2X9W A;  3DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...