3AA1B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from ckip-1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa1B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa1B02
3LK2B 3LK3A 3AA6A 3AAEB 2KXPB 3LK41 3LK3B 3LK42 2KZ7A 5ADXL 3AA1A 3AA6B 5ADXK 1IZNA 3AAAA 2KZ7B 3AA1B 4AKRA 1IZNB 5AFUL 3AA0A 5AFUK 3AAAB 3AA7A 4AKRB 3LK2A 3AA0B 3AA7B 3AAEA 2KXPA
chains in the Genus database with same CATH superfamily
2I59A 4O4XA 2BG9C 4WYVA 3AA6A 3NRYA 1Y01A 2D0TA 2Z6EA 5LXTE 4UEMA 4QQ1A 5ADXK 3UQ7A 2DWGA 2IUBA 5AQSB 1BT9A 1XMOT 2WSSV 4FUVA 1XDPA 3JCUO 6PRNA 4DR1T 2A2FX 5LGUB 3RQWA 4WW0A 2YU2A 2EHOB 3RIAA 1NENA 5CGMA 1VRBA 2CXFA 5T5FA 4MFRA 1PHOA 2QYWA 3B5MA 1ZV4X 2VURA 2YU1A 1FIOA 3KV4A 3L8RA 4ZS2A 5C3JA 2F1CX 5KAFO 4TZ4C 3MK7C 1BXWA 3ZSSA 4KX6A 2CPTA 3SFEA 4I43B 3QOFA 1PRNA 2ERVA 2XE1A 3I9YA 3ZJ2A 3M3ZB 3VKHA 1XZYA 4DUYT 4LF9T 4C4VB 4AYID 4X5TA 3AAEB 5FVLA 2YDSA 3N9MA 2PTFA 2WM9A 4FZMA 1ORMA 4HFCA 4LSEA 3PUQA 2MHLA 2XE5A 2CEAA 1GFMA 2R88A 3CX8B 3RQUA 1P4TA 4CN1A 2XQ9A 3PUZF 3NBXX 2AE9A 3PUWF 5AQUB 3SOLA 2LJLA 2K48A 2WZHA 2ACZA 3CQGB 5LBMA 3SS1A 2FJAA 2WZIA 5HXSA 3Q5EA 4WBNE 2W2UA 3LK3A 2JQHA 2E9XD 3TLUA 4C91A 5KXJA 5HXHA 2C0SA 5LMNT 4I0UA 4L5GA 2BVLA 4F6RC 2UU9T 1X9BA 3CIRA 4FQEA 2BBHA 2OA5A 5J2UE 2W67A 2XQAA 3HI2A 3UU6A 3OJAA 4Z8XA 3PU3A 4X1IE 2RA1A 2XHEB 3IHRA 1LKXA 3S4UA 1ZHWA 2NOXA 2VVNA 4LFBT 2HHHT 2V7MA 5L3FB 4RLCA 3FZLB 1YKEB 4HWHA 3WAKA 2BS4A 2ODVA 2P9BA 1B7TA 1MPFA 4EZHA 3NSGA 5ABFB 4PFOA 4UVBB 2XAFB 2XTQA 2V6YB 4B3TT 2LSGA 2PFVA 1UUSA 4H9PC 3PGRA 1M62A 4PR7A 4LSFA 4PK4A 4KRAA 3P7IA 3MZKB 2XM1A 4V1Av 3SZVA 4UIGA 2L3LA 4HFEA 1KNPA 4AYEC 3UFGA 1KNRA 2BG9E 3OYZA 2IHR1 2ZM8A 2HPLA 2M6BA 4G76A 5G3AA 5CFBA 4AKHA 4HWDA 1BR4A 3UU2A 3LBXA 3RYFE 5FYMA 1MM4A 4AYNA 1BH3A 3ZT6A 3QB5A 1UX5A 4M1PA 3A2SX 5FL1A 1U4QA 4AIUA 3AE8A 3C98B 3LBXB 3EAMA 5LHGB 2XAGB 5AQIB 5AQPB 4DV2T 3LG7A 2NTYA 1W09A 4KHPT 2LLYA 4X62T 1CUNA 3GN5A 1WYCA 1O3XA 2CRBA 2D0UA 4H9OC 4CN4A 3C4ZA 2KC0A 3ABVA 4DIDB 2HN2A 4TUYE 2WAUA 3N9QA 4AZLA 5PRNA 3TLTA 2H89A 3O9XA 2Y2XA 2LSYA 3ONXA 1YQ4A 3VKGA 2VASA 5JQGE 4K0UA 4X20E 2MAWA 2XE3A 2YPVA 1ZKEA 2E9XB 3BS0A 2K3WA 2M07A 2HN1A 5JDHA 5AQMB 5GV0A 5LJMA 3Q9DA 3VRBA 3HKDE 2DCFA 1N32T 2Y48B 5AFUL 5L2LA 5H6RB 2KSRA 1G73A 2DNXA 5DABA 4PJMA 3PGSA 1XMQT 1D0XA 5FXZA 1HG2A 1HS7A 4H9RC 2H3RA 3UAQA 4PJNA 2WDVA 2C5KT 4JV5T 5KMGP 2BS2A 3VZWX 4FOZA 2XTLA 4QX8B 4AKGA 5E0OA 5L3EB 4DBQA 3N9NA 2ZM0A 4EB6E 4ZI3C 2YK0A 3JADA 1GQEA 5FMNA 3CX6B 2WMNA 5G39A 1IBLT 4GOUA 1KEYA 3BQIA 2WS3A 3A8YC 4JEHB 1YQ3A 4TN7B 4AYDC 5FXVA 1HNXT 1FJGT 2Q9QA 3L3PA 1D1BA 3I1AA 3VY9X 4NXNT 4JI3T 3JAEA 2V8SV 3Q5DA 2UUBT 3LFMA 4K3CA 2VL8A 3U78A 4KBMB 3OBVE 3RIFA 5JR9B 4AQYT 4ZS3A 1JNZA 1UX4A 2D5UA 3N2KE 4FRTA 2XTRA 5DJQC 2BG9A 1XNRT 4IE0A 3WI3A 1WLXA 1GFPA 4CXXA 4HEAA 4HFDA 2W4XA 2KWHA 3RGLA 3ZMVB 4IL6O 3ZMTB 1MNEA 2E8IA 4XNKA 4GF4A 3LK2B 1BR1A 3A7MA 5G38A 4H9NC 1M7KA 3T1HT 3QNUA 3PUGA 2LM2A 3HKCE 3UFEA 4ILCA 5ADXL 3IBPA 5KDMC 2BG9B 3AAAA 4O3XB 1IZNB 2J1DG 2MOZA 2QVAA 1N36T 2C5IT 5HXRA 4RLBA 4KI0F 3OPCA 1D1AA 5LOVE 3HA4A 4U74A 3AXJB 4XNLA 1MMAA 3AEBA 3AVRA 3F31A 4ADZA 3SY9A 3PUYF 3VR9A 5HXCA 1S35A 3PF1A 4FZLA 4YY3T 2NTXA 3PJAJ 3KFWX 1V9DA 3WU2O 3KBUA 3RC8A 3T24A 2W80C 4NUVA 4U33A 3GWHA 1G8XA 5AQLB 4O4HE 5FXXA 3DTOA 5JDFA 2ZLDA 4CI2B 4PW8A 4ZI7E 3ZSTA 5B5EO 5AQJB 4YLHA 2N2LA 2YOEA 1KK7A 4DV0T 4CI3B 1J1JA 4IHJE 2JQYA 3VE1A 1YS5A 3AE3A 2NW7A 3JCFA 3ZCJA 2Y0LA 4ZEYA 4AQGA 4UV8B 3HOEA 2V7LA 1T98A 5CA1E 3BRYA 3C5OA 4H9QC 2Q9QC 4PFPA 2X66A 3JAFA 5DQVA 4AKRA 4LSIA 2ZM6T 3HKBE 4EAHA 1AJ3A 1E2AA 5DL6A 3PDYA 5L3CB 4G63A 2J62A 4IREA 2N2NA 2J47A 5FY0A 3PUVF 1EZ3A 3AVSA 1D0ZA 4DV4T 1X79A 4TWHA 1UK5A 3TZGA 3OVUA 2VB6A 3UU3A 1YXRA 2YINA 3HOLA 2FGQX 1UURA 2XSBA 4UF0A 3AEAA 2PBIA 3AA6B 5DL7A 3WI4A 1HX8A 4JI5T 3J7Yq 2QTKA 5BR8T 5LGNB 4I4TE 4U72A 4NXMT 4KUMB 3UULA 1I6ZA 1XDOA 3L39A 4DMWA 3KBTA 4E1TA 3RYIE 4ZI3D 1NWMX 2J4GA 4XBFB 4L9IA 5ABEA 3SY7A 3K3NA 5EK2A 2NW9A 1HNWT 4ILAA 4B3ST 2CHNA 1HXXA 1N34T 3CMLA 4Q25A 4ANJA 2BKNA 2LSIA 4UV9B 3VE2A 3RIUC 2IMLA 4DR2T 3G7GA 4PNIA 2CE7A 4EXTA 3P8CD 3KVAA 3AA7A 4YFSA 4FZNA 3VY8X 2E5LT 2KMFA 1YKHB 3OKQA 3UUXB 4H63V 4Z91A 5A1LA 5IWAT 3A0BO 3ZMSB 4GCQA 3N5LA 4QHOA 2X9KA 5AQNB 5AQFB 4N59A 2L8KA 3R84B 3AEGA 5L47A 3KV6A 2OV9A 3N2OA 2PJQA 3AA7B 3EDVA 4CN6A 1HTJF 3LDQB 2KDYA 3J9X1 3UUNA 4IDQA 5TISO 3T20A 2VKHA 2Y6XA 4QH1A 5HYAA 3Q2MA 3EHZA 4DMVA 3AE9A 7PRNA 3P4SA 2F1TA 3RX6A 4L0RA 2J4UP 5JDNA 3AECA 4GYSA 2A72A 3PQSA 3UT5E 4D64A 3MKDA 4QXHB 3LK3B 4QKNA 2B1EA 3O1JA 2XQ6A 3N9PA 3C4WA 4DUZT 4JCHA 3JC6C 2ZM2A 3KZIO 1QLBA 4DR5T 2XMXA 2JMMA 2BVMA 1IBKT 2JPFA 4O3ZA 3AB3B 1QSDA 4IT4A 1MIVA 4MHCA 4OYJA 3DWOX 4IE7A 4BUMX 4LFCT 5FNVE 4O4JE 4X65T 3LK41 2BS3A 4D65A 3ZT5A 2CBJA 3AE1A 3TLWA 1ZHXA 1HG5A 5CJ5A 4RL9A 5LBQB 5AQOB 1ZHCA 4UB8O 5GONE 2LE8A 2A9UA 4YT0A 1IJ6A 3ONJA 2VQET 1MIWA 4HWFA 5L4HA 3PU8A 3AA1A 3RLFF 5CA0E 2VKOA 3GMIA 5LGTB 4PAGA 3ZC1A 2WB5A 3CQCB 4X64T 3ANWA 5JH7E 2CBIA 2AXTO 2M6IA 2Q9QD 2WVPA 1WR0A 4EGWA 3B57A 4U7IA 3Q5WA 2N1GA 4CI1B 3R6NA 2K0LA 3PUAA 4N78D 5D5DA 5AQQB 2K4TA 3BK9A 4LF8T 2XQ4A 3LK42 4JI4T 4COFA 4C90A 5BMVE 2K9AA 2WU5A 4PJ0O 5KAIO 5ETWA 3AA0A 4U31A 2RP4A 4QX7B 3UUBA 3BQLA 5LA6E 5AQKB 1NEKA 2N2MA 4O4UA 4AI6A 4HN9A 2X67A 2XQ8A 2PG8A 5JVDE 2ACXA 2NW8A 1OEDA 4MALA 3T1YT 4YSZA 3OTOT 1MIYA 5LP6E 2MBGA 3C51A 1HNZT 4IDZA 3QRAA 4IE6A 4CXYA 2M67A 4OYKA 1WCRA 3PUXF 4EYYR 1W0BA 1JNRA 5FP3A 1BR2A 4E1SA 4AKLA 2IC6A 1VCSA 2PORA 4AKIA 5DL5A 2R6GF 4JI7T 1HF8A 4P1NA 4IE5A 2XASB 2F4VT 4GKJT 3O0EA 4DV3T 3GN5B 2VVSA 3SYSA 3KV5A 4ISTA 2Y8DA 3UU5A 4QH5A 3VR8A 5LMUT 4YSXA 1WYBA 1VCTA 1VOMA 3CK6A 3QC9A 4ERRA 1Z8UA 2ZMAA 1HR0T 2R4PA 2ZLYA 3AE5A 4ZXLA 2HH7A 1GFQA 2IW5B 4LMLA 2LOSA 3ESLA 4UXNB 5DQWA 5LG4A 2A3DA 2JQ9A 3ZT7A 3FBZA 1XNQT 4IIJE 5HAXA 4K3BA 3IEEA 1IJ5A 4LSHA 3RRCA 2WBLA 2BBJA 2LSKA 8PRNA 2D2SA 3TLSA 3P4WA 2XQ7A 3ZPOA 5J2TE 2IDOB 1Q9FA 4P09A 2CA5A 2UUCT 1OPFA 5M4YA 2YN6A 1NAFA 4YXDA 3NZPA 1ZOYA 2CM0A 2NWBA 5F8PA 4AKMA 2Y0HA 2KXPA 2CLYC 2L9QA 2X9HA 5H6QB 2DHRA 4TNVA 1CHUA 3CQXC 4LMKA 1MM5A 4FESA 2V1DB 3SZDA 2H7VC 1US7B 2YDQA 4BJMA 2Q9QB 5JDQA 2CWOA 2D9DA 2XE2A 4EOZB 1H6S1 3VRAA 3PJAA 4DR6T 3P50A 2Y0KA 1OEDC 4HFVA 4O2AE 5FVKA 4BA9A 4BAYB 4LF7T 3SYBA 3N9OA 2UUAT 4WZXA 4ZOLE 2VKDA 2QGSA 1MMNA 3QRCA 3H3AA 2IIUA 3VU7H 5TAOA 3PURA 1R8IA 1MMGA 4NUUA 5CB4E 3EUHA 5JTGA 4JUYA 3NRXA 4YHJA 2XQ5A 2XZEA 5HEHA 2WWVA 2IWWA 3AAAB 5HEGA 3HW9A 4QXBB 3AEDA 3UQ4A 4FSPA 2W63A 4ISSA 2V26A 1ZHTA 3MXZA 2WJRA 3EMNX 3HL6A 2FGRA 4RJWA 1Y64B 3POQA 3M65A 4HFBA 2BDEA 3O1IA 4E7ZA 4U9CA 5L3GB 3EVYA 3RIUA 4I55E 3EABA 5EE2A 3KVBA 4YJ3E 4HWIB 5GTIO 4GCPA 3C50A 4FJOA 3NJTA 2KZ7A 2LT3A 4TNWA 2WMOA 3CPZA 3AE7A 5FY7A 2X27X 3PRNA 2X9YA 2UXCT 4IE4A 2M06A 5F5WA 4ZZCA 2WWUA 3WAJA 5L3BB 4EZ4A 3FB2A 2E5VA 2FJDA 5JRCA 3NVOA 5J1GA 4WNKA 3P4QA 4O3WA 3BRZA 4FMSA 1FMVA 4JI2T 2Y7SA 5FL0A 3ZN1B 5JR9C 3DWNA 2FJEA 3HKEE 3K19A 4EV6A 1WFDA 2DWKA 3RH3A 4EYUA 2LHNA 2O4VA 2JQKA 4H9SE 2X9XA 3A0HO 3MACA 2LSJA 3I9WA 4EEBA 5JRCB 4FT6A 5IYUA 2BKPA 3VZTX 3I0QA 3UPGA 3LJCA 3HWBA 2XG6A 2R4OA 4AKRB 3K3OA 3P4PA 1ZEEA 2LRKA 2EHOA 1SHZC 3NWIA 3AAIA 5HCJA 4LF5T 2RPAA 3KINB 2C5JA 5JDGA 4J2CA 2LKHA 2W00A 5FKYA 3DZMA 2I6HA 3K1SA 5HWXA 3RHWA 3W15B 2LKGA 3VHLA 2K24A 1ZHZA 2R8AA 3RI5A 5HWYA 2YDRA 3PORA 4DVDA 4OX9T 3RC3A 2LOPA 3QB5K 4N74A 3PTRB 2JQQA 2I0MA 1QJPA 2KLQA 2CCQA 2W66A 4GYRA 1LRZA 2B76A 2V5CA 5H2FO 4DBRA 4UF0B 5IYZE 4LFAT 3AE2A 2HPJA 3CKDA 3ZJ1A 4U2ZA 5C2TA 3RKOA 5LNKA 2UXNB 2V5DA 4C4VA 2ZFGA 2CMRA 3NZQA 3AAEA 2VK9A 1Z0PA 3KVDD 4JLEA 1T16A 4B61A 4JFBA 4AFKA 3SWHA 5LG3A 2K5BB 2UXXB 1H7CA 2IAKA 3ZLIA 5KX5E 3RYHE 2IC9A 2AXDS 1MNDA 4ZI2C 5HCMA 4QH4A 4B3RT 1OEDE 2YNKA 4JI0T 1DU2A 4AXPA 2IWVA 4TWFA 1MMDA 4A97A 2LRLA 1HX1B 2JIWA 4HFIA 4TV8E 4A56A 4JYAT 3FXEB 5IUXA 3T0SA 4A5XA 4WBOA 4DR3T 4N75A 3TKLB 4O2BE 2X51A 4PK5A 1G90A 4D5UA 4LF4T 4CTDA 3QK6A 4DO0A 4YTPA 5LB7B 2SPCA 1OXZA 2X0YA 5LCYA 4EIWA 3V8UA 3SRZA 4FSOA 3FZMB 1IBMT 3V5SA 3FYXA 1ZHYA 3H37A 4KR8A 2JMHA 5LHHB 1OWAA 2W0GA 3IF8B 4O3YA 2MPKA 4H63H 4GIWA 2EHOC 5HEUA 2X0LB 4F8HA 5G26A 4Z3TA 1HCIA 3UTKA 3ZC0A 5ABFA 4Z90A 4I50E 1QUUA 3EI0A 2V6YA 4JBWF 5LHIB 2VKJA 2FUPA 2X0HA 5AQVB 2R4LA 5JREA 3ZEFB 4PUXA 5AQRB 4X1YE 4N58A 4AQFA 4YSYA 3JTYA 3ZKRA 4NIQA 3C64A 2DL1A 4GKKT 3PV0F 4GK5E 3FXDB 4O49A 3BQKA 5AQGB 4HWCA 3MJXA 4HFHA 2LHRA 2ODUA 5JDLA 3RYCE 2R4NA 4EEDA 4KHZF 2G0UA 5IHYA 2XPKA 5HEJA 1T1LA 3LSVA 2V7IA 3AA1B 3ZN0B 5DL8A 3ANWB 2MNHA 4C00A 4IDPA 2WDQA 4PK6A 1S94A 3PGUA 1WRDA 4A98A 1YD8G 5JDMA 1FMWA 1N33T 3FBLA 5EK3A 2BZBA 5AQHB 4DV6T 1LVFA 2CLYB 1Q9GA 3PUSA 3U3IA 2JJ9A 2GK9A 4UELA 3UUMA 3AA0B 2XY8B 1KFYA 5E79O 3IA3A 4UB6O 3WI5A 5GTHO 4MBQA 4KR4A 3AEFA 2XUEA 1WR6A 1U5PA 4U3CA 4HTEA 3Q5XA 4ILUA 1OEDB 5FXWA 4AISA 1J5ET 2V6XA 3CX7B 2E9XA 4XAXB 4GK0E 2R89A 1E54A 4ASKA 5B66O 2KINB 4CZZB 4PJJA 2JRKA 3KV9A 2OMFA 5LYJE 3CVRA 3AE4A 4UR9A 3KDSE 3UU8A 4CQIA 3T8OA 2XAQB 3FZHB 2WY2A 4ZHQE 2E2AA 2XM2A 3AE6A 1QJ8A 2V7KA 1S5LO 4NPPA 4ZI2D 1GFNA 2QA7A 3PE0A 3VZUX 2WJQA 3OYXA 4XZCA 2MTQA 4G2AA 4QWNB 2X9WA 2MYSA 4AQFC 1KF6A 1E7PA 2XAHB 1HFAA 4CXWA 2YKSA 4U7YA 4FRXA 1BR0A 3L09A 2F1VA 4YHHT 1FEWA 2LM9A 4DV7T 4JEUB 4TX5A 3RBHA 3PQUA 2XAJB 2BKOA 3DA3A 3G06A 5JR9A 4IL9A 4IDNA 4DV5T 2WDRA 3ZYLA 3UU4A 4X1KE 4O4LE 3E08A 4JI1T 4YTMA 4YJ2E 4IL4A 2NR4A 2N9DA 3H3MA 2VQFT 3POXA 2X68A 3ONLC 4X66T 2W62A 5ABGA 4B3MT 4OK0A 3LK2A 2CXLA 3JC6D 3N2GE 4O8SA 4HKAA 2EHOD 2LEHA 3E0ZA 3V5UA 2FJBA 2KXPB 3DJBA 3RKGA 1L0VA 2NP9A 4IDOA 2H7OA 1IZNA 4QXCB 4TWDA 4FI5A 3A5XA 3CWZB 2WQYA 1SUMB 4LF6T 3MA9A 3ZYKA 1GFOA 4BJNA 2W81C 5L3DB 1T7SA 2WCAA 5HEOA 2JMKA 4G75A 2ES0A 5ABHA 2UXBT 3AXJA 3NKZA 3DP7A 2WP9A 4DNDA 1ZP0A 4OHFA 3ZMZB 1YW0A 4AYMC 1LVKA 2XSAA 4ZZBA 2CXDA 3FHNA 4E7SA 4B6XA 4ILBA 2E9XC 1W9RA 3P4RA 3RPUA 4O4IE 2KNDA 4LMJA 1D1CA 4YTNA 5FVNA 3K3QC 4P0BA 3ZCIA 3POUA 1KNZA 3K8PC 5AQTB 2H88A 4HGAA 4K0KT 3QUJA 5JDPA 5AFUK 3F57A 5F3JA 1QJ9A 2QRXA 3EDUA 3X1DA 2LHFA 4U2YA 5C8YE 4AUIA 2V7JA 2XJ7A 2J1NA 1J5WA 3AEEA 4DV1T 4KP3C 5HXEA 4RJXA 4P0AA 3SFDA 2CWYA 3FZKB 3DA4A 4JI8T 1XWMA 3ETUA 1OSMA 2YEVC 4UVAB 5L4EA 3GP6A 3FZFB 1D0YA 4GCSA 4MLKA 2W61A 2ODJA 4DR4T 3RRWA 4PJLA 1UCUA 1IAPA 3C4XA 3F2EA 1SA0E 5EZYE 2DLRA 1I94T 4DR7T 2XQ3A 4HE8A 2FBWA 2KT9A 1T8BA 3D0TA 4GHBA 3E22E 2LFUA 5FY1A 2KZ7B 1UGOA 2VWAA 1THQA 4F4BA 1SE7A 1E1HB 1W0AA 1HXUA 2GE4A 3O4XE 2DI4A 2KWIB 3HR0A 2OLTA 4JI6T 4C69X 3ZYMA 2WU2A 3N9LA 2VL0A 2PRNA 3ETVA 4IGUA 3TLVA 3ZMUB 3B13A 5EK4A 2CHOA 2XQYA 4TV9E 1HXTA 4UVCB 4OFZA 3I0OA 1T72A 3O1HA 5J0ZA 2UXDT 3GA8A 3RF1A 4KMCA 5LJNA
chains in the Genus database with same CATH topology
2I59A 4O4XA 3LK2B 1BR1A 2M67A 4EIWA 4OYKA 3V8UA 4H9NC 3AA6A 3NRYA 3PUGA 4EYYR 3SRZA 2D0TA 2Z6EA 5FP3A 4FSOA 5LXTE 4UEMA 3HKCE 3UFEA 1BR2A 3V5SA 5ADXL 4E1SA 4QQ1A 3IBPA 5KDMC 1ZHYA 3FYXA 2DWGA 5ADXK 3H37A 4KR8A 2JMHA 5LHHB 1OWAA 2W0GA 3IF8B 4AKLA 1BT9A 2IC6A 3AAAA 4O3YA 4O3XB 2WSSV 1IZNB 4H63H 4GIWA 2PORA 2EHOC 4AKIA 2X0LB 4FUVA 5G26A 4Z3TA 1HCIA 6PRNA 2J1DG 2MOZA 2A2FX 3UTKA 3ZC0A 5DL5A 5LGUB 2C5IT 4WW0A 5HXRA 2YU2A 4RLBA 1HF8A 4I50E 2EHOB 1QUUA 4IE5A 2XASB 1D1AA 1VRBA 5LOVE 3HA4A 4U74A 2CXFA 5T5FA 3O0EA 4XNLA 5LHIB 2VKJA 3GN5B 4MFRA 1PHOA 1MMAA 3AVRA 4ADZA 3F31A 3SYSA 3SY9A 1ZV4X 3KV5A 4ISTA 5JREA 5HXCA 3ZEFB 1S35A 2Y8DA 2YU1A 4PUXA 1FIOA 3KV4A 4FZLA 4ZS2A 2NTXA 1WYBA 1VOMA 4X1YE 4N58A 3KFWX 3QC9A 4AQFA 4ERRA 2ZMAA 1V9DA 3JTYA 4XNKA 4TZ4C 3MK7C 1BXWA 3C64A 2ZLYA 2HH7A 3KBUA 3RC8A 1GFQA 4GK5E 4I43B 3FXDB 4O49A 3BQKA 3T24A 2IW5B 2W80C 4NUVA 2LOSA 3MJXA 3GWHA 1G8XA 1PRNA 3ESLA 4UXNB 5DQWA 5LG4A 2A3DA 2ERVA 2XE1A 4O4HE 5FXXA 3DTOA 3FBZA 3I9YA 2LHRA 3ZJ2A 4IIJE 5HAXA 5JDFA 4PW8A 4CI2B 4ZI7E 2ZLDA 3VKHA 2ODUA 3IEEA 5JDLA 1IJ5A 3RYCE 4AYID 4LSHA 3RRCA 2WBLA 4YLHA 3AAEB 2LSKA 2N2LA 3N9MA 8PRNA 2G0UA 2WM9A 2D2SA 5IHYA 5J2TE 3ZPOA 4FZMA 1ORMA 1Q9FA 1KK7A 2V7IA 2CA5A 4P09A 4CI3B 1OPFA 4LSEA 3AA1B 4IHJE 5M4YA 3ZN0B 3PUQA 2MHLA 2XE5A 1NAFA 3VE1A 1YS5A 3NZPA 5DL8A 2CEAA 2NW7A 1GFMA 2CM0A 3CX8B 3ANWB 3ZCJA 2MNHA 2NWBA 5F8PA 1P4TA 2Y0LA 4AKMA 4AQGA 4PK6A 1S94A 4UV8B 2KXPA 2Y0HA 3HOEA 2CLYC 2L9QA 1WRDA 2X9HA 5H6QB 2V7LA 2DHRA 1T98A 1YD8G 5CA1E 5JDMA 1FMWA 3C5OA 3FBLA 4H9QC 5EK3A 2Q9QC 2BZBA 4PFPA 1LVFA 2X66A 2CLYB 3CQXC 5DQVA 1Q9GA 3PUSA 3NBXX 4AKRA 1MM5A 3U3IA 4FESA 2V1DB 3SOLA 3SZDA 2H7VC 2LJLA 1US7B 2K48A 2JJ9A 4LSIA 2GK9A 3CQGB 5LBMA 3HKBE 4BJMA 2Q9QB 3SS1A 4UELA 5JDQA 3UUMA 4EAHA 5HXSA 3AA0B 1AJ3A 4WBNE 2CWOA 5DL6A 3PDYA 2XE2A 4EOZB 3LK3A 1H6S1 3WI5A 2E9XD 4C91A 4MBQA 4KR4A 5L3CB 4G63A 2Y0KA 2XUEA 1WR6A 4HFVA 4O2AE 4BA9A 1U5PA 5HXHA 2C0SA 4HTEA 2N2NA 4BAYB 4L5GA 3SYBA 3N9OA 3Q5XA 5FY0A 2BVLA 4ZOLE 2VKDA 4ILUA 4F6RC 1EZ3A 3AVSA 1D0ZA 5FXWA 2QGSA 1X79A 1MMNA 3TZGA 2OA5A 3CX7B 2E9XA 2VB6A 3H3AA 5J2UE 4XAXB 4GK0E 3VU7H 3QRCA 3PURA 5TAOA 3HI2A 1MMGA 2YINA 3OJAA 4NUUA 4Z8XA 5CB4E 2FGQX 3PU3A 3EUHA 3HOLA 1E54A 4X1IE 4ASKA 4UF0A 4JUYA 2KINB 2PBIA 3AA6B 3NRXA 2JRKA 2RA1A 4PJJA 3KV9A 4CZZB 4GF4A 2OMFA 5DL7A 3WI4A 2XHEB 3IHRA 1LKXA 5LYJE 1HX8A 3S4UA 1ZHWA 2NOXA 3J7Yq 2QTKA 3CVRA 4YHJA 5LGNB 4I4TE 4U72A 2V7MA 3AAAB 4KUMB 3KDSE 5L3FB 4RLCA 1YKEB 3UULA 4CQIA 3HW9A 3T8OA 4QXBB 3WAKA 2XAQB 4DMWA 2ODVA 3KBTA 4ZHQE 4FSPA 2W63A 4E1TA 2P9BA 3RYIE 4ISSA 1B7TA 2V26A 1MPFA 1ZHTA 1QJ8A 2V7KA 3MXZA 4EZHA 4ZI3D 3EMNX 3NSGA 3HL6A 4PFOA 4UVBB 4ZI2D 2XAFB 1GFNA 2FGRA 1Y64B 3POQA 4RJWA 1NWMX 3M65A 2QA7A 3PE0A 4XBFB 3VZUX 2BDEA 3O1IA 4E7ZA 2XTQA 4L9IA 3SY7A 3OYXA 5L3GB 4U9CA 2LSGA 4XZCA 2PFVA 3EVYA 3K3NA 5EK2A 2MTQA 4G2AA 4H9PC 4QWNB 2NW9A 2X9WA 4I55E 2MYSA 5EE2A 3KVBA 4YJ3E 4AQFC 1HXXA 4LSFA 2XAHB 4GCPA 1HFAA 4PK4A 4CXWA 4KRAA 3P7IA 3MZKB 3C50A 3CMLA 4FJOA 4V1Av 4ANJA 1BR0A 4FRXA 3SZVA 2LSIA 4UIGA 4UV9B 2L3LA 3L09A 2KZ7A 2F1VA 3VE2A 1FEWA 2LM9A 2LT3A 4JEUB 4TX5A 3RBHA 3PQUA 4AYEC 2XAJB 3G7GA 2WMOA 4PNIA 2CE7A 4EXTA 3CPZA 3DA3A 3P8CD 3KVAA 3OYZA 3AA7A 4YFSA 2ZM8A 2HPLA 4FZNA 3VY8X 5FY7A 5JR9A 2X27X 3PRNA 4G76A 2X9YA 2M06A 2KMFA 4IE4A 3ZYLA 4X1KE 2WWUA 4O4LE 3E08A 4AKHA 3WAJA 1BR4A 5L3BB 1YKHB 3OKQA 3UU2A 4EZ4A 3FB2A 3LBXA 3RYFE 3UUXB 4YJ2E 2N9DA 5FYMA 1MM4A 5JRCA 4AYNA 4H63V 5J1GA 4WNKA 5A1LA 4O3WA 1BH3A 3POXA 4FMSA 2X68A 3ZMSB 1FMVA 3N5LA 2Y7SA 4GCQA 2W62A 4QHOA 4N59A 3ZN1B 2L8KA 3R84B 5JR9C 3KV6A 4OK0A 3LK2A 2CXLA 3JC6D 3N2OA 2PJQA 3AA7B 3EDVA 3N2GE 3HKEE 4O8SA 3K19A 1HTJF 4HKAA 1UX5A 4M1PA 2KDYA 2EHOD 3RH3A 2DWKA 2LEHA 3E0ZA 2LHNA 3J9X1 3UUNA 3V5UA 4H9SE 4EYUA 2O4VA 3A2SX 2X9XA 2KXPB 1U4QA 3DJBA 3T20A 3MACA 2VKHA 2Y6XA 2NP9A 3C98B 2H7OA 2LSJA 3LBXB 4QXCB 5HYAA 1IZNA 5LHGB 3I9WA 4FI5A 5JRCB 4FT6A 5IYUA 2XAGB 3A5XA 3Q2MA 3CWZB 3I0QA 3VZTX 3UPGA 3LJCA 3MA9A 4DMVA 7PRNA 2F1TA 3HWBA 3RX6A 2XG6A 4L0RA 4AKRB 3K3OA 3LG7A 3ZYKA 1GFOA 2NTYA 1ZEEA 2J4UP 2EHOA 4BJNA 1SHZC 2W81C 5JDNA 3AAIA 5L3DB 2JMKA 4G75A 2ES0A 4GYSA 2A72A 3KINB 1CUNA 2C5JA 5JDGA 4J2CA 3PQSA 3UT5E 4D64A 3DP7A 2W00A 3GN5A 3MKDA 4QXHB 1WYCA 1O3XA 4DNDA 3LK3B 4QKNA 2B1EA 2D0UA 3O1JA 4H9OC 3C4ZA 4OHFA 3N9PA 3C4WA 2KC0A 4JCHA 5HWXA 3ZMZB 3JC6C 1YW0A 3W15B 2ZM2A 4AYMC 1LVKA 4TUYE 3VHLA 2K24A 1ZHZA 2CXDA 2WAUA 3N9QA 2XMXA 3FHNA 4AZLA 5PRNA 4E7SA 2JMMA 2BVMA 4B6XA 3O9XA 2Y2XA 5HWYA 2JPFA 2E9XC 4O3ZA 3PORA 4DVDA 2LSYA 3RC3A 3AB3B 1QSDA 3ONXA 3RPUA 1MIVA 2VASA 3VKGA 5JQGE 4O4IE 2LOPA 4MHCA 4OYJA 2KNDA 3PTRB 4K0UA 4X20E 2JQQA 4IE7A 4BUMX 2XE3A 1D1CA 1QJPA 5FNVE 2KLQA 1ZKEA 2YPVA 2E9XB 4O4JE 3LK41 2CCQA 4GYRA 5FVNA 4D65A 2M07A 3K3QC 4P0BA 5JDHA 1LRZA 3ZCIA 3POUA 1KNZA 5GV0A 3K8PC 5LJMA 4DBRA 4UF0B 1ZHXA 3Q9DA 4HGAA 5IYZE 3HKDE 3QUJA 1HG5A 5JDPA 2DCFA 4RL9A 2Y48B 5LBQB 2HPJA 3CKDA 3ZJ1A 5AFUL 5AFUK 3F57A 5F3JA 1ZHCA 5L2LA 5H6RB 3RKOA 5LNKA 2UXNB 1QJ9A 1G73A 2DNXA 5GONE 2ZFGA 2CMRA 3EDUA 5DABA 2LE8A 3NZQA 4PJMA 2LHFA 1IJ6A 1D0XA 3AAEA 5FXZA 5C8YE 4AUIA 1HG2A 1MIWA 2V7JA 2J1NA 1HS7A 4H9RC 2H3RA 3UAQA 4KP3C 4PJNA 5HXEA 4RJXA 4P0AA 2C5KT 2VK9A 1Z0PA 3KVDD 4JLEA 5KMGP 3VZWX 3PU8A 2CWYA 3AA1A 5CA0E 4FOZA 2VKOA 3DA4A 4B61A 3GMIA 4JFBA 4AFKA 5LGTB 3SWHA 4PAGA 3ZC1A 2XTLA 2K5BB 1OSMA 3ETUA 2UXXB 1H7CA 4QX8B 2YEVC 3CQCB 4AKGA 4UVAB 5E0OA 2IAKA 3ANWA 5L3EB 4DBQA 5JH7E 3GP6A 3ZLIA 3N9NA 5KX5E 3RYHE 1D0YA 2Q9QD 2IC9A 4GCSA 3B57A 2ZM0A 2W61A 4MLKA 3Q5WA 1MNDA 2N1GA 4ZI3C 4EB6E 4CI1B 2ODJA 2YK0A 3RRWA 4ZI2C 3R6NA 2K0LA 3PUAA 4PJLA 2YNKA 4N78D 1UCUA 5D5DA 1IAPA 3C4XA 5FMNA 4AXPA 3CX6B 3F2EA 1MMDA 1SA0E 2WMNA 2K4TA 4GOUA 5EZYE 2DLRA 3BK9A 3BQIA 4HE8A 2KT9A 3D0TA 3LK42 4JEHB 4GHBA 3E22E 4C90A 4TV8E 5BMVE 2LFUA 2K9AA 4TN7B 4AYDC 5FY1A 5FXVA 2KZ7B 2Q9QA 3L3PA 1D1BA 3I1AA 4A56A 2VWAA 5ETWA 1THQA 3AA0A 3VY9X 4F4BA 2RP4A 4QX7B 3FXEB 1E1HB 1HXUA 2GE4A 3O4XE 3T0SA 4WBOA 2DI4A 2KWIB 3HR0A 3LFMA 4C69X 3BQLA 5LA6E 3TKLB 2VL8A 3U78A 3ZYMA 4KBMB 4O2BE 3N9LA 3OBVE 5JR9B 2X51A 4ZS3A 1UX4A 2D5UA 3N2KE 2N2MA 2PRNA 2XTRA 5LCYA 4FRTA 4PK5A 3ETVA 4IGUA 5DJQC 4AI6A 4O4UA 4HN9A 4IE0A 3WI3A 2X67A 3ZMUB 1G90A 3B13A 2PG8A 5EK4A 5JVDE 1WLXA 2ACXA 2NW8A 2XQYA 4TV9E 1GFPA 4MALA 4CXXA 4HEAA 1HXTA 4D5UA 4UVCB 4OFZA 2KWHA 1MIYA 3QK6A 3I0OA 4DO0A 3ZMVB 3O1HA 5LP6E 2MBGA 3C51A 4IDZA 2SPCA 1MNEA 1OXZA 3ZMTB 3GA8A 2E8IA 3QRAA 4KMCA 5LJNA 4IE6A 4CXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK2 B;  3LK3 A;  3AA6 A;  3AAE B;  2KXP B;  3LK4 1;  3LK3 B;  3LK4 2;  2KZ7 A;  5ADX L;  3AA1 A;  3AA6 B;  5ADX K;  1IZN A;  3AAA A;  2KZ7 B;  3AA1 B;  4AKR A;  1IZN B;  5AFU L;  3AA0 A;  5AFU K;  3AAA B;  3AA7 A;  4AKR B;  3LK2 A;  3AA0 B;  3AA7 B;  3AAE A;  2KXP A; 
#chains in the Genus database with same CATH topology
 2I59 A;  4O4X A;  2BG9 C;  4WYV A;  3AA6 A;  3NRY A;  1Y01 A;  2D0T A;  2Z6E A;  5LXT E;  4UEM A;  4QQ1 A;  5ADX K;  3UQ7 A;  2DWG A;  2IUB A;  5AQS B;  1BT9 A;  1XMO T;  2WSS V;  4FUV A;  1XDP A;  3JCU O;  6PRN A;  4DR1 T;  2A2F X;  5LGU B;  3RQW A;  4WW0 A;  2YU2 A;  2EHO B;  3RIA A;  1NEN A;  5CGM A;  1VRB A;  2CXF A;  5T5F A;  4MFR A;  1PHO A;  2QYW A;  3B5M A;  1ZV4 X;  2VUR A;  2YU1 A;  1FIO A;  3KV4 A;  3L8R A;  4ZS2 A;  5C3J A;  2F1C X;  5KAF O;  4TZ4 C;  3MK7 C;  1BXW A;  3ZSS A;  4KX6 A;  2CPT A;  3SFE A;  4I43 B;  3QOF A;  1PRN A;  2ERV A;  2XE1 A;  3I9Y A;  3ZJ2 A;  3M3Z B;  3VKH A;  1XZY A;  4DUY T;  4LF9 T;  4C4V B;  4AYI D;  4X5T A;  3AAE B;  5FVL A;  2YDS A;  3N9M A;  2PTF A;  2WM9 A;  4FZM A;  1ORM A;  4HFC A;  4LSE A;  3PUQ A;  2MHL A;  2XE5 A;  2CEA A;  1GFM A;  2R88 A;  3CX8 B;  3RQU A;  1P4T A;  4CN1 A;  2XQ9 A;  3PUZ F;  3NBX X;  2AE9 A;  3PUW F;  5AQU B;  3SOL A;  2LJL A;  2K48 A;  2WZH A;  2ACZ A;  3CQG B;  5LBM A;  3SS1 A;  2FJA A;  2WZI A;  5HXS A;  3Q5E A;  4WBN E;  2W2U A;  3LK3 A;  2JQH A;  2E9X D;  3TLU A;  4C91 A;  5KXJ A;  5HXH A;  2C0S A;  5LMN T;  4I0U A;  4L5G A;  2BVL A;  4F6R C;  2UU9 T;  1X9B A;  3CIR A;  4FQE A;  2BBH A;  2OA5 A;  5J2U E;  2W67 A;  2XQA A;  3HI2 A;  3UU6 A;  3OJA A;  4Z8X A;  3PU3 A;  4X1I E;  2RA1 A;  2XHE B;  3IHR A;  1LKX A;  3S4U A;  1ZHW A;  2NOX A;  2VVN A;  4LFB T;  2HHH T;  2V7M A;  5L3F B;  4RLC A;  3FZL B;  1YKE B;  4HWH A;  3WAK A;  2BS4 A;  2ODV A;  2P9B A;  1B7T A;  1MPF A;  4EZH A;  3NSG A;  5ABF B;  4PFO A;  4UVB B;  2XAF B;  2XTQ A;  2V6Y B;  4B3T T;  2LSG A;  2PFV A;  1UUS A;  4H9P C;  3PGR A;  1M62 A;  4PR7 A;  4LSF A;  4PK4 A;  4KRA A;  3P7I A;  3MZK B;  2XM1 A;  4V1A v;  3SZV A;  4UIG A;  2L3L A;  4HFE A;  1KNP A;  4AYE C;  3UFG A;  1KNR A;  2BG9 E;  3OYZ A;  2IHR 1;  2ZM8 A;  2HPL A;  2M6B A;  4G76 A;  5G3A A;  5CFB A;  4AKH A;  4HWD A;  1BR4 A;  3UU2 A;  3LBX A;  3RYF E;  5FYM A;  1MM4 A;  4AYN A;  1BH3 A;  3ZT6 A;  3QB5 A;  1UX5 A;  4M1P A;  3A2S X;  5FL1 A;  1U4Q A;  4AIU A;  3AE8 A;  3C98 B;  3LBX B;  3EAM A;  5LHG B;  2XAG B;  5AQI B;  5AQP B;  4DV2 T;  3LG7 A;  2NTY A;  1W09 A;  4KHP T;  2LLY A;  4X62 T;  1CUN A;  3GN5 A;  1WYC A;  1O3X A;  2CRB A;  2D0U A;  4H9O C;  4CN4 A;  3C4Z A;  2KC0 A;  3ABV A;  4DID B;  2HN2 A;  4TUY E;  2WAU A;  3N9Q A;  4AZL A;  5PRN A;  3TLT A;  2H89 A;  3O9X A;  2Y2X A;  2LSY A;  3ONX A;  1YQ4 A;  3VKG A;  2VAS A;  5JQG E;  4K0U A;  4X20 E;  2MAW A;  2XE3 A;  2YPV A;  1ZKE A;  2E9X B;  3BS0 A;  2K3W A;  2M07 A;  2HN1 A;  5JDH A;  5AQM B;  5GV0 A;  5LJM A;  3Q9D A;  3VRB A;  3HKD E;  2DCF A;  1N32 T;  2Y48 B;  5AFU L;  5L2L A;  5H6R B;  2KSR A;  1G73 A;  2DNX A;  5DAB A;  4PJM A;  3PGS A;  1XMQ T;  1D0X A;  5FXZ A;  1HG2 A;  1HS7 A;  4H9R C;  2H3R A;  3UAQ A;  4PJN A;  2WDV A;  2C5K T;  4JV5 T;  5KMG P;  2BS2 A;  3VZW X;  4FOZ A;  2XTL A;  4QX8 B;  4AKG A;  5E0O A;  5L3E B;  4DBQ A;  3N9N A;  2ZM0 A;  4EB6 E;  4ZI3 C;  2YK0 A;  3JAD A;  1GQE A;  5FMN A;  3CX6 B;  2WMN A;  5G39 A;  1IBL T;  4GOU A;  1KEY A;  3BQI A;  2WS3 A;  3A8Y C;  4JEH B;  1YQ3 A;  4TN7 B;  4AYD C;  5FXV A;  1HNX T;  1FJG T;  2Q9Q A;  3L3P A;  1D1B A;  3I1A A;  3VY9 X;  4NXN T;  4JI3 T;  3JAE A;  2V8S V;  3Q5D A;  2UUB T;  3LFM A;  4K3C A;  2VL8 A;  3U78 A;  4KBM B;  3OBV E;  3RIF A;  5JR9 B;  4AQY T;  4ZS3 A;  1JNZ A;  1UX4 A;  2D5U A;  3N2K E;  4FRT A;  2XTR A;  5DJQ C;  2BG9 A;  1XNR T;  4IE0 A;  3WI3 A;  1WLX A;  1GFP A;  4CXX A;  4HEA A;  4HFD A;  2W4X A;  2KWH A;  3RGL A;  3ZMV B;  4IL6 O;  3ZMT B;  1MNE A;  2E8I A;  4XNK A;  4GF4 A;  3LK2 B;  1BR1 A;  3A7M A;  5G38 A;  4H9N C;  1M7K A;  3T1H T;  3QNU A;  3PUG A;  2LM2 A;  3HKC E;  3UFE A;  4ILC A;  5ADX L;  3IBP A;  5KDM C;  2BG9 B;  3AAA A;  4O3X B;  1IZN B;  2J1D G;  2MOZ A;  2QVA A;  1N36 T;  2C5I T;  5HXR A;  4RLB A;  4KI0 F;  3OPC A;  1D1A A;  5LOV E;  3HA4 A;  4U74 A;  3AXJ B;  4XNL A;  1MMA A;  3AEB A;  3AVR A;  3F31 A;  4ADZ A;  3SY9 A;  3PUY F;  3VR9 A;  5HXC A;  1S35 A;  3PF1 A;  4FZL A;  4YY3 T;  2NTX A;  3PJA J;  3KFW X;  1V9D A;  3WU2 O;  3KBU A;  3RC8 A;  3T24 A;  2W80 C;  4NUV A;  4U33 A;  3GWH A;  1G8X A;  5AQL B;  4O4H E;  5FXX A;  3DTO A;  5JDF A;  2ZLD A;  4CI2 B;  4PW8 A;  4ZI7 E;  3ZST A;  5B5E O;  5AQJ B;  4YLH A;  2N2L A;  2YOE A;  1KK7 A;  4DV0 T;  4CI3 B;  1J1J A;  4IHJ E;  2JQY A;  3VE1 A;  1YS5 A;  3AE3 A;  2NW7 A;  3JCF A;  3ZCJ A;  2Y0L A;  4ZEY A;  4AQG A;  4UV8 B;  3HOE A;  2V7L A;  1T98 A;  5CA1 E;  3BRY A;  3C5O A;  4H9Q C;  2Q9Q C;  4PFP A;  2X66 A;  3JAF A;  5DQV A;  4AKR A;  4LSI A;  2ZM6 T;  3HKB E;  4EAH A;  1AJ3 A;  1E2A A;  5DL6 A;  3PDY A;  5L3C B;  4G63 A;  2J62 A;  4IRE A;  2N2N A;  2J47 A;  5FY0 A;  3PUV F;  1EZ3 A;  3AVS A;  1D0Z A;  4DV4 T;  1X79 A;  4TWH A;  1UK5 A;  3TZG A;  3OVU A;  2VB6 A;  3UU3 A;  1YXR A;  2YIN A;  3HOL A;  2FGQ X;  1UUR A;  2XSB A;  4UF0 A;  3AEA A;  2PBI A;  3AA6 B;  5DL7 A;  3WI4 A;  1HX8 A;  4JI5 T;  3J7Y q;  2QTK A;  5BR8 T;  5LGN B;  4I4T E;  4U72 A;  4NXM T;  4KUM B;  3UUL A;  1I6Z A;  1XDO A;  3L39 A;  4DMW A;  3KBT A;  4E1T A;  3RYI E;  4ZI3 D;  1NWM X;  2J4G A;  4XBF B;  4L9I A;  5ABE A;  3SY7 A;  3K3N A;  5EK2 A;  2NW9 A;  1HNW T;  4ILA A;  4B3S T;  2CHN A;  1HXX A;  1N34 T;  3CML A;  4Q25 A;  4ANJ A;  2BKN A;  2LSI A;  4UV9 B;  3VE2 A;  3RIU C;  2IML A;  4DR2 T;  3G7G A;  4PNI A;  2CE7 A;  4EXT A;  3P8C D;  3KVA A;  3AA7 A;  4YFS A;  4FZN A;  3VY8 X;  2E5L T;  2KMF A;  1YKH B;  3OKQ A;  3UUX B;  4H63 V;  4Z91 A;  5A1L A;  5IWA T;  3A0B O;  3ZMS B;  4GCQ A;  3N5L A;  4QHO A;  2X9K A;  5AQN B;  5AQF B;  4N59 A;  2L8K A;  3R84 B;  3AEG A;  5L47 A;  3KV6 A;  2OV9 A;  3N2O A;  2PJQ A;  3AA7 B;  3EDV A;  4CN6 A;  1HTJ F;  3LDQ B;  2KDY A;  3J9X 1;  3UUN A;  4IDQ A;  5TIS O;  3T20 A;  2VKH A;  2Y6X A;  4QH1 A;  5HYA A;  3Q2M A;  3EHZ A;  4DMV A;  3AE9 A;  7PRN A;  3P4S A;  2F1T A;  3RX6 A;  4L0R A;  2J4U P;  5JDN A;  3AEC A;  4GYS A;  2A72 A;  3PQS A;  3UT5 E;  4D64 A;  3MKD A;  4QXH B;  3LK3 B;  4QKN A;  2B1E A;  3O1J A;  2XQ6 A;  3N9P A;  3C4W A;  4DUZ T;  4JCH A;  3JC6 C;  2ZM2 A;  3KZI O;  1QLB A;  4DR5 T;  2XMX A;  2JMM A;  2BVM A;  1IBK T;  2JPF A;  4O3Z A;  3AB3 B;  1QSD A;  4IT4 A;  1MIV A;  4MHC A;  4OYJ A;  3DWO X;  4IE7 A;  4BUM X;  4LFC T;  5FNV E;  4O4J E;  4X65 T;  3LK4 1;  2BS3 A;  4D65 A;  3ZT5 A;  2CBJ A;  3AE1 A;  3TLW A;  1ZHX A;  1HG5 A;  5CJ5 A;  4RL9 A;  5LBQ B;  5AQO B;  1ZHC A;  4UB8 O;  5GON E;  2LE8 A;  2A9U A;  4YT0 A;  1IJ6 A;  3ONJ A;  2VQE T;  1MIW A;  4HWF A;  5L4H A;  3PU8 A;  3AA1 A;  3RLF F;  5CA0 E;  2VKO A;  3GMI A;  5LGT B;  4PAG A;  3ZC1 A;  2WB5 A;  3CQC B;  4X64 T;  3ANW A;  5JH7 E;  2CBI A;  2AXT O;  2M6I A;  2Q9Q D;  2WVP A;  1WR0 A;  4EGW A;  3B57 A;  4U7I A;  3Q5W A;  2N1G A;  4CI1 B;  3R6N A;  2K0L A;  3PUA A;  4N78 D;  5D5D A;  5AQQ B;  2K4T A;  3BK9 A;  4LF8 T;  2XQ4 A;  3LK4 2;  4JI4 T;  4COF A;  4C90 A;  5BMV E;  2K9A A;  2WU5 A;  4PJ0 O;  5KAI O;  5ETW A;  3AA0 A;  4U31 A;  2RP4 A;  4QX7 B;  3UUB A;  3BQL A;  5LA6 E;  5AQK B;  1NEK A;  2N2M A;  4O4U A;  4AI6 A;  4HN9 A;  2X67 A;  2XQ8 A;  2PG8 A;  5JVD E;  2ACX A;  2NW8 A;  1OED A;  4MAL A;  3T1Y T;  4YSZ A;  3OTO T;  1MIY A;  5LP6 E;  2MBG A;  3C51 A;  1HNZ T;  4IDZ A;  3QRA A;  4IE6 A;  4CXY A;  2M67 A;  4OYK A;  1WCR A;  3PUX F;  4EYY R;  1W0B A;  1JNR A;  5FP3 A;  1BR2 A;  4E1S A;  4AKL A;  2IC6 A;  1VCS A;  2POR A;  4AKI A;  5DL5 A;  2R6G F;  4JI7 T;  1HF8 A;  4P1N A;  4IE5 A;  2XAS B;  2F4V T;  4GKJ T;  3O0E A;  4DV3 T;  3GN5 B;  2VVS A;  3SYS A;  3KV5 A;  4IST A;  2Y8D A;  3UU5 A;  4QH5 A;  3VR8 A;  5LMU T;  4YSX A;  1WYB A;  1VCT A;  1VOM A;  3CK6 A;  3QC9 A;  4ERR A;  1Z8U A;  2ZMA A;  1HR0 T;  2R4P A;  2ZLY A;  3AE5 A;  4ZXL A;  2HH7 A;  1GFQ A;  2IW5 B;  4LML A;  2LOS A;  3ESL A;  4UXN B;  5DQW A;  5LG4 A;  2A3D A;  2JQ9 A;  3ZT7 A;  3FBZ A;  1XNQ T;  4IIJ E;  5HAX A;  4K3B A;  3IEE A;  1IJ5 A;  4LSH A;  3RRC A;  2WBL A;  2BBJ A;  2LSK A;  8PRN A;  2D2S A;  3TLS A;  3P4W A;  2XQ7 A;  3ZPO A;  5J2T E;  2IDO B;  1Q9F A;  4P09 A;  2CA5 A;  2UUC T;  1OPF A;  5M4Y A;  2YN6 A;  1NAF A;  4YXD A;  3NZP A;  1ZOY A;  2CM0 A;  2NWB A;  5F8P A;  4AKM A;  2Y0H A;  2KXP A;  2CLY C;  2L9Q A;  2X9H A;  5H6Q B;  2DHR A;  4TNV A;  1CHU A;  3CQX C;  4LMK A;  1MM5 A;  4FES A;  2V1D B;  3SZD A;  2H7V C;  1US7 B;  2YDQ A;  4BJM A;  2Q9Q B;  5JDQ A;  2CWO A;  2D9D A;  2XE2 A;  4EOZ B;  1H6S 1;  3VRA A;  3PJA A;  4DR6 T;  3P50 A;  2Y0K A;  1OED C;  4HFV A;  4O2A E;  5FVK A;  4BA9 A;  4BAY B;  4LF7 T;  3SYB A;  3N9O A;  2UUA T;  4WZX A;  4ZOL E;  2VKD A;  2QGS A;  1MMN A;  3QRC A;  3H3A A;  2IIU A;  3VU7 H;  5TAO A;  3PUR A;  1R8I A;  1MMG A;  4NUU A;  5CB4 E;  3EUH A;  5JTG A;  4JUY A;  3NRX A;  4YHJ A;  2XQ5 A;  2XZE A;  5HEH A;  2WWV A;  2IWW A;  3AAA B;  5HEG A;  3HW9 A;  4QXB B;  3AED A;  3UQ4 A;  4FSP A;  2W63 A;  4ISS A;  2V26 A;  1ZHT A;  3MXZ A;  2WJR A;  3EMN X;  3HL6 A;  2FGR A;  4RJW A;  1Y64 B;  3POQ A;  3M65 A;  4HFB A;  2BDE A;  3O1I A;  4E7Z A;  4U9C A;  5L3G B;  3EVY A;  3RIU A;  4I55 E;  3EAB A;  5EE2 A;  3KVB A;  4YJ3 E;  4HWI B;  5GTI O;  4GCP A;  3C50 A;  4FJO A;  3NJT A;  2KZ7 A;  2LT3 A;  4TNW A;  2WMO A;  3CPZ A;  3AE7 A;  5FY7 A;  2X27 X;  3PRN A;  2X9Y A;  2UXC T;  4IE4 A;  2M06 A;  5F5W A;  4ZZC A;  2WWU A;  3WAJ A;  5L3B B;  4EZ4 A;  3FB2 A;  2E5V A;  2FJD A;  5JRC A;  3NVO A;  5J1G A;  4WNK A;  3P4Q A;  4O3W A;  3BRZ A;  4FMS A;  1FMV A;  4JI2 T;  2Y7S A;  5FL0 A;  3ZN1 B;  5JR9 C;  3DWN A;  2FJE A;  3HKE E;  3K19 A;  4EV6 A;  1WFD A;  2DWK A;  3RH3 A;  4EYU A;  2LHN A;  2O4V A;  2JQK A;  4H9S E;  2X9X A;  3A0H O;  3MAC A;  2LSJ A;  3I9W A;  4EEB A;  5JRC B;  4FT6 A;  5IYU A;  2BKP A;  3VZT X;  3I0Q A;  3UPG A;  3LJC A;  3HWB A;  2XG6 A;  2R4O A;  4AKR B;  3K3O A;  3P4P A;  1ZEE A;  2LRK A;  2EHO A;  1SHZ C;  3NWI A;  3AAI A;  5HCJ A;  4LF5 T;  2RPA A;  3KIN B;  2C5J A;  5JDG A;  4J2C A;  2LKH A;  2W00 A;  5FKY A;  3DZM A;  2I6H A;  3K1S A;  5HWX A;  3RHW A;  3W15 B;  2LKG A;  3VHL A;  2K24 A;  1ZHZ A;  2R8A A;  3RI5 A;  5HWY A;  2YDR A;  3POR A;  4DVD A;  4OX9 T;  3RC3 A;  2LOP A;  3QB5 K;  4N74 A;  3PTR B;  2JQQ A;  2I0M A;  1QJP A;  2KLQ A;  2CCQ A;  2W66 A;  4GYR A;  1LRZ A;  2B76 A;  2V5C A;  5H2F O;  4DBR A;  4UF0 B;  5IYZ E;  4LFA T;  3AE2 A;  2HPJ A;  3CKD A;  3ZJ1 A;  4U2Z A;  5C2T A;  3RKO A;  5LNK A;  2UXN B;  2V5D A;  4C4V A;  2ZFG A;  2CMR A;  3NZQ A;  3AAE A;  2VK9 A;  1Z0P A;  3KVD D;  4JLE A;  1T16 A;  4B61 A;  4JFB A;  4AFK A;  3SWH A;  5LG3 A;  2K5B B;  2UXX B;  1H7C A;  2IAK A;  3ZLI A;  5KX5 E;  3RYH E;  2IC9 A;  2AXD S;  1MND A;  4ZI2 C;  5HCM A;  4QH4 A;  4B3R T;  1OED E;  2YNK A;  4JI0 T;  1DU2 A;  4AXP A;  2IWV A;  4TWF A;  1MMD A;  4A97 A;  2LRL A;  1HX1 B;  2JIW A;  4HFI A;  4TV8 E;  4A56 A;  4JYA T;  3FXE B;  5IUX A;  3T0S A;  4A5X A;  4WBO A;  4DR3 T;  4N75 A;  3TKL B;  4O2B E;  2X51 A;  4PK5 A;  1G90 A;  4D5U A;  4LF4 T;  4CTD A;  3QK6 A;  4DO0 A;  4YTP A;  5LB7 B;  2SPC A;  1OXZ A;  2X0Y A;  5LCY A;  4EIW A;  3V8U A;  3SRZ A;  4FSO A;  3FZM B;  1IBM T;  3V5S A;  3FYX A;  1ZHY A;  3H37 A;  4KR8 A;  2JMH A;  5LHH B;  1OWA A;  2W0G A;  3IF8 B;  4O3Y A;  2MPK A;  4H63 H;  4GIW A;  2EHO C;  5HEU A;  2X0L B;  4F8H A;  5G26 A;  4Z3T A;  1HCI A;  3UTK A;  3ZC0 A;  5ABF A;  4Z90 A;  4I50 E;  1QUU A;  3EI0 A;  2V6Y A;  4JBW F;  5LHI B;  2VKJ A;  2FUP A;  2X0H A;  5AQV B;  2R4L A;  5JRE A;  3ZEF B;  4PUX A;  5AQR B;  4X1Y E;  4N58 A;  4AQF A;  4YSY A;  3JTY A;  3ZKR A;  4NIQ A;  3C64 A;  2DL1 A;  4GKK T;  3PV0 F;  4GK5 E;  3FXD B;  4O49 A;  3BQK A;  5AQG B;  4HWC A;  3MJX A;  4HFH A;  2LHR A;  2ODU A;  5JDL A;  3RYC E;  2R4N A;  4EED A;  4KHZ F;  2G0U A;  5IHY A;  2XPK A;  5HEJ A;  1T1L A;  3LSV A;  2V7I A;  3AA1 B;  3ZN0 B;  5DL8 A;  3ANW B;  2MNH A;  4C00 A;  4IDP A;  2WDQ A;  4PK6 A;  1S94 A;  3PGU A;  1WRD A;  4A98 A;  1YD8 G;  5JDM A;  1FMW A;  1N33 T;  3FBL A;  5EK3 A;  2BZB A;  5AQH B;  4DV6 T;  1LVF A;  2CLY B;  1Q9G A;  3PUS A;  3U3I A;  2JJ9 A;  2GK9 A;  4UEL A;  3UUM A;  3AA0 B;  2XY8 B;  1KFY A;  5E79 O;  3IA3 A;  4UB6 O;  3WI5 A;  5GTH O;  4MBQ A;  4KR4 A;  3AEF A;  2XUE A;  1WR6 A;  1U5P A;  4U3C A;  4HTE A;  3Q5X A;  4ILU A;  1OED B;  5FXW A;  4AIS A;  1J5E T;  2V6X A;  3CX7 B;  2E9X A;  4XAX B;  4GK0 E;  2R89 A;  1E54 A;  4ASK A;  5B66 O;  2KIN B;  4CZZ B;  4PJJ A;  2JRK A;  3KV9 A;  2OMF A;  5LYJ E;  3CVR A;  3AE4 A;  4UR9 A;  3KDS E;  3UU8 A;  4CQI A;  3T8O A;  2XAQ B;  3FZH B;  2WY2 A;  4ZHQ E;  2E2A A;  2XM2 A;  3AE6 A;  1QJ8 A;  2V7K A;  1S5L O;  4NPP A;  4ZI2 D;  1GFN A;  2QA7 A;  3PE0 A;  3VZU X;  2WJQ A;  3OYX A;  4XZC A;  2MTQ A;  4G2A A;  4QWN B;  2X9W A;  2MYS A;  4AQF C;  1KF6 A;  1E7P A;  2XAH B;  1HFA A;  4CXW A;  2YKS A;  4U7Y A;  4FRX A;  1BR0 A;  3L09 A;  2F1V A;  4YHH T;  1FEW A;  2LM9 A;  4DV7 T;  4JEU B;  4TX5 A;  3RBH A;  3PQU A;  2XAJ B;  2BKO A;  3DA3 A;  3G06 A;  5JR9 A;  4IL9 A;  4IDN A;  4DV5 T;  2WDR A;  3ZYL A;  3UU4 A;  4X1K E;  4O4L E;  3E08 A;  4JI1 T;  4YTM A;  4YJ2 E;  4IL4 A;  2NR4 A;  2N9D A;  3H3M A;  2VQF T;  3POX A;  2X68 A;  3ONL C;  4X66 T;  2W62 A;  5ABG A;  4B3M T;  4OK0 A;  3LK2 A;  2CXL A;  3JC6 D;  3N2G E;  4O8S A;  4HKA A;  2EHO D;  2LEH A;  3E0Z A;  3V5U A;  2FJB A;  2KXP B;  3DJB A;  3RKG A;  1L0V A;  2NP9 A;  4IDO A;  2H7O A;  1IZN A;  4QXC B;  4TWD A;  4FI5 A;  3A5X A;  3CWZ B;  2WQY A;  1SUM B;  4LF6 T;  3MA9 A;  3ZYK A;  1GFO A;  4BJN A;  2W81 C;  5L3D B;  1T7S A;  2WCA A;  5HEO A;  2JMK A;  4G75 A;  2ES0 A;  5ABH A;  2UXB T;  3AXJ A;  3NKZ A;  3DP7 A;  2WP9 A;  4DND A;  1ZP0 A;  4OHF A;  3ZMZ B;  1YW0 A;  4AYM C;  1LVK A;  2XSA A;  4ZZB A;  2CXD A;  3FHN A;  4E7S A;  4B6X A;  4ILB A;  2E9X C;  1W9R A;  3P4R A;  3RPU A;  4O4I E;  2KND A;  4LMJ A;  1D1C A;  4YTN A;  5FVN A;  3K3Q C;  4P0B A;  3ZCI A;  3POU A;  1KNZ A;  3K8P C;  5AQT B;  2H88 A;  4HGA A;  4K0K T;  3QUJ A;  5JDP A;  5AFU K;  3F57 A;  5F3J A;  1QJ9 A;  2QRX A;  3EDU A;  3X1D A;  2LHF A;  4U2Y A;  5C8Y E;  4AUI A;  2V7J A;  2XJ7 A;  2J1N A;  1J5W A;  3AEE A;  4DV1 T;  4KP3 C;  5HXE A;  4RJX A;  4P0A A;  3SFD A;  2CWY A;  3FZK B;  3DA4 A;  4JI8 T;  1XWM A;  3ETU A;  1OSM A;  2YEV C;  4UVA B;  5L4E A;  3GP6 A;  3FZF B;  1D0Y A;  4GCS A;  4MLK A;  2W61 A;  2ODJ A;  4DR4 T;  3RRW A;  4PJL A;  1UCU A;  1IAP A;  3C4X A;  3F2E A;  1SA0 E;  5EZY E;  2DLR A;  1I94 T;  4DR7 T;  2XQ3 A;  4HE8 A;  2FBW A;  2KT9 A;  1T8B A;  3D0T A;  4GHB A;  3E22 E;  2LFU A;  5FY1 A;  2KZ7 B;  1UGO A;  2VWA A;  1THQ A;  4F4B A;  1SE7 A;  1E1H B;  1W0A A;  1HXU A;  2GE4 A;  3O4X E;  2DI4 A;  2KWI B;  3HR0 A;  2OLT A;  4JI6 T;  4C69 X;  3ZYM A;  2WU2 A;  3N9L A;  2VL0 A;  2PRN A;  3ETV A;  4IGU A;  3TLV A;  3ZMU B;  3B13 A;  5EK4 A;  2CHO A;  2XQY A;  4TV9 E;  1HXT A;  4UVC B;  4OFZ A;  3I0O A;  1T72 A;  3O1H A;  5J0Z A;  2UXD T;  3GA8 A;  3RF1 A;  4KMC A;  5LJN A; 
#chains in the Genus database with same CATH homology
 2I59 A;  4O4X A;  3LK2 B;  1BR1 A;  2M67 A;  4EIW A;  4OYK A;  3V8U A;  4H9N C;  3AA6 A;  3NRY A;  3PUG A;  4EYY R;  3SRZ A;  2D0T A;  2Z6E A;  5FP3 A;  4FSO A;  5LXT E;  4UEM A;  3HKC E;  3UFE A;  1BR2 A;  3V5S A;  5ADX L;  4E1S A;  4QQ1 A;  3IBP A;  5KDM C;  1ZHY A;  3FYX A;  2DWG A;  5ADX K;  3H37 A;  4KR8 A;  2JMH A;  5LHH B;  1OWA A;  2W0G A;  3IF8 B;  4AKL A;  1BT9 A;  2IC6 A;  3AAA A;  4O3Y A;  4O3X B;  2WSS V;  1IZN B;  4H63 H;  4GIW A;  2POR A;  2EHO C;  4AKI A;  2X0L B;  4FUV A;  5G26 A;  4Z3T A;  1HCI A;  6PRN A;  2J1D G;  2MOZ A;  2A2F X;  3UTK A;  3ZC0 A;  5DL5 A;  5LGU B;  2C5I T;  4WW0 A;  5HXR A;  2YU2 A;  4RLB A;  1HF8 A;  4I50 E;  2EHO B;  1QUU A;  4IE5 A;  2XAS B;  1D1A A;  1VRB A;  5LOV E;  3HA4 A;  4U74 A;  2CXF A;  5T5F A;  3O0E A;  4XNL A;  5LHI B;  2VKJ A;  3GN5 B;  4MFR A;  1PHO A;  1MMA A;  3AVR A;  4ADZ A;  3F31 A;  3SYS A;  3SY9 A;  1ZV4 X;  3KV5 A;  4IST A;  5JRE A;  5HXC A;  3ZEF B;  1S35 A;  2Y8D A;  2YU1 A;  4PUX A;  1FIO A;  3KV4 A;  4FZL A;  4ZS2 A;  2NTX A;  1WYB A;  1VOM A;  4X1Y E;  4N58 A;  3KFW X;  3QC9 A;  4AQF A;  4ERR A;  2ZMA A;  1V9D A;  3JTY A;  4XNK A;  4TZ4 C;  3MK7 C;  1BXW A;  3C64 A;  2ZLY A;  2HH7 A;  3KBU A;  3RC8 A;  1GFQ A;  4GK5 E;  4I43 B;  3FXD B;  4O49 A;  3BQK A;  3T24 A;  2IW5 B;  2W80 C;  4NUV A;  2LOS A;  3MJX A;  3GWH A;  1G8X A;  1PRN A;  3ESL A;  4UXN B;  5DQW A;  5LG4 A;  2A3D A;  2ERV A;  2XE1 A;  4O4H E;  5FXX A;  3DTO A;  3FBZ A;  3I9Y A;  2LHR A;  3ZJ2 A;  4IIJ E;  5HAX A;  5JDF A;  4PW8 A;  4CI2 B;  4ZI7 E;  2ZLD A;  3VKH A;  2ODU A;  3IEE A;  5JDL A;  1IJ5 A;  3RYC E;  4AYI D;  4LSH A;  3RRC A;  2WBL A;  4YLH A;  3AAE B;  2LSK A;  2N2L A;  3N9M A;  8PRN A;  2G0U A;  2WM9 A;  2D2S A;  5IHY A;  5J2T E;  3ZPO A;  4FZM A;  1ORM A;  1Q9F A;  1KK7 A;  2V7I A;  2CA5 A;  4P09 A;  4CI3 B;  1OPF A;  4LSE A;  3AA1 B;  4IHJ E;  5M4Y A;  3ZN0 B;  3PUQ A;  2MHL A;  2XE5 A;  1NAF A;  3VE1 A;  1YS5 A;  3NZP A;  5DL8 A;  2CEA A;  2NW7 A;  1GFM A;  2CM0 A;  3CX8 B;  3ANW B;  3ZCJ A;  2MNH A;  2NWB A;  5F8P A;  1P4T A;  2Y0L A;  4AKM A;  4AQG A;  4PK6 A;  1S94 A;  4UV8 B;  2KXP A;  2Y0H A;  3HOE A;  2CLY C;  2L9Q A;  1WRD A;  2X9H A;  5H6Q B;  2V7L A;  2DHR A;  1T98 A;  1YD8 G;  5CA1 E;  5JDM A;  1FMW A;  3C5O A;  3FBL A;  4H9Q C;  5EK3 A;  2Q9Q C;  2BZB A;  4PFP A;  1LVF A;  2X66 A;  2CLY B;  3CQX C;  5DQV A;  1Q9G A;  3PUS A;  3NBX X;  4AKR A;  1MM5 A;  3U3I A;  4FES A;  2V1D B;  3SOL A;  3SZD A;  2H7V C;  2LJL A;  1US7 B;  2K48 A;  2JJ9 A;  4LSI A;  2GK9 A;  3CQG B;  5LBM A;  3HKB E;  4BJM A;  2Q9Q B;  3SS1 A;  4UEL A;  5JDQ A;  3UUM A;  4EAH A;  5HXS A;  3AA0 B;  1AJ3 A;  4WBN E;  2CWO A;  5DL6 A;  3PDY A;  2XE2 A;  4EOZ B;  3LK3 A;  1H6S 1;  3WI5 A;  2E9X D;  4C91 A;  4MBQ A;  4KR4 A;  5L3C B;  4G63 A;  2Y0K A;  2XUE A;  1WR6 A;  4HFV A;  4O2A E;  4BA9 A;  1U5P A;  5HXH A;  2C0S A;  4HTE A;  2N2N A;  4BAY B;  4L5G A;  3SYB A;  3N9O A;  3Q5X A;  5FY0 A;  2BVL A;  4ZOL E;  2VKD A;  4ILU A;  4F6R C;  1EZ3 A;  3AVS A;  1D0Z A;  5FXW A;  2QGS A;  1X79 A;  1MMN A;  3TZG A;  2OA5 A;  3CX7 B;  2E9X A;  2VB6 A;  3H3A A;  5J2U E;  4XAX B;  4GK0 E;  3VU7 H;  3QRC A;  3PUR A;  5TAO A;  3HI2 A;  1MMG A;  2YIN A;  3OJA A;  4NUU A;  4Z8X A;  5CB4 E;  2FGQ X;  3PU3 A;  3EUH A;  3HOL A;  1E54 A;  4X1I E;  4ASK A;  4UF0 A;  4JUY A;  2KIN B;  2PBI A;  3AA6 B;  3NRX A;  2JRK A;  2RA1 A;  4PJJ A;  3KV9 A;  4CZZ B;  4GF4 A;  2OMF A;  5DL7 A;  3WI4 A;  2XHE B;  3IHR A;  1LKX A;  5LYJ E;  1HX8 A;  3S4U A;  1ZHW A;  2NOX A;  3J7Y q;  2QTK A;  3CVR A;  4YHJ A;  5LGN B;  4I4T E;  4U72 A;  2V7M A;  3AAA B;  4KUM B;  3KDS E;  5L3F B;  4RLC A;  1YKE B;  3UUL A;  4CQI A;  3HW9 A;  3T8O A;  4QXB B;  3WAK A;  2XAQ B;  4DMW A;  2ODV A;  3KBT A;  4ZHQ E;  4FSP A;  2W63 A;  4E1T A;  2P9B A;  3RYI E;  4ISS A;  1B7T A;  2V26 A;  1MPF A;  1ZHT A;  1QJ8 A;  2V7K A;  3MXZ A;  4EZH A;  4ZI3 D;  3EMN X;  3NSG A;  3HL6 A;  4PFO A;  4UVB B;  4ZI2 D;  2XAF B;  1GFN A;  2FGR A;  1Y64 B;  3POQ A;  4RJW A;  1NWM X;  3M65 A;  2QA7 A;  3PE0 A;  4XBF B;  3VZU X;  2BDE A;  3O1I A;  4E7Z A;  2XTQ A;  4L9I A;  3SY7 A;  3OYX A;  5L3G B;  4U9C A;  2LSG A;  4XZC A;  2PFV A;  3EVY A;  3K3N A;  5EK2 A;  2MTQ A;  4G2A A;  4H9P C;  4QWN B;  2NW9 A;  2X9W A;  4I55 E;  2MYS A;  5EE2 A;  3KVB A;  4YJ3 E;  4AQF C;  1HXX A;  4LSF A;  2XAH B;  4GCP A;  1HFA A;  4PK4 A;  4CXW A;  4KRA A;  3P7I A;  3MZK B;  3C50 A;  3CML A;  4FJO A;  4V1A v;  4ANJ A;  1BR0 A;  4FRX A;  3SZV A;  2LSI A;  4UIG A;  4UV9 B;  2L3L A;  3L09 A;  2KZ7 A;  2F1V A;  3VE2 A;  1FEW A;  2LM9 A;  2LT3 A;  4JEU B;  4TX5 A;  3RBH A;  3PQU A;  4AYE C;  2XAJ B;  3G7G A;  2WMO A;  4PNI A;  2CE7 A;  4EXT A;  3CPZ A;  3DA3 A;  3P8C D;  3KVA A;  3OYZ A;  3AA7 A;  4YFS A;  2ZM8 A;  2HPL A;  4FZN A;  3VY8 X;  5FY7 A;  5JR9 A;  2X27 X;  3PRN A;  4G76 A;  2X9Y A;  2M06 A;  2KMF A;  4IE4 A;  3ZYL A;  4X1K E;  2WWU A;  4O4L E;  3E08 A;  4AKH A;  3WAJ A;  1BR4 A;  5L3B B;  1YKH B;  3OKQ A;  3UU2 A;  4EZ4 A;  3FB2 A;  3LBX A;  3RYF E;  3UUX B;  4YJ2 E;  2N9D A;  5FYM A;  1MM4 A;  5JRC A;  4AYN A;  4H63 V;  5J1G A;  4WNK A;  5A1L A;  4O3W A;  1BH3 A;  3POX A;  4FMS A;  2X68 A;  3ZMS B;  1FMV A;  3N5L A;  2Y7S A;  4GCQ A;  2W62 A;  4QHO A;  4N59 A;  3ZN1 B;  2L8K A;  3R84 B;  5JR9 C;  3KV6 A;  4OK0 A;  3LK2 A;  2CXL A;  3JC6 D;  3N2O A;  2PJQ A;  3AA7 B;  3EDV A;  3N2G E;  3HKE E;  4O8S A;  3K19 A;  1HTJ F;  4HKA A;  1UX5 A;  4M1P A;  2KDY A;  2EHO D;  3RH3 A;  2DWK A;  2LEH A;  3E0Z A;  2LHN A;  3J9X 1;  3UUN A;  3V5U A;  4H9S E;  4EYU A;  2O4V A;  3A2S X;  2X9X A;  2KXP B;  1U4Q A;  3DJB A;  3T20 A;  3MAC A;  2VKH A;  2Y6X A;  2NP9 A;  3C98 B;  2H7O A;  2LSJ A;  3LBX B;  4QXC B;  5HYA A;  1IZN A;  5LHG B;  3I9W A;  4FI5 A;  5JRC B;  4FT6 A;  5IYU A;  2XAG B;  3A5X A;  3Q2M A;  3CWZ B;  3I0Q A;  3VZT X;  3UPG A;  3LJC A;  3MA9 A;  4DMV A;  7PRN A;  2F1T A;  3HWB A;  3RX6 A;  2XG6 A;  4L0R A;  4AKR B;  3K3O A;  3LG7 A;  3ZYK A;  1GFO A;  2NTY A;  1ZEE A;  2J4U P;  2EHO A;  4BJN A;  1SHZ C;  2W81 C;  5JDN A;  3AAI A;  5L3D B;  2JMK A;  4G75 A;  2ES0 A;  4GYS A;  2A72 A;  3KIN B;  1CUN A;  2C5J A;  5JDG A;  4J2C A;  3PQS A;  3UT5 E;  4D64 A;  3DP7 A;  2W00 A;  3GN5 A;  3MKD A;  4QXH B;  1WYC A;  1O3X A;  4DND A;  3LK3 B;  4QKN A;  2B1E A;  2D0U A;  3O1J A;  4H9O C;  3C4Z A;  4OHF A;  3N9P A;  3C4W A;  2KC0 A;  4JCH A;  5HWX A;  3ZMZ B;  3JC6 C;  1YW0 A;  3W15 B;  2ZM2 A;  4AYM C;  1LVK A;  4TUY E;  3VHL A;  2K24 A;  1ZHZ A;  2CXD A;  2WAU A;  3N9Q A;  2XMX A;  3FHN A;  4AZL A;  5PRN A;  4E7S A;  2JMM A;  2BVM A;  4B6X A;  3O9X A;  2Y2X A;  5HWY A;  2JPF A;  2E9X C;  4O3Z A;  3POR A;  4DVD A;  2LSY A;  3RC3 A;  3AB3 B;  1QSD A;  3ONX A;  3RPU A;  1MIV A;  2VAS A;  3VKG A;  5JQG E;  4O4I E;  2LOP A;  4MHC A;  4OYJ A;  2KND A;  3PTR B;  4K0U A;  4X20 E;  2JQQ A;  4IE7 A;  4BUM X;  2XE3 A;  1D1C A;  1QJP A;  5FNV E;  2KLQ A;  1ZKE A;  2YPV A;  2E9X B;  4O4J E;  3LK4 1;  2CCQ A;  4GYR A;  5FVN A;  4D65 A;  2M07 A;  3K3Q C;  4P0B A;  5JDH A;  1LRZ A;  3ZCI A;  3POU A;  1KNZ A;  5GV0 A;  3K8P C;  5LJM A;  4DBR A;  4UF0 B;  1ZHX A;  3Q9D A;  4HGA A;  5IYZ E;  3HKD E;  3QUJ A;  1HG5 A;  5JDP A;  2DCF A;  4RL9 A;  2Y48 B;  5LBQ B;  2HPJ A;  3CKD A;  3ZJ1 A;  5AFU L;  5AFU K;  3F57 A;  5F3J A;  1ZHC A;  5L2L A;  5H6R B;  3RKO A;  5LNK A;  2UXN B;  1QJ9 A;  1G73 A;  2DNX A;  5GON E;  2ZFG A;  2CMR A;  3EDU A;  5DAB A;  2LE8 A;  3NZQ A;  4PJM A;  2LHF A;  1IJ6 A;  1D0X A;  3AAE A;  5FXZ A;  5C8Y E;  4AUI A;  1HG2 A;  1MIW A;  2V7J A;  2J1N A;  1HS7 A;  4H9R C;  2H3R A;  3UAQ A;  4KP3 C;  4PJN A;  5HXE A;  4RJX A;  4P0A A;  2C5K T;  2VK9 A;  1Z0P A;  3KVD D;  4JLE A;  5KMG P;  3VZW X;  3PU8 A;  2CWY A;  3AA1 A;  5CA0 E;  4FOZ A;  2VKO A;  3DA4 A;  4B61 A;  3GMI A;  4JFB A;  4AFK A;  5LGT B;  3SWH A;  4PAG A;  3ZC1 A;  2XTL A;  2K5B B;  1OSM A;  3ETU A;  2UXX B;  1H7C A;  4QX8 B;  2YEV C;  3CQC B;  4AKG A;  4UVA B;  5E0O A;  2IAK A;  3ANW A;  5L3E B;  4DBQ A;  5JH7 E;  3GP6 A;  3ZLI A;  3N9N A;  5KX5 E;  3RYH E;  1D0Y A;  2Q9Q D;  2IC9 A;  4GCS A;  3B57 A;  2ZM0 A;  2W61 A;  4MLK A;  3Q5W A;  1MND A;  2N1G A;  4ZI3 C;  4EB6 E;  4CI1 B;  2ODJ A;  2YK0 A;  3RRW A;  4ZI2 C;  3R6N A;  2K0L A;  3PUA A;  4PJL A;  2YNK A;  4N78 D;  1UCU A;  5D5D A;  1IAP A;  3C4X A;  5FMN A;  4AXP A;  3CX6 B;  3F2E A;  1MMD A;  1SA0 E;  2WMN A;  2K4T A;  4GOU A;  5EZY E;  2DLR A;  3BK9 A;  3BQI A;  4HE8 A;  2KT9 A;  3D0T A;  3LK4 2;  4JEH B;  4GHB A;  3E22 E;  4C90 A;  4TV8 E;  5BMV E;  2LFU A;  2K9A A;  4TN7 B;  4AYD C;  5FY1 A;  5FXV A;  2KZ7 B;  2Q9Q A;  3L3P A;  1D1B A;  3I1A A;  4A56 A;  2VWA A;  5ETW A;  1THQ A;  3AA0 A;  3VY9 X;  4F4B A;  2RP4 A;  4QX7 B;  3FXE B;  1E1H B;  1HXU A;  2GE4 A;  3O4X E;  3T0S A;  4WBO A;  2DI4 A;  2KWI B;  3HR0 A;  3LFM A;  4C69 X;  3BQL A;  5LA6 E;  3TKL B;  2VL8 A;  3U78 A;  3ZYM A;  4KBM B;  4O2B E;  3N9L A;  3OBV E;  5JR9 B;  2X51 A;  4ZS3 A;  1UX4 A;  2D5U A;  3N2K E;  2N2M A;  2PRN A;  2XTR A;  5LCY A;  4FRT A;  4PK5 A;  3ETV A;  4IGU A;  5DJQ C;  4AI6 A;  4O4U A;  4HN9 A;  4IE0 A;  3WI3 A;  2X67 A;  3ZMU B;  1G90 A;  3B13 A;  2PG8 A;  5EK4 A;  5JVD E;  1WLX A;  2ACX A;  2NW8 A;  2XQY A;  4TV9 E;  1GFP A;  4MAL A;  4CXX A;  4HEA A;  1HXT A;  4D5U A;  4UVC B;  4OFZ A;  2KWH A;  1MIY A;  3QK6 A;  3I0O A;  4DO0 A;  3ZMV B;  3O1H A;  5LP6 E;  2MBG A;  3C51 A;  4IDZ A;  2SPC A;  1MNE A;  1OXZ A;  3ZMT B;  3GA8 A;  2E8I A;  3QRA A;  4KMC A;  5LJN A;  4IE6 A;  4CXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...