3AA5X

A52f e.coli rnase hi
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
153
structure length
153
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAFIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 46
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa5X00
2AJQA 4AHVA 4W5RA 4F2SA 3VA0A 4CHQA 2O4IA 1TKXA 2QK9A 1TK5A 4ZTFA 4GW6A 4FCYA 4FJNA 3AVBA 3VA3A 1HQUA 4FJXA 3VN5A 1RCHA 1IKVA 3LZJA 4DTSA 1XI1A 1U04A 5KRTA 4JS4A 1W0HA 4DMNA 5D3GA 2ZE2A 4OGEA 3U6FA 4C8KA 1A5WA 1RBTA 4E3SA 4CJVA 1KLNA 3HPGA 1VSHA 4CGGA 2Q3SA 1S5JA 4RW7A 3AO2A 4DLGA 5I3UA 4KO0A 1WAJA 2JLEA 1BCMA 1XHXA 3AA4A 2E4LA 3DRPA 4FVMA 1W9HA 3M8PA 5K14A 1QTMA 1QSLA 1WLJA 3LZIA 2HNZA 1JL2A 1JXBA 3NF7A 1RBVA 1HPZA 1Y97A 2RN2A 4YFUA 3V6DA 5EU7A 3OYGA 3KLIA 4J2EA 3QERA 4PY5A 2FBXA 4JRQA 3NF6A 3KKSA 3NH1A 3TR8A 2WOMA 4B3OA 4MQ3A 4DQPA 3AO5A 1IKYA 4CHZA 3SCXA 1L3SA 3SV3A 3ZT3A 1ZBUA 4OPJA 3HT3A 1TGOA 2HHXA 1NK8A 1B9FA 3RTVA 4FW1A 2D0BA 3VQPA 3DLRA 1Z25A 1T05A 1I3AA 1UOCA 2FBTA 4CERA 3JSMA 2PYJA 4E89A 3V81A 2HHTA 2HHUA 4IFYA 4BACA 4W5TA 4KTQA 2Z1HA 4I2QA 3B6PA 3ZSWA 1TK8A 4Q0BA 1SUQA 5KGWA 3KK1A 2A1RA 3AVMA 4BWJA 3SV4A 4HUEA 4GVMA 2XY7A 1S1WA 3RMAA 3HK2A 3C95A 1IKWA 1ZYQA 1S1VA 3P5JA 3AVJA 4B9NA 2E6LA 4FJIA 5KRSA 4O4GA 1CXQA 1ASUA 1UAXA 3PX6A 2VG7A 5HP1A 2EHGA 3CM6A 4HVJA 4M3XA 3S3MA 3VQ6A 4HCBA 1ASWA 1C0UA 4CEAA 3MAQA 4FYDA 3LPUA 3QESA 1RT1A 3U3YA 4FK0A 2HHVA 3B6OA 1WSGA 4CESA 4EP4A 1CLQA 2BANA 4RW8A 4CJPA 4DQRA 4DTNA 3LWMA 1MU2A 3LPTA 2GUIA 4CJSA 1Q8IA 2DFHA 1TK0A 2FC0A 1JLCA 3L3UA 2YKMA 1Z26A 4DSKA 4KI4A 2XY5A 3ITHA 3TABA 1A5XA 3O4QA 3K5NA 3T1AA 3PY8A 4H8KA 4CJLA 4E7HA 1BHLA 4AILC 4KI6A 4N5SA 2LSNA 3IS9A 4O5BA 3IG1A 3HVTA 3AO1A 4CF0A 2GV9A 4E1NA 4O44A 4UQGA 2DTUA 3TWHA 3MXMA 2HHQA 3PO4A 3RMDA 1WSHA 3CQ8A 1RBRA 3HL8A 3KLGA 4I9LA 4CGJA 3EY1A 1VSKA 4ID1A 4CIEA 2RKIA 1DTTA 4CJTA 2ZD1A 4FLWA 4CIFA 1NOZA 3HPHA 3ZSXA 4AHTA 1U45A 1QSYA 4FJ9A 3AVKA 1JLQA 4CHNA 3HVRA 1YTUA 3NBPA 5JS2A 3SQ0A 1RDAA 3G0ZA 2I5JA 3THVA 4F3TA 4KTWA 4FM2A 1CXUA 4E7JA 1RT4A 4FW2A 3AVAA 5SZTA 3VQ8A 2YKNA 4DU1A 3QETA 3QEVA 1SL1A 1NKEA 1FKOA 1RDCA 4G1QA 4OKJA 1S1XA 1LV5A 5DK5A 3ULDA 1SL2A 4CFBA 3NH2A 3D0PA 1SL0A 3QIPA 2D0CA 1NKCA 4EP5A 4ELVA 1U49A 4DTPA 4FJHA 4Y1CA 1S1TA 3L2WA 4DFMA 4N41A 2KFZA 1IO2A 1JKHA 2D5RA 3CG7A 3K5OA 3VQEA 4CJUA 3WNHA 4DSFA 4HUGA 4KRFA 2KFNA 4C8OA 4CFCA 3K5MA 1RT2A 4RW9A 4FLYA 3DOLA 4KHSA 4IG3A 1D9FA 4CGHA 4M45A 1UA0A 2OZSA 1JLFA 3IAYA 3KTQA 3DLKA 3C6UA 3VQ4A 1YT3A 3ZSQA 3OYDA 3QEPA 4YNQA 5SWMA 4LH4A 3OS2A 3SPZA 2R7YA 3ZT0A 3V1OA 1N6QA 2G8WA 1TKTA 4KB1A 2IAJA 3RRGA 3SQ2A 3SUNA 3MXJA 4PA1A 1NK4A 3NDKA 3TANA 5HLFA 3FFIA 1FK9A 3OVNA 3L2QA 1HYVA 1RBSA 4FLTA 1WNSA 4NCBA 3UIQA 3P83D 1NK7A 2X6SA 2X78A 1F21A 4Q5VA 2XHBA 4DTXA 1CZ9A 1TL1A 4CEEA 4KHUA 1C1AA 3ISNC 1IG9A 2P51A 1GOBA 4CJRA 1LWCA 3OYNA 2XO7A 1VSEA 2HVHA 4CJFA 1Q9XA 3KJVA 3AA2A 3ZSRA 1B92A 2DFFA 4Z4CA 3EYZA 3ZT2A 2DY4A 1EKEA 4CK2A 3U3GA 3ZSYA 4HTUA 4FJ7A 4KB0A 4RW4A 1XWLA 2YNHA 4WE1A 4BDYA 3O3FA 3QEWA 2JGUA 3I0SA 3VQCA 1S6PA 5HBMA 4W5NA 3VQBA 3BDPA 4RG8A 4BE2A 3AVNA 3LDSA 2W42A 3OS1A 1BIUA 4CE9A 3K59A 1RT3A 4CCHA 4AHRA 3HYFA 4CGFA 1HMVA 2P5OA 2KTQA 4OPKA 2OPPA 1X9SA 3DYAA 3H08A 3M8RA 3EZ5A 4CEFA 3ASMA 4L8RB 4DTRA 1S6QA 3OYBA 2ETJA 2X74A 2G8FA 4EZ9A 4OGCA 4CIGA 2HVIA 4CECA 1VSFA 1RT5A 4CEDA 3VQ5A 3TAMA 1NJYA 2XY6A 4AHSA 4CHYA 4N56A 1L5UA 5FROA 4M3UA 4CF1A 4FLXA 1HQEA 1O1WA 2DFEA 3L2VA 3V9SA 4M3ZA 4E0DA 1BL3A 3L2UA 1BI4A 1ZBLA 3MEDA 1CZBA 1D5AA 1LAVA 5KI6A 4OJRA 4XIUA 1SKSA 3VQAA 4KHNA 1JXEA 3OJUA 1BI4B 1NK0A 3O4NA 1LW2A 1SKRA 1EP4A 3JYTA 3P1GA 2RPIA 1S9EA 2Z1JA 1HNVA 1VSIA 4PQUA 3F9KA 5J2MA 1T7PA 4DU3A 4KFBA 4N76A 4CEOA 4IG0A 4F4KA 5FDLA 4FJKA 3NE6A 1KTQA 4B9UA 1HRHA 1YTAA 2BE2A 3F73A 4B9VA 4NCAA 4B9TA 1LWFA 1RDDA 3T3FA 3HJFA 2IOCA 2VG6A 1X9WA 4C8LA 3QINA 5C24A 3AVIA 3BGRA 3NHGA 1TKDA 2OPRA 1KFDA 2VWKA 4KPYA 3LANA 4Z4HA 3DI6A 4CGIA 3D45A 3DLEA 5HRRA 2G8VA 1WN7A 2IDOA 4OLBA 3S3NA 5CYQA 3CFRA 3KD1E 3VQQA 4M3YA 3K2PA 1NKBA 5HRNA 1RNHA 3PV8A 3OYMA 2XY8A 2FBYA 4DSEA 4F3OA 4DTUA 4DTOA 4CJQA 5KTQA 1KVBA 1WSJA 4FJMA 4NCGA 3QEIA 4OKEA 2G8KA 3DLHA 1LAWA 3T19A 3KK3A 1XHZA 2B6AA 4KKOA 5C25A 2GBZA 4DSLA 2F8TA 4B8AB 3TARA 1DLOA 2YHBA 1HJRA 4B8CA 4KHQA 1TAUA 3SUPA 4KHYA 1FXXA 3HP9A 1DTQA 1KLMA 3OYIA 4J2AA 3CM5A 4FXDA 2Z1IA 5C42A 4W5OA 4CHOA 2HHWA 3ZSVA 1C0TA 3L8BA 3PUFA 3TAQA 4DTJA 1C0MA 3DRRA 4BDZA 1UA1A 2IS3A 3CFPA 1SKWA 4AHCA 1U4BA 2F8SA 1VSMA 4DFPA 3HSTB 3ZCMA 4EZ6A 3KLFA 3NF9A 3M8SA 4BWMA 2HHSA 2XRIA 4KHWA 4DQSA 3AO3A 3AVGA 3NFAA 1WSEA 4FM1A 2YNFA 5E41A 3PO5A 3RWUA 3V1QA 3TI0A 4Z4GA 1TVRA 4E7KA 4M3TA 2OPSA 4PWDA 1FKPA 1RILA 1D9DA 2F96A 4I2PA 4AHUA 1RTJA 5HROA 4NYFA 1R0AA 3V9XA 3OJSA 2HW3A 2YNIA 1HYSA 3V9ZA 2RF2A 3HM9A 4DLEA 2OA8A 5CZ2A 5J2NA 4ELUA 1ITGA 4QAGA 5CY4A 5I42A 2PYLA 4M42A 2E6MA 1C6VA 3TAGA 4M41A 4DU4A 1XC9A 3QNNA 3PX0A 3LWLA 4DFKA 3NGYA 4FZXC 2KQ2A 4LD0A 4K8ZA 1N5YA 1VSDA 1YVUA 1NJZA 4FJJA 3QO9A 4CFDA 4DQIA 4I7FA 1VRUA 3C94A 4F2RA 1U48A 3OS0A 4CGDA 1JLBA 4NYNA 1K6YA 1VK0A 3V9WA 2O4GA 4M3RA 1QHTA 1TL3A 1WSIA 4FK2A 1JLEA 3DOKA 4DTMA 1KVAA 4BDPA 3LAMA 3RMBA 4FJLA 1KFSA 3NGZA 4JS5A 4RW6A 1L3TA 1VSLA 2Y1IA 4O0IA 3CFOA 4I9QA 4FJ8A 4Y1DA 4FLUA 4FM0A 1Q9YA 4F8RA 1G15A 1KCFA 3AVHA 4DQQA 1C1CA 3OYJA 1JLAA 4LSLA 3PX4A 4DFJA 4FK4A 1EX4A 3OYEA 3HXMA 1RTHA 2ATQA 3MEGA 4M3WA 5FRMA 5CZ1A 4FZZA 4E7LA 4J2DA 1GOAA 4ID5A 4IFVA 3V4IA 3L2RA 4K8XA 3L3VA 4LH5A 1B9DA 2WONA 4GMJB 2YV0X 1D8YA 3OYLA 3ZT4A 2A1SA 4IDKA 4B08A 3OYFA 1X1PA 4ICLA 5KGXA 4LSNA 1VRTA 1WSFA 1X9MA 4C8MA 4E1MA 4CEZA 1LW0A 4CK3A 2Z1GA 2G8UA 2B5JA 1EXQA 2X6NA 4JLHA 3HPOA 3NF8A 3K57A 4FZYA 2KZMA 4CJ3A 2NUBA 3S3OA 4CF9A 4IKFA 3TAFA 3MECA 1T03A 2YHAA 3ALYA 2IC3A 4HUFA 1C1BA 4FJ5A 2P1JA 3AA3A 3KLEA 1RTDA 2PY5A 2VWJA 1QS4A 1RT7A 4LY7A 4H4OA 3V9UA 3WNGA 3O3HA 2BGGA 1BIZA 2QKBA 4CK1A 1A5VA 4JRPA 4HHTA 2OZMA 3V1RA 4DS4A 4FJGA 4CF2A 4KREA 3SZ2A 3ZSOA 2HB5A 3DLBA 1EETA 5HRSA 2G8IA 4CJWA 1KVCA 3SPYA 4B9LA 4R5PA 5J1EA 4DWIA 3NCIA 2ZQBA 5DMRA 1L3UA 3OYAA 1HYZA 1WAFA 2YNGA 4W5QA 3QNOA 4H4MA 1KSPA 4CEBA 1U47A 1S1UA 3OYCA 3SQ1A 1BQMA 1HNIA 2BDPA 4OKKA 1BISA 1REVA 2KW4A 1NK6A 1L3VA 3DM2A 3E01A 3A2FA 2IGIA 3KKRA 1ZBIA 3KIOA 2PZSA 1J5OA 4O0JA 4ELTA 1RTIA 2QKKA 2HNYA 5J2PA 4IBNA 4Z4EA 3SYZA 2QXFA 4B9MA 3HO1A 2B4JA 1GOCA 3M8QA 4CJKA 3KLHA 3AV9A 3I8DA 4C8NA 1IKXA 5CYMA 2OYQA 1VSJA 3NAEA 1UWBA 3DMJA 1RDBA 4Z0UA 1T8EA 4DSIA 3RR8A 3LAKA 4HCCA 3ZT1A 4Z4FA 5JS1A 2OPQA 3AO4A 2ITGA 1I39A 4CFAA 3K5LA 3SNNA 3G10A 1BGXT 1LWEA 2FBVA 4CJ4A 2HNDA 3S9HA 3LP2A 3SQ4A 4FLZA 4DF8A 3SI6A 3AVFA 3C6TA 4PUOA 2KZZA 3KD5E 3LP3A 3DRSA 4ZTJA 2HMIA 3QLHA 1TKZA 3AVLA 1SV5A 4ZHRA 4MFBA 1IH7A 3VQDA 1JLGA 3RMCA 3MXIA 1NK5A 1JL1A 3QEXA 4Z4IA 1QQCA 4DF4A 4AH9A 1J54A 1ZBHA 4OVLA 1QE1A 4B9SA 2G8HA 4OLAA 1BQNA 1TAQA 3KK2A 1J53A 3I0RA 1QSSA 4DG1A 1S9GA 3AVCA 2P5GA 2D0AA 4BE0A 3RR7A 3MEEA 1RBUA 1TV6A 1NJWA 4J2BA 1ASVA 3OY9A 3CYMA 3SJJA 1J9AA 3K58A 1KRPA 3SUOA 4N47A 1NOYA 3AA5X 3RRHA 5T7BA 1NK9A 3NGIA 3SUQA 5J2QA 4O55A 3OYKA 4KAZA 2Y1JA 3ZSZA 3LP0A 3O3GA 4CJ5A 3WNFA 1BCOA 4QCLA 2VG5A 3IRXA 1RT6A 4QOZB 3QIOA 3WNEA 3TAEA 1ZBFA 1NJXA 3NH0A 4KTZA 4CJEA 5FRNA 4DSJA 3VQ9A 4CEQA 4TSXA 3LALA 3DLGA 5HRPA 4FLVA 4DS5A 3TAPA 4E7IA 4BE1A 2EX3A 3LP1A 4CHPA 4KV8A 3VQ7A 4E19A 3HP6A 3OYHA 4CF8A
chains in the Genus database with same CATH superfamily
4W5RA 1FW6A 3O5BA 2O4IA 4FCYA 1HQUA 4DTSA 1XI1A 3U6FA 4BROA 4MDAA 3AO2A 4FWMA 4A57A 4IOCL 5I3UA 1BCMA 3J7ZO 3DRPA 1QTMA 1QSLA 1WLJA 3LZIA 1JL2A 1JXBA 2HNZA 3NF7A 2UXBK 4H5WA 5EU7A 4J2EA 4PY5A 3NF6A 3KKSA 4MQ3A 4DQPA 3AO5A 1IKYA 3GBTA 5AZJA 4BGAA 1L3SA 3SV3A 1ZBUA 3IUCA 1NK8A 3RTVA 3K9KA 2D0BA 3CERA 3DLRA 1VHXA 3CMEN 1T05A 5CHIA 1RFQA 3FZHA 4CERA 3JSMA 4BRNA 2HHUA 4FL9A 3CJCA 1SUQA 2YJFA 5KGWA 2A1RA 3SV4A 2XY7A 3ZEUB 2HOEA 4BRDA 3HK2A 3C95A 1FJGK 1IKWA 5AQZA 4MLEA 1ASUA 1P8ZA 4CZIA 4HVJA 3DWLA 4HCBA 2P9KA 1C0UA 1ZBSA 2HHVA 4CESA 1OH6A 4BRCA 1MU2A 2W40A 2DFHA 3PIOL 1K8AO 2A6AA 3VENA 1IBLK 4BRMA 3T1AA 4CJLA 3H3OB 4AILC 3IS9A 4O5BA 3VESA 1IV0A 3AO1A 2DTUA 3CC4N 3TWHA 2HHQA 1WSHA 4I9LA 3H1VX 1VSKA 2RKIA 4KTQA 4DR3K 3AGKA 4JHDA 4AHTA 1BDGA 2P9NA 3NBPA 2O8FB 3G0ZA 5GINA 4KTWA 5BPNA 3VQ8A 3D2FA 2NNWA 3D2EA 3FR0A 1NJIO 1RDCA 1S1XA 1LV5A 3CJ9A 3CCEN 5HOOA 4CFBA 5LJWA 3NH2A 3GOIA 3VTHA 4FJHA 3H1QA 1U49A 3L2WA 4DFMA 4ISEA 3MWTA 3K5OA 3CG7A 3VQEA 3MN9A 4CJUA 5DM7L 3GL1A 4C8OA 1RT2A 4IG3A 4CGHA 3IAYA 1YJ9N 3DXMA 3LDQA 3QEPA 4WQ5A 5SWMA 4LH4A 5B8HA 1N6QA 2IAJA 3SQ2A 3MXJA 4LF4K 4M7XA 4BR5A 5HLFA 3OVNA 2ITMA 3O1WA 4NCBA 4GKKK 2X6SA 5BREA 2X78A 1F21A 2XHBA 1TL1A 1NLVA 4H5NA 1C1AA 1TYQB 3IMXA 3SMSA 2XO7A 4IDHA 4XH5A 3KJVA 2YHWA 5AQNA 1NMNA 4LFBK 4CK2A 4HTUA 2HBJA 4KB0A 4RW4A 4WE1A 3CCLN 3I8BA 4JI5K 2JGUA 4JI1K 1S6PA 3SAGA 3DLLL 2CH5A 2ASPA 3BDPA 1BA1A 4BE2A 3OS1A 3LDOA 2GTDA 4A2BA 1HMVA 4OPKA 2CGLA 3EZ5A 4O8KA 4DTRA 4BRGA 3OYBA 2UXCK 2ETJA 2X74A 2GWKA 3EZWA 4OGCA 1VSFA 1HKCA 3MCPA 3MN7A 4AHSA 4N56A 5FROA 5AQMA 4M3UA 2OTLN 3L2VA 4M3ZA 5LJVA 2P9UB 1ZBLA 3L2UA 4DV6K 4OJRA 3OJUA 1NK0A 1DT9A 1VQ5N 3CJBA 4XEIA 2Z1JA 4DUZK 4LF5K 2QWQA 1W7AA 3F9KA 2OCEA 5J2MA 4BR9A 4N76A 4IG0A 2QWPA 4QS8A 5FDLA 4FJKA 1KTQA 2BE2A 3R9PA 4B3SK 2IOCA 4G9ZA 1M90O 3QINA 1NGJA 3BZCA 4ISFA 3BGRA 3NHGA 1TKDA 4KPYA 3U8XA 5HRRA 2IDOA 4FSVA 3R1XA 3UE5A 3BZKA 3VQQA 4M3YA 3K2PA 2YHYA 1RNHA 2O8EA 2E1YA 3OYMA 4DSEA 3QICA 4DTOA 1QQMA 1KVBA 4NCGA 3QEIA 4OKEA 3DLHA 4IXCA 1XHZA 3EE9A 5H1SQ 4B8AB 2YHBA 4AF1A 1TAUA 4KHYA 1FXXA 4PL8A 5JICA 2Z1IA 1NGBA 5C42A 1T44A 3TAQA 1C0MA 2A42A 4BDZA 2IS3A 4PHTX 1SKWA 1Q82O 2F8SA 4IJNA 4JI0K 3NFAA 4FM1A 1KXPA 2YNFA 3THYB 4Z4GA 4E7KA 1T3VA 2OPSA 4PWDA 1BG3A 1D9DA 4NYFA 4JI3K 3HM9A 2OA8A 3WEEA 5CZ2A 5HL7L 1T6CA 4QAGA 5KPTA 3RSEA 2HHHK 4DU4A 3PX0A 4DFKA 3NGYA 4BRHA 1Q18A 2HSTA 1VSDA 1YVUA 3ULEB 4BQLA 1VRUA 4FO0A 3C7NB 1JLBA 2D0PA 4CZHA 1TL3A 1JLEA 1KVAA 1KFSA 3SJHA 3FZKA 2NRXA 3HOSA 1L3TA 1VSLA 2Y1IA 4I9QA 3CFOA 3QBXA 4WQ4A 5M1PA 1Q9YA 3G71N 4A59A 1X3NA 1G15A 1KCFA 2E1ZA 3AVHA 4DQQA 4F8RA 5BPLA 3EE8A 4FZZA 4E7LA 4B1VA 4JKCA 4IFVA 2WONA 4GMJB 2YV0X 2HF4A 4DQ8A 4IDKA 4LF9K 3MK6A 3EKUA 4ICLA 4L3QA 2QW9A 1GLDG 1VQ9N 5A2QO 4H0XB 5C10A 4JD2A 1LW0A 2Z1GA 2G8UA 3HPOA 2V52B 2VWBA 1C0GA 4CF9A 3TAFA 1T03A 2YHAA 5BR9A 2D0OA 2PY5A 2O8DA 3ENHA 2VWJA 4LY7A 4H4OA 3V9UA 2BGGA 1BIZA 4WFAL 2FF3B 1NGIA 2GWJA 5MLCQ 3V1RA 4JRPA 4DS4A 4EHUA 4FJGA 2IVOA 4U67L 3PSFA 3ZSOA 5HRSA 1BUPA 2FF6A 4DWIA 2CH6A 3OYAA 2YNGA 1KSPA 5AQUA 1JCFA 3T1YK 3SQ1A 2BDPA 4OKKA 1REVA 2KW4A 1SAZA 5BRFA 3VETA 3E01A 3OBWA 3KKRA 2IGIA 1XQSC 1ZBIA 2GX9A 5CE3A 2HNYA 2P9KB 3DXKA 3SYZA 2O8BA 3FZMA 3O8MA 3I8DA 2OYQA 1VSJA 1UWBA 3HTVA 4XH4A 4Z0UA 1T8EA 4DSIA 3LAKA 3K5LA 4RWTA 4WF9L 3S9HA 1EWRA 3LP3A 4YORA 5IWAK 4YOTA 1N8RO 3AVLA 1SV5A 3W0LA 4MFBA 4H0TB 1JLGA 1NK5A 1NGGA 4GNIA 1BOTO 4DF4A 4JHDB 4AH9A 1J54A 3EN9A 1LOTB 4NLBA 4OVLA 5LL6Z 4B9SA 1S9GA 2NRZA 1LCUA 1NJWA 4J2BA 4NO7A 1ASVA 3OY9A 3CYMA 5AQPA 3VPZA 1NOYA 3RRHA 4FWQA 2BH1A 3LP0A 3O3GA 4QCLA 3PSIA 1XMOK 3DXMB 5AFUA 5C0YA 4DSJA 4CEQA 3DLGA 4WFBL 3TAPA 2E2OA 2EX3A 3OYHA 2KFZA 4JI7K 3VF4A 2Q36A 3BF1A 4CHQA 1TKXA 4BC4A 4GW6A 3SBTA 3THXA 1I94K 5KRTA 1M1KO 4B3MK 1W0HA 1YVNA 4DMNA 1H1VA 2A5XA 2P9IA 4B1ZA 3RVCA 1KLNA 1VSHA 4CGGA 2Q3SA 4C23A 4KO0A 2JLEA 1XHXA 2GUPA 3M8PA 4FPBA 1RBVA 1Y97A 2RN2A 3V6DA 4J8FA 5AQSA 4DR4K 4OO1J 3AY9A 3BP8A 3NH1A 2WOMA 4B3OA 4LF7K 2JWLA 4CHZA 3CI5A 3SCXA 3ZT3A 4ISGA 4OPJA 3O9RA 2F4VK 3W3DA 3LDNA 3CHWA 3ZYYX 3SBGA 2PYJA 3NMUA 2HHTA 5M1NA 1NG9A 3U4LA 1TK8A 3B6PA 4Q0BA 3KK1A 3AVMA 4BWJA 1C0FA 2E88A 4FWRA 3RMAA 1ZYQA 1S1VA 3A5MC 3F9MA 4O4GA 1CXQA 1UAXA 2IIRA 2VG7A 3PX6A 4M3XA 3S3MA 3MAQA 4FYDA 3WQTA 5ELZA 4CJPA 2GUIA 4CJSA 1Q8IA 1TK0A 3L3UA 1JLCA 3WXKA 1X9JA 1Z26A 4DUYK 4KI4A 3ZETA 3TABA 3VGMA 1A5XA 3PY8A 1J5EK 4KI6A 4E7HA 1BHLA 4RCHA 4N5SA 2LSNA 2ZJPL 5F1XA 4CF0A 2GV9A 1OVQA 3DAWA 4GV6A 1RBRA 3MDQA 4CGJA 4ID1A 2KTQA 3QNNA 2ZD1A 3ZSXA 3AVKA 1KAYA 1YTUA 2ASOA 3O9UA 1RDAA 3SQ0A 2I5JA 3THVA 4F3TA 4FM2A 4E7JA 3JXUA 1RT4A 3AVAA 5SZTA 5JVHL 3QETA 3IDHA 1SL1A 1NKEA 3J7AP 1FKOA 4OKJA 3J7YP 1BU6O 3ULDA 1SL0A 3D0PA 1S1TA 3JAMO 1JKHA 2D5RA 1VQON 4HUGA 4RW9A 1QZ6A 5JLFA 4DR6K 1D9FA 2OZSA 5AQFA 2AP1A 3OYDA 3VQ4A 1YT3A 4YNQA 2E20A 3O6WA 3V1OA 4M63C 1TKTA 3OHRA 4IZ9A 3J81O 3VEOA 1NK4A 3TANA 4BC3A 4JKHA 5AQGA 2HMPA 4BG9A 1VQLN 3WEEB 3CQYA 3BUZB 1NU0A 1VQ4N 3CD6N 1JCGA 3RSEB 4BRFA 3G25A 4IWVA 1LWCA 4CZKA 1VSEA 2HVHA 4CJFA 1Q9XA 3TPQA 2UUBK 4Z4CA 3EYZA 4DR2K 1EKEA 4C1NK 3ZSYA 4GY2B 4FJ9A 4IEIA 2YNHA 4BDYA 2FXUA 3VQCA 3KWIA 1HJOA 2F9WA 4RG8A 4BRPA 3K59A 1RT3A 3TSUA 4CCHA 3HYFA 5F0XA 4PKHA 4CEFA 1KAZA 1S6QA 2G8FA 1XUPO 4DV3K 2HVIA 4CECA 1RT5A 4CHYA 3E9OA 1ATSA 2DFEA 4QS7A 1HLUA 1BL3A 1BI4A 3MEDA 1CZBA 1RDUA 2H3GX 1OH5A 3TTCA 4CZGA 4KHNA 1JXEA 4FVUA 3ENOA 3O4NA 3JYTA 3M3ZA 4JD2B 2HBKA 1S9EA 1VQ6N 3L6QA 1VSIA 3WXMB 4RTFD 4PQUA 1T7PA 4F4KA 4I6MB 1YTAA 2Q0UA 3VGKA 4LC9B 3T3FA 1X9WA 4C8LA 5FPEA 3CCJN 5GAHP 1KFDA 3T1HK 5CR4A 2VWKA 4AQYK 1HNXK 5E26A 4CGIA 3O80A 1YITN 3DLEA 2QI2A 2QWLA 1OH8A 3MCAB 3GDQA 3CJ1A 2KKZA 3JS6A 1Z6RA 5GIPA 1WBBA 4IOAL 1NGEA 2P9LA 4BRIA 1NNEA 4JK7A 4F3OA 4CJQA 1NWKA 3C65A 2B6AA 4BRAA 3DXKB 4DSLA 4JV5K 3C6HA 3HP9A 3WXIA 3CF5L 3OYIA 4J2AA 3OBYA 2YX6A 3SMPA 3CPWM 2D4WA 3VMFB 3DRRA 1JJ2M 4NXMK 1U4BA 1VSMA 4EZ6A 3HSTB 4BWMA 2XRIA 1YIJN 4KHWA 4FJIA 5E41A 3FFKB 3TI0A 2QEXN 4I2PA 1RTJA 1K8KA 2W41A 2P9PB 3VEVA 4BREA 2YNIA 5BRHA 4GV9A 2WC9A 4ILHA 1WB9A 5I42A 4M42A 5F2RA 1K9MO 1XC9A 2KQ2A 1U2VB 5M1KA 1NJZA 4CFDA 3MN5A 4OPAA 1U48A 4CGDA 4NYNA 1K6YA 1VK0A 3V9WA 1VQKN 4FK2A 3THWA 4BDPA 4CD3A 2PFUA 5AQKA 4JKFA 4FJLA 3NGZA 5AQRA 4JS5A 3VERA 4IOXA 4Y1DA 4FLUA 1GLBG 3U9DA 4LSLA 3PX4A 1EX4A 3HXMA 4M3WA 5FRMA 1GOAA 3FZLA 4ID5A 4BVOA 4K8XA 1YJWN 4LH5A 4UY8O 4CBWA 2NRRA 5EX5A 1IBMK 5KGXA 4LSNA 3AAQA 4C8MA 4FWSA 3NF8A 4CJ3A 4JKGA 3S3OA 4H0PA 1QZ5A 4IKFA 3MECA 3ALYA 4EHTA 3WXJA 2IC3A 3AARA 4K41A 1C1BA 4FJ5A 2UYTA 1KAXA 1T6DA 3FLCO 3WNGA 1BA0A 2OZMA 5FPMA 4GKJK 5AQIA 4EFHA 4MO5A 4B9LA 3A5OC 5DMRA 1WAFA 4H4MA 4KH4A 4IJAA 4CEBA 1S72N 2UUCK 1BQMA 1HNIA 5GAGP 1BISA 5BRDA 1NK6A 3DM2A 3O9SA 2PZSA 4O0JA 4IBNA 3O4WA 1XC3A 2Q0RA 4B9MA 4Z4EA 3HO1A 4C8NA 1V4SA 3NAEA 1RDBA 5BPMA 2OTJN 4HCCA 3ZT1A 4Z4FA 2FSJA 3CCRN 4CFAA 2FBVA 4CJ4A 4FLZA 3C6TA 2KZZA 3KD5E 1N34K 3DRSA 2HMIA 4PL7A 2D1KA 3HSCA 2J4RA 3VQDA 3RMCA 3GE1A 1QQCA 1ATRA 1ZBHA 4AM7A 4KH5A 2P5GA 3AVCA 2AA4A 5AQJA 3RR7A 1HNZK 2E2NA 1J9AA 3K58A 3AA5X 1NK9A 3NGIA 5J2QA 3F2KA 4R79A 4K25A 3ZSZA 2Y1JA 3WNFA 1GLCG 4CVNE 1BCOA 1W2BM 3TTDA 5ADXA 3PLAA 5GIOA 4CJEA 5FRNA 5M1FA 3VQ9A 3IKMA 5HRPA 5BN9A 2A41A 1DGKN 4BE1A 1K73O 1NGHA 1IJJA 3CCSN 4CF8A 5BR8K 3VA0A 4FJNA 3AVBA 3VN5A 1RCHA 1U04A 1Z05A 2UXDK 5IT9O 3K9JA 5D3GA 2A3ZA 2ZE2A 2YJEA 1A5WA 1QQNA 1S5JA 4RW7A 4DLGA 2ZGZA 3GG4A 1MA9B 1NMDA 3FZFA 3H46O 3EO3A 3A5LC 1HPZA 3OYGA 1X3MA 1HKBA 4K43A 3QERA 4OPHA 4JRQA 4JI6K 3CXCM 3TR8A 1OVYA 3CCUN 3HT3A 1TGOA 4H5VA 5AZJB 1SQKA 2HHXA 3VQPA 4B1WB 1Z25A 2HBLA 2FBTA 5M1QA 3V81A 4IFYA 4BACA 3ZEUA 1VAZA 2Z1HA 3ZSWA 3LDPA 4BC5A 4HUEA 4B1UB 4CD1A 3FE1A 3AVJA 2Q2RA 2QM1A 5KRSA 2BUPA 2EHGA 2ZWHA 4JKBA 3VQ6A 2QWRA 2ZJRL 3S41A 1RT1A 2JWKA 3U3YA 3B6OA 1CLQA 1SZ2A 4JI8K 3BF3A 2BANA 4DQRA 4DTNA 3LWMA 3LPTA 4EIAA 1MWKA 3E9PA 4LF8K 3CIPA 2YKMA 3CC7N 2XY5A 3ITHA 4IFEA 3O4QA 3M1FA 3IG1A 3HVTA 4C1NI 4UQGA 4M7YA 4X64K 3KLGA 1R59O 4YDUC 3EY1A 4CIEA 4CJTA 1DTTA 4JN4A 4FLWA 1ESVA 1U45A 3HPHA 2I7PA 1JLQA 1DEJA 3HVRA 5JS2A 2CGJA 5C2FA 1CXUA 5I9EB 4FW2A 2P9NB 4G1QA 5AZIA 1SS6A 4JI4K 3VOVA 1SL2A 4YHHK 3D2FB 4ELVA 3D2EB 4U7BA 1NKCA 4N41A 4AM6A 4KBOA 3VEWA 3KK7A 3MN6A 3WNHA 2KFNA 1BO5O 4FLYA 3DOLA 3HRGA 4M45A 1UA0A 1JLFA 3DLKA 3VTIA 2ASMA 3EEQA 3OS2A 3SPZA 2R7YA 3Q7BA 1QHAA 3SUNA 3VF6A 3FFIA 1FK9A 4JKAA 1K8KB 1RBSA 3WT0A 3L2QA 4BG8A 5AQTA 1WNSA 3AGRA 1XNRK 3P83D 1TYQA 4HWIA 4Q5VA 4DTXA 1CZ9A 5C15A 5AFUH 3ISNC 2P51A 1GOBA 2F9TA 3UKRA 1QQOA 4JI2K 3AAPA 1NGCA 3A5NC 3ZSRA 5FPDA 1B92A 3G4SN 1NGFA 3ZT2A 3ATVA 2DY4A 3U3GA 4FJ7A 4Z94A 3QEWA 4H0OA 4CZMA 2FSNA 4H5RA 1WUAA 3THWB 5HBMA 4W5NA 4Y0WA 5LY3A 2W42A 4CE9A 1S3XA 3HM8A 4JEPA 2OPPA 3DYAA 3H08A 3M8RA 4MLHA 1N36K 2VGNA 3J8AA 4GV3A 3R8EA 4CEDA 2P9UA 2YHXA 3VQ5A 1NJYA 3VGLA 4CF1A 1HQEA 4FOIA 1O13A 1O1WA 3V9SA 3MX5A 5KI6A 4JK9A 1LW2A 1EP4A 3P1GA 2RPIA 2V7ZA 1HNVA 1E4GT 1MWMA 1ATNA 4A62A 4DU3A 4KFBA 4CEOA 5JVGL 5AQWA 3NE6A 4B9UA 1JCEA 1HRHA 3SLCA 3F73A 1E3MA 4NCAA 4BR4A 1RDDA 3M6GA 5EOYA 3MX2A 2PAVA 4A61A 2YI1A 3QFPA 1MDUB 1HX1A 2OPRA 4LFCK 3C6AA 4BQZA 1VQ7N 3LANA 4Z4HA 3D45A 1P90A 1WN7A 3S3NA 5CYQA 3CFRA 3KD1E 4CZLA 5HRNA 1TUYA 3H3NO 4X65K 3OW2M 4DTUA 3B8AX 1IG8A 3ID6A 2O8EB 3QFUA 1LAWA 1RDWX 2F7TA 4KKOA 2GBZA 3TARA 4B1XB 1DLOA 1HJRA 5GADP 1DTQA 2OANA 4JK8A 4FXDA 3D7EO 4CHOA 1HNWK 3EL2A 1C0TA 1HPMA 4F9OA 3PUFA 4EAHD 4AHCA 3ZCMA 2V7YA 3M8SA 4BR2A 3AO3A 3AVGA 3PO5A 3V1QA 3LM9A 4B1YB 4M3TA 1FKPA 5KPZA 1R0AA 2KHOA 3V9XA 2HW3A 4E1JA 5E84A 4KHPK 3WQUA 3LDLA 4DLEA 5J2NA 5FLXO 4O8UA 4ILGB 4ELUA 1ITGA 3O08A 4DV1K 3P31A 1N33K 2O8CA 5CY4A 2PYLA 2PBDA 5KQ8A 2E6MA 3TAGA 3LWLA 1HKGA 4LD0A 4IEEA 4K8ZA 1N5YA 4FJJA 3QO9A 1EQYA 3OS0A 4M3RA 3ZLJA 3LAMA 3RMBA 3TSQA 4RW6A 4O0IA 1ILYA 1E4FT 2HF3A 4FM0A 4CW7B 4BY9C 1YF5L 3OYJA 3P38A 4DFJA 4FK4A 3OYEA 1RTHA 2ATQA 3MEGA 5CZ1A 3VEXA 4J2DA 3V4IA 3L2RA 3K0SA 1B9DA 2I7NA 1D8YA 3OYLA 3ZT4A 2A1SA 4B08A 3OYFA 1X1PA 3A0IX 1X9MA 3SK3A 4E1MA 4CZFA 4CK3A 3K57A 4JLHA 4FZYA 4QS9A 1EWQA 2NUBA 1WOQA 3E9LA 3CQXA 4FWPA 3R3LA 1RTDA 1QS4A 3SAFA 3ZX0A 4H0YB 4CK1A 4HHTA 3J80O 2O8DB 4CF2A 4KREA 3DLBA 1EETA 2G8IA 1KVCA 3SPYA 3L0QA 5J1EA 1HR0K 1HYZA 3NVMA 1U47A 1S1UA 1VQNN 4DCHA 1L3VA 2DPNA 2A40A 3A2FA 4WYBA 4H03B 4ELTA 1RTIA 2WUSA 4YY3K 4DHYA 2NZTA 2VQFK 2QXFA 4K0KK 3KLHA 1IKXA 5CYMA 3ENBA 1DKGD 4DR5K 3DMJA 2O8BB 1XNQK 3HOTA 5JS1A 2OPQA 4BRQA 3SNNA 1CZAN 3SI6A 3SQ4A 4B3RK 1NBWA 5KPRA 3KZBA 1TKZA 4ZHRA 3BY5A 1BWFO 2NLXA 4Z4IA 1OKJA 1QE1A 2QWOA 3C0BA 3CCQN 1J53A 3I0RA 4DG1A 2NRWA 3PIPL 1RBUA 1TV6A 3N4PA 3SJJA 5AZIB 4O55A 2QA4N 2IVPA 5AQYA 5AQQA 2VG5A 3IRXA 1RT6A 1YXQA 3L4QA 3QIOA 1VQMN 1S22A 1U6ZA 3LALA 4K42A 4FLVA 3P4IA 1RGIA 4CHPA 3VQ7A 3HP6A 2AJQA 3CJAA 4AHVA 4GVEA 4WFNL 4F2SA 2QK9A 1TK5A 4ZTFA 2ZM6K 1EO1A 3VA3A 2WFBA 1Q86O 1YI2N 4FJXA 1IKVA 5AQHA 3LZJA 4JS4A 3THXB 4OGEA 4YOXA 4C8KA 1RBTA 4E3SA 4CJVA 3HPGA 3UKRB 2P9IB 1WAJA 4V19S 4LF6K 3AA4A 4H0VB 2E4LA 4FVMA 1W9HA 4YDUA 5K14A 4YFUA 3HZ6A 2VYPA 3R6MA 3EKSA 3KLIA 2W6LA 3OTOK 2FBXA 2QXLA 5AQVA 2EWSA 1B9FA 3UKUA 4FW1A 5EVZA 3G6EN 2NRTA 1I3AA 1UOCA 3T69A 3F5TA 4E89A 4W5TA 4BGBA 4I2QA 1NGAA 4GVMA 3KVGA 1GLAG 1S1WA 4X62K 1QVGM 4BVPA 3P5JA 2WBNA 4B9NA 2E6LA 5HP1A 3CM6A 3CETA 1ASWA 5C12A 4CEAA 3ATUA 3LPUA 3QESA 1ZC6A 4FK0A 5KQDA 1WSGA 2RHKA 4EP4A 3I55N 4RW8A 2P9SA 3VEZA 4X66K 2FC0A 4BRLA 2Q1NA 4DSKA 4YOUA 3K5NA 4H8KA 3ZX3A 1YAGA 3WUHA 3ZETB 1NM1A 4E1NA 4O44A 3CPEA 2ZJQL 3MXMA 3ID8A 3TTFA 3PO4A 3RMDA 3CQ8A 1ZXOA 3HL8A 4CIFA 1NOZA 5C2DA 1QSYA 4CHNA 4FWKA 4DU1A 2YKNA 3QEVA 4CZEA 2E2QA 1XMQK 5DK5A 3QIPA 2D0CA 4EP5A 4DTPA 4Y1CA 2NRVA 1IO2A 4DSFA 4KRFA 3MWPA 4CFCA 3K5MA 4FWLA 4KHSA 4YOVA 3KTQA 3C6UA 3ZSQA 2G8WA 3ZT0A 1TUUA 4FPAA 4KB1A 2GEMA 3RRGA 4JKDA 4PA1A 4JYAK 3NDKA 4FLTA 1HYVA 1OH7A 2E2PA 4CJ7A 3Q7CA 3UIQA 1N32K 1NK7A 2KLAA 2UUAK 1W97L 4PKGA 2O8CB 4CEEA 5ADXH 4KHUA 1IG9A 4CJRA 4DV2K 3OYNA 5AJ3K 3AA2A 3TU5A 5GAEP 1Y64A 2DFFA 3A8YA 1XWLA 3O3FA 3I0SA 3VQBA 4BR7A 1VQPN 3AVNA 3LDSA 1BIUA 4DR1K 4AHRA 4CGFA 2P5OA 3IFRA 2Q97A 1QVFM 1X9SA 3ASMA 4L8RB 5AR0A 4EZ9A 4CIGA 3TAMA 1L5UA 2XY6A 1G99A 1GLLO 3I56N 4FLXA 3U9ZA 2QTDA 4E0DA 1GLEG 3UB5A 3NVKA 1D5AA 1LAVA 3O1BA 3SAHA 4XIUA 1SKSA 3VQAA 4CI6A 1BI4B 1SKRA 3HBTA 3H45C 4I6MA 4WQ5C 3LM2A 4DV5K 3DJCA 2FSKA 1Q81O 4B9VA 4B9TA 1LWFA 3HJFA 2VG6A 1HUXA 3I33A 3VEYA 4O5FA 2NRHA 5C24A 2ZGYA 3AVIA 5LMNK 4H5TA 3DI6A 4BRKA 1Q7YO 3CJ7A 2ZF5O 3N4QA 2G8VA 4OLBA 1YJNN 1NGDA 5TKYA 3CC2N 3QBWA 3BEXA 1NKBA 4FWNA 3PV8A 2XY8A 2FBYA 2O8FA 4B9QA 5KTQA 1WSJA 4FJMA 2G8KA 2P9LB 5JMVA 3T19A 3KK3A 2F8TA 5C25A 1J6ZA 4CBXA 4B8CA 4KHQA 3SUPA 5TKWA 1KLMA 3CM5A 4W5OA 4MDBA 2HHWA 3ZSVA 5EXWA 3L8BA 1YHQN 4DTJA 1UA1A 3CFPA 4DFPA 4DV0K 3KLFA 2FLOA 3NF9A 2HHSA 4DQSA 3RWUA 1WSEA 3CCVN 1TVRA 1IBKK 2P9PA 1RILA 2VGMA 2WTUA 4ILJA 4DV7K 2F96A 4AHUA 5HROA 3OJSA 3KHYA 2VQEK 1HYSA 3V9ZA 2RF2A 5FPNA 1C6VA 1U2VA 4M41A 1GLFO 1KQSM 2HBMA 4FZXC 3O9QA 2QWMA 4YOWA 4DQIA 4I7FA 3T7ZA 3C94A 4F2RA 2O4GA 4HTLA 4JAXA 1QHTA 1WSIA 3DOKA 4DTMA 1KD1O 2W6KA 3CMAN 1VQ8N 4FJ8A 3M5RA 1C1CA 3ZX2A 1JLAA 2Q31A 3L3VA 3FGUA 3MMVA 4MO4A 4DR7K 4DV4K 5AQLA 4NLCA 1VRTA 1WSFA 4CEZA 1V4TA 1D4XA 2B5JA 1EXQA 2X6NA 2KZMA 3O9TA 4FWOA 2E8AA 3D6RA 3KWGA 4JKGB 4HUFA 2GELA 2P1JA 3AA3A 3KLEA 1RT7A 3P39A 3O3HA 3QB0A 3UKUB 2QKBA 1A5VA 5JLHA 4PKIA 3SZ2A 4NB4A 4XH1A 2HB5A 4BC2A 4CJWA 5AQOA 5LMUK 4R5PA 3NCIA 2ZQBA 1L3UA 3QNOA 2E5LK 4W5QA 4CZJA 3OYCA 4A5AA 1GLJO 3TSPA 5M1OA 1KC8O 3KIOA 1J5OA 4BR0A 3WXLA 2QKKA 4OX9K 5J2PA 3CCMN 2B4JA 1GOCA 3M8QA 4CJKA 3AV9A 4WQ4C 4B3TK 2VCPA 3RR8A 5BN8A 2P9SB 4DKWA 3AO4A 2ITGA 1I39A 2YCHA 2RE2A 3G10A 1BGXT 1LWEA 2HNDA 3LP2A 4DF8A 3OA9A 3AVFA 2CGKA 2IVNA 4PUOA 1WBDA 2UU9K 4ZTJA 3QLHA 3THYA 5AQXA 1IH7A 3MXIA 1YUWA 1JL1A 3QEXA 3L4IA 2BTFA 3VF2A 3E66A 4IO9L 4JNEA 2G8HA 3H6EA 4OLAA 1BQNA 1TAQA 3KK2A 3QMLA 1QSSA 2QWNA 5EY4A 2D0AA 3E1YA 4BE0A 3MEEA 2V51B 1KRPA 4WCEL 3SUOA 4N47A 5T7BA 3SUQA 3OYKA 3ULEA 3C7NA 4CJ5A 4NXNK 3LL3A 4A2AA 4A5BA 4LFAK 4QOZB 4DB3A 3WNEA 3TAEA 1ZBFA 1NJXA 3NH0A 3QDKA 4KTZA 5DM6L 4CBUA 3HI0A 4KH6A 4TSXA 4IO8A 4DS5A 4E7IA 4KAZA 3LP1A 4JKEA 4E19A 4KV8A 4YOYA 4FOEA
chains in the Genus database with same CATH topology
2AJQA 4AHVA 4W5RA 4F2SA 3VA0A 4CHQA 2O4IA 1TKXA 2QK9A 1TK5A 4ZTFA 4GW6A 4FCYA 4FJNA 3AVBA 3VA3A 1HQUA 4FJXA 3VN5A 1RCHA 1IKVA 3LZJA 4DTSA 1XI1A 1U04A 5KRTA 4JS4A 1W0HA 4DMNA 5D3GA 2ZE2A 4OGEA 3U6FA 4C8KA 1A5WA 1RBTA 4E3SA 4CJVA 1KLNA 3HPGA 1VSHA 4CGGA 2Q3SA 1S5JA 4RW7A 3AO2A 4DLGA 5I3UA 4KO0A 1WAJA 2JLEA 1BCMA 1XHXA 3AA4A 2E4LA 3DRPA 4FVMA 1W9HA 3M8PA 5K14A 1QTMA 1QSLA 1WLJA 3LZIA 2HNZA 1JL2A 1JXBA 3NF7A 1RBVA 1HPZA 1Y97A 2RN2A 4YFUA 3V6DA 5EU7A 3OYGA 3KLIA 4J2EA 3QERA 4PY5A 2FBXA 4JRQA 3NF6A 3KKSA 3NH1A 3TR8A 2WOMA 4B3OA 4MQ3A 4DQPA 3AO5A 1IKYA 4CHZA 3SCXA 1L3SA 3SV3A 3ZT3A 1ZBUA 4OPJA 3HT3A 1TGOA 2HHXA 1NK8A 1B9FA 3RTVA 4FW1A 2D0BA 3VQPA 3DLRA 1Z25A 1T05A 1I3AA 1UOCA 2FBTA 4CERA 3JSMA 2PYJA 4E89A 3V81A 2HHTA 2HHUA 4IFYA 4BACA 4W5TA 4KTQA 2Z1HA 4I2QA 3B6PA 3ZSWA 1TK8A 4Q0BA 1SUQA 5KGWA 3KK1A 2A1RA 3AVMA 4BWJA 3SV4A 4HUEA 4GVMA 2XY7A 1S1WA 3RMAA 3HK2A 3C95A 1IKWA 1ZYQA 1S1VA 3P5JA 3AVJA 4B9NA 2E6LA 4FJIA 5KRSA 4O4GA 1CXQA 1ASUA 1UAXA 3PX6A 2VG7A 5HP1A 2EHGA 3CM6A 4HVJA 4M3XA 3S3MA 3VQ6A 4HCBA 1ASWA 1C0UA 4CEAA 3MAQA 4FYDA 3LPUA 3QESA 1RT1A 3U3YA 4FK0A 2HHVA 3B6OA 1WSGA 4CESA 4EP4A 1CLQA 2BANA 4RW8A 4CJPA 4DQRA 4DTNA 3LWMA 1MU2A 3LPTA 2GUIA 4CJSA 1Q8IA 2DFHA 1TK0A 2FC0A 1JLCA 3L3UA 2YKMA 1Z26A 4DSKA 4KI4A 2XY5A 3ITHA 3TABA 1A5XA 3O4QA 3K5NA 3T1AA 3PY8A 4H8KA 4CJLA 4E7HA 1BHLA 4AILC 4KI6A 4N5SA 2LSNA 3IS9A 4O5BA 3IG1A 3HVTA 3AO1A 4CF0A 2GV9A 4E1NA 4O44A 4UQGA 2DTUA 3TWHA 3MXMA 2HHQA 3PO4A 3RMDA 1WSHA 3CQ8A 1RBRA 3HL8A 3KLGA 4I9LA 4CGJA 3EY1A 1VSKA 4ID1A 4CIEA 2RKIA 1DTTA 4CJTA 2ZD1A 4FLWA 4CIFA 1NOZA 3HPHA 3ZSXA 4AHTA 1U45A 1QSYA 4FJ9A 3AVKA 1JLQA 4CHNA 3HVRA 1YTUA 3NBPA 5JS2A 3SQ0A 1RDAA 3G0ZA 2I5JA 3THVA 4F3TA 4KTWA 4FM2A 1CXUA 4E7JA 1RT4A 4FW2A 3AVAA 5SZTA 3VQ8A 2YKNA 4DU1A 3QETA 3QEVA 1SL1A 1NKEA 1FKOA 1RDCA 4G1QA 4OKJA 1S1XA 1LV5A 5DK5A 3ULDA 1SL2A 4CFBA 3NH2A 3D0PA 1SL0A 3QIPA 2D0CA 1NKCA 4EP5A 4ELVA 1U49A 4DTPA 4FJHA 4Y1CA 1S1TA 3L2WA 4DFMA 4N41A 2KFZA 1IO2A 1JKHA 2D5RA 3CG7A 3K5OA 3VQEA 4CJUA 3WNHA 4DSFA 4HUGA 4KRFA 2KFNA 4C8OA 4CFCA 3K5MA 1RT2A 4RW9A 4FLYA 3DOLA 4KHSA 4IG3A 1D9FA 4CGHA 4M45A 1UA0A 2OZSA 1JLFA 3IAYA 3KTQA 3DLKA 3C6UA 3VQ4A 1YT3A 3ZSQA 3OYDA 3QEPA 4YNQA 5SWMA 4LH4A 3OS2A 3SPZA 2R7YA 3ZT0A 3V1OA 1N6QA 2G8WA 1TKTA 4KB1A 2IAJA 3RRGA 3SQ2A 3SUNA 3MXJA 4PA1A 1NK4A 3NDKA 3TANA 5HLFA 3FFIA 1FK9A 3OVNA 3L2QA 1HYVA 1RBSA 4FLTA 1WNSA 4NCBA 3UIQA 3P83D 1NK7A 2X6SA 2X78A 1F21A 4Q5VA 2XHBA 4DTXA 1CZ9A 1TL1A 4CEEA 4KHUA 1C1AA 3ISNC 1IG9A 2P51A 1GOBA 4CJRA 1LWCA 3OYNA 2XO7A 1VSEA 2HVHA 4CJFA 1Q9XA 3KJVA 3AA2A 3ZSRA 1B92A 2DFFA 4Z4CA 3EYZA 3ZT2A 2DY4A 1EKEA 4CK2A 3U3GA 3ZSYA 4HTUA 4FJ7A 4KB0A 4RW4A 1XWLA 2YNHA 4WE1A 4BDYA 3O3FA 3QEWA 2JGUA 3I0SA 3VQCA 1S6PA 5HBMA 4W5NA 3VQBA 3BDPA 4RG8A 4BE2A 3AVNA 3LDSA 2W42A 3OS1A 1BIUA 4CE9A 3K59A 1RT3A 4CCHA 4AHRA 3HYFA 4CGFA 1HMVA 2P5OA 2KTQA 4OPKA 2OPPA 1X9SA 3DYAA 3H08A 3M8RA 3EZ5A 4CEFA 3ASMA 4L8RB 4DTRA 1S6QA 3OYBA 2ETJA 2X74A 2G8FA 4EZ9A 4OGCA 4CIGA 2HVIA 4CECA 1VSFA 1RT5A 4CEDA 3VQ5A 3TAMA 1NJYA 2XY6A 4AHSA 4CHYA 4N56A 1L5UA 5FROA 4M3UA 4CF1A 4FLXA 1HQEA 1O1WA 2DFEA 3L2VA 3V9SA 4M3ZA 4E0DA 1BL3A 3L2UA 1BI4A 1ZBLA 3MEDA 1CZBA 1D5AA 1LAVA 5KI6A 4OJRA 4XIUA 1SKSA 3VQAA 4KHNA 1JXEA 3OJUA 1BI4B 1NK0A 3O4NA 1LW2A 1SKRA 1EP4A 3JYTA 3P1GA 2RPIA 1S9EA 2Z1JA 1HNVA 1VSIA 4PQUA 3F9KA 5J2MA 1T7PA 4DU3A 4KFBA 4N76A 4CEOA 4IG0A 4F4KA 5FDLA 4FJKA 3NE6A 1KTQA 4B9UA 1HRHA 1YTAA 2BE2A 3F73A 4B9VA 4NCAA 4B9TA 1LWFA 1RDDA 3T3FA 3HJFA 2IOCA 2VG6A 1X9WA 4C8LA 3QINA 5C24A 3AVIA 3BGRA 3NHGA 1TKDA 2OPRA 1KFDA 2VWKA 4KPYA 3LANA 4Z4HA 3DI6A 4CGIA 3D45A 3DLEA 5HRRA 2G8VA 1WN7A 2IDOA 4OLBA 3S3NA 5CYQA 3CFRA 3KD1E 3VQQA 4M3YA 3K2PA 1NKBA 5HRNA 1RNHA 3PV8A 3OYMA 2XY8A 2FBYA 4DSEA 4F3OA 4DTUA 4DTOA 4CJQA 5KTQA 1KVBA 1WSJA 4FJMA 4NCGA 3QEIA 4OKEA 2G8KA 3DLHA 1LAWA 3T19A 3KK3A 1XHZA 2B6AA 4KKOA 5C25A 2GBZA 4DSLA 2F8TA 4B8AB 3TARA 1DLOA 2YHBA 1HJRA 4B8CA 4KHQA 1TAUA 3SUPA 4KHYA 1FXXA 3HP9A 1DTQA 1KLMA 3OYIA 4J2AA 3CM5A 4FXDA 2Z1IA 5C42A 4W5OA 4CHOA 2HHWA 3ZSVA 1C0TA 3L8BA 3PUFA 3TAQA 4DTJA 1C0MA 3DRRA 4BDZA 1UA1A 2IS3A 3CFPA 1SKWA 4AHCA 1U4BA 2F8SA 1VSMA 4DFPA 3HSTB 3ZCMA 4EZ6A 3KLFA 3NF9A 3M8SA 4BWMA 2HHSA 2XRIA 4KHWA 4DQSA 3AO3A 3AVGA 3NFAA 1WSEA 4FM1A 2YNFA 5E41A 3PO5A 3RWUA 3V1QA 3TI0A 4Z4GA 1TVRA 4E7KA 4M3TA 2OPSA 4PWDA 1FKPA 1RILA 1D9DA 2F96A 4I2PA 4AHUA 1RTJA 5HROA 4NYFA 1R0AA 3V9XA 3OJSA 2HW3A 2YNIA 1HYSA 3V9ZA 2RF2A 3HM9A 4DLEA 2OA8A 5CZ2A 5J2NA 4ELUA 1ITGA 4QAGA 5CY4A 5I42A 2PYLA 4M42A 2E6MA 1C6VA 3TAGA 4M41A 4DU4A 1XC9A 3QNNA 3PX0A 3LWLA 4DFKA 3NGYA 4FZXC 2KQ2A 4LD0A 4K8ZA 1N5YA 1VSDA 1YVUA 1NJZA 4FJJA 3QO9A 4CFDA 4DQIA 4I7FA 1VRUA 3C94A 4F2RA 1U48A 3OS0A 4CGDA 1JLBA 4NYNA 1K6YA 1VK0A 3V9WA 2O4GA 4M3RA 1QHTA 1TL3A 1WSIA 4FK2A 1JLEA 3DOKA 4DTMA 1KVAA 4BDPA 3LAMA 3RMBA 4FJLA 1KFSA 3NGZA 4JS5A 4RW6A 1L3TA 1VSLA 2Y1IA 4O0IA 3CFOA 4I9QA 4FJ8A 4Y1DA 4FLUA 4FM0A 1Q9YA 4F8RA 1G15A 1KCFA 3AVHA 4DQQA 1C1CA 3OYJA 1JLAA 4LSLA 3PX4A 4DFJA 4FK4A 1EX4A 3OYEA 3HXMA 1RTHA 2ATQA 3MEGA 4M3WA 5FRMA 5CZ1A 4FZZA 4E7LA 4J2DA 1GOAA 4ID5A 4IFVA 3V4IA 3L2RA 4K8XA 3L3VA 4LH5A 1B9DA 2WONA 4GMJB 2YV0X 1D8YA 3OYLA 3ZT4A 2A1SA 4IDKA 4B08A 3OYFA 1X1PA 4ICLA 5KGXA 4LSNA 1VRTA 1WSFA 1X9MA 4C8MA 4E1MA 4CEZA 1LW0A 4CK3A 2Z1GA 2G8UA 2B5JA 1EXQA 2X6NA 4JLHA 3HPOA 3NF8A 3K57A 4FZYA 2KZMA 4CJ3A 2NUBA 3S3OA 4CF9A 4IKFA 3TAFA 3MECA 1T03A 2YHAA 3ALYA 2IC3A 4HUFA 1C1BA 4FJ5A 2P1JA 3AA3A 3KLEA 1RTDA 2PY5A 2VWJA 1QS4A 1RT7A 4LY7A 4H4OA 3V9UA 3WNGA 3O3HA 2BGGA 1BIZA 2QKBA 4CK1A 1A5VA 4JRPA 4HHTA 2OZMA 3V1RA 4DS4A 4FJGA 4CF2A 4KREA 3SZ2A 3ZSOA 2HB5A 3DLBA 1EETA 5HRSA 2G8IA 4CJWA 1KVCA 3SPYA 4B9LA 4R5PA 5J1EA 4DWIA 3NCIA 2ZQBA 5DMRA 1L3UA 3OYAA 1HYZA 1WAFA 2YNGA 4W5QA 3QNOA 4H4MA 1KSPA 4CEBA 1U47A 1S1UA 3OYCA 3SQ1A 1BQMA 1HNIA 2BDPA 4OKKA 1BISA 1REVA 2KW4A 1NK6A 1L3VA 3DM2A 3E01A 3A2FA 2IGIA 3KKRA 1ZBIA 3KIOA 2PZSA 1J5OA 4O0JA 4ELTA 1RTIA 2QKKA 2HNYA 5J2PA 4IBNA 4Z4EA 3SYZA 2QXFA 4B9MA 3HO1A 2B4JA 1GOCA 3M8QA 4CJKA 3KLHA 3AV9A 3I8DA 4C8NA 1IKXA 5CYMA 2OYQA 1VSJA 3NAEA 1UWBA 3DMJA 1RDBA 4Z0UA 1T8EA 4DSIA 3RR8A 3LAKA 4HCCA 3ZT1A 4Z4FA 5JS1A 2OPQA 3AO4A 2ITGA 1I39A 4CFAA 3K5LA 3SNNA 3G10A 1BGXT 1LWEA 2FBVA 4CJ4A 2HNDA 3S9HA 3LP2A 3SQ4A 4FLZA 4DF8A 3SI6A 3AVFA 3C6TA 4PUOA 2KZZA 3KD5E 3LP3A 3DRSA 4ZTJA 2HMIA 3QLHA 1TKZA 3AVLA 1SV5A 4ZHRA 4MFBA 1IH7A 3VQDA 1JLGA 3RMCA 3MXIA 1NK5A 1JL1A 3QEXA 4Z4IA 1QQCA 4DF4A 4AH9A 1J54A 1ZBHA 4OVLA 1QE1A 4B9SA 2G8HA 4OLAA 1BQNA 1TAQA 3KK2A 1J53A 3I0RA 1QSSA 4DG1A 1S9GA 3AVCA 2P5GA 2D0AA 4BE0A 3RR7A 3MEEA 1RBUA 1TV6A 1NJWA 4J2BA 1ASVA 3OY9A 3CYMA 3SJJA 1J9AA 3K58A 1KRPA 3SUOA 4N47A 1NOYA 3AA5X 3RRHA 5T7BA 1NK9A 3NGIA 3SUQA 5J2QA 4O55A 3OYKA 4KAZA 2Y1JA 3ZSZA 3LP0A 3O3GA 4CJ5A 3WNFA 1BCOA 4QCLA 2VG5A 3IRXA 1RT6A 4QOZB 3QIOA 3WNEA 3TAEA 1ZBFA 1NJXA 3NH0A 4KTZA 4CJEA 5FRNA 4DSJA 3VQ9A 4CEQA 4TSXA 3LALA 3DLGA 5HRPA 4FLVA 4DS5A 3TAPA 4E7IA 4BE1A 2EX3A 3LP1A 4CHPA 4KV8A 3VQ7A 4E19A 3HP6A 3OYHA 4CF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJQ A;  4AHV A;  4W5R A;  4F2S A;  3VA0 A;  4CHQ A;  2O4I A;  1TKX A;  2QK9 A;  1TK5 A;  4ZTF A;  4GW6 A;  4FCY A;  4FJN A;  3AVB A;  3VA3 A;  1HQU A;  4FJX A;  3VN5 A;  1RCH A;  1IKV A;  3LZJ A;  4DTS A;  1XI1 A;  1U04 A;  5KRT A;  4JS4 A;  1W0H A;  4DMN A;  5D3G A;  2ZE2 A;  4OGE A;  3U6F A;  4C8K A;  1A5W A;  1RBT A;  4E3S A;  4CJV A;  1KLN A;  3HPG A;  1VSH A;  4CGG A;  2Q3S A;  1S5J A;  4RW7 A;  3AO2 A;  4DLG A;  5I3U A;  4KO0 A;  1WAJ A;  2JLE A;  1BCM A;  1XHX A;  3AA4 A;  2E4L A;  3DRP A;  4FVM A;  1W9H A;  3M8P A;  5K14 A;  1QTM A;  1QSL A;  1WLJ A;  3LZI A;  2HNZ A;  1JL2 A;  1JXB A;  3NF7 A;  1RBV A;  1HPZ A;  1Y97 A;  2RN2 A;  4YFU A;  3V6D A;  5EU7 A;  3OYG A;  3KLI A;  4J2E A;  3QER A;  4PY5 A;  2FBX A;  4JRQ A;  3NF6 A;  3KKS A;  3NH1 A;  3TR8 A;  2WOM A;  4B3O A;  4MQ3 A;  4DQP A;  3AO5 A;  1IKY A;  4CHZ A;  3SCX A;  1L3S A;  3SV3 A;  3ZT3 A;  1ZBU A;  4OPJ A;  3HT3 A;  1TGO A;  2HHX A;  1NK8 A;  1B9F A;  3RTV A;  4FW1 A;  2D0B A;  3VQP A;  3DLR A;  1Z25 A;  1T05 A;  1I3A A;  1UOC A;  2FBT A;  4CER A;  3JSM A;  2PYJ A;  4E89 A;  3V81 A;  2HHT A;  2HHU A;  4IFY A;  4BAC A;  4W5T A;  4KTQ A;  2Z1H A;  4I2Q A;  3B6P A;  3ZSW A;  1TK8 A;  4Q0B A;  1SUQ A;  5KGW A;  3KK1 A;  2A1R A;  3AVM A;  4BWJ A;  3SV4 A;  4HUE A;  4GVM A;  2XY7 A;  1S1W A;  3RMA A;  3HK2 A;  3C95 A;  1IKW A;  1ZYQ A;  1S1V A;  3P5J A;  3AVJ A;  4B9N A;  2E6L A;  4FJI A;  5KRS A;  4O4G A;  1CXQ A;  1ASU A;  1UAX A;  3PX6 A;  2VG7 A;  5HP1 A;  2EHG A;  3CM6 A;  4HVJ A;  4M3X A;  3S3M A;  3VQ6 A;  4HCB A;  1ASW A;  1C0U A;  4CEA A;  3MAQ A;  4FYD A;  3LPU A;  3QES A;  1RT1 A;  3U3Y A;  4FK0 A;  2HHV A;  3B6O A;  1WSG A;  4CES A;  4EP4 A;  1CLQ A;  2BAN A;  4RW8 A;  4CJP A;  4DQR A;  4DTN A;  3LWM A;  1MU2 A;  3LPT A;  2GUI A;  4CJS A;  1Q8I A;  2DFH A;  1TK0 A;  2FC0 A;  1JLC A;  3L3U A;  2YKM A;  1Z26 A;  4DSK A;  4KI4 A;  2XY5 A;  3ITH A;  3TAB A;  1A5X A;  3O4Q A;  3K5N A;  3T1A A;  3PY8 A;  4H8K A;  4CJL A;  4E7H A;  1BHL A;  4AIL C;  4KI6 A;  4N5S A;  2LSN A;  3IS9 A;  4O5B A;  3IG1 A;  3HVT A;  3AO1 A;  4CF0 A;  2GV9 A;  4E1N A;  4O44 A;  4UQG A;  2DTU A;  3TWH A;  3MXM A;  2HHQ A;  3PO4 A;  3RMD A;  1WSH A;  3CQ8 A;  1RBR A;  3HL8 A;  3KLG A;  4I9L A;  4CGJ A;  3EY1 A;  1VSK A;  4ID1 A;  4CIE A;  2RKI A;  1DTT A;  4CJT A;  2ZD1 A;  4FLW A;  4CIF A;  1NOZ A;  3HPH A;  3ZSX A;  4AHT A;  1U45 A;  1QSY A;  4FJ9 A;  3AVK A;  1JLQ A;  4CHN A;  3HVR A;  1YTU A;  3NBP A;  5JS2 A;  3SQ0 A;  1RDA A;  3G0Z A;  2I5J A;  3THV A;  4F3T A;  4KTW A;  4FM2 A;  1CXU A;  4E7J A;  1RT4 A;  4FW2 A;  3AVA A;  5SZT A;  3VQ8 A;  2YKN A;  4DU1 A;  3QET A;  3QEV A;  1SL1 A;  1NKE A;  1FKO A;  1RDC A;  4G1Q A;  4OKJ A;  1S1X A;  1LV5 A;  5DK5 A;  3ULD A;  1SL2 A;  4CFB A;  3NH2 A;  3D0P A;  1SL0 A;  3QIP A;  2D0C A;  1NKC A;  4EP5 A;  4ELV A;  1U49 A;  4DTP A;  4FJH A;  4Y1C A;  1S1T A;  3L2W A;  4DFM A;  4N41 A;  2KFZ A;  1IO2 A;  1JKH A;  2D5R A;  3CG7 A;  3K5O A;  3VQE A;  4CJU A;  3WNH A;  4DSF A;  4HUG A;  4KRF A;  2KFN A;  4C8O A;  4CFC A;  3K5M A;  1RT2 A;  4RW9 A;  4FLY A;  3DOL A;  4KHS A;  4IG3 A;  1D9F A;  4CGH A;  4M45 A;  1UA0 A;  2OZS A;  1JLF A;  3IAY A;  3KTQ A;  3DLK A;  3C6U A;  3VQ4 A;  1YT3 A;  3ZSQ A;  3OYD A;  3QEP A;  4YNQ A;  5SWM A;  4LH4 A;  3OS2 A;  3SPZ A;  2R7Y A;  3ZT0 A;  3V1O A;  1N6Q A;  2G8W A;  1TKT A;  4KB1 A;  2IAJ A;  3RRG A;  3SQ2 A;  3SUN A;  3MXJ A;  4PA1 A;  1NK4 A;  3NDK A;  3TAN A;  5HLF A;  3FFI A;  1FK9 A;  3OVN A;  3L2Q A;  1HYV A;  1RBS A;  4FLT A;  1WNS A;  4NCB A;  3UIQ A;  3P83 D;  1NK7 A;  2X6S A;  2X78 A;  1F21 A;  4Q5V A;  2XHB A;  4DTX A;  1CZ9 A;  1TL1 A;  4CEE A;  4KHU A;  1C1A A;  3ISN C;  1IG9 A;  2P51 A;  1GOB A;  4CJR A;  1LWC A;  3OYN A;  2XO7 A;  1VSE A;  2HVH A;  4CJF A;  1Q9X A;  3KJV A;  3AA2 A;  3ZSR A;  1B92 A;  2DFF A;  4Z4C A;  3EYZ A;  3ZT2 A;  2DY4 A;  1EKE A;  4CK2 A;  3U3G A;  3ZSY A;  4HTU A;  4FJ7 A;  4KB0 A;  4RW4 A;  1XWL A;  2YNH A;  4WE1 A;  4BDY A;  3O3F A;  3QEW A;  2JGU A;  3I0S A;  3VQC A;  1S6P A;  5HBM A;  4W5N A;  3VQB A;  3BDP A;  4RG8 A;  4BE2 A;  3AVN A;  3LDS A;  2W42 A;  3OS1 A;  1BIU A;  4CE9 A;  3K59 A;  1RT3 A;  4CCH A;  4AHR A;  3HYF A;  4CGF A;  1HMV A;  2P5O A;  2KTQ A;  4OPK A;  2OPP A;  1X9S A;  3DYA A;  3H08 A;  3M8R A;  3EZ5 A;  4CEF A;  3ASM A;  4L8R B;  4DTR A;  1S6Q A;  3OYB A;  2ETJ A;  2X74 A;  2G8F A;  4EZ9 A;  4OGC A;  4CIG A;  2HVI A;  4CEC A;  1VSF A;  1RT5 A;  4CED A;  3VQ5 A;  3TAM A;  1NJY A;  2XY6 A;  4AHS A;  4CHY A;  4N56 A;  1L5U A;  5FRO A;  4M3U A;  4CF1 A;  4FLX A;  1HQE A;  1O1W A;  2DFE A;  3L2V A;  3V9S A;  4M3Z A;  4E0D A;  1BL3 A;  3L2U A;  1BI4 A;  1ZBL A;  3MED A;  1CZB A;  1D5A A;  1LAV A;  5KI6 A;  4OJR A;  4XIU A;  1SKS A;  3VQA A;  4KHN A;  1JXE A;  3OJU A;  1BI4 B;  1NK0 A;  3O4N A;  1LW2 A;  1SKR A;  1EP4 A;  3JYT A;  3P1G A;  2RPI A;  1S9E A;  2Z1J A;  1HNV A;  1VSI A;  4PQU A;  3F9K A;  5J2M A;  1T7P A;  4DU3 A;  4KFB A;  4N76 A;  4CEO A;  4IG0 A;  4F4K A;  5FDL A;  4FJK A;  3NE6 A;  1KTQ A;  4B9U A;  1HRH A;  1YTA A;  2BE2 A;  3F73 A;  4B9V A;  4NCA A;  4B9T A;  1LWF A;  1RDD A;  3T3F A;  3HJF A;  2IOC A;  2VG6 A;  1X9W A;  4C8L A;  3QIN A;  5C24 A;  3AVI A;  3BGR A;  3NHG A;  1TKD A;  2OPR A;  1KFD A;  2VWK A;  4KPY A;  3LAN A;  4Z4H A;  3DI6 A;  4CGI A;  3D45 A;  3DLE A;  5HRR A;  2G8V A;  1WN7 A;  2IDO A;  4OLB A;  3S3N A;  5CYQ A;  3CFR A;  3KD1 E;  3VQQ A;  4M3Y A;  3K2P A;  1NKB A;  5HRN A;  1RNH A;  3PV8 A;  3OYM A;  2XY8 A;  2FBY A;  4DSE A;  4F3O A;  4DTU A;  4DTO A;  4CJQ A;  5KTQ A;  1KVB A;  1WSJ A;  4FJM A;  4NCG A;  3QEI A;  4OKE A;  2G8K A;  3DLH A;  1LAW A;  3T19 A;  3KK3 A;  1XHZ A;  2B6A A;  4KKO A;  5C25 A;  2GBZ A;  4DSL A;  2F8T A;  4B8A B;  3TAR A;  1DLO A;  2YHB A;  1HJR A;  4B8C A;  4KHQ A;  1TAU A;  3SUP A;  4KHY A;  1FXX A;  3HP9 A;  1DTQ A;  1KLM A;  3OYI A;  4J2A A;  3CM5 A;  4FXD A;  2Z1I A;  5C42 A;  4W5O A;  4CHO A;  2HHW A;  3ZSV A;  1C0T A;  3L8B A;  3PUF A;  3TAQ A;  4DTJ A;  1C0M A;  3DRR A;  4BDZ A;  1UA1 A;  2IS3 A;  3CFP A;  1SKW A;  4AHC A;  1U4B A;  2F8S A;  1VSM A;  4DFP A;  3HST B;  3ZCM A;  4EZ6 A;  3KLF A;  3NF9 A;  3M8S A;  4BWM A;  2HHS A;  2XRI A;  4KHW A;  4DQS A;  3AO3 A;  3AVG A;  3NFA A;  1WSE A;  4FM1 A;  2YNF A;  5E41 A;  3PO5 A;  3RWU A;  3V1Q A;  3TI0 A;  4Z4G A;  1TVR A;  4E7K A;  4M3T A;  2OPS A;  4PWD A;  1FKP A;  1RIL A;  1D9D A;  2F96 A;  4I2P A;  4AHU A;  1RTJ A;  5HRO A;  4NYF A;  1R0A A;  3V9X A;  3OJS A;  2HW3 A;  2YNI A;  1HYS A;  3V9Z A;  2RF2 A;  3HM9 A;  4DLE A;  2OA8 A;  5CZ2 A;  5J2N A;  4ELU A;  1ITG A;  4QAG A;  5CY4 A;  5I42 A;  2PYL A;  4M42 A;  2E6M A;  1C6V A;  3TAG A;  4M41 A;  4DU4 A;  1XC9 A;  3QNN A;  3PX0 A;  3LWL A;  4DFK A;  3NGY A;  4FZX C;  2KQ2 A;  4LD0 A;  4K8Z A;  1N5Y A;  1VSD A;  1YVU A;  1NJZ A;  4FJJ A;  3QO9 A;  4CFD A;  4DQI A;  4I7F A;  1VRU A;  3C94 A;  4F2R A;  1U48 A;  3OS0 A;  4CGD A;  1JLB A;  4NYN A;  1K6Y A;  1VK0 A;  3V9W A;  2O4G A;  4M3R A;  1QHT A;  1TL3 A;  1WSI A;  4FK2 A;  1JLE A;  3DOK A;  4DTM A;  1KVA A;  4BDP A;  3LAM A;  3RMB A;  4FJL A;  1KFS A;  3NGZ A;  4JS5 A;  4RW6 A;  1L3T A;  1VSL A;  2Y1I A;  4O0I A;  3CFO A;  4I9Q A;  4FJ8 A;  4Y1D A;  4FLU A;  4FM0 A;  1Q9Y A;  4F8R A;  1G15 A;  1KCF A;  3AVH A;  4DQQ A;  1C1C A;  3OYJ A;  1JLA A;  4LSL A;  3PX4 A;  4DFJ A;  4FK4 A;  1EX4 A;  3OYE A;  3HXM A;  1RTH A;  2ATQ A;  3MEG A;  4M3W A;  5FRM A;  5CZ1 A;  4FZZ A;  4E7L A;  4J2D A;  1GOA A;  4ID5 A;  4IFV A;  3V4I A;  3L2R A;  4K8X A;  3L3V A;  4LH5 A;  1B9D A;  2WON A;  4GMJ B;  2YV0 X;  1D8Y A;  3OYL A;  3ZT4 A;  2A1S A;  4IDK A;  4B08 A;  3OYF A;  1X1P A;  4ICL A;  5KGX A;  4LSN A;  1VRT A;  1WSF A;  1X9M A;  4C8M A;  4E1M A;  4CEZ A;  1LW0 A;  4CK3 A;  2Z1G A;  2G8U A;  2B5J A;  1EXQ A;  2X6N A;  4JLH A;  3HPO A;  3NF8 A;  3K57 A;  4FZY A;  2KZM A;  4CJ3 A;  2NUB A;  3S3O A;  4CF9 A;  4IKF A;  3TAF A;  3MEC A;  1T03 A;  2YHA A;  3ALY A;  2IC3 A;  4HUF A;  1C1B A;  4FJ5 A;  2P1J A;  3AA3 A;  3KLE A;  1RTD A;  2PY5 A;  2VWJ A;  1QS4 A;  1RT7 A;  4LY7 A;  4H4O A;  3V9U A;  3WNG A;  3O3H A;  2BGG A;  1BIZ A;  2QKB A;  4CK1 A;  1A5V A;  4JRP A;  4HHT A;  2OZM A;  3V1R A;  4DS4 A;  4FJG A;  4CF2 A;  4KRE A;  3SZ2 A;  3ZSO A;  2HB5 A;  3DLB A;  1EET A;  5HRS A;  2G8I A;  4CJW A;  1KVC A;  3SPY A;  4B9L A;  4R5P A;  5J1E A;  4DWI A;  3NCI A;  2ZQB A;  5DMR A;  1L3U A;  3OYA A;  1HYZ A;  1WAF A;  2YNG A;  4W5Q A;  3QNO A;  4H4M A;  1KSP A;  4CEB A;  1U47 A;  1S1U A;  3OYC A;  3SQ1 A;  1BQM A;  1HNI A;  2BDP A;  4OKK A;  1BIS A;  1REV A;  2KW4 A;  1NK6 A;  1L3V A;  3DM2 A;  3E01 A;  3A2F A;  2IGI A;  3KKR A;  1ZBI A;  3KIO A;  2PZS A;  1J5O A;  4O0J A;  4ELT A;  1RTI A;  2QKK A;  2HNY A;  5J2P A;  4IBN A;  4Z4E A;  3SYZ A;  2QXF A;  4B9M A;  3HO1 A;  2B4J A;  1GOC A;  3M8Q A;  4CJK A;  3KLH A;  3AV9 A;  3I8D A;  4C8N A;  1IKX A;  5CYM A;  2OYQ A;  1VSJ A;  3NAE A;  1UWB A;  3DMJ A;  1RDB A;  4Z0U A;  1T8E A;  4DSI A;  3RR8 A;  3LAK A;  4HCC A;  3ZT1 A;  4Z4F A;  5JS1 A;  2OPQ A;  3AO4 A;  2ITG A;  1I39 A;  4CFA A;  3K5L A;  3SNN A;  3G10 A;  1BGX T;  1LWE A;  2FBV A;  4CJ4 A;  2HND A;  3S9H A;  3LP2 A;  3SQ4 A;  4FLZ A;  4DF8 A;  3SI6 A;  3AVF A;  3C6T A;  4PUO A;  2KZZ A;  3KD5 E;  3LP3 A;  3DRS A;  4ZTJ A;  2HMI A;  3QLH A;  1TKZ A;  3AVL A;  1SV5 A;  4ZHR A;  4MFB A;  1IH7 A;  3VQD A;  1JLG A;  3RMC A;  3MXI A;  1NK5 A;  1JL1 A;  3QEX A;  4Z4I A;  1QQC A;  4DF4 A;  4AH9 A;  1J54 A;  1ZBH A;  4OVL A;  1QE1 A;  4B9S A;  2G8H A;  4OLA A;  1BQN A;  1TAQ A;  3KK2 A;  1J53 A;  3I0R A;  1QSS A;  4DG1 A;  1S9G A;  3AVC A;  2P5G A;  2D0A A;  4BE0 A;  3RR7 A;  3MEE A;  1RBU A;  1TV6 A;  1NJW A;  4J2B A;  1ASV A;  3OY9 A;  3CYM A;  3SJJ A;  1J9A A;  3K58 A;  1KRP A;  3SUO A;  4N47 A;  1NOY A;  3AA5 X;  3RRH A;  5T7B A;  1NK9 A;  3NGI A;  3SUQ A;  5J2Q A;  4O55 A;  3OYK A;  4KAZ A;  2Y1J A;  3ZSZ A;  3LP0 A;  3O3G A;  4CJ5 A;  3WNF A;  1BCO A;  4QCL A;  2VG5 A;  3IRX A;  1RT6 A;  4QOZ B;  3QIO A;  3WNE A;  3TAE A;  1ZBF A;  1NJX A;  3NH0 A;  4KTZ A;  4CJE A;  5FRN A;  4DSJ A;  3VQ9 A;  4CEQ A;  4TSX A;  3LAL A;  3DLG A;  5HRP A;  4FLV A;  4DS5 A;  3TAP A;  4E7I A;  4BE1 A;  2EX3 A;  3LP1 A;  4CHP A;  4KV8 A;  3VQ7 A;  4E19 A;  3HP6 A;  3OYH A;  4CF8 A; 
#chains in the Genus database with same CATH topology
 4W5R A;  1FW6 A;  3O5B A;  2O4I A;  4FCY A;  1HQU A;  4DTS A;  1XI1 A;  3U6F A;  4BRO A;  4MDA A;  3AO2 A;  4FWM A;  4A57 A;  4IOC L;  5I3U A;  1BCM A;  3J7Z O;  3DRP A;  1QTM A;  1QSL A;  1WLJ A;  3LZI A;  1JL2 A;  1JXB A;  2HNZ A;  3NF7 A;  2UXB K;  4H5W A;  5EU7 A;  4J2E A;  4PY5 A;  3NF6 A;  3KKS A;  4MQ3 A;  4DQP A;  3AO5 A;  1IKY A;  3GBT A;  5AZJ A;  4BGA A;  1L3S A;  3SV3 A;  1ZBU A;  3IUC A;  1NK8 A;  3RTV A;  3K9K A;  2D0B A;  3CER A;  3DLR A;  1VHX A;  3CME N;  1T05 A;  5CHI A;  1RFQ A;  3FZH A;  4CER A;  3JSM A;  4BRN A;  2HHU A;  4FL9 A;  3CJC A;  1SUQ A;  2YJF A;  5KGW A;  2A1R A;  3SV4 A;  2XY7 A;  3ZEU B;  2HOE A;  4BRD A;  3HK2 A;  3C95 A;  1FJG K;  1IKW A;  5AQZ A;  4MLE A;  1ASU A;  1P8Z A;  4CZI A;  4HVJ A;  3DWL A;  4HCB A;  2P9K A;  1C0U A;  1ZBS A;  2HHV A;  4CES A;  1OH6 A;  4BRC A;  1MU2 A;  2W40 A;  2DFH A;  3PIO L;  1K8A O;  2A6A A;  3VEN A;  1IBL K;  4BRM A;  3T1A A;  4CJL A;  3H3O B;  4AIL C;  3IS9 A;  4O5B A;  3VES A;  1IV0 A;  3AO1 A;  2DTU A;  3CC4 N;  3TWH A;  2HHQ A;  1WSH A;  4I9L A;  3H1V X;  1VSK A;  2RKI A;  4KTQ A;  4DR3 K;  3AGK A;  4JHD A;  4AHT A;  1BDG A;  2P9N A;  3NBP A;  2O8F B;  3G0Z A;  5GIN A;  4KTW A;  5BPN A;  3VQ8 A;  3D2F A;  2NNW A;  3D2E A;  3FR0 A;  1NJI O;  1RDC A;  1S1X A;  1LV5 A;  3CJ9 A;  3CCE N;  5HOO A;  4CFB A;  5LJW A;  3NH2 A;  3GOI A;  3VTH A;  4FJH A;  3H1Q A;  1U49 A;  3L2W A;  4DFM A;  4ISE A;  3MWT A;  3K5O A;  3CG7 A;  3VQE A;  3MN9 A;  4CJU A;  5DM7 L;  3GL1 A;  4C8O A;  1RT2 A;  4IG3 A;  4CGH A;  3IAY A;  1YJ9 N;  3DXM A;  3LDQ A;  3QEP A;  4WQ5 A;  5SWM A;  4LH4 A;  5B8H A;  1N6Q A;  2IAJ A;  3SQ2 A;  3MXJ A;  4LF4 K;  4M7X A;  4BR5 A;  5HLF A;  3OVN A;  2ITM A;  3O1W A;  4NCB A;  4GKK K;  2X6S A;  5BRE A;  2X78 A;  1F21 A;  2XHB A;  1TL1 A;  1NLV A;  4H5N A;  1C1A A;  1TYQ B;  3IMX A;  3SMS A;  2XO7 A;  4IDH A;  4XH5 A;  3KJV A;  2YHW A;  5AQN A;  1NMN A;  4LFB K;  4CK2 A;  4HTU A;  2HBJ A;  4KB0 A;  4RW4 A;  4WE1 A;  3CCL N;  3I8B A;  4JI5 K;  2JGU A;  4JI1 K;  1S6P A;  3SAG A;  3DLL L;  2CH5 A;  2ASP A;  3BDP A;  1BA1 A;  4BE2 A;  3OS1 A;  3LDO A;  2GTD A;  4A2B A;  1HMV A;  4OPK A;  2CGL A;  3EZ5 A;  4O8K A;  4DTR A;  4BRG A;  3OYB A;  2UXC K;  2ETJ A;  2X74 A;  2GWK A;  3EZW A;  4OGC A;  1VSF A;  1HKC A;  3MCP A;  3MN7 A;  4AHS A;  4N56 A;  5FRO A;  5AQM A;  4M3U A;  2OTL N;  3L2V A;  4M3Z A;  5LJV A;  2P9U B;  1ZBL A;  3L2U A;  4DV6 K;  4OJR A;  3OJU A;  1NK0 A;  1DT9 A;  1VQ5 N;  3CJB A;  4XEI A;  2Z1J A;  4DUZ K;  4LF5 K;  2QWQ A;  1W7A A;  3F9K A;  2OCE A;  5J2M A;  4BR9 A;  4N76 A;  4IG0 A;  2QWP A;  4QS8 A;  5FDL A;  4FJK A;  1KTQ A;  2BE2 A;  3R9P A;  4B3S K;  2IOC A;  4G9Z A;  1M90 O;  3QIN A;  1NGJ A;  3BZC A;  4ISF A;  3BGR A;  3NHG A;  1TKD A;  4KPY A;  3U8X A;  5HRR A;  2IDO A;  4FSV A;  3R1X A;  3UE5 A;  3BZK A;  3VQQ A;  4M3Y A;  3K2P A;  2YHY A;  1RNH A;  2O8E A;  2E1Y A;  3OYM A;  4DSE A;  3QIC A;  4DTO A;  1QQM A;  1KVB A;  4NCG A;  3QEI A;  4OKE A;  3DLH A;  4IXC A;  1XHZ A;  3EE9 A;  5H1S Q;  4B8A B;  2YHB A;  4AF1 A;  1TAU A;  4KHY A;  1FXX A;  4PL8 A;  5JIC A;  2Z1I A;  1NGB A;  5C42 A;  1T44 A;  3TAQ A;  1C0M A;  2A42 A;  4BDZ A;  2IS3 A;  4PHT X;  1SKW A;  1Q82 O;  2F8S A;  4IJN A;  4JI0 K;  3NFA A;  4FM1 A;  1KXP A;  2YNF A;  3THY B;  4Z4G A;  4E7K A;  1T3V A;  2OPS A;  4PWD A;  1BG3 A;  1D9D A;  4NYF A;  4JI3 K;  3HM9 A;  2OA8 A;  3WEE A;  5CZ2 A;  5HL7 L;  1T6C A;  4QAG A;  5KPT A;  3RSE A;  2HHH K;  4DU4 A;  3PX0 A;  4DFK A;  3NGY A;  4BRH A;  1Q18 A;  2HST A;  1VSD A;  1YVU A;  3ULE B;  4BQL A;  1VRU A;  4FO0 A;  3C7N B;  1JLB A;  2D0P A;  4CZH A;  1TL3 A;  1JLE A;  1KVA A;  1KFS A;  3SJH A;  3FZK A;  2NRX A;  3HOS A;  1L3T A;  1VSL A;  2Y1I A;  4I9Q A;  3CFO A;  3QBX A;  4WQ4 A;  5M1P A;  1Q9Y A;  3G71 N;  4A59 A;  1X3N A;  1G15 A;  1KCF A;  2E1Z A;  3AVH A;  4DQQ A;  4F8R A;  5BPL A;  3EE8 A;  4FZZ A;  4E7L A;  4B1V A;  4JKC A;  4IFV A;  2WON A;  4GMJ B;  2YV0 X;  2HF4 A;  4DQ8 A;  4IDK A;  4LF9 K;  3MK6 A;  3EKU A;  4ICL A;  4L3Q A;  2QW9 A;  1GLD G;  1VQ9 N;  5A2Q O;  4H0X B;  5C10 A;  4JD2 A;  1LW0 A;  2Z1G A;  2G8U A;  3HPO A;  2V52 B;  2VWB A;  1C0G A;  4CF9 A;  3TAF A;  1T03 A;  2YHA A;  5BR9 A;  2D0O A;  2PY5 A;  2O8D A;  3ENH A;  2VWJ A;  4LY7 A;  4H4O A;  3V9U A;  2BGG A;  1BIZ A;  4WFA L;  2FF3 B;  1NGI A;  2GWJ A;  5MLC Q;  3V1R A;  4JRP A;  4DS4 A;  4EHU A;  4FJG A;  2IVO A;  4U67 L;  3PSF A;  3ZSO A;  5HRS A;  1BUP A;  2FF6 A;  4DWI A;  2CH6 A;  3OYA A;  2YNG A;  1KSP A;  5AQU A;  1JCF A;  3T1Y K;  3SQ1 A;  2BDP A;  4OKK A;  1REV A;  2KW4 A;  1SAZ A;  5BRF A;  3VET A;  3E01 A;  3OBW A;  3KKR A;  2IGI A;  1XQS C;  1ZBI A;  2GX9 A;  5CE3 A;  2HNY A;  2P9K B;  3DXK A;  3SYZ A;  2O8B A;  3FZM A;  3O8M A;  3I8D A;  2OYQ A;  1VSJ A;  1UWB A;  3HTV A;  4XH4 A;  4Z0U A;  1T8E A;  4DSI A;  3LAK A;  3K5L A;  4RWT A;  4WF9 L;  3S9H A;  1EWR A;  3LP3 A;  4YOR A;  5IWA K;  4YOT A;  1N8R O;  3AVL A;  1SV5 A;  3W0L A;  4MFB A;  4H0T B;  1JLG A;  1NK5 A;  1NGG A;  4GNI A;  1BOT O;  4DF4 A;  4JHD B;  4AH9 A;  1J54 A;  3EN9 A;  1LOT B;  4NLB A;  4OVL A;  5LL6 Z;  4B9S A;  1S9G A;  2NRZ A;  1LCU A;  1NJW A;  4J2B A;  4NO7 A;  1ASV A;  3OY9 A;  3CYM A;  5AQP A;  3VPZ A;  1NOY A;  3RRH A;  4FWQ A;  2BH1 A;  3LP0 A;  3O3G A;  4QCL A;  3PSI A;  1XMO K;  3DXM B;  5AFU A;  5C0Y A;  4DSJ A;  4CEQ A;  3DLG A;  4WFB L;  3TAP A;  2E2O A;  2EX3 A;  3OYH A;  2KFZ A;  4JI7 K;  3VF4 A;  2Q36 A;  3BF1 A;  4CHQ A;  1TKX A;  4BC4 A;  4GW6 A;  3SBT A;  3THX A;  1I94 K;  5KRT A;  1M1K O;  4B3M K;  1W0H A;  1YVN A;  4DMN A;  1H1V A;  2A5X A;  2P9I A;  4B1Z A;  3RVC A;  1KLN A;  1VSH A;  4CGG A;  2Q3S A;  4C23 A;  4KO0 A;  2JLE A;  1XHX A;  2GUP A;  3M8P A;  4FPB A;  1RBV A;  1Y97 A;  2RN2 A;  3V6D A;  4J8F A;  5AQS A;  4DR4 K;  4OO1 J;  3AY9 A;  3BP8 A;  3NH1 A;  2WOM A;  4B3O A;  4LF7 K;  2JWL A;  4CHZ A;  3CI5 A;  3SCX A;  3ZT3 A;  4ISG A;  4OPJ A;  3O9R A;  2F4V K;  3W3D A;  3LDN A;  3CHW A;  3ZYY X;  3SBG A;  2PYJ A;  3NMU A;  2HHT A;  5M1N A;  1NG9 A;  3U4L A;  1TK8 A;  3B6P A;  4Q0B A;  3KK1 A;  3AVM A;  4BWJ A;  1C0F A;  2E88 A;  4FWR A;  3RMA A;  1ZYQ A;  1S1V A;  3A5M C;  3F9M A;  4O4G A;  1CXQ A;  1UAX A;  2IIR A;  2VG7 A;  3PX6 A;  4M3X A;  3S3M A;  3MAQ A;  4FYD A;  3WQT A;  5ELZ A;  4CJP A;  2GUI A;  4CJS A;  1Q8I A;  1TK0 A;  3L3U A;  1JLC A;  3WXK A;  1X9J A;  1Z26 A;  4DUY K;  4KI4 A;  3ZET A;  3TAB A;  3VGM A;  1A5X A;  3PY8 A;  1J5E K;  4KI6 A;  4E7H A;  1BHL A;  4RCH A;  4N5S A;  2LSN A;  2ZJP L;  5F1X A;  4CF0 A;  2GV9 A;  1OVQ A;  3DAW A;  4GV6 A;  1RBR A;  3MDQ A;  4CGJ A;  4ID1 A;  2KTQ A;  3QNN A;  2ZD1 A;  3ZSX A;  3AVK A;  1KAY A;  1YTU A;  2ASO A;  3O9U A;  1RDA A;  3SQ0 A;  2I5J A;  3THV A;  4F3T A;  4FM2 A;  4E7J A;  3JXU A;  1RT4 A;  3AVA A;  5SZT A;  5JVH L;  3QET A;  3IDH A;  1SL1 A;  1NKE A;  3J7A P;  1FKO A;  4OKJ A;  3J7Y P;  1BU6 O;  3ULD A;  1SL0 A;  3D0P A;  1S1T A;  3JAM O;  1JKH A;  2D5R A;  1VQO N;  4HUG A;  4RW9 A;  1QZ6 A;  5JLF A;  4DR6 K;  1D9F A;  2OZS A;  5AQF A;  2AP1 A;  3OYD A;  3VQ4 A;  1YT3 A;  4YNQ A;  2E20 A;  3O6W A;  3V1O A;  4M63 C;  1TKT A;  3OHR A;  4IZ9 A;  3J81 O;  3VEO A;  1NK4 A;  3TAN A;  4BC3 A;  4JKH A;  5AQG A;  2HMP A;  4BG9 A;  1VQL N;  3WEE B;  3CQY A;  3BUZ B;  1NU0 A;  1VQ4 N;  3CD6 N;  1JCG A;  3RSE B;  4BRF A;  3G25 A;  4IWV A;  1LWC A;  4CZK A;  1VSE A;  2HVH A;  4CJF A;  1Q9X A;  3TPQ A;  2UUB K;  4Z4C A;  3EYZ A;  4DR2 K;  1EKE A;  4C1N K;  3ZSY A;  4GY2 B;  4FJ9 A;  4IEI A;  2YNH A;  4BDY A;  2FXU A;  3VQC A;  3KWI A;  1HJO A;  2F9W A;  4RG8 A;  4BRP A;  3K59 A;  1RT3 A;  3TSU A;  4CCH A;  3HYF A;  5F0X A;  4PKH A;  4CEF A;  1KAZ A;  1S6Q A;  2G8F A;  1XUP O;  4DV3 K;  2HVI A;  4CEC A;  1RT5 A;  4CHY A;  3E9O A;  1ATS A;  2DFE A;  4QS7 A;  1HLU A;  1BL3 A;  1BI4 A;  3MED A;  1CZB A;  1RDU A;  2H3G X;  1OH5 A;  3TTC A;  4CZG A;  4KHN A;  1JXE A;  4FVU A;  3ENO A;  3O4N A;  3JYT A;  3M3Z A;  4JD2 B;  2HBK A;  1S9E A;  1VQ6 N;  3L6Q A;  1VSI A;  3WXM B;  4RTF D;  4PQU A;  1T7P A;  4F4K A;  4I6M B;  1YTA A;  2Q0U A;  3VGK A;  4LC9 B;  3T3F A;  1X9W A;  4C8L A;  5FPE A;  3CCJ N;  5GAH P;  1KFD A;  3T1H K;  5CR4 A;  2VWK A;  4AQY K;  1HNX K;  5E26 A;  4CGI A;  3O80 A;  1YIT N;  3DLE A;  2QI2 A;  2QWL A;  1OH8 A;  3MCA B;  3GDQ A;  3CJ1 A;  2KKZ A;  3JS6 A;  1Z6R A;  5GIP A;  1WBB A;  4IOA L;  1NGE A;  2P9L A;  4BRI A;  1NNE A;  4JK7 A;  4F3O A;  4CJQ A;  1NWK A;  3C65 A;  2B6A A;  4BRA A;  3DXK B;  4DSL A;  4JV5 K;  3C6H A;  3HP9 A;  3WXI A;  3CF5 L;  3OYI A;  4J2A A;  3OBY A;  2YX6 A;  3SMP A;  3CPW M;  2D4W A;  3VMF B;  3DRR A;  1JJ2 M;  4NXM K;  1U4B A;  1VSM A;  4EZ6 A;  3HST B;  4BWM A;  2XRI A;  1YIJ N;  4KHW A;  4FJI A;  5E41 A;  3FFK B;  3TI0 A;  2QEX N;  4I2P A;  1RTJ A;  1K8K A;  2W41 A;  2P9P B;  3VEV A;  4BRE A;  2YNI A;  5BRH A;  4GV9 A;  2WC9 A;  4ILH A;  1WB9 A;  5I42 A;  4M42 A;  5F2R A;  1K9M O;  1XC9 A;  2KQ2 A;  1U2V B;  5M1K A;  1NJZ A;  4CFD A;  3MN5 A;  4OPA A;  1U48 A;  4CGD A;  4NYN A;  1K6Y A;  1VK0 A;  3V9W A;  1VQK N;  4FK2 A;  3THW A;  4BDP A;  4CD3 A;  2PFU A;  5AQK A;  4JKF A;  4FJL A;  3NGZ A;  5AQR A;  4JS5 A;  3VER A;  4IOX A;  4Y1D A;  4FLU A;  1GLB G;  3U9D A;  4LSL A;  3PX4 A;  1EX4 A;  3HXM A;  4M3W A;  5FRM A;  1GOA A;  3FZL A;  4ID5 A;  4BVO A;  4K8X A;  1YJW N;  4LH5 A;  4UY8 O;  4CBW A;  2NRR A;  5EX5 A;  1IBM K;  5KGX A;  4LSN A;  3AAQ A;  4C8M A;  4FWS A;  3NF8 A;  4CJ3 A;  4JKG A;  3S3O A;  4H0P A;  1QZ5 A;  4IKF A;  3MEC A;  3ALY A;  4EHT A;  3WXJ A;  2IC3 A;  3AAR A;  4K41 A;  1C1B A;  4FJ5 A;  2UYT A;  1KAX A;  1T6D A;  3FLC O;  3WNG A;  1BA0 A;  2OZM A;  5FPM A;  4GKJ K;  5AQI A;  4EFH A;  4MO5 A;  4B9L A;  3A5O C;  5DMR A;  1WAF A;  4H4M A;  4KH4 A;  4IJA A;  4CEB A;  1S72 N;  2UUC K;  1BQM A;  1HNI A;  5GAG P;  1BIS A;  5BRD A;  1NK6 A;  3DM2 A;  3O9S A;  2PZS A;  4O0J A;  4IBN A;  3O4W A;  1XC3 A;  2Q0R A;  4B9M A;  4Z4E A;  3HO1 A;  4C8N A;  1V4S A;  3NAE A;  1RDB A;  5BPM A;  2OTJ N;  4HCC A;  3ZT1 A;  4Z4F A;  2FSJ A;  3CCR N;  4CFA A;  2FBV A;  4CJ4 A;  4FLZ A;  3C6T A;  2KZZ A;  3KD5 E;  1N34 K;  3DRS A;  2HMI A;  4PL7 A;  2D1K A;  3HSC A;  2J4R A;  3VQD A;  3RMC A;  3GE1 A;  1QQC A;  1ATR A;  1ZBH A;  4AM7 A;  4KH5 A;  2P5G A;  3AVC A;  2AA4 A;  5AQJ A;  3RR7 A;  1HNZ K;  2E2N A;  1J9A A;  3K58 A;  3AA5 X;  1NK9 A;  3NGI A;  5J2Q A;  3F2K A;  4R79 A;  4K25 A;  3ZSZ A;  2Y1J A;  3WNF A;  1GLC G;  4CVN E;  1BCO A;  1W2B M;  3TTD A;  5ADX A;  3PLA A;  5GIO A;  4CJE A;  5FRN A;  5M1F A;  3VQ9 A;  3IKM A;  5HRP A;  5BN9 A;  2A41 A;  1DGK N;  4BE1 A;  1K73 O;  1NGH A;  1IJJ A;  3CCS N;  4CF8 A;  5BR8 K;  3VA0 A;  4FJN A;  3AVB A;  3VN5 A;  1RCH A;  1U04 A;  1Z05 A;  2UXD K;  5IT9 O;  3K9J A;  5D3G A;  2A3Z A;  2ZE2 A;  2YJE A;  1A5W A;  1QQN A;  1S5J A;  4RW7 A;  4DLG A;  2ZGZ A;  3GG4 A;  1MA9 B;  1NMD A;  3FZF A;  3H46 O;  3EO3 A;  3A5L C;  1HPZ A;  3OYG A;  1X3M A;  1HKB A;  4K43 A;  3QER A;  4OPH A;  4JRQ A;  4JI6 K;  3CXC M;  3TR8 A;  1OVY A;  3CCU N;  3HT3 A;  1TGO A;  4H5V A;  5AZJ B;  1SQK A;  2HHX A;  3VQP A;  4B1W B;  1Z25 A;  2HBL A;  2FBT A;  5M1Q A;  3V81 A;  4IFY A;  4BAC A;  3ZEU A;  1VAZ A;  2Z1H A;  3ZSW A;  3LDP A;  4BC5 A;  4HUE A;  4B1U B;  4CD1 A;  3FE1 A;  3AVJ A;  2Q2R A;  2QM1 A;  5KRS A;  2BUP A;  2EHG A;  2ZWH A;  4JKB A;  3VQ6 A;  2QWR A;  2ZJR L;  3S41 A;  1RT1 A;  2JWK A;  3U3Y A;  3B6O A;  1CLQ A;  1SZ2 A;  4JI8 K;  3BF3 A;  2BAN A;  4DQR A;  4DTN A;  3LWM A;  3LPT A;  4EIA A;  1MWK A;  3E9P A;  4LF8 K;  3CIP A;  2YKM A;  3CC7 N;  2XY5 A;  3ITH A;  4IFE A;  3O4Q A;  3M1F A;  3IG1 A;  3HVT A;  4C1N I;  4UQG A;  4M7Y A;  4X64 K;  3KLG A;  1R59 O;  4YDU C;  3EY1 A;  4CIE A;  4CJT A;  1DTT A;  4JN4 A;  4FLW A;  1ESV A;  1U45 A;  3HPH A;  2I7P A;  1JLQ A;  1DEJ A;  3HVR A;  5JS2 A;  2CGJ A;  5C2F A;  1CXU A;  5I9E B;  4FW2 A;  2P9N B;  4G1Q A;  5AZI A;  1SS6 A;  4JI4 K;  3VOV A;  1SL2 A;  4YHH K;  3D2F B;  4ELV A;  3D2E B;  4U7B A;  1NKC A;  4N41 A;  4AM6 A;  4KBO A;  3VEW A;  3KK7 A;  3MN6 A;  3WNH A;  2KFN A;  1BO5 O;  4FLY A;  3DOL A;  3HRG A;  4M45 A;  1UA0 A;  1JLF A;  3DLK A;  3VTI A;  2ASM A;  3EEQ A;  3OS2 A;  3SPZ A;  2R7Y A;  3Q7B A;  1QHA A;  3SUN A;  3VF6 A;  3FFI A;  1FK9 A;  4JKA A;  1K8K B;  1RBS A;  3WT0 A;  3L2Q A;  4BG8 A;  5AQT A;  1WNS A;  3AGR A;  1XNR K;  3P83 D;  1TYQ A;  4HWI A;  4Q5V A;  4DTX A;  1CZ9 A;  5C15 A;  5AFU H;  3ISN C;  2P51 A;  1GOB A;  2F9T A;  3UKR A;  1QQO A;  4JI2 K;  3AAP A;  1NGC A;  3A5N C;  3ZSR A;  5FPD A;  1B92 A;  3G4S N;  1NGF A;  3ZT2 A;  3ATV A;  2DY4 A;  3U3G A;  4FJ7 A;  4Z94 A;  3QEW A;  4H0O A;  4CZM A;  2FSN A;  4H5R A;  1WUA A;  3THW B;  5HBM A;  4W5N A;  4Y0W A;  5LY3 A;  2W42 A;  4CE9 A;  1S3X A;  3HM8 A;  4JEP A;  2OPP A;  3DYA A;  3H08 A;  3M8R A;  4MLH A;  1N36 K;  2VGN A;  3J8A A;  4GV3 A;  3R8E A;  4CED A;  2P9U A;  2YHX A;  3VQ5 A;  1NJY A;  3VGL A;  4CF1 A;  1HQE A;  4FOI A;  1O13 A;  1O1W A;  3V9S A;  3MX5 A;  5KI6 A;  4JK9 A;  1LW2 A;  1EP4 A;  3P1G A;  2RPI A;  2V7Z A;  1HNV A;  1E4G T;  1MWM A;  1ATN A;  4A62 A;  4DU3 A;  4KFB A;  4CEO A;  5JVG L;  5AQW A;  3NE6 A;  4B9U A;  1JCE A;  1HRH A;  3SLC A;  3F73 A;  1E3M A;  4NCA A;  4BR4 A;  1RDD A;  3M6G A;  5EOY A;  3MX2 A;  2PAV A;  4A61 A;  2YI1 A;  3QFP A;  1MDU B;  1HX1 A;  2OPR A;  4LFC K;  3C6A A;  4BQZ A;  1VQ7 N;  3LAN A;  4Z4H A;  3D45 A;  1P90 A;  1WN7 A;  3S3N A;  5CYQ A;  3CFR A;  3KD1 E;  4CZL A;  5HRN A;  1TUY A;  3H3N O;  4X65 K;  3OW2 M;  4DTU A;  3B8A X;  1IG8 A;  3ID6 A;  2O8E B;  3QFU A;  1LAW A;  1RDW X;  2F7T A;  4KKO A;  2GBZ A;  3TAR A;  4B1X B;  1DLO A;  1HJR A;  5GAD P;  1DTQ A;  2OAN A;  4JK8 A;  4FXD A;  3D7E O;  4CHO A;  1HNW K;  3EL2 A;  1C0T A;  1HPM A;  4F9O A;  3PUF A;  4EAH D;  4AHC A;  3ZCM A;  2V7Y A;  3M8S A;  4BR2 A;  3AO3 A;  3AVG A;  3PO5 A;  3V1Q A;  3LM9 A;  4B1Y B;  4M3T A;  1FKP A;  5KPZ A;  1R0A A;  2KHO A;  3V9X A;  2HW3 A;  4E1J A;  5E84 A;  4KHP K;  3WQU A;  3LDL A;  4DLE A;  5J2N A;  5FLX O;  4O8U A;  4ILG B;  4ELU A;  1ITG A;  3O08 A;  4DV1 K;  3P31 A;  1N33 K;  2O8C A;  5CY4 A;  2PYL A;  2PBD A;  5KQ8 A;  2E6M A;  3TAG A;  3LWL A;  1HKG A;  4LD0 A;  4IEE A;  4K8Z A;  1N5Y A;  4FJJ A;  3QO9 A;  1EQY A;  3OS0 A;  4M3R A;  3ZLJ A;  3LAM A;  3RMB A;  3TSQ A;  4RW6 A;  4O0I A;  1ILY A;  1E4F T;  2HF3 A;  4FM0 A;  4CW7 B;  4BY9 C;  1YF5 L;  3OYJ A;  3P38 A;  4DFJ A;  4FK4 A;  3OYE A;  1RTH A;  2ATQ A;  3MEG A;  5CZ1 A;  3VEX A;  4J2D A;  3V4I A;  3L2R A;  3K0S A;  1B9D A;  2I7N A;  1D8Y A;  3OYL A;  3ZT4 A;  2A1S A;  4B08 A;  3OYF A;  1X1P A;  3A0I X;  1X9M A;  3SK3 A;  4E1M A;  4CZF A;  4CK3 A;  3K57 A;  4JLH A;  4FZY A;  4QS9 A;  1EWQ A;  2NUB A;  1WOQ A;  3E9L A;  3CQX A;  4FWP A;  3R3L A;  1RTD A;  1QS4 A;  3SAF A;  3ZX0 A;  4H0Y B;  4CK1 A;  4HHT A;  3J80 O;  2O8D B;  4CF2 A;  4KRE A;  3DLB A;  1EET A;  2G8I A;  1KVC A;  3SPY A;  3L0Q A;  5J1E A;  1HR0 K;  1HYZ A;  3NVM A;  1U47 A;  1S1U A;  1VQN N;  4DCH A;  1L3V A;  2DPN A;  2A40 A;  3A2F A;  4WYB A;  4H03 B;  4ELT A;  1RTI A;  2WUS A;  4YY3 K;  4DHY A;  2NZT A;  2VQF K;  2QXF A;  4K0K K;  3KLH A;  1IKX A;  5CYM A;  3ENB A;  1DKG D;  4DR5 K;  3DMJ A;  2O8B B;  1XNQ K;  3HOT A;  5JS1 A;  2OPQ A;  4BRQ A;  3SNN A;  1CZA N;  3SI6 A;  3SQ4 A;  4B3R K;  1NBW A;  5KPR A;  3KZB A;  1TKZ A;  4ZHR A;  3BY5 A;  1BWF O;  2NLX A;  4Z4I A;  1OKJ A;  1QE1 A;  2QWO A;  3C0B A;  3CCQ N;  1J53 A;  3I0R A;  4DG1 A;  2NRW A;  3PIP L;  1RBU A;  1TV6 A;  3N4P A;  3SJJ A;  5AZI B;  4O55 A;  2QA4 N;  2IVP A;  5AQY A;  5AQQ A;  2VG5 A;  3IRX A;  1RT6 A;  1YXQ A;  3L4Q A;  3QIO A;  1VQM N;  1S22 A;  1U6Z A;  3LAL A;  4K42 A;  4FLV A;  3P4I A;  1RGI A;  4CHP A;  3VQ7 A;  3HP6 A;  2AJQ A;  3CJA A;  4AHV A;  4GVE A;  4WFN L;  4F2S A;  2QK9 A;  1TK5 A;  4ZTF A;  2ZM6 K;  1EO1 A;  3VA3 A;  2WFB A;  1Q86 O;  1YI2 N;  4FJX A;  1IKV A;  5AQH A;  3LZJ A;  4JS4 A;  3THX B;  4OGE A;  4YOX A;  4C8K A;  1RBT A;  4E3S A;  4CJV A;  3HPG A;  3UKR B;  2P9I B;  1WAJ A;  4V19 S;  4LF6 K;  3AA4 A;  4H0V B;  2E4L A;  4FVM A;  1W9H A;  4YDU A;  5K14 A;  4YFU A;  3HZ6 A;  2VYP A;  3R6M A;  3EKS A;  3KLI A;  2W6L A;  3OTO K;  2FBX A;  2QXL A;  5AQV A;  2EWS A;  1B9F A;  3UKU A;  4FW1 A;  5EVZ A;  3G6E N;  2NRT A;  1I3A A;  1UOC A;  3T69 A;  3F5T A;  4E89 A;  4W5T A;  4BGB A;  4I2Q A;  1NGA A;  4GVM A;  3KVG A;  1GLA G;  1S1W A;  4X62 K;  1QVG M;  4BVP A;  3P5J A;  2WBN A;  4B9N A;  2E6L A;  5HP1 A;  3CM6 A;  3CET A;  1ASW A;  5C12 A;  4CEA A;  3ATU A;  3LPU A;  3QES A;  1ZC6 A;  4FK0 A;  5KQD A;  1WSG A;  2RHK A;  4EP4 A;  3I55 N;  4RW8 A;  2P9S A;  3VEZ A;  4X66 K;  2FC0 A;  4BRL A;  2Q1N A;  4DSK A;  4YOU A;  3K5N A;  4H8K A;  3ZX3 A;  1YAG A;  3WUH A;  3ZET B;  1NM1 A;  4E1N A;  4O44 A;  3CPE A;  2ZJQ L;  3MXM A;  3ID8 A;  3TTF A;  3PO4 A;  3RMD A;  3CQ8 A;  1ZXO A;  3HL8 A;  4CIF A;  1NOZ A;  5C2D A;  1QSY A;  4CHN A;  4FWK A;  4DU1 A;  2YKN A;  3QEV A;  4CZE A;  2E2Q A;  1XMQ K;  5DK5 A;  3QIP A;  2D0C A;  4EP5 A;  4DTP A;  4Y1C A;  2NRV A;  1IO2 A;  4DSF A;  4KRF A;  3MWP A;  4CFC A;  3K5M A;  4FWL A;  4KHS A;  4YOV A;  3KTQ A;  3C6U A;  3ZSQ A;  2G8W A;  3ZT0 A;  1TUU A;  4FPA A;  4KB1 A;  2GEM A;  3RRG A;  4JKD A;  4PA1 A;  4JYA K;  3NDK A;  4FLT A;  1HYV A;  1OH7 A;  2E2P A;  4CJ7 A;  3Q7C A;  3UIQ A;  1N32 K;  1NK7 A;  2KLA A;  2UUA K;  1W97 L;  4PKG A;  2O8C B;  4CEE A;  5ADX H;  4KHU A;  1IG9 A;  4CJR A;  4DV2 K;  3OYN A;  5AJ3 K;  3AA2 A;  3TU5 A;  5GAE P;  1Y64 A;  2DFF A;  3A8Y A;  1XWL A;  3O3F A;  3I0S A;  3VQB A;  4BR7 A;  1VQP N;  3AVN A;  3LDS A;  1BIU A;  4DR1 K;  4AHR A;  4CGF A;  2P5O A;  3IFR A;  2Q97 A;  1QVF M;  1X9S A;  3ASM A;  4L8R B;  5AR0 A;  4EZ9 A;  4CIG A;  3TAM A;  1L5U A;  2XY6 A;  1G99 A;  1GLL O;  3I56 N;  4FLX A;  3U9Z A;  2QTD A;  4E0D A;  1GLE G;  3UB5 A;  3NVK A;  1D5A A;  1LAV A;  3O1B A;  3SAH A;  4XIU A;  1SKS A;  3VQA A;  4CI6 A;  1BI4 B;  1SKR A;  3HBT A;  3H45 C;  4I6M A;  4WQ5 C;  3LM2 A;  4DV5 K;  3DJC A;  2FSK A;  1Q81 O;  4B9V A;  4B9T A;  1LWF A;  3HJF A;  2VG6 A;  1HUX A;  3I33 A;  3VEY A;  4O5F A;  2NRH A;  5C24 A;  2ZGY A;  3AVI A;  5LMN K;  4H5T A;  3DI6 A;  4BRK A;  1Q7Y O;  3CJ7 A;  2ZF5 O;  3N4Q A;  2G8V A;  4OLB A;  1YJN N;  1NGD A;  5TKY A;  3CC2 N;  3QBW A;  3BEX A;  1NKB A;  4FWN A;  3PV8 A;  2XY8 A;  2FBY A;  2O8F A;  4B9Q A;  5KTQ A;  1WSJ A;  4FJM A;  2G8K A;  2P9L B;  5JMV A;  3T19 A;  3KK3 A;  2F8T A;  5C25 A;  1J6Z A;  4CBX A;  4B8C A;  4KHQ A;  3SUP A;  5TKW A;  1KLM A;  3CM5 A;  4W5O A;  4MDB A;  2HHW A;  3ZSV A;  5EXW A;  3L8B A;  1YHQ N;  4DTJ A;  1UA1 A;  3CFP A;  4DFP A;  4DV0 K;  3KLF A;  2FLO A;  3NF9 A;  2HHS A;  4DQS A;  3RWU A;  1WSE A;  3CCV N;  1TVR A;  1IBK K;  2P9P A;  1RIL A;  2VGM A;  2WTU A;  4ILJ A;  4DV7 K;  2F96 A;  4AHU A;  5HRO A;  3OJS A;  3KHY A;  2VQE K;  1HYS A;  3V9Z A;  2RF2 A;  5FPN A;  1C6V A;  1U2V A;  4M41 A;  1GLF O;  1KQS M;  2HBM A;  4FZX C;  3O9Q A;  2QWM A;  4YOW A;  4DQI A;  4I7F A;  3T7Z A;  3C94 A;  4F2R A;  2O4G A;  4HTL A;  4JAX A;  1QHT A;  1WSI A;  3DOK A;  4DTM A;  1KD1 O;  2W6K A;  3CMA N;  1VQ8 N;  4FJ8 A;  3M5R A;  1C1C A;  3ZX2 A;  1JLA A;  2Q31 A;  3L3V A;  3FGU A;  3MMV A;  4MO4 A;  4DR7 K;  4DV4 K;  5AQL A;  4NLC A;  1VRT A;  1WSF A;  4CEZ A;  1V4T A;  1D4X A;  2B5J A;  1EXQ A;  2X6N A;  2KZM A;  3O9T A;  4FWO A;  2E8A A;  3D6R A;  3KWG A;  4JKG B;  4HUF A;  2GEL A;  2P1J A;  3AA3 A;  3KLE A;  1RT7 A;  3P39 A;  3O3H A;  3QB0 A;  3UKU B;  2QKB A;  1A5V A;  5JLH A;  4PKI A;  3SZ2 A;  4NB4 A;  4XH1 A;  2HB5 A;  4BC2 A;  4CJW A;  5AQO A;  5LMU K;  4R5P A;  3NCI A;  2ZQB A;  1L3U A;  3QNO A;  2E5L K;  4W5Q A;  4CZJ A;  3OYC A;  4A5A A;  1GLJ O;  3TSP A;  5M1O A;  1KC8 O;  3KIO A;  1J5O A;  4BR0 A;  3WXL A;  2QKK A;  4OX9 K;  5J2P A;  3CCM N;  2B4J A;  1GOC A;  3M8Q A;  4CJK A;  3AV9 A;  4WQ4 C;  4B3T K;  2VCP A;  3RR8 A;  5BN8 A;  2P9S B;  4DKW A;  3AO4 A;  2ITG A;  1I39 A;  2YCH A;  2RE2 A;  3G10 A;  1BGX T;  1LWE A;  2HND A;  3LP2 A;  4DF8 A;  3OA9 A;  3AVF A;  2CGK A;  2IVN A;  4PUO A;  1WBD A;  2UU9 K;  4ZTJ A;  3QLH A;  3THY A;  5AQX A;  1IH7 A;  3MXI A;  1YUW A;  1JL1 A;  3QEX A;  3L4I A;  2BTF A;  3VF2 A;  3E66 A;  4IO9 L;  4JNE A;  2G8H A;  3H6E A;  4OLA A;  1BQN A;  1TAQ A;  3KK2 A;  3QML A;  1QSS A;  2QWN A;  5EY4 A;  2D0A A;  3E1Y A;  4BE0 A;  3MEE A;  2V51 B;  1KRP A;  4WCE L;  3SUO A;  4N47 A;  5T7B A;  3SUQ A;  3OYK A;  3ULE A;  3C7N A;  4CJ5 A;  4NXN K;  3LL3 A;  4A2A A;  4A5B A;  4LFA K;  4QOZ B;  4DB3 A;  3WNE A;  3TAE A;  1ZBF A;  1NJX A;  3NH0 A;  3QDK A;  4KTZ A;  5DM6 L;  4CBU A;  3HI0 A;  4KH6 A;  4TSX A;  4IO8 A;  4DS5 A;  4E7I A;  4KAZ A;  3LP1 A;  4JKE A;  4E19 A;  4KV8 A;  4YOY A;  4FOE A; 
#chains in the Genus database with same CATH homology
 2AJQ A;  4AHV A;  4W5R A;  4F2S A;  3VA0 A;  4CHQ A;  2O4I A;  1TKX A;  2QK9 A;  1TK5 A;  4ZTF A;  4GW6 A;  4FCY A;  4FJN A;  3AVB A;  3VA3 A;  1HQU A;  4FJX A;  3VN5 A;  1RCH A;  1IKV A;  3LZJ A;  4DTS A;  1XI1 A;  1U04 A;  5KRT A;  4JS4 A;  1W0H A;  4DMN A;  5D3G A;  2ZE2 A;  4OGE A;  3U6F A;  4C8K A;  1A5W A;  1RBT A;  4E3S A;  4CJV A;  1KLN A;  3HPG A;  1VSH A;  4CGG A;  2Q3S A;  1S5J A;  4RW7 A;  3AO2 A;  4DLG A;  5I3U A;  4KO0 A;  1WAJ A;  2JLE A;  1BCM A;  1XHX A;  3AA4 A;  2E4L A;  3DRP A;  4FVM A;  1W9H A;  3M8P A;  5K14 A;  1QTM A;  1QSL A;  1WLJ A;  3LZI A;  2HNZ A;  1JL2 A;  1JXB A;  3NF7 A;  1RBV A;  1HPZ A;  1Y97 A;  2RN2 A;  4YFU A;  3V6D A;  5EU7 A;  3OYG A;  3KLI A;  4J2E A;  3QER A;  4PY5 A;  2FBX A;  4JRQ A;  3NF6 A;  3KKS A;  3NH1 A;  3TR8 A;  2WOM A;  4B3O A;  4MQ3 A;  4DQP A;  3AO5 A;  1IKY A;  4CHZ A;  3SCX A;  1L3S A;  3SV3 A;  3ZT3 A;  1ZBU A;  4OPJ A;  3HT3 A;  1TGO A;  2HHX A;  1NK8 A;  1B9F A;  3RTV A;  4FW1 A;  2D0B A;  3VQP A;  3DLR A;  1Z25 A;  1T05 A;  1I3A A;  1UOC A;  2FBT A;  4CER A;  3JSM A;  2PYJ A;  4E89 A;  3V81 A;  2HHT A;  2HHU A;  4IFY A;  4BAC A;  4W5T A;  4KTQ A;  2Z1H A;  4I2Q A;  3B6P A;  3ZSW A;  1TK8 A;  4Q0B A;  1SUQ A;  5KGW A;  3KK1 A;  2A1R A;  3AVM A;  4BWJ A;  3SV4 A;  4HUE A;  4GVM A;  2XY7 A;  1S1W A;  3RMA A;  3HK2 A;  3C95 A;  1IKW A;  1ZYQ A;  1S1V A;  3P5J A;  3AVJ A;  4B9N A;  2E6L A;  4FJI A;  5KRS A;  4O4G A;  1CXQ A;  1ASU A;  1UAX A;  3PX6 A;  2VG7 A;  5HP1 A;  2EHG A;  3CM6 A;  4HVJ A;  4M3X A;  3S3M A;  3VQ6 A;  4HCB A;  1ASW A;  1C0U A;  4CEA A;  3MAQ A;  4FYD A;  3LPU A;  3QES A;  1RT1 A;  3U3Y A;  4FK0 A;  2HHV A;  3B6O A;  1WSG A;  4CES A;  4EP4 A;  1CLQ A;  2BAN A;  4RW8 A;  4CJP A;  4DQR A;  4DTN A;  3LWM A;  1MU2 A;  3LPT A;  2GUI A;  4CJS A;  1Q8I A;  2DFH A;  1TK0 A;  2FC0 A;  1JLC A;  3L3U A;  2YKM A;  1Z26 A;  4DSK A;  4KI4 A;  2XY5 A;  3ITH A;  3TAB A;  1A5X A;  3O4Q A;  3K5N A;  3T1A A;  3PY8 A;  4H8K A;  4CJL A;  4E7H A;  1BHL A;  4AIL C;  4KI6 A;  4N5S A;  2LSN A;  3IS9 A;  4O5B A;  3IG1 A;  3HVT A;  3AO1 A;  4CF0 A;  2GV9 A;  4E1N A;  4O44 A;  4UQG A;  2DTU A;  3TWH A;  3MXM A;  2HHQ A;  3PO4 A;  3RMD A;  1WSH A;  3CQ8 A;  1RBR A;  3HL8 A;  3KLG A;  4I9L A;  4CGJ A;  3EY1 A;  1VSK A;  4ID1 A;  4CIE A;  2RKI A;  1DTT A;  4CJT A;  2ZD1 A;  4FLW A;  4CIF A;  1NOZ A;  3HPH A;  3ZSX A;  4AHT A;  1U45 A;  1QSY A;  4FJ9 A;  3AVK A;  1JLQ A;  4CHN A;  3HVR A;  1YTU A;  3NBP A;  5JS2 A;  3SQ0 A;  1RDA A;  3G0Z A;  2I5J A;  3THV A;  4F3T A;  4KTW A;  4FM2 A;  1CXU A;  4E7J A;  1RT4 A;  4FW2 A;  3AVA A;  5SZT A;  3VQ8 A;  2YKN A;  4DU1 A;  3QET A;  3QEV A;  1SL1 A;  1NKE A;  1FKO A;  1RDC A;  4G1Q A;  4OKJ A;  1S1X A;  1LV5 A;  5DK5 A;  3ULD A;  1SL2 A;  4CFB A;  3NH2 A;  3D0P A;  1SL0 A;  3QIP A;  2D0C A;  1NKC A;  4EP5 A;  4ELV A;  1U49 A;  4DTP A;  4FJH A;  4Y1C A;  1S1T A;  3L2W A;  4DFM A;  4N41 A;  2KFZ A;  1IO2 A;  1JKH A;  2D5R A;  3CG7 A;  3K5O A;  3VQE A;  4CJU A;  3WNH A;  4DSF A;  4HUG A;  4KRF A;  2KFN A;  4C8O A;  4CFC A;  3K5M A;  1RT2 A;  4RW9 A;  4FLY A;  3DOL A;  4KHS A;  4IG3 A;  1D9F A;  4CGH A;  4M45 A;  1UA0 A;  2OZS A;  1JLF A;  3IAY A;  3KTQ A;  3DLK A;  3C6U A;  3VQ4 A;  1YT3 A;  3ZSQ A;  3OYD A;  3QEP A;  4YNQ A;  5SWM A;  4LH4 A;  3OS2 A;  3SPZ A;  2R7Y A;  3ZT0 A;  3V1O A;  1N6Q A;  2G8W A;  1TKT A;  4KB1 A;  2IAJ A;  3RRG A;  3SQ2 A;  3SUN A;  3MXJ A;  4PA1 A;  1NK4 A;  3NDK A;  3TAN A;  5HLF A;  3FFI A;  1FK9 A;  3OVN A;  3L2Q A;  1HYV A;  1RBS A;  4FLT A;  1WNS A;  4NCB A;  3UIQ A;  3P83 D;  1NK7 A;  2X6S A;  2X78 A;  1F21 A;  4Q5V A;  2XHB A;  4DTX A;  1CZ9 A;  1TL1 A;  4CEE A;  4KHU A;  1C1A A;  3ISN C;  1IG9 A;  2P51 A;  1GOB A;  4CJR A;  1LWC A;  3OYN A;  2XO7 A;  1VSE A;  2HVH A;  4CJF A;  1Q9X A;  3KJV A;  3AA2 A;  3ZSR A;  1B92 A;  2DFF A;  4Z4C A;  3EYZ A;  3ZT2 A;  2DY4 A;  1EKE A;  4CK2 A;  3U3G A;  3ZSY A;  4HTU A;  4FJ7 A;  4KB0 A;  4RW4 A;  1XWL A;  2YNH A;  4WE1 A;  4BDY A;  3O3F A;  3QEW A;  2JGU A;  3I0S A;  3VQC A;  1S6P A;  5HBM A;  4W5N A;  3VQB A;  3BDP A;  4RG8 A;  4BE2 A;  3AVN A;  3LDS A;  2W42 A;  3OS1 A;  1BIU A;  4CE9 A;  3K59 A;  1RT3 A;  4CCH A;  4AHR A;  3HYF A;  4CGF A;  1HMV A;  2P5O A;  2KTQ A;  4OPK A;  2OPP A;  1X9S A;  3DYA A;  3H08 A;  3M8R A;  3EZ5 A;  4CEF A;  3ASM A;  4L8R B;  4DTR A;  1S6Q A;  3OYB A;  2ETJ A;  2X74 A;  2G8F A;  4EZ9 A;  4OGC A;  4CIG A;  2HVI A;  4CEC A;  1VSF A;  1RT5 A;  4CED A;  3VQ5 A;  3TAM A;  1NJY A;  2XY6 A;  4AHS A;  4CHY A;  4N56 A;  1L5U A;  5FRO A;  4M3U A;  4CF1 A;  4FLX A;  1HQE A;  1O1W A;  2DFE A;  3L2V A;  3V9S A;  4M3Z A;  4E0D A;  1BL3 A;  3L2U A;  1BI4 A;  1ZBL A;  3MED A;  1CZB A;  1D5A A;  1LAV A;  5KI6 A;  4OJR A;  4XIU A;  1SKS A;  3VQA A;  4KHN A;  1JXE A;  3OJU A;  1BI4 B;  1NK0 A;  3O4N A;  1LW2 A;  1SKR A;  1EP4 A;  3JYT A;  3P1G A;  2RPI A;  1S9E A;  2Z1J A;  1HNV A;  1VSI A;  4PQU A;  3F9K A;  5J2M A;  1T7P A;  4DU3 A;  4KFB A;  4N76 A;  4CEO A;  4IG0 A;  4F4K A;  5FDL A;  4FJK A;  3NE6 A;  1KTQ A;  4B9U A;  1HRH A;  1YTA A;  2BE2 A;  3F73 A;  4B9V A;  4NCA A;  4B9T A;  1LWF A;  1RDD A;  3T3F A;  3HJF A;  2IOC A;  2VG6 A;  1X9W A;  4C8L A;  3QIN A;  5C24 A;  3AVI A;  3BGR A;  3NHG A;  1TKD A;  2OPR A;  1KFD A;  2VWK A;  4KPY A;  3LAN A;  4Z4H A;  3DI6 A;  4CGI A;  3D45 A;  3DLE A;  5HRR A;  2G8V A;  1WN7 A;  2IDO A;  4OLB A;  3S3N A;  5CYQ A;  3CFR A;  3KD1 E;  3VQQ A;  4M3Y A;  3K2P A;  1NKB A;  5HRN A;  1RNH A;  3PV8 A;  3OYM A;  2XY8 A;  2FBY A;  4DSE A;  4F3O A;  4DTU A;  4DTO A;  4CJQ A;  5KTQ A;  1KVB A;  1WSJ A;  4FJM A;  4NCG A;  3QEI A;  4OKE A;  2G8K A;  3DLH A;  1LAW A;  3T19 A;  3KK3 A;  1XHZ A;  2B6A A;  4KKO A;  5C25 A;  2GBZ A;  4DSL A;  2F8T A;  4B8A B;  3TAR A;  1DLO A;  2YHB A;  1HJR A;  4B8C A;  4KHQ A;  1TAU A;  3SUP A;  4KHY A;  1FXX A;  3HP9 A;  1DTQ A;  1KLM A;  3OYI A;  4J2A A;  3CM5 A;  4FXD A;  2Z1I A;  5C42 A;  4W5O A;  4CHO A;  2HHW A;  3ZSV A;  1C0T A;  3L8B A;  3PUF A;  3TAQ A;  4DTJ A;  1C0M A;  3DRR A;  4BDZ A;  1UA1 A;  2IS3 A;  3CFP A;  1SKW A;  4AHC A;  1U4B A;  2F8S A;  1VSM A;  4DFP A;  3HST B;  3ZCM A;  4EZ6 A;  3KLF A;  3NF9 A;  3M8S A;  4BWM A;  2HHS A;  2XRI A;  4KHW A;  4DQS A;  3AO3 A;  3AVG A;  3NFA A;  1WSE A;  4FM1 A;  2YNF A;  5E41 A;  3PO5 A;  3RWU A;  3V1Q A;  3TI0 A;  4Z4G A;  1TVR A;  4E7K A;  4M3T A;  2OPS A;  4PWD A;  1FKP A;  1RIL A;  1D9D A;  2F96 A;  4I2P A;  4AHU A;  1RTJ A;  5HRO A;  4NYF A;  1R0A A;  3V9X A;  3OJS A;  2HW3 A;  2YNI A;  1HYS A;  3V9Z A;  2RF2 A;  3HM9 A;  4DLE A;  2OA8 A;  5CZ2 A;  5J2N A;  4ELU A;  1ITG A;  4QAG A;  5CY4 A;  5I42 A;  2PYL A;  4M42 A;  2E6M A;  1C6V A;  3TAG A;  4M41 A;  4DU4 A;  1XC9 A;  3QNN A;  3PX0 A;  3LWL A;  4DFK A;  3NGY A;  4FZX C;  2KQ2 A;  4LD0 A;  4K8Z A;  1N5Y A;  1VSD A;  1YVU A;  1NJZ A;  4FJJ A;  3QO9 A;  4CFD A;  4DQI A;  4I7F A;  1VRU A;  3C94 A;  4F2R A;  1U48 A;  3OS0 A;  4CGD A;  1JLB A;  4NYN A;  1K6Y A;  1VK0 A;  3V9W A;  2O4G A;  4M3R A;  1QHT A;  1TL3 A;  1WSI A;  4FK2 A;  1JLE A;  3DOK A;  4DTM A;  1KVA A;  4BDP A;  3LAM A;  3RMB A;  4FJL A;  1KFS A;  3NGZ A;  4JS5 A;  4RW6 A;  1L3T A;  1VSL A;  2Y1I A;  4O0I A;  3CFO A;  4I9Q A;  4FJ8 A;  4Y1D A;  4FLU A;  4FM0 A;  1Q9Y A;  4F8R A;  1G15 A;  1KCF A;  3AVH A;  4DQQ A;  1C1C A;  3OYJ A;  1JLA A;  4LSL A;  3PX4 A;  4DFJ A;  4FK4 A;  1EX4 A;  3OYE A;  3HXM A;  1RTH A;  2ATQ A;  3MEG A;  4M3W A;  5FRM A;  5CZ1 A;  4FZZ A;  4E7L A;  4J2D A;  1GOA A;  4ID5 A;  4IFV A;  3V4I A;  3L2R A;  4K8X A;  3L3V A;  4LH5 A;  1B9D A;  2WON A;  4GMJ B;  2YV0 X;  1D8Y A;  3OYL A;  3ZT4 A;  2A1S A;  4IDK A;  4B08 A;  3OYF A;  1X1P A;  4ICL A;  5KGX A;  4LSN A;  1VRT A;  1WSF A;  1X9M A;  4C8M A;  4E1M A;  4CEZ A;  1LW0 A;  4CK3 A;  2Z1G A;  2G8U A;  2B5J A;  1EXQ A;  2X6N A;  4JLH A;  3HPO A;  3NF8 A;  3K57 A;  4FZY A;  2KZM A;  4CJ3 A;  2NUB A;  3S3O A;  4CF9 A;  4IKF A;  3TAF A;  3MEC A;  1T03 A;  2YHA A;  3ALY A;  2IC3 A;  4HUF A;  1C1B A;  4FJ5 A;  2P1J A;  3AA3 A;  3KLE A;  1RTD A;  2PY5 A;  2VWJ A;  1QS4 A;  1RT7 A;  4LY7 A;  4H4O A;  3V9U A;  3WNG A;  3O3H A;  2BGG A;  1BIZ A;  2QKB A;  4CK1 A;  1A5V A;  4JRP A;  4HHT A;  2OZM A;  3V1R A;  4DS4 A;  4FJG A;  4CF2 A;  4KRE A;  3SZ2 A;  3ZSO A;  2HB5 A;  3DLB A;  1EET A;  5HRS A;  2G8I A;  4CJW A;  1KVC A;  3SPY A;  4B9L A;  4R5P A;  5J1E A;  4DWI A;  3NCI A;  2ZQB A;  5DMR A;  1L3U A;  3OYA A;  1HYZ A;  1WAF A;  2YNG A;  4W5Q A;  3QNO A;  4H4M A;  1KSP A;  4CEB A;  1U47 A;  1S1U A;  3OYC A;  3SQ1 A;  1BQM A;  1HNI A;  2BDP A;  4OKK A;  1BIS A;  1REV A;  2KW4 A;  1NK6 A;  1L3V A;  3DM2 A;  3E01 A;  3A2F A;  2IGI A;  3KKR A;  1ZBI A;  3KIO A;  2PZS A;  1J5O A;  4O0J A;  4ELT A;  1RTI A;  2QKK A;  2HNY A;  5J2P A;  4IBN A;  4Z4E A;  3SYZ A;  2QXF A;  4B9M A;  3HO1 A;  2B4J A;  1GOC A;  3M8Q A;  4CJK A;  3KLH A;  3AV9 A;  3I8D A;  4C8N A;  1IKX A;  5CYM A;  2OYQ A;  1VSJ A;  3NAE A;  1UWB A;  3DMJ A;  1RDB A;  4Z0U A;  1T8E A;  4DSI A;  3RR8 A;  3LAK A;  4HCC A;  3ZT1 A;  4Z4F A;  5JS1 A;  2OPQ A;  3AO4 A;  2ITG A;  1I39 A;  4CFA A;  3K5L A;  3SNN A;  3G10 A;  1BGX T;  1LWE A;  2FBV A;  4CJ4 A;  2HND A;  3S9H A;  3LP2 A;  3SQ4 A;  4FLZ A;  4DF8 A;  3SI6 A;  3AVF A;  3C6T A;  4PUO A;  2KZZ A;  3KD5 E;  3LP3 A;  3DRS A;  4ZTJ A;  2HMI A;  3QLH A;  1TKZ A;  3AVL A;  1SV5 A;  4ZHR A;  4MFB A;  1IH7 A;  3VQD A;  1JLG A;  3RMC A;  3MXI A;  1NK5 A;  1JL1 A;  3QEX A;  4Z4I A;  1QQC A;  4DF4 A;  4AH9 A;  1J54 A;  1ZBH A;  4OVL A;  1QE1 A;  4B9S A;  2G8H A;  4OLA A;  1BQN A;  1TAQ A;  3KK2 A;  1J53 A;  3I0R A;  1QSS A;  4DG1 A;  1S9G A;  3AVC A;  2P5G A;  2D0A A;  4BE0 A;  3RR7 A;  3MEE A;  1RBU A;  1TV6 A;  1NJW A;  4J2B A;  1ASV A;  3OY9 A;  3CYM A;  3SJJ A;  1J9A A;  3K58 A;  1KRP A;  3SUO A;  4N47 A;  1NOY A;  3AA5 X;  3RRH A;  5T7B A;  1NK9 A;  3NGI A;  3SUQ A;  5J2Q A;  4O55 A;  3OYK A;  4KAZ A;  2Y1J A;  3ZSZ A;  3LP0 A;  3O3G A;  4CJ5 A;  3WNF A;  1BCO A;  4QCL A;  2VG5 A;  3IRX A;  1RT6 A;  4QOZ B;  3QIO A;  3WNE A;  3TAE A;  1ZBF A;  1NJX A;  3NH0 A;  4KTZ A;  4CJE A;  5FRN A;  4DSJ A;  3VQ9 A;  4CEQ A;  4TSX A;  3LAL A;  3DLG A;  5HRP A;  4FLV A;  4DS5 A;  3TAP A;  4E7I A;  4BE1 A;  2EX3 A;  3LP1 A;  4CHP A;  4KV8 A;  3VQ7 A;  4E19 A;  3HP6 A;  3OYH A;  4CF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...