3AA5X

A52f e.coli rnase hi
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
153
structure length
153
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAFIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
molecule keywords Ribonuclease HI
molecule tags Hydrolase
source organism Escherichia coli
total genus 46
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa5X00
3L2VA 1X9WA 3QNNA 4CECA 2WOMA 4KKOA 2D0BA 1TK5A 4KHYA 3V4IA 4C8MA 2X6NA 1RT5A 3AVAA 2OPSA 3AVMA 5CZ2A 3ZCMA 3C95A 3OYEA 4BDYA 4BDZA 3VA0A 2FBTA 4Z0UA 4CFCA 2WONA 2QKBA 3VQEA 4Z4FA 1HPZA 4I9LA 3SCXA 4KHWA 4E1NA 3V1OA 3KLIA 3ITHA 3NH1A 3QETA 4J2EA 4K8ZA 4DSIA 4E0DA 4YNQA 4YFUA 1TK8A 3VQCA 1N6QA 4O4GA 4M3TA 1ZBHA 1BIUA 3NGZA 2BE2A 1B9DA 3AVJA 3LAKA 1JLBA 4BACA 4HCCA 3AVFA 4N47A 4EZ6A 4CJRA 2O4GA 1EKEA 5DK5A 4DG1A 1B92A 5HP1A 3SPYA 3V9UA 3QIOA 1VSEA 5K14A 4QOZB 4GVMA 3AVNA 4DTSA 4CJEA 4I9QA 1WSFA 4CGDA 3RRGA 4CEZA 1RT3A 1JXBA 1VSLA 3LP3A 4CJVA 4FLYA 1HYZA 3T3FA 2AJQA 5I3UA 1NOYA 2G8VA 4O0IA 2F8SA 2ZE2A 1S9EA 3TAMA 1C0TA 4DFMA 4DSEA 3D0PA 1YTUA 4CEFA 1VSMA 5I42A 1WSIA 4DQSA 1KCFA 1IKVA 4IG3A 4W5OA 5HLFA 1KFSA 1S1VA 2P51A 4B08A 4ID5A 1J5OA 3OJUA 1BI4A 1RDBA 4B9LA 4E1MA 1LW2A 1LV5A 4KI4A 2G8UA 4AILC 4RG8A 4M41A 4H4MA 3TARA 1C1AA 2G8IA 2KZZA 3ZSOA 5FRNA 3L3UA 3RMCA 4KRFA 3DMJA 2KZMA 4AHUA 3QIPA 2HVIA 2RPIA 2YHAA 1HJRA 3H08A 1HYSA 5JS2A 3OYMA 4NYNA 3V9XA 2HHQA 4PQUA 4OKKA 3NH2A 3SUOA 4O44A 3VQ6A 4KB1A 4FK2A 1I39A 3MXJA 4CEQA 5FDLA 5EU7A 1LWFA 4CHZA 5CZ1A 3V9SA 3BDPA 4DFKA 4FK4A 4ELTA 3VQQA 3NF7A 3DYAA 4CIEA 5KI6A 1VSFA 4BE0A 3KTQA 1RT7A 1NK0A 3K59A 3TWHA 2HNZA 3QEIA 3VQ5A 1X9MA 4AHTA 4W5RA 1BI4B 2KFNA 4FJKA 4RW4A 3IAYA 3CM5A 4FJ8A 2E6LA 3DLRA 4DU4A 5KTQA 1TKTA 1QS4A 4DU1A 3QINA 4FJHA 3WNFA 4EP5A 4HUGA 3OS0A 3I0SA 5J2NA 1EETA 3EYZA 3TAEA 4N76A 3VQDA 3KLHA 5KGXA 4XIUA 1HQUA 2VG6A 4FZXC 2D0CA 3VQBA 3DLEA 2Z1HA 4C8NA 5SWMA 2XO7A 2FC0A 4NCAA 4KV8A 2FBYA 3SUQA 2DFEA 1YTAA 3HK2A 4FJXA 1Q9YA 4CERA 3DLHA 4CK1A 3SQ4A 1VSHA 1X1PA 4KREA 2D5RA 1TV6A 4M3RA 2GV9A 1KSPA 4PWDA 4W5NA 4H8KA 1S6PA 1HYVA 4I2QA 2E4LA 2X78A 3AVLA 4NCGA 3E01A 4DLEA 3THVA 1SKSA 3K5OA 2HNYA 4B9UA 1U45A 4KTWA 3C6UA 3ZT2A 2YNFA 4KFBA 1U04A 3LWLA 3JYTA 4FJ9A 3VQPA 3O3GA 3OJSA 3V9ZA 2XY6A 2PZSA 4C8LA 4DTUA 3C94A 4E7KA 1T8EA 3OYBA 1FXXA 1YT3A 3AVBA 1UWBA 3SUNA 2A1SA 3IRXA 1NJWA 5HRNA 4J2AA 2RKIA 1RBRA 5HRPA 1HMVA 1WAFA 2BDPA 3HJFA 1ITGA 4E7LA 4FW2A 3HM9A 4IKFA 4FJNA 1RDCA 4H4OA 3M8QA 4F2RA 4FLWA 5FROA 1EXQA 1QTMA 4O5BA 1B9FA 4DWIA 4JRPA 4CK2A 4DSJA 1JLQA 3CG7A 4OPJA 3ZSQA 4DTJA 2B4JA 4OGEA 3DLBA 1IKYA 1BHLA 1W0HA 2DFFA 3SV3A 3K5MA 4KHQA 3PY8A 1A5VA 3AA3A 1SL1A 4Y1CA 4WE1A 1J9AA 1JLCA 2OPRA 3AVIA 5HBMA 4LD0A 2GUIA 4E7JA 4DU3A 1UA0A 1VK0A 3MEDA 3I8DA 2XY5A 4RW7A 1RBVA 4DFJA 1LAWA 4DQIA 4M42A 3AO4A 1TKZA 2Z1IA 1D5AA 1A5XA 1VRUA 4IBNA 4CJWA 4HUFA 3ZT4A 3TANA 2HHVA 2D0AA 1DTQA 3LAMA 2YNHA 4Z4CA 3L2UA 1WNSA 1QHTA 3AO5A 1I3AA 3OVNA 3NCIA 1GOCA 4FJJA 3VQ4A 3RR8A 1JLAA 2PYJA 1ZBFA 3KD1E 1KVCA 3P1GA 1GOBA 5CYQA 4M45A 3S3OA 4FZZA 3K5LA 3LDSA 3HPGA 2P1JA 2IGIA 4OLAA 1SV5A 4E7HA 4CESA 3L2WA 3QEPA 1RT2A 1NK5A 3VQ7A 3QEVA 4LY7A 4DF4A 4GW6A 1RDDA 1NK8A 4PUOA 2ATQA 4J2DA 5FRMA 3F9KA 3NF8A 3VQ8A 4FW1A 4G1QA 1JLFA 3ZT0A 1L3TA 3O3HA 3LP2A 5J2QA 4AH9A 4N56A 1NK7A 1QSLA 2PYLA 4HCBA 4ICLA 5C42A 1SKWA 4CEDA 3DM2A 3EZ5A 1NKCA 1CXQA 1J54A 3AO1A 3MAQA 1RBSA 4FLVA 1C0MA 4I7FA 3U3GA 3QEXA 2HB5A 3DRRA 3IS9A 4CHOA 4IFVA 3RR7A 1T7PA 1Z26A 4FVMA 1C1BA 4DMNA 2OPPA 4CJUA 1JKHA 3OS1A 1L3SA 1L3UA 4C8KA 4FZYA 4BWMA 4B9VA 1LW0A 4DF8A 3M8RA 1HQEA 3HVTA 3TR8A 1U4BA 2DFHA 1BQMA 1C0UA 4CJPA 3SI6A 4OGCA 1ZBIA 5D3GA 1VRTA 2ETJA 1HRHA 1RDAA 4IG0A 2P5OA 3OS2A 2OPQA 3MXIA 2E6MA 3CQ8A 2Y1IA 3VA3A 3S3MA 4Z4HA 3PV8A 5JS1A 1LWCA 1WSEA 3DOKA 3KK3A 1JXEA 1NOZA 4CF0A 3CFPA 3LALA 1SL2A 1TVRA 2HHSA 4M3XA 4MQ3A 1VSDA 4OPKA 1A5WA 1BL3A 2KQ2A 4HHTA 4ZTJA 3HPHA 4F4KA 1RTHA 4TSXA 1JLGA 3ZSWA 3M8PA 4CHYA 1CZBA 1G15A 1DLOA 1RT6A 3ZSYA 4CJKA 3QEWA 5HROA 3O4QA 4AHCA 3JSMA 3K5NA 3QLHA 4ZTFA 2A1RA 2RF2A 5HRRA 1L3VA 3B6OA 3OYCA 2KW4A 1RTJA 1REVA 4KPYA 2X6SA 4QAGA 1TGOA 3ZSVA 4CK3A 3CFRA 3DI6A 1NJXA 3AA2A 1C1CA 3AVGA 1MU2A 3OYDA 4CEBA 3PX4A 1N5YA 1TKXA 3TAPA 4EZ9A 3MEGA 3SV4A 2OYQA 3ZSZA 3OYHA 3L8BA 1X9SA 1S9GA 3VQ9A 4ELUA 3WNHA 4Z4EA 3DLGA 3O4NA 1JL2A 1DTTA 4FM0A 4CGHA 4N41A 2KTQA 3LANA 3PUFA 4DQPA 4J2BA 1RILA 4JS5A 4E7IA 1W9HA 3LWMA 3LZIA 4B8AB 1RT4A 1FKOA 4ID1A 4RW6A 3HXMA 3S9HA 3DLKA 3K2PA 4RW9A 4JRQA 3SQ2A 1QSYA 4O55A 2DY4A 4B9NA 3ASMA 1T05A 2YNGA 2XY7A 4BE1A 1U49A 2HW3A 1WN7A 5C24A 3MXMA 4CF1A 4M3WA 4B3OA 3SZ2A 4I2PA 3PX6A 3NH0A 2YKMA 1ASUA 3LPUA 1RNHA 3D45A 1RTDA 1XI1A 3TAGA 1HNIA 4ELVA 3NF6A 1NK4A 3AA4A 2RN2A 5KGWA 3AV9A 1ASWA 3DRSA 3OYIA 2Z1JA 4FCYA 1EP4A 1ASVA 1CZ9A 3HPOA 2YHBA 3T19A 3UIQA 4FJMA 1XWLA 1QQCA 3NDKA 1ZBUA 5HRSA 2GBZA 3F73A 4CIFA 2Q3SA 3SQ0A 2JGUA 1NJYA 3KLGA 4HUEA 2B6AA 3M8SA 3RMDA 1D9FA 1RBTA 2Y1JA 5E41A 2FBXA 1TKDA 1IKXA 3L2RA 1RT1A 3NGIA 2F8TA 3HO1A 2PY5A 1WAJA 2IS3A 1KVBA 3C6TA 2YKNA 4FM2A 1IH7A 4FLXA 4CJ5A 4CCHA 4CEEA 1F21A 1XHZA 4KHUA 1BISA 1K6YA 1U47A 3ZT1A 4CEAA 3FFIA 4FJ7A 1C6VA 3VN5A 1VSKA 2W42A 3RTVA 2X74A 4HTUA 1NKEA 4OKEA 4CF2A 4UQGA 1L5UA 3NHGA 4M3UA 3ZT3A 1SKRA 3LP1A 2VWJA 3K57A 1Q8IA 1TL3A 3CYMA 3TABA 3ZSRA 4CIGA 4W5QA 1IG9A 1Y97A 3MECA 1BIZA 4CHNA 2I5JA 4AHVA 4DTXA 1KFDA 4FLZA 3PO4A 2OZSA 2YNIA 1XHXA 3G0ZA 4DFPA 1TK0A 3HYFA 4Z4GA 2EHGA 3MEEA 4DTRA 3SNNA 2G8HA 1SL0A 4F2SA 4CE9A 3SYZA 4KTQA 3L3VA 4KO0A 3OYNA 4NYFA 3SQ1A 4LH4A 4FK0A 2NUBA 4CGFA 3TAFA 4K8XA 2OA8A 1BCMA 2ZQBA 3KIOA 1CLQA 3NGYA 4DSFA 1QSSA 4DQQA 1IKWA 3SUPA 3KLEA 4F8RA 4FJIA 3S3NA 2IC3A 3SJJA 5J2PA 2HNDA 2XRIA 4R5PA 4IFYA 3AVCA 3OYFA 1IO2A 3V81A 1ZBLA 4Q0BA 3HSTB 2G8KA 3IG1A 3NF9A 3T1AA 1T03A 1FKPA 3V1RA 3QNOA 4IDKA 4CFBA 2HVHA 3A2FA 4CF8A 4KAZA 4JLHA 3RMAA 1LAVA 3HP9A 4CGJA 1NJZA 4Q5VA 4DLGA 3BGRA 1KVAA 2B5JA 4CJQA 4DS4A 3CFOA 1CXUA 3OYAA 2G8WA 2OZMA 3ULDA 1BQNA 1EX4A 2FBVA 2XY8A 3CM6A 4RW8A 3V1QA 5J2MA 4E89A 4OVLA 4CGIA 1S1XA 3OYGA 4FYDA 1GOAA 2VG7A 3QO9A 2G8FA 3KK1A 4MFBA 3KLFA 3TI0A 2IAJA 1U48A 4LSLA 3ZSXA 3KJVA 1S1TA 4DSKA 3NE6A 2JLEA 1JL1A 4OKJA 4AHSA 3V9WA 4OLBA 2DTUA 3EY1A 4DQRA 4CHQA 4C8OA 3RRHA 5SZTA 2XHBA 2IDOA 4LH5A 4CEOA 3AVKA 3O3FA 4B9SA 4PY5A 4GMJB 4Z4IA 4DSLA 3HVRA 4KHNA 5CYMA 2ITGA 3G10A 1YVUA 1UAXA 3ALYA 4ZHRA 3QERA 4QCLA 2EX3A 4CJSA 1NK6A 1R0AA 4O0JA 3KD5E 2HHWA 1WSHA 4M3ZA 1QE1A 3VQAA 4B9MA 1S5JA 3WNEA 3U3YA 4L8RB 4Y1DA 3OYJA 4F3TA 1TAUA 4DTNA 3PO5A 2QXFA 2LSNA 1KRPA 4CF9A 1WSJA 3DRPA 3HP6A 1VSJA 3RMBA 4FJ5A 4JS4A 2QKKA 3QESA 3NAEA 4BDPA 2HHXA 4B9TA 2R7YA 2HMIA 3NBPA 4BE2A 3KK2A 5CY4A 3NFAA 1S1WA 1WSGA 5DMRA 5KRTA 2Z1GA 3HL8A 5T7BA 4HVJA 3U6FA 4FLTA 3V6DA 4KB0A 1S6QA 4E19A 4CFDA 4PA1A 1KLMA 3TAQA 1RCHA 5KRSA 1Q9XA 1ZYQA 1TAQA 4EP4A 2F96A 1JLEA 1UOCA 3P83D 3AO3A 4CJ4A 3L2QA 4DTPA 2BGGA 2QK9A 4CJLA 3RWUA 3OYLA 1D9DA 4FXDA 1Z25A 2VG5A 4KTZA 3AA5X 4CJ3A 3KKRA 4LSNA 4CFAA 4CJTA 1RTIA 3SPZA 1XC9A 1VSIA 1KLNA 1SUQA 2YV0X 4FM1A 1NK9A 2P5GA 3PX0A 3OYKA 4FJLA 1NKBA 2KFZA 4F3OA 3LP0A 4AHRA 4KI6A 1HNVA 4KHSA 4M3YA 1S1UA 3I0RA 2IOCA 3ISNC 2HHTA 4DS5A 4NCBA 1UA1A 1J53A 5J1EA 3LPTA 3AO2A 1WLJA 4DTOA 2O4IA 1FK9A 2BANA 1LWEA 1D8YA 5C25A 4N5SA 1O1WA 4W5TA 3WNGA 4CHPA 3LZJA 3DOLA 4CGGA 4FLUA 3AVHA 1RBUA 4BWJA 4E3SA 4DTMA 3B6PA 3KKSA 3P5JA 2ZD1A 2VWKA 4CJFA 2HHUA 1KTQA 4FJGA 1BCOA 1BGXT 3OY9A 4OJRA 3HT3A 4B8CA 1TL1A 3K58A
chains in the Genus database with same CATH superfamily
4H0TB 3QNNA 4KKOA 2HBJA 4LF9K 2X6NA 1RT5A 3AVMA 4A57A 5B8HA 1JCGA 3SNNA 4DUYK 2QA4N 2WONA 3VQEA 1HPZA 3KWIA 4JAXA 2HBMA 4H0XB 3DWLA 4YNQA 4YFUA 1TK8A 1N6QA 1ZBHA 1BIUA 3CI5A 3C6HA 3WXLA 2CGKA 4ISGA 3NGZA 1B9DA 3CJ7A 3AVJA 2GX9A 1JLBA 3LAKA 4BACA 4HCCA 5AQPA 2O4GA 2O8EA 4DG1A 1B92A 3CJCA 5TKYA 2UUBK 1QZ5A 1HLUA 2F9TA 3QIOA 5FLXO 5K14A 4EFHA 1H1VA 4DTSA 2JWLA 4YOWA 4L3QA 4CEZA 1RT3A 1YUWA 1VSLA 2VWBA 4CJVA 3JAMO 1XNRK 2ZGZA 3FZMA 3TAMA 1GLFO 4DSEA 1YTUA 1MWKA 3SMPA 1KCFA 4BR9A 4ID5A 1FJGK 3OJUA 2P9KA 1VQPN 1LW2A 4RG8A 2HHHK 3VTHA 5FPNA 3L3UA 4AHUA 2HVIA 1HJRA 1HYSA 2GELA 4OKKA 1ATSA 1I39A 3MXJA 5LMUK 5FDLA 3HM8A 5EU7A 3BDPA 4BQZA 5M1PA 3MWTA 2P9PA 1NK0A 2HNZA 1N33K 3VQ5A 4IOAL 1VHXA 4CD1A 2E6LA 3DLRA 2VYPA 1S72N 3WNFA 1BDGA 5J2NA 1WBDA 5KGXA 4DV1K 2VG6A 2D0CA 3D7EO 3DLEA 2Z1HA 3C65A 3KZBA 4NCAA 4KV8A 3SUQA 2DFEA 2OTJN 3DLHA 2RE2A 4CI6A 4W5NA 2QTDA 5TKWA 1NU0A 2E4LA 5AQJA 2X78A 3AVLA 4NCGA 4DLEA 3THVA 4B9UA 4KTWA 1X9JA 3C6UA 1U04A 3LWLA 1BA0A 3VQPA 2PZSA 3L4QA 2H3GX 1YT3A 4BRQA 3SUNA 5AQWA 2A1SA 3IRXA 1NJWA 3HM9A 4FLWA 1QTMA 4JRPA 2WBNA 4BGBA 3ZSQA 1IKYA 1BHLA 1W0HA 3UKRB 4KHQA 3PY8A 1RDWX 1NGGA 3F9MA 3B8AX 4Y1CA 5KQ8A 1J9AA 1JLCA 4M3WA 1LAWA 3WQUA 3SBGA 1GLCG 4IBNA 1A5XA 4CJWA 4DV6K 4HUFA 3L2UA 4Z4CA 3NCIA 1I3AA 4FJJA 3LDPA 4LF8K 1ZBFA 1OH8A 3P1GA 1GOBA 5CYQA 2HBLA 4BRFA 3HPGA 2P1JA 4OLAA 1BA1A 1SV5A 5KPRA 2NRWA 4LY7A 4CZKA 4PUOA 5FRMA 1G99A 3VQ8A 4KHPK 4FW1A 4M3TA 3ZT0A 1L3TA 3LP2A 4AH9A 4N56A 1XMQK 4ICLA 3JXUA 4CEDA 3DM2A 3EZ5A 1NKCA 3AO1A 3MAQA 3HSCA 1C0MA 3L0QA 4I7FA 4BRIA 1C1BA 3VENA 4CJUA 1L3SA 4BWMA 4GVEA 1HQEA 3HVTA 3TR8A 3SAFA 4DR1K 2DFHA 2P9SA 5CR4A 2NNWA 1ZBIA 5D3GA 1P90A 2ETJA 1RDAA 4H0OA 5AQYA 1YVNA 3ZX2A 3CQ8A 3S3MA 5JS1A 1NOZA 1HNWK 3LALA 1SL2A 4C1NK 5KPTA 4YHHK 2ZF5O 1BL3A 4HHTA 4IDHA 1CZBA 5HROA 3NVMA 2BTFA 3O4QA 5HRRA 4FPAA 3B6OA 4B3SK 4CW7B 3G71N 4QS7A 1TGOA 3ZSVA 3CFRA 3VPZA 3DI6A 1NJXA 4IOXA 4GKKK 1TKXA 1W7AA 3SV4A 3T1YK 2OYQA 3OYHA 3L8BA 1S9GA 2ZJPL 1DTTA 2KTQA 4BROA 1RILA 4E7IA 1K73O 5AQTA 1W9HA 4DV5K 3S9HA 4BRLA 3LDQA 4EAHD 1QSYA 2DY4A 4YY3K 2XY7A 4QS9A 4BE1A 4OPAA 1VQ5N 2RHKA 3MXMA 4B3OA 3SZ2A 3CC2N 1IJJA 2WC9A 2PFUA 4I2PA 1RTDA 3E66A 2RN2A 1TYQA 3AV9A 2D0PA 4CZIA 1NM1A 1NGAA 1FW6A 1XWLA 5LJVA 3F73A 4CIFA 1NJYA 4AM6A 2V7YA 4HUEA 3RMDA 1D9FA 2Y1JA 5E41A 1RT1A 1XUPO 2YX6A 3CJBA 1QZ6A 3L4IA 3OBWA 2PY5A 1WAJA 2P9NB 4FM2A 4CEEA 2WTUA 1XHZA 3LM9A 2QM1A 4DR2K 3CCRN 4CEAA 3FFIA 3CJAA 3T69A 3CXCM 4BGAA 1NJIO 4I6MA 2X74A 1VQKN 2QWPA 4OKEA 4UQGA 3VGLA 3K57A 1N36K 1TL3A 1Y97A 5F2RA 4GNIA 4CHNA 2QWMA 1XHXA 4Z4GA 1WBBA 1S22A 3ZX3A 1HNXK 4X64K 2EHGA 2G8HA 4DTRA 4M63C 2QW9A 4KTQA 3L3VA 4NYFA 3P38A 2IVPA 4CGFA 3CQYA 2OA8A 3KIOA 2E2OA 4DQQA 3SUPA 3KLEA 4F8RA 3SJJA 1JCEA 4R5PA 3CPWM 3OYFA 3V81A 4Q0BA 3DJCA 3PIOL 2Q1NA 3A2FA 4JD2B 4JLHA 2O8BB 3M1FA 1HX1A 4CGJA 4WFBL 4CJQA 3HTVA 4F9OA 3CFOA 3ULDA 4RW8A 4KBOA 4FWQA 1GOAA 1T6DA 4MFBA 3ZSXA 3TPQA 1S1TA 3CD6N 2BUPA 4O5FA 2JLEA 1JL1A 3VF2A 3V9WA 5AZIA 2DTUA 4DQRA 5SZTA 3ZEUB 4K25A 4CEOA 3AVKA 5M1OA 4J8FA 1YVUA 3H6EA 4OO1J 2Q2RA 3QERA 4QCLA 2EX3A 3D2FA 3J81O 4B9MA 4Y1DA 2UXCK 1KAYA 1KRPA 4RWTA 4CF9A 3HOTA 3R1XA 4BC3A 1WOQA 3NAEA 4O8UA 2VQEK 5AQMA 1M90O 3KVGA 3MCPA 3M6GA 2Z1GA 3U6FA 3V6DA 1S6QA 4PA1A 1V4SA 3O4WA 5KRSA 4DTPA 3P83D 4CJ4A 3AO3A 4H5TA 1TUYA 1VQNN 3GBTA 2FSNA 3FZKA 4CJLA 2UXDK 4FO0A 1WB9A 4CFAA 3SPZA 4CJTA 5AQXA 1XC9A 3U9DA 4FM1A 3PX0A 3OYKA 4FSVA 4F3OA 3GE1A 4KI6A 1HNVA 3MWPA 1S1UA 3I0RA 2IOCA 3J80O 2Q0RA 2HHTA 3UKUB 4DS5A 1SZ2A 1J53A 5J1EA 3LPTA 3CCLN 3ULEA 1FK9A 5EXWA 4W5TA 3LZJA 4FLUA 1I94K 4DTMA 1ESVA 3B6PA 1Z6RA 2VWKA 3WXMB 4CJFA 1BGXT 3Q7BA 4IFEA 5C15A 3K5NA 3K58A 2NZTA 3GG4A 3FZFA 2WOMA 1TK5A 3W3DA 1GLLO 1LOTB 5CZ2A 3OYEA 4BDZA 3ZCMA 5A2QO 4CFCA 3CC7N 4B9QA 3IDHA 1BG3A 4RCHA 4KHWA 4E1NA 3V1OA 4FWKA 4DSIA 4JHDB 1EWRA 3FFKB 4DR4K 3KK7A 5DK5A 5HP1A 1DEJA 4FWSA 3THWA 4QOZB 5AQRA 1WSFA 4MDBA 3RRGA 4B1WB 3ENHA 3T3FA 5I3UA 1NOYA 1S9EA 3O8MA 1SAZA 4CEFA 4FWOA 5I42A 4JI4K 4W5OA 4IG3A 2P51A 2UXBK 4B08A 1RDBA 1YI2N 1LV5A 4KI4A 2NRRA 4U67L 2YCHA 4M41A 2EWSA 4H4MA 3TARA 2A5XA 3RMCA 4KRFA 3DMJA 2KZMA 4G9ZA 3QIPA 2YHAA 5JS2A 1C0FA 3BZCA 2HHQA 1VQ9N 4PQUA 3NH2A 3SUOA 4O44A 3KWGA 3IMXA 2A42A 4DFKA 2ZM6K 3CMAN 3DYAA 1VSFA 3H1VX 5KPZA 4BE0A 4IO9L 1RDUA 1X9MA 4AHTA 4W5RA 2P9KB 4FJKA 1BU6O 4CZMA 1HPMA 5KTQA 3SBTA 1TKTA 1QS4A 4EP5A 1Q18A 1MDUB 3I0SA 1EETA 3EYZA 3VQDA 3KLHA 4BR7A 2E1ZA 5JVGL 3VQBA 5E26A 4C8NA 5SWMA 2XO7A 4DUZK 2FC0A 3CIPA 5AZJA 3Q7CA 4FJXA 1Q9YA 3HK2A 4CERA 4CK1A 1VSHA 3QFUA 2D5RA 3EE8A 4H8KA 4YOXA 1S6PA 1SKSA 1R59O 3E01A 2VQFK 4ILGB 3K5OA 2HNYA 2QWOA 4JK8A 3JYTA 4KFBA 4JKHA 3CMEN 2YI1A 4X65K 2FF6A 4E7KA 5BREA 5GAEP 5LJWA 3AVBA 4J2AA 1WAFA 3EZWA 1T44A 4HTLA 1OVQA 2BDPA 1ITGA 3HJFA 4FW2A 1YITN 4FJNA 5FROA 2VGMA 4O5BA 4DWIA 3CG7A 2GTDA 2HSTA 1ZXOA 3BZKA 5JVHL 3AA3A 4WE1A 5HBMA 3I8DA 4RW7A 1RBVA 4WCEL 4DFJA 1D5AA 4KH5A 1YJ9N 2HHVA 2D0AA 1DTQA 2YNHA 2Q31A 5EX5A 1GOCA 3VQ4A 4M45A 3SMSA 2WUSA 4FZZA 3K5LA 4KH6A 2IGIA 4CESA 3L2WA 2P9LA 3VETA 3QEVA 4LC9B 3AAPA 4DF4A 4GW6A 1RDDA 3O9TA 2ATQA 5AQIA 1HJOA 4J2DA 3NF8A 5GAHP 3CCEN 4YDUA 3O3HA 5C42A 1KXPA 1CXQA 1VQ4N 4O8KA 3GL1A 3VGKA 3QEXA 4CHOA 3L6QA 3O9SA 3J7YP 3OS1A 1L3UA 4FZYA 4B9VA 2P9IA 3I8BA 1C0UA 4OGCA 5BRDA 1JJ2M 2QWQA 2W41A 2O8FA 4GY2B 1HRHA 3MXIA 2E6MA 4ISEA 3MX2A 1WSEA 2ZJRL 2QI2A 3KK3A 5JICA 3CFPA 3ZYYX 1TVRA 2HHSA 4M3XA 1VSDA 4OPKA 4ZTJA 3HPHA 5BPLA 4TSXA 5M1NA 2OTLN 4PHTX 3AAQA 5C2FA 3WXIA 1G15A 4DQIA 3QEWA 3QLHA 4JI1K 4ILHA 3UB5A 1RTJA 4KPYA 5ELZA 4QAGA 2P9SB 1OKJA 4RTFD 1MU2A 4CEBA 3A5LC 3TAPA 5JLFA 3E9PA 5M1FA 4BRKA 1NGDA 1XMOK 4Z4EA 3DLGA 3O4NA 4J2BA 4DR5K 3LZIA 3PSFA 4B8AB 3HRGA 1FKOA 4ID1A 4RW6A 3HXMA 3DLKA 3K2PA 3R9PA 3ASMA 2YNGA 1U49A 2HW3A 5BRFA 4GV3A 1IV0A 2AA4A 3CHWA 1KQSM 2YKMA 1RNHA 3D45A 1NK4A 2KKZA 1HKGA 3A8YA 3ATVA 5KGWA 4NXMK 1ASWA 3OYIA 3HPOA 2YHBA 3T19A 4FJMA 1QQCA 1ZBUA 5HRSA 2Q3SA 3PLAA 1N8RO 2F4VK 2B6AA 2WFBA 2W6LA 3CCVN 2FBXA 4H0PA 4JI7K 3SAGA 1HKBA 4FLXA 2E20A 1ZBSA 3O9RA 3WT0A 2W42A 3RTVA 1TYQB 4M3UA 3LP1A 4YORA 5AQHA 4XH5A 4BRAA 4K41A 3FLCO 4FOIA 4AHVA 5MLCQ 4K42A 1GLDG 4DFPA 1TK0A 3HYFA 4E1JA 3TTFA 5BPNA 2CH5A 3OYNA 4KO0A 1P8ZA 4H5RA 4JK9A 3FZLA 1IKWA 4XH1A 4FJIA 2IC3A 2HNDA 3SAHA 3AVCA 4I6MB 4JKGA 3HSTB 1FKPA 3QFPA 4CFBA 1QQMA 4KAZA 3MCAB 3NMUA 1LAVA 4PKHA 1HUXA 3CM6A 3V1QA 4H5VA 5J2MA 4OVLA 3ID8A 4FYDA 1YXQA 2QEXN 3KLFA 2NRTA 4LSLA 3KJVA 4DSKA 3U4LA 3EE9A 5ADXA 3O5BA 3NE6A 2AP1A 4JN4A 4A2BA 4AHSA 4FWPA 1ILYA 2E2PA 3EN9A 4B3MK 3O3FA 3QBXA 3U9ZA 4Z4IA 3C7NB 4EHUA 4KHNA 3EO3A 2BH1A 1QQNA 4MO5A 1UAXA 3VOVA 5I9EB 1R0AA 3TSUA 3CC4N 1GLAG 4M3ZA 3U3YA 4DKWA 4WFAL 3OYJA 4L8RB 3WUHA 3PO5A 2QXFA 3DRPA 1K8KA 3TSQA 4LFAK 1VSJA 2GWKA 3RMBA 3WXJA 2QKKA 5AQLA 4JKAA 4BC4A 3DXKB 3ENOA 2ASMA 4LF7K 5AZIB 4BRDA 3VEOA 4CFDA 4CZFA 1KLMA 2ZWHA 1RCHA 1TAQA 3CETA 2BGGA 3D2FB 1D9DA 2VG5A 3KKRA 1KLNA 1RTIA 2DPNA 1VSIA 2Q0UA 1KC8O 3EEQA 4JI0K 3MMVA 4M3YA 2O8DA 3ISNC 4NCBA 4JNEA 3K9KA 1WLJA 1NG9A 2OANA 3TSPA 3DLLL 1D8YA 1LWEA 1O1WA 5LMNK 3AVHA 4YDUC 1MA9B 3KKSA 2E2NA 5BR8K 1TL1A 3L2VA 1X9WA 3VEZA 1VQ6N 5EVZA 5GAGP 4KHYA 3V4IA 5F1XA 3AVAA 4PKIA 1NK7A 3C95A 2FBTA 4Z0UA 2QKBA 3G25A 4Z4FA 4I9LA 3ULEB 3KLIA 3NH1A 3QETA 4CZGA 4K8ZA 1XC3A 5AFUA 2JWKA 1NNEA 2Q97A 4N47A 3C7NA 2J4RA 5M1QA 4CJRA 3AY9A 1DKGD 3V9UA 1J6ZA 1VSEA 3AVNA 1IG8A 3SLCA 4CJEA 4I9QA 1LCUA 4WYBA 3NVKA 4AQYK 1QVFM 2AJQA 3M3ZA 3H1QA 2G8VA 2NRXA 2F8SA 3VGMA 4DV4K 1VSMA 1IKVA 3CCJN 3DXKA 1BI4A 4JKEA 2V52B 2G8IA 2KZZA 5FPMA 3C0BA 3VEWA 4JKCA 3R8EA 4NYNA 3OYMA 3V9XA 3THWB 3HI0A 3TTDA 3M5RA 3CF5L 4LFBK 4FK2A 2UUAK 4WF9L 3BF3A 4IO8A 1LWFA 4CHZA 4Z94A 4Y0WA 3THYB 4FK4A 4ELTA 1QVGM 3NF7A 2IVNA 5KI6A 3LDNA 3KTQA 4MDAA 3K59A 1S3XA 3QEIA 1IBKK 4X66K 2GWJA 4A5AA 4BQLA 3CM5A 1ATNA 4FJHA 5EY4A 3HZ6A 4N76A 3KHYA 3SK3A 1DGKN 4MO4A 2FBYA 5AJ3K 4OPHA 3SQ4A 4KREA 4M7XA 4M3RA 2GV9A 4DCHA 4B1UB 2GEMA 2CGLA 4I2QA 3ZETA 2E2QA 2KFNA 4GV6A 3OW2M 4OX9K 1C0GA 3V9ZA 4C8LA 4DTUA 3C94A 2Q36A 3OYBA 4BRHA 1Z05A 5HRPA 2I7NA 4E7LA 4IKFA 4F2RA 2HF3A 1EXQA 2FLOA 3G4SN 1B9FA 2W40A 4CK2A 1JLQA 4DTJA 1Q82O 3CJ1A 5AZJB 4DV2K 3HBTA 4HWIA 3DLBA 2YJFA 2DFFA 3ZX0A 3SV3A 3K5MA 1SL1A 4LD0A 2OPRA 3AVIA 4H5NA 4E7JA 1RFQA 3H3NO 4FWRA 4NLBA 1VK0A 4B1XB 2XY5A 3O9UA 2FSJA 3AO4A 2Z1IA 1BOTO 5AQSA 4B1ZA 3J7AP 1VRUA 3ZT4A 5FRNA 3OVNA 1QHTA 3AO5A 4NLCA 5KQDA 3RR8A 1JLAA 5BN8A 3KD1E 3S3OA 3U8XA 2VGNA 1RGIA 3VQ7A 4DR3K 1TUUA 4JKBA 3AGRA 4YOTA 1NK8A 4G1QA 1JLFA 1QSLA 1U2VB 5J2QA 4HCBA 3VMFB 4FWLA 3TTCA 1KD1O 4FLVA 3THYA 4JI2K 3DRRA 4IFVA 1T7PA 1Z26A 3R6MA 2D1KA 4C8KA 4A59A 5JMVA 4BRCA 1T6CA 1LW0A 4DF8A 3D2EA 3M8RA 1U4BA 4DQ8A 1BQMA 5FPDA 3SI6A 1VRTA 2PBDA 4IG0A 2OPQA 2HF4A 2P9LB 3VA3A 3R3LA 4BR0A 4DV0K 1JXEA 4CF0A 2P9UA 4GV9A 4MQ3A 1E4FT 3ID6A 1RTHA 4BR4A 3ZSWA 3BY5A 3M8PA 4JI6K 3JSMA 4ZTFA 2F8TA 2A1RA 3OHRA 1L3VA 2RF2A 4B1VA 4UY8O 4BG9A 3OYCA 2QWRA 3P39A 5DM7L 2KLAA 2P9IB 4LFCK 3AA2A 1C1CA 3S41A 3FE1A 3PX4A 4IZ9A 3A5NC 2O8FB 4EZ9A 3MEGA 3QBWA 3ZSZA 4BRGA 4JI3K 3DAWA 4DV3K 4FM0A 4N41A 3LANA 3PUFA 3MN5A 4JS5A 4K0KK 3LWMA 3D6RA 1NGCA 2E5LK 1RT4A 1YAGA 1IBLK 4RW9A 3W0LA 3SQ2A 2V51B 3AGKA 3QMLA 4B9NA 5AQNA 4MLEA 1HKCA 1WN7A 1V4TA 5CHIA 4BVOA 3NH0A 1ASUA 3LPUA 1XI1A 3TAGA 1HNIA 2HMPA 3EKSA 1D4XA 1YJNN 1K8AO 2HOEA 4FCYA 4U7BA 1CZ9A 3PSIA 4PL8A 1YIJN 2GBZA 3VEXA 2UYTA 1NGIA 3SQ0A 3VESA 2JGUA 1JCFA 1TKDA 3L2RA 1U2VA 3C6TA 2IS3A 4C1NI 1IH7A 1NBWA 3VF6A 4BRPA 2O8CA 3H3OB 1C6VA 3VN5A 1VSKA 4HTUA 4JK7A 4CF2A 3NHGA 1SKRA 4FL9A 2VWJA 4B1YB 1Q8IA 3CYMA 1NGBA 3TABA 2CGJA 3ZSRA 4CIGA 4W5QA 3VEVA 4H03B 3HOSA 4DTXA 4FLZA 3PO4A 2YNIA 4IXCA 3G0ZA 4CBUA 5C10A 3MEEA 2ASOA 1SL0A 4F2SA 4CE9A 3CJ9A 4R79A 3SYZA 3SQ1A 4LH4A 4FK0A 2NUBA 5BR9A 3THXB 1BCMA 2ZQBA 4BVPA 2W6KA 5LY3A 4WQ5A 2CH6A 2NRHA 3DXMA 4LF5K 1QSSA 1CLQA 3S3NA 1OH6A 5J2PA 3H45C 2XRIA 1ZBLA 4IFYA 1WUAA 1IO2A 4YOYA 4JV5K 2G8KA 3NF9A 1T03A 4FOEA 4YOUA 2HVHA 3H46O 2HBKA 4DLGA 3BGRA 1KVAA 3OYAA 1CXUA 1BQNA 2FBVA 5GIOA 4E89A 3WEEA 1S1XA 1NGHA 2A6AA 3RSEA 2QWNA 2VG7A 3QO9A 2G8FA 3TI0A 2IAJA 1U48A 1KAZA 5C0YA 2NLXA 4DV7K 3RRHA 2E88A 2XHBA 4IWVA 1Y64A 1N32K 4LH5A 4B9SA 4PY5A 4JKGB 4GMJB 5F0XA 3OTOK 4BY9C 2E1YA 3G10A 4NB4A 2FF3B 3ALYA 1VQLN 3O1BA 1NK6A 4YOVA 3FGUA 2V7ZA 1QE1A 3VQAA 1S5JA 3WNEA 3F5TA 4CZJA 2YHYA 1WSJA 3MN7A 3HP6A 3VERA 4FJ5A 3O9QA 4JS4A 1ATRA 4BDPA 3NBPA 4BE2A 3K9JA 3IKMA 3NFAA 1HR0K 1S1WA 1WSGA 5DMRA 5KRTA 3K0SA 1BUPA 4HVJA 3BP8A 4WFNL 1UOCA 4A62A 4H0VB 1X3MA 4FXDA 3AA5X 4CJ3A 3TU5A 2P5GA 1SUQA 4FJLA 1NK9A 4GKJK 1N34K 1NKBA 5E84A 1K8KB 5AQZA 4KHSA 5AQVA 2PAVA 3GDQA 3AO2A 4DTOA 5C25A 4CHPA 3THXA 4BWJA 1RBUA 3QICA 4H0YB 1NLVA 1KTQA 1BCOA 3OY9A 4OJRA 3HT3A 2VCPA 4CECA 5FPEA 2D0BA 5LL6Z 2D4WA 3A5MC 4C8MA 2OPSA 4BDYA 3VA0A 2O8DB 2E8AA 4CZEA 4PL7A 3SCXA 2IVOA 2D0OA 3ITHA 4J2EA 4E0DA 4IOCL 3VQCA 3ZLJA 4O4GA 2BE2A 1W97L 3WXKA 2F9WA 3AVFA 3LL3A 4EZ6A 5AQUA 1EKEA 3SPYA 3CERA 4GVMA 4AF1A 4BR2A 4CGDA 3IUCA 4JKDA 1JXBA 3LP3A 4FLYA 1HYZA 3LDLA 4QS8A 4O0IA 2YHWA 2ZE2A 2NRVA 1C0TA 4DFMA 3D0PA 1WSIA 4DQSA 2IIRA 5HLFA 1KFSA 5H1SQ 1S1VA 3RVCA 4BR5A 1J5OA 4B9LA 4E1MA 1VQMN 2G8UA 4AILC 1NWKA 1C1AA 3OA9A 3ZSOA 5IWAK 4JI8K 4M7YA 1EQYA 4EHTA 2RPIA 3H08A 3BUZB 3T1HK 3VQ6A 3C6AA 4KB1A 3LM2A 4CEQA 1SS6A 5CZ1A 3V9SA 3E9LA 3VQQA 4A2AA 3J8AA 4CIEA 1RT7A 3TWHA 1BI4B 4RW4A 3IAYA 4FJ8A 4DU4A 1YJWN 1W2BM 4JKFA 3CCQN 1OH7A 4DU1A 3QINA 4HUGA 3OS0A 3TAEA 4XIUA 3A5OC 1NGFA 1HQUA 4FZXC 2GUPA 1KAXA 5GINA 4IEEA 3I33A 3CCUN 1YTAA 5GIPA 1YF5L 1QHAA 3UKRA 2F7TA 1X1PA 1TV6A 1KSPA 4PWDA 3MK6A 1VQ8N 1HYVA 2OZSA 3CQXA 4DB3A 5HL7L 1U45A 3ZT2A 2YNFA 4BREA 4FJ9A 4AM7A 3O3GA 3OJSA 2XY6A 1NMDA 4NO7A 1T8EA 1FXXA 1UWBA 1J5EK 4B3RK 5HRNA 2RKIA 1RBRA 1HMVA 4WQ4A 5AR0A 5BN9A 3MN6A 1RDCA 4H4OA 3M8QA 4WQ5C 2YJEA 1MWMA 2NRZA 4CJ7A 4IJNA 5C2DA 4DSJA 4OPJA 3AARA 3P4IA 2B4JA 1O13A 2UU9K 4OGEA 4EIAA 5JLHA 1QQOA 1A5VA 3N4QA 4BRMA 2GUIA 1UA0A 4DU3A 3MEDA 3ZETB 4M42A 1TKZA 3TANA 3LAMA 1WNSA 1E3MA 4CBXA 2PYJA 1KVCA 1GLEG 4DR7K 4ISFA 4BG8A 3LDSA 4E7HA 3QEPA 1NK5A 1RT2A 1Q81O 3F9KA 3FZHA 2PYLA 1EWQA 1SKWA 2A3ZA 1J54A 1RBSA 3BF1A 2ASPA 3U3GA 4LF4K 2HB5A 4JI5K 3IS9A 4V19S 3RR7A 4FVMA 4DMNA 2OPPA 1JKHA 4BC5A 4ILJA 1NMNA 3MN9A 4CJPA 3VF4A 3EKUA 2P5OA 3OS2A 2Y1IA 4Z4HA 3PV8A 4B3TK 1LWCA 1NGJA 5IT9O 3DOKA 1EO1A 1A5WA 2KQ2A 4F4KA 4XH4A 4KH4A 1K9MO 1JLGA 3E9OA 4CHYA 3ZSYA 4CJKA 1DLOA 1RT6A 4AHCA 3P31A 2QWLA 1CZAN 4K43A 2KW4A 1DT9A 1REVA 3D2EB 2X6SA 4CK3A 5HOOA 3LDOA 3AVGA 3F2KA 3OBYA 3O6WA 3QB0A 3UE5A 3OYDA 1N5YA 3SJHA 3BEXA 3WQTA 2UUCK 1X9SA 4DR6K 2A41A 3O08A 3VQ9A 4ELUA 3WNHA 5M1KA 4FVUA 1JL2A 1HNZK 2P9UB 4CGHA 4DQPA 5AQKA 4CD3A 3JS6A 1BO5O 4JRQA 2P9NA 4O55A 3IFRA 4IEIA 1GLJO 5ADXH 1T05A 5C24A 4CF1A 1SQKA 3PX6A 1Q86O 4ELVA 3NF6A 3AA4A 1E4GT 3EL2A 4IJAA 2OCEA 3DRSA 4BC2A 2Z1JA 1EP4A 1ASVA 3UIQA 3NDKA 3KLGA 3M8SA 1RBTA 3HO1A 1IKXA 3NGIA 5DM6L 1KVBA 2YKNA 4X62K 4CCHA 4CJ5A 1F21A 1VQ7N 4KHUA 1BISA 1K6YA 1U47A 3ZT1A 1XNQK 1BWFO 4FJ7A 3J7ZO 3PIPL 4JEPA 1NKEA 2ITMA 1L5UA 2FXUA 3ZT3A 3E1YA 4FWNA 4PKGA 4JD2A 1IG9A 2O8BA 3MECA 1BIZA 4FWMA 2KHOA 1YHQN 2I5JA 2ZJQL 1OVYA 1KFDA 1GLBG 2QXLA 5AQFA 3TAFA 4K8XA 4CZLA 5BPMA 3NGYA 2O8CB 4DSFA 4XEIA 3ZEUA 1U6ZA 3MDQA 3IG1A 4CZHA 3T1AA 3QNOA 3O80A 3V1RA 4IDKA 4CF8A 3I56N 3RMAA 3A0IX 1IBMK 3HP9A 3ENBA 1NJZA 4Q5VA 2B5JA 4DS4A 4H5WA 5C12A 2G8WA 2OZMA 1EX4A 2XY8A 3OYGA 4CGIA 5EOYA 4DHYA 3CCMN 4CBWA 3KK1A 1OH5A 4OKJA 3VEYA 3I55N 3DXMB 4OLBA 3ATUA 3EY1A 3O1WA 4CHQA 4C8OA 5GADP 1ZC6A 2A40A 2IDOA 5AFUH 3CCSN 4DSLA 3FR0A 3HVRA 2O8EB 5CYMA 2ITGA 4LF6K 4ZHRA 4BRNA 4CJSA 3MX5A 4FPBA 3G6EN 4O0JA 3KD5E 2HHWA 1WSHA 4F3TA 1VAZA 3WEEB 5CE3A 1TAUA 4DTNA 3RSEB 2LSNA 5AQQA 3QDKA 4WQ4C 3QESA 2HHXA 3UKUA 4B9TA 3GOIA 2R7YA 2HMIA 3KK2A 5CY4A 5T7BA 4KB0A 3HL8A 4FLTA 4E19A 3N4PA 3TAQA 1NGEA 1Q9XA 1ZYQA 4EP4A 2F96A 1JLEA 2YHXA 3L2QA 2QK9A 4A5BA 1Q7YO 3RWUA 3OYLA 4NXNK 1Z25A 4KTZA 4LSNA 4A61A 3CPEA 2YV0X 2KFZA 3LP0A 4AHRA 1M1KO 4C23A 1XQSC 2P9PB 1UA1A 4CVNE 4JYAK 2O4IA 2BANA 5BRHA 2FSKA 4N5SA 4MLHA 3WNGA 3VTIA 3DOLA 5AQGA 4CGGA 1VQON 3T7ZA 1X3NA 4E3SA 2ZGYA 3P5JA 5AQOA 2ZD1A 4JHDA 2HHUA 4FJGA 2I7PA 1T3VA 4B8CA
chains in the Genus database with same CATH topology
3L2VA 1X9WA 3QNNA 4CECA 2WOMA 4KKOA 2D0BA 1TK5A 4KHYA 3V4IA 4C8MA 2X6NA 1RT5A 3AVAA 2OPSA 3AVMA 5CZ2A 3ZCMA 3C95A 3OYEA 4BDYA 4BDZA 3VA0A 2FBTA 4Z0UA 4CFCA 2WONA 2QKBA 3VQEA 4Z4FA 1HPZA 4I9LA 3SCXA 4KHWA 4E1NA 3V1OA 3KLIA 3ITHA 3NH1A 3QETA 4J2EA 4K8ZA 4DSIA 4E0DA 4YNQA 4YFUA 1TK8A 3VQCA 1N6QA 4O4GA 4M3TA 1ZBHA 1BIUA 3NGZA 2BE2A 1B9DA 3AVJA 3LAKA 1JLBA 4BACA 4HCCA 3AVFA 4N47A 4EZ6A 4CJRA 2O4GA 1EKEA 5DK5A 4DG1A 1B92A 5HP1A 3SPYA 3V9UA 3QIOA 1VSEA 5K14A 4QOZB 4GVMA 3AVNA 4DTSA 4CJEA 4I9QA 1WSFA 4CGDA 3RRGA 4CEZA 1RT3A 1JXBA 1VSLA 3LP3A 4CJVA 4FLYA 1HYZA 3T3FA 2AJQA 5I3UA 1NOYA 2G8VA 4O0IA 2F8SA 2ZE2A 1S9EA 3TAMA 1C0TA 4DFMA 4DSEA 3D0PA 1YTUA 4CEFA 1VSMA 5I42A 1WSIA 4DQSA 1KCFA 1IKVA 4IG3A 4W5OA 5HLFA 1KFSA 1S1VA 2P51A 4B08A 4ID5A 1J5OA 3OJUA 1BI4A 1RDBA 4B9LA 4E1MA 1LW2A 1LV5A 4KI4A 2G8UA 4AILC 4RG8A 4M41A 4H4MA 3TARA 1C1AA 2G8IA 2KZZA 3ZSOA 5FRNA 3L3UA 3RMCA 4KRFA 3DMJA 2KZMA 4AHUA 3QIPA 2HVIA 2RPIA 2YHAA 1HJRA 3H08A 1HYSA 5JS2A 3OYMA 4NYNA 3V9XA 2HHQA 4PQUA 4OKKA 3NH2A 3SUOA 4O44A 3VQ6A 4KB1A 4FK2A 1I39A 3MXJA 4CEQA 5FDLA 5EU7A 1LWFA 4CHZA 5CZ1A 3V9SA 3BDPA 4DFKA 4FK4A 4ELTA 3VQQA 3NF7A 3DYAA 4CIEA 5KI6A 1VSFA 4BE0A 3KTQA 1RT7A 1NK0A 3K59A 3TWHA 2HNZA 3QEIA 3VQ5A 1X9MA 4AHTA 4W5RA 1BI4B 2KFNA 4FJKA 4RW4A 3IAYA 3CM5A 4FJ8A 2E6LA 3DLRA 4DU4A 5KTQA 1TKTA 1QS4A 4DU1A 3QINA 4FJHA 3WNFA 4EP5A 4HUGA 3OS0A 3I0SA 5J2NA 1EETA 3EYZA 3TAEA 4N76A 3VQDA 3KLHA 5KGXA 4XIUA 1HQUA 2VG6A 4FZXC 2D0CA 3VQBA 3DLEA 2Z1HA 4C8NA 5SWMA 2XO7A 2FC0A 4NCAA 4KV8A 2FBYA 3SUQA 2DFEA 1YTAA 3HK2A 4FJXA 1Q9YA 4CERA 3DLHA 4CK1A 3SQ4A 1VSHA 1X1PA 4KREA 2D5RA 1TV6A 4M3RA 2GV9A 1KSPA 4PWDA 4W5NA 4H8KA 1S6PA 1HYVA 4I2QA 2E4LA 2X78A 3AVLA 4NCGA 3E01A 4DLEA 3THVA 1SKSA 3K5OA 2HNYA 4B9UA 1U45A 4KTWA 3C6UA 3ZT2A 2YNFA 4KFBA 1U04A 3LWLA 3JYTA 4FJ9A 3VQPA 3O3GA 3OJSA 3V9ZA 2XY6A 2PZSA 4C8LA 4DTUA 3C94A 4E7KA 1T8EA 3OYBA 1FXXA 1YT3A 3AVBA 1UWBA 3SUNA 2A1SA 3IRXA 1NJWA 5HRNA 4J2AA 2RKIA 1RBRA 5HRPA 1HMVA 1WAFA 2BDPA 3HJFA 1ITGA 4E7LA 4FW2A 3HM9A 4IKFA 4FJNA 1RDCA 4H4OA 3M8QA 4F2RA 4FLWA 5FROA 1EXQA 1QTMA 4O5BA 1B9FA 4DWIA 4JRPA 4CK2A 4DSJA 1JLQA 3CG7A 4OPJA 3ZSQA 4DTJA 2B4JA 4OGEA 3DLBA 1IKYA 1BHLA 1W0HA 2DFFA 3SV3A 3K5MA 4KHQA 3PY8A 1A5VA 3AA3A 1SL1A 4Y1CA 4WE1A 1J9AA 1JLCA 2OPRA 3AVIA 5HBMA 4LD0A 2GUIA 4E7JA 4DU3A 1UA0A 1VK0A 3MEDA 3I8DA 2XY5A 4RW7A 1RBVA 4DFJA 1LAWA 4DQIA 4M42A 3AO4A 1TKZA 2Z1IA 1D5AA 1A5XA 1VRUA 4IBNA 4CJWA 4HUFA 3ZT4A 3TANA 2HHVA 2D0AA 1DTQA 3LAMA 2YNHA 4Z4CA 3L2UA 1WNSA 1QHTA 3AO5A 1I3AA 3OVNA 3NCIA 1GOCA 4FJJA 3VQ4A 3RR8A 1JLAA 2PYJA 1ZBFA 3KD1E 1KVCA 3P1GA 1GOBA 5CYQA 4M45A 3S3OA 4FZZA 3K5LA 3LDSA 3HPGA 2P1JA 2IGIA 4OLAA 1SV5A 4E7HA 4CESA 3L2WA 3QEPA 1RT2A 1NK5A 3VQ7A 3QEVA 4LY7A 4DF4A 4GW6A 1RDDA 1NK8A 4PUOA 2ATQA 4J2DA 5FRMA 3F9KA 3NF8A 3VQ8A 4FW1A 4G1QA 1JLFA 3ZT0A 1L3TA 3O3HA 3LP2A 5J2QA 4AH9A 4N56A 1NK7A 1QSLA 2PYLA 4HCBA 4ICLA 5C42A 1SKWA 4CEDA 3DM2A 3EZ5A 1NKCA 1CXQA 1J54A 3AO1A 3MAQA 1RBSA 4FLVA 1C0MA 4I7FA 3U3GA 3QEXA 2HB5A 3DRRA 3IS9A 4CHOA 4IFVA 3RR7A 1T7PA 1Z26A 4FVMA 1C1BA 4DMNA 2OPPA 4CJUA 1JKHA 3OS1A 1L3SA 1L3UA 4C8KA 4FZYA 4BWMA 4B9VA 1LW0A 4DF8A 3M8RA 1HQEA 3HVTA 3TR8A 1U4BA 2DFHA 1BQMA 1C0UA 4CJPA 3SI6A 4OGCA 1ZBIA 5D3GA 1VRTA 2ETJA 1HRHA 1RDAA 4IG0A 2P5OA 3OS2A 2OPQA 3MXIA 2E6MA 3CQ8A 2Y1IA 3VA3A 3S3MA 4Z4HA 3PV8A 5JS1A 1LWCA 1WSEA 3DOKA 3KK3A 1JXEA 1NOZA 4CF0A 3CFPA 3LALA 1SL2A 1TVRA 2HHSA 4M3XA 4MQ3A 1VSDA 4OPKA 1A5WA 1BL3A 2KQ2A 4HHTA 4ZTJA 3HPHA 4F4KA 1RTHA 4TSXA 1JLGA 3ZSWA 3M8PA 4CHYA 1CZBA 1G15A 1DLOA 1RT6A 3ZSYA 4CJKA 3QEWA 5HROA 3O4QA 4AHCA 3JSMA 3K5NA 3QLHA 4ZTFA 2A1RA 2RF2A 5HRRA 1L3VA 3B6OA 3OYCA 2KW4A 1RTJA 1REVA 4KPYA 2X6SA 4QAGA 1TGOA 3ZSVA 4CK3A 3CFRA 3DI6A 1NJXA 3AA2A 1C1CA 3AVGA 1MU2A 3OYDA 4CEBA 3PX4A 1N5YA 1TKXA 3TAPA 4EZ9A 3MEGA 3SV4A 2OYQA 3ZSZA 3OYHA 3L8BA 1X9SA 1S9GA 3VQ9A 4ELUA 3WNHA 4Z4EA 3DLGA 3O4NA 1JL2A 1DTTA 4FM0A 4CGHA 4N41A 2KTQA 3LANA 3PUFA 4DQPA 4J2BA 1RILA 4JS5A 4E7IA 1W9HA 3LWMA 3LZIA 4B8AB 1RT4A 1FKOA 4ID1A 4RW6A 3HXMA 3S9HA 3DLKA 3K2PA 4RW9A 4JRQA 3SQ2A 1QSYA 4O55A 2DY4A 4B9NA 3ASMA 1T05A 2YNGA 2XY7A 4BE1A 1U49A 2HW3A 1WN7A 5C24A 3MXMA 4CF1A 4M3WA 4B3OA 3SZ2A 4I2PA 3PX6A 3NH0A 2YKMA 1ASUA 3LPUA 1RNHA 3D45A 1RTDA 1XI1A 3TAGA 1HNIA 4ELVA 3NF6A 1NK4A 3AA4A 2RN2A 5KGWA 3AV9A 1ASWA 3DRSA 3OYIA 2Z1JA 4FCYA 1EP4A 1ASVA 1CZ9A 3HPOA 2YHBA 3T19A 3UIQA 4FJMA 1XWLA 1QQCA 3NDKA 1ZBUA 5HRSA 2GBZA 3F73A 4CIFA 2Q3SA 3SQ0A 2JGUA 1NJYA 3KLGA 4HUEA 2B6AA 3M8SA 3RMDA 1D9FA 1RBTA 2Y1JA 5E41A 2FBXA 1TKDA 1IKXA 3L2RA 1RT1A 3NGIA 2F8TA 3HO1A 2PY5A 1WAJA 2IS3A 1KVBA 3C6TA 2YKNA 4FM2A 1IH7A 4FLXA 4CJ5A 4CCHA 4CEEA 1F21A 1XHZA 4KHUA 1BISA 1K6YA 1U47A 3ZT1A 4CEAA 3FFIA 4FJ7A 1C6VA 3VN5A 1VSKA 2W42A 3RTVA 2X74A 4HTUA 1NKEA 4OKEA 4CF2A 4UQGA 1L5UA 3NHGA 4M3UA 3ZT3A 1SKRA 3LP1A 2VWJA 3K57A 1Q8IA 1TL3A 3CYMA 3TABA 3ZSRA 4CIGA 4W5QA 1IG9A 1Y97A 3MECA 1BIZA 4CHNA 2I5JA 4AHVA 4DTXA 1KFDA 4FLZA 3PO4A 2OZSA 2YNIA 1XHXA 3G0ZA 4DFPA 1TK0A 3HYFA 4Z4GA 2EHGA 3MEEA 4DTRA 3SNNA 2G8HA 1SL0A 4F2SA 4CE9A 3SYZA 4KTQA 3L3VA 4KO0A 3OYNA 4NYFA 3SQ1A 4LH4A 4FK0A 2NUBA 4CGFA 3TAFA 4K8XA 2OA8A 1BCMA 2ZQBA 3KIOA 1CLQA 3NGYA 4DSFA 1QSSA 4DQQA 1IKWA 3SUPA 3KLEA 4F8RA 4FJIA 3S3NA 2IC3A 3SJJA 5J2PA 2HNDA 2XRIA 4R5PA 4IFYA 3AVCA 3OYFA 1IO2A 3V81A 1ZBLA 4Q0BA 3HSTB 2G8KA 3IG1A 3NF9A 3T1AA 1T03A 1FKPA 3V1RA 3QNOA 4IDKA 4CFBA 2HVHA 3A2FA 4CF8A 4KAZA 4JLHA 3RMAA 1LAVA 3HP9A 4CGJA 1NJZA 4Q5VA 4DLGA 3BGRA 1KVAA 2B5JA 4CJQA 4DS4A 3CFOA 1CXUA 3OYAA 2G8WA 2OZMA 3ULDA 1BQNA 1EX4A 2FBVA 2XY8A 3CM6A 4RW8A 3V1QA 5J2MA 4E89A 4OVLA 4CGIA 1S1XA 3OYGA 4FYDA 1GOAA 2VG7A 3QO9A 2G8FA 3KK1A 4MFBA 3KLFA 3TI0A 2IAJA 1U48A 4LSLA 3ZSXA 3KJVA 1S1TA 4DSKA 3NE6A 2JLEA 1JL1A 4OKJA 4AHSA 3V9WA 4OLBA 2DTUA 3EY1A 4DQRA 4CHQA 4C8OA 3RRHA 5SZTA 2XHBA 2IDOA 4LH5A 4CEOA 3AVKA 3O3FA 4B9SA 4PY5A 4GMJB 4Z4IA 4DSLA 3HVRA 4KHNA 5CYMA 2ITGA 3G10A 1YVUA 1UAXA 3ALYA 4ZHRA 3QERA 4QCLA 2EX3A 4CJSA 1NK6A 1R0AA 4O0JA 3KD5E 2HHWA 1WSHA 4M3ZA 1QE1A 3VQAA 4B9MA 1S5JA 3WNEA 3U3YA 4L8RB 4Y1DA 3OYJA 4F3TA 1TAUA 4DTNA 3PO5A 2QXFA 2LSNA 1KRPA 4CF9A 1WSJA 3DRPA 3HP6A 1VSJA 3RMBA 4FJ5A 4JS4A 2QKKA 3QESA 3NAEA 4BDPA 2HHXA 4B9TA 2R7YA 2HMIA 3NBPA 4BE2A 3KK2A 5CY4A 3NFAA 1S1WA 1WSGA 5DMRA 5KRTA 2Z1GA 3HL8A 5T7BA 4HVJA 3U6FA 4FLTA 3V6DA 4KB0A 1S6QA 4E19A 4CFDA 4PA1A 1KLMA 3TAQA 1RCHA 5KRSA 1Q9XA 1ZYQA 1TAQA 4EP4A 2F96A 1JLEA 1UOCA 3P83D 3AO3A 4CJ4A 3L2QA 4DTPA 2BGGA 2QK9A 4CJLA 3RWUA 3OYLA 1D9DA 4FXDA 1Z25A 2VG5A 4KTZA 3AA5X 4CJ3A 3KKRA 4LSNA 4CFAA 4CJTA 1RTIA 3SPZA 1XC9A 1VSIA 1KLNA 1SUQA 2YV0X 4FM1A 1NK9A 2P5GA 3PX0A 3OYKA 4FJLA 1NKBA 2KFZA 4F3OA 3LP0A 4AHRA 4KI6A 1HNVA 4KHSA 4M3YA 1S1UA 3I0RA 2IOCA 3ISNC 2HHTA 4DS5A 4NCBA 1UA1A 1J53A 5J1EA 3LPTA 3AO2A 1WLJA 4DTOA 2O4IA 1FK9A 2BANA 1LWEA 1D8YA 5C25A 4N5SA 1O1WA 4W5TA 3WNGA 4CHPA 3LZJA 3DOLA 4CGGA 4FLUA 3AVHA 1RBUA 4BWJA 4E3SA 4DTMA 3B6PA 3KKSA 3P5JA 2ZD1A 2VWKA 4CJFA 2HHUA 1KTQA 4FJGA 1BCOA 1BGXT 3OY9A 4OJRA 3HT3A 4B8CA 1TL1A 3K58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  1X9W A;  3QNN A;  4CEC A;  2WOM A;  4KKO A;  2D0B A;  1TK5 A;  4KHY A;  3V4I A;  4C8M A;  2X6N A;  1RT5 A;  3AVA A;  2OPS A;  3AVM A;  5CZ2 A;  3ZCM A;  3C95 A;  3OYE A;  4BDY A;  4BDZ A;  3VA0 A;  2FBT A;  4Z0U A;  4CFC A;  2WON A;  2QKB A;  3VQE A;  4Z4F A;  1HPZ A;  4I9L A;  3SCX A;  4KHW A;  4E1N A;  3V1O A;  3KLI A;  3ITH A;  3NH1 A;  3QET A;  4J2E A;  4K8Z A;  4DSI A;  4E0D A;  4YNQ A;  4YFU A;  1TK8 A;  3VQC A;  1N6Q A;  4O4G A;  4M3T A;  1ZBH A;  1BIU A;  3NGZ A;  2BE2 A;  1B9D A;  3AVJ A;  3LAK A;  1JLB A;  4BAC A;  4HCC A;  3AVF A;  4N47 A;  4EZ6 A;  4CJR A;  2O4G A;  1EKE A;  5DK5 A;  4DG1 A;  1B92 A;  5HP1 A;  3SPY A;  3V9U A;  3QIO A;  1VSE A;  5K14 A;  4QOZ B;  4GVM A;  3AVN A;  4DTS A;  4CJE A;  4I9Q A;  1WSF A;  4CGD A;  3RRG A;  4CEZ A;  1RT3 A;  1JXB A;  1VSL A;  3LP3 A;  4CJV A;  4FLY A;  1HYZ A;  3T3F A;  2AJQ A;  5I3U A;  1NOY A;  2G8V A;  4O0I A;  2F8S A;  2ZE2 A;  1S9E A;  3TAM A;  1C0T A;  4DFM A;  4DSE A;  3D0P A;  1YTU A;  4CEF A;  1VSM A;  5I42 A;  1WSI A;  4DQS A;  1KCF A;  1IKV A;  4IG3 A;  4W5O A;  5HLF A;  1KFS A;  1S1V A;  2P51 A;  4B08 A;  4ID5 A;  1J5O A;  3OJU A;  1BI4 A;  1RDB A;  4B9L A;  4E1M A;  1LW2 A;  1LV5 A;  4KI4 A;  2G8U A;  4AIL C;  4RG8 A;  4M41 A;  4H4M A;  3TAR A;  1C1A A;  2G8I A;  2KZZ A;  3ZSO A;  5FRN A;  3L3U A;  3RMC A;  4KRF A;  3DMJ A;  2KZM A;  4AHU A;  3QIP A;  2HVI A;  2RPI A;  2YHA A;  1HJR A;  3H08 A;  1HYS A;  5JS2 A;  3OYM A;  4NYN A;  3V9X A;  2HHQ A;  4PQU A;  4OKK A;  3NH2 A;  3SUO A;  4O44 A;  3VQ6 A;  4KB1 A;  4FK2 A;  1I39 A;  3MXJ A;  4CEQ A;  5FDL A;  5EU7 A;  1LWF A;  4CHZ A;  5CZ1 A;  3V9S A;  3BDP A;  4DFK A;  4FK4 A;  4ELT A;  3VQQ A;  3NF7 A;  3DYA A;  4CIE A;  5KI6 A;  1VSF A;  4BE0 A;  3KTQ A;  1RT7 A;  1NK0 A;  3K59 A;  3TWH A;  2HNZ A;  3QEI A;  3VQ5 A;  1X9M A;  4AHT A;  4W5R A;  1BI4 B;  2KFN A;  4FJK A;  4RW4 A;  3IAY A;  3CM5 A;  4FJ8 A;  2E6L A;  3DLR A;  4DU4 A;  5KTQ A;  1TKT A;  1QS4 A;  4DU1 A;  3QIN A;  4FJH A;  3WNF A;  4EP5 A;  4HUG A;  3OS0 A;  3I0S A;  5J2N A;  1EET A;  3EYZ A;  3TAE A;  4N76 A;  3VQD A;  3KLH A;  5KGX A;  4XIU A;  1HQU A;  2VG6 A;  4FZX C;  2D0C A;  3VQB A;  3DLE A;  2Z1H A;  4C8N A;  5SWM A;  2XO7 A;  2FC0 A;  4NCA A;  4KV8 A;  2FBY A;  3SUQ A;  2DFE A;  1YTA A;  3HK2 A;  4FJX A;  1Q9Y A;  4CER A;  3DLH A;  4CK1 A;  3SQ4 A;  1VSH A;  1X1P A;  4KRE A;  2D5R A;  1TV6 A;  4M3R A;  2GV9 A;  1KSP A;  4PWD A;  4W5N A;  4H8K A;  1S6P A;  1HYV A;  4I2Q A;  2E4L A;  2X78 A;  3AVL A;  4NCG A;  3E01 A;  4DLE A;  3THV A;  1SKS A;  3K5O A;  2HNY A;  4B9U A;  1U45 A;  4KTW A;  3C6U A;  3ZT2 A;  2YNF A;  4KFB A;  1U04 A;  3LWL A;  3JYT A;  4FJ9 A;  3VQP A;  3O3G A;  3OJS A;  3V9Z A;  2XY6 A;  2PZS A;  4C8L A;  4DTU A;  3C94 A;  4E7K A;  1T8E A;  3OYB A;  1FXX A;  1YT3 A;  3AVB A;  1UWB A;  3SUN A;  2A1S A;  3IRX A;  1NJW A;  5HRN A;  4J2A A;  2RKI A;  1RBR A;  5HRP A;  1HMV A;  1WAF A;  2BDP A;  3HJF A;  1ITG A;  4E7L A;  4FW2 A;  3HM9 A;  4IKF A;  4FJN A;  1RDC A;  4H4O A;  3M8Q A;  4F2R A;  4FLW A;  5FRO A;  1EXQ A;  1QTM A;  4O5B A;  1B9F A;  4DWI A;  4JRP A;  4CK2 A;  4DSJ A;  1JLQ A;  3CG7 A;  4OPJ A;  3ZSQ A;  4DTJ A;  2B4J A;  4OGE A;  3DLB A;  1IKY A;  1BHL A;  1W0H A;  2DFF A;  3SV3 A;  3K5M A;  4KHQ A;  3PY8 A;  1A5V A;  3AA3 A;  1SL1 A;  4Y1C A;  4WE1 A;  1J9A A;  1JLC A;  2OPR A;  3AVI A;  5HBM A;  4LD0 A;  2GUI A;  4E7J A;  4DU3 A;  1UA0 A;  1VK0 A;  3MED A;  3I8D A;  2XY5 A;  4RW7 A;  1RBV A;  4DFJ A;  1LAW A;  4DQI A;  4M42 A;  3AO4 A;  1TKZ A;  2Z1I A;  1D5A A;  1A5X A;  1VRU A;  4IBN A;  4CJW A;  4HUF A;  3ZT4 A;  3TAN A;  2HHV A;  2D0A A;  1DTQ A;  3LAM A;  2YNH A;  4Z4C A;  3L2U A;  1WNS A;  1QHT A;  3AO5 A;  1I3A A;  3OVN A;  3NCI A;  1GOC A;  4FJJ A;  3VQ4 A;  3RR8 A;  1JLA A;  2PYJ A;  1ZBF A;  3KD1 E;  1KVC A;  3P1G A;  1GOB A;  5CYQ A;  4M45 A;  3S3O A;  4FZZ A;  3K5L A;  3LDS A;  3HPG A;  2P1J A;  2IGI A;  4OLA A;  1SV5 A;  4E7H A;  4CES A;  3L2W A;  3QEP A;  1RT2 A;  1NK5 A;  3VQ7 A;  3QEV A;  4LY7 A;  4DF4 A;  4GW6 A;  1RDD A;  1NK8 A;  4PUO A;  2ATQ A;  4J2D A;  5FRM A;  3F9K A;  3NF8 A;  3VQ8 A;  4FW1 A;  4G1Q A;  1JLF A;  3ZT0 A;  1L3T A;  3O3H A;  3LP2 A;  5J2Q A;  4AH9 A;  4N56 A;  1NK7 A;  1QSL A;  2PYL A;  4HCB A;  4ICL A;  5C42 A;  1SKW A;  4CED A;  3DM2 A;  3EZ5 A;  1NKC A;  1CXQ A;  1J54 A;  3AO1 A;  3MAQ A;  1RBS A;  4FLV A;  1C0M A;  4I7F A;  3U3G A;  3QEX A;  2HB5 A;  3DRR A;  3IS9 A;  4CHO A;  4IFV A;  3RR7 A;  1T7P A;  1Z26 A;  4FVM A;  1C1B A;  4DMN A;  2OPP A;  4CJU A;  1JKH A;  3OS1 A;  1L3S A;  1L3U A;  4C8K A;  4FZY A;  4BWM A;  4B9V A;  1LW0 A;  4DF8 A;  3M8R A;  1HQE A;  3HVT A;  3TR8 A;  1U4B A;  2DFH A;  1BQM A;  1C0U A;  4CJP A;  3SI6 A;  4OGC A;  1ZBI A;  5D3G A;  1VRT A;  2ETJ A;  1HRH A;  1RDA A;  4IG0 A;  2P5O A;  3OS2 A;  2OPQ A;  3MXI A;  2E6M A;  3CQ8 A;  2Y1I A;  3VA3 A;  3S3M A;  4Z4H A;  3PV8 A;  5JS1 A;  1LWC A;  1WSE A;  3DOK A;  3KK3 A;  1JXE A;  1NOZ A;  4CF0 A;  3CFP A;  3LAL A;  1SL2 A;  1TVR A;  2HHS A;  4M3X A;  4MQ3 A;  1VSD A;  4OPK A;  1A5W A;  1BL3 A;  2KQ2 A;  4HHT A;  4ZTJ A;  3HPH A;  4F4K A;  1RTH A;  4TSX A;  1JLG A;  3ZSW A;  3M8P A;  4CHY A;  1CZB A;  1G15 A;  1DLO A;  1RT6 A;  3ZSY A;  4CJK A;  3QEW A;  5HRO A;  3O4Q A;  4AHC A;  3JSM A;  3K5N A;  3QLH A;  4ZTF A;  2A1R A;  2RF2 A;  5HRR A;  1L3V A;  3B6O A;  3OYC A;  2KW4 A;  1RTJ A;  1REV A;  4KPY A;  2X6S A;  4QAG A;  1TGO A;  3ZSV A;  4CK3 A;  3CFR A;  3DI6 A;  1NJX A;  3AA2 A;  1C1C A;  3AVG A;  1MU2 A;  3OYD A;  4CEB A;  3PX4 A;  1N5Y A;  1TKX A;  3TAP A;  4EZ9 A;  3MEG A;  3SV4 A;  2OYQ A;  3ZSZ A;  3OYH A;  3L8B A;  1X9S A;  1S9G A;  3VQ9 A;  4ELU A;  3WNH A;  4Z4E A;  3DLG A;  3O4N A;  1JL2 A;  1DTT A;  4FM0 A;  4CGH A;  4N41 A;  2KTQ A;  3LAN A;  3PUF A;  4DQP A;  4J2B A;  1RIL A;  4JS5 A;  4E7I A;  1W9H A;  3LWM A;  3LZI A;  4B8A B;  1RT4 A;  1FKO A;  4ID1 A;  4RW6 A;  3HXM A;  3S9H A;  3DLK A;  3K2P A;  4RW9 A;  4JRQ A;  3SQ2 A;  1QSY A;  4O55 A;  2DY4 A;  4B9N A;  3ASM A;  1T05 A;  2YNG A;  2XY7 A;  4BE1 A;  1U49 A;  2HW3 A;  1WN7 A;  5C24 A;  3MXM A;  4CF1 A;  4M3W A;  4B3O A;  3SZ2 A;  4I2P A;  3PX6 A;  3NH0 A;  2YKM A;  1ASU A;  3LPU A;  1RNH A;  3D45 A;  1RTD A;  1XI1 A;  3TAG A;  1HNI A;  4ELV A;  3NF6 A;  1NK4 A;  3AA4 A;  2RN2 A;  5KGW A;  3AV9 A;  1ASW A;  3DRS A;  3OYI A;  2Z1J A;  4FCY A;  1EP4 A;  1ASV A;  1CZ9 A;  3HPO A;  2YHB A;  3T19 A;  3UIQ A;  4FJM A;  1XWL A;  1QQC A;  3NDK A;  1ZBU A;  5HRS A;  2GBZ A;  3F73 A;  4CIF A;  2Q3S A;  3SQ0 A;  2JGU A;  1NJY A;  3KLG A;  4HUE A;  2B6A A;  3M8S A;  3RMD A;  1D9F A;  1RBT A;  2Y1J A;  5E41 A;  2FBX A;  1TKD A;  1IKX A;  3L2R A;  1RT1 A;  3NGI A;  2F8T A;  3HO1 A;  2PY5 A;  1WAJ A;  2IS3 A;  1KVB A;  3C6T A;  2YKN A;  4FM2 A;  1IH7 A;  4FLX A;  4CJ5 A;  4CCH A;  4CEE A;  1F21 A;  1XHZ A;  4KHU A;  1BIS A;  1K6Y A;  1U47 A;  3ZT1 A;  4CEA A;  3FFI A;  4FJ7 A;  1C6V A;  3VN5 A;  1VSK A;  2W42 A;  3RTV A;  2X74 A;  4HTU A;  1NKE A;  4OKE A;  4CF2 A;  4UQG A;  1L5U A;  3NHG A;  4M3U A;  3ZT3 A;  1SKR A;  3LP1 A;  2VWJ A;  3K57 A;  1Q8I A;  1TL3 A;  3CYM A;  3TAB A;  3ZSR A;  4CIG A;  4W5Q A;  1IG9 A;  1Y97 A;  3MEC A;  1BIZ A;  4CHN A;  2I5J A;  4AHV A;  4DTX A;  1KFD A;  4FLZ A;  3PO4 A;  2OZS A;  2YNI A;  1XHX A;  3G0Z A;  4DFP A;  1TK0 A;  3HYF A;  4Z4G A;  2EHG A;  3MEE A;  4DTR A;  3SNN A;  2G8H A;  1SL0 A;  4F2S A;  4CE9 A;  3SYZ A;  4KTQ A;  3L3V A;  4KO0 A;  3OYN A;  4NYF A;  3SQ1 A;  4LH4 A;  4FK0 A;  2NUB A;  4CGF A;  3TAF A;  4K8X A;  2OA8 A;  1BCM A;  2ZQB A;  3KIO A;  1CLQ A;  3NGY A;  4DSF A;  1QSS A;  4DQQ A;  1IKW A;  3SUP A;  3KLE A;  4F8R A;  4FJI A;  3S3N A;  2IC3 A;  3SJJ A;  5J2P A;  2HND A;  2XRI A;  4R5P A;  4IFY A;  3AVC A;  3OYF A;  1IO2 A;  3V81 A;  1ZBL A;  4Q0B A;  3HST B;  2G8K A;  3IG1 A;  3NF9 A;  3T1A A;  1T03 A;  1FKP A;  3V1R A;  3QNO A;  4IDK A;  4CFB A;  2HVH A;  3A2F A;  4CF8 A;  4KAZ A;  4JLH A;  3RMA A;  1LAV A;  3HP9 A;  4CGJ A;  1NJZ A;  4Q5V A;  4DLG A;  3BGR A;  1KVA A;  2B5J A;  4CJQ A;  4DS4 A;  3CFO A;  1CXU A;  3OYA A;  2G8W A;  2OZM A;  3ULD A;  1BQN A;  1EX4 A;  2FBV A;  2XY8 A;  3CM6 A;  4RW8 A;  3V1Q A;  5J2M A;  4E89 A;  4OVL A;  4CGI A;  1S1X A;  3OYG A;  4FYD A;  1GOA A;  2VG7 A;  3QO9 A;  2G8F A;  3KK1 A;  4MFB A;  3KLF A;  3TI0 A;  2IAJ A;  1U48 A;  4LSL A;  3ZSX A;  3KJV A;  1S1T A;  4DSK A;  3NE6 A;  2JLE A;  1JL1 A;  4OKJ A;  4AHS A;  3V9W A;  4OLB A;  2DTU A;  3EY1 A;  4DQR A;  4CHQ A;  4C8O A;  3RRH A;  5SZT A;  2XHB A;  2IDO A;  4LH5 A;  4CEO A;  3AVK A;  3O3F A;  4B9S A;  4PY5 A;  4GMJ B;  4Z4I A;  4DSL A;  3HVR A;  4KHN A;  5CYM A;  2ITG A;  3G10 A;  1YVU A;  1UAX A;  3ALY A;  4ZHR A;  3QER A;  4QCL A;  2EX3 A;  4CJS A;  1NK6 A;  1R0A A;  4O0J A;  3KD5 E;  2HHW A;  1WSH A;  4M3Z A;  1QE1 A;  3VQA A;  4B9M A;  1S5J A;  3WNE A;  3U3Y A;  4L8R B;  4Y1D A;  3OYJ A;  4F3T A;  1TAU A;  4DTN A;  3PO5 A;  2QXF A;  2LSN A;  1KRP A;  4CF9 A;  1WSJ A;  3DRP A;  3HP6 A;  1VSJ A;  3RMB A;  4FJ5 A;  4JS4 A;  2QKK A;  3QES A;  3NAE A;  4BDP A;  2HHX A;  4B9T A;  2R7Y A;  2HMI A;  3NBP A;  4BE2 A;  3KK2 A;  5CY4 A;  3NFA A;  1S1W A;  1WSG A;  5DMR A;  5KRT A;  2Z1G A;  3HL8 A;  5T7B A;  4HVJ A;  3U6F A;  4FLT A;  3V6D A;  4KB0 A;  1S6Q A;  4E19 A;  4CFD A;  4PA1 A;  1KLM A;  3TAQ A;  1RCH A;  5KRS A;  1Q9X A;  1ZYQ A;  1TAQ A;  4EP4 A;  2F96 A;  1JLE A;  1UOC A;  3P83 D;  3AO3 A;  4CJ4 A;  3L2Q A;  4DTP A;  2BGG A;  2QK9 A;  4CJL A;  3RWU A;  3OYL A;  1D9D A;  4FXD A;  1Z25 A;  2VG5 A;  4KTZ A;  3AA5 X;  4CJ3 A;  3KKR A;  4LSN A;  4CFA A;  4CJT A;  1RTI A;  3SPZ A;  1XC9 A;  1VSI A;  1KLN A;  1SUQ A;  2YV0 X;  4FM1 A;  1NK9 A;  2P5G A;  3PX0 A;  3OYK A;  4FJL A;  1NKB A;  2KFZ A;  4F3O A;  3LP0 A;  4AHR A;  4KI6 A;  1HNV A;  4KHS A;  4M3Y A;  1S1U A;  3I0R A;  2IOC A;  3ISN C;  2HHT A;  4DS5 A;  4NCB A;  1UA1 A;  1J53 A;  5J1E A;  3LPT A;  3AO2 A;  1WLJ A;  4DTO A;  2O4I A;  1FK9 A;  2BAN A;  1LWE A;  1D8Y A;  5C25 A;  4N5S A;  1O1W A;  4W5T A;  3WNG A;  4CHP A;  3LZJ A;  3DOL A;  4CGG A;  4FLU A;  3AVH A;  1RBU A;  4BWJ A;  4E3S A;  4DTM A;  3B6P A;  3KKS A;  3P5J A;  2ZD1 A;  2VWK A;  4CJF A;  2HHU A;  1KTQ A;  4FJG A;  1BCO A;  1BGX T;  3OY9 A;  4OJR A;  3HT3 A;  4B8C A;  1TL1 A;  3K58 A; 
#chains in the Genus database with same CATH topology
 4H0T B;  3QNN A;  4KKO A;  2HBJ A;  4LF9 K;  2X6N A;  1RT5 A;  3AVM A;  4A57 A;  5B8H A;  1JCG A;  3SNN A;  4DUY K;  2QA4 N;  2WON A;  3VQE A;  1HPZ A;  3KWI A;  4JAX A;  2HBM A;  4H0X B;  3DWL A;  4YNQ A;  4YFU A;  1TK8 A;  1N6Q A;  1ZBH A;  1BIU A;  3CI5 A;  3C6H A;  3WXL A;  2CGK A;  4ISG A;  3NGZ A;  1B9D A;  3CJ7 A;  3AVJ A;  2GX9 A;  1JLB A;  3LAK A;  4BAC A;  4HCC A;  5AQP A;  2O4G A;  2O8E A;  4DG1 A;  1B92 A;  3CJC A;  5TKY A;  2UUB K;  1QZ5 A;  1HLU A;  2F9T A;  3QIO A;  5FLX O;  5K14 A;  4EFH A;  1H1V A;  4DTS A;  2JWL A;  4YOW A;  4L3Q A;  4CEZ A;  1RT3 A;  1YUW A;  1VSL A;  2VWB A;  4CJV A;  3JAM O;  1XNR K;  2ZGZ A;  3FZM A;  3TAM A;  1GLF O;  4DSE A;  1YTU A;  1MWK A;  3SMP A;  1KCF A;  4BR9 A;  4ID5 A;  1FJG K;  3OJU A;  2P9K A;  1VQP N;  1LW2 A;  4RG8 A;  2HHH K;  3VTH A;  5FPN A;  3L3U A;  4AHU A;  2HVI A;  1HJR A;  1HYS A;  2GEL A;  4OKK A;  1ATS A;  1I39 A;  3MXJ A;  5LMU K;  5FDL A;  3HM8 A;  5EU7 A;  3BDP A;  4BQZ A;  5M1P A;  3MWT A;  2P9P A;  1NK0 A;  2HNZ A;  1N33 K;  3VQ5 A;  4IOA L;  1VHX A;  4CD1 A;  2E6L A;  3DLR A;  2VYP A;  1S72 N;  3WNF A;  1BDG A;  5J2N A;  1WBD A;  5KGX A;  4DV1 K;  2VG6 A;  2D0C A;  3D7E O;  3DLE A;  2Z1H A;  3C65 A;  3KZB A;  4NCA A;  4KV8 A;  3SUQ A;  2DFE A;  2OTJ N;  3DLH A;  2RE2 A;  4CI6 A;  4W5N A;  2QTD A;  5TKW A;  1NU0 A;  2E4L A;  5AQJ A;  2X78 A;  3AVL A;  4NCG A;  4DLE A;  3THV A;  4B9U A;  4KTW A;  1X9J A;  3C6U A;  1U04 A;  3LWL A;  1BA0 A;  3VQP A;  2PZS A;  3L4Q A;  2H3G X;  1YT3 A;  4BRQ A;  3SUN A;  5AQW A;  2A1S A;  3IRX A;  1NJW A;  3HM9 A;  4FLW A;  1QTM A;  4JRP A;  2WBN A;  4BGB A;  3ZSQ A;  1IKY A;  1BHL A;  1W0H A;  3UKR B;  4KHQ A;  3PY8 A;  1RDW X;  1NGG A;  3F9M A;  3B8A X;  4Y1C A;  5KQ8 A;  1J9A A;  1JLC A;  4M3W A;  1LAW A;  3WQU A;  3SBG A;  1GLC G;  4IBN A;  1A5X A;  4CJW A;  4DV6 K;  4HUF A;  3L2U A;  4Z4C A;  3NCI A;  1I3A A;  4FJJ A;  3LDP A;  4LF8 K;  1ZBF A;  1OH8 A;  3P1G A;  1GOB A;  5CYQ A;  2HBL A;  4BRF A;  3HPG A;  2P1J A;  4OLA A;  1BA1 A;  1SV5 A;  5KPR A;  2NRW A;  4LY7 A;  4CZK A;  4PUO A;  5FRM A;  1G99 A;  3VQ8 A;  4KHP K;  4FW1 A;  4M3T A;  3ZT0 A;  1L3T A;  3LP2 A;  4AH9 A;  4N56 A;  1XMQ K;  4ICL A;  3JXU A;  4CED A;  3DM2 A;  3EZ5 A;  1NKC A;  3AO1 A;  3MAQ A;  3HSC A;  1C0M A;  3L0Q A;  4I7F A;  4BRI A;  1C1B A;  3VEN A;  4CJU A;  1L3S A;  4BWM A;  4GVE A;  1HQE A;  3HVT A;  3TR8 A;  3SAF A;  4DR1 K;  2DFH A;  2P9S A;  5CR4 A;  2NNW A;  1ZBI A;  5D3G A;  1P90 A;  2ETJ A;  1RDA A;  4H0O A;  5AQY A;  1YVN A;  3ZX2 A;  3CQ8 A;  3S3M A;  5JS1 A;  1NOZ A;  1HNW K;  3LAL A;  1SL2 A;  4C1N K;  5KPT A;  4YHH K;  2ZF5 O;  1BL3 A;  4HHT A;  4IDH A;  1CZB A;  5HRO A;  3NVM A;  2BTF A;  3O4Q A;  5HRR A;  4FPA A;  3B6O A;  4B3S K;  4CW7 B;  3G71 N;  4QS7 A;  1TGO A;  3ZSV A;  3CFR A;  3VPZ A;  3DI6 A;  1NJX A;  4IOX A;  4GKK K;  1TKX A;  1W7A A;  3SV4 A;  3T1Y K;  2OYQ A;  3OYH A;  3L8B A;  1S9G A;  2ZJP L;  1DTT A;  2KTQ A;  4BRO A;  1RIL A;  4E7I A;  1K73 O;  5AQT A;  1W9H A;  4DV5 K;  3S9H A;  4BRL A;  3LDQ A;  4EAH D;  1QSY A;  2DY4 A;  4YY3 K;  2XY7 A;  4QS9 A;  4BE1 A;  4OPA A;  1VQ5 N;  2RHK A;  3MXM A;  4B3O A;  3SZ2 A;  3CC2 N;  1IJJ A;  2WC9 A;  2PFU A;  4I2P A;  1RTD A;  3E66 A;  2RN2 A;  1TYQ A;  3AV9 A;  2D0P A;  4CZI A;  1NM1 A;  1NGA A;  1FW6 A;  1XWL A;  5LJV A;  3F73 A;  4CIF A;  1NJY A;  4AM6 A;  2V7Y A;  4HUE A;  3RMD A;  1D9F A;  2Y1J A;  5E41 A;  1RT1 A;  1XUP O;  2YX6 A;  3CJB A;  1QZ6 A;  3L4I A;  3OBW A;  2PY5 A;  1WAJ A;  2P9N B;  4FM2 A;  4CEE A;  2WTU A;  1XHZ A;  3LM9 A;  2QM1 A;  4DR2 K;  3CCR N;  4CEA A;  3FFI A;  3CJA A;  3T69 A;  3CXC M;  4BGA A;  1NJI O;  4I6M A;  2X74 A;  1VQK N;  2QWP A;  4OKE A;  4UQG A;  3VGL A;  3K57 A;  1N36 K;  1TL3 A;  1Y97 A;  5F2R A;  4GNI A;  4CHN A;  2QWM A;  1XHX A;  4Z4G A;  1WBB A;  1S22 A;  3ZX3 A;  1HNX K;  4X64 K;  2EHG A;  2G8H A;  4DTR A;  4M63 C;  2QW9 A;  4KTQ A;  3L3V A;  4NYF A;  3P38 A;  2IVP A;  4CGF A;  3CQY A;  2OA8 A;  3KIO A;  2E2O A;  4DQQ A;  3SUP A;  3KLE A;  4F8R A;  3SJJ A;  1JCE A;  4R5P A;  3CPW M;  3OYF A;  3V81 A;  4Q0B A;  3DJC A;  3PIO L;  2Q1N A;  3A2F A;  4JD2 B;  4JLH A;  2O8B B;  3M1F A;  1HX1 A;  4CGJ A;  4WFB L;  4CJQ A;  3HTV A;  4F9O A;  3CFO A;  3ULD A;  4RW8 A;  4KBO A;  4FWQ A;  1GOA A;  1T6D A;  4MFB A;  3ZSX A;  3TPQ A;  1S1T A;  3CD6 N;  2BUP A;  4O5F A;  2JLE A;  1JL1 A;  3VF2 A;  3V9W A;  5AZI A;  2DTU A;  4DQR A;  5SZT A;  3ZEU B;  4K25 A;  4CEO A;  3AVK A;  5M1O A;  4J8F A;  1YVU A;  3H6E A;  4OO1 J;  2Q2R A;  3QER A;  4QCL A;  2EX3 A;  3D2F A;  3J81 O;  4B9M A;  4Y1D A;  2UXC K;  1KAY A;  1KRP A;  4RWT A;  4CF9 A;  3HOT A;  3R1X A;  4BC3 A;  1WOQ A;  3NAE A;  4O8U A;  2VQE K;  5AQM A;  1M90 O;  3KVG A;  3MCP A;  3M6G A;  2Z1G A;  3U6F A;  3V6D A;  1S6Q A;  4PA1 A;  1V4S A;  3O4W A;  5KRS A;  4DTP A;  3P83 D;  4CJ4 A;  3AO3 A;  4H5T A;  1TUY A;  1VQN N;  3GBT A;  2FSN A;  3FZK A;  4CJL A;  2UXD K;  4FO0 A;  1WB9 A;  4CFA A;  3SPZ A;  4CJT A;  5AQX A;  1XC9 A;  3U9D A;  4FM1 A;  3PX0 A;  3OYK A;  4FSV A;  4F3O A;  3GE1 A;  4KI6 A;  1HNV A;  3MWP A;  1S1U A;  3I0R A;  2IOC A;  3J80 O;  2Q0R A;  2HHT A;  3UKU B;  4DS5 A;  1SZ2 A;  1J53 A;  5J1E A;  3LPT A;  3CCL N;  3ULE A;  1FK9 A;  5EXW A;  4W5T A;  3LZJ A;  4FLU A;  1I94 K;  4DTM A;  1ESV A;  3B6P A;  1Z6R A;  2VWK A;  3WXM B;  4CJF A;  1BGX T;  3Q7B A;  4IFE A;  5C15 A;  3K5N A;  3K58 A;  2NZT A;  3GG4 A;  3FZF A;  2WOM A;  1TK5 A;  3W3D A;  1GLL O;  1LOT B;  5CZ2 A;  3OYE A;  4BDZ A;  3ZCM A;  5A2Q O;  4CFC A;  3CC7 N;  4B9Q A;  3IDH A;  1BG3 A;  4RCH A;  4KHW A;  4E1N A;  3V1O A;  4FWK A;  4DSI A;  4JHD B;  1EWR A;  3FFK B;  4DR4 K;  3KK7 A;  5DK5 A;  5HP1 A;  1DEJ A;  4FWS A;  3THW A;  4QOZ B;  5AQR A;  1WSF A;  4MDB A;  3RRG A;  4B1W B;  3ENH A;  3T3F A;  5I3U A;  1NOY A;  1S9E A;  3O8M A;  1SAZ A;  4CEF A;  4FWO A;  5I42 A;  4JI4 K;  4W5O A;  4IG3 A;  2P51 A;  2UXB K;  4B08 A;  1RDB A;  1YI2 N;  1LV5 A;  4KI4 A;  2NRR A;  4U67 L;  2YCH A;  4M41 A;  2EWS A;  4H4M A;  3TAR A;  2A5X A;  3RMC A;  4KRF A;  3DMJ A;  2KZM A;  4G9Z A;  3QIP A;  2YHA A;  5JS2 A;  1C0F A;  3BZC A;  2HHQ A;  1VQ9 N;  4PQU A;  3NH2 A;  3SUO A;  4O44 A;  3KWG A;  3IMX A;  2A42 A;  4DFK A;  2ZM6 K;  3CMA N;  3DYA A;  1VSF A;  3H1V X;  5KPZ A;  4BE0 A;  4IO9 L;  1RDU A;  1X9M A;  4AHT A;  4W5R A;  2P9K B;  4FJK A;  1BU6 O;  4CZM A;  1HPM A;  5KTQ A;  3SBT A;  1TKT A;  1QS4 A;  4EP5 A;  1Q18 A;  1MDU B;  3I0S A;  1EET A;  3EYZ A;  3VQD A;  3KLH A;  4BR7 A;  2E1Z A;  5JVG L;  3VQB A;  5E26 A;  4C8N A;  5SWM A;  2XO7 A;  4DUZ K;  2FC0 A;  3CIP A;  5AZJ A;  3Q7C A;  4FJX A;  1Q9Y A;  3HK2 A;  4CER A;  4CK1 A;  1VSH A;  3QFU A;  2D5R A;  3EE8 A;  4H8K A;  4YOX A;  1S6P A;  1SKS A;  1R59 O;  3E01 A;  2VQF K;  4ILG B;  3K5O A;  2HNY A;  2QWO A;  4JK8 A;  3JYT A;  4KFB A;  4JKH A;  3CME N;  2YI1 A;  4X65 K;  2FF6 A;  4E7K A;  5BRE A;  5GAE P;  5LJW A;  3AVB A;  4J2A A;  1WAF A;  3EZW A;  1T44 A;  4HTL A;  1OVQ A;  2BDP A;  1ITG A;  3HJF A;  4FW2 A;  1YIT N;  4FJN A;  5FRO A;  2VGM A;  4O5B A;  4DWI A;  3CG7 A;  2GTD A;  2HST A;  1ZXO A;  3BZK A;  5JVH L;  3AA3 A;  4WE1 A;  5HBM A;  3I8D A;  4RW7 A;  1RBV A;  4WCE L;  4DFJ A;  1D5A A;  4KH5 A;  1YJ9 N;  2HHV A;  2D0A A;  1DTQ A;  2YNH A;  2Q31 A;  5EX5 A;  1GOC A;  3VQ4 A;  4M45 A;  3SMS A;  2WUS A;  4FZZ A;  3K5L A;  4KH6 A;  2IGI A;  4CES A;  3L2W A;  2P9L A;  3VET A;  3QEV A;  4LC9 B;  3AAP A;  4DF4 A;  4GW6 A;  1RDD A;  3O9T A;  2ATQ A;  5AQI A;  1HJO A;  4J2D A;  3NF8 A;  5GAH P;  3CCE N;  4YDU A;  3O3H A;  5C42 A;  1KXP A;  1CXQ A;  1VQ4 N;  4O8K A;  3GL1 A;  3VGK A;  3QEX A;  4CHO A;  3L6Q A;  3O9S A;  3J7Y P;  3OS1 A;  1L3U A;  4FZY A;  4B9V A;  2P9I A;  3I8B A;  1C0U A;  4OGC A;  5BRD A;  1JJ2 M;  2QWQ A;  2W41 A;  2O8F A;  4GY2 B;  1HRH A;  3MXI A;  2E6M A;  4ISE A;  3MX2 A;  1WSE A;  2ZJR L;  2QI2 A;  3KK3 A;  5JIC A;  3CFP A;  3ZYY X;  1TVR A;  2HHS A;  4M3X A;  1VSD A;  4OPK A;  4ZTJ A;  3HPH A;  5BPL A;  4TSX A;  5M1N A;  2OTL N;  4PHT X;  3AAQ A;  5C2F A;  3WXI A;  1G15 A;  4DQI A;  3QEW A;  3QLH A;  4JI1 K;  4ILH A;  3UB5 A;  1RTJ A;  4KPY A;  5ELZ A;  4QAG A;  2P9S B;  1OKJ A;  4RTF D;  1MU2 A;  4CEB A;  3A5L C;  3TAP A;  5JLF A;  3E9P A;  5M1F A;  4BRK A;  1NGD A;  1XMO K;  4Z4E A;  3DLG A;  3O4N A;  4J2B A;  4DR5 K;  3LZI A;  3PSF A;  4B8A B;  3HRG A;  1FKO A;  4ID1 A;  4RW6 A;  3HXM A;  3DLK A;  3K2P A;  3R9P A;  3ASM A;  2YNG A;  1U49 A;  2HW3 A;  5BRF A;  4GV3 A;  1IV0 A;  2AA4 A;  3CHW A;  1KQS M;  2YKM A;  1RNH A;  3D45 A;  1NK4 A;  2KKZ A;  1HKG A;  3A8Y A;  3ATV A;  5KGW A;  4NXM K;  1ASW A;  3OYI A;  3HPO A;  2YHB A;  3T19 A;  4FJM A;  1QQC A;  1ZBU A;  5HRS A;  2Q3S A;  3PLA A;  1N8R O;  2F4V K;  2B6A A;  2WFB A;  2W6L A;  3CCV N;  2FBX A;  4H0P A;  4JI7 K;  3SAG A;  1HKB A;  4FLX A;  2E20 A;  1ZBS A;  3O9R A;  3WT0 A;  2W42 A;  3RTV A;  1TYQ B;  4M3U A;  3LP1 A;  4YOR A;  5AQH A;  4XH5 A;  4BRA A;  4K41 A;  3FLC O;  4FOI A;  4AHV A;  5MLC Q;  4K42 A;  1GLD G;  4DFP A;  1TK0 A;  3HYF A;  4E1J A;  3TTF A;  5BPN A;  2CH5 A;  3OYN A;  4KO0 A;  1P8Z A;  4H5R A;  4JK9 A;  3FZL A;  1IKW A;  4XH1 A;  4FJI A;  2IC3 A;  2HND A;  3SAH A;  3AVC A;  4I6M B;  4JKG A;  3HST B;  1FKP A;  3QFP A;  4CFB A;  1QQM A;  4KAZ A;  3MCA B;  3NMU A;  1LAV A;  4PKH A;  1HUX A;  3CM6 A;  3V1Q A;  4H5V A;  5J2M A;  4OVL A;  3ID8 A;  4FYD A;  1YXQ A;  2QEX N;  3KLF A;  2NRT A;  4LSL A;  3KJV A;  4DSK A;  3U4L A;  3EE9 A;  5ADX A;  3O5B A;  3NE6 A;  2AP1 A;  4JN4 A;  4A2B A;  4AHS A;  4FWP A;  1ILY A;  2E2P A;  3EN9 A;  4B3M K;  3O3F A;  3QBX A;  3U9Z A;  4Z4I A;  3C7N B;  4EHU A;  4KHN A;  3EO3 A;  2BH1 A;  1QQN A;  4MO5 A;  1UAX A;  3VOV A;  5I9E B;  1R0A A;  3TSU A;  3CC4 N;  1GLA G;  4M3Z A;  3U3Y A;  4DKW A;  4WFA L;  3OYJ A;  4L8R B;  3WUH A;  3PO5 A;  2QXF A;  3DRP A;  1K8K A;  3TSQ A;  4LFA K;  1VSJ A;  2GWK A;  3RMB A;  3WXJ A;  2QKK A;  5AQL A;  4JKA A;  4BC4 A;  3DXK B;  3ENO A;  2ASM A;  4LF7 K;  5AZI B;  4BRD A;  3VEO A;  4CFD A;  4CZF A;  1KLM A;  2ZWH A;  1RCH A;  1TAQ A;  3CET A;  2BGG A;  3D2F B;  1D9D A;  2VG5 A;  3KKR A;  1KLN A;  1RTI A;  2DPN A;  1VSI A;  2Q0U A;  1KC8 O;  3EEQ A;  4JI0 K;  3MMV A;  4M3Y A;  2O8D A;  3ISN C;  4NCB A;  4JNE A;  3K9K A;  1WLJ A;  1NG9 A;  2OAN A;  3TSP A;  3DLL L;  1D8Y A;  1LWE A;  1O1W A;  5LMN K;  3AVH A;  4YDU C;  1MA9 B;  3KKS A;  2E2N A;  5BR8 K;  1TL1 A;  3L2V A;  1X9W A;  3VEZ A;  1VQ6 N;  5EVZ A;  5GAG P;  4KHY A;  3V4I A;  5F1X A;  3AVA A;  4PKI A;  1NK7 A;  3C95 A;  2FBT A;  4Z0U A;  2QKB A;  3G25 A;  4Z4F A;  4I9L A;  3ULE B;  3KLI A;  3NH1 A;  3QET A;  4CZG A;  4K8Z A;  1XC3 A;  5AFU A;  2JWK A;  1NNE A;  2Q97 A;  4N47 A;  3C7N A;  2J4R A;  5M1Q A;  4CJR A;  3AY9 A;  1DKG D;  3V9U A;  1J6Z A;  1VSE A;  3AVN A;  1IG8 A;  3SLC A;  4CJE A;  4I9Q A;  1LCU A;  4WYB A;  3NVK A;  4AQY K;  1QVF M;  2AJQ A;  3M3Z A;  3H1Q A;  2G8V A;  2NRX A;  2F8S A;  3VGM A;  4DV4 K;  1VSM A;  1IKV A;  3CCJ N;  3DXK A;  1BI4 A;  4JKE A;  2V52 B;  2G8I A;  2KZZ A;  5FPM A;  3C0B A;  3VEW A;  4JKC A;  3R8E A;  4NYN A;  3OYM A;  3V9X A;  3THW B;  3HI0 A;  3TTD A;  3M5R A;  3CF5 L;  4LFB K;  4FK2 A;  2UUA K;  4WF9 L;  3BF3 A;  4IO8 A;  1LWF A;  4CHZ A;  4Z94 A;  4Y0W A;  3THY B;  4FK4 A;  4ELT A;  1QVG M;  3NF7 A;  2IVN A;  5KI6 A;  3LDN A;  3KTQ A;  4MDA A;  3K59 A;  1S3X A;  3QEI A;  1IBK K;  4X66 K;  2GWJ A;  4A5A A;  4BQL A;  3CM5 A;  1ATN A;  4FJH A;  5EY4 A;  3HZ6 A;  4N76 A;  3KHY A;  3SK3 A;  1DGK N;  4MO4 A;  2FBY A;  5AJ3 K;  4OPH A;  3SQ4 A;  4KRE A;  4M7X A;  4M3R A;  2GV9 A;  4DCH A;  4B1U B;  2GEM A;  2CGL A;  4I2Q A;  3ZET A;  2E2Q A;  2KFN A;  4GV6 A;  3OW2 M;  4OX9 K;  1C0G A;  3V9Z A;  4C8L A;  4DTU A;  3C94 A;  2Q36 A;  3OYB A;  4BRH A;  1Z05 A;  5HRP A;  2I7N A;  4E7L A;  4IKF A;  4F2R A;  2HF3 A;  1EXQ A;  2FLO A;  3G4S N;  1B9F A;  2W40 A;  4CK2 A;  1JLQ A;  4DTJ A;  1Q82 O;  3CJ1 A;  5AZJ B;  4DV2 K;  3HBT A;  4HWI A;  3DLB A;  2YJF A;  2DFF A;  3ZX0 A;  3SV3 A;  3K5M A;  1SL1 A;  4LD0 A;  2OPR A;  3AVI A;  4H5N A;  4E7J A;  1RFQ A;  3H3N O;  4FWR A;  4NLB A;  1VK0 A;  4B1X B;  2XY5 A;  3O9U A;  2FSJ A;  3AO4 A;  2Z1I A;  1BOT O;  5AQS A;  4B1Z A;  3J7A P;  1VRU A;  3ZT4 A;  5FRN A;  3OVN A;  1QHT A;  3AO5 A;  4NLC A;  5KQD A;  3RR8 A;  1JLA A;  5BN8 A;  3KD1 E;  3S3O A;  3U8X A;  2VGN A;  1RGI A;  3VQ7 A;  4DR3 K;  1TUU A;  4JKB A;  3AGR A;  4YOT A;  1NK8 A;  4G1Q A;  1JLF A;  1QSL A;  1U2V B;  5J2Q A;  4HCB A;  3VMF B;  4FWL A;  3TTC A;  1KD1 O;  4FLV A;  3THY A;  4JI2 K;  3DRR A;  4IFV A;  1T7P A;  1Z26 A;  3R6M A;  2D1K A;  4C8K A;  4A59 A;  5JMV A;  4BRC A;  1T6C A;  1LW0 A;  4DF8 A;  3D2E A;  3M8R A;  1U4B A;  4DQ8 A;  1BQM A;  5FPD A;  3SI6 A;  1VRT A;  2PBD A;  4IG0 A;  2OPQ A;  2HF4 A;  2P9L B;  3VA3 A;  3R3L A;  4BR0 A;  4DV0 K;  1JXE A;  4CF0 A;  2P9U A;  4GV9 A;  4MQ3 A;  1E4F T;  3ID6 A;  1RTH A;  4BR4 A;  3ZSW A;  3BY5 A;  3M8P A;  4JI6 K;  3JSM A;  4ZTF A;  2F8T A;  2A1R A;  3OHR A;  1L3V A;  2RF2 A;  4B1V A;  4UY8 O;  4BG9 A;  3OYC A;  2QWR A;  3P39 A;  5DM7 L;  2KLA A;  2P9I B;  4LFC K;  3AA2 A;  1C1C A;  3S41 A;  3FE1 A;  3PX4 A;  4IZ9 A;  3A5N C;  2O8F B;  4EZ9 A;  3MEG A;  3QBW A;  3ZSZ A;  4BRG A;  4JI3 K;  3DAW A;  4DV3 K;  4FM0 A;  4N41 A;  3LAN A;  3PUF A;  3MN5 A;  4JS5 A;  4K0K K;  3LWM A;  3D6R A;  1NGC A;  2E5L K;  1RT4 A;  1YAG A;  1IBL K;  4RW9 A;  3W0L A;  3SQ2 A;  2V51 B;  3AGK A;  3QML A;  4B9N A;  5AQN A;  4MLE A;  1HKC A;  1WN7 A;  1V4T A;  5CHI A;  4BVO A;  3NH0 A;  1ASU A;  3LPU A;  1XI1 A;  3TAG A;  1HNI A;  2HMP A;  3EKS A;  1D4X A;  1YJN N;  1K8A O;  2HOE A;  4FCY A;  4U7B A;  1CZ9 A;  3PSI A;  4PL8 A;  1YIJ N;  2GBZ A;  3VEX A;  2UYT A;  1NGI A;  3SQ0 A;  3VES A;  2JGU A;  1JCF A;  1TKD A;  3L2R A;  1U2V A;  3C6T A;  2IS3 A;  4C1N I;  1IH7 A;  1NBW A;  3VF6 A;  4BRP A;  2O8C A;  3H3O B;  1C6V A;  3VN5 A;  1VSK A;  4HTU A;  4JK7 A;  4CF2 A;  3NHG A;  1SKR A;  4FL9 A;  2VWJ A;  4B1Y B;  1Q8I A;  3CYM A;  1NGB A;  3TAB A;  2CGJ A;  3ZSR A;  4CIG A;  4W5Q A;  3VEV A;  4H03 B;  3HOS A;  4DTX A;  4FLZ A;  3PO4 A;  2YNI A;  4IXC A;  3G0Z A;  4CBU A;  5C10 A;  3MEE A;  2ASO A;  1SL0 A;  4F2S A;  4CE9 A;  3CJ9 A;  4R79 A;  3SYZ A;  3SQ1 A;  4LH4 A;  4FK0 A;  2NUB A;  5BR9 A;  3THX B;  1BCM A;  2ZQB A;  4BVP A;  2W6K A;  5LY3 A;  4WQ5 A;  2CH6 A;  2NRH A;  3DXM A;  4LF5 K;  1QSS A;  1CLQ A;  3S3N A;  1OH6 A;  5J2P A;  3H45 C;  2XRI A;  1ZBL A;  4IFY A;  1WUA A;  1IO2 A;  4YOY A;  4JV5 K;  2G8K A;  3NF9 A;  1T03 A;  4FOE A;  4YOU A;  2HVH A;  3H46 O;  2HBK A;  4DLG A;  3BGR A;  1KVA A;  3OYA A;  1CXU A;  1BQN A;  2FBV A;  5GIO A;  4E89 A;  3WEE A;  1S1X A;  1NGH A;  2A6A A;  3RSE A;  2QWN A;  2VG7 A;  3QO9 A;  2G8F A;  3TI0 A;  2IAJ A;  1U48 A;  1KAZ A;  5C0Y A;  2NLX A;  4DV7 K;  3RRH A;  2E88 A;  2XHB A;  4IWV A;  1Y64 A;  1N32 K;  4LH5 A;  4B9S A;  4PY5 A;  4JKG B;  4GMJ B;  5F0X A;  3OTO K;  4BY9 C;  2E1Y A;  3G10 A;  4NB4 A;  2FF3 B;  3ALY A;  1VQL N;  3O1B A;  1NK6 A;  4YOV A;  3FGU A;  2V7Z A;  1QE1 A;  3VQA A;  1S5J A;  3WNE A;  3F5T A;  4CZJ A;  2YHY A;  1WSJ A;  3MN7 A;  3HP6 A;  3VER A;  4FJ5 A;  3O9Q A;  4JS4 A;  1ATR A;  4BDP A;  3NBP A;  4BE2 A;  3K9J A;  3IKM A;  3NFA A;  1HR0 K;  1S1W A;  1WSG A;  5DMR A;  5KRT A;  3K0S A;  1BUP A;  4HVJ A;  3BP8 A;  4WFN L;  1UOC A;  4A62 A;  4H0V B;  1X3M A;  4FXD A;  3AA5 X;  4CJ3 A;  3TU5 A;  2P5G A;  1SUQ A;  4FJL A;  1NK9 A;  4GKJ K;  1N34 K;  1NKB A;  5E84 A;  1K8K B;  5AQZ A;  4KHS A;  5AQV A;  2PAV A;  3GDQ A;  3AO2 A;  4DTO A;  5C25 A;  4CHP A;  3THX A;  4BWJ A;  1RBU A;  3QIC A;  4H0Y B;  1NLV A;  1KTQ A;  1BCO A;  3OY9 A;  4OJR A;  3HT3 A;  2VCP A;  4CEC A;  5FPE A;  2D0B A;  5LL6 Z;  2D4W A;  3A5M C;  4C8M A;  2OPS A;  4BDY A;  3VA0 A;  2O8D B;  2E8A A;  4CZE A;  4PL7 A;  3SCX A;  2IVO A;  2D0O A;  3ITH A;  4J2E A;  4E0D A;  4IOC L;  3VQC A;  3ZLJ A;  4O4G A;  2BE2 A;  1W97 L;  3WXK A;  2F9W A;  3AVF A;  3LL3 A;  4EZ6 A;  5AQU A;  1EKE A;  3SPY A;  3CER A;  4GVM A;  4AF1 A;  4BR2 A;  4CGD A;  3IUC A;  4JKD A;  1JXB A;  3LP3 A;  4FLY A;  1HYZ A;  3LDL A;  4QS8 A;  4O0I A;  2YHW A;  2ZE2 A;  2NRV A;  1C0T A;  4DFM A;  3D0P A;  1WSI A;  4DQS A;  2IIR A;  5HLF A;  1KFS A;  5H1S Q;  1S1V A;  3RVC A;  4BR5 A;  1J5O A;  4B9L A;  4E1M A;  1VQM N;  2G8U A;  4AIL C;  1NWK A;  1C1A A;  3OA9 A;  3ZSO A;  5IWA K;  4JI8 K;  4M7Y A;  1EQY A;  4EHT A;  2RPI A;  3H08 A;  3BUZ B;  3T1H K;  3VQ6 A;  3C6A A;  4KB1 A;  3LM2 A;  4CEQ A;  1SS6 A;  5CZ1 A;  3V9S A;  3E9L A;  3VQQ A;  4A2A A;  3J8A A;  4CIE A;  1RT7 A;  3TWH A;  1BI4 B;  4RW4 A;  3IAY A;  4FJ8 A;  4DU4 A;  1YJW N;  1W2B M;  4JKF A;  3CCQ N;  1OH7 A;  4DU1 A;  3QIN A;  4HUG A;  3OS0 A;  3TAE A;  4XIU A;  3A5O C;  1NGF A;  1HQU A;  4FZX C;  2GUP A;  1KAX A;  5GIN A;  4IEE A;  3I33 A;  3CCU N;  1YTA A;  5GIP A;  1YF5 L;  1QHA A;  3UKR A;  2F7T A;  1X1P A;  1TV6 A;  1KSP A;  4PWD A;  3MK6 A;  1VQ8 N;  1HYV A;  2OZS A;  3CQX A;  4DB3 A;  5HL7 L;  1U45 A;  3ZT2 A;  2YNF A;  4BRE A;  4FJ9 A;  4AM7 A;  3O3G A;  3OJS A;  2XY6 A;  1NMD A;  4NO7 A;  1T8E A;  1FXX A;  1UWB A;  1J5E K;  4B3R K;  5HRN A;  2RKI A;  1RBR A;  1HMV A;  4WQ4 A;  5AR0 A;  5BN9 A;  3MN6 A;  1RDC A;  4H4O A;  3M8Q A;  4WQ5 C;  2YJE A;  1MWM A;  2NRZ A;  4CJ7 A;  4IJN A;  5C2D A;  4DSJ A;  4OPJ A;  3AAR A;  3P4I A;  2B4J A;  1O13 A;  2UU9 K;  4OGE A;  4EIA A;  5JLH A;  1QQO A;  1A5V A;  3N4Q A;  4BRM A;  2GUI A;  1UA0 A;  4DU3 A;  3MED A;  3ZET B;  4M42 A;  1TKZ A;  3TAN A;  3LAM A;  1WNS A;  1E3M A;  4CBX A;  2PYJ A;  1KVC A;  1GLE G;  4DR7 K;  4ISF A;  4BG8 A;  3LDS A;  4E7H A;  3QEP A;  1NK5 A;  1RT2 A;  1Q81 O;  3F9K A;  3FZH A;  2PYL A;  1EWQ A;  1SKW A;  2A3Z A;  1J54 A;  1RBS A;  3BF1 A;  2ASP A;  3U3G A;  4LF4 K;  2HB5 A;  4JI5 K;  3IS9 A;  4V19 S;  3RR7 A;  4FVM A;  4DMN A;  2OPP A;  1JKH A;  4BC5 A;  4ILJ A;  1NMN A;  3MN9 A;  4CJP A;  3VF4 A;  3EKU A;  2P5O A;  3OS2 A;  2Y1I A;  4Z4H A;  3PV8 A;  4B3T K;  1LWC A;  1NGJ A;  5IT9 O;  3DOK A;  1EO1 A;  1A5W A;  2KQ2 A;  4F4K A;  4XH4 A;  4KH4 A;  1K9M O;  1JLG A;  3E9O A;  4CHY A;  3ZSY A;  4CJK A;  1DLO A;  1RT6 A;  4AHC A;  3P31 A;  2QWL A;  1CZA N;  4K43 A;  2KW4 A;  1DT9 A;  1REV A;  3D2E B;  2X6S A;  4CK3 A;  5HOO A;  3LDO A;  3AVG A;  3F2K A;  3OBY A;  3O6W A;  3QB0 A;  3UE5 A;  3OYD A;  1N5Y A;  3SJH A;  3BEX A;  3WQT A;  2UUC K;  1X9S A;  4DR6 K;  2A41 A;  3O08 A;  3VQ9 A;  4ELU A;  3WNH A;  5M1K A;  4FVU A;  1JL2 A;  1HNZ K;  2P9U B;  4CGH A;  4DQP A;  5AQK A;  4CD3 A;  3JS6 A;  1BO5 O;  4JRQ A;  2P9N A;  4O55 A;  3IFR A;  4IEI A;  1GLJ O;  5ADX H;  1T05 A;  5C24 A;  4CF1 A;  1SQK A;  3PX6 A;  1Q86 O;  4ELV A;  3NF6 A;  3AA4 A;  1E4G T;  3EL2 A;  4IJA A;  2OCE A;  3DRS A;  4BC2 A;  2Z1J A;  1EP4 A;  1ASV A;  3UIQ A;  3NDK A;  3KLG A;  3M8S A;  1RBT A;  3HO1 A;  1IKX A;  3NGI A;  5DM6 L;  1KVB A;  2YKN A;  4X62 K;  4CCH A;  4CJ5 A;  1F21 A;  1VQ7 N;  4KHU A;  1BIS A;  1K6Y A;  1U47 A;  3ZT1 A;  1XNQ K;  1BWF O;  4FJ7 A;  3J7Z O;  3PIP L;  4JEP A;  1NKE A;  2ITM A;  1L5U A;  2FXU A;  3ZT3 A;  3E1Y A;  4FWN A;  4PKG A;  4JD2 A;  1IG9 A;  2O8B A;  3MEC A;  1BIZ A;  4FWM A;  2KHO A;  1YHQ N;  2I5J A;  2ZJQ L;  1OVY A;  1KFD A;  1GLB G;  2QXL A;  5AQF A;  3TAF A;  4K8X A;  4CZL A;  5BPM A;  3NGY A;  2O8C B;  4DSF A;  4XEI A;  3ZEU A;  1U6Z A;  3MDQ A;  3IG1 A;  4CZH A;  3T1A A;  3QNO A;  3O80 A;  3V1R A;  4IDK A;  4CF8 A;  3I56 N;  3RMA A;  3A0I X;  1IBM K;  3HP9 A;  3ENB A;  1NJZ A;  4Q5V A;  2B5J A;  4DS4 A;  4H5W A;  5C12 A;  2G8W A;  2OZM A;  1EX4 A;  2XY8 A;  3OYG A;  4CGI A;  5EOY A;  4DHY A;  3CCM N;  4CBW A;  3KK1 A;  1OH5 A;  4OKJ A;  3VEY A;  3I55 N;  3DXM B;  4OLB A;  3ATU A;  3EY1 A;  3O1W A;  4CHQ A;  4C8O A;  5GAD P;  1ZC6 A;  2A40 A;  2IDO A;  5AFU H;  3CCS N;  4DSL A;  3FR0 A;  3HVR A;  2O8E B;  5CYM A;  2ITG A;  4LF6 K;  4ZHR A;  4BRN A;  4CJS A;  3MX5 A;  4FPB A;  3G6E N;  4O0J A;  3KD5 E;  2HHW A;  1WSH A;  4F3T A;  1VAZ A;  3WEE B;  5CE3 A;  1TAU A;  4DTN A;  3RSE B;  2LSN A;  5AQQ A;  3QDK A;  4WQ4 C;  3QES A;  2HHX A;  3UKU A;  4B9T A;  3GOI A;  2R7Y A;  2HMI A;  3KK2 A;  5CY4 A;  5T7B A;  4KB0 A;  3HL8 A;  4FLT A;  4E19 A;  3N4P A;  3TAQ A;  1NGE A;  1Q9X A;  1ZYQ A;  4EP4 A;  2F96 A;  1JLE A;  2YHX A;  3L2Q A;  2QK9 A;  4A5B A;  1Q7Y O;  3RWU A;  3OYL A;  4NXN K;  1Z25 A;  4KTZ A;  4LSN A;  4A61 A;  3CPE A;  2YV0 X;  2KFZ A;  3LP0 A;  4AHR A;  1M1K O;  4C23 A;  1XQS C;  2P9P B;  1UA1 A;  4CVN E;  4JYA K;  2O4I A;  2BAN A;  5BRH A;  2FSK A;  4N5S A;  4MLH A;  3WNG A;  3VTI A;  3DOL A;  5AQG A;  4CGG A;  1VQO N;  3T7Z A;  1X3N A;  4E3S A;  2ZGY A;  3P5J A;  5AQO A;  2ZD1 A;  4JHD A;  2HHU A;  4FJG A;  2I7P A;  1T3V A;  4B8C A; 
#chains in the Genus database with same CATH homology
 3L2V A;  1X9W A;  3QNN A;  4CEC A;  2WOM A;  4KKO A;  2D0B A;  1TK5 A;  4KHY A;  3V4I A;  4C8M A;  2X6N A;  1RT5 A;  3AVA A;  2OPS A;  3AVM A;  5CZ2 A;  3ZCM A;  3C95 A;  3OYE A;  4BDY A;  4BDZ A;  3VA0 A;  2FBT A;  4Z0U A;  4CFC A;  2WON A;  2QKB A;  3VQE A;  4Z4F A;  1HPZ A;  4I9L A;  3SCX A;  4KHW A;  4E1N A;  3V1O A;  3KLI A;  3ITH A;  3NH1 A;  3QET A;  4J2E A;  4K8Z A;  4DSI A;  4E0D A;  4YNQ A;  4YFU A;  1TK8 A;  3VQC A;  1N6Q A;  4O4G A;  4M3T A;  1ZBH A;  1BIU A;  3NGZ A;  2BE2 A;  1B9D A;  3AVJ A;  3LAK A;  1JLB A;  4BAC A;  4HCC A;  3AVF A;  4N47 A;  4EZ6 A;  4CJR A;  2O4G A;  1EKE A;  5DK5 A;  4DG1 A;  1B92 A;  5HP1 A;  3SPY A;  3V9U A;  3QIO A;  1VSE A;  5K14 A;  4QOZ B;  4GVM A;  3AVN A;  4DTS A;  4CJE A;  4I9Q A;  1WSF A;  4CGD A;  3RRG A;  4CEZ A;  1RT3 A;  1JXB A;  1VSL A;  3LP3 A;  4CJV A;  4FLY A;  1HYZ A;  3T3F A;  2AJQ A;  5I3U A;  1NOY A;  2G8V A;  4O0I A;  2F8S A;  2ZE2 A;  1S9E A;  3TAM A;  1C0T A;  4DFM A;  4DSE A;  3D0P A;  1YTU A;  4CEF A;  1VSM A;  5I42 A;  1WSI A;  4DQS A;  1KCF A;  1IKV A;  4IG3 A;  4W5O A;  5HLF A;  1KFS A;  1S1V A;  2P51 A;  4B08 A;  4ID5 A;  1J5O A;  3OJU A;  1BI4 A;  1RDB A;  4B9L A;  4E1M A;  1LW2 A;  1LV5 A;  4KI4 A;  2G8U A;  4AIL C;  4RG8 A;  4M41 A;  4H4M A;  3TAR A;  1C1A A;  2G8I A;  2KZZ A;  3ZSO A;  5FRN A;  3L3U A;  3RMC A;  4KRF A;  3DMJ A;  2KZM A;  4AHU A;  3QIP A;  2HVI A;  2RPI A;  2YHA A;  1HJR A;  3H08 A;  1HYS A;  5JS2 A;  3OYM A;  4NYN A;  3V9X A;  2HHQ A;  4PQU A;  4OKK A;  3NH2 A;  3SUO A;  4O44 A;  3VQ6 A;  4KB1 A;  4FK2 A;  1I39 A;  3MXJ A;  4CEQ A;  5FDL A;  5EU7 A;  1LWF A;  4CHZ A;  5CZ1 A;  3V9S A;  3BDP A;  4DFK A;  4FK4 A;  4ELT A;  3VQQ A;  3NF7 A;  3DYA A;  4CIE A;  5KI6 A;  1VSF A;  4BE0 A;  3KTQ A;  1RT7 A;  1NK0 A;  3K59 A;  3TWH A;  2HNZ A;  3QEI A;  3VQ5 A;  1X9M A;  4AHT A;  4W5R A;  1BI4 B;  2KFN A;  4FJK A;  4RW4 A;  3IAY A;  3CM5 A;  4FJ8 A;  2E6L A;  3DLR A;  4DU4 A;  5KTQ A;  1TKT A;  1QS4 A;  4DU1 A;  3QIN A;  4FJH A;  3WNF A;  4EP5 A;  4HUG A;  3OS0 A;  3I0S A;  5J2N A;  1EET A;  3EYZ A;  3TAE A;  4N76 A;  3VQD A;  3KLH A;  5KGX A;  4XIU A;  1HQU A;  2VG6 A;  4FZX C;  2D0C A;  3VQB A;  3DLE A;  2Z1H A;  4C8N A;  5SWM A;  2XO7 A;  2FC0 A;  4NCA A;  4KV8 A;  2FBY A;  3SUQ A;  2DFE A;  1YTA A;  3HK2 A;  4FJX A;  1Q9Y A;  4CER A;  3DLH A;  4CK1 A;  3SQ4 A;  1VSH A;  1X1P A;  4KRE A;  2D5R A;  1TV6 A;  4M3R A;  2GV9 A;  1KSP A;  4PWD A;  4W5N A;  4H8K A;  1S6P A;  1HYV A;  4I2Q A;  2E4L A;  2X78 A;  3AVL A;  4NCG A;  3E01 A;  4DLE A;  3THV A;  1SKS A;  3K5O A;  2HNY A;  4B9U A;  1U45 A;  4KTW A;  3C6U A;  3ZT2 A;  2YNF A;  4KFB A;  1U04 A;  3LWL A;  3JYT A;  4FJ9 A;  3VQP A;  3O3G A;  3OJS A;  3V9Z A;  2XY6 A;  2PZS A;  4C8L A;  4DTU A;  3C94 A;  4E7K A;  1T8E A;  3OYB A;  1FXX A;  1YT3 A;  3AVB A;  1UWB A;  3SUN A;  2A1S A;  3IRX A;  1NJW A;  5HRN A;  4J2A A;  2RKI A;  1RBR A;  5HRP A;  1HMV A;  1WAF A;  2BDP A;  3HJF A;  1ITG A;  4E7L A;  4FW2 A;  3HM9 A;  4IKF A;  4FJN A;  1RDC A;  4H4O A;  3M8Q A;  4F2R A;  4FLW A;  5FRO A;  1EXQ A;  1QTM A;  4O5B A;  1B9F A;  4DWI A;  4JRP A;  4CK2 A;  4DSJ A;  1JLQ A;  3CG7 A;  4OPJ A;  3ZSQ A;  4DTJ A;  2B4J A;  4OGE A;  3DLB A;  1IKY A;  1BHL A;  1W0H A;  2DFF A;  3SV3 A;  3K5M A;  4KHQ A;  3PY8 A;  1A5V A;  3AA3 A;  1SL1 A;  4Y1C A;  4WE1 A;  1J9A A;  1JLC A;  2OPR A;  3AVI A;  5HBM A;  4LD0 A;  2GUI A;  4E7J A;  4DU3 A;  1UA0 A;  1VK0 A;  3MED A;  3I8D A;  2XY5 A;  4RW7 A;  1RBV A;  4DFJ A;  1LAW A;  4DQI A;  4M42 A;  3AO4 A;  1TKZ A;  2Z1I A;  1D5A A;  1A5X A;  1VRU A;  4IBN A;  4CJW A;  4HUF A;  3ZT4 A;  3TAN A;  2HHV A;  2D0A A;  1DTQ A;  3LAM A;  2YNH A;  4Z4C A;  3L2U A;  1WNS A;  1QHT A;  3AO5 A;  1I3A A;  3OVN A;  3NCI A;  1GOC A;  4FJJ A;  3VQ4 A;  3RR8 A;  1JLA A;  2PYJ A;  1ZBF A;  3KD1 E;  1KVC A;  3P1G A;  1GOB A;  5CYQ A;  4M45 A;  3S3O A;  4FZZ A;  3K5L A;  3LDS A;  3HPG A;  2P1J A;  2IGI A;  4OLA A;  1SV5 A;  4E7H A;  4CES A;  3L2W A;  3QEP A;  1RT2 A;  1NK5 A;  3VQ7 A;  3QEV A;  4LY7 A;  4DF4 A;  4GW6 A;  1RDD A;  1NK8 A;  4PUO A;  2ATQ A;  4J2D A;  5FRM A;  3F9K A;  3NF8 A;  3VQ8 A;  4FW1 A;  4G1Q A;  1JLF A;  3ZT0 A;  1L3T A;  3O3H A;  3LP2 A;  5J2Q A;  4AH9 A;  4N56 A;  1NK7 A;  1QSL A;  2PYL A;  4HCB A;  4ICL A;  5C42 A;  1SKW A;  4CED A;  3DM2 A;  3EZ5 A;  1NKC A;  1CXQ A;  1J54 A;  3AO1 A;  3MAQ A;  1RBS A;  4FLV A;  1C0M A;  4I7F A;  3U3G A;  3QEX A;  2HB5 A;  3DRR A;  3IS9 A;  4CHO A;  4IFV A;  3RR7 A;  1T7P A;  1Z26 A;  4FVM A;  1C1B A;  4DMN A;  2OPP A;  4CJU A;  1JKH A;  3OS1 A;  1L3S A;  1L3U A;  4C8K A;  4FZY A;  4BWM A;  4B9V A;  1LW0 A;  4DF8 A;  3M8R A;  1HQE A;  3HVT A;  3TR8 A;  1U4B A;  2DFH A;  1BQM A;  1C0U A;  4CJP A;  3SI6 A;  4OGC A;  1ZBI A;  5D3G A;  1VRT A;  2ETJ A;  1HRH A;  1RDA A;  4IG0 A;  2P5O A;  3OS2 A;  2OPQ A;  3MXI A;  2E6M A;  3CQ8 A;  2Y1I A;  3VA3 A;  3S3M A;  4Z4H A;  3PV8 A;  5JS1 A;  1LWC A;  1WSE A;  3DOK A;  3KK3 A;  1JXE A;  1NOZ A;  4CF0 A;  3CFP A;  3LAL A;  1SL2 A;  1TVR A;  2HHS A;  4M3X A;  4MQ3 A;  1VSD A;  4OPK A;  1A5W A;  1BL3 A;  2KQ2 A;  4HHT A;  4ZTJ A;  3HPH A;  4F4K A;  1RTH A;  4TSX A;  1JLG A;  3ZSW A;  3M8P A;  4CHY A;  1CZB A;  1G15 A;  1DLO A;  1RT6 A;  3ZSY A;  4CJK A;  3QEW A;  5HRO A;  3O4Q A;  4AHC A;  3JSM A;  3K5N A;  3QLH A;  4ZTF A;  2A1R A;  2RF2 A;  5HRR A;  1L3V A;  3B6O A;  3OYC A;  2KW4 A;  1RTJ A;  1REV A;  4KPY A;  2X6S A;  4QAG A;  1TGO A;  3ZSV A;  4CK3 A;  3CFR A;  3DI6 A;  1NJX A;  3AA2 A;  1C1C A;  3AVG A;  1MU2 A;  3OYD A;  4CEB A;  3PX4 A;  1N5Y A;  1TKX A;  3TAP A;  4EZ9 A;  3MEG A;  3SV4 A;  2OYQ A;  3ZSZ A;  3OYH A;  3L8B A;  1X9S A;  1S9G A;  3VQ9 A;  4ELU A;  3WNH A;  4Z4E A;  3DLG A;  3O4N A;  1JL2 A;  1DTT A;  4FM0 A;  4CGH A;  4N41 A;  2KTQ A;  3LAN A;  3PUF A;  4DQP A;  4J2B A;  1RIL A;  4JS5 A;  4E7I A;  1W9H A;  3LWM A;  3LZI A;  4B8A B;  1RT4 A;  1FKO A;  4ID1 A;  4RW6 A;  3HXM A;  3S9H A;  3DLK A;  3K2P A;  4RW9 A;  4JRQ A;  3SQ2 A;  1QSY A;  4O55 A;  2DY4 A;  4B9N A;  3ASM A;  1T05 A;  2YNG A;  2XY7 A;  4BE1 A;  1U49 A;  2HW3 A;  1WN7 A;  5C24 A;  3MXM A;  4CF1 A;  4M3W A;  4B3O A;  3SZ2 A;  4I2P A;  3PX6 A;  3NH0 A;  2YKM A;  1ASU A;  3LPU A;  1RNH A;  3D45 A;  1RTD A;  1XI1 A;  3TAG A;  1HNI A;  4ELV A;  3NF6 A;  1NK4 A;  3AA4 A;  2RN2 A;  5KGW A;  3AV9 A;  1ASW A;  3DRS A;  3OYI A;  2Z1J A;  4FCY A;  1EP4 A;  1ASV A;  1CZ9 A;  3HPO A;  2YHB A;  3T19 A;  3UIQ A;  4FJM A;  1XWL A;  1QQC A;  3NDK A;  1ZBU A;  5HRS A;  2GBZ A;  3F73 A;  4CIF A;  2Q3S A;  3SQ0 A;  2JGU A;  1NJY A;  3KLG A;  4HUE A;  2B6A A;  3M8S A;  3RMD A;  1D9F A;  1RBT A;  2Y1J A;  5E41 A;  2FBX A;  1TKD A;  1IKX A;  3L2R A;  1RT1 A;  3NGI A;  2F8T A;  3HO1 A;  2PY5 A;  1WAJ A;  2IS3 A;  1KVB A;  3C6T A;  2YKN A;  4FM2 A;  1IH7 A;  4FLX A;  4CJ5 A;  4CCH A;  4CEE A;  1F21 A;  1XHZ A;  4KHU A;  1BIS A;  1K6Y A;  1U47 A;  3ZT1 A;  4CEA A;  3FFI A;  4FJ7 A;  1C6V A;  3VN5 A;  1VSK A;  2W42 A;  3RTV A;  2X74 A;  4HTU A;  1NKE A;  4OKE A;  4CF2 A;  4UQG A;  1L5U A;  3NHG A;  4M3U A;  3ZT3 A;  1SKR A;  3LP1 A;  2VWJ A;  3K57 A;  1Q8I A;  1TL3 A;  3CYM A;  3TAB A;  3ZSR A;  4CIG A;  4W5Q A;  1IG9 A;  1Y97 A;  3MEC A;  1BIZ A;  4CHN A;  2I5J A;  4AHV A;  4DTX A;  1KFD A;  4FLZ A;  3PO4 A;  2OZS A;  2YNI A;  1XHX A;  3G0Z A;  4DFP A;  1TK0 A;  3HYF A;  4Z4G A;  2EHG A;  3MEE A;  4DTR A;  3SNN A;  2G8H A;  1SL0 A;  4F2S A;  4CE9 A;  3SYZ A;  4KTQ A;  3L3V A;  4KO0 A;  3OYN A;  4NYF A;  3SQ1 A;  4LH4 A;  4FK0 A;  2NUB A;  4CGF A;  3TAF A;  4K8X A;  2OA8 A;  1BCM A;  2ZQB A;  3KIO A;  1CLQ A;  3NGY A;  4DSF A;  1QSS A;  4DQQ A;  1IKW A;  3SUP A;  3KLE A;  4F8R A;  4FJI A;  3S3N A;  2IC3 A;  3SJJ A;  5J2P A;  2HND A;  2XRI A;  4R5P A;  4IFY A;  3AVC A;  3OYF A;  1IO2 A;  3V81 A;  1ZBL A;  4Q0B A;  3HST B;  2G8K A;  3IG1 A;  3NF9 A;  3T1A A;  1T03 A;  1FKP A;  3V1R A;  3QNO A;  4IDK A;  4CFB A;  2HVH A;  3A2F A;  4CF8 A;  4KAZ A;  4JLH A;  3RMA A;  1LAV A;  3HP9 A;  4CGJ A;  1NJZ A;  4Q5V A;  4DLG A;  3BGR A;  1KVA A;  2B5J A;  4CJQ A;  4DS4 A;  3CFO A;  1CXU A;  3OYA A;  2G8W A;  2OZM A;  3ULD A;  1BQN A;  1EX4 A;  2FBV A;  2XY8 A;  3CM6 A;  4RW8 A;  3V1Q A;  5J2M A;  4E89 A;  4OVL A;  4CGI A;  1S1X A;  3OYG A;  4FYD A;  1GOA A;  2VG7 A;  3QO9 A;  2G8F A;  3KK1 A;  4MFB A;  3KLF A;  3TI0 A;  2IAJ A;  1U48 A;  4LSL A;  3ZSX A;  3KJV A;  1S1T A;  4DSK A;  3NE6 A;  2JLE A;  1JL1 A;  4OKJ A;  4AHS A;  3V9W A;  4OLB A;  2DTU A;  3EY1 A;  4DQR A;  4CHQ A;  4C8O A;  3RRH A;  5SZT A;  2XHB A;  2IDO A;  4LH5 A;  4CEO A;  3AVK A;  3O3F A;  4B9S A;  4PY5 A;  4GMJ B;  4Z4I A;  4DSL A;  3HVR A;  4KHN A;  5CYM A;  2ITG A;  3G10 A;  1YVU A;  1UAX A;  3ALY A;  4ZHR A;  3QER A;  4QCL A;  2EX3 A;  4CJS A;  1NK6 A;  1R0A A;  4O0J A;  3KD5 E;  2HHW A;  1WSH A;  4M3Z A;  1QE1 A;  3VQA A;  4B9M A;  1S5J A;  3WNE A;  3U3Y A;  4L8R B;  4Y1D A;  3OYJ A;  4F3T A;  1TAU A;  4DTN A;  3PO5 A;  2QXF A;  2LSN A;  1KRP A;  4CF9 A;  1WSJ A;  3DRP A;  3HP6 A;  1VSJ A;  3RMB A;  4FJ5 A;  4JS4 A;  2QKK A;  3QES A;  3NAE A;  4BDP A;  2HHX A;  4B9T A;  2R7Y A;  2HMI A;  3NBP A;  4BE2 A;  3KK2 A;  5CY4 A;  3NFA A;  1S1W A;  1WSG A;  5DMR A;  5KRT A;  2Z1G A;  3HL8 A;  5T7B A;  4HVJ A;  3U6F A;  4FLT A;  3V6D A;  4KB0 A;  1S6Q A;  4E19 A;  4CFD A;  4PA1 A;  1KLM A;  3TAQ A;  1RCH A;  5KRS A;  1Q9X A;  1ZYQ A;  1TAQ A;  4EP4 A;  2F96 A;  1JLE A;  1UOC A;  3P83 D;  3AO3 A;  4CJ4 A;  3L2Q A;  4DTP A;  2BGG A;  2QK9 A;  4CJL A;  3RWU A;  3OYL A;  1D9D A;  4FXD A;  1Z25 A;  2VG5 A;  4KTZ A;  3AA5 X;  4CJ3 A;  3KKR A;  4LSN A;  4CFA A;  4CJT A;  1RTI A;  3SPZ A;  1XC9 A;  1VSI A;  1KLN A;  1SUQ A;  2YV0 X;  4FM1 A;  1NK9 A;  2P5G A;  3PX0 A;  3OYK A;  4FJL A;  1NKB A;  2KFZ A;  4F3O A;  3LP0 A;  4AHR A;  4KI6 A;  1HNV A;  4KHS A;  4M3Y A;  1S1U A;  3I0R A;  2IOC A;  3ISN C;  2HHT A;  4DS5 A;  4NCB A;  1UA1 A;  1J53 A;  5J1E A;  3LPT A;  3AO2 A;  1WLJ A;  4DTO A;  2O4I A;  1FK9 A;  2BAN A;  1LWE A;  1D8Y A;  5C25 A;  4N5S A;  1O1W A;  4W5T A;  3WNG A;  4CHP A;  3LZJ A;  3DOL A;  4CGG A;  4FLU A;  3AVH A;  1RBU A;  4BWJ A;  4E3S A;  4DTM A;  3B6P A;  3KKS A;  3P5J A;  2ZD1 A;  2VWK A;  4CJF A;  2HHU A;  1KTQ A;  4FJG A;  1BCO A;  1BGX T;  3OY9 A;  4OJR A;  3HT3 A;  4B8C A;  1TL1 A;  3K58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...