3AA5X

A52f e.coli rnase hi
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
153
structure length
153
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAFIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 46
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa5X00
1C1CA 4RW6A 4F3TA 3KKSA 5J2QA 3QIOA 4CIEA 1BI4A 1JLBA 1WSHA 4CEDA 3RMAA 4FXDA 1IKWA 5FRMA 4IFVA 3CFOA 4KTWA 4CFCA 1U04A 3HPOA 2DFEA 3SPZA 3K59A 4DSLA 4FJMA 4IFYA 2VWKA 3LP1A 4LH5A 2FBXA 3QNNA 3V6DA 3DYAA 1C0TA 4RW7A 3P1GA 3KIOA 3V1RA 3BDPA 2B6AA 3ASMA 3RWUA 2E6LA 4CJVA 4W5TA 3SQ0A 1YT3A 4OVLA 4CHPA 4DLEA 3KLFA 1J5OA 2WONA 4DF8A 1IO2A 3RMBA 4KFBA 4I7FA 3KJVA 1QSSA 4OLAA 4OKKA 2VG5A 5CYQA 2HNZA 3OYLA 3HXMA 4FJLA 1L5UA 3PO4A 3P5JA 4AHUA 1BI4B 4CK3A 3VQ4A 4DQRA 1J53A 3SPYA 3AO4A 3M8RA 4FLXA 4DTPA 2VWJA 1NJZA 3K58A 4DQPA 1TAUA 4FJJA 4RW9A 4Y1CA 4CJTA 5KRSA 3NDKA 3NAEA 4FM2A 2HHXA 3TI0A 3NGZA 3HO1A 3OYAA 1BCOA 1VSFA 3U3GA 3AVAA 1VSDA 4E7LA 4AHRA 1HYZA 4CJUA 4FJKA 1JL2A 2YHAA 1LAWA 1S1VA 4I9LA 4HTUA 1Q9XA 1D9FA 2IGIA 1IKXA 4Z4IA 4NYFA 5HROA 2Z1JA 4FZXC 5KTQA 1Q9YA 4J2BA 2IDOA 4O5BA 3DLEA 4UQGA 4N47A 1B9FA 3AO2A 3AO1A 1TL3A 4BE1A 4DTOA 5J2PA 4ICLA 1EXQA 1KVBA 1VSLA 4CHNA 2DTUA 1S1XA 2BANA 4GVMA 5FROA 3EYZA 1TKDA 4KO0A 1KLNA 2LSNA 4B9SA 2G8VA 3T1AA 4CJQA 4E19A 3NH1A 2D5RA 5JS2A 4AHSA 4C8KA 4CHQA 2OZSA 3KKRA 4DS4A 1TK0A 1TGOA 4EP4A 4FLZA 4FJ5A 3V4IA 1HPZA 2YNGA 1XC9A 1RT4A 2GV9A 3ZT0A 5J1EA 4CFAA 3CG7A 3OS2A 3OYEA 4DWIA 4KHUA 1JXEA 2RF2A 4KHYA 4DSJA 4FJ7A 2HHWA 2IC3A 1NKCA 4FZYA 4M45A 1C1AA 5CZ1A 1T03A 4LSNA 4KHSA 2XY8A 4ID5A 1DLOA 3RRGA 1JLQA 1WSIA 1L3UA 2HVHA 3SNNA 1JLCA 5FRNA 1HYSA 4DSIA 3SUNA 1RTDA 3HJFA 4B8CA 1NOZA 1SL2A 4LD0A 2YNFA 4FW1A 3MXMA 2P5GA 1ASVA 2HHUA 1CXUA 4H8KA 1KCFA 1HYVA 1LW0A 2RKIA 4DFKA 3K2PA 4CJEA 2QK9A 1WLJA 3O4QA 3LPTA 3AVGA 3C94A 2BE2A 3QO9A 2A1RA 1UA1A 3F9KA 2OA8A 2B5JA 1U4BA 4FJGA 1BGXT 1KFDA 2HW3A 4M42A 5HBMA 1J9AA 1JL1A 2QXFA 5E41A 1TVRA 4FK2A 5HRRA 2KFNA 4IKFA 3QLHA 4OKEA 4CEFA 4Z4EA 2FBTA 3HYFA 4CJLA 3V81A 4HUFA 3RMCA 3AVKA 1RDDA 4FJ9A 3QEVA 1NJXA 2F8TA 1FK9A 1HQUA 4ZTFA 1Z26A 4BDZA 4CJSA 4DLGA 4DTUA 4FJXA 1F21A 1ASUA 3E01A 5K14A 5KGWA 3OJSA 3CFPA 3NBPA 3QIPA 4CK1A 4DU3A 1RDBA 1YTAA 1KFSA 3MXIA 2KZMA 1X9SA 5J2MA 3AVHA 3CYMA 4CF2A 1SUQA 3ITHA 3IAYA 1XHZA 1GOBA 3SUPA 1RBVA 3ZSZA 4B9UA 1XHXA 4DSFA 2IS3A 2P51A 4LH4A 1R0AA 4CIGA 2EHGA 4DTJA 3PV8A 1VSIA 4AHCA 2I5JA 3MAQA 4Y1DA 1VK0A 2DFFA 2E4LA 3VQ9A 2OPRA 1SL1A 2G8UA 3C6TA 1W9HA 3QNOA 2O4IA 3G10A 3L3VA 3KLIA 5HRPA 1NJWA 4C8MA 3LPUA 3RR8A 1JLGA 3S3MA 1QTMA 1EKEA 4KTZA 2X6SA 3SV3A 4Z0UA 3VQEA 4KKOA 1NOYA 1CZ9A 3AVMA 1IKYA 3AA2A 2RN2A 3L3UA 4O0IA 4R5PA 3LALA 3DOLA 3VQDA 5HRNA 4DU4A 1WNSA 1S6PA 2A1SA 2FC0A 4CJ3A 3K5MA 3AVFA 3DLRA 4ZHRA 4M3RA 3HPGA 3NE6A 3PX6A 2HHQA 4LY7A 3ZSWA 3DRSA 4F3OA 2HHVA 1CXQA 4J2EA 2GBZA 3KLEA 3OYBA 2VG7A 3OS0A 1TV6A 4CGJA 4CJKA 4FJ8A 5I42A 4Q0BA 4DFPA 4B8AB 1SV5A 1NKEA 3NF6A 1UWBA 4CHYA 4CGFA 4CF0A 4F8RA 4CGGA 4M3WA 1U47A 1HNIA 3I0RA 2NUBA 4CHZA 4B3OA 3TABA 2ZE2A 4O44A 4H4OA 4FLYA 2BDPA 2BGGA 3DOKA 3OJUA 3KK1A 1RBSA 4E0DA 4KTQA 5C25A 3AA4A 2JLEA 3AVNA 4M3UA 4EZ6A 1BIUA 1HQEA 1JLEA 2KTQA 1JLFA 4QAGA 4FZZA 1LW2A 1REVA 4CGHA 4L8RB 3MEDA 1X9MA 1RTHA 3TAEA 1G15A 1EP4A 3S3NA 1RT5A 4Q5VA 4Z4HA 3SJJA 4BWMA 3NGYA 4OGCA 4CJRA 4HUGA 1RBRA 1RT6A 4DMNA 4W5RA 1BCMA 4FLTA 4QCLA 3G0ZA 4DTMA 4O4GA 3NGIA 3AA5X 4KAZA 3B6PA 3V1OA 4PY5A 3MEGA 1VRUA 1WAFA 1A5VA 1C0MA 1VSJA 2XY6A 1TL1A 2KZZA 4AHVA 1IH7A 4NCAA 4KREA 3VQQA 3K5OA 3T19A 4J2DA 3KK2A 2GUIA 1RT2A 4FJIA 3KK3A 1YVUA 3L8BA 1GOAA 3VN5A 4JS5A 4NCBA 1T05A 2PYJA 4W5QA 4CEOA 3TAQA 1U48A 4G1QA 1Y97A 3THVA 4K8XA 1HMVA 1LWEA 3DRRA 1J54A 1S9GA 4Z4FA 1SKSA 4FM1A 3ZSVA 4DTRA 4O55A 4OKJA 3OYCA 2D0AA 2HNDA 4CESA 3VQ7A 3V9XA 2X6NA 3OS1A 2IAJA 1NK0A 4M3XA 1L3VA 3PUFA 2ITGA 4RW4A 3L2UA 3LDSA 1NK5A 1VSMA 3KLGA 3V9WA 3AVCA 3AV9A 1TKZA 4CF1A 4OLBA 4OPKA 2DFHA 1FXXA 4AHTA 5SZTA 3RR7A 3C95A 2Z1IA 5KI6A 4W5OA 4CECA 1FKPA 1X1PA 2Y1JA 3ISNC 3L2QA 1QQCA 5JS1A 4DTXA 4KHNA 2FBYA 5EU7A 3JSMA 1GOCA 1ZBUA 2D0BA 4M3YA 3K5NA 2XRIA 4E89A 4CEAA 3OYNA 4JRQA 1JLAA 2YNHA 4KHWA 5J2NA 2QKBA 4HVJA 4BE0A 3SI6A 1X9WA 1ZBHA 2X74A 3DMJA 4BE2A 3V9UA 4CERA 2KQ2A 1WSJA 4M3TA 3TWHA 3V1QA 3VQBA 4N76A 3HM9A 1D8YA 4IBNA 3OVNA 3ZT3A 3ALYA 3SUQA 1N6QA 3OYIA 1ZBIA 1VSKA 3ZSXA 1C1BA 3ZSYA 3U3YA 3AVBA 4DG1A 4I2PA 2P5OA 1U49A 4PWDA 3QINA 4AILC 2QKKA 2HHSA 3LZJA 3ULDA 1T7PA 4CE9A 3O4NA 1T8EA 3RRHA 1TAQA 2WOMA 1RT3A 1RTJA 2OPPA 4W5NA 1RCHA 3QEIA 3DRPA 4CJWA 2Y1IA 4FYDA 4CJPA 4FLVA 4PUOA 3QEPA 1ASWA 4DQSA 4FK4A 2ZQBA 4DF4A 1LAVA 3OYDA 5CZ2A 3F73A 4H4MA 3KLHA 3LAKA 4N5SA 3TANA 1SKWA 3ZT4A 4LSLA 3OYJA 1KTQA 4FLWA 2PZSA 1RBUA 3HSTB 4M3ZA 4B9VA 5CY4A 4CCHA 3M8SA 3DM2A 1JKHA 1D5AA 3L2RA 4DTSA 1ZYQA 1D9DA 1NK6A 3OYMA 4DSEA 1I39A 1ZBLA 3WNFA 4M41A 2G8HA 3DLBA 3LZIA 1BISA 4FM0A 3VQPA 3SV4A 1SKRA 1LV5A 3AVIA 3L2VA 2E6MA 4CIFA 3KD5E 3O3GA 4WE1A 4OPJA 5HP1A 3OYKA 1DTQA 3QETA 4KHQA 4FK0A 4O0JA 1HNVA 3NF9A 4B9MA 3HPHA 1VSEA 1WAJA 2JGUA 1KRPA 4J2AA 3TARA 4ZTJA 1SL0A 1UOCA 3SYZA 1CLQA 1Z25A 5KGXA 3D0PA 3PX4A 3WNHA 3I8DA 3QEWA 3NHGA 3BGRA 4E3SA 3LP3A 2YV0X 1DTTA 5KRTA 2HNYA 3OYFA 4JRPA 3ZT2A 3TAMA 4ELUA 1WSEA 4ELTA 4E7KA 4BDPA 2D0CA 3O3HA 3WNEA 4KRFA 3AA3A 3CM6A 4JS4A 1BHLA 3HK2A 2DY4A 1RT1A 2YKNA 2OYQA 3I0SA 4CEQA 4XIUA 2OPSA 3NF7A 2ETJA 4CFBA 1RTIA 1NK4A 3JYTA 1NKBA 3LWLA 4E7JA 3SUOA 2YKMA 3FFIA 3V9ZA 3AO5A 3B6OA 2PYLA 3PO5A 3CM5A 4DFMA 4B9LA 2Z1HA 1RDAA 2YNIA 3LP0A 4CF9A 3O3FA 4BACA 3CQ8A 4DQQA 4F2RA 3MXJA 3VQ8A 1U45A 3OYHA 1RILA 4E7HA 4CEBA 4B9NA 1UAXA 4B9TA 4GMJB 3NH0A 1EX4A 4E1MA 4FCYA 4RW8A 3NCIA 4HUEA 2ZD1A 4FVMA 1XWLA 3M8QA 4DQIA 3AVLA 3TAPA 2XY7A 3TAFA 3AO3A 5HRSA 3IRXA 3LWMA 3MEEA 4TSXA 4E1NA 1KVAA 3QEXA 2HVIA 1UA0A 3P83D 4YFUA 2F96A 4CHOA 5T7BA 3U6FA 2HB5A 3TAGA 3EZ5A 4HCCA 4EP5A 4ID1A 4NCGA 2G8FA 1L3SA 5SWMA 4OJRA 2KFZA 2YHBA 3CFRA 3C6UA 3NF8A 1A5XA 2Z1GA 2EX3A 3LANA 4HHTA 3HP9A 4KV8A 3S9HA 4B08A 4QOZB 4CK2A 3VA3A 1TK8A 4MFBA 1YTUA 5HLFA 4EZ9A 4I9QA 4KB1A 3L2WA 1MU2A 1FKOA 4JLHA 4CFDA 1QE1A 3LAMA 4CGDA 2KW4A 3A2FA 1IKVA 1QHTA 2Q3SA 3VQCA 3ZSOA 2ATQA 2F8SA 4PA1A 1RBTA 2B4JA 3H08A 4PQUA 2VG6A 4MQ3A 3VQ6A 3HL8A 2G8KA 2AJQA 1NK7A 4BWJA 4E7IA 2PY5A 5DMRA 1N5YA 1NJYA 3HVRA 5FDLA 2XHBA 1C6VA 3D45A 3VA0A 4F2SA 3SQ2A 4AH9A 2G8WA 3TR8A 4BDYA 4KPYA 3RTVA 3HVTA 4FJNA 3T3FA 1O1WA 4C8OA 4N41A 2XY5A 1CZBA 4CJ5A 4I2QA 1TK5A 3DLGA 3NFAA 2P1JA 3RMDA 4DSKA 3ZSRA 1B9DA 3ZT1A 3DI6A 1C0UA 2XO7A 2OZMA 2W42A 3MECA 2OPQA 1BL3A 4ELVA 3NH2A 1S6QA 3OY9A 1WSGA 5C42A 3SQ4A 1Q8IA 1LWCA 3PX0A 1QSLA 2HHTA 4CEZA 1NK8A 4Z4CA 3VQAA 1I3AA 2HMIA 4CJFA 4DTNA 3OYGA 1JXBA 4OGEA 1S9EA 3K57A 4K8ZA 2RPIA 4GW6A 4DFJA 1TKTA 5D3GA 4CGIA 3ZSQA 1NK9A 2IOCA 3PY8A 3HT3A 1KVCA 4IG0A 3QESA 1KSPA 1K6YA 4C8LA 3HP6A 1S1WA 1L3TA 3M8PA 1XI1A 1VRTA 3EY1A 3K5LA 1B92A 4IDKA 1S1TA 1A5WA 1TKXA 3LP2A 2R7YA 3SQ1A 1S5JA 4F4KA 3VQ5A 5I3UA 1BQNA 1HJRA 2O4GA 4NYNA 1WSFA 3ZCMA 3V9SA 4RG8A 4IG3A 1QSYA 1QS4A 4HCBA 4FJHA 4Z4GA 3IG1A 4CEEA 3DLKA 3SZ2A 5C24A 4DS5A 3DLHA 3UIQA 1KLMA 2G8IA 1S1UA 4CF8A 5DK5A 4KI4A 4N56A 3IS9A 4C8NA 1LWFA 1ZBFA 4YNQA 4KI6A 3QERA 1HRHA 1WN7A 4CJ4A 2X78A 1RDCA 4FW2A 1RNHA 3SCXA 3AVJA 5CYMA 1ITGA 2FBVA 4KB0A 1BIZA 3S3OA 4DU1A 1RT7A 1BQMA 1W0HA 3WNGA 3KD1E 1IG9A 4FLUA 1EETA 3KTQA 1VSHA
chains in the Genus database with same CATH superfamily
1C1CA 2P9PA 5FPNA 5J2QA 3QIOA 1BI4A 1WSHA 1KC8O 1ATNA 3HPOA 2DFEA 2ZF5O 2FF6A 3K59A 4DV1K 4LH5A 3QNNA 2FBXA 3V6DA 1NGAA 4IZ9A 3KIOA 2B6AA 3ASMA 1D4XA 4CJVA 1YT3A 4OVLA 4DLEA 1IO2A 4KFBA 1U2VA 3ID6A 3KJVA 1QSSA 2VG5A 2WUSA 4H0PA 4B9QA 3ID8A 1L5UA 3D2EA 3P5JA 3QFUA 4DQRA 4FLXA 4RW9A 5KRSA 2D4WA 3RSEB 3TI0A 3P31A 3A5LC 1VSDA 4AHRA 4FJKA 1D9FA 1ZXOA 2IGIA 3L6QA 1IKXA 2P9LB 5AQWA 1OVYA 4O5BA 3DLEA 4ILGB 4N47A 1B9FA 1J5EK 4ISGA 2DTUA 4H5WA 5C2DA 1KLNA 4JYAK 4CVNE 2G8VA 3T1AA 4PHTX 5JS2A 3SAHA 5AQKA 1TK0A 1ATSA 4FJ5A 1HPZA 5FPDA 1W7AA 4B3SK 4LF6K 3VTHA 4DSJA 4FJ7A 5AQNA 3MK6A 5CZ1A 1GLCG 4FWRA 3CPWM 3RRGA 1NBWA 1L3UA 3SNNA 1HYSA 1RTDA 4FPBA 4PKHA 2P5GA 3H45C 3PIPL 2NRXA 3O1WA 4F3TA 2W41A 4WFNL 2OA8A 3AVGA 2BE2A 1JCGA 3RSEA 3F9KA 1RGIA 3CC7N 2HW3A 5HBMA 3VMFB 4FK2A 4IKFA 2IVNA 3QLHA 4ILHA 3HYFA 4CJLA 3BF1A 1HQUA 4ZTFA 3T69A 3OTOK 1F21A 1LCUA 5KGWA 4DU3A 3MXIA 5E26A 1X9SA 5J2MA 3AVHA 1YJNN 3IAYA 1GOBA 3SUPA 3ZSZA 2P51A 4CIGA 3PV8A 1MWMA 4BGAA 4BGBA 3O4WA 3NMUA 3KK7A 5KPZA 1NGDA 4KH6A 3KLIA 5AQTA 4WQ5C 5HRPA 4LF9K 3RR8A 1GLFO 1JLGA 3S3MA 1QTMA 2X6SA 3SV3A 4Z0UA 4O0IA 3L3UA 4R79A 4R5PA 5HRNA 3C7NA 3U8XA 3VESA 3ZLJA 2A1SA 3BP8A 2A3ZA 5FLXO 4ZHRA 3WXMB 4LY7A 1NG9A 4B1UB 3DRSA 1CXQA 4JK7A 5BPMA 3Q7BA 1VAZA 4EIAA 4FVUA 4AM7A 4FJ8A 5I42A 4Q0BA 1NKEA 4M3WA 4XH1A 4A5BA 1CZAN 3THWB 2BGGA 3OJUA 3Q7CA 3KK1A 4E0DA 1VQMN 5C25A 1HQEA 2ZGYA 2KTQA 1JLFA 2PBDA 4JD2B 5AZJB 1BOTO 4L8RB 2F9TA 3MEDA 3T1YK 3CXCM 1X9MA 4IO8A 2GX9A 4EHTA 3NVMA 2QWPA 3THYB 3TAEA 1EP4A 2FSKA 1RT5A 5KQ8A 3NGYA 4OGCA 2V51B 4QCLA 3E9OA 2QXLA 4DTMA 4OX9K 2NRTA 1GLDG 4OPHA 3THXB 4KREA 3K5OA 3T19A 1RT2A 4KBOA 1GOAA 4JS5A 4NCBA 4BRHA 3VF4A 1U48A 4G1QA 1Y97A 5BRHA 4RWTA 4K8XA 1HMVA 3LDPA 5EY4A 1SKSA 4DTRA 4H0OA 3OYCA 1YXQA 2D1KA 3PUFA 1SAZA 5CR4A 1NK5A 5GAEP 3KLGA 3AVCA 3R6MA 4OPKA 3DAWA 2DFHA 5SZTA 5E84A 4CECA 3L2QA 4DTXA 4KHNA 4YY3K 1S22A 1ZBUA 3H46O 1OH5A 4M3YA 4KHWA 4MLHA 4HVJA 3AARA 1ZBHA 3DMJA 4BE2A 2KQ2A 3C7NB 5M1KA 4NLCA 3HM9A 1M1KO 3OYIA 1C1BA 3ZSYA 4GKKK 4PWDA 3QINA 2IVPA 4I6MB 3FZFA 1TAQA 2WOMA 1RCHA 2Y1IA 4PUOA 2P9UA 4MDAA 2ZQBA 3QB0A 5TKYA 3F73A 2Q0RA 3LAKA 4N5SA 4LSLA 3OYJA 2HBLA 2ZJQL 4B9VA 3JS6A 3M8SA 1D5AA 1NK6A 4DSEA 1I39A 1ZBLA 3D2FB 3N4QA 4M41A 2G8HA 3VGLA 3DLBA 4JKBA 4K0KK 3EEQA 4FM0A 5GIPA 1SKRA 3L2VA 1LV5A 4CIFA 5HP1A 1P90A 2O8CA 1DKGD 2IIRA 4KHQA 1IBMK 1ILYA 3HI0A 1BU6O 1YAGA 3TARA 2WTUA 1UOCA 3SYZA 1Z25A 2UXDK 3I8DA 3QEWA 1TYQA 4E3SA 2NRVA 3OYFA 2QWMA 3ZT2A 3TAMA 1WSEA 3WNEA 3WEEB 1BHLA 4XIUA 3OA9A 4CFBA 1NK4A 2RE2A 3I56N 2HF4A 2E2OA 3SUOA 2YKMA 3FFIA 2PYLA 3B6OA 3CM5A 4DFMA 4B9LA 2GTDA 1RDAA 2YNIA 3LP0A 4CF9A 3CCVN 1N32K 4F2RA 4O8UA 3OYHA 1RILA 2JWKA 3MN5A 3O80A 4B9NA 1VQLN 4LF7K 3MCAB 1EX4A 2UU9K 3HM8A 5AQYA 1XWLA 1EWQA 3AVLA 2XY7A 3TAFA 2W40A 5HRSA 5H1SQ 2QI2A 4K41A 4H5RA 1KVAA 4A5AA 4DV6K 2F96A 4CHOA 3U6FA 3EZ5A 4LFBK 5M1NA 2ZM6K 3C0BA 3CFRA 2KFZA 1NGHA 3C6UA 4FWSA 4IEEA 5BR8K 4B08A 4QOZB 1U2VB 1TK8A 3SMSA 5AQSA 4JKDA 1MU2A 4JLHA 3LAMA 4C1NK 3VQCA 2ZJRL 1LOTB 1RBTA 3FZHA 3H08A 2VG6A 4MQ3A 3HL8A 4B3TK 1XC3A 5LL6Z 3HVRA 1NNEA 1C6VA 3D45A 4KPYA 3RTVA 4YOWA 2O8CB 3T3FA 2XY5A 2NRZA 4BR9A 1VQKN 4I2QA 2P9NA 1HNWK 5EOYA 2O8EB 1B9DA 3ZT1A 5CE3A 3MECA 4PL8A 2OPQA 1MDUB 2QEXN 1VQ4N 3OY9A 3PX0A 1Q8IA 2HHTA 4CEZA 4Z4CA 3QDKA 4IJNA 3GG4A 2QW9A 4CJFA 4EHUA 4DTNA 2RHKA 4JHDA 5GAGP 1S9EA 1TKTA 5D3GA 2WFBA 3ZSQA 3MX5A 4B3MK 4BR4A 3QESA 1XUPO 1XI1A 4BC5A 1VRTA 3EY1A 3K5LA 1B92A 3FE1A 2UUBK 3EE8A 1NGJA 1S1TA 1S5JA 4B3RK 5I3UA 4JK9A 1NGEA 3ZCMA 3V9SA 3VF6A 4CJ7A 1YHQN 5C24A 4DS5A 3UIQA 4DUYK 4DR5K 1S1UA 1ZBFA 2Q0UA 3QERA 1HRHA 2CGKA 3M1FA 4FW2A 4U7BA 3WQTA 1YJWN 1BQMA 1W0HA 5GINA 4FLUA 1OH6A 4DR7K 3RMAA 4CEDA 1QQOA 3FZKA 4IFVA 4KTWA 4CFCA 1U04A 5BRDA 3WXIA 4FJMA 2H3GX 2P9PB 3LP1A 1J5OA 4CHPA 3BUZB 3KLFA 2WONA 1GLAG 1X9JA 4DF8A 3HRGA 3EO3A 3R8EA 4I7FA 1IBLK 3ULEA 4FJLA 3TSQA 3D6RA 3UKUB 4CK3A 1J53A 3J7YP 4DTPA 2VWJA 3K58A 1TAUA 1J6ZA 3KWIA 4FJJA 3NAEA 3NDKA 1VSFA 3U3GA 3R3LA 3AVAA 4CJUA 3A8YA 2QWLA 2YHAA 1S1VA 2W6LA 4FZXC 5MLCQ 2UXBK 5KTQA 1Q9YA 1NWKA 4BG8A 5J2PA 4CHNA 1EXQA 1VSLA 3AY9A 1NGGA 1O13A 3MX2A 4GVMA 5FROA 1WBBA 1TKDA 3QICA 4B9SA 3A5MC 5AQXA 2OZSA 3K9JA 4DV2K 4CHQA 1OKJA 2QWRA 4EP4A 4FPAA 4DV4K 1WBDA 4KHUA 2RF2A 4FZYA 5ADXA 4KH5A 2XY8A 4ID5A 2HVHA 5FRNA 4M7YA 3HOTA 3SUNA 3HJFA 4B8CA 4DR1K 2NNWA 3AAQA 3THYA 1JJ2M 4CZGA 1HYVA 4DFKA 3DXMA 3K2PA 3SLCA 3O4QA 4CJEA 3LPTA 1VQNN 3C94A 4BG9A 1UA1A 3ULEB 1JCEA 2E1ZA 1KFDA 2Q31A 4BREA 4JI6K 3CQYA 5JVHL 1TVRA 4B1ZA 1X3MA 1KQSM 4CEFA 3VEWA 4Z4EA 4FJ9A 3AVKA 1RDDA 1U6ZA 2OTJN 3TTCA 4CJSA 4DLGA 3E01A 2FSNA 3NBPA 4CK1A 2PAVA 1YF5L 4DQ8A 1SUQA 4MDBA 1RBVA 1XHXA 2IS3A 1R0AA 2VGNA 2EHGA 1VSIA 1VK0A 3KZBA 5C2FA 2OPRA 2G8UA 5IWAK 3DJCA 4BR0A 5JVGL 1NJWA 4YOXA 5EVZA 3AAPA 4KTZA 2WBNA 3CERA 4KKOA 3AA2A 2RN2A 5AR0A 4O5FA 5AFUH 3DOLA 3HOSA 1N34K 4BRGA 2A6AA 4DU4A 1EQYA 4G9ZA 2FC0A 4U67L 2GELA 3AVFA 3DLRA 4Y0WA 4M3RA 2YJFA 3HPGA 1EWRA 3PIOL 2NLXA 3O5BA 3OYBA 3OS0A 1TV6A 4DB3A 4DFPA 4B8AB 3CHWA 4CHYA 4JKGB 4B1WB 1U47A 3CI5A 2NUBA 4CHZA 2HF3A 4O44A 4EAHD 3KVGA 4DV5K 3MWPA 4KTQA 1HUXA 3THXA 4CD1A 3ZX0A 1HJOA 4EZ6A 1JCFA 1G99A 4FZZA 1REVA 4CGHA 2HSTA 1XQSC 3CMEN 1BG3A 3S3NA 4Z4HA 3IDHA 5EXWA 3O6WA 4BRMA 4W5RA 1BCMA 3VGMA 3IFRA 3AA5X 3V1OA 3MEGA 1A5VA 3GBTA 1TL1A 4MLEA 2XY6A 3O9SA 5LMUK 4NCAA 3VQQA 1IV0A 3L8BA 4GKJK 4W5QA 3TAQA 3THVA 1LWEA 1S9GA 3DXKB 4FM1A 4CZLA 4O55A 2HNDA 3V9XA 2HBKA 2IAJA 4YOTA 3B8AX 4RW4A 3LDSA 4IXCA 4OLBA 4AQYK 1HNXK 5AQPA 5KI6A 5JS1A 3NVKA 3TSUA 2QWNA 3E9PA 2D0BA 2E88A 3LDLA 5BREA 2XRIA 4E89A 2QKBA 2AP1A 3JAMO 3SI6A 3PLAA 3LL3A 4JK8A 1WOQA 4M3TA 2FXUA 4CI6A 3TWHA 3R9PA 3A0IX 5AQJA 4BRAA 3ALYA 3VOVA 4AILC 3N4PA 3O4NA 3RRHA 2OPPA 1RTJA 2D0OA 4W5NA 5JICA 2OCEA 2GWKA 1QHAA 3F5TA 4DQSA 3OYDA 1SKWA 4FLWA 3HSTB 2HBMA 3DM2A 2ASOA 1RFQA 4H0VB 4B1XB 3VQPA 3SV4A 3KD5E 4DR4K 3O3GA 2F9WA 1DTQA 1K8KA 3OYKA 3QETA 3EL2A 4O0JA 2O8EA 4A61A 1HNVA 2HOEA 4B9MA 4JI1K 4JHDB 3VEYA 1VSEA 1VQPN 2JGUA 4J2AA 1K8AO 3TU5A 3I55N 2DPNA 5C12A 1CLQA 5KGXA 3PX4A 3WNHA 4CZEA 2O8DA 3CCSN 4FWNA 3LP3A 1DTTA 4CD3A 4JRPA 3E1YA 4X64K 4BC2A 1KD1O 4ELUA 1IG8A 3O3HA 3AA3A 3CM6A 4JS4A 4JD2A 2OYQA 2P9IA 4CEQA 2OPSA 4WQ4A 3ZETA 3VTIA 3AO5A 3CCJN 1KXPA 2YHYA 3LDOA 3CCRN 3O3FA 3CQ8A 4DQQA 3MXJA 4YDUA 1U45A 1K9MO 5AQUA 3CPEA 1UAXA 3SJHA 1QVGM 4FOIA 4HUEA 1C0FA 4BC3A 4OO1J 4GV3A 3T1HK 4XH5A 3IRXA 5LY3A 1Q18A 4TSXA 3QEXA 3CJ9A 3TTDA 3F2KA 1NGCA 3CCUN 2YHBA 1IBKK 3NF8A 1A5XA 1SS6A 2I7NA 2EX3A 4HHTA 1QQNA 4CK2A 4KB1A 4QS7A 3L2WA 4CFDA 2I7PA 4CBXA 3UKUA 3UB5A 4A2BA 3ZSOA 2F8SA 1VQON 2B4JA 2A40A 4OPAA 4DHYA 2AJQA 2PY5A 1T3VA 3F9MA 1NJYA 3O9TA 4FO0A 3MCPA 4F2SA 3SQ2A 3TR8A 1K8KB 4FJNA 1T6DA 4CJ5A 4DSKA 3CJAA 5AQMA 4ISFA 5BPLA 2VCPA 2OZMA 1VHXA 4JKGA 3NH2A 5C42A 1BDGA 1NU0A 4FWOA 4BQLA 2OANA 4OGEA 4K8ZA 2RPIA 4DFJA 2KKZA 4CGIA 1NGBA 1NK9A 5DM6L 2YHWA 3WXKA 4C23A 1K6YA 1L3TA 1S1WA 4RCHA 3WXLA 4IDKA 1TKXA 3ZX3A 3CF5L 1BUPA 3CJBA 4EFHA 4FJHA 4LC9B 4H03B 3DLKA 1N33K 3DLHA 1KLMA 2BH1A 4KI4A 4C8NA 5LJWA 1RDCA 5CYMA 4FWKA 4JKCA 1ITGA 3SBTA 1BIZA 4BR5A 2HBJA 1RT7A 3KD1E 1WB9A 1IG9A 3CC2N 1EETA 4PKGA 4IDHA 4RW6A 3KKSA 4FXDA 1IKWA 4ILJA 4YHHK 5F0XA 3CFOA 3SPZA 4DCHA 4DUZK 4DSLA 3BF3A 3CJ7A 4IFYA 2VWKA 4A62A 3DYAA 4RW7A 1H1VA 4JKAA 2QA4N 3BDPA 5TKWA 3RWUA 2E6LA 3IMXA 3W0LA 1DEJA 2P9SB 3HZ6A 1ESVA 5BN8A 4M7XA 3R1XA 4OKKA 5CYQA 2E5LK 3OYLA 1VQ9N 4FWLA 4AHUA 3SPYA 2YX6A 3CD6N 1NJZA 4Y1CA 4CJTA 4FM2A 3NGZA 4CBWA 2V7ZA 2UYTA 1JL2A 1QZ5A 3ZYYX 4I9LA 1HKBA 1LAWA 4HTUA 1Q9XA 4DR3K 4NYFA 5HROA 2Z1JA 4UQGA 2NRRA 3AO2A 3AO1A 1EO1A 1TL3A 4BE1A 4DTOA 4ICLA 1KVBA 3GOIA 4NXNK 1VQ8N 4KO0A 2LSNA 4E19A 3NH1A 4AHSA 1S72N 1OH7A 3KKRA 4DS4A 1TGOA 4FLZA 3V4IA 2YNGA 3BY5A 3CC4N 3ZT0A 3CG7A 3CCEN 2IC3A 4H0TB 1C1AA 3I8BA 1T03A 3J7ZO 4JAXA 4LSNA 1JLQA 4J8FA 1JLCA 1IJJA 1HX1A 4WFBL 3UKRA 1NOZA 4IEIA 5BN9A 1SL2A 3MXMA 4FW1A 3WUHA 3J80O 4H8KA 5AQZA 2RKIA 2QK9A 1WLJA 3HO1A 2A1RA 1BGXT 2CGJA 1GLJO 5B8HA 2QXFA 3P4IA 1NMDA 4JV5K 2KFNA 4H5NA 4JKFA 4OKEA 3V81A 3RMCA 2F8TA 3QEVA 1FK9A 1Z26A 4BDZA 4DTUA 4FJXA 5K14A 1Y64A 2QWOA 3QIPA 4BVPA 1YTAA 3VEZA 2KZMA 3QFPA 2QTDA 4CF2A 1XHZA 4B9UA 4LH4A 1VQ7N 4DTJA 4AHCA 2I5JA 3MAQA 4Y1DA 2E4LA 1SL1A 3VEOA 3C6TA 1W9HA 2O4IA 3E66A 3G10A 3WXJA 3L3VA 4QS8A 1RDUA 4K25A 3VQEA 4MO4A 4FWQA 1NOYA 1CZ9A 2ZGZA 1IKYA 3AVMA 5AZJA 2UUAK 1WUAA 3U4LA 3VQDA 2CGLA 1WNSA 3LM9A 4CW7B 3MN9A 3PX6A 2HHQA 4K43A 3ZSWA 4F3OA 2HHVA 4J2EA 1BWFO 2GBZA 4DKWA 2VG7A 1E4GT 4HTLA 4CJKA 1SV5A 3NF6A 1UWBA 1SQKA 1NM1A 1YJ9N 4JI8K 3TABA 4H4OA 1TYQB 3CJ1A 3AA4A 2JLEA 5ELZA 4QAGA 1HNZK 3VGKA 2O8DB 1LW2A 3IUCA 2FSJA 2P9NB 1R59O 4NO7A 5F1XA 3SJJA 2VQFK 3TSPA 2A42A 4HUGA 1RBRA 4DMNA 3G0ZA 4O4GA 4WQ4C 2P9SA 4KAZA 3B6PA 1TUUA 1VSJA 1WAFA 1C0MA 2KZZA 4JN4A 4CZMA 4Z94A 4CBUA 4FJIA 3KK3A 2GEMA 1YVUA 3VN5A 1BO5O 2PYJA 4CZKA 3DRRA 1J54A 5AQHA 3G6EN 4CESA 1XMQK 3VQ7A 1NK0A 2X6NA 5AQIA 3OS1A 4M3XA 1L3VA 3L2UA 3O9RA 1MA9B 3V9WA 3SMPA 1TKZA 4CF1A 1YIJN 3L4QA 2OTLN 3OHRA 4W5OA 1X1PA 3ISNC 1QQCA 2VGMA 2FBYA 1GOCA 2CH6A 5AQGA 3OYNA 4CEAA 3BEXA 1JLAA 1Z05A 2YNHA 1XMOK 1YVNA 5J2NA 4BE0A 2P9KB 5GAHP 4JI5K 1WSJA 1VQ6N 3PSIA 3VQBA 4N76A 4FOEA 1D8YA 4IBNA 3OVNA 3ZT3A 3SUQA 1N6QA 3ZEUA 3ZSXA 3U3YA 3P38A 4I2PA 2P5OA 5AQOA 1U49A 3SBGA 2HHSA 3LZJA 3ULDA 1GLLO 3FLCO 4CE9A 4JNEA 1T7PA 4GV9A 1FW6A 3QEIA 3VERA 2F4VK 4FYDA 4RTFD 3VENA 3QEPA 4WQ5A 4FK4A 4DF4A 3KLHA 3ZT4A 2PZSA 4CCHA 1D9DA 5IT9O 3C6AA 2V7YA 1OVQA 4OPJA 5C10A 4FK0A 3H6EA 4BRLA 3NF9A 3HPHA 2D0PA 4BQZA 1WAJA 1KRPA 4ZTJA 1SL0A 3D0PA 3NHGA 3BGRA 3ZX2A 5KRTA 2IVOA 3C65A 1P8ZA 4FWMA 4M63C 3J7AP 4DR2K 1HPMA 4ISEA 2DY4A 1RT1A 4FSVA 3I0SA 3NF7A 2ETJA 1RTIA 3JYTA 1V4SA 3G71N 3LWLA 3J81O 3FGUA 3ENHA 4BACA 5ADXH 4H5TA 4E7HA 4CZFA 3SAGA 3H1QA 4B9TA 3D2EB 4RW8A 2ZD1A 4FVMA 3TAPA 3HSCA 3AO3A 3QBWA 3G4SN 1UA0A 3P83D 3K0SA 3TAGA 4MO5A 1C0GA 5AZIB 2G8FA 4BY9C 5GADP 5SWMA 1L3SA 1N8RO 3KHYA 3DLLL 4KV8A 1YTUA 4CZIA 5HLFA 1FKOA 2KW4A 1QQMA 4PA1A 4XH4A 4BRFA 4PQUA 3ENOA 1DGKN 5AQQA 1NK7A 1TUYA 5FDLA 2XHBA 3TPQA 5M1QA 2V52B 4BR7A 2G8WA 3HVTA 3VF2A 1O1WA 4C8OA 1CZBA 2P1JA 3RMDA 1MWKA 5AQRA 2E20A 4BRNA 5AFUA 3FZLA 3UE5A 3SQ4A 1NK8A 3FFKB 3VQAA 1I3AA 4A2AA 4BROA 2NRWA 2WC9A 3CETA 2Q2RA 2O8FB 2FF3B 3D7EO 3K57A 3BZKA 3THWA 3PSFA 5F2RA 4A59A 4IG0A 3QBXA 3HP6A 5HL7L 3H3OB 2O8FA 2R7YA 1A5WA 3LP2A 3SQ1A 3CCMN 4CZJA 4QS9A 4DV0K 2O4GA 1WSFA 4A57A 1QSYA 4Z4GA 3EN9A 4CEEA 1BA0A 3KWGA 3TTFA 4N56A 3IS9A 4FWPA 1LWFA 4YNQA 4KI6A 2X78A 1RNHA 5HOOA 2A41A 2FBVA 4F9OA 4KB0A 3S3OA 1I94K 3WNGA 3KTQA 1VSHA 1HKGA 3OBWA 4CIEA 1JLBA 4IFEA 5FRMA 4IOAL 5AJ3K 3CJCA 3M6GA 2QWQA 2O8BA 1C0TA 3P1GA 3V1RA 4W5TA 3SQ0A 2UXCK 1E4FT 2YCHA 2FLOA 3RMBA 4XEIA 4OLAA 2HNZA 5M1PA 3HXMA 3PO4A 1BI4B 3VQ4A 4DWIA 3AO4A 3M8RA 3SAFA 4DQPA 1X3NA 2HHXA 1ATRA 3OYAA 1BCOA 4PKIA 4E1JA 4E7LA 1HYZA 1XNQK 4IO9L 5JMVA 4Z4IA 5LMNK 4J2BA 2IDOA 3HTVA 1S1XA 2BANA 3EYZA 4JI3K 3CMAN 4CJQA 2D5RA 4C8KA 3IKMA 2A5XA 2GUPA 1XC9A 1RT4A 2GV9A 4GNIA 5J1EA 4CFAA 3OS2A 3OYEA 3T7ZA 4KHYA 1JXEA 2HHWA 1NKCA 4KH4A 4M45A 3OW2M 3M3ZA 4LF8K 4KHSA 1DLOA 1WSIA 1Q81O 5AQVA 4X66K 4K42A 4DSIA 1Z6RA 4BVOA 4O8KA 4LD0A 5M1OA 2YNFA 1ASVA 2HHUA 2HHHK 3O9QA 1CXUA 4V19S 1KCFA 1LW0A 3QMLA 3QO9A 4BRPA 2B5JA 1U4BA 4FJGA 4M42A 1J9AA 2E2PA 2P9UB 1JL1A 3P39A 5KPRA 5M1FA 5E41A 5HRRA 2FBTA 3ATUA 3HBTA 4HUFA 3I33A 3O8MA 1NJXA 4BR2A 5A2QO 1YUWA 1ASUA 1W2BM 3OJSA 3CFPA 1RDBA 4NB4A 1KFSA 2GWJA 3CYMA 3ITHA 3VEXA 1K73O 2YI1A 3L0QA 4DSFA 3VPZA 1T6CA 4JEPA 2AA4A 3RVCA 4YOUA 2DFFA 5JLFA 3VQ9A 5BRFA 1M90O 4DV3K 3QNOA 3GDQA 4C8MA 3LPUA 1EKEA 2P9KA 2NRHA 5FPMA 3LALA 3EE9A 4JKHA 1S6PA 3JXUA 3K5MA 4CJ3A 3NE6A 4X65K 3O9UA 4WYBA 3KLEA 5JLHA 4CGJA 3VEVA 3WEEA 4F8RA 3U9DA 4JI2K 4CF0A 4CGGA 4CGFA 1HNIA 3I0RA 4B3OA 1Q86O 1YI2N 3WQUA 2ZE2A 4FLYA 2BDPA 2YHXA 3DOKA 1RBSA 3OBYA 3AGRA 3AVNA 4M3UA 1BIUA 1JLEA 1HLUA 2ITMA 2BUPA 4JI4K 2JWLA 1T44A 4LF5K 1RTHA 1KAXA 1G15A 3VETA 4Q5VA 4BWMA 1GLEG 3BZCA 4CJRA 4JI0K 4FLTA 1RT6A 1HKCA 1RDWX 1OH8A 3NGIA 1QZ6A 4NLBA 4PY5A 1VRUA 4AHVA 1IH7A 2P9LA 4BRDA 4J2DA 3KK2A 2GUIA 1Q82O 1T05A 4CEOA 5C15A 3DWLA 4Z4FA 3ZSVA 4H0YB 4OKJA 2D0AA 4BRIA 4WCEL 1QVFM 2ITGA 3L4IA 1NLVA 1VSMA 2KHOA 2Q1NA 3AV9A 4AHTA 1FXXA 3RR7A 3C95A 2Z1IA 1FKPA 4H5VA 2Y1JA 5EU7A 5BR9A 3JSMA 4GY2B 3M5RA 3K5NA 4JRQA 4YORA 3CCLN 1X9WA 2X74A 2ZWHA 4CZHA 3V9UA 4CERA 1GLBG 3V1QA 3ZEUB 5AZIA 1ZBIA 3UKRB 1VSKA 3ZETB 3AVBA 4DG1A 5FPEA 2HMPA 4BRQA 2QKKA 3K9KA 4HWIA 4PL7A 1YITN 1T8EA 4L3QA 1RT3A 4IJAA 1KAZA 3WT0A 3DRPA 4AM6A 1KAYA 4IOXA 3J8AA 4AF1A 4CJWA 4CJPA 4FLVA 1XNRK 4FL9A 1ASWA 2QM1A 1LAVA 3TANA 5CZ2A 4H4MA 3MWTA 2F7TA 1KTQA 2P9IB 3H3NO 1RBUA 4M3ZA 5CY4A 3ATVA 1JKHA 2BTFA 3GE1A 5EX5A 4BRCA 3L2RA 4DTSA 3A5OC 1ZYQA 4B1YB 2Q97A 3OYMA 4LF4K 3C6HA 3WNFA 2YJEA 3LZIA 1BISA 3AVIA 2E6MA 4WE1A 1E3MA 3GL1A 4YDUC 3DXMB 3O08A 4YOVA 4DV7K 1W97L 4YOYA 2ASPA 2J4RA 3CQXA 4B1VA 2YV0X 3MN6A 2Q36A 3LDQA 2HNYA 4BRKA 1NGIA 3LM2A 4ELTA 4E7KA 2UUCK 4BDPA 3MDQA 2D0CA 3SK3A 3MN7A 4KRFA 3HK2A 5LJVA 1BA1A 2YKNA 1N36K 2E2QA 1NKBA 4E7JA 3V9ZA 3PO5A 3O1BA 2Z1HA 5KQDA 4IOCL 1DT9A 1NJIO 3VQ8A 4NXMK 2E2NA 4CEBA 2PFUA 3EKSA 3FZMA 4GMJB 3NH0A 4E1MA 4FCYA 3NCIA 1VQ5N 3M8QA 4DQIA 3LWMA 3E9LA 4X62K 4BC4A 3MEEA 4E1NA 2HVIA 4LFCK 4C1NI 5AQLA 4YFUA 5T7BA 2HB5A 4H0XB 4HCCA 3FR0A 4EP5A 4ID1A 4NCGA 4OJRA 2O8BB 3G25A 2Z1GA 3S41A 3ENBA 3LANA 3HP9A 3S9HA 1NMNA 1ZC6A 3VA3A 2CH5A 4MFBA 2ASMA 4EZ9A 4GVEA 4I9QA 3U9ZA 3A5NC 3EZWA 1QE1A 5C0YA 4CGDA 3A2FA 1Q7YO 1IKVA 1QHTA 2Q3SA 2ATQA 3DXKA 2ZJPL 2NZTA 5AQFA 5BPNA 4UY8O 3VQ6A 2G8KA 2W6KA 4BWJA 4E7IA 5DMRA 1N5YA 1S3XA 5DM7L 4WF9L 3VA0A 4AH9A 4BDYA 4DR6K 1HR0K 4GV6A 4N41A 2E1YA 1TK5A 3DLGA 3NFAA 3D2FA 3ZSRA 3EKUA 3DI6A 1C0UA 2XO7A 2W42A 1BL3A 2EWSA 4ELVA 4JI7K 1S6QA 3MMVA 1WSGA 1LWCA 1QSLA 2HMIA 3H1VX 3OYGA 1JXBA 5CHIA 4GW6A 5GIOA 3AGKA 3CCQN 4LFAK 2VYPA 4I6MA 1FJGK 2IOCA 3PY8A 3HT3A 1KVCA 1KSPA 4C8LA 3M8PA 3W3DA 4F4KA 3VQ5A 1BQNA 1HJRA 4NYNA 4RG8A 4IG3A 1QS4A 4HCBA 4WFAL 3IG1A 3SZ2A 4KHPK 5KPTA 2E8AA 1V4TA 2G8IA 2VQEK 4CF8A 5DK5A 1ZBSA 2VWBA 1NGFA 1WN7A 1SZ2A 4CJ4A 3SCXA 3AVJA 4IWVA 4JKEA 4DU1A 5I9EB 3LDNA 2KLAA 3CIPA
chains in the Genus database with same CATH topology
1C1CA 4RW6A 4F3TA 3KKSA 5J2QA 3QIOA 4CIEA 1BI4A 1JLBA 1WSHA 4CEDA 3RMAA 4FXDA 1IKWA 5FRMA 4IFVA 3CFOA 4KTWA 4CFCA 1U04A 3HPOA 2DFEA 3SPZA 3K59A 4DSLA 4FJMA 4IFYA 2VWKA 3LP1A 4LH5A 2FBXA 3QNNA 3V6DA 3DYAA 1C0TA 4RW7A 3P1GA 3KIOA 3V1RA 3BDPA 2B6AA 3ASMA 3RWUA 2E6LA 4CJVA 4W5TA 3SQ0A 1YT3A 4OVLA 4CHPA 4DLEA 3KLFA 1J5OA 2WONA 4DF8A 1IO2A 3RMBA 4KFBA 4I7FA 3KJVA 1QSSA 4OLAA 4OKKA 2VG5A 5CYQA 2HNZA 3OYLA 3HXMA 4FJLA 1L5UA 3PO4A 3P5JA 4AHUA 1BI4B 4CK3A 3VQ4A 4DQRA 1J53A 3SPYA 3AO4A 3M8RA 4FLXA 4DTPA 2VWJA 1NJZA 3K58A 4DQPA 1TAUA 4FJJA 4RW9A 4Y1CA 4CJTA 5KRSA 3NDKA 3NAEA 4FM2A 2HHXA 3TI0A 3NGZA 3HO1A 3OYAA 1BCOA 1VSFA 3U3GA 3AVAA 1VSDA 4E7LA 4AHRA 1HYZA 4CJUA 4FJKA 1JL2A 2YHAA 1LAWA 1S1VA 4I9LA 4HTUA 1Q9XA 1D9FA 2IGIA 1IKXA 4Z4IA 4NYFA 5HROA 2Z1JA 4FZXC 5KTQA 1Q9YA 4J2BA 2IDOA 4O5BA 3DLEA 4UQGA 4N47A 1B9FA 3AO2A 3AO1A 1TL3A 4BE1A 4DTOA 5J2PA 4ICLA 1EXQA 1KVBA 1VSLA 4CHNA 2DTUA 1S1XA 2BANA 4GVMA 5FROA 3EYZA 1TKDA 4KO0A 1KLNA 2LSNA 4B9SA 2G8VA 3T1AA 4CJQA 4E19A 3NH1A 2D5RA 5JS2A 4AHSA 4C8KA 4CHQA 2OZSA 3KKRA 4DS4A 1TK0A 1TGOA 4EP4A 4FLZA 4FJ5A 3V4IA 1HPZA 2YNGA 1XC9A 1RT4A 2GV9A 3ZT0A 5J1EA 4CFAA 3CG7A 3OS2A 3OYEA 4DWIA 4KHUA 1JXEA 2RF2A 4KHYA 4DSJA 4FJ7A 2HHWA 2IC3A 1NKCA 4FZYA 4M45A 1C1AA 5CZ1A 1T03A 4LSNA 4KHSA 2XY8A 4ID5A 1DLOA 3RRGA 1JLQA 1WSIA 1L3UA 2HVHA 3SNNA 1JLCA 5FRNA 1HYSA 4DSIA 3SUNA 1RTDA 3HJFA 4B8CA 1NOZA 1SL2A 4LD0A 2YNFA 4FW1A 3MXMA 2P5GA 1ASVA 2HHUA 1CXUA 4H8KA 1KCFA 1HYVA 1LW0A 2RKIA 4DFKA 3K2PA 4CJEA 2QK9A 1WLJA 3O4QA 3LPTA 3AVGA 3C94A 2BE2A 3QO9A 2A1RA 1UA1A 3F9KA 2OA8A 2B5JA 1U4BA 4FJGA 1BGXT 1KFDA 2HW3A 4M42A 5HBMA 1J9AA 1JL1A 2QXFA 5E41A 1TVRA 4FK2A 5HRRA 2KFNA 4IKFA 3QLHA 4OKEA 4CEFA 4Z4EA 2FBTA 3HYFA 4CJLA 3V81A 4HUFA 3RMCA 3AVKA 1RDDA 4FJ9A 3QEVA 1NJXA 2F8TA 1FK9A 1HQUA 4ZTFA 1Z26A 4BDZA 4CJSA 4DLGA 4DTUA 4FJXA 1F21A 1ASUA 3E01A 5K14A 5KGWA 3OJSA 3CFPA 3NBPA 3QIPA 4CK1A 4DU3A 1RDBA 1YTAA 1KFSA 3MXIA 2KZMA 1X9SA 5J2MA 3AVHA 3CYMA 4CF2A 1SUQA 3ITHA 3IAYA 1XHZA 1GOBA 3SUPA 1RBVA 3ZSZA 4B9UA 1XHXA 4DSFA 2IS3A 2P51A 4LH4A 1R0AA 4CIGA 2EHGA 4DTJA 3PV8A 1VSIA 4AHCA 2I5JA 3MAQA 4Y1DA 1VK0A 2DFFA 2E4LA 3VQ9A 2OPRA 1SL1A 2G8UA 3C6TA 1W9HA 3QNOA 2O4IA 3G10A 3L3VA 3KLIA 5HRPA 1NJWA 4C8MA 3LPUA 3RR8A 1JLGA 3S3MA 1QTMA 1EKEA 4KTZA 2X6SA 3SV3A 4Z0UA 3VQEA 4KKOA 1NOYA 1CZ9A 3AVMA 1IKYA 3AA2A 2RN2A 3L3UA 4O0IA 4R5PA 3LALA 3DOLA 3VQDA 5HRNA 4DU4A 1WNSA 1S6PA 2A1SA 2FC0A 4CJ3A 3K5MA 3AVFA 3DLRA 4ZHRA 4M3RA 3HPGA 3NE6A 3PX6A 2HHQA 4LY7A 3ZSWA 3DRSA 4F3OA 2HHVA 1CXQA 4J2EA 2GBZA 3KLEA 3OYBA 2VG7A 3OS0A 1TV6A 4CGJA 4CJKA 4FJ8A 5I42A 4Q0BA 4DFPA 4B8AB 1SV5A 1NKEA 3NF6A 1UWBA 4CHYA 4CGFA 4CF0A 4F8RA 4CGGA 4M3WA 1U47A 1HNIA 3I0RA 2NUBA 4CHZA 4B3OA 3TABA 2ZE2A 4O44A 4H4OA 4FLYA 2BDPA 2BGGA 3DOKA 3OJUA 3KK1A 1RBSA 4E0DA 4KTQA 5C25A 3AA4A 2JLEA 3AVNA 4M3UA 4EZ6A 1BIUA 1HQEA 1JLEA 2KTQA 1JLFA 4QAGA 4FZZA 1LW2A 1REVA 4CGHA 4L8RB 3MEDA 1X9MA 1RTHA 3TAEA 1G15A 1EP4A 3S3NA 1RT5A 4Q5VA 4Z4HA 3SJJA 4BWMA 3NGYA 4OGCA 4CJRA 4HUGA 1RBRA 1RT6A 4DMNA 4W5RA 1BCMA 4FLTA 4QCLA 3G0ZA 4DTMA 4O4GA 3NGIA 3AA5X 4KAZA 3B6PA 3V1OA 4PY5A 3MEGA 1VRUA 1WAFA 1A5VA 1C0MA 1VSJA 2XY6A 1TL1A 2KZZA 4AHVA 1IH7A 4NCAA 4KREA 3VQQA 3K5OA 3T19A 4J2DA 3KK2A 2GUIA 1RT2A 4FJIA 3KK3A 1YVUA 3L8BA 1GOAA 3VN5A 4JS5A 4NCBA 1T05A 2PYJA 4W5QA 4CEOA 3TAQA 1U48A 4G1QA 1Y97A 3THVA 4K8XA 1HMVA 1LWEA 3DRRA 1J54A 1S9GA 4Z4FA 1SKSA 4FM1A 3ZSVA 4DTRA 4O55A 4OKJA 3OYCA 2D0AA 2HNDA 4CESA 3VQ7A 3V9XA 2X6NA 3OS1A 2IAJA 1NK0A 4M3XA 1L3VA 3PUFA 2ITGA 4RW4A 3L2UA 3LDSA 1NK5A 1VSMA 3KLGA 3V9WA 3AVCA 3AV9A 1TKZA 4CF1A 4OLBA 4OPKA 2DFHA 1FXXA 4AHTA 5SZTA 3RR7A 3C95A 2Z1IA 5KI6A 4W5OA 4CECA 1FKPA 1X1PA 2Y1JA 3ISNC 3L2QA 1QQCA 5JS1A 4DTXA 4KHNA 2FBYA 5EU7A 3JSMA 1GOCA 1ZBUA 2D0BA 4M3YA 3K5NA 2XRIA 4E89A 4CEAA 3OYNA 4JRQA 1JLAA 2YNHA 4KHWA 5J2NA 2QKBA 4HVJA 4BE0A 3SI6A 1X9WA 1ZBHA 2X74A 3DMJA 4BE2A 3V9UA 4CERA 2KQ2A 1WSJA 4M3TA 3TWHA 3V1QA 3VQBA 4N76A 3HM9A 1D8YA 4IBNA 3OVNA 3ZT3A 3ALYA 3SUQA 1N6QA 3OYIA 1ZBIA 1VSKA 3ZSXA 1C1BA 3ZSYA 3U3YA 3AVBA 4DG1A 4I2PA 2P5OA 1U49A 4PWDA 3QINA 4AILC 2QKKA 2HHSA 3LZJA 3ULDA 1T7PA 4CE9A 3O4NA 1T8EA 3RRHA 1TAQA 2WOMA 1RT3A 1RTJA 2OPPA 4W5NA 1RCHA 3QEIA 3DRPA 4CJWA 2Y1IA 4FYDA 4CJPA 4FLVA 4PUOA 3QEPA 1ASWA 4DQSA 4FK4A 2ZQBA 4DF4A 1LAVA 3OYDA 5CZ2A 3F73A 4H4MA 3KLHA 3LAKA 4N5SA 3TANA 1SKWA 3ZT4A 4LSLA 3OYJA 1KTQA 4FLWA 2PZSA 1RBUA 3HSTB 4M3ZA 4B9VA 5CY4A 4CCHA 3M8SA 3DM2A 1JKHA 1D5AA 3L2RA 4DTSA 1ZYQA 1D9DA 1NK6A 3OYMA 4DSEA 1I39A 1ZBLA 3WNFA 4M41A 2G8HA 3DLBA 3LZIA 1BISA 4FM0A 3VQPA 3SV4A 1SKRA 1LV5A 3AVIA 3L2VA 2E6MA 4CIFA 3KD5E 3O3GA 4WE1A 4OPJA 5HP1A 3OYKA 1DTQA 3QETA 4KHQA 4FK0A 4O0JA 1HNVA 3NF9A 4B9MA 3HPHA 1VSEA 1WAJA 2JGUA 1KRPA 4J2AA 3TARA 4ZTJA 1SL0A 1UOCA 3SYZA 1CLQA 1Z25A 5KGXA 3D0PA 3PX4A 3WNHA 3I8DA 3QEWA 3NHGA 3BGRA 4E3SA 3LP3A 2YV0X 1DTTA 5KRTA 2HNYA 3OYFA 4JRPA 3ZT2A 3TAMA 4ELUA 1WSEA 4ELTA 4E7KA 4BDPA 2D0CA 3O3HA 3WNEA 4KRFA 3AA3A 3CM6A 4JS4A 1BHLA 3HK2A 2DY4A 1RT1A 2YKNA 2OYQA 3I0SA 4CEQA 4XIUA 2OPSA 3NF7A 2ETJA 4CFBA 1RTIA 1NK4A 3JYTA 1NKBA 3LWLA 4E7JA 3SUOA 2YKMA 3FFIA 3V9ZA 3AO5A 3B6OA 2PYLA 3PO5A 3CM5A 4DFMA 4B9LA 2Z1HA 1RDAA 2YNIA 3LP0A 4CF9A 3O3FA 4BACA 3CQ8A 4DQQA 4F2RA 3MXJA 3VQ8A 1U45A 3OYHA 1RILA 4E7HA 4CEBA 4B9NA 1UAXA 4B9TA 4GMJB 3NH0A 1EX4A 4E1MA 4FCYA 4RW8A 3NCIA 4HUEA 2ZD1A 4FVMA 1XWLA 3M8QA 4DQIA 3AVLA 3TAPA 2XY7A 3TAFA 3AO3A 5HRSA 3IRXA 3LWMA 3MEEA 4TSXA 4E1NA 1KVAA 3QEXA 2HVIA 1UA0A 3P83D 4YFUA 2F96A 4CHOA 5T7BA 3U6FA 2HB5A 3TAGA 3EZ5A 4HCCA 4EP5A 4ID1A 4NCGA 2G8FA 1L3SA 5SWMA 4OJRA 2KFZA 2YHBA 3CFRA 3C6UA 3NF8A 1A5XA 2Z1GA 2EX3A 3LANA 4HHTA 3HP9A 4KV8A 3S9HA 4B08A 4QOZB 4CK2A 3VA3A 1TK8A 4MFBA 1YTUA 5HLFA 4EZ9A 4I9QA 4KB1A 3L2WA 1MU2A 1FKOA 4JLHA 4CFDA 1QE1A 3LAMA 4CGDA 2KW4A 3A2FA 1IKVA 1QHTA 2Q3SA 3VQCA 3ZSOA 2ATQA 2F8SA 4PA1A 1RBTA 2B4JA 3H08A 4PQUA 2VG6A 4MQ3A 3VQ6A 3HL8A 2G8KA 2AJQA 1NK7A 4BWJA 4E7IA 2PY5A 5DMRA 1N5YA 1NJYA 3HVRA 5FDLA 2XHBA 1C6VA 3D45A 3VA0A 4F2SA 3SQ2A 4AH9A 2G8WA 3TR8A 4BDYA 4KPYA 3RTVA 3HVTA 4FJNA 3T3FA 1O1WA 4C8OA 4N41A 2XY5A 1CZBA 4CJ5A 4I2QA 1TK5A 3DLGA 3NFAA 2P1JA 3RMDA 4DSKA 3ZSRA 1B9DA 3ZT1A 3DI6A 1C0UA 2XO7A 2OZMA 2W42A 3MECA 2OPQA 1BL3A 4ELVA 3NH2A 1S6QA 3OY9A 1WSGA 5C42A 3SQ4A 1Q8IA 1LWCA 3PX0A 1QSLA 2HHTA 4CEZA 1NK8A 4Z4CA 3VQAA 1I3AA 2HMIA 4CJFA 4DTNA 3OYGA 1JXBA 4OGEA 1S9EA 3K57A 4K8ZA 2RPIA 4GW6A 4DFJA 1TKTA 5D3GA 4CGIA 3ZSQA 1NK9A 2IOCA 3PY8A 3HT3A 1KVCA 4IG0A 3QESA 1KSPA 1K6YA 4C8LA 3HP6A 1S1WA 1L3TA 3M8PA 1XI1A 1VRTA 3EY1A 3K5LA 1B92A 4IDKA 1S1TA 1A5WA 1TKXA 3LP2A 2R7YA 3SQ1A 1S5JA 4F4KA 3VQ5A 5I3UA 1BQNA 1HJRA 2O4GA 4NYNA 1WSFA 3ZCMA 3V9SA 4RG8A 4IG3A 1QSYA 1QS4A 4HCBA 4FJHA 4Z4GA 3IG1A 4CEEA 3DLKA 3SZ2A 5C24A 4DS5A 3DLHA 3UIQA 1KLMA 2G8IA 1S1UA 4CF8A 5DK5A 4KI4A 4N56A 3IS9A 4C8NA 1LWFA 1ZBFA 4YNQA 4KI6A 3QERA 1HRHA 1WN7A 4CJ4A 2X78A 1RDCA 4FW2A 1RNHA 3SCXA 3AVJA 5CYMA 1ITGA 2FBVA 4KB0A 1BIZA 3S3OA 4DU1A 1RT7A 1BQMA 1W0HA 3WNGA 3KD1E 1IG9A 4FLUA 1EETA 3KTQA 1VSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C1C A;  4RW6 A;  4F3T A;  3KKS A;  5J2Q A;  3QIO A;  4CIE A;  1BI4 A;  1JLB A;  1WSH A;  4CED A;  3RMA A;  4FXD A;  1IKW A;  5FRM A;  4IFV A;  3CFO A;  4KTW A;  4CFC A;  1U04 A;  3HPO A;  2DFE A;  3SPZ A;  3K59 A;  4DSL A;  4FJM A;  4IFY A;  2VWK A;  3LP1 A;  4LH5 A;  2FBX A;  3QNN A;  3V6D A;  3DYA A;  1C0T A;  4RW7 A;  3P1G A;  3KIO A;  3V1R A;  3BDP A;  2B6A A;  3ASM A;  3RWU A;  2E6L A;  4CJV A;  4W5T A;  3SQ0 A;  1YT3 A;  4OVL A;  4CHP A;  4DLE A;  3KLF A;  1J5O A;  2WON A;  4DF8 A;  1IO2 A;  3RMB A;  4KFB A;  4I7F A;  3KJV A;  1QSS A;  4OLA A;  4OKK A;  2VG5 A;  5CYQ A;  2HNZ A;  3OYL A;  3HXM A;  4FJL A;  1L5U A;  3PO4 A;  3P5J A;  4AHU A;  1BI4 B;  4CK3 A;  3VQ4 A;  4DQR A;  1J53 A;  3SPY A;  3AO4 A;  3M8R A;  4FLX A;  4DTP A;  2VWJ A;  1NJZ A;  3K58 A;  4DQP A;  1TAU A;  4FJJ A;  4RW9 A;  4Y1C A;  4CJT A;  5KRS A;  3NDK A;  3NAE A;  4FM2 A;  2HHX A;  3TI0 A;  3NGZ A;  3HO1 A;  3OYA A;  1BCO A;  1VSF A;  3U3G A;  3AVA A;  1VSD A;  4E7L A;  4AHR A;  1HYZ A;  4CJU A;  4FJK A;  1JL2 A;  2YHA A;  1LAW A;  1S1V A;  4I9L A;  4HTU A;  1Q9X A;  1D9F A;  2IGI A;  1IKX A;  4Z4I A;  4NYF A;  5HRO A;  2Z1J A;  4FZX C;  5KTQ A;  1Q9Y A;  4J2B A;  2IDO A;  4O5B A;  3DLE A;  4UQG A;  4N47 A;  1B9F A;  3AO2 A;  3AO1 A;  1TL3 A;  4BE1 A;  4DTO A;  5J2P A;  4ICL A;  1EXQ A;  1KVB A;  1VSL A;  4CHN A;  2DTU A;  1S1X A;  2BAN A;  4GVM A;  5FRO A;  3EYZ A;  1TKD A;  4KO0 A;  1KLN A;  2LSN A;  4B9S A;  2G8V A;  3T1A A;  4CJQ A;  4E19 A;  3NH1 A;  2D5R A;  5JS2 A;  4AHS A;  4C8K A;  4CHQ A;  2OZS A;  3KKR A;  4DS4 A;  1TK0 A;  1TGO A;  4EP4 A;  4FLZ A;  4FJ5 A;  3V4I A;  1HPZ A;  2YNG A;  1XC9 A;  1RT4 A;  2GV9 A;  3ZT0 A;  5J1E A;  4CFA A;  3CG7 A;  3OS2 A;  3OYE A;  4DWI A;  4KHU A;  1JXE A;  2RF2 A;  4KHY A;  4DSJ A;  4FJ7 A;  2HHW A;  2IC3 A;  1NKC A;  4FZY A;  4M45 A;  1C1A A;  5CZ1 A;  1T03 A;  4LSN A;  4KHS A;  2XY8 A;  4ID5 A;  1DLO A;  3RRG A;  1JLQ A;  1WSI A;  1L3U A;  2HVH A;  3SNN A;  1JLC A;  5FRN A;  1HYS A;  4DSI A;  3SUN A;  1RTD A;  3HJF A;  4B8C A;  1NOZ A;  1SL2 A;  4LD0 A;  2YNF A;  4FW1 A;  3MXM A;  2P5G A;  1ASV A;  2HHU A;  1CXU A;  4H8K A;  1KCF A;  1HYV A;  1LW0 A;  2RKI A;  4DFK A;  3K2P A;  4CJE A;  2QK9 A;  1WLJ A;  3O4Q A;  3LPT A;  3AVG A;  3C94 A;  2BE2 A;  3QO9 A;  2A1R A;  1UA1 A;  3F9K A;  2OA8 A;  2B5J A;  1U4B A;  4FJG A;  1BGX T;  1KFD A;  2HW3 A;  4M42 A;  5HBM A;  1J9A A;  1JL1 A;  2QXF A;  5E41 A;  1TVR A;  4FK2 A;  5HRR A;  2KFN A;  4IKF A;  3QLH A;  4OKE A;  4CEF A;  4Z4E A;  2FBT A;  3HYF A;  4CJL A;  3V81 A;  4HUF A;  3RMC A;  3AVK A;  1RDD A;  4FJ9 A;  3QEV A;  1NJX A;  2F8T A;  1FK9 A;  1HQU A;  4ZTF A;  1Z26 A;  4BDZ A;  4CJS A;  4DLG A;  4DTU A;  4FJX A;  1F21 A;  1ASU A;  3E01 A;  5K14 A;  5KGW A;  3OJS A;  3CFP A;  3NBP A;  3QIP A;  4CK1 A;  4DU3 A;  1RDB A;  1YTA A;  1KFS A;  3MXI A;  2KZM A;  1X9S A;  5J2M A;  3AVH A;  3CYM A;  4CF2 A;  1SUQ A;  3ITH A;  3IAY A;  1XHZ A;  1GOB A;  3SUP A;  1RBV A;  3ZSZ A;  4B9U A;  1XHX A;  4DSF A;  2IS3 A;  2P51 A;  4LH4 A;  1R0A A;  4CIG A;  2EHG A;  4DTJ A;  3PV8 A;  1VSI A;  4AHC A;  2I5J A;  3MAQ A;  4Y1D A;  1VK0 A;  2DFF A;  2E4L A;  3VQ9 A;  2OPR A;  1SL1 A;  2G8U A;  3C6T A;  1W9H A;  3QNO A;  2O4I A;  3G10 A;  3L3V A;  3KLI A;  5HRP A;  1NJW A;  4C8M A;  3LPU A;  3RR8 A;  1JLG A;  3S3M A;  1QTM A;  1EKE A;  4KTZ A;  2X6S A;  3SV3 A;  4Z0U A;  3VQE A;  4KKO A;  1NOY A;  1CZ9 A;  3AVM A;  1IKY A;  3AA2 A;  2RN2 A;  3L3U A;  4O0I A;  4R5P A;  3LAL A;  3DOL A;  3VQD A;  5HRN A;  4DU4 A;  1WNS A;  1S6P A;  2A1S A;  2FC0 A;  4CJ3 A;  3K5M A;  3AVF A;  3DLR A;  4ZHR A;  4M3R A;  3HPG A;  3NE6 A;  3PX6 A;  2HHQ A;  4LY7 A;  3ZSW A;  3DRS A;  4F3O A;  2HHV A;  1CXQ A;  4J2E A;  2GBZ A;  3KLE A;  3OYB A;  2VG7 A;  3OS0 A;  1TV6 A;  4CGJ A;  4CJK A;  4FJ8 A;  5I42 A;  4Q0B A;  4DFP A;  4B8A B;  1SV5 A;  1NKE A;  3NF6 A;  1UWB A;  4CHY A;  4CGF A;  4CF0 A;  4F8R A;  4CGG A;  4M3W A;  1U47 A;  1HNI A;  3I0R A;  2NUB A;  4CHZ A;  4B3O A;  3TAB A;  2ZE2 A;  4O44 A;  4H4O A;  4FLY A;  2BDP A;  2BGG A;  3DOK A;  3OJU A;  3KK1 A;  1RBS A;  4E0D A;  4KTQ A;  5C25 A;  3AA4 A;  2JLE A;  3AVN A;  4M3U A;  4EZ6 A;  1BIU A;  1HQE A;  1JLE A;  2KTQ A;  1JLF A;  4QAG A;  4FZZ A;  1LW2 A;  1REV A;  4CGH A;  4L8R B;  3MED A;  1X9M A;  1RTH A;  3TAE A;  1G15 A;  1EP4 A;  3S3N A;  1RT5 A;  4Q5V A;  4Z4H A;  3SJJ A;  4BWM A;  3NGY A;  4OGC A;  4CJR A;  4HUG A;  1RBR A;  1RT6 A;  4DMN A;  4W5R A;  1BCM A;  4FLT A;  4QCL A;  3G0Z A;  4DTM A;  4O4G A;  3NGI A;  3AA5 X;  4KAZ A;  3B6P A;  3V1O A;  4PY5 A;  3MEG A;  1VRU A;  1WAF A;  1A5V A;  1C0M A;  1VSJ A;  2XY6 A;  1TL1 A;  2KZZ A;  4AHV A;  1IH7 A;  4NCA A;  4KRE A;  3VQQ A;  3K5O A;  3T19 A;  4J2D A;  3KK2 A;  2GUI A;  1RT2 A;  4FJI A;  3KK3 A;  1YVU A;  3L8B A;  1GOA A;  3VN5 A;  4JS5 A;  4NCB A;  1T05 A;  2PYJ A;  4W5Q A;  4CEO A;  3TAQ A;  1U48 A;  4G1Q A;  1Y97 A;  3THV A;  4K8X A;  1HMV A;  1LWE A;  3DRR A;  1J54 A;  1S9G A;  4Z4F A;  1SKS A;  4FM1 A;  3ZSV A;  4DTR A;  4O55 A;  4OKJ A;  3OYC A;  2D0A A;  2HND A;  4CES A;  3VQ7 A;  3V9X A;  2X6N A;  3OS1 A;  2IAJ A;  1NK0 A;  4M3X A;  1L3V A;  3PUF A;  2ITG A;  4RW4 A;  3L2U A;  3LDS A;  1NK5 A;  1VSM A;  3KLG A;  3V9W A;  3AVC A;  3AV9 A;  1TKZ A;  4CF1 A;  4OLB A;  4OPK A;  2DFH A;  1FXX A;  4AHT A;  5SZT A;  3RR7 A;  3C95 A;  2Z1I A;  5KI6 A;  4W5O A;  4CEC A;  1FKP A;  1X1P A;  2Y1J A;  3ISN C;  3L2Q A;  1QQC A;  5JS1 A;  4DTX A;  4KHN A;  2FBY A;  5EU7 A;  3JSM A;  1GOC A;  1ZBU A;  2D0B A;  4M3Y A;  3K5N A;  2XRI A;  4E89 A;  4CEA A;  3OYN A;  4JRQ A;  1JLA A;  2YNH A;  4KHW A;  5J2N A;  2QKB A;  4HVJ A;  4BE0 A;  3SI6 A;  1X9W A;  1ZBH A;  2X74 A;  3DMJ A;  4BE2 A;  3V9U A;  4CER A;  2KQ2 A;  1WSJ A;  4M3T A;  3TWH A;  3V1Q A;  3VQB A;  4N76 A;  3HM9 A;  1D8Y A;  4IBN A;  3OVN A;  3ZT3 A;  3ALY A;  3SUQ A;  1N6Q A;  3OYI A;  1ZBI A;  1VSK A;  3ZSX A;  1C1B A;  3ZSY A;  3U3Y A;  3AVB A;  4DG1 A;  4I2P A;  2P5O A;  1U49 A;  4PWD A;  3QIN A;  4AIL C;  2QKK A;  2HHS A;  3LZJ A;  3ULD A;  1T7P A;  4CE9 A;  3O4N A;  1T8E A;  3RRH A;  1TAQ A;  2WOM A;  1RT3 A;  1RTJ A;  2OPP A;  4W5N A;  1RCH A;  3QEI A;  3DRP A;  4CJW A;  2Y1I A;  4FYD A;  4CJP A;  4FLV A;  4PUO A;  3QEP A;  1ASW A;  4DQS A;  4FK4 A;  2ZQB A;  4DF4 A;  1LAV A;  3OYD A;  5CZ2 A;  3F73 A;  4H4M A;  3KLH A;  3LAK A;  4N5S A;  3TAN A;  1SKW A;  3ZT4 A;  4LSL A;  3OYJ A;  1KTQ A;  4FLW A;  2PZS A;  1RBU A;  3HST B;  4M3Z A;  4B9V A;  5CY4 A;  4CCH A;  3M8S A;  3DM2 A;  1JKH A;  1D5A A;  3L2R A;  4DTS A;  1ZYQ A;  1D9D A;  1NK6 A;  3OYM A;  4DSE A;  1I39 A;  1ZBL A;  3WNF A;  4M41 A;  2G8H A;  3DLB A;  3LZI A;  1BIS A;  4FM0 A;  3VQP A;  3SV4 A;  1SKR A;  1LV5 A;  3AVI A;  3L2V A;  2E6M A;  4CIF A;  3KD5 E;  3O3G A;  4WE1 A;  4OPJ A;  5HP1 A;  3OYK A;  1DTQ A;  3QET A;  4KHQ A;  4FK0 A;  4O0J A;  1HNV A;  3NF9 A;  4B9M A;  3HPH A;  1VSE A;  1WAJ A;  2JGU A;  1KRP A;  4J2A A;  3TAR A;  4ZTJ A;  1SL0 A;  1UOC A;  3SYZ A;  1CLQ A;  1Z25 A;  5KGX A;  3D0P A;  3PX4 A;  3WNH A;  3I8D A;  3QEW A;  3NHG A;  3BGR A;  4E3S A;  3LP3 A;  2YV0 X;  1DTT A;  5KRT A;  2HNY A;  3OYF A;  4JRP A;  3ZT2 A;  3TAM A;  4ELU A;  1WSE A;  4ELT A;  4E7K A;  4BDP A;  2D0C A;  3O3H A;  3WNE A;  4KRF A;  3AA3 A;  3CM6 A;  4JS4 A;  1BHL A;  3HK2 A;  2DY4 A;  1RT1 A;  2YKN A;  2OYQ A;  3I0S A;  4CEQ A;  4XIU A;  2OPS A;  3NF7 A;  2ETJ A;  4CFB A;  1RTI A;  1NK4 A;  3JYT A;  1NKB A;  3LWL A;  4E7J A;  3SUO A;  2YKM A;  3FFI A;  3V9Z A;  3AO5 A;  3B6O A;  2PYL A;  3PO5 A;  3CM5 A;  4DFM A;  4B9L A;  2Z1H A;  1RDA A;  2YNI A;  3LP0 A;  4CF9 A;  3O3F A;  4BAC A;  3CQ8 A;  4DQQ A;  4F2R A;  3MXJ A;  3VQ8 A;  1U45 A;  3OYH A;  1RIL A;  4E7H A;  4CEB A;  4B9N A;  1UAX A;  4B9T A;  4GMJ B;  3NH0 A;  1EX4 A;  4E1M A;  4FCY A;  4RW8 A;  3NCI A;  4HUE A;  2ZD1 A;  4FVM A;  1XWL A;  3M8Q A;  4DQI A;  3AVL A;  3TAP A;  2XY7 A;  3TAF A;  3AO3 A;  5HRS A;  3IRX A;  3LWM A;  3MEE A;  4TSX A;  4E1N A;  1KVA A;  3QEX A;  2HVI A;  1UA0 A;  3P83 D;  4YFU A;  2F96 A;  4CHO A;  5T7B A;  3U6F A;  2HB5 A;  3TAG A;  3EZ5 A;  4HCC A;  4EP5 A;  4ID1 A;  4NCG A;  2G8F A;  1L3S A;  5SWM A;  4OJR A;  2KFZ A;  2YHB A;  3CFR A;  3C6U A;  3NF8 A;  1A5X A;  2Z1G A;  2EX3 A;  3LAN A;  4HHT A;  3HP9 A;  4KV8 A;  3S9H A;  4B08 A;  4QOZ B;  4CK2 A;  3VA3 A;  1TK8 A;  4MFB A;  1YTU A;  5HLF A;  4EZ9 A;  4I9Q A;  4KB1 A;  3L2W A;  1MU2 A;  1FKO A;  4JLH A;  4CFD A;  1QE1 A;  3LAM A;  4CGD A;  2KW4 A;  3A2F A;  1IKV A;  1QHT A;  2Q3S A;  3VQC A;  3ZSO A;  2ATQ A;  2F8S A;  4PA1 A;  1RBT A;  2B4J A;  3H08 A;  4PQU A;  2VG6 A;  4MQ3 A;  3VQ6 A;  3HL8 A;  2G8K A;  2AJQ A;  1NK7 A;  4BWJ A;  4E7I A;  2PY5 A;  5DMR A;  1N5Y A;  1NJY A;  3HVR A;  5FDL A;  2XHB A;  1C6V A;  3D45 A;  3VA0 A;  4F2S A;  3SQ2 A;  4AH9 A;  2G8W A;  3TR8 A;  4BDY A;  4KPY A;  3RTV A;  3HVT A;  4FJN A;  3T3F A;  1O1W A;  4C8O A;  4N41 A;  2XY5 A;  1CZB A;  4CJ5 A;  4I2Q A;  1TK5 A;  3DLG A;  3NFA A;  2P1J A;  3RMD A;  4DSK A;  3ZSR A;  1B9D A;  3ZT1 A;  3DI6 A;  1C0U A;  2XO7 A;  2OZM A;  2W42 A;  3MEC A;  2OPQ A;  1BL3 A;  4ELV A;  3NH2 A;  1S6Q A;  3OY9 A;  1WSG A;  5C42 A;  3SQ4 A;  1Q8I A;  1LWC A;  3PX0 A;  1QSL A;  2HHT A;  4CEZ A;  1NK8 A;  4Z4C A;  3VQA A;  1I3A A;  2HMI A;  4CJF A;  4DTN A;  3OYG A;  1JXB A;  4OGE A;  1S9E A;  3K57 A;  4K8Z A;  2RPI A;  4GW6 A;  4DFJ A;  1TKT A;  5D3G A;  4CGI A;  3ZSQ A;  1NK9 A;  2IOC A;  3PY8 A;  3HT3 A;  1KVC A;  4IG0 A;  3QES A;  1KSP A;  1K6Y A;  4C8L A;  3HP6 A;  1S1W A;  1L3T A;  3M8P A;  1XI1 A;  1VRT A;  3EY1 A;  3K5L A;  1B92 A;  4IDK A;  1S1T A;  1A5W A;  1TKX A;  3LP2 A;  2R7Y A;  3SQ1 A;  1S5J A;  4F4K A;  3VQ5 A;  5I3U A;  1BQN A;  1HJR A;  2O4G A;  4NYN A;  1WSF A;  3ZCM A;  3V9S A;  4RG8 A;  4IG3 A;  1QSY A;  1QS4 A;  4HCB A;  4FJH A;  4Z4G A;  3IG1 A;  4CEE A;  3DLK A;  3SZ2 A;  5C24 A;  4DS5 A;  3DLH A;  3UIQ A;  1KLM A;  2G8I A;  1S1U A;  4CF8 A;  5DK5 A;  4KI4 A;  4N56 A;  3IS9 A;  4C8N A;  1LWF A;  1ZBF A;  4YNQ A;  4KI6 A;  3QER A;  1HRH A;  1WN7 A;  4CJ4 A;  2X78 A;  1RDC A;  4FW2 A;  1RNH A;  3SCX A;  3AVJ A;  5CYM A;  1ITG A;  2FBV A;  4KB0 A;  1BIZ A;  3S3O A;  4DU1 A;  1RT7 A;  1BQM A;  1W0H A;  3WNG A;  3KD1 E;  1IG9 A;  4FLU A;  1EET A;  3KTQ A;  1VSH A; 
#chains in the Genus database with same CATH topology
 1C1C A;  2P9P A;  5FPN A;  5J2Q A;  3QIO A;  1BI4 A;  1WSH A;  1KC8 O;  1ATN A;  3HPO A;  2DFE A;  2ZF5 O;  2FF6 A;  3K59 A;  4DV1 K;  4LH5 A;  3QNN A;  2FBX A;  3V6D A;  1NGA A;  4IZ9 A;  3KIO A;  2B6A A;  3ASM A;  1D4X A;  4CJV A;  1YT3 A;  4OVL A;  4DLE A;  1IO2 A;  4KFB A;  1U2V A;  3ID6 A;  3KJV A;  1QSS A;  2VG5 A;  2WUS A;  4H0P A;  4B9Q A;  3ID8 A;  1L5U A;  3D2E A;  3P5J A;  3QFU A;  4DQR A;  4FLX A;  4RW9 A;  5KRS A;  2D4W A;  3RSE B;  3TI0 A;  3P31 A;  3A5L C;  1VSD A;  4AHR A;  4FJK A;  1D9F A;  1ZXO A;  2IGI A;  3L6Q A;  1IKX A;  2P9L B;  5AQW A;  1OVY A;  4O5B A;  3DLE A;  4ILG B;  4N47 A;  1B9F A;  1J5E K;  4ISG A;  2DTU A;  4H5W A;  5C2D A;  1KLN A;  4JYA K;  4CVN E;  2G8V A;  3T1A A;  4PHT X;  5JS2 A;  3SAH A;  5AQK A;  1TK0 A;  1ATS A;  4FJ5 A;  1HPZ A;  5FPD A;  1W7A A;  4B3S K;  4LF6 K;  3VTH A;  4DSJ A;  4FJ7 A;  5AQN A;  3MK6 A;  5CZ1 A;  1GLC G;  4FWR A;  3CPW M;  3RRG A;  1NBW A;  1L3U A;  3SNN A;  1HYS A;  1RTD A;  4FPB A;  4PKH A;  2P5G A;  3H45 C;  3PIP L;  2NRX A;  3O1W A;  4F3T A;  2W41 A;  4WFN L;  2OA8 A;  3AVG A;  2BE2 A;  1JCG A;  3RSE A;  3F9K A;  1RGI A;  3CC7 N;  2HW3 A;  5HBM A;  3VMF B;  4FK2 A;  4IKF A;  2IVN A;  3QLH A;  4ILH A;  3HYF A;  4CJL A;  3BF1 A;  1HQU A;  4ZTF A;  3T69 A;  3OTO K;  1F21 A;  1LCU A;  5KGW A;  4DU3 A;  3MXI A;  5E26 A;  1X9S A;  5J2M A;  3AVH A;  1YJN N;  3IAY A;  1GOB A;  3SUP A;  3ZSZ A;  2P51 A;  4CIG A;  3PV8 A;  1MWM A;  4BGA A;  4BGB A;  3O4W A;  3NMU A;  3KK7 A;  5KPZ A;  1NGD A;  4KH6 A;  3KLI A;  5AQT A;  4WQ5 C;  5HRP A;  4LF9 K;  3RR8 A;  1GLF O;  1JLG A;  3S3M A;  1QTM A;  2X6S A;  3SV3 A;  4Z0U A;  4O0I A;  3L3U A;  4R79 A;  4R5P A;  5HRN A;  3C7N A;  3U8X A;  3VES A;  3ZLJ A;  2A1S A;  3BP8 A;  2A3Z A;  5FLX O;  4ZHR A;  3WXM B;  4LY7 A;  1NG9 A;  4B1U B;  3DRS A;  1CXQ A;  4JK7 A;  5BPM A;  3Q7B A;  1VAZ A;  4EIA A;  4FVU A;  4AM7 A;  4FJ8 A;  5I42 A;  4Q0B A;  1NKE A;  4M3W A;  4XH1 A;  4A5B A;  1CZA N;  3THW B;  2BGG A;  3OJU A;  3Q7C A;  3KK1 A;  4E0D A;  1VQM N;  5C25 A;  1HQE A;  2ZGY A;  2KTQ A;  1JLF A;  2PBD A;  4JD2 B;  5AZJ B;  1BOT O;  4L8R B;  2F9T A;  3MED A;  3T1Y K;  3CXC M;  1X9M A;  4IO8 A;  2GX9 A;  4EHT A;  3NVM A;  2QWP A;  3THY B;  3TAE A;  1EP4 A;  2FSK A;  1RT5 A;  5KQ8 A;  3NGY A;  4OGC A;  2V51 B;  4QCL A;  3E9O A;  2QXL A;  4DTM A;  4OX9 K;  2NRT A;  1GLD G;  4OPH A;  3THX B;  4KRE A;  3K5O A;  3T19 A;  1RT2 A;  4KBO A;  1GOA A;  4JS5 A;  4NCB A;  4BRH A;  3VF4 A;  1U48 A;  4G1Q A;  1Y97 A;  5BRH A;  4RWT A;  4K8X A;  1HMV A;  3LDP A;  5EY4 A;  1SKS A;  4DTR A;  4H0O A;  3OYC A;  1YXQ A;  2D1K A;  3PUF A;  1SAZ A;  5CR4 A;  1NK5 A;  5GAE P;  3KLG A;  3AVC A;  3R6M A;  4OPK A;  3DAW A;  2DFH A;  5SZT A;  5E84 A;  4CEC A;  3L2Q A;  4DTX A;  4KHN A;  4YY3 K;  1S22 A;  1ZBU A;  3H46 O;  1OH5 A;  4M3Y A;  4KHW A;  4MLH A;  4HVJ A;  3AAR A;  1ZBH A;  3DMJ A;  4BE2 A;  2KQ2 A;  3C7N B;  5M1K A;  4NLC A;  3HM9 A;  1M1K O;  3OYI A;  1C1B A;  3ZSY A;  4GKK K;  4PWD A;  3QIN A;  2IVP A;  4I6M B;  3FZF A;  1TAQ A;  2WOM A;  1RCH A;  2Y1I A;  4PUO A;  2P9U A;  4MDA A;  2ZQB A;  3QB0 A;  5TKY A;  3F73 A;  2Q0R A;  3LAK A;  4N5S A;  4LSL A;  3OYJ A;  2HBL A;  2ZJQ L;  4B9V A;  3JS6 A;  3M8S A;  1D5A A;  1NK6 A;  4DSE A;  1I39 A;  1ZBL A;  3D2F B;  3N4Q A;  4M41 A;  2G8H A;  3VGL A;  3DLB A;  4JKB A;  4K0K K;  3EEQ A;  4FM0 A;  5GIP A;  1SKR A;  3L2V A;  1LV5 A;  4CIF A;  5HP1 A;  1P90 A;  2O8C A;  1DKG D;  2IIR A;  4KHQ A;  1IBM K;  1ILY A;  3HI0 A;  1BU6 O;  1YAG A;  3TAR A;  2WTU A;  1UOC A;  3SYZ A;  1Z25 A;  2UXD K;  3I8D A;  3QEW A;  1TYQ A;  4E3S A;  2NRV A;  3OYF A;  2QWM A;  3ZT2 A;  3TAM A;  1WSE A;  3WNE A;  3WEE B;  1BHL A;  4XIU A;  3OA9 A;  4CFB A;  1NK4 A;  2RE2 A;  3I56 N;  2HF4 A;  2E2O A;  3SUO A;  2YKM A;  3FFI A;  2PYL A;  3B6O A;  3CM5 A;  4DFM A;  4B9L A;  2GTD A;  1RDA A;  2YNI A;  3LP0 A;  4CF9 A;  3CCV N;  1N32 K;  4F2R A;  4O8U A;  3OYH A;  1RIL A;  2JWK A;  3MN5 A;  3O80 A;  4B9N A;  1VQL N;  4LF7 K;  3MCA B;  1EX4 A;  2UU9 K;  3HM8 A;  5AQY A;  1XWL A;  1EWQ A;  3AVL A;  2XY7 A;  3TAF A;  2W40 A;  5HRS A;  5H1S Q;  2QI2 A;  4K41 A;  4H5R A;  1KVA A;  4A5A A;  4DV6 K;  2F96 A;  4CHO A;  3U6F A;  3EZ5 A;  4LFB K;  5M1N A;  2ZM6 K;  3C0B A;  3CFR A;  2KFZ A;  1NGH A;  3C6U A;  4FWS A;  4IEE A;  5BR8 K;  4B08 A;  4QOZ B;  1U2V B;  1TK8 A;  3SMS A;  5AQS A;  4JKD A;  1MU2 A;  4JLH A;  3LAM A;  4C1N K;  3VQC A;  2ZJR L;  1LOT B;  1RBT A;  3FZH A;  3H08 A;  2VG6 A;  4MQ3 A;  3HL8 A;  4B3T K;  1XC3 A;  5LL6 Z;  3HVR A;  1NNE A;  1C6V A;  3D45 A;  4KPY A;  3RTV A;  4YOW A;  2O8C B;  3T3F A;  2XY5 A;  2NRZ A;  4BR9 A;  1VQK N;  4I2Q A;  2P9N A;  1HNW K;  5EOY A;  2O8E B;  1B9D A;  3ZT1 A;  5CE3 A;  3MEC A;  4PL8 A;  2OPQ A;  1MDU B;  2QEX N;  1VQ4 N;  3OY9 A;  3PX0 A;  1Q8I A;  2HHT A;  4CEZ A;  4Z4C A;  3QDK A;  4IJN A;  3GG4 A;  2QW9 A;  4CJF A;  4EHU A;  4DTN A;  2RHK A;  4JHD A;  5GAG P;  1S9E A;  1TKT A;  5D3G A;  2WFB A;  3ZSQ A;  3MX5 A;  4B3M K;  4BR4 A;  3QES A;  1XUP O;  1XI1 A;  4BC5 A;  1VRT A;  3EY1 A;  3K5L A;  1B92 A;  3FE1 A;  2UUB K;  3EE8 A;  1NGJ A;  1S1T A;  1S5J A;  4B3R K;  5I3U A;  4JK9 A;  1NGE A;  3ZCM A;  3V9S A;  3VF6 A;  4CJ7 A;  1YHQ N;  5C24 A;  4DS5 A;  3UIQ A;  4DUY K;  4DR5 K;  1S1U A;  1ZBF A;  2Q0U A;  3QER A;  1HRH A;  2CGK A;  3M1F A;  4FW2 A;  4U7B A;  3WQT A;  1YJW N;  1BQM A;  1W0H A;  5GIN A;  4FLU A;  1OH6 A;  4DR7 K;  3RMA A;  4CED A;  1QQO A;  3FZK A;  4IFV A;  4KTW A;  4CFC A;  1U04 A;  5BRD A;  3WXI A;  4FJM A;  2H3G X;  2P9P B;  3LP1 A;  1J5O A;  4CHP A;  3BUZ B;  3KLF A;  2WON A;  1GLA G;  1X9J A;  4DF8 A;  3HRG A;  3EO3 A;  3R8E A;  4I7F A;  1IBL K;  3ULE A;  4FJL A;  3TSQ A;  3D6R A;  3UKU B;  4CK3 A;  1J53 A;  3J7Y P;  4DTP A;  2VWJ A;  3K58 A;  1TAU A;  1J6Z A;  3KWI A;  4FJJ A;  3NAE A;  3NDK A;  1VSF A;  3U3G A;  3R3L A;  3AVA A;  4CJU A;  3A8Y A;  2QWL A;  2YHA A;  1S1V A;  2W6L A;  4FZX C;  5MLC Q;  2UXB K;  5KTQ A;  1Q9Y A;  1NWK A;  4BG8 A;  5J2P A;  4CHN A;  1EXQ A;  1VSL A;  3AY9 A;  1NGG A;  1O13 A;  3MX2 A;  4GVM A;  5FRO A;  1WBB A;  1TKD A;  3QIC A;  4B9S A;  3A5M C;  5AQX A;  2OZS A;  3K9J A;  4DV2 K;  4CHQ A;  1OKJ A;  2QWR A;  4EP4 A;  4FPA A;  4DV4 K;  1WBD A;  4KHU A;  2RF2 A;  4FZY A;  5ADX A;  4KH5 A;  2XY8 A;  4ID5 A;  2HVH A;  5FRN A;  4M7Y A;  3HOT A;  3SUN A;  3HJF A;  4B8C A;  4DR1 K;  2NNW A;  3AAQ A;  3THY A;  1JJ2 M;  4CZG A;  1HYV A;  4DFK A;  3DXM A;  3K2P A;  3SLC A;  3O4Q A;  4CJE A;  3LPT A;  1VQN N;  3C94 A;  4BG9 A;  1UA1 A;  3ULE B;  1JCE A;  2E1Z A;  1KFD A;  2Q31 A;  4BRE A;  4JI6 K;  3CQY A;  5JVH L;  1TVR A;  4B1Z A;  1X3M A;  1KQS M;  4CEF A;  3VEW A;  4Z4E A;  4FJ9 A;  3AVK A;  1RDD A;  1U6Z A;  2OTJ N;  3TTC A;  4CJS A;  4DLG A;  3E01 A;  2FSN A;  3NBP A;  4CK1 A;  2PAV A;  1YF5 L;  4DQ8 A;  1SUQ A;  4MDB A;  1RBV A;  1XHX A;  2IS3 A;  1R0A A;  2VGN A;  2EHG A;  1VSI A;  1VK0 A;  3KZB A;  5C2F A;  2OPR A;  2G8U A;  5IWA K;  3DJC A;  4BR0 A;  5JVG L;  1NJW A;  4YOX A;  5EVZ A;  3AAP A;  4KTZ A;  2WBN A;  3CER A;  4KKO A;  3AA2 A;  2RN2 A;  5AR0 A;  4O5F A;  5AFU H;  3DOL A;  3HOS A;  1N34 K;  4BRG A;  2A6A A;  4DU4 A;  1EQY A;  4G9Z A;  2FC0 A;  4U67 L;  2GEL A;  3AVF A;  3DLR A;  4Y0W A;  4M3R A;  2YJF A;  3HPG A;  1EWR A;  3PIO L;  2NLX A;  3O5B A;  3OYB A;  3OS0 A;  1TV6 A;  4DB3 A;  4DFP A;  4B8A B;  3CHW A;  4CHY A;  4JKG B;  4B1W B;  1U47 A;  3CI5 A;  2NUB A;  4CHZ A;  2HF3 A;  4O44 A;  4EAH D;  3KVG A;  4DV5 K;  3MWP A;  4KTQ A;  1HUX A;  3THX A;  4CD1 A;  3ZX0 A;  1HJO A;  4EZ6 A;  1JCF A;  1G99 A;  4FZZ A;  1REV A;  4CGH A;  2HST A;  1XQS C;  3CME N;  1BG3 A;  3S3N A;  4Z4H A;  3IDH A;  5EXW A;  3O6W A;  4BRM A;  4W5R A;  1BCM A;  3VGM A;  3IFR A;  3AA5 X;  3V1O A;  3MEG A;  1A5V A;  3GBT A;  1TL1 A;  4MLE A;  2XY6 A;  3O9S A;  5LMU K;  4NCA A;  3VQQ A;  1IV0 A;  3L8B A;  4GKJ K;  4W5Q A;  3TAQ A;  3THV A;  1LWE A;  1S9G A;  3DXK B;  4FM1 A;  4CZL A;  4O55 A;  2HND A;  3V9X A;  2HBK A;  2IAJ A;  4YOT A;  3B8A X;  4RW4 A;  3LDS A;  4IXC A;  4OLB A;  4AQY K;  1HNX K;  5AQP A;  5KI6 A;  5JS1 A;  3NVK A;  3TSU A;  2QWN A;  3E9P A;  2D0B A;  2E88 A;  3LDL A;  5BRE A;  2XRI A;  4E89 A;  2QKB A;  2AP1 A;  3JAM O;  3SI6 A;  3PLA A;  3LL3 A;  4JK8 A;  1WOQ A;  4M3T A;  2FXU A;  4CI6 A;  3TWH A;  3R9P A;  3A0I X;  5AQJ A;  4BRA A;  3ALY A;  3VOV A;  4AIL C;  3N4P A;  3O4N A;  3RRH A;  2OPP A;  1RTJ A;  2D0O A;  4W5N A;  5JIC A;  2OCE A;  2GWK A;  1QHA A;  3F5T A;  4DQS A;  3OYD A;  1SKW A;  4FLW A;  3HST B;  2HBM A;  3DM2 A;  2ASO A;  1RFQ A;  4H0V B;  4B1X B;  3VQP A;  3SV4 A;  3KD5 E;  4DR4 K;  3O3G A;  2F9W A;  1DTQ A;  1K8K A;  3OYK A;  3QET A;  3EL2 A;  4O0J A;  2O8E A;  4A61 A;  1HNV A;  2HOE A;  4B9M A;  4JI1 K;  4JHD B;  3VEY A;  1VSE A;  1VQP N;  2JGU A;  4J2A A;  1K8A O;  3TU5 A;  3I55 N;  2DPN A;  5C12 A;  1CLQ A;  5KGX A;  3PX4 A;  3WNH A;  4CZE A;  2O8D A;  3CCS N;  4FWN A;  3LP3 A;  1DTT A;  4CD3 A;  4JRP A;  3E1Y A;  4X64 K;  4BC2 A;  1KD1 O;  4ELU A;  1IG8 A;  3O3H A;  3AA3 A;  3CM6 A;  4JS4 A;  4JD2 A;  2OYQ A;  2P9I A;  4CEQ A;  2OPS A;  4WQ4 A;  3ZET A;  3VTI A;  3AO5 A;  3CCJ N;  1KXP A;  2YHY A;  3LDO A;  3CCR N;  3O3F A;  3CQ8 A;  4DQQ A;  3MXJ A;  4YDU A;  1U45 A;  1K9M O;  5AQU A;  3CPE A;  1UAX A;  3SJH A;  1QVG M;  4FOI A;  4HUE A;  1C0F A;  4BC3 A;  4OO1 J;  4GV3 A;  3T1H K;  4XH5 A;  3IRX A;  5LY3 A;  1Q18 A;  4TSX A;  3QEX A;  3CJ9 A;  3TTD A;  3F2K A;  1NGC A;  3CCU N;  2YHB A;  1IBK K;  3NF8 A;  1A5X A;  1SS6 A;  2I7N A;  2EX3 A;  4HHT A;  1QQN A;  4CK2 A;  4KB1 A;  4QS7 A;  3L2W A;  4CFD A;  2I7P A;  4CBX A;  3UKU A;  3UB5 A;  4A2B A;  3ZSO A;  2F8S A;  1VQO N;  2B4J A;  2A40 A;  4OPA A;  4DHY A;  2AJQ A;  2PY5 A;  1T3V A;  3F9M A;  1NJY A;  3O9T A;  4FO0 A;  3MCP A;  4F2S A;  3SQ2 A;  3TR8 A;  1K8K B;  4FJN A;  1T6D A;  4CJ5 A;  4DSK A;  3CJA A;  5AQM A;  4ISF A;  5BPL A;  2VCP A;  2OZM A;  1VHX A;  4JKG A;  3NH2 A;  5C42 A;  1BDG A;  1NU0 A;  4FWO A;  4BQL A;  2OAN A;  4OGE A;  4K8Z A;  2RPI A;  4DFJ A;  2KKZ A;  4CGI A;  1NGB A;  1NK9 A;  5DM6 L;  2YHW A;  3WXK A;  4C23 A;  1K6Y A;  1L3T A;  1S1W A;  4RCH A;  3WXL A;  4IDK A;  1TKX A;  3ZX3 A;  3CF5 L;  1BUP A;  3CJB A;  4EFH A;  4FJH A;  4LC9 B;  4H03 B;  3DLK A;  1N33 K;  3DLH A;  1KLM A;  2BH1 A;  4KI4 A;  4C8N A;  5LJW A;  1RDC A;  5CYM A;  4FWK A;  4JKC A;  1ITG A;  3SBT A;  1BIZ A;  4BR5 A;  2HBJ A;  1RT7 A;  3KD1 E;  1WB9 A;  1IG9 A;  3CC2 N;  1EET A;  4PKG A;  4IDH A;  4RW6 A;  3KKS A;  4FXD A;  1IKW A;  4ILJ A;  4YHH K;  5F0X A;  3CFO A;  3SPZ A;  4DCH A;  4DUZ K;  4DSL A;  3BF3 A;  3CJ7 A;  4IFY A;  2VWK A;  4A62 A;  3DYA A;  4RW7 A;  1H1V A;  4JKA A;  2QA4 N;  3BDP A;  5TKW A;  3RWU A;  2E6L A;  3IMX A;  3W0L A;  1DEJ A;  2P9S B;  3HZ6 A;  1ESV A;  5BN8 A;  4M7X A;  3R1X A;  4OKK A;  5CYQ A;  2E5L K;  3OYL A;  1VQ9 N;  4FWL A;  4AHU A;  3SPY A;  2YX6 A;  3CD6 N;  1NJZ A;  4Y1C A;  4CJT A;  4FM2 A;  3NGZ A;  4CBW A;  2V7Z A;  2UYT A;  1JL2 A;  1QZ5 A;  3ZYY X;  4I9L A;  1HKB A;  1LAW A;  4HTU A;  1Q9X A;  4DR3 K;  4NYF A;  5HRO A;  2Z1J A;  4UQG A;  2NRR A;  3AO2 A;  3AO1 A;  1EO1 A;  1TL3 A;  4BE1 A;  4DTO A;  4ICL A;  1KVB A;  3GOI A;  4NXN K;  1VQ8 N;  4KO0 A;  2LSN A;  4E19 A;  3NH1 A;  4AHS A;  1S72 N;  1OH7 A;  3KKR A;  4DS4 A;  1TGO A;  4FLZ A;  3V4I A;  2YNG A;  3BY5 A;  3CC4 N;  3ZT0 A;  3CG7 A;  3CCE N;  2IC3 A;  4H0T B;  1C1A A;  3I8B A;  1T03 A;  3J7Z O;  4JAX A;  4LSN A;  1JLQ A;  4J8F A;  1JLC A;  1IJJ A;  1HX1 A;  4WFB L;  3UKR A;  1NOZ A;  4IEI A;  5BN9 A;  1SL2 A;  3MXM A;  4FW1 A;  3WUH A;  3J80 O;  4H8K A;  5AQZ A;  2RKI A;  2QK9 A;  1WLJ A;  3HO1 A;  2A1R A;  1BGX T;  2CGJ A;  1GLJ O;  5B8H A;  2QXF A;  3P4I A;  1NMD A;  4JV5 K;  2KFN A;  4H5N A;  4JKF A;  4OKE A;  3V81 A;  3RMC A;  2F8T A;  3QEV A;  1FK9 A;  1Z26 A;  4BDZ A;  4DTU A;  4FJX A;  5K14 A;  1Y64 A;  2QWO A;  3QIP A;  4BVP A;  1YTA A;  3VEZ A;  2KZM A;  3QFP A;  2QTD A;  4CF2 A;  1XHZ A;  4B9U A;  4LH4 A;  1VQ7 N;  4DTJ A;  4AHC A;  2I5J A;  3MAQ A;  4Y1D A;  2E4L A;  1SL1 A;  3VEO A;  3C6T A;  1W9H A;  2O4I A;  3E66 A;  3G10 A;  3WXJ A;  3L3V A;  4QS8 A;  1RDU A;  4K25 A;  3VQE A;  4MO4 A;  4FWQ A;  1NOY A;  1CZ9 A;  2ZGZ A;  1IKY A;  3AVM A;  5AZJ A;  2UUA K;  1WUA A;  3U4L A;  3VQD A;  2CGL A;  1WNS A;  3LM9 A;  4CW7 B;  3MN9 A;  3PX6 A;  2HHQ A;  4K43 A;  3ZSW A;  4F3O A;  2HHV A;  4J2E A;  1BWF O;  2GBZ A;  4DKW A;  2VG7 A;  1E4G T;  4HTL A;  4CJK A;  1SV5 A;  3NF6 A;  1UWB A;  1SQK A;  1NM1 A;  1YJ9 N;  4JI8 K;  3TAB A;  4H4O A;  1TYQ B;  3CJ1 A;  3AA4 A;  2JLE A;  5ELZ A;  4QAG A;  1HNZ K;  3VGK A;  2O8D B;  1LW2 A;  3IUC A;  2FSJ A;  2P9N B;  1R59 O;  4NO7 A;  5F1X A;  3SJJ A;  2VQF K;  3TSP A;  2A42 A;  4HUG A;  1RBR A;  4DMN A;  3G0Z A;  4O4G A;  4WQ4 C;  2P9S A;  4KAZ A;  3B6P A;  1TUU A;  1VSJ A;  1WAF A;  1C0M A;  2KZZ A;  4JN4 A;  4CZM A;  4Z94 A;  4CBU A;  4FJI A;  3KK3 A;  2GEM A;  1YVU A;  3VN5 A;  1BO5 O;  2PYJ A;  4CZK A;  3DRR A;  1J54 A;  5AQH A;  3G6E N;  4CES A;  1XMQ K;  3VQ7 A;  1NK0 A;  2X6N A;  5AQI A;  3OS1 A;  4M3X A;  1L3V A;  3L2U A;  3O9R A;  1MA9 B;  3V9W A;  3SMP A;  1TKZ A;  4CF1 A;  1YIJ N;  3L4Q A;  2OTL N;  3OHR A;  4W5O A;  1X1P A;  3ISN C;  1QQC A;  2VGM A;  2FBY A;  1GOC A;  2CH6 A;  5AQG A;  3OYN A;  4CEA A;  3BEX A;  1JLA A;  1Z05 A;  2YNH A;  1XMO K;  1YVN A;  5J2N A;  4BE0 A;  2P9K B;  5GAH P;  4JI5 K;  1WSJ A;  1VQ6 N;  3PSI A;  3VQB A;  4N76 A;  4FOE A;  1D8Y A;  4IBN A;  3OVN A;  3ZT3 A;  3SUQ A;  1N6Q A;  3ZEU A;  3ZSX A;  3U3Y A;  3P38 A;  4I2P A;  2P5O A;  5AQO A;  1U49 A;  3SBG A;  2HHS A;  3LZJ A;  3ULD A;  1GLL O;  3FLC O;  4CE9 A;  4JNE A;  1T7P A;  4GV9 A;  1FW6 A;  3QEI A;  3VER A;  2F4V K;  4FYD A;  4RTF D;  3VEN A;  3QEP A;  4WQ5 A;  4FK4 A;  4DF4 A;  3KLH A;  3ZT4 A;  2PZS A;  4CCH A;  1D9D A;  5IT9 O;  3C6A A;  2V7Y A;  1OVQ A;  4OPJ A;  5C10 A;  4FK0 A;  3H6E A;  4BRL A;  3NF9 A;  3HPH A;  2D0P A;  4BQZ A;  1WAJ A;  1KRP A;  4ZTJ A;  1SL0 A;  3D0P A;  3NHG A;  3BGR A;  3ZX2 A;  5KRT A;  2IVO A;  3C65 A;  1P8Z A;  4FWM A;  4M63 C;  3J7A P;  4DR2 K;  1HPM A;  4ISE A;  2DY4 A;  1RT1 A;  4FSV A;  3I0S A;  3NF7 A;  2ETJ A;  1RTI A;  3JYT A;  1V4S A;  3G71 N;  3LWL A;  3J81 O;  3FGU A;  3ENH A;  4BAC A;  5ADX H;  4H5T A;  4E7H A;  4CZF A;  3SAG A;  3H1Q A;  4B9T A;  3D2E B;  4RW8 A;  2ZD1 A;  4FVM A;  3TAP A;  3HSC A;  3AO3 A;  3QBW A;  3G4S N;  1UA0 A;  3P83 D;  3K0S A;  3TAG A;  4MO5 A;  1C0G A;  5AZI B;  2G8F A;  4BY9 C;  5GAD P;  5SWM A;  1L3S A;  1N8R O;  3KHY A;  3DLL L;  4KV8 A;  1YTU A;  4CZI A;  5HLF A;  1FKO A;  2KW4 A;  1QQM A;  4PA1 A;  4XH4 A;  4BRF A;  4PQU A;  3ENO A;  1DGK N;  5AQQ A;  1NK7 A;  1TUY A;  5FDL A;  2XHB A;  3TPQ A;  5M1Q A;  2V52 B;  4BR7 A;  2G8W A;  3HVT A;  3VF2 A;  1O1W A;  4C8O A;  1CZB A;  2P1J A;  3RMD A;  1MWK A;  5AQR A;  2E20 A;  4BRN A;  5AFU A;  3FZL A;  3UE5 A;  3SQ4 A;  1NK8 A;  3FFK B;  3VQA A;  1I3A A;  4A2A A;  4BRO A;  2NRW A;  2WC9 A;  3CET A;  2Q2R A;  2O8F B;  2FF3 B;  3D7E O;  3K57 A;  3BZK A;  3THW A;  3PSF A;  5F2R A;  4A59 A;  4IG0 A;  3QBX A;  3HP6 A;  5HL7 L;  3H3O B;  2O8F A;  2R7Y A;  1A5W A;  3LP2 A;  3SQ1 A;  3CCM N;  4CZJ A;  4QS9 A;  4DV0 K;  2O4G A;  1WSF A;  4A57 A;  1QSY A;  4Z4G A;  3EN9 A;  4CEE A;  1BA0 A;  3KWG A;  3TTF A;  4N56 A;  3IS9 A;  4FWP A;  1LWF A;  4YNQ A;  4KI6 A;  2X78 A;  1RNH A;  5HOO A;  2A41 A;  2FBV A;  4F9O A;  4KB0 A;  3S3O A;  1I94 K;  3WNG A;  3KTQ A;  1VSH A;  1HKG A;  3OBW A;  4CIE A;  1JLB A;  4IFE A;  5FRM A;  4IOA L;  5AJ3 K;  3CJC A;  3M6G A;  2QWQ A;  2O8B A;  1C0T A;  3P1G A;  3V1R A;  4W5T A;  3SQ0 A;  2UXC K;  1E4F T;  2YCH A;  2FLO A;  3RMB A;  4XEI A;  4OLA A;  2HNZ A;  5M1P A;  3HXM A;  3PO4 A;  1BI4 B;  3VQ4 A;  4DWI A;  3AO4 A;  3M8R A;  3SAF A;  4DQP A;  1X3N A;  2HHX A;  1ATR A;  3OYA A;  1BCO A;  4PKI A;  4E1J A;  4E7L A;  1HYZ A;  1XNQ K;  4IO9 L;  5JMV A;  4Z4I A;  5LMN K;  4J2B A;  2IDO A;  3HTV A;  1S1X A;  2BAN A;  3EYZ A;  4JI3 K;  3CMA N;  4CJQ A;  2D5R A;  4C8K A;  3IKM A;  2A5X A;  2GUP A;  1XC9 A;  1RT4 A;  2GV9 A;  4GNI A;  5J1E A;  4CFA A;  3OS2 A;  3OYE A;  3T7Z A;  4KHY A;  1JXE A;  2HHW A;  1NKC A;  4KH4 A;  4M45 A;  3OW2 M;  3M3Z A;  4LF8 K;  4KHS A;  1DLO A;  1WSI A;  1Q81 O;  5AQV A;  4X66 K;  4K42 A;  4DSI A;  1Z6R A;  4BVO A;  4O8K A;  4LD0 A;  5M1O A;  2YNF A;  1ASV A;  2HHU A;  2HHH K;  3O9Q A;  1CXU A;  4V19 S;  1KCF A;  1LW0 A;  3QML A;  3QO9 A;  4BRP A;  2B5J A;  1U4B A;  4FJG A;  4M42 A;  1J9A A;  2E2P A;  2P9U B;  1JL1 A;  3P39 A;  5KPR A;  5M1F A;  5E41 A;  5HRR A;  2FBT A;  3ATU A;  3HBT A;  4HUF A;  3I33 A;  3O8M A;  1NJX A;  4BR2 A;  5A2Q O;  1YUW A;  1ASU A;  1W2B M;  3OJS A;  3CFP A;  1RDB A;  4NB4 A;  1KFS A;  2GWJ A;  3CYM A;  3ITH A;  3VEX A;  1K73 O;  2YI1 A;  3L0Q A;  4DSF A;  3VPZ A;  1T6C A;  4JEP A;  2AA4 A;  3RVC A;  4YOU A;  2DFF A;  5JLF A;  3VQ9 A;  5BRF A;  1M90 O;  4DV3 K;  3QNO A;  3GDQ A;  4C8M A;  3LPU A;  1EKE A;  2P9K A;  2NRH A;  5FPM A;  3LAL A;  3EE9 A;  4JKH A;  1S6P A;  3JXU A;  3K5M A;  4CJ3 A;  3NE6 A;  4X65 K;  3O9U A;  4WYB A;  3KLE A;  5JLH A;  4CGJ A;  3VEV A;  3WEE A;  4F8R A;  3U9D A;  4JI2 K;  4CF0 A;  4CGG A;  4CGF A;  1HNI A;  3I0R A;  4B3O A;  1Q86 O;  1YI2 N;  3WQU A;  2ZE2 A;  4FLY A;  2BDP A;  2YHX A;  3DOK A;  1RBS A;  3OBY A;  3AGR A;  3AVN A;  4M3U A;  1BIU A;  1JLE A;  1HLU A;  2ITM A;  2BUP A;  4JI4 K;  2JWL A;  1T44 A;  4LF5 K;  1RTH A;  1KAX A;  1G15 A;  3VET A;  4Q5V A;  4BWM A;  1GLE G;  3BZC A;  4CJR A;  4JI0 K;  4FLT A;  1RT6 A;  1HKC A;  1RDW X;  1OH8 A;  3NGI A;  1QZ6 A;  4NLB A;  4PY5 A;  1VRU A;  4AHV A;  1IH7 A;  2P9L A;  4BRD A;  4J2D A;  3KK2 A;  2GUI A;  1Q82 O;  1T05 A;  4CEO A;  5C15 A;  3DWL A;  4Z4F A;  3ZSV A;  4H0Y B;  4OKJ A;  2D0A A;  4BRI A;  4WCE L;  1QVF M;  2ITG A;  3L4I A;  1NLV A;  1VSM A;  2KHO A;  2Q1N A;  3AV9 A;  4AHT A;  1FXX A;  3RR7 A;  3C95 A;  2Z1I A;  1FKP A;  4H5V A;  2Y1J A;  5EU7 A;  5BR9 A;  3JSM A;  4GY2 B;  3M5R A;  3K5N A;  4JRQ A;  4YOR A;  3CCL N;  1X9W A;  2X74 A;  2ZWH A;  4CZH A;  3V9U A;  4CER A;  1GLB G;  3V1Q A;  3ZEU B;  5AZI A;  1ZBI A;  3UKR B;  1VSK A;  3ZET B;  3AVB A;  4DG1 A;  5FPE A;  2HMP A;  4BRQ A;  2QKK A;  3K9K A;  4HWI A;  4PL7 A;  1YIT N;  1T8E A;  4L3Q A;  1RT3 A;  4IJA A;  1KAZ A;  3WT0 A;  3DRP A;  4AM6 A;  1KAY A;  4IOX A;  3J8A A;  4AF1 A;  4CJW A;  4CJP A;  4FLV A;  1XNR K;  4FL9 A;  1ASW A;  2QM1 A;  1LAV A;  3TAN A;  5CZ2 A;  4H4M A;  3MWT A;  2F7T A;  1KTQ A;  2P9I B;  3H3N O;  1RBU A;  4M3Z A;  5CY4 A;  3ATV A;  1JKH A;  2BTF A;  3GE1 A;  5EX5 A;  4BRC A;  3L2R A;  4DTS A;  3A5O C;  1ZYQ A;  4B1Y B;  2Q97 A;  3OYM A;  4LF4 K;  3C6H A;  3WNF A;  2YJE A;  3LZI A;  1BIS A;  3AVI A;  2E6M A;  4WE1 A;  1E3M A;  3GL1 A;  4YDU C;  3DXM B;  3O08 A;  4YOV A;  4DV7 K;  1W97 L;  4YOY A;  2ASP A;  2J4R A;  3CQX A;  4B1V A;  2YV0 X;  3MN6 A;  2Q36 A;  3LDQ A;  2HNY A;  4BRK A;  1NGI A;  3LM2 A;  4ELT A;  4E7K A;  2UUC K;  4BDP A;  3MDQ A;  2D0C A;  3SK3 A;  3MN7 A;  4KRF A;  3HK2 A;  5LJV A;  1BA1 A;  2YKN A;  1N36 K;  2E2Q A;  1NKB A;  4E7J A;  3V9Z A;  3PO5 A;  3O1B A;  2Z1H A;  5KQD A;  4IOC L;  1DT9 A;  1NJI O;  3VQ8 A;  4NXM K;  2E2N A;  4CEB A;  2PFU A;  3EKS A;  3FZM A;  4GMJ B;  3NH0 A;  4E1M A;  4FCY A;  3NCI A;  1VQ5 N;  3M8Q A;  4DQI A;  3LWM A;  3E9L A;  4X62 K;  4BC4 A;  3MEE A;  4E1N A;  2HVI A;  4LFC K;  4C1N I;  5AQL A;  4YFU A;  5T7B A;  2HB5 A;  4H0X B;  4HCC A;  3FR0 A;  4EP5 A;  4ID1 A;  4NCG A;  4OJR A;  2O8B B;  3G25 A;  2Z1G A;  3S41 A;  3ENB A;  3LAN A;  3HP9 A;  3S9H A;  1NMN A;  1ZC6 A;  3VA3 A;  2CH5 A;  4MFB A;  2ASM A;  4EZ9 A;  4GVE A;  4I9Q A;  3U9Z A;  3A5N C;  3EZW A;  1QE1 A;  5C0Y A;  4CGD A;  3A2F A;  1Q7Y O;  1IKV A;  1QHT A;  2Q3S A;  2ATQ A;  3DXK A;  2ZJP L;  2NZT A;  5AQF A;  5BPN A;  4UY8 O;  3VQ6 A;  2G8K A;  2W6K A;  4BWJ A;  4E7I A;  5DMR A;  1N5Y A;  1S3X A;  5DM7 L;  4WF9 L;  3VA0 A;  4AH9 A;  4BDY A;  4DR6 K;  1HR0 K;  4GV6 A;  4N41 A;  2E1Y A;  1TK5 A;  3DLG A;  3NFA A;  3D2F A;  3ZSR A;  3EKU A;  3DI6 A;  1C0U A;  2XO7 A;  2W42 A;  1BL3 A;  2EWS A;  4ELV A;  4JI7 K;  1S6Q A;  3MMV A;  1WSG A;  1LWC A;  1QSL A;  2HMI A;  3H1V X;  3OYG A;  1JXB A;  5CHI A;  4GW6 A;  5GIO A;  3AGK A;  3CCQ N;  4LFA K;  2VYP A;  4I6M A;  1FJG K;  2IOC A;  3PY8 A;  3HT3 A;  1KVC A;  1KSP A;  4C8L A;  3M8P A;  3W3D A;  4F4K A;  3VQ5 A;  1BQN A;  1HJR A;  4NYN A;  4RG8 A;  4IG3 A;  1QS4 A;  4HCB A;  4WFA L;  3IG1 A;  3SZ2 A;  4KHP K;  5KPT A;  2E8A A;  1V4T A;  2G8I A;  2VQE K;  4CF8 A;  5DK5 A;  1ZBS A;  2VWB A;  1NGF A;  1WN7 A;  1SZ2 A;  4CJ4 A;  3SCX A;  3AVJ A;  4IWV A;  4JKE A;  4DU1 A;  5I9E B;  3LDN A;  2KLA A;  3CIP A; 
#chains in the Genus database with same CATH homology
 1C1C A;  4RW6 A;  4F3T A;  3KKS A;  5J2Q A;  3QIO A;  4CIE A;  1BI4 A;  1JLB A;  1WSH A;  4CED A;  3RMA A;  4FXD A;  1IKW A;  5FRM A;  4IFV A;  3CFO A;  4KTW A;  4CFC A;  1U04 A;  3HPO A;  2DFE A;  3SPZ A;  3K59 A;  4DSL A;  4FJM A;  4IFY A;  2VWK A;  3LP1 A;  4LH5 A;  2FBX A;  3QNN A;  3V6D A;  3DYA A;  1C0T A;  4RW7 A;  3P1G A;  3KIO A;  3V1R A;  3BDP A;  2B6A A;  3ASM A;  3RWU A;  2E6L A;  4CJV A;  4W5T A;  3SQ0 A;  1YT3 A;  4OVL A;  4CHP A;  4DLE A;  3KLF A;  1J5O A;  2WON A;  4DF8 A;  1IO2 A;  3RMB A;  4KFB A;  4I7F A;  3KJV A;  1QSS A;  4OLA A;  4OKK A;  2VG5 A;  5CYQ A;  2HNZ A;  3OYL A;  3HXM A;  4FJL A;  1L5U A;  3PO4 A;  3P5J A;  4AHU A;  1BI4 B;  4CK3 A;  3VQ4 A;  4DQR A;  1J53 A;  3SPY A;  3AO4 A;  3M8R A;  4FLX A;  4DTP A;  2VWJ A;  1NJZ A;  3K58 A;  4DQP A;  1TAU A;  4FJJ A;  4RW9 A;  4Y1C A;  4CJT A;  5KRS A;  3NDK A;  3NAE A;  4FM2 A;  2HHX A;  3TI0 A;  3NGZ A;  3HO1 A;  3OYA A;  1BCO A;  1VSF A;  3U3G A;  3AVA A;  1VSD A;  4E7L A;  4AHR A;  1HYZ A;  4CJU A;  4FJK A;  1JL2 A;  2YHA A;  1LAW A;  1S1V A;  4I9L A;  4HTU A;  1Q9X A;  1D9F A;  2IGI A;  1IKX A;  4Z4I A;  4NYF A;  5HRO A;  2Z1J A;  4FZX C;  5KTQ A;  1Q9Y A;  4J2B A;  2IDO A;  4O5B A;  3DLE A;  4UQG A;  4N47 A;  1B9F A;  3AO2 A;  3AO1 A;  1TL3 A;  4BE1 A;  4DTO A;  5J2P A;  4ICL A;  1EXQ A;  1KVB A;  1VSL A;  4CHN A;  2DTU A;  1S1X A;  2BAN A;  4GVM A;  5FRO A;  3EYZ A;  1TKD A;  4KO0 A;  1KLN A;  2LSN A;  4B9S A;  2G8V A;  3T1A A;  4CJQ A;  4E19 A;  3NH1 A;  2D5R A;  5JS2 A;  4AHS A;  4C8K A;  4CHQ A;  2OZS A;  3KKR A;  4DS4 A;  1TK0 A;  1TGO A;  4EP4 A;  4FLZ A;  4FJ5 A;  3V4I A;  1HPZ A;  2YNG A;  1XC9 A;  1RT4 A;  2GV9 A;  3ZT0 A;  5J1E A;  4CFA A;  3CG7 A;  3OS2 A;  3OYE A;  4DWI A;  4KHU A;  1JXE A;  2RF2 A;  4KHY A;  4DSJ A;  4FJ7 A;  2HHW A;  2IC3 A;  1NKC A;  4FZY A;  4M45 A;  1C1A A;  5CZ1 A;  1T03 A;  4LSN A;  4KHS A;  2XY8 A;  4ID5 A;  1DLO A;  3RRG A;  1JLQ A;  1WSI A;  1L3U A;  2HVH A;  3SNN A;  1JLC A;  5FRN A;  1HYS A;  4DSI A;  3SUN A;  1RTD A;  3HJF A;  4B8C A;  1NOZ A;  1SL2 A;  4LD0 A;  2YNF A;  4FW1 A;  3MXM A;  2P5G A;  1ASV A;  2HHU A;  1CXU A;  4H8K A;  1KCF A;  1HYV A;  1LW0 A;  2RKI A;  4DFK A;  3K2P A;  4CJE A;  2QK9 A;  1WLJ A;  3O4Q A;  3LPT A;  3AVG A;  3C94 A;  2BE2 A;  3QO9 A;  2A1R A;  1UA1 A;  3F9K A;  2OA8 A;  2B5J A;  1U4B A;  4FJG A;  1BGX T;  1KFD A;  2HW3 A;  4M42 A;  5HBM A;  1J9A A;  1JL1 A;  2QXF A;  5E41 A;  1TVR A;  4FK2 A;  5HRR A;  2KFN A;  4IKF A;  3QLH A;  4OKE A;  4CEF A;  4Z4E A;  2FBT A;  3HYF A;  4CJL A;  3V81 A;  4HUF A;  3RMC A;  3AVK A;  1RDD A;  4FJ9 A;  3QEV A;  1NJX A;  2F8T A;  1FK9 A;  1HQU A;  4ZTF A;  1Z26 A;  4BDZ A;  4CJS A;  4DLG A;  4DTU A;  4FJX A;  1F21 A;  1ASU A;  3E01 A;  5K14 A;  5KGW A;  3OJS A;  3CFP A;  3NBP A;  3QIP A;  4CK1 A;  4DU3 A;  1RDB A;  1YTA A;  1KFS A;  3MXI A;  2KZM A;  1X9S A;  5J2M A;  3AVH A;  3CYM A;  4CF2 A;  1SUQ A;  3ITH A;  3IAY A;  1XHZ A;  1GOB A;  3SUP A;  1RBV A;  3ZSZ A;  4B9U A;  1XHX A;  4DSF A;  2IS3 A;  2P51 A;  4LH4 A;  1R0A A;  4CIG A;  2EHG A;  4DTJ A;  3PV8 A;  1VSI A;  4AHC A;  2I5J A;  3MAQ A;  4Y1D A;  1VK0 A;  2DFF A;  2E4L A;  3VQ9 A;  2OPR A;  1SL1 A;  2G8U A;  3C6T A;  1W9H A;  3QNO A;  2O4I A;  3G10 A;  3L3V A;  3KLI A;  5HRP A;  1NJW A;  4C8M A;  3LPU A;  3RR8 A;  1JLG A;  3S3M A;  1QTM A;  1EKE A;  4KTZ A;  2X6S A;  3SV3 A;  4Z0U A;  3VQE A;  4KKO A;  1NOY A;  1CZ9 A;  3AVM A;  1IKY A;  3AA2 A;  2RN2 A;  3L3U A;  4O0I A;  4R5P A;  3LAL A;  3DOL A;  3VQD A;  5HRN A;  4DU4 A;  1WNS A;  1S6P A;  2A1S A;  2FC0 A;  4CJ3 A;  3K5M A;  3AVF A;  3DLR A;  4ZHR A;  4M3R A;  3HPG A;  3NE6 A;  3PX6 A;  2HHQ A;  4LY7 A;  3ZSW A;  3DRS A;  4F3O A;  2HHV A;  1CXQ A;  4J2E A;  2GBZ A;  3KLE A;  3OYB A;  2VG7 A;  3OS0 A;  1TV6 A;  4CGJ A;  4CJK A;  4FJ8 A;  5I42 A;  4Q0B A;  4DFP A;  4B8A B;  1SV5 A;  1NKE A;  3NF6 A;  1UWB A;  4CHY A;  4CGF A;  4CF0 A;  4F8R A;  4CGG A;  4M3W A;  1U47 A;  1HNI A;  3I0R A;  2NUB A;  4CHZ A;  4B3O A;  3TAB A;  2ZE2 A;  4O44 A;  4H4O A;  4FLY A;  2BDP A;  2BGG A;  3DOK A;  3OJU A;  3KK1 A;  1RBS A;  4E0D A;  4KTQ A;  5C25 A;  3AA4 A;  2JLE A;  3AVN A;  4M3U A;  4EZ6 A;  1BIU A;  1HQE A;  1JLE A;  2KTQ A;  1JLF A;  4QAG A;  4FZZ A;  1LW2 A;  1REV A;  4CGH A;  4L8R B;  3MED A;  1X9M A;  1RTH A;  3TAE A;  1G15 A;  1EP4 A;  3S3N A;  1RT5 A;  4Q5V A;  4Z4H A;  3SJJ A;  4BWM A;  3NGY A;  4OGC A;  4CJR A;  4HUG A;  1RBR A;  1RT6 A;  4DMN A;  4W5R A;  1BCM A;  4FLT A;  4QCL A;  3G0Z A;  4DTM A;  4O4G A;  3NGI A;  3AA5 X;  4KAZ A;  3B6P A;  3V1O A;  4PY5 A;  3MEG A;  1VRU A;  1WAF A;  1A5V A;  1C0M A;  1VSJ A;  2XY6 A;  1TL1 A;  2KZZ A;  4AHV A;  1IH7 A;  4NCA A;  4KRE A;  3VQQ A;  3K5O A;  3T19 A;  4J2D A;  3KK2 A;  2GUI A;  1RT2 A;  4FJI A;  3KK3 A;  1YVU A;  3L8B A;  1GOA A;  3VN5 A;  4JS5 A;  4NCB A;  1T05 A;  2PYJ A;  4W5Q A;  4CEO A;  3TAQ A;  1U48 A;  4G1Q A;  1Y97 A;  3THV A;  4K8X A;  1HMV A;  1LWE A;  3DRR A;  1J54 A;  1S9G A;  4Z4F A;  1SKS A;  4FM1 A;  3ZSV A;  4DTR A;  4O55 A;  4OKJ A;  3OYC A;  2D0A A;  2HND A;  4CES A;  3VQ7 A;  3V9X A;  2X6N A;  3OS1 A;  2IAJ A;  1NK0 A;  4M3X A;  1L3V A;  3PUF A;  2ITG A;  4RW4 A;  3L2U A;  3LDS A;  1NK5 A;  1VSM A;  3KLG A;  3V9W A;  3AVC A;  3AV9 A;  1TKZ A;  4CF1 A;  4OLB A;  4OPK A;  2DFH A;  1FXX A;  4AHT A;  5SZT A;  3RR7 A;  3C95 A;  2Z1I A;  5KI6 A;  4W5O A;  4CEC A;  1FKP A;  1X1P A;  2Y1J A;  3ISN C;  3L2Q A;  1QQC A;  5JS1 A;  4DTX A;  4KHN A;  2FBY A;  5EU7 A;  3JSM A;  1GOC A;  1ZBU A;  2D0B A;  4M3Y A;  3K5N A;  2XRI A;  4E89 A;  4CEA A;  3OYN A;  4JRQ A;  1JLA A;  2YNH A;  4KHW A;  5J2N A;  2QKB A;  4HVJ A;  4BE0 A;  3SI6 A;  1X9W A;  1ZBH A;  2X74 A;  3DMJ A;  4BE2 A;  3V9U A;  4CER A;  2KQ2 A;  1WSJ A;  4M3T A;  3TWH A;  3V1Q A;  3VQB A;  4N76 A;  3HM9 A;  1D8Y A;  4IBN A;  3OVN A;  3ZT3 A;  3ALY A;  3SUQ A;  1N6Q A;  3OYI A;  1ZBI A;  1VSK A;  3ZSX A;  1C1B A;  3ZSY A;  3U3Y A;  3AVB A;  4DG1 A;  4I2P A;  2P5O A;  1U49 A;  4PWD A;  3QIN A;  4AIL C;  2QKK A;  2HHS A;  3LZJ A;  3ULD A;  1T7P A;  4CE9 A;  3O4N A;  1T8E A;  3RRH A;  1TAQ A;  2WOM A;  1RT3 A;  1RTJ A;  2OPP A;  4W5N A;  1RCH A;  3QEI A;  3DRP A;  4CJW A;  2Y1I A;  4FYD A;  4CJP A;  4FLV A;  4PUO A;  3QEP A;  1ASW A;  4DQS A;  4FK4 A;  2ZQB A;  4DF4 A;  1LAV A;  3OYD A;  5CZ2 A;  3F73 A;  4H4M A;  3KLH A;  3LAK A;  4N5S A;  3TAN A;  1SKW A;  3ZT4 A;  4LSL A;  3OYJ A;  1KTQ A;  4FLW A;  2PZS A;  1RBU A;  3HST B;  4M3Z A;  4B9V A;  5CY4 A;  4CCH A;  3M8S A;  3DM2 A;  1JKH A;  1D5A A;  3L2R A;  4DTS A;  1ZYQ A;  1D9D A;  1NK6 A;  3OYM A;  4DSE A;  1I39 A;  1ZBL A;  3WNF A;  4M41 A;  2G8H A;  3DLB A;  3LZI A;  1BIS A;  4FM0 A;  3VQP A;  3SV4 A;  1SKR A;  1LV5 A;  3AVI A;  3L2V A;  2E6M A;  4CIF A;  3KD5 E;  3O3G A;  4WE1 A;  4OPJ A;  5HP1 A;  3OYK A;  1DTQ A;  3QET A;  4KHQ A;  4FK0 A;  4O0J A;  1HNV A;  3NF9 A;  4B9M A;  3HPH A;  1VSE A;  1WAJ A;  2JGU A;  1KRP A;  4J2A A;  3TAR A;  4ZTJ A;  1SL0 A;  1UOC A;  3SYZ A;  1CLQ A;  1Z25 A;  5KGX A;  3D0P A;  3PX4 A;  3WNH A;  3I8D A;  3QEW A;  3NHG A;  3BGR A;  4E3S A;  3LP3 A;  2YV0 X;  1DTT A;  5KRT A;  2HNY A;  3OYF A;  4JRP A;  3ZT2 A;  3TAM A;  4ELU A;  1WSE A;  4ELT A;  4E7K A;  4BDP A;  2D0C A;  3O3H A;  3WNE A;  4KRF A;  3AA3 A;  3CM6 A;  4JS4 A;  1BHL A;  3HK2 A;  2DY4 A;  1RT1 A;  2YKN A;  2OYQ A;  3I0S A;  4CEQ A;  4XIU A;  2OPS A;  3NF7 A;  2ETJ A;  4CFB A;  1RTI A;  1NK4 A;  3JYT A;  1NKB A;  3LWL A;  4E7J A;  3SUO A;  2YKM A;  3FFI A;  3V9Z A;  3AO5 A;  3B6O A;  2PYL A;  3PO5 A;  3CM5 A;  4DFM A;  4B9L A;  2Z1H A;  1RDA A;  2YNI A;  3LP0 A;  4CF9 A;  3O3F A;  4BAC A;  3CQ8 A;  4DQQ A;  4F2R A;  3MXJ A;  3VQ8 A;  1U45 A;  3OYH A;  1RIL A;  4E7H A;  4CEB A;  4B9N A;  1UAX A;  4B9T A;  4GMJ B;  3NH0 A;  1EX4 A;  4E1M A;  4FCY A;  4RW8 A;  3NCI A;  4HUE A;  2ZD1 A;  4FVM A;  1XWL A;  3M8Q A;  4DQI A;  3AVL A;  3TAP A;  2XY7 A;  3TAF A;  3AO3 A;  5HRS A;  3IRX A;  3LWM A;  3MEE A;  4TSX A;  4E1N A;  1KVA A;  3QEX A;  2HVI A;  1UA0 A;  3P83 D;  4YFU A;  2F96 A;  4CHO A;  5T7B A;  3U6F A;  2HB5 A;  3TAG A;  3EZ5 A;  4HCC A;  4EP5 A;  4ID1 A;  4NCG A;  2G8F A;  1L3S A;  5SWM A;  4OJR A;  2KFZ A;  2YHB A;  3CFR A;  3C6U A;  3NF8 A;  1A5X A;  2Z1G A;  2EX3 A;  3LAN A;  4HHT A;  3HP9 A;  4KV8 A;  3S9H A;  4B08 A;  4QOZ B;  4CK2 A;  3VA3 A;  1TK8 A;  4MFB A;  1YTU A;  5HLF A;  4EZ9 A;  4I9Q A;  4KB1 A;  3L2W A;  1MU2 A;  1FKO A;  4JLH A;  4CFD A;  1QE1 A;  3LAM A;  4CGD A;  2KW4 A;  3A2F A;  1IKV A;  1QHT A;  2Q3S A;  3VQC A;  3ZSO A;  2ATQ A;  2F8S A;  4PA1 A;  1RBT A;  2B4J A;  3H08 A;  4PQU A;  2VG6 A;  4MQ3 A;  3VQ6 A;  3HL8 A;  2G8K A;  2AJQ A;  1NK7 A;  4BWJ A;  4E7I A;  2PY5 A;  5DMR A;  1N5Y A;  1NJY A;  3HVR A;  5FDL A;  2XHB A;  1C6V A;  3D45 A;  3VA0 A;  4F2S A;  3SQ2 A;  4AH9 A;  2G8W A;  3TR8 A;  4BDY A;  4KPY A;  3RTV A;  3HVT A;  4FJN A;  3T3F A;  1O1W A;  4C8O A;  4N41 A;  2XY5 A;  1CZB A;  4CJ5 A;  4I2Q A;  1TK5 A;  3DLG A;  3NFA A;  2P1J A;  3RMD A;  4DSK A;  3ZSR A;  1B9D A;  3ZT1 A;  3DI6 A;  1C0U A;  2XO7 A;  2OZM A;  2W42 A;  3MEC A;  2OPQ A;  1BL3 A;  4ELV A;  3NH2 A;  1S6Q A;  3OY9 A;  1WSG A;  5C42 A;  3SQ4 A;  1Q8I A;  1LWC A;  3PX0 A;  1QSL A;  2HHT A;  4CEZ A;  1NK8 A;  4Z4C A;  3VQA A;  1I3A A;  2HMI A;  4CJF A;  4DTN A;  3OYG A;  1JXB A;  4OGE A;  1S9E A;  3K57 A;  4K8Z A;  2RPI A;  4GW6 A;  4DFJ A;  1TKT A;  5D3G A;  4CGI A;  3ZSQ A;  1NK9 A;  2IOC A;  3PY8 A;  3HT3 A;  1KVC A;  4IG0 A;  3QES A;  1KSP A;  1K6Y A;  4C8L A;  3HP6 A;  1S1W A;  1L3T A;  3M8P A;  1XI1 A;  1VRT A;  3EY1 A;  3K5L A;  1B92 A;  4IDK A;  1S1T A;  1A5W A;  1TKX A;  3LP2 A;  2R7Y A;  3SQ1 A;  1S5J A;  4F4K A;  3VQ5 A;  5I3U A;  1BQN A;  1HJR A;  2O4G A;  4NYN A;  1WSF A;  3ZCM A;  3V9S A;  4RG8 A;  4IG3 A;  1QSY A;  1QS4 A;  4HCB A;  4FJH A;  4Z4G A;  3IG1 A;  4CEE A;  3DLK A;  3SZ2 A;  5C24 A;  4DS5 A;  3DLH A;  3UIQ A;  1KLM A;  2G8I A;  1S1U A;  4CF8 A;  5DK5 A;  4KI4 A;  4N56 A;  3IS9 A;  4C8N A;  1LWF A;  1ZBF A;  4YNQ A;  4KI6 A;  3QER A;  1HRH A;  1WN7 A;  4CJ4 A;  2X78 A;  1RDC A;  4FW2 A;  1RNH A;  3SCX A;  3AVJ A;  5CYM A;  1ITG A;  2FBV A;  4KB0 A;  1BIZ A;  3S3O A;  4DU1 A;  1RT7 A;  1BQM A;  1W0H A;  3WNG A;  3KD1 E;  1IG9 A;  4FLU A;  1EET A;  3KTQ A;  1VSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...