3AA9A

Crystal structure analysis of the mutant cuta1 (e61v) from e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
b'TASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein cutA
publication title Remarkable improvement in the heat stability of CutA1 from Escherichia coli by rational protein design
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 22
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aa9A00
1OSCA 3HLUA 4RWWA 3AHPA 2J9EA 3M05A 1HWUA 1UL3A 1NH8A 3LF0A 3GSDA 3O8WA 2J9DE 1NH7A 4NYOA 4C3LA 4C3KA 3O5TB 4YB7A 2CZ4A 3L7PA 1KR4A 5D4OA 1V6HA 1P1LA 4WK3A 3NCPA 4CO1A 3CE8A 4CNYA 3NCRA 4OZJA 4C3MA 4USJC 3DFEA 4RX6A 1NAQA 5DRKA 1NZAA 1O5JA 2NUUG 4D3HA 4CO3A 3N5BA 2XZWA 4CO4A 5DS7A 2JJ4D 4E98A 3T9ZA 3OPKA 1V3SA 2RD5C 3AA9A 3AA8A 3AH6A 2J9DA 2ZOMA 5L9NA 4Y65A 1UMJA 1VFJA 4Y6IA 4IYQA 1XK8A 2GNKA 1V9OA 2GW8A 4USHA 2E66A 1V3RA 2EG1A 2Z0GA 1VHFA 2J9CA 4CNZA 5D4PA 5D4NA 3TA0A 3MHYA 1H3DA 4R25A 3NCQA 4YB6A 2EG2A 4YB5A 4OZLA 1QY7A 2NS1B 3BZQA 4OZNA 2XBPA 3X3UA 2XULA 2PIIA 3TA2A 2V5HG 4CO2A 4AFFA 2GX8A 4RWXA 2DCLA 2O67A 5D4LA 1J2VA 4NYPA 4D3GA 1UFLA 1GNKA 4RLEA 2VD3A 1PILA 4USIA 1O51A 4ZK7M 2NUHA 3TA1A 2O66A 1UKUA 4CO5A 1Q1KA 2XG8A 4CO0A 2ZFHA 4WK1A
chains in the Genus database with same CATH superfamily
4BWMA 4WF9Q 2VB6A 4PXCA 3RG6A 2G1HA 2GA7A 4IFYA 5K20B 4WZMA 2UUWA 2AQ4A 2DNNA 1R27B 4J9SA 1N54B 1C1CA 2X3DA 1WDTA 4A4JA 2QX0A 3NCPA 2FVCA 1GMWD 5GMEA 1SC1B 2WB1D 4OZJA 1RA7A 2AJ0A 1S4FA 3V81B 2LXUA 2O1PA 1DTTB 3ILJA 2VJUA 4PRFA 2HGNA 2XY5A 1M1HA 3SEOA 3HXMA 3ONQA 3QGGA 1V9OA 1I94J 1NB2A 4CRJA 3CCVS 2BE7D 2F1FA 4EZ9A 1JWWA 4ZLPA 2ALZA 2Y8YA 4KKOA 5CA5A 2ACMA 2P9GA 1WNEA 2MGZB 4RZRA 2BV3A 4EYIB 4ZCKA 2Z56B 2LFVA 2XSJA 4CLFA 1CPZA 1E6VB 2HQFA 2OPRB 2C2MB 5KT3A 4CO5A 4MFBB 2HMIA 2D3OR 4IDKA 3LA0A 2V68A 4OX8A 3HZEA 2P9CA 4DPOA 4UUXA 3KNAA 1U2CA 1S9FA 4AE5A 1T9WA 4ER8A 3OBIA 4M5DB 3MM9B 3FSIA 1U1OA 4CLWA 4F50A 4CDIA 3MEKA 3SBMA 2VPYB 1NNDA 2B9YA 5K14B 4ILMA 3KNGA 3AXKA 4HI2A 1GTEA 1ZA1B 3Q2SC 3FC9A 2DB1A 1CQNA 3ENAA 1PSDA 5JUMA 2O5DA 3IM9A 2ZC4A 4OI0A 5CZVA 3EWGA 3BR8A 2UU9F 2DR9A 4KJIA 5DG9A 1HWKA 1BD6A 5HBMA 3AAWB 3DRRB 4CIOA 4GRSA 1TU0B 4L75A 3NMRA 4WE1B 1HQ2A 5C5JA 2BKNA 4C6AA 4C8ZA 1UFWA 5IWAJ 3FK4A 5KFUA 1VQLS 4KHPF 4J37A 4IO9Q 2ZEJA 2HHHF 2QJ3A 4C48A 3GTYX 3TQ1A 1SPBP 2DVIA 2FLOA 3PIOQ 1T9VA 4JV2A 3AHPA 2Y1IA 1X4CA 4F4ZA 1U1KA 1NH7A 1H7XA 2DHXA 3KJQB 4L3KA 2KM8B 2ZKUA 1P27B 5A2QY 1P1LA 1NK8A 4MK8A 4KGZB 4ANEA 1DJ0A 5HMYA 4P52A 2YNGA 2HBRB 2COLA 5HL7Q 5E3PA 4KIAA 2MLZA 1T05B 1D8ZA 1J27A 4B17A 2FHJD 4KH1B 5LXRA 1CJTA 2FIUA 2EG1A 1RZMA 1VHFA 3HJVA 4OX9F 3HF5A 2ADCA 3OHAA 2BRKA 3BQ2A 1KRPA 2JEJA 2IVMA 3SCLE 2LXFA 4RW8A 1RADB 2YNFA 3C15A 2W4DA 4K4UA 2C2EA 5F3TA 1TVRA 4PG5A 2CG8A 1CQMA 3EICA 4A8FA 1R7IA 1S9GA 2QO3A 5DQGA 1LK7A 1RBOB 1UA1A 4K7QA 1GMVA 2DHAA 4P9SA 3BN4A 3GV7B 4CNYA 4LRCA 4J9NA 3MMBA 2ZVSA 4DR3F 4HT5A 1PCAA 1SKUB 3ZXWA 3OVBA 1X31C 4RW6A 4Z37A 1S9EA 2RHQB 4W92B 1WWHA 3RZAA 5HMXA 4KTQA 4NLWA 2EI5A 3LP2B 3HVRA 3AODA 1REVB 3ZTPA 2CQ1A 5ETSA 1Q5YA 1XTZA 2VQFF 1MMLA 1F9HA 2AGOA 4ICLB 4RBUA 4EI2A 3CJ5A 1GAOA 2EW9A 3E01B 1RSCA 2IY5B 2FHMA 5GADI 1SL1A 1UFLA 4KHMA 5T7LA 3PY8A 4HR2A 1UP1A 2J8SA 2WBRA 1VOMA 2V2QA 1O8BA 1VRUB 3CIMA 4I2QA 4LFAJ 2VV5A 3BQ1A 1SC4B 2FVRA 1KS2A 2AKWB 1RT6B 2XSFA 1RTIB 2M3DA 4X62J 3T41A 2NZ4A 1O6XA 4IQXA 1JLQA 5KG2A 4Z2XA 3JSYA 1SJ1A 3EPIA 4F0HA 3QSYB 1SJ4P 3OTCA 1OY8A 1Q81T 3D1OA 4MK7A 3VVTA 1SBRA 2AEFA 2UXDJ 5EN1A 3N5FA 2GHVC 1HPZB 4X4OA 5M2PA 4GKKF 3I4PA 1W7WA 3OJSA 1HIYA 3BSAA 3A12A 3V6DA 3I4HX 1OIAA 1XR7A 1NSAA 2QMXA 5IT9Y 1RA6A 3MAAB 2BE2B 2BM0A 2IJRA 2HRYA 1I5OB 1VQPS 2DGOA 2OFHX 5AJ3F 4WK1A 3UNGC 1FE4A 4LFBF 4EMDA 3PW4A 1M5OC 4F2SA 1EAYC 3HHLA 3NEKA 4IR1A 3E8OA 4DSFA 1PGZA 4DG1B 4JI0J 1IBCB 3K58A 4AQYJ 4LSNB 3D9BA 4J5OA 1WF0A 2PSZA 2MQOA 2GCFA 3J7A1 1T03A 1JLBB 5I3UB 3MEDB 4OZ1A 3DOKB 2UUBJ 2L9NA 1BGXT 3TAQA 2XZWA 1ZZNA 3T5KA 3VAKA 3DGPB 2DRBA 4XDCA 1S6PB 3UNYA 2UUCJ 4R0JA 2YQ3A 1EHWA 2XWYA 4OYIA 1HQUB 1VQ8S 3P5BP 1SIWB 3IWLA 3AY0A 1JLFA 2IAJB 2PN6A 1LFPA 1RB0A 2Z58B 3S7RA 2YX7A 2VG7A 1FF2A 2MEWA 3LW5C 2C2OB 4C8YA 2XMMA 4PQUA 5AXKA 4Q2MA 2HFVA 5LL6d 1RKIA 2OMLA 2PT0A 1M90T 3H2VE 2ZFHA 2LMIA 5J2NA 3HKZD 1RT7B 4QIEA 3KK3B 2FDNA 4LF6F 3BKUA 3CMAS 3NGTA 3AOAA 4XDDA 5DGBA 1RWWB 1X5TA 3ET6B 5KFWA 1RT3A 2CPHA 3DFEA 1HHTP 3KLFA 3TUZC 3A4TA 3M9MB 4C9DA 4RW7B 2EFNA 1S12A 3DLEA 3LANA 1F5BA 1HBMA 3OPKA 5IXUA 4OV1A 5LM7E 3MUVP 3MR6A 4USTA 2E1CA 2R8HA 3CCMS 4DPYA 4CLLA 4IO1A 2RQMA 3P4UB 1R0AB 2WHOA 3QO9A 2HFSA 2EEYA 2CPXA 3Q8QB 1LWEB 4OQJA 3ZZOA 2CJBA 4X4QA 2V9KA 3VGVA 4Q0BA 4F3QA 2P9EA 2KFZA 3G71S 3MMAA 3PRDA 4ZP7A 4NCBA 2ZZMA 5LJ3Y 3QJPA 5CYQB 2KM8C 5D0HA 2B5JB 4DPWA 4G1PA 4EEYA 4GVBB 3EJMA 4K4ZA 2DNGA 2BOAA 3ZTRA 1A7GE 4FXWA 2PA8D 3G86A 4V19J 1H72C 1XMQF 3G6ES 1SUQB 5DLGA 1RE1B 3TNVA 1XR5A 3FFIA 4ZCIA 2J9DA 2XY6A 3NBPB 4H4MB 4BBYA 3SSRA 3ITHB 4FYYB 5KFOA 4H54A 1FRMA 4NCGB 4JI6F 1OYEA 5D4PA 4IQMA 2XZTB 5DLFA 5C42A 1YRUA 2EG2A 3N01A 3BGLA 2VG6A 2QZ8A 2QEXS 1FNMA 2V6AA 2DHSA 3T5HA 3TZZA 3NKYA 4ZP9A 3SQOP 4CH1A 2POKA 2LEBA 1IKVB 2N3OA 1IBLJ 1KEKA 3D6MB 5C25B 2BW2A 4ED6A 2CQCA 4OYAA 2PA3A 2ZE2B 4DPXA 2OLWA 2W7OA 4ECYA 1YITS 4PAAA 2HHWA 3HSJA 3WQPA 2R8IA 2H4YB 1NHVA 5C24A 2VF3A 1NLKL 1UVIA 2DNQA 3UDCA 4ZKAA 2FVSA 1R89A 4NASA 2M5YA 2V67A 1JK9B 1VS3A 2RQKA 3U1NA 1P9QC 3CC7S 3FQLA 5LMNJ 3DXBA 3US5A 4DL2A 3I0SB 1PO6A 4QQBA 2Y9HA 5KFCA 4EBDA 3A8JA 2LKZA 2QYGA 3I87A 3OD2A 3JSMB 4FXDA 2XULA 3RAXA 5L46A 1VHIA 3JYTB 4I56A 1T11A 3TWZA 4Y00A 1JNRB 4IRDA 3NGUA 1PG5B 4ECVA 4DL4A 1MMNA 2RS8A 3IG1A 2V94A 1UWAA 3G82A 2NSBA 2CQGA 4CT8A 4OI3A 2IC3A 4UOFA 5KT6A 1EQ0A 3K5PA 1WUUA 1Y9OA 1FVQA 2LDYA 1JXEA 2BQUA 4NXMJ 4DMZA 2CG4A 3BYRA 2AHOB 3SYZA 4OJGA 4LFCF 2F4VF 1XQIA 3GWCA 1S72S 1WEXA 1TL7B 5ETLA 4X84A 1LW0A 1TQLA 4USUA 4B3TF 4BC7A 5E5NA 2PGCA 3GR0A 5GAEI 3UR3C 2LA6A 3AA8A 1FTCA 2ZKTA 2UUAJ 1S1UB 4R5PB 4HEA9 2W2OP 3JXOA 1RAAB 1QDUB 4IG0A 5A8KA 3DDKA 2XEXA 1RP5A 1XNQJ 1RDRA 4WFAQ 2CNKB 4IKAA 3P49B 3GILA 5K8OA 4WWSA 4F4KA 2KXHA 2HNDA 2YNHA 4DR1F 2YWFA 4OHWA 3SXLA 1RWUA 5D4LA 1RT5B 2UP1A 2ZC3A 3J7YI 5IV3A 1VRTA 2UZAA 4Y34A 5IQ6A 1HMVA 4DV0J 5F41A 2KVIA 4NMLA 2EFGA 2MSSA 1KNZA 2H3EB 3MDFA 2V4RA 2F40A 4B3SJ 2YXLA 2HAFA 3GPAA 1S0VA 1YVFA 5HATA 4X4RA 2MZSA 2JHEA 2XI3A 1JLGA 3W3SA 4O3PA 4IH7A 1M0SA 1LW2A 4AL7A 4O4GA 3EPGA 2H4WB 2FLPA 5A0YA 1NZAA 2AYGA 3W8GA 4DQIA 2MQNA 1M5KC 2B4UA 3MM7B 2FJVA 4NI2A 1UAWA 3K7RA 4PPDA 3M8PA 2K3IA 4KB7A 4H4OB 1LWCB 3CDWA 4LR9A 1TZ0A 4K4WA 2X3GA 1AROP 4X4PA 2R8KA 2OEKA 3C19A 3Q2TC 3G87A 2DH9A 2ZH2A 4ZITA 1H6KX 3RUBL 3ZZZA 2M8DB 2IA6A 2XNQA 4ATNA 1FX4A 3WBZA 1PKUA 2CQ3A 2ACYA 3VZIA 4C8MA 1NXIA 2ZOGA 3RB6A 2RDDA 3L7PA 4ZVUB 4F4YA 3BSOA 2X1FA 4WK3A 1KQSR 3TUIC 1SJ3P 3IMQJ 4I6YA 4RUBA 1RWXB 2VUGA 4RR5A 2ZBQA 4JI2F 3CPWR 2WBMA 2V8DA 3IAS9 2PC6A 3ZZRA 4YN3B 4TU7A 2JX2A 5C2CA 3PHTA 3BYPA 1EKRA 1TV6A 2LECA 2Q6BA 1MN9A 1TKTA 3AFGA 3MF5A 2ASYA 4DX5A 4MH8A 4LBIA 3NY0A 4URGA 2OO4A 2V5HG 3DRYA 4URQU 4RWXA 3F0NA 4ZA1A 4CLTA 2BZ2A 2E5JA 5F8NA 4F26A 3GE9A 4Q5VA 3BO4A 2XG8A 3GLJA 4DV6F 2BVZA 3WIUA 2QSFA 4QJVA 2I6WA 2GMJA 4PXEA 2VBXA 4OJHA 5FDLB 2AMCB 1FRLA 1X7VA 4U6PA 3UCUP 3G8TA 2CRLA 3H2LA 1MNEA 1NMEB 3QGPA 3AJ2A 2CJ9A 1R0CB 1OS5A 4PUOB 3GYNA 2OKQA 4B9UA 3OR2B 2I38A 5DZ7A 2R7XA 1H7WA 1QTNB 4TY8B 2HGLA 2HNZA 3EDRB 4QU7A 5E2QA 1Y7PA 1YIJS 2HYIB 2F8EX 4I68A 4RW9A 3PZPA 1B99A 2GC8A 3OFEA 2NPFA 2JEFA 3ZNJ1 3M9NB 2E66A 4O3OA 3E51A 2EWHA 4FVCA 2W9BA 1VGYA 2ZBCA 4QYRA 2HAIA 4R25A 1S0OA 2QA1A 3PHEA 2QLBB 1G1XA 3B4DA 1RHJB 3GV5B 1R31A 2H1YA 2V50A 2BJDA 4Q2LA 4ZVEA 4ZVSB 3ISZA 2OUGA 5E3AA 4X64F 4X65F 3CCJS 4IFVB 2QA2A 1M5PC 5L1LA 2FHOB 3ZTQA 2JDJA 2L48A 3E3XA 1UWBB 3UVJB 2DBBA 1YBAA 3GIKA 3DRSA 2CAJA 1ZM2A 5J1PA 2DGSA 4JYAF 1ZM9A 3M6XA 3FCHA 1HLWA 1OO0B 1VQOS 4J9OA 2GQQA 2P8IA 2Y0BB 3RU0A 1X4DA 1NKEA 3PO4A 5LOQA 2JL9A 3I5AA 4OYBA 3RB3A 1UW4A 1HWLA 4MT1A 1XC9A 1F3FA 2VQFJ 2RH3A 1V3RA 4M5IA 1PJ7A 2BKOA 2I5JB 4OX7A 2D69A 2DNMA 4C97A 4DOZA 4DUTA 1S6QA 4K5SA 1X9SA 3VAJA 2NLWA 1J2VA 4C11B 1V5IB 1JLEB 2GIQA 1TAQA 4QPXA 3UN2A 4L6V3 1R6YA 2FHKA 5AT1B 1CJKB 3G6YA 3KK2A 2X1GA 3GCWP 3KLGA 1JXVA 3QQCD 4EO6A 4PWUA 1XMBA 2DIUA 2R7RA 2XHWA 3GJTB 3LAKA 4JP8A 1QAYA 1EP4B 4YHHF 5KOXA 1C4CA 2DEJA 1IR0A 2MKYA 4DU7A 4TU8A 1N5YB 2F9DA 3NGDA 3TANA 3HJFA 1JLAB 4EK2A 5DDQC 9RUBA 4N77A 1TL4A 2GAGC 2BX6A 1Y3KA 4LSLB 4GKKJ 4WYWA 1N34J 4RW4A 2IMWP 3PXGa 3J7AN 2IYIA 2J9CA 2DPJA 1HYSB 2Z8QA 3RR8A 2R8GA 1U25A 5KFYA 3AQOA 3FJ2A 2CPZA 3ZC4A 4NCAA 2XBPA 2Q3PA 1IBMJ 3R5AA 5GADU 1RU1A 2R7OA 3VGTA 3K5NA 2IJFA 3PIPQ 4DS5A 3D54A 3MM5A 5J1EB 4PWWA 1Z4UA 3J80U 1CC7A 1AZSB 1FERA 3UN3A 2RNEA 2JOQA 2XI2A 2R2RA 1U0HA 3OUYB 1BUXA 4C7QA 3W8PA 1E6YA 2MB0B 3NWRA 4IG3A 4DPTA 2M8HA 2DNLA 1Z1ZA 1Y10A 2QLWA 3FBCA 2OTLS 2DXDA 1YBTA 4DPUA 5G0RB 4QWEA 2K1RA 4NLPA 5FIIA 4TQSA 4AXIA 1FJ7A 2IIHA 2KH9A 3L7OA 1MWQA 4ES2A 2EKNA 4CH0S 1NHUA 2W7PA 5KFDA 1JMTA 4MKVA 3AQPA 2W8KA 3KK1B 1RQ0A 3D0IE 1RAEB 4I1TA 5JMNA 1DFDA 2ZD1A 4P7VA 3BPSP 2WVFA 2HEKA 4LQ9A 5HI7A 1UVMA 2D9PA 4O0IA 1MG7A 2QL7B 1S1XB 3ETOA 2YWEA 4K8RA 4OIXA 1MU2A 2DGWA 4KV8A 5DG8A 5HROB 5HMWA 1NJWA 2WK4A 1QUVA 3R5BA 1HBUA 3N5BA 1BWEA 3JTPA 4CO4A 1I6JA 4DV4J 1G6BA 2CQBA 4F3MA 3TVYA 1CULA 1MLAA 4DR2F 3ZZ0A 2OMOA 2HG4A 4DCJB 1F1BB 4RL1A 2R7TA 3GFZA 1FX2A 1Y11A 2KJVA 3MD3A 3DRPB 3DXSX 2BBEA 1T9TA 2V2KA 4YEAA 4G1QA 4QWBA 3BZQA 1XJWB 2XMTA 3T6BA 1U24A 4CTAB 5BXIA 1WJ9A 3CTRA 1E6VA 2OPRA 2FHJA 5A76A 3HFVA 2E5IA 1FKPA 3OFGA 4MFBA 1OPIA 1B0PA 2Q6CA 4DQQA 4NLXA 3MEGB 1QTMA 4C8KA 1UVNA 3PW2A 1NH8A 2EK6A 3O8WA 2J7KA 2P6SA 2PD1A 2AYBA 2BJ8A 5HVGA 5DM6Q 4R8UA 4ED7A 2W8LA 3HD2A 2OH2A 3FSYA 4OMFG 1XMQJ 2AD9A 1O5JA 4NE9C 4ECSA 2HHXA 3V4IA 2LQJA 4DCOB 1S49A 2V2ZA 4WTOB 4WBFA 2ZNZA 2VFRA 5B0FA 5IQQA 2VHGA 3H8YA 3NNHA 4B3MJ 2HW3A 1YX2A 2CQHA 2OTJS 4F04B 2RKIA 5E3QA 1CJVA 2B43A 1PBAA 1H98A 1O0PA 3OTOF 4DR6F 2XGPA 1YZ6A 4U7UD 3GIIA 2AGQA 1VDHA 1RAGB 1HKAA 4X66F 4JV5J 1QLNA 4OZ3A 1K44A 2CQ0A 2KU7A 4YP3A 2IYGA 3GCXP 1YTYA 4YOEA 2JVOA 4C3KA 5JVGQ 1XMOF 2W9AA 2HVHA 2DH8A 3BGRA 3JB9k 1Q78A 1KVKA 2DHGA 4YUDA 4WFXA 5LT5A 1X60A 4JI5F 2B51A 1HNVB 3EVWA 5D6GA 3MPWA 2HIYA 4MYUA 3HK2A 3HMJG 1QE1A 2M88A 4I69A 2L08A 3QSIA 4Y6IA 1WHVA 4JI1F 2WCXA 3PNIA 3TJ8A 2L9WA 3SQGA 3C66A 3RGIA 3DOMB 5JVHQ 1VQMS 4NA1A 3W64A 3O6QA 4LF4J 2HVEA 1FK9A 4ILRA 4PG7A 3J81U 3A8IA 3LP0B 4USVA 5HQLA 1D3WA 4DR7J 3CULA 3RRHA 4D3GA 4JBCA 1VQ5S 3TVZA 3UDEA 2ABYA 3LWLA 4ERDA 3X1LB 4LRDA 4CLKA 3CWJA 1KWMA 2WZ1A 7FD1A 2X51A 3DLKB 4Y3CA 2PEHA 4C3LA 1ULRA 1QJHA 3LGHA 3CD6S 4LFCJ 2I9SA 2RIJA 2DPIA 2J0SD 2VA3A 3AJ1A 3MWBA 4F4AA 5HLFA 3C6UA 2DR7A 1XNRF 2H9ZA 2QA4G 3MUTP 4NLUA 1P9YA 4DX8H 3MM8B 3BKFA 1U2FA 4MIWA 4J90A 4NXNJ 2VOOA 3DMJA 2B3TB 3FZ2A 1XK8A 2Z2YB 1GXUA 3M32B 4ICLA 1Q7YT 4BS2A 5KG6A 3M7VA 4TVAB 1JLCA 4DL7A 1OYDA 3E01A 1WEZA 4LRFA 2FGOA 1NO8A 1S0MA 2IMOA 3W2WA 3LP1A 5E3CA 1S10A 2XC9A 1LK5A 4HL9A 1Q86T 4U8YA 4FDFA 4USMA 2AF6A 3VAHA 2W2QP 2PI4A 2ZUAA 2XS5A 1XEZA 2Z2ZA 1NM2A 3AD8C 3PCOB 2ZM6F 1G2EA 1FKOA 4WYLA 1FJGJ 5H9EK 2CJKA 2MHEA 1S77D 1GEHA 2XCAA 3RRKA 1S1TB 3TW0A 4CWBA 5KG0A 1KOOA 2A2CA 2LQ5A 3HT3A 1VQKS 3PJXA 1Y4ZB 1VBYA 1BQMB 2UV8G 2BJ3A 2ZH5A 3CJ3A 2I1RA 3DM2A 2GHPA 3K17A 2IBKA 2OEMA 5GAEU 1WKLA 3PACA 1W26A 4M5LA 3S1TA 2G1DA 3T1HJ 1IM6A 5DGAA 3Q8PB 4NZ7A 1RU2A 1TUWA 3K8WA 4AYBD 3DLLQ 1Y5LB 3M2VA 3EZUA 5IT9U 1FDNA 1UFKA 5IC6B 4B08A 3MAAA 2NPIA 2ROPA 4G3IA 3M1VA 3PTWA 4QBUA 3J7YU 2GVDA 2YKMB 1Q82T 1KONA 4HYKA 2L3MA 2A0FB 4Q7AA 5HO4A 2IBOA 2DRAA 4FKYA 1GX5A 3C16A 4FF2A 2C2ZB 1IQZA 2JEGA 1F3VA 1P6TA 3BREA 4M5KA 4GO5X 3W65A 4LIWA 1FNXH 3QAEA 3Q8UA 2ZH3A 2FJEB 1TUVA 2XMUA 2P5VA 1T9UA 4IFYB 5J2PA 3M8YA 1HNIA 4ZLLA 5DG7A 1C1CB 1RCOB 3IN5A 1LV5A 3VAMA 3CB4A 4JI7J 4X4TA 3LWMA 2A1BA 3VV2B 1YJNS 2IAJA 1YRXA 2YKOA 2ZJQQ 3FBBA 3GSIA 2ADBA 2E5LF 5BR8F 4XPCA 1KLNA 1UZDA 3FCWA 4PEOA 2W01A 2ZBIA 2YH1A 1AA1B 2XLIA 2NUHA 1WOOA 4DV6J 5KFXA 2BQ3A 4KKOB 1HNWJ 3I5BA 4K4XA 1RT7A 1CLFA 2RRBA 3QYYA 1SVDA 2CPEA 2EC2A 5F9LA 4DFPA 3W7BA 4ZPAA 2CIMA 2XSJB 3R7BB 3LUYA 1MROA 3OL9A 4P2MA 3ULHA 4ALZA 4EFAC 5LMUJ 4PKDB 2C2NA 2HMIB 4NOHA 4IDKB 2FUG9 1T95A 5HSPA 4DN0A 4RW7A 3U1MA 1NDKA 1H0HB 3EMTA 3RBZA 4RKUC 4QWCA 4ZJLA 3KHHA 1Q8IA 1F5AA 3MZIA 4PXBA 2OSRA 4DXLA 2BJ7A 3CO0P 4EUVA 4O3QA 3B54A 1LWEA 4YB6A 2FB0A 3NGKA 2RQCA 3FCVA 2GX8A 2J0XA 1UCNA 1TMJA 4J9MA 4ZJOA 5CXTA 3AD9C 4ED2A 3NG8A 3MAQA 2CQ2A 2X1BA 1IVZA 1WKKA 4XPEA 3T1YF 1IBKF 1U6FA 3PDNA 2ZH8A 7AT1B 5THWA 1R3NA 3BDPA 3KG0A 3JAMU 3N28A 3AOCA 4KH0B 3KWMA 4MIBA 1NK0A 2H54B 1NSKL 3Q86A 2C42A 3WIVA 3TYTA 1C2PA 2MJNA 3VALA 3NBPA 1SJRA 2FPHX 5L9NA 5U47A 1VFJA 4FBTA 4LF9F 2JFDA 2ZJPQ 4B3OA 3IR7B 1M5HA 3TARA 5BJRA 3VQSA 2IDLA 4NLQA 2WSEC 4DI6A 2B4PA 1WORA 4B3RJ 2IRUA 5GMDA 1Q53A 4FNIA 4DSKA 2MZJA 2GGPA 3IGVA 4J9PA 2HWHA 3NOCA 1CJTB 3N79A 1KKHA 5HANA 3CJKB 1F5CA 3P8BB 5AE3A 1FA0A 2QTWA 3KUHA 2ASDA 3MFHA 4RW8B 2YNFB 3C15B 1WG1A 4OYOA 4Y2AA 3R97A 4RNNA 2ZBRA 3KJVA 4LF5F 1TVRB 3I5CA 3EDQB 2CDRB 3W9JA 1B4SA 1TL3A 3D6FB 1S9GB 1PYTA 3AA9A 1EX8A 4UOHA 3BH7B 3AB4B 2CZ9A 1UVKA 1VI7A 1KVJA 1U7LA 2JZ5A 3MMBB 3CCWA 2B6AA 2AYMA 2D41A 4RW6B 1HA1A 1VR6A 4HH0A 3LH2S 2UXBF 1S9EB 1MSWD 2W2PP 1SXLA 3QRPA 1TUGB 3TRGA 1HNXJ 1CVJA 4CT9A 5HJXA 3KTQA 2LP4A 3OR1A 3QIPA 2FJXA 4F0KA 2V9WA 4F67A 1VQSA 1HWUA 1YJ7A 3CCES 2XB2D 2HRUA 2I8EA 5KT4A 4U7CA 2HHPA 3D66A 3GYXB 2VL1A 4KPYA 1YKWA 2Z2LA 4P7TA 2E29A 4Y2CA 1HI8A 2YKNB 1TL7A 3L7UA 5KG3A 2F9JA 1HFEL 2ZZTA 3A8KA 3OTBA 4RUAA 1F0XA 3JQKA 5FLXY 2VA2A 3IC1A 3FQKA 4I2QB 2OIHA 4P6QA 1ZZFA 1RHUB 4JI8F 4KE5A 5CYMA 4U96A 2OEJA 5I42A 1FXRA 1U0SA 4Y65A 6FD1A 1JLQB 3M6UA 2W4PA 4LF8J 3BGUA 1BQNA 1WELA 3OLBA 4A8SA 3R5GA 1ZA2B 4CM0A 3CT9A 1BHNA 2O01C 2IHR1 2AX1A 4B9MA 2ZH4A 2V4JB 2FZGB 1F9FA 5L1JA 3TUJC 3JS9A 2WW8A 2ZHAA 1PILA 3JSBA 4JI3F 2E7XA 2GIRA 1XIQA 1FJCA 3KLVA 3V6DB 3TR5A 4WXOA 1Y5IB 2KVQE 2E1PA 1HL6A 2FJAB 1KP6A 3THPA 2MZ1A 1U09A 2QL5B 4DU8A 3P6YC 2GJ2A 1VJQA 2G2ZA 2XMJA 2PE8A 1SKSA 3PYDA 4U7UK 1J5EJ 4PG4A 4UW2A 4HTJA 3L95X 1S5ZA 3ZZTA 2QL9B 4QIFA 1APSA 2BR0A 2F7VA 2YY3A 1T03B 2YKAA 2ROEA 1BC6A 1RGVA 2UXCJ 2MKJA 1Z2LA 3MCSA 5ETPA 1IKXA 4DV7F 3A8EA 3NOGA 2GJIA 5K9FA 3CD7A 5CHCB 1N5VA 2VPZB 5B7WA 3TZYA 3MM6A 2FJDB 1Y5NB 4N7TA 3L4BC 2JLEA 1ZPVA 1PC5A 2HRTA 1NRKA 2V0NA 3W2VB 3HULA 2KFNA 2LQ8A 2VG7B 2AGPA 4ZP8A 2J6TA 3GSDA 2CYYA 4YR2A 4PCQA 2B8PA 3MCNA 4TNOA 4K0KJ 4K2JA 2I2YA 3VF0B 3B82A 2G9OA 4DJBA 4CO3A 3EGVA 1VRQC 2ZOMA 5KFJA 1UPMB 1ZETA 1L5UA 1RT3B 4NYZA 4I2PA 3Q23A 4Y0FA 1QD1A 2DNYA 2HNYA 2WAQD 4J9LA 5D4NA 4BCAA 4WIQA 3B8HA 4DL6A 2J0WA 3DLEB 4DHVA 1HBMB 3ISND 2DXFA 3PX4A 1SIZA 3CCSS 2KDOA 3V5RA 3L09A 1XR6A 3H5YA 3QO9B 3P3DA 4QPTA 2F8HA 4RWWA 1LNQA 4DV5J 4OYWA 3DU5A 5FDLA 2C3YA 4Q0BB 4C8LA 1SH3A 2XMWA 2R7QA 1RTJA 3QWPA 3MMAB 4Z7YA 3ENWA 2ZVIA 4DFJA 4FN5A 4OZ2A 5ETQA 2H5EA 2VZ9A 2NXNA 1EETA 4JI5J 4DZ6A 1SI9A 2RUSA 1WSVA 2HHVA 3D0HE 2R3VA 1SQEA 1N33J 4M63A 2RMLA 4H4KA 3O44A 2ZH9A 1WHYA 1N52B 1FTRA 5K8NA 5AXLA 2VC0A 3C6TB 3H4BA 1KLMB 5MAOA 2M4MA 5CAAA 5EUHA 1WF1A 3SDEB 4TY9A 3W66A 3GB0A 2DGQA 3HHDA 1X4EA 2HS0A 3H40A 1UJ6A 2JEIA 3KLEA 3CD0A 2W9CA 3QGHA 1IXKA 2R7UA 1JX4A 2A18A 1S97A 4ELUA 3RBEA 2KO1A 2MSTA 5C42B 2J9EA 3BN7A 4TYAA 2VG6B 3D67A 5L1KA 4ZJQA 2CPJA 2HS3A 4DR5J 4DV2J 3WHIA 5IWAF 2CQIA 4LMZA 4C4WA 2G13A 2CZVC 3I9ZA 5ETMA 2LEAA 2DO4A 2MKSA 2XCPA 2MY8A 5KFLA 2QLXA 4C2MA 4IR9A 3NMAA 1TKZA 1MWZA 2VIHA 3G96A 2DY1A 3NNAA 3H42A 1V3SA 3MR7A 1C1BA 5H1SV 4J9RA 5C24B 3IWNC 1HR0J 2DIVA 4RPFA 2FVPA 4NZ6A 3MI7X 4FZVA 5K5MA 4XTTA 2ZDOA 1D9FA 5KG7A 2MQ8A 2DO0A 1S4EA 4EBEA 2CADA 3MPDA 2K2PA 2W24A 2ZH7A 5D0RA 3FRYA 1N0UA 1EKSA 2LU1A 2G2OA 1CJKA 3FGVA 2QYCA 4TYBA 3QPIA 4Q43A 3DU6A 3R7NB 1KVIA 5HK4A 1SKWA 2DGXA 1QAIA 1F2GA 2ZWOA 1C0TB 5D0EA 2JC1A 4MJKA 2G2YA 4ECWA 1Y00A 3GQCA 2NXCA 2IC3B 2OELA 1SJFA 2HZAA 3BBBA 4RUCA 4NLDA 5J2MB 2HGMA 4FF3A 4DUYJ 1JLAA 3HCXA 2WOMB 2XYGB 4XIUA 3H5XA 4LSLA 1YZ7A 1K8AT 3PG9A 1CC8A 1DAXA 1LW0B 2LQ9A 1K47A 3EGZA 5DQHA 2DRDA 1RK8A 4KFBA 1TR0A 4UOGA 1RTDA 3BS9A 4PG8A 4YS2A 1TTHB 3KMSA 3OXLA 4OZLA 5D8HB 2WVEA 2W25A 4P2SA 5F9NA 1TKDA 2OD6A 4BDPA 4OYMA 3THVA 4IG0B 5A8KB 1TKXA 4RO0A 2KB2A 4A47A 2VPWB 3M30A 3TJAA 5IS2A 2YH0A 2MKIA 4ED1A 2HWIA 2OP5A 3ISNC 1VC5A 3EM1A 3HSGA 2WW4A 2H48B 3MAHA 5ETOA 1YI2S 3H5UA 4NL5A 3L9ZA 2HNDB 1IKWA 4XO0A 1VRTB 3VAIA 3HHLC 4AUKA 2HBYB 4YY3J 4YMEA 5L38A 1YJWS 4UTGA 4LFAF 4ZP6A 4KSEB 4AT1B 1JLGB 1GFWB 4X62F 3TQEA 4L3NA 2GJFA 1LW2B 4O4GB 5A0YB 4I6WA 3IRXA 1NK5A 2NQPA 2VFSA 3TA0A 2EFOA 4LR8A 1N4LA 1H2TZ 4YB5A 4ZIVA 4ZIWA 3NS5A 3GP9A 4NI2B 4ENOA 4NLYA 3M8PB 5IV4A 3U27A 2MZTA 2VONA 4OHYA 3RYLA 2OPPA 4OI2A 3OSPA 4DV3J 1IJEB 5A8RA 4DS4A 1M1KT 3LF0A 2CNLB 2E9ZA 1U8WA 1ZOTA 2V69A 3H98A 3KKFA 4TXSA 4YB7A 2ZOFA 3EZ5A 4KGXB 2QFJA 5HROA 1Q0NA 3VAGA 5KFIA 2VG5B 2AV5A 3BQ0A 4C0BA 3D5MA 3Q0AA 4FXVA 5CABA 1TL5A 3TP2A 4JI0F 3K8VA 4AQYF 5HJYA 3BSCA 2XWXA 2AJ1A 5LSLA 2XMVA 1IJFB 1KQFB 2VDHA 5DDPC 3ILOA 2D3ZA 1TFWA 1VQ7S 1WD6A 2B9EA 2UUCF 1VLYA 2ZBPA 4HHHA 2F3JA 1RISA 1N6QA 1B3TA 3MCOA 1CG2A 4FVMA 5HP1A 5DJBA 1BWVA 1T3OA 1TKTB 2YPYA 2VQEJ 5ETVA 1SQFA 2RJZA 2J6UA 2R7VA 3T6JA 2VASA 1T7PA 3MEEA 1FKAF 4IOBA 2W2MP 3I0RA 3OFHA 3UN5A 2ZHOA 2Y1LB 1IQTA 3F56A 1HQEA 3HSZA 5ADZA 2A6MA 1U6BA 1S99A 3OHBA 2HFOA 1UTAA 3EGNA 3ZO7A 4LUBA 3QRQA 4PWDA 2WTFA 2C22A 3EGWB 4LF9J 3M2RA 2R42A 4FPIA 4WP9A 5HQMA 1GXLA 3PFOA 5ITHA 3FEYB 1H74A 1WF2A 3NXZA 2HK3A 1B7FA 2U2FA 2HNZB 1DZ5A 4S0MA 4AD6A 1DQAA 1JIHA 5KFZA 2BA9A 4RW9B 3HDSA 2V34A 1KOHA 2E5GA 2BANA 2FVQA 1YJTA 1UA0A 2WRMA 2IVFB 4Q45A 5J2QA 1AYEA 2D3O1 2VICA 4MK9A 4L76A 2N82B 3F73A 2CQDA 3TX0A 2UV8A 1PYSB 1BQXA 4G6VB 3H2UB 1VQ4S 2JFKA 4OI6A 2HHSA 2BXJA 1HNVA 2IJNA 4ZCMA 3SV4A 4I64A 3FBEA 2QA4S 4R0EA 1ZAWA 2Q1LA 1RT1B 3DRSB 4C8NA 4JV0A 1XWLA 4ES3A 1HBOA 4NLVA 1WI6A 1FJEB 3ILIA 1JXLA 3FEXB 3PFEA 3KLIB 5C2GA 4DN9A 2J6SA 2RF2B 4KRWA 2HZCA 2H5JB 2X1AA 1HARA 1RJJA 4JOUA 2GQ2A 3UW1A 3NAHA 5IZHA 1T94A 1LKZA 1CS4A 2CVIA 5GAHI 4DV1J 4Y28C 2M70A 4LIRA 3W5XA 2BEFA 4WCEQ 3ICLA 1DQ9A 1FDBA 4LJMA 1BE4A 2GQCA 5CD4H 4KYZA 3EVMA 3TAMA 1S6QB 2PI5A 5D3GA 3MR5A 1OY9A 2AIRB 4K50A 3ZNUA 4YR0A 1S1VA 1FCAA 1IBLF 1UEVA 3KK2B 3KLGB 3MFIA 2VJVA 1BLUA 1SL0A 5KT5A 5G4DA 3H90A 3UWTA 3G6XA 4ETZA 2QT7A 4J91A 2X7IA 1ZPWX 2DGVA 3IS9A 4FBUA 3DCAA 2R7SA 4PYAA 4NEZA 4QW8A 2AEJA 3NCQA 2KRRA 2Z4PA 4OFZA 2NCKL 4ED3A 1B7YB 4DDFA 2VFTA 2VFUA 2D3UA 4M94A 3CF5Q 4NLOA 4U95A 5ETNA 3CJSA 1J5OA 3QJJA 4RW4B 4RNMA 1YJRA 1T9YA 4DL5A 3BR9A 1ZM3A 3EXYA 3DI6A 3CCRS 1IKYA 1S1TA 5J1NA 4OYXA 1W2BR 3GIJA 5IM0A 4F2RA 3P96A 4I7FA 1ICEB 1CJUA 2N3LA 4WP3A 1RLDA 3DYAB 3VZHA 3D7SB 3KMQA 1W2IA 1DBDA 1TK5A 1Q79A 3M2UB 5IOLA 4DBQA 4OI4A 4HLBA 4C8OA 3MGJA 1WACA 1S6UA 1X5PA 3MM5B 5E0OA 1P8GA 3CDUA 1EJ7L 3GU0A 3P5TL 5BYQA 3J80Y 4JI4J 3HVTA 2MQMA 2UVWA 5I3PA 4M5JA 2RB7A 1U0HB 4NXMF 2EK1A 3OXFA 2GVZA 2UVVA 1E6YB 3IGNA 3CMES 4IG3B 1LOUA 3R27A 2V8PA 2JC0A 1DTQA 4O3RA 2NREA 3D1HA 2HIQA 3C8YA 2UVRA 1VLOA 3IR6B 4HDHA 2EBEA 5B0DA 4DR4F 1ITPA 3GONA 3MURP 3QAUA 4USIA 2AZ1A 2PO4A 3Q8SB 2YQ1A 3GJQB 2PMHA 2XMKA 1XNQF 5KFBA 1A9NB 2QN6B 5EHHA 2QGFB 4FYXB 2ASJA 4HHJA 5L39A 5D78A 4KC5A 2B7CB 3G6VA 4RU2A 4DV0F 1V3ZA 3GG0A 2GO8A 1HI1A 4CO1A 2ZD1B 1FFSB 2LLZA 3TAPA 1VIXA 1IUJA 4ECRA 3GJSB 4B3SF 2MY7A 1F6TA 3DKDA 3CGIA 2DGTA 1S1WA 2YBVA 4ANCA 2ZH1A 4HACA 1EIYB 4K59A 1MU2B 2VOPA 4KV8B 3VGSA 4DL3A 5F8JA 1C0UA 4DUZF 3H7HB 3CJ2A 4YDXA 1FO1A 2Z0GA 3BH6B 3FMBA 1NJXA 1HBUB 5EX3A 1A6LA 1DLOA 1NEEA 1R8BA 4YFUA 2R2UA 1RT4B 4ELVA 2Q79A 2R9LA 1CULB 1HD0A 2AJFE 4JB8B 4U67Q 5BYRA 2VFVA 3CO9A 4ZN3A 5HVFA 1RTHA 4MYTA 2E1RA 2G4BA 2AEMA 1IWAA 5HVHA 1DQ8A 5CCLA 4CQ1A 2OPQA 3DOLA 4G1QB 3DLBA 2E9RX 4KPCA 1HD1A 3CNQP 3TZXA 3NS7B 1N5SA 3HHNB 1TP7A 1QVFR 4DF4A 2Q43A 3KFWX 2APOA 3W63A 4N5SA 2HQCA 1FKPB 3UD5A 1HHSA 2UU9J 4WZQA 2EFPA 5M2UA 3CMQA 1D9AA 4QWAA 3I9V9 5KFGA 2VKZG 4R8UB 2NYIA 1NDCA 1SV5A 4KHPJ 5B09A 1NHKL 2HHHJ 3D28A 3W60A 4BHQA 3V4IB 1X5OA 3EZOA 1DURA 4MAKA 3LPYA 2V4QA 2HKEA 3GZ7A 5B08A 2HFUA 3ADAC 1G4CA 3VAFA 2WONA 2UUTA 3OV7A 1Q4RA 5CQGA 3IRWP 1YJVA 4DEZA 2VC1A 3QLHA 4AL5A 2RKIB 4ZPTR 2U1AA 1CJVB 2YVSA 1N5TA 3V6HA 4QR1A 2DR6A 2OPSB 1RUSA 3R1HA 3D6TB 5L1IA 5FJ4A 1JJHA 3DLGA 2VODA 4BWJA 4MTPA 5F0WA 4F0MA 1NJIT 3V2UC 3IBWA 5LSOA 1BXNA 9ATCB 2G0IA 1N36F 2FY1A 1KSPA 4OX9J 1YWXA 1UW9A 2ZH6A 3QIDA 2K3KA 1SB6A 1K73T 1RYSA 1OSDA 2MZQA 5KAKA 3UO0A 2B9XA 1TL1A 3NL0A 4CYUA 3BGRB 3RAMA 1JKHB 3UE2A 1X0PA 1B70B 1EQMA 2C3UA 4QIGA 3PVXA 1ZTWA 2XYHB 3GR1A 1GMUA 4LRAA 2QMUB 1QE1B 2MLXA 2K06A 4DF8A 3MMCA 3SQGB 1NSPA 3CJKA 3NRBA 3P45B 3FSXA 4LBPA 3UPFA 1QM9A 3HHEA 1FK9B 4DR3J 4P74A 3S01A 1UL3A 3J81Y 2PFDA 1VISA 4WU2A 4ES1A 3RBXA 4K4SA 4M8LA 5RUBA 4M5NA 4PR6A 3HP6A 2ZHBA 3ZZUA 2KHCA 1LWFA 4WIIA 3PX0A 4RX6A 4LRBA 4ZVGA 3CJTA 4LR7A 2HVDA 1PJ6A 3QRRA 1U02A 3IBFB 4TN2A 3EVOA 5GAGI 2JJ4D 3SMZA 3RR7A 2CUYA 3IM8A 3PYGA 3EXCX 2A3JA 2YNIA 2Z2MA 5HLFB 3C6UB 3QFWA 4E8UA 2R2SA 3G2XA 4DZDA 4FP9A 4WJBA 2N4DA 4L73A 3HZGA 4IH5A 1SC6A 2DTJA 3FBFA 2PIIA 3Q8RB 2MQQA 4CO2A 3M9OB 1YHQS 1QSSA 3DMJB 3C14B 4NLTA 1LXNA 1U1LA 2YKPA 2E1MC 3LALA 3QMQA 4P2FA 3T3FA 1JLCB 3O2IA 5B0CA 1S7IA 3HPOA 3W2WB 3LP1B 3HO1A 1VC6A 4LREA 1X4AA 3D3CJ 3I31A 2FY8A 2XMAA 2ILYA 2YKNA 3KXDA 1V5VA 1NK9A 3SIPB 1KHVA 1GMWA 5FLXU 1FKOB 2FYXA 4ZCLA 2P2CB 3T19A 4QIVA 1AB8A 2YKQA 4KGMA 3D3BJ 4E98A 4O44A 2DD8S 3QT8A 4QR2A 4U9RA 3CJ8A 1AUDA 3KDOA 3IAM9 2DCUB 4ID5A 2DHHA 3DM2B 4NMXA 5AJ3J 3CCTA 4LFBJ 5LXYA 4WFYA 1ACMB 4CLUA 4KO0A 3M8QA 1QY7A 4F25A 4Q8EA 1K9MT 1ZH5A 3RW7A 2V4JA 3LPEA 4UZCA 3RBDA 1T02A 2IFXA 1GNKA 5IT0A 1N34F 2EKYA 3MECA 3CCZA 2KT3A 4RJVA 1Q5VA 4CP5A 5A6PA 3H25A 4USKA 3M2VB 3OL7A 1DHMA 3FRZA 3J7Z5 1IBMF 2RRAA 2C3PA 3K57A 2AP6A 3M1VB 2GVDB 2FC9A 3LO3A 2RDIA 3JSRA 1PIEA 5KFHA 3C16B 4GKJF 4ZS6A 3MPVA 2YX1A 4QU6A 2CPIA 4PXDA 4GC7A 1KHWA 4FPRA 2BABA 2QMWA 1YLXA 4HH1A 5IFMA 2CJAA 4MKAA 2LVWA 3MHYA 5J2PB 1X5SA 1HNIB 4P2XA 4ED0A 3T5LA 1HHQA 1XERA 4M1KA 4LF6J 3MPUB 2O67A 2ZDPA 4OHZA 4I67A 4PYDA 3CVKA 3WZ0A 2ZZNA 1B0TA 3H0PA 4U8VA 3DLHA 1TFYA 4ZHRB 1QAXA 2VBYA 1LFWA 3Q83A 3W2VA 3V81A 3MPYA 3CCQS 1DTTA 4X4VA 2LA4A 1GT8A 3K5OA 3O5TB 1IM4A 5H9FK 3W61A 5F8IA 3QZ8A 3AXMA 2GMHA 1TAUA 2C3OA 2XNRA 2DITA 4QW9A 2HBQB 3K5LA 4QYZK 4OYPA 2EBGA 2MGZA 3Q8VA 2NSCA 1OQ6A 1MROB 1L3UA 1NPRA 2DYAA 1WC6A 1H73A 2NZCA 1U2RA 2GW8A 1FXLA 2NR0A 1HBNB 3OTDA 4WXWA 2BJ9A 3R2CJ 4F7VA 4DV4F 1ZYQA 2W4CA 4WKYA 1NBEB 4RU9A 4M5GA 2NS1B 4F8RA 4F02A 2E7VA 2BOPA 3GV8B 2DY9A 2RT3A 1ZM4A 4ECXA 2HLUA 4M5DA 3MM9A 3PW5A 3ZZPA 4W4MA 3MXHP 1ZS6A 1RT2B 1NK7A 2YX4A 1U47A 1JJ2R 1M1GA 5K14A 2JLGA 3CIZA 3BO3A 1JNZB 1GTHA 1DY3A 4DX6A 3R9LA 2WB4A 2IM2A 4Q8FA 1RCXB 1FT8A 3CXCR 4FF1A 4ANDA 4NLGA 3VWSA 5F8GA 4IH6A 3PRBA 4GMKA 2B7BB 4JI6J 2FZCB 3DRRA 1RWKB 3OQ2A 1YK9A 4WE1A 4GC6A 5KFFA 4ED4A 2RAQA 4ED5A 3JAMY 3C6TA 4N8NA 1KLMA 2KXFA 3NLCA 1N5QA 2RVJA 2VBWA 3W5ZA 1RAHB 3SDEA 2F4FA 3TVKA 2RUGA 5CD4A 1MN7A 3CC4S 2CXEA 2LU2A 3VQTA 1LQ9A 3SCIE 4NLRA 1Y3JA 2N7CA 5A2QU 4B3MF 3UD3P 3CJ0A 4B3OB 4CLSA 2XLKA 2IA0A 3A3OB 1N32F 3RRGA 2J8AA 4HVZA 3KLHB 2DNHA 2MKCA 4TLRA 3IR5B 1T05A 1RAJA 2GGPB 4UOCA 1NPKA 3MMJA 1FDAA 3QATA 2EVZA 1GQEA 2CA9A 5D0GA 4JV5F 1HNZF 3K89A 2YPZA 5HAOA 4LVNP 2NXJA 3OLAA 3CEDA 3BB5A 3FNNA 3W5YA 5ETTA 5K8MA 3A1YG 3PR5B 3DLJA 4OYZA 2VBZA 3KJVB 2CQ4A 3BM7A 2MHNA 2Q66A 2GV1A 2VPXB 2F65A 2RQ4A 2A10A 3BF4A 5M2RA 1TL3B 1S48A 4NPOA 1FRKA 3X3UA 1PC4A 4KGKA 2EFQA 5DO2A 4O0NA 1ELOA 4NZ0A 3RB0A 3LGNA 2HVIA 1FRXA 1NU4A 2J5AA 4WKRA 4ILLA 1NPPA 2F4VJ 3RB4A 2IRYA 2AW0A 2B6AB 5GAHU 1NZ8A 3DHWC 4LF4F 1FEHA 3POTB 4B3TJ 5I3QA 1ZAXA 4ECQA 4YQWA 3SV3A 4TU9A 4DR7F 1C0TA 2RILA 3HT0A 3QZ7A 1T0TV 2CFXA 3LP2A 3VTIA 3M6WA 3G8SA 3OR1B 3QIPB 2FD2A 2HFNA 2FGCA 3NCRA 1REVA 4JUZA 5B0BA 2QG9B 2V8HA 4P75A 5J2MA 3N6LA 4MMOA 1WTBA 2WOMA 4WFZA 2YWWA 4J7CA 3QGIA 1D8YA 4DR1J 2CVEA 1WOSA 1VQYA 1IN0A 3K59A 5EDWA 4F4XA 1B64A 2DNPA 2Y8WA 2KT5A 3DDIA 2BYCA 4ZVPB 1VQ9S 3HM9A 1UJ5A 4L72B 1S6OA 2IM0A 1VRUA 3M8WA 4G65A 4DR4J 1Q7LB 3DC2A 5CYMB 3D4JA 2V63A 5I42B 1QSYA 4NXNF 3GFYA 2XYPB 3IWXA 1RT6A 1RTIA 3Q22A 2HK2A 1BQNB 3K0JA 2KTQA 1Q1KA 4PZVA 3KG4A 5DETA 4A8QA 2C1EB 1RWVB 2K7JA 5E33A 3K5MA 2EXUA 2XTJP 2J7WA 2HVZA 5KFKA 4CLYA 1U1NA 4LT6A 3HX9A 2Z57B 2XGQA 2V2VA 4ZPBA 1HPZA 4AXJA 2AJQA 1UPPA 2ILZA 1FJGF 1PBUA 4CM2A 1REGX 2XO7A 2R4FA 1U48A 2VKRA 1FNOA 2D7SA 4C98A 2GMLA 1R6VA 2XS7A 3NS6A 3RAQA 5KFNA 1NKCA 4DUZJ 4A46A 5F8MA 1WHWA 1X4BA 2BE2A 4A8WA 2YWKA 1K0TA 1TK8A 3IBCB 5K8PA 2HLTA 4KT0C 3U02A 3PJ9A 2QSWA 5A8WB 4X2BA 3J7ZT 2BJ1A 3O1LA 3IFEA 2OSQA 2OI2A 4J9KA 4DG1A 4LSNA 1FD8A 3KDNA 1FEEA 3T1HF 4B9LA 5E7OB 4K2XA 1U4BA 2PFFB 3PYFA 4KY3A 1JLBA 1HW8A 5I3UA 3MEDA 1L3SA 4M95A 1IKXB 3DOKA 4JI2J 5KTQA 4O3SA 4P73A 3BV8A 3DGPA 2BMBA 1S6PA 3OVAA 5EGYA 2CZ4A 3M4XA 3MM6B 3BGOP 4I6AA 2KG0A 2QLFB 4FS2A 2VG5A 4PQAA 1HQUA 1M5SA 4FYVB 4RBVA 2NYHA 1VYAA 1GK8A 2OFGX 1EB0A 2CJQA 2RD5C 1VC0A 4CZCA 4UZBA 4LF7F 3KYLA 3BDEA 3TI0A 5F3ZA 2D1CA 1KBRA 1RWMB 4USHA 1RHMB 2ZWPA 2M7SA 5B0GA 1HI0P 1WC5A 4EZ6A 1LXJA 2MYFA 1HWJA 4OZ5A 2IPOB 1VQNS 3KK3A 4XAKA 4JI7F 2CWXA 2RRNA 1WC3A 4I2PB 2XO6A 4UQGA 2Y3YA 4ZVOB 4PG6A 2JLFA 3ENQA 2DNOA 4ITSA 5HQ8A 3ET6A 3CDAA 2HNYB 3C2PA 3GG1A 4CO0A 3RW6A 2AWZA 1X4HA 2ATLA 2JH3A 2A6OA 5KFPA 3R5CA 2J9DE 4NYOA 2HWTA 2M0GB 3BPDA 2XY7A 1GXTA 1W25A 3UD4P 3B78A 4PABA 3R5JB 2IM3A 1HNWF 1N36J 1R0AA 5GMKa 4ZDNA 3CJQA 1UEKA 2Y1JA 1RTJB 3UI3A 4K5RA 3V4MA 1L3KA 4OHVA 2FQQB 2DNKA 3W9IA 1P1TA 3NAIA 4WU3A 5KFMA 5LMUF 4L74A 1EETB 4X64J 1SJQA 4DQPA 4X65J 1I3OB 5HBMB 4KGVB 2QLJB 5CYQA 3UCZP 1Q8BA 2B5JA 4EBCA 1YGYA 4GVBA 1I51B 3DGVA 2B8QA 3OT9A 1GH8A 1O51A 5KT2A 3I56S 4BLGA 4DLEA 2DNRA 3F41A 1LEOA 4JYAJ 1KN6A 1PYOB 4W90B 3PO5A 1OQ3A 1SUQA 2I0XA 1R8PA 2FTRA 3KLEB 3KJFB 2W9CB 1S57A 4P71A 3I32A 3WX8A 2MKKA 4H4MA 2VU5A 3ITHA 5L9XA 2MTLA 3FVYA 1WDDA 1TK0A 1NAQA 5DRKA 4OJ3A 3NWGA 4NCGA 3QBCA 2YNGB 3N9UC 2B4OA 3NNCA 2PMWA 3N4WA 1RT1A 2FZKB 3G8QA 2VH7A 2CQPA 4QCLA 1Q8KA 1RYRA 5T41A 4IRCA 1DRZA 3N6MA 2IRXA 3KLIA 1IKVA 1TKZB 1KC8T 1FRIA 2RF2A 2DEIA 4CI0B 5C25A 3OL8A 1F2HA 1WOPA 2AYEA 3AT1B 4KBIA 2CPFA 4DQSA 3LAMA 3ZTOA 4NA3A 1N8RT 1C1BB 2ZE2A 2E44A 3A3PB 3LQVA 3PKYA 3QJLA 3CJRA 4YHHJ 2HURA 1A0OB 2HPUA 4IOCQ 2DH7A 4DQRA 1U49A 3HD1A 4ZLNA 4B3RF 4YR3A 2DR5A 3MOJB 4OV6A 1T3NA 3UCGA 2CNOB 3DN9A 3DDNA 2HHQA 1MMDA 1RWNB 8ATCB 2BW7A 4V1Ak 5KT7A 2ALYB 1X4GA 4LF1A 3M6VA 2GIFA 2RE1A 3I0SA 1MW7A 2NUUG 1RTZA 3MD1A 4HT7A 1RHQB 1QSLA 5DS7A 3TZWA 1RBLA 3JSMA 1PAEX 1CEZA 3GJRB 5GAGU 3R7SB 3TO8A 4LSZB 4FS1A 3JYTA 1UMJA 3WX4A 4WFNQ 3V6KA 1VJWA 2CPYA 4J9VA 3ZZYA 1WTFA 1UEUA 3F44A 3QT6A 2H5IB 4OHXA 2FJBB 4ZOSA 4G1IA 1IWGA 4A48A 3R8YA 3PM9A 4J9QA 5T7LB 3SFUA 4NLSA 4KFBB 1WC4A 1RTDB 1FD2A 5B0AA 2HQIA 1PJ5A 3KJNB 3J81j 6AT1B 2QRRA 3DYAA 4C0HA 4I0WA 1WHXA 3S6EA 2YQ0A 3M2UA 3W1YC 1TKXB 1S1UA 1HNXF 1RWOB 4R5PA 3M30B 2CDQA 2LYVA 1URRA 4DWIA 5JXSA 4GKJJ 2L9DA 4CLZA 1U1MA 1S79A 5F8HA 4URSA 4ED8A 4ZPDA 2M2BA 1N48A 3T9ZA 2BE9B 3AH6A 3BSNA 1IKWB 2Y0SD 2KHDA 2HHUA 2KYZA 3GIRA 1RT5A 2A2DA 1KFSA 4B02A 5DM7Q 4OX6A 1FDDA 4ZPVR 1YRTA 3R2DJ 1U26A 3GIMA 2FLLA 3JTOA 2XS2A 3BGFA 3R3TA 1SQGA 1WC0A 4WFBQ 4CH7A 2KYXA 1L3TA 3E2EA 2V8VA 3MUMP 2DCLA 3I82A 2MZRA 3JQMA 3IRXB 4LF8F 4P10A 1K0VA 3SZ2A 1SCJB 3QWUA 3VGUA 4E0DA 2C2RA 4FYDA 1M5VC 3IP0A 3I96A 3HHLB 3MM7A 2CNNB 1U6ZA 2KG1A 2OPPB 3JQJA 1EARA 1S0NA 4DR2J 4H4OA 1LWCA 4C3MA 4USJC 4B9SA 3SSSA 1VK8A 3NGSA 2KJWA 5A8RB 4RNOA 4UQTA 1AT1B 2GAHC 4ELTA 5F0UA 5SUHA 1RBAA 5MLCV 4LBHA 2LCWA 2J7UA 5E3RA 4ZVTB 3HFZB 5AE2A 4CNZA 1X9MA 1J5EF 2QC3A 3PEJA 2HBZB 4O23A 2NXEA 2XHCA 1JLFB 1RT4A 2M52A 3UQSA 1VCTA 4B9TA 2MDAA 3KHGA 1H2VZ 3CC2S 2F63A 1OY6A 1NK4A 1ZAVA 4PQUB 1B0VA 4ZK7M 4ECTA 2UXCF 2O66A 2HQ3A 4YB1P 2KKHA 5H9FJ 1VBKA 3IXQA 5J2NB 4DX7A 5B0EA 1Q16B 1N6QB 1WEYA 1X8DA 5HP1B 2DISA 2RHSB 4TKTA 3SCJE 4QYZJ 2K8GA 5LJ5Y 2FC8A 2VDIA 3MEEB 2XM3A 3N0VA 2MXYA 1X9WA 3DNCA 3KLFB 3I0RB 3A3NB 4BC9A 4LVOP 2DK2A 3FUYA 3WDOA 1HQEB 1YJUA 3T1AA 1KQKA 2C2KB 4C0OC 4K0KF 3KUEA 3OTOJ 4DR6J 1R8AA 1NCLA 1LWXA 1I94F 5CH7B 2YTCA 3UFCX 5CYJA 4H4KC 3FEZA 4X66J 2R2TA 3OSNA 4FKXA 2BJEA 1X0FA 2EPIA 4F36A 3QFHA 4PWDB 3HHLD 4FF4A 2J76E 2GHWA 3M2RB 1XMOJ 1YJ9S 3ILLA 4DCPB 1NJZA 3PYEA 1N32J 4PUOA 3QT7A 4WPAA 2N7YA 1NK6A 3OR2A 3H5SA 2PEBA 2OPSA 5DZ6A 4TY8A 3PW7A 2LQBA 4HI1A 3NP5A 3M8SA 2BANB 4N8OA 1OMSA 4JI1J 4DL0C 5J2QB 1HNZJ 2ERRA 2MQPA 1U1RA 2R7WA 4DV5F 1KTQA 2MMYA 3TEGA 2KFYA 3UDLA 3I55S 3Q89A 1AFIA 4QR0A 2DR8A 3ELHA 2CPDA 3BBCA 1JKHA 3FFIB 3CJ4A 4ECZA 3S8SA 2QE5A 3SFGA 2BUNA 3FZBA 4E2FB 3GMGA 4DSLA 3MTKA 2C28A 4IFVA 4EYHB 2IDEA 3BO2A 2B4VA 2BRLA 1U45A 1AXQA 3OW2R 4NWBA 2RSQA 1N33F 3EUNA 1UWBA 3UVJA 1FESA 1G7CB 4NRTA 1HBOB 1KQGB 3M8RA 3U7JA 4DFKA 1WI8A 2GS8A 1JJ4A 1XNRJ 4P72A 4ZN1A 3CUNA 5KG4A 4B9VA 1EZZB 1Y0HA 1I1GA 4IOAQ 4RBTA 1NDLA 1CS4B 3H59A 1G3OA 1CSJA 3TOQA 3K2YA 2AJ2A 4MKBA 3KHRA 2MKHA 3TAMB 4X4UA 2HQDA 2I5JA 3D6HB 1NB7A 1RLCL 2KXNB 4DR5F 4A8KA 5D3GB 4DV2F 6FDRA 4A8OA 2JNJA 1RXOB 3VR1A 3SCKE 3AD7C 1S1VB 4C11A 3TJ9A 1JLEA 1TELA 4RNFA 1NJYA 2ZM6J 5E41A 1FFWB 5DDRC 3BEGB 4EGLA 4A8MP 3TA2A 3C14A 4IRKA 4AFFA 1N0VC 5KFEA 4O4RA 2ZUGA 2KZZA 1FFGB 4EU0A 2C2DA 3IS9B 3IA0A 1HR0F 3PRVA 1EP4A 4ZVHA 1UKUA 4NRUA 4TQRA 3IG1B 5I4MA 3G82B 1KTVA 1BMQB 3B4MA 3M05A 2H65B 3ZTSA 1N5YA 3MOZA 1HWIA 3OTEA 3Q24A 1RAOA 4J9UE 4ZPWR 1FVSA 2IM1A 1J5OB 4ZVFA 2G0CA 2HFZA 1FXDA 2CJXB 3CE8A 4WP8A 1OPZA 3DI6B 5BYSA 3D1QA 2KZMA 2V8GA 3R6LB 4AL6A 1N56A 1IKYB 8RUCA 5IM0B 1HYSA 4I7FB 1CJUB 1NUEA 2H51B 2JWNA 4ETXA 1FWLA 1FHTA 1K1QA 2WVDA 3VCDA 1WC1A 3UDVA 4ZVQB 5H9EJ 4NA2A 4QZVB 3T9NA 5KFAA 4K4YA 3HVTB 1VIOA 5KFQA 4DUYF 5J1EA 2GFFA 4OZNA 1AZSA 1DARA 4OJ1A 2GVZB 1Q8LA 4KR0B 2F5GA 2YNHB 1U8SA 3OUYA 2WSFC 2B56A 2JSXA 1Z2ZA 1HMVB 1SC3B 1DTQB 1UVLA 3MR3A 4UY85 5D77A 4TLQA 1BY9A 3LTOA 2W2NP 3D0GE 1YSJA 5G0RA 3LOUA 2PMZD 2AT1B 5EWFA 1VMBA 1SH2A 2MJUA 1FWKA 5AXNA 1RACB 3V6JA 3U1LA 1K1SA 2EC0A 4ZVRB 3AB2B 5HMZA 1JQGA 3UR0A 4LF7J 2E5LJ 3KK1A 5BR8J 3M8ZA 3BKTA 2MPUA 1XBWA 2MQLA 2UXDF 4QWDA 1H2UX 3D2WA 4GO7X 1SL2A 1RAFB 2AU0A 3FKBA 1FRJA 4YY3F 2IVYA 2B0GA 4DLGA 3FMWA 2SXLA 3A13A 1H38A 3PR4A 3OVSA 2ZJRQ 1QUPA 1RI7A 4HDGA 4ID8A 1VBZA 1IR2A 1S1WB 4EWTA 1JJCB 3RJMB 1FWPA 4HACB 1S1XA 3PKMA 1RAIB 4RLEA 1C0UB 4ZHRA 3W9HA 1WG5A 1FI4A 1IR1A 1D09B 5SZTA 2UVUA 1DLOB 1UETA 2G0JA 2LDIA 3R5DA 2BQRA 1VK3A 1U1QA 1L3VA 2O3DA 5D4OA 2AX0A 1RTHB 2YWHA 5C7PA 4DV3F 4Y2KA 4HTIA 2OPQB 3DOLB 1AW0A 4OZ0A 1QVGR 3SI8A 1VQ6S 2D9OA 3DRPA 4UF4A 2KL8A 2UUBF 3QNWB 2XLJA 1YQHA 1U1PA 3KHLA 4N76A 2WVCA 3VVUA 4DSIA 4X4NA 4XK8C 3G4SS 4YDDB 4CTAA 3D68A 4MKYA 3CD5A 1TV6B 1HBNA 1N88A 1NSQA 5KFSA 4DSJA 4USWA 5KFVA 4LQ3A 3CCUS 4N47A 2ZNYA 5DDOC 5KOWA 3MEGA 3DRXA 4NX9A 4K4TA 4F4WA 2E9TA 4ZPCA 3T1YJ 1IBKJ 4Z7CA 4HHUA 1F9EB 1SV5B 2CKWA 4O3NA 3T5JA 4UT4A 1RT2A 4IUFA 2HSEB 3C3LA 3HHKA 3N6NA 3HLUA 2RU3A 5F8LA 2OJ3A 4CLPA 2J0QD 5L8RC 1S7HA 1RWPB 1D9DA 1S76D 1GX6A 3KG1A 4A8XA 2WONB 2C3MA 3HVAA 1ZBTA 1TMMA 2VQEF 5KG5A 1VBXA 3QLHB 2JRSA 4W98A 4D3HA 4K4VA 4Y2IA 1RHKB 5KG1A 4M5MA 1YDLA 4OI1A 4RUHA 2PDAA 5D15A 4ZLJA 1YBUA 3DLGB 4KQZA 4A8YA 2W7AA 4KHRA 3MR2A 1S59A 3HI9A 2FLNA 2OAUA 2W9BB 3RTVA 2QFIA 3H20A 5DQIA 1TL1B 3IO1A 2L41A 1RABB 2DNZA 4CYUB 2HHTA 2KT2A 2BKPA 4NYPA 2K7KA 2VD3A 3HVWA 3TA1A 4OLPA 1OWXA 2AZ3A 4LF5J 2ATCB 5AXMA 2ASLA 1OSCA 3KLHA 3R1LA 4N56A 2KRBA 1WKJA 3G9CA 4CCHA 3AOBA 3PW0A 4NEYA 1PAUB 3L3CA 2N4CA 5KFRA 3R6GB 2DJWA 3MMCB 1ZTTA 5FD1A 1V6HA 3C46A 3CDEA 2OHDA 1URNA 2B9WA 4Y2MA 3DOMA 3CDBA 3GFXA 1T8EA 3PV8A 3EE3A 2UXBJ 3LP0A 2CWKA 3MTJA 1CBKA 2LEPA 2YWGA 1FE0A 5JJBA 1C4AA 2CJYB 1LWFB 3HKWA 5CZXA 5T14A 2HS4A 1UZHA 2WVBA 2BDPA 3PJWA 3DLKA 2WSCC 3EX7B 1X4FA 4Q44A 5ETKA 2DT9A 2YNIB 3W62A 3KUGA 2QIFA 2NXUA 2GO9A 7FDRA 4LF2A 4OLOA 1SH0A 3POTA 1AUSL 1R43A 3MM8A 2FJWA 2E1AA 8AT1B 1WG4A 4M5HA 2OD4A 1SKRA 4JI8J 2HZVA 1KDNA 1KR4A 2P6TA 3WC2A 3H4DA 4DV1F 2JVRA 3FDSA 5ETRA 1XN9A 3SSQA 3M32A 4B9NA 3CSKA 4EO8A 3ETMA 3CCLS 4IYQA 2MLYA 4RNHA 5CCMA 3WC0A 3LGMA 3OL6A 5LMNF 3PEHA 3THTA 5IC4B 5KFTA 2F8MA 3CW2C 2RU9A 2XQCA 4JI3J 1AFJA 2LXIA 1H3DA 1T9XA 2Y1RI 4GVLA 3EYZA 2XZDB 3TEHB 4PPZA 1MWYA 4JV1A 3ZFVA 1NKBA 1QAJA 1YG0A 1RKJA 4O44B 4FYWB 1KFDA 1JB0C 4F3OA 2RS2A 1BQMA 4V19X 3GYGA 4ID5B 3TUPA 2AJ4A 2Z30B 5GVQA 1D0EA 5AE1A 4N41A 1R0BG 4KO0B 3M8QB 3DHXA 3HSDA 3OJUA 3BBFA 1WSRA 3QT5A 2RDJA 2M9KA 4WTYA 1UJ4A 4ZMMA 3HFKA 5IT4A 5HN0A 2E5HA 2R8JA 2KN4A 1FRHA 2DXEA 3MECB 2GZOA 1RHRB 3AJDA 3OFFA 1ROFA 2ROGA 4I4BA 2HQGA 1R8HA 4UUWA 2DGUA 4KAIA 3I6PA 4ECUA 3O3LA 4QOTA 3TX8A 3MCMA 1D1UA 2DKOB 3PX6A 3KOAA 2ZITA 1HW9A 4DV7J 5A6WA 5EWEA 4OL8A 3BJYA 1Q95G 2K1RB 4QIWD 2OGUA 2UUAF 1OJ4A 3JTNA 2QV6A 2D74B 2GNKA 2W1BA 3NGRA 1UVJA 1F60B 2YKMA 4HKQA 3GFHA 3VHQA 4UY8T 4FNHA 4DSEA 3OXGA 2KI2A 4JI4F 2EFVA 2E7WA 5A8WA 4X4SA 2BACA 2BM1A 1R8CA 3ENVA 1NDPA 5EWGA 3B6BA 5LSRA 1KD1T 5EX0A 3Q8YA 4MIAA 4DFMA
chains in the Genus database with same CATH topology
2ZD1A 1JLBA 1HW8A 4P7VA 4BWMA 5I3UA 3MEDA 4WF9Q 2VB6A 1L3SA 4M95A 1IKXB 1IJEB 4PXCA 5A8RA 4LQ9A 3DOKA 5HI7A 4DS4A 1UVMA 2GA7A 4IFYA 5KTQA 2D9PA 1M1KT 3LF0A 2UUWA 4O3SA 4WZMA 2E9ZA 2AQ4A 4O0IA 2DNNA 1R27B 1ZOTA 4J9SA 1S1XB 3H98A 1N54B 3DGPA 3KKFA 1C1CA 1S6PA 3ETOA 4TXSA 4YB7A 5EGYA 3OVAA 4A4JA 2YWEA 2CZ4A 3M4XA 3MM6B 2ZOFA 3EZ5A 4OIXA 4I6AA 1MU2A 3NCPA 2KG0A 2FVCA 2DGWA 2QFJA 5HROA 4KV8A 4FS2A 3VAGA 2WB1D 4OZJA 2VG5A 5DG8A 1RA7A 5HROB 5KFIA 5HMWA 4PQAA 1NJWA 2VG5B 2AJ0A 2WK4A 2AV5A 1S4FA 3BQ0A 1HQUA 1M5SA 4C0BA 3V81B 1QUVA 2LXUA 2O1PA 3D5MA 1DTTB 3R5BA 1HBUA 3N5BA 4RBVA 1BWEA 3JTPA 4CO4A 1I6JA 3Q0AA 4FXVA 1TL5A 4PRFA 3TP2A 2OFGX 1G6BA 2CJQA 2RD5C 1VC0A 4JI0F 4CZCA 2HGNA 2CQBA 3K8VA 4F3MA 4AQYF 2XY5A 4LF7F 3KYLA 3SEOA 3TVYA 3BSCA 3BDEA 4DR2F 3ZZ0A 2OMOA 2HG4A 3HXMA 3TI0A 5F3ZA 2D1CA 2AJ1A 2XWXA 3ONQA 3QGGA 1V9OA 4USHA 5LSLA 2XMVA 1IJFB 2R7TA 3GFZA 2M7SA 2KJVA 5B0GA 3CCVS 2F1FA 1KQFB 3MD3A 4ZLPA 3DRPB 4EZ9A 1JWWA 5DDPC 2ALZA 1HI0P 2D3ZA 3DXSX 4KKOA 5CA5A 1TFWA 2BBEA 2V2KA 1VQ7S 4YEAA 4G1QA 4EZ6A 4QWBA 1WD6A 1LXJA 2MYFA 3BZQA 1HWJA 2P9GA 1WNEA 2UUCF 2MGZB 4OZ5A 1VLYA 2XMTA 3T6BA 4RZRA 2BV3A 1U24A 1VQNS 4CTAB 2F3JA 3KK3A 4EYIB 4XAKA 4ZCKA 4JI7F 2RRNA 1RISA 1N6QA 3CTRA 1E6VA 2XSJA 2OPRA 1CG2A 2FHJA 4I2PB 1CPZA 4FVMA 4UQGA 5HP1A 5DJBA 1E6VB 1T3OA 1TKTB 2E5IA 2OPRB 2JLFA 4PG6A 4KPYA 3ENQA 2DNOA 5KT3A 1FKPA 4ITSA 5HQ8A 3CDAA 2RJZA 2J6UA 3OFGA 4MFBA 4CO5A 2HNYB 2R7VA 3T6JA 3C2PA 3GG1A 4CO0A 2VASA 1OPIA 3RW6A 1T7PA 4MFBB 3MEEA 1FKAF 1B0PA 2AWZA 2Q6CA 4IOBA 4DQQA 2HMIA 4NLXA 1X4HA 4ECVA 4DL4A 4IDKA 2D3OR 3MEGB 1QTMA 4OX8A 4C8KA 3HZEA 3I0RA 2ATLA 3OFHA 2P9CA 1UVNA 3PW2A 4DPOA 1NH8A 4UUXA 2ZHOA 2JH3A 3KNAA 1IQTA 5KFPA 1S9FA 2EK6A 3O8WA 3R5CA 2J9DE 3F56A 2J7KA 4AE5A 4NYOA 1HQEA 2HWTA 2P6SA 2PD1A 2AYBA 2M0GB 5DM6Q 3OBIA 4M5DB 4R8UA 4ED7A 3MM9B 5ADZA 2XY7A 1GXTA 2W8LA 3FSIA 1W25A 3UD4P 1U1OA 3B78A 1U6BA 2OH2A 4F50A 3FSYA 1S99A 3MEKA 3OHBA 2HFOA 2VPYB 1NNDA 4OMFG 2B9YA 2IM3A 2AD9A 1HNWF 5K14B 3EGNA 5GMKa 3KNGA 1R0AA 4ILMA 1O5JA 4ZDNA 4ECSA 2Y1JA 2HHXA 3V4IA 2LQJA 4HI2A 1S49A 1GTEA 4LUBA 1RTJB 3Q2SC 3UI3A 2DB1A 1CQNA 5JUMA 1PSDA 2ZNZA 4K5RA 2O5DA 3V4MA 4PWDA 2ZC4A 2WTFA 1L3KA 2VFRA 4OHVA 2C22A 2DNKA 5B0FA 3EGWB 5IQQA 1P1TA 3NAIA 4OI0A 4WU3A 5KFMA 3M2RA 5LMUF 5CZVA 3H8YA 3NNHA 1GXLA 3BR8A 3PFOA 2DR9A 2UU9F 5ITHA 3FEYB 2HW3A 1EETB 1WF2A 4KJIA 5DG9A 1HWKA 1SJQA 4DQPA 1B7FA 1BD6A 5HBMA 2CQHA 3AAWB 3DRRB 4CIOA 5HBMB 2U2FA 2HNZB 1DZ5A 2OTJS 2RKIA 1DQAA 5E3QA 3NMRA 2B43A 1JIHA 5KFZA 4WE1B 5CYQA 3UCZP 5C5JA 1Q8BA 2B5JA 4EBCA 4C8ZA 2BA9A 1UFWA 1H98A 4RW9B 1YGYA 3HDSA 1O0PA 1KOHA 5KFUA 3OTOF 4DR6F 1VQLS 2E5GA 4KHPF 2BANA 4J37A 2XGPA 2FVQA 4IO9Q 1YJTA 1GH8A 1O51A 2HHHF 5KT2A 3I56S 1UA0A 3GIIA 4DLEA 2WRMA 2IVFB 4Q45A 2AGQA 2DNRA 5J2QA 3TQ1A 2DVIA 2FLOA 3PIOQ 3F41A 4X66F 4MK9A 1QLNA 4JV2A 3AHPA 1KN6A 4W90B 2Y1IA 3PO5A 1OQ3A 2N82B 3F73A 1SUQA 2CQDA 2I0XA 2CQ0A 1R8PA 2KU7A 2FTRA 1X4CA 4F4ZA 4YP3A 1U1KA 2IYGA 3KLEB 1NH7A 1H7XA 2DHXA 1YTYA 2W9CB 4YOEA 2JVOA 4C3KA 2UV8A 5JVGQ 2KM8B 1XMOF 2W9AA 2ZKUA 2HVHA 1BQXA 1P27B 5A2QY 3I32A 2DH8A 4G6VB 3BGRA 1P1LA 3H2UB 1NK8A 1VQ4S 4MK8A 3JB9k 2JFKA 2MKKA 4H4MA 1DJ0A 1Q78A 5HMYA 5L9XA 3ITHA 4OI6A 2DHGA 3FVYA 4WFXA 4YUDA 2YNGA 1TK0A 2HHSA 2BXJA 1NAQA 5DRKA 5LT5A 4OJ3A 3NWGA 2COLA 5HL7Q 4NCGA 2YNGB 5E3PA 3N9UC 4KIAA 2B4OA 1HNVA 2IJNA 4ZCMA 3NNCA 3SV4A 4I64A 4JI5F 2B51A 1HNVB 3N4WA 1T05B 2QA4S 4R0EA 5D6GA 1RT1A 3MPWA 1ZAWA 2Q1LA 3G8QA 2VH7A 1RT1B 4MYUA 3DRSB 1D8ZA 3HK2A 3HMJG 2CQPA 4C8NA 4JV0A 1XWLA 1QE1A 4ES3A 4QCLA 2M88A 4I69A 2L08A 4Y6IA 1WHVA 4JI1F 2WCXA 1HBOA 4NLVA 1WI6A 1RYRA 3PNIA 4B17A 5T41A 1FJEB 4IRCA 2FHJD 1JXLA 2L9WA 3SQGA 5LXRA 1DRZA 3C66A 3N6MA 3FEXB 2IRXA 2FIUA 3KLIA 1IKVA 2EG1A 3PFEA 1VHFA 1TKZB 1KC8T 5JVHQ 1VQMS 3KLIB 4NA1A 3HF5A 1FRIA 2RF2A 4OX9F 3O6QA 2ADCA 4DN9A 3OHAA 2BRKA 3BQ2A 1FK9A 2J6SA 4CI0B 5C25A 2RF2B 4KRWA 3OL8A 1KRPA 4ILRA 2JEJA 2HZCA 2IVMA 2AYEA 2X1AA 1HARA 4PG7A 1RJJA 3SCLE 4JOUA 3LP0B 4KBIA 2GQ2A 2CPFA 2LXFA 3UW1A 4DQSA 3NAHA 4RW8A 3LAMA 2YNFA 5IZHA 4NA3A 1D3WA 3CULA 3RRHA 1N8RT 1C1BB 1T94A 2ZE2A 2E44A 2W4DA 4D3GA 4JBCA 3LQVA 1LKZA 3PKYA 1VQ5S 3TVZA 4K4UA 2CVIA 3QJLA 5GAHI 2ABYA 3LWLA 4Y28C 2C2EA 4ERDA 3X1LB 2M70A 4LIRA 5F3TA 3CWJA 1TVRA 2HPUA 4WCEQ 3ICLA 1DQ9A 1FDBA 4LJMA 2GQCA 4PG5A 2X51A 7FD1A 5CD4H 3DLKB 4IOCQ 2DH7A 4DQRA 1U49A 3TAMA 4B3RF 1CQMA 4YR3A 2DR5A 4Y3CA 4A8FA 1R7IA 1S6QB 3MOJB 1T3NA 2PI5A 5D3GA 3UCGA 2PEHA 4C3LA 3MR5A 1S9GA 2QO3A 3DN9A 1ULRA 1LK7A 5DQGA 3DDNA 1UA1A 2HHQA 1QJHA 1MMDA 3CD6S 4K50A 2DHAA 2I9SA 2RIJA 2DPIA 2J0SD 2VA3A 3AJ1A 3BN4A 4YR0A 3MWBA 3GV7B 5HLFA 4CNYA 1S1VA 3C6UA 1FCAA 2DR7A 1IBLF 1XNRF 1UEVA 5KT7A 4J9NA 1X4GA 3M6VA 2H9ZA 3MMBA 2RE1A 3I0SA 3KK2B 2QA4G 2ZVSA 1MW7A 3MUTP 4DR3F 3KLGB 4HT5A 2NUUG 4NLUA 3MFIA 4DX8H 3MM8B 3MD1A 3OVBA 4RW6A 4HT7A 1BLUA 1SL0A 4Z37A 1U2FA 1QSLA 5KT5A 5DS7A 5G4DA 3JSMA 1S9EA 3UWTA 4W92B 3G6XA 1CEZA 1WWHA 5GAGU 3RZAA 4MIWA 3TO8A 5HMXA 4KTQA 4ETZA 4NLWA 2EI5A 2VOOA 2QT7A 3DMJA 3LP2B 4FS1A 3JYTA 1UMJA 3WX4A 2B3TB 3FZ2A 1XK8A 1ZPWX 3HVRA 2DGVA 1REVB 4WFNQ 1GXUA 3IS9A 2CQ1A 4FBUA 1XTZA 3DCAA 2VQFF 1MMLA 3M32B 3V6KA 2R7SA 4ICLA 1Q7YT 1VJWA 4BS2A 2CPYA 5KG6A 2AGOA 4ICLB 4RBUA 4QW8A 3CJ5A 3ZZYA 1JLCA 3NCQA 4DL7A 2KRRA 2Z4PA 4OFZA 3E01A 1GAOA 1WEZA 2EW9A 4ED3A 2FGOA 1WTFA 1NO8A 3E01B 2IMOA 1S0MA 1UEUA 3W2WA 3LP1A 5E3CA 1S10A 4DDFA 2VFTA 2XC9A 2VFUA 2D3UA 3F44A 4M94A 3CF5Q 1LK5A 2FHMA 4HL9A 4NLOA 2FJBB 4OHXA 5GADI 1Q86T 1J5OA 1SL1A 4ZOSA 3QJJA 2AF6A 4G1IA 1UFLA 4KHMA 3VAHA 2PI4A 5T7LA 4RW4B 4A48A 3PY8A 4RNMA 1YJRA 3PM9A 4J9QA 2XS5A 5T7LB 4DL5A 1XEZA 3SFUA 2ZM6F 1UP1A 1ZM3A 3BR9A 3EXYA 3DI6A 4NLSA 1FKOA 1G2EA 4WYLA 4KFBB 2WBRA 3CCRS 1RTDB 1FD2A 1VOMA 2MHEA 2CJKA 5B0AA 1S77D 1IKYA 1O8BA 1S1TA 2HQIA 5J1NA 2XCAA 1VRUB 1W2BR 3GIJA 5IM0A 4F2RA 3RRKA 3CIMA 3P96A 1S1TB 2QRRA 4I7FA 3TW0A 4I2QA 3DYAA 2N3LA 2VV5A 5KG0A 4C0HA 3BQ1A 4I0WA 1WHXA 3DYAB 3VZHA 1KOOA 2A2CA 2LQ5A 3S6EA 3HT3A 2FVRA 1KS2A 1VQKS 3KMQA 3M2UA 1RT6B 3PJXA 2XSFA 1RTIB 1Y4ZB 1VBYA 1W2IA 2M3DA 1DBDA 1TK5A 1Q79A 1TKXB 3M2UB 1S1UA 1BQMB 1HNXF 4R5PA 2NZ4A 3M30B 2UV8G 2CDQA 2LYVA 4DBQA 4IQXA 4OI4A 4HLBA 1JLQA 4C8OA 3MGJA 2ZH5A 1WACA 5KG2A 1S6UA 4Z2XA 3CJ3A 1URRA 4DWIA 3JSYA 1SJ1A 1X5PA 2I1RA 3MM5B 5JXSA 5E0OA 3EPIA 3DM2A 1P8GA 3CDUA 2L9DA 2GHPA 1SJ4P 1U1MA 3P5TL 1S79A 3OTCA 5BYQA 3J80Y 2IBKA 5F8HA 4URSA 3HVTA 4ZPDA 4ED8A 1Q81T 2M2BA 2MQMA 3D1OA 1N48A 2UVWA 4MK7A 3T9ZA 5I3PA 1SBRA 2RB7A 3AH6A 3BSNA 1IKWB 2EK1A 2Y0SD 3OXFA 5GAEU 4NXMF 5EN1A 2KHDA 2UVVA 3PACA 3N5FA 1E6YB 2HHUA 3IGNA 2KYZA 1RT5A 2GHVC 1HPZB 2A2DA 4B02A 4X4OA 5DM7Q 1KFSA 3CMES 4IG3B 4OX6A 5M2PA 1FDDA 4ZPVR 1LOUA 3R27A 3S1TA 4GKKF 2G1DA 3I4PA 1YRTA 1U26A 3GIMA 2FLLA 5DGAA 3JTOA 3OJSA 2JC0A 2XS2A 3Q8PB 3BGFA 1DTQA 4O3RA 4NZ7A 3R3TA 2NREA 4WFBQ 3K8WA 3BSAA 3D1HA 2KYXA 4AYBD 4CH7A 2HIQA 3DLLQ 1Y5LB 3I4HX 3V6DA 1L3TA 1OIAA 3C8YA 2UVRA 3M2VA 3E2EA 1XR7A 3EZUA 3IR6B 2V8VA 3MUMP 4HDHA 1FDNA 2EBEA 5B0DA 4DR4F 2DCLA 4B08A 3I82A 2QMXA 5IT9Y 2NPIA 1RA6A 2ROPA 2MZRA 4G3IA 3IRXB 3MURP 4LF8F 3QAUA 3M1VA 2BE2B 4USIA 2PO4A 4QBUA 2BM0A 3Q8SB 3J7YU 1K0VA 2YKMB 1Q82T 2HRYA 1KONA 2PMHA 4HYKA 2L3MA 1VQPS 2DGOA 2OFHX 2XMKA 3SZ2A 4Q7AA 1XNQF 5AJ3F 4WK1A 3UNGC 1FE4A 5HO4A 5KFBA 4LFBF 3QWUA 1A9NB 2IBOA 2DRAA 3PW4A 5EHHA 1GX5A 1M5OC 4E0DA 2C2RA 4FF2A 4F2SA 4FYDA 1IQZA 2ASJA 1M5VC 3HHLA 4HHJA 5L39A 2JEGA 1P6TA 3BREA 3I96A 5D78A 4KC5A 3HHLB 4IR1A 3E8OA 3MM7A 2B7CB 4DSFA 3G6VA 1U6ZA 1PGZA 2KG1A 2OPPB 4DG1B 3K58A 4RU2A 4GO5X 4LSNB 4LIWA 1FNXH 3QAEA 1S0NA 4DV0F 1V3ZA 3GG0A 2GO8A 1HI1A 4H4OA 4CO1A 4J5OA 1WF0A 1LWCA 2PSZA 2MQOA 4C3MA 4USJC 4B9SA 2GCFA 3J7A1 3SSSA 2ZD1B 1T03A 1JLBB 5I3UB 1VK8A 2FJEB 3MEDB 2ZH3A 2LLZA 1TUVA 2KJWA 2XMUA 5A8RB 3TAPA 4RNOA 1VIXA 4OZ1A 1IUJA 3DOKB 4UQTA 4ECRA 2P5VA 2L9NA 4B3SF 4IFYB 1BGXT 3TAQA 5J2PA 2MY7A 2XZWA 3T5KA 1ZZNA 4ELTA 1HNIA 3VAKA 3CGIA 5DG7A 2DRBA