3AAAB

Crystal structure of actin capping protein in complex with v-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 82
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaaB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaaB02
3AA0A 3AA7B 5ADXK 3LK3B 3AAEA 4AKRB 3AA0B 3AAEB 3AAAA 3LK42 5AFUL 3LK2A 2KZ7A 3AA6A 3AAAB 1IZNA 3LK2B 3AA6B 3LK41 5AFUK 5ADXL 2KZ7B 2KXPA 3AA1A 3AA7A 1IZNB 3LK3A 2KXPB 4AKRA 3AA1B
chains in the Genus database with same CATH superfamily
4WYVA 1SHZC 4DR7T 1BR0A 2R4PA 2E2AA 2JQ9A 4IDPA 5E0OA 2XQ8A 3SY7A 4FI5A 3O1HA 4DR2T 4HWIB 1HF8A 5TISO 1ORMA 1HTJF 4TWFA 5JDLA 5CGMA 3N9QA 2JQHA 3ZMTB 3K19A 4AYDC 3NRYA 3UUXB 1ZV4X 3QC9A 3MKDA 3UTKA 5FVNA 2J62A 2YKSA 4B3RT 3LK2A 3ZN1B 3PV0F 2QA7A 4PJMA 3VU7H 4IDZA 4IL6O 3DJBA 4JYAT 4DV7T 4IL9A 1U5PA 2KNDA 3ANWB 5ABEA 2UUAT 4X62T 3K1SA 3UFEA 2F1VA 5CB4E 4UB8O 2VKOA 2K4TA 2JPFA 3B5MA 2JIWA 5LA6E 3FHNA 3LBXB 2MNHA 2H88A 2CLYB 4PFPA 4B3MT 2PORA 3UU2A 3PDYA 3RF1A 5AQTB 2JQYA 4BJMA 3PRNA 4CI3B 4GKKT 4TV9E 5JR9B 2W2UA 2R4NA 2Y2XA 3K3NA 2XSBA 3Q5WA 3TZGA 3KV4A 3AE5A 3LK3B 4U33A 1Q9FA 3KBTA 4AQFC 2A3DA 3VKHA 4N59A 5L3EB 1UK5A 1IAPA 3RI5A 4ZI2C 3O1IA 2OMFA 2BKPA 1W0AA 4O2AE 5ABGA 3KDSE 4U2ZA 2UXCT 4ASKA 3AE7A 3F31A 4QX7B 2VURA 3VKGA 3V5SA 5C3JA 4EEDA 2W00A 5AQNB 3VRBA 3I1AA 1FIOA 4K0UA 3AE8A 4JBWF 5PRNA 5LJMA 2VWAA 4G2AA 2LSIA 2XE2A 1OPFA 3PGUA 5AFUK 2N1GA 4NUUA 4QH4A 3C50A 3PF1A 4QXBB 4LSEA 1KFYA 3Q2MA 4NIQA 1KK7A 3C4ZA 2J4UP 3VZTX 1FMWA 5LHIB 1QJ8A 4FQEA 1N36T 1HG5A 5LHHB 3M65A 3PTRB 2WJRA 3KVDD 5IYZE 3Q9DA 4JI4T 4QHOA 3GA8A 3OTOT 4I4TE 3P50A 4GCQA 5DJQC 2WDRA 2KMFA 4UF0B 4KHZF 1OSMA 3KVBA 4Z91A 3HKCE 5FVKA 4DVDA 2BVLA 3SWHA 4XNKA 4PK6A 3EDUA 3AE4A 3EVYA 4YHHT 1UCUA 2CEAA 4NPPA 4AKLA 2I6HA 5HCMA 4PNIA 3CQCB 5LOVE 1Q9GA 3RYFE 2V7MA 2FGQX 2C0SA 5L3DB 2I0MA 5AQKB 3JAEA 3KFWX 5KMGP 4DV3T 1VCTA 5TAOA 5FY1A 4OFZA 2NOXA 3RLFF 3ESLA 3WAJA 5GONE 3RYCE 1QSDA 4JV5T 4I0UA 5LMNT 1NWMX 2Y48B 3AA7A 1BR1A 2WM9A 2XHEB 2N2NA 3CMLA 1ZHCA 2Q9QA 4AKMA 2WWVA 5ABFB 5AQMB 4AYMC 4DR6T 4YHJA 4KUMB 3P4SA 5FMNA 1X9BA 3FB2A 3CK6A 3N9NA 5LG4A 3ZCIA 5F5WA 5DL8A 3BK9A 2CCQA 2H7VC 4LF7T 2Y7SA 2OV9A 3H37A 1XNQT 5HEGA 3TLWA 2PTFA 4U31A 3RIFA 4FESA 3T24A 2WMNA 5DL5A 3P7IA 4BA9A 5FY0A 3AAEA 5LXTE 2XTQA 2L9QA 3J9X1 1YD8G 3AAAA 2X9HA 4IE7A 2C5IT 3PURA 5LGNB 4CZZB 2JMKA 4PK5A 1MMDA 4HE8A 4ZHQE 2Q9QC 2X51A 2CHOA 2XMXA 4PK4A 2W61A 2R4OA 2JQQA 3VR8A 2FJDA 3ZYMA 3RC8A 3JAFA 1T98A 3VE1A 4EOZB 1GQEA 1CUNA 5L3CB 3RPUA 4CN4A 1XDOA 4CN1A 2B1EA 3UU5A 3Q5EA 2AXTO 4QXCB 4M1PA 1HFAA 4K3CA 1PHOA 3ONJA 4K0KT 2V6XA 3N2GE 3JC6C 3QB5A 1S94A 3FXEB 4DV2T 3OPCA 3HA4A 4DV5T 5AQHB 2W67A 4UEMA 3N9PA 1IBMT 4JI8T 1D0XA 3GMIA 1B7TA 3AA1B 5L4HA 4QH1A 2ZM0A 1WFDA 5J0ZA 3RIUC 4UVCB 4RJXA 3TLVA 5J2TE 3T20A 2BS4A 1HR0T 1UURA 4XBFB 4NXMT 3T8OA 3E0ZA 5JDGA 4PJJA 5HEJA 2KXPA 3I0OA 5EK3A 3EUHA 2HN1A 2CMRA 2E5LT 1G73A 2W81C 1MM5A 3ZN0B 1MMNA 2WAUA 5DQVA 2WS3A 4TN7B 2E9XC 4Z3TA 2IIUA 1OEDA 2XM2A 4FMSA 2ACXA 4ILCA 5KAIO 4A98A 1JNZA 3KVAA 2ZFGA 3PQSA 3I9YA 2OLTA 2BS3A 3T0SA 3R6NA 3ZC0A 4FOZA 2BBJA 2VKDA 2DLRA 5C2TA 1I6ZA 4YY3T 3NWIA 4IDNA 2UUBT 2XUEA 4E1TA 3H3MA 5LJNA 2XJ7A 4DUZT 3O1JA 3EHZA 2CXFA 5T5FA 2LM9A 2KLQA 2LE8A 1SUMB 2BG9A 4P1NA 3FZMB 5AQRB 2L8KA 2AE9A 4LSFA 4EZHA 3PE0A 4LFCT 2QVAA 1IZNA 1LVFA 4C69X 3UU6A 4EB6E 1ZKEA 1JNRA 4C4VA 5IHYA 3JC6D 4AKRB 5AQLB 2XE3A 4HWHA 1UUSA 4F8HA 4YFSA 1N33T 3GN5B 3L09A 4N78D 2MOZA 3CKDA 4JFBA 2M6BA 2X9YA 1MIWA 4GF4A 3KV5A 4UIGA 2ZLDA 4N74A 3WAKA 3ZMSB 2X68A 6PRNA 2N2MA 3IF8B 2A2FX 5JQGE 2R6GF 1HNWT 3RYHE 4IGUA 4LFAT 4YT0A 4DIDB 5KDMC 4DR3T 5DL6A 4X20E 2V7IA 3RH3A 3O9XA 1BT9A 3IBPA 4ILUA 3L3PA 1VOMA 4GYRA 3RGLA 2W62A 3NBXX 3P4PA 4LF6T 2CRBA 3AA0B 5IYUA 3SY9A 5GTHO 5L3BB 3HI2A 2E9XD 5GTIO 3PU8A 1THQA 3QRCA 5LBQB 4AUIA 3RBHA 5BMVE 4HN9A 1H7CA 2LSYA 3P4RA 2J47A 3A8YC 2XAGB 4JCHA 4JUYA 4A56A 5A1LA 3AEEA 5JRCA 2V1DB 4DR4T 3ZYKA 5LBMA 5LP6E 3N5LA 4H9OC 2D5UA 2IMLA 2LKHA 3AEGA 2WWUA 5JTGA 1P4TA 3AB3B 4ZS2A 2M67A 3C4WA 4IE6A 3RQWA 2R8AA 2XQ5A 2V26A 3SYBA 4ZZCA 1NAFA 2XM1A 2D2SA 3HKDE 3Q5XA 2W80C 1YKHB 2QTKA 2MBGA 2PFVA 2IWWA 3QNUA 3PU3A 4FUVA 5IUXA 2Y0HA 5KAFO 3UQ4A 2EHOA 1G90A 4O4HE 4PJLA 4NXNT 3KV9A 1HX8A 2BKNA 3UFGA 3AE9A 4WNKA 3SS1A 1D1CA 3AVSA 3GP6A 2XAQB 1W09A 5H6RB 5KX5E 2HHHT 5J1GA 4KBMB 5JVDE 1ZHXA 5LGTB 1XWMA 2XQ7A 4D5UA 4YTPA 5J2UE 3UQ7A 2SPCA 3N9LA 4UR9A 3UU8A 4COFA 2XQ6A 4KR8A 4LFBT 4B6XA 3VZUX 5JDMA 4QWNB 2XASB 4N75A 3BQKA 2LEHA 4OYKA 3B13A 4ZI3D 4O4XA 5AQPB 3SFEA 4PJ0O 2CXDA 5B66O 2K3WA 4RLCA 4FZLA 3OBVE 5CA0E 4O3WA 3RHWA 1YS5A 2EHOC 1WYBA 4CXXA 4MFRA 3VR9A 3QK6A 2X66A 3AXJA 5HAXA 4IT4A 2Q9QB 4H9QC 1UX5A 2AXDS 4LMLA 2XAJB 2F1CX 2CWOA 4D64A 3AE1A 2OA5A 1MIYA 4H9RC 3VE2A 4GK5E 1N34T 3C51A 2D9DA 4E7SA 1QJPA 4L5GA 2V7LA 3ZMUB 4MALA 2UU9T 3AA6A 1HXTA 3QOFA 4PUXA 1KEYA 5LGUB 4JLEA 3MZKB 5JDHA 2WQYA 2GE4A 3S4UA 2WMOA 2M6IA 3EABA 2BS2A 4F6RC 2P9BA 3PORA 5HXEA 2PBIA 2UXBT 5FXXA 2X27X 4AZLA 3IHRA 2UXNB 3JTYA 4O4UA 4LF9T 2V6YB 4AFKA 5HCJA 1HNZT 5B5EO 1US7B 1WLXA 1Y01A 3ANWA 4ILAA 4HWDA 3EAMA 5FL1A 1KNPA 3ZJ1A 1J5ET 3AEBA 4CN6A 3ZMZB 4LSHA 3PUSA 3UUNA 5FYMA 5HWXA 4Z8XA 2E9XB 3LBXA 4XNLA 2RA1A 1ZHYA 1MIVA 4TWHA 4IE0A 3NZQA 5LB7B 2FUPA 5AQGB 4ZI2D 2LSKA 4JI7T 2LHNA 4X65T 2LRKA 1V9DA 5JR9A 4P09A 3UAQA 1IBLT 2IWVA 2IUBA 4Z90A 5ADXL 3DP7A 3LK3A 5LYJE 4AKHA 3ZSTA 1S5LO 3PUVF 2Z6EA 3VY9X 4EXTA 3OJAA 4O4IE 5EK2A 4AYID 1SA0E 1GFNA 1MM4A 4CTDA 2Y6XA 1WCRA 1QLBA 2KZ7B 4ZI7E 4TNWA 4O49A 4EYYR 4X1KE 2LHFA 3HOLA 4QH5A 4U3CA 1GFOA 5LNKA 2LM2A 3LG7A 4QQ1A 2QYWA 3HKBE 4FSOA 3G7GA 4TNVA 1T8BA 4FT6A 2R4LA 1XMOT 3RX6A 4AI6A 3RRWA 2X0HA 2WY2A 3JCFA 2LT3A 3AEFA 3T1YT 4AKIA 5HXCA 5GV0A 3AEAA 4HFCA 4OX9T 3P4QA 4QX8B 4GHBA 2WSSV 2K48A 4HEAA 1YW0A 4X1YE 3A0HO 5JDPA 4C00A 4AKGA 1E7PA 2DNXA 1HXUA 3L39A 4JEUB 4CXYA 3CX6B 5LCYA 2FJEA 4I55E 3QB5K 4UF0A 4DR1T 2WVPA 4EEBA 2XQAA 4B61A 1IZNB 1HXXA 2CPTA 2JMMA 1AJ3A 4YTMA 2VL0A 4P0BA 1OWAA 2HN2A 4H9SE 1NEKA 4V1Av 2A72A 5ABHA 3PUQA 4XZCA 3CX7B 2ODUA 4N58A 3K3QC 1HX1B 2DI4A 3C64A 5JDFA 5AQQB 4A97A 2H3RA 4B3ST 1ZHZA 4O2BE 2XZEA 2UXXB 4LMJA 1T7SA 1GFMA 2CE7A 3ONXA 3TLTA 2KT9A 2LOSA 2QRXA 3PGRA 3LDQB 3RQUA 2VVSA 2YU1A 3LSVA 4GYSA 2WBLA 4EV6A 1FMVA 4JI1T 5DL7A 4EYUA 2HPJA 2KC0A 4X66T 1U4QA 3TKLB 3BS0A 2DL1A 2F1TA 3CWZB 2FBWA 4IDOA 5EE2A 4ZXLA 1G8XA 5ABFA 1MMGA 1LRZA 4YLHA 4L0RA 4WZXA 3UT5E 2ZLYA 1ZHTA 4I50E 2L3LA 2W63A 4UV8B 4L9IA 3ETUA 4PAGA 3PUYF 3PUGA 4EZ4A 2WU5A 4OK0A 4C90A 5G3AA 5L3FB 3BQLA 2QGSA 1BH3A 1DU2A 3MK7C 3F2EA 2NW9A 3V8UA 1KNRA 2Y0KA 4TX5A 3LK2B 3K3OA 2KWHA 2Q9QD 3N9MA 2W0GA 2RPAA 2WB5A 2B76A 4JEHB 1LKXA 4H9NC 4CI1B 3HR0A 4MHCA 4GCPA 3M3ZB 3ZC1A 1MMAA 2IW5B 1IJ6A 1UX4A 5AQOB 1XMQT 2EHOB 2UUCT 5ETWA 4KRAA 4FSPA 4AYEC 1OEDC 2V7JA 1FJGT 2XSAA 2N9DA 1XDPA 3U3IA 4CQIA 2DWGA 4LF5T 4UB6O 2XAFB 1ZEEA 4IREA 3JCUO 3SYSA 5JDNA 3AVRA 3OVUA 5FKYA 2X0LB 5JH7E 5EZYE 1WRDA 5L2LA 4J2CA 3H3AA 1Z0PA 1Z8UA 2NP9A 3C98B 4AXPA 3MJXA 3NZPA 5LHGB 3RIAA 4EAHA 3ZPOA 2FJAA 4A5XA 4GCSA 1IBKT 3C4XA 3AA1A 4H63H 1OXZA 2XPKA 2BKOA 1N32T 4KMCA 2BG9C 2BZBA 2K24A 2XTLA 1HS7A 3FBZA 5AQSB 2VK9A 3UULA 2FGRA 2MYSA 2NTYA 4QXHB 4ISTA 2KINB 1IJ5A 3I0QA 2ACZA 2DWKA 4MLKA 4LSIA 4PR7A 4DUYT 2A9UA 4DO0A 1YQ4A 3BRYA 3PQUA 2IC6A 4LF4T 1GFQA 2CBIA 1BR4A 1M62A 3HKEE 3ABVA 3L8RA 4AQYT 3WI5A 4C91A 4O3ZA 3AE6A 5H2FO 2IC9A 4IE4A 4K3BA 5G38A 1D1BA 4YTNA 3UPGA 3AA6B 3V5UA 3SZDA 4IIJE 1J1JA 2BBHA 3ZSSA 3EMNX 4JI6T 4KP3C 2NW7A 4FJOA 2ZM6T 4PFOA 2E8IA 3ONLC 5LMUT 3DA4A 2NR4A 1FEWA 1YXRA 4G76A 4AQFA 4DV6T 1WYCA 4JI0T 3HL6A 3NJTA 1ZHWA 5HWYA 3E08A 5L4EA 3VHLA 3OYXA 4PJNA 2KWIB 2LKGA 2XTRA 3CQXC 2XQ3A 3G06A 2PJQA 3ZYLA 4GIWA 2ZMAA 1HG2A 4FZMA 3SOLA 2XE1A 5H6QB 2CHNA 3NSGA 4X64T 3PUAA 4AKRA 3IEEA 5ADXK 5EK4A 4UXNB 3AE3A 2ZM2A 1KF6A 2NWBA 3GN5A 1E1HB 2LHRA 4BAYB 5AQFB 1HCIA 4RLBA 1E54A 3A2SX 3DTOA 5AQVB 1L0VA 4BJNA 4TUYE 2H89A 1HNXT 3DZMA 3KINB 3AA7B 3AAIA 1QJ9A 3A5XA 3ZMVB 4IE5A 5L47A 3NKZA 5HXHA 3O4XE 4D65A 3ZT6A 5FXVA 4F4BA 4BUMX 1T72A 1ZOYA 3POUA 3NRXA 3ZT5A 8PRNA 3ZJ2A 2C5KT 2YINA 3AA0A 4AQGA 2W66A 4H63V 4ZOLE 2WZIA 2G0UA 4O4LE 4DV4T 2YDQA 4I43B 3ZT7A 4ZZBA 4G63A 1T1LA 3SRZA 1MNDA 1R8IA 3WU2O 3A7MA 3CVRA 3F57A 4U9CA 1M7KA 2YNKA 2PRNA 3P4WA 4MBQA 2IDOB 2CM0A 4IDQA 3I9WA 4DMVA 4H9PC 3ZEFB 3MACA 4UV9B 5CJ5A 3AAEB 5JDQA 4DV1T 4HFDA 4ADZA 3WI3A 3HW9A 3AAAB 2I59A 3RYIE 2V5CA 2JMHA 3PUZF 4O3XB 4CXWA 3IA3A 5DQWA 5HXRA 2YOEA 5KXJA 4U74A 1D1AA 4E7ZA 3QUJA 5L3GB 3VZWX 3BRZA 5AQJB 2MTQA 3FZFB 4TZ4C 3HWBA 1Y64B 4FRXA 5C8YE 3POQA 2LJLA 3W15B 1XNRT 2JRKA 3MA9A 2VASA 4HFVA 2CXLA 4E1SA 2RP4A 4ILBA 2MAWA 4KX6A 4HKAA 3X1DA 4X5TA 2LSGA 5FY7A 3CQGB 3GWHA 3FXDB 2VB6A 4TWDA 1J5WA 4NUVA 4DNDA 2YDSA 3TLSA 2WU2A 4AYNA 1ZP0A 2JJ9A 3LJCA 4DMWA 2EHOD 2J1NA 2E5VA 2DCFA 4DV0T 2IHR1 1D0ZA 2PG8A 1X79A 4U7YA 3AEDA 1NENA 1VRBA 1E2AA 3SFDA 3KBUA 3AECA 1UGOA 1H6S1 1W0BA 3OKQA 2V8SV 4OHFA 4ISSA 4HGAA 3WI4A 2KXPB 5JREA 4YSYA 4DBRA 1T16A 4HFBA 2LFUA 4O8SA 2X9WA 1WR6A 5D5DA 3A0BO 1OEDB 2CLYC 3EI0A 2YN6A 4DBQA 2CWYA 2VKJA 1BR2A 3D0TA 3RC3A 2X9XA 1LVKA 2UXDT 2X9KA 5JR9C 5HXSA 2Y8DA 1CHUA 1XZYA 2WCAA 4B3TT 3ETVA 5AFUL 3PUXF 5HYAA 3FZLB 4JI5T 5LG3A 4HFHA 4FZNA 4HFEA 1YQ3A 2VQET 2ODJA 2D0UA 2XAHB 2W4XA 3RRCA 1WR0A 3RKGA 4CI2B 3DWNA 4UVBB 4HWFA 1W9RA 2YEVC 2HPLA 5G39A 4GOUA 2V6YA 5HEHA 2XQ4A 2BG9B 3RIUA 3JADA 2VKHA 1EZ3A 4O4JE 4QKNA 2MHLA 3RKOA 3FYXA 4LF8T 2YDRA 5DABA 4C4VB 3K8PC 4GK0E 2JQKA 3UUBA 1MNEA 5F8PA 4JI2T 2C5JA 3BQIA 4X1IE 1GFPA 2E9XA 2XG6A 2BDEA 2K5BB 3C5OA 4FRTA 4GKJT 2N2LA 3PJAA 2WP9A 3FZHB 2J4GA 4ZS3A 4WBNE 4YSZA 4AIUA 3DA3A 5FXWA 3PUWF 3B57A 2VVNA 2XQ9A 1PRNA 2YU2A 2LLYA 2K9AA 1OEDE 2R89A 3KZIO 3LFMA 5IWAT 4WBOA 3E22E 3AE2A 4UVAB 4WW0A 5AQUB 2YPVA 2XY8B 2KDYA 2HH7A 4UELA 2VQFT 1MPFA 3OYZA 3LK42 2H7OA 2KZ7A 3U78A 3DWOX 7PRNA 3P8CD 4IL4A 1SE7A 5CFBA 3N2OA 4JI3T 3R84B 5FVLA 2M06A 1S35A 2XQYA 4KHPT 2R88A 4ERRA 3PJAJ 5JRCB 2XE5A 4G75A 4RL9A 2D0TA 3N2KE 2LSJA 2MPKA 2O4VA 4O3YA 3VY8X 3PGSA 4EGWA 2BG9E 2F4VT 4OYJA 2K0LA 4U7IA 2VL8A 4KR4A 4YSXA 3VRAA 4U72A 1VCSA 3UU4A 1D0YA 4U2YA 3ZLIA 3J7Yq 5CA1E 3EDVA 1KNZA 2ZM8A 4DR5T 5G26A 4YXDA 5FP3A 3HOEA 3POXA 3CIRA 2J1DG 2M07A 4AISA 2WDVA 4KI0F 4RJWA 4XAXB 4P0AA 1QUUA 3Q5DA 5M4YA 3O0EA 5HEUA 2WJQA 5HEOA 4LMKA 3ZKRA 2NW8A 2V7KA 3NVOA 5E79O 4YJ3E 3TLUA 3ZCJA 3MXZA 4ANJA 4HTEA 5BR8T 2IAKA 2KSRA 3SZVA 3QRAA 4HFIA 5FNVE 2CA5A 4ZEYA 5FL0A 2ERVA 4TV8E 3FBLA 4YJ2E 2BVMA 4IHJE 2ODVA 2ES0A 2Y0LA 3UUMA 2FJBA 3CPZA 1BXWA 2CBJA 2WDQA 2LOPA 5F3JA 4HWCA 2X67A 3T1HT 3KV6A 3UU3A 2GK9A 2V5DA 2DHRA 4ZI3C 4EIWA 2X0YA 3AXJB 2LRLA 2NTXA 3N9OA 4Q25A 3CX8B 3LK41 4PW8A 3FZKB 5AQIB 1I94T 1O3XA 2WZHA 2YK0A 5FXZA 1YKEB
chains in the Genus database with same CATH topology
1G73A 3AA0A 4AQGA 2LHFA 2W81C 4H63V 3HOLA 1MM5A 3ZN0B 1MMNA 2WAUA 5DQVA 4ZOLE 1GFOA 1SHZC 1BR0A 5LNKA 4TN7B 2E9XC 2G0UA 4Z3TA 4O4LE 3LG7A 4I43B 4QQ1A 4FMSA 2ACXA 5E0OA 3SY7A 4FI5A 4G63A 3O1HA 3HKBE 3KVAA 4FSOA 2ZFGA 1HF8A 3SRZA 3G7GA 3PQSA 1MNDA 3I9YA 4FT6A 3CVRA 3F57A 4U9CA 1ORMA 1HTJF 3RX6A 4AI6A 5JDLA 2YNKA 2PRNA 3T0SA 3N9QA 4MBQA 3RRWA 3R6NA 3ZC0A 3ZMTB 3K19A 4AYDC 2CM0A 3I9WA 4FOZA 3NRYA 4DMVA 4H9PC 3UUXB 2LT3A 1ZV4X 3MACA 3QC9A 3ZEFB 3MKDA 2VKDA 2DLRA 4UV9B 3AAEB 5HXCA 3UTKA 5GV0A 5JDQA 5FVNA 4QX8B 3LK2A 4ADZA 3WI3A 3HW9A 4GHBA 3AAAB 3ZN1B 2I59A 2WSSV 2K48A 3RYIE 4HEAA 2QA7A 4PJMA 3VU7H 2JMHA 1YW0A 2XUEA 4IDZA 4X1YE 4O3XB 4E1TA 5JDPA 5LJNA 3DJBA 4CXWA 4AKGA 1HXUA 2DNXA 4JEUB 4CXYA 3O1JA 1U5PA 2KNDA 2CXFA 5DQWA 5T5FA 5HXRA 3CX6B 3ANWB 4U74A 1D1AA 5LCYA 4E7ZA 2LM9A 2KLQA 4I55E 2LE8A 3QUJA 4UF0A 5L3GB 3VZWX 2L8KA 4LSFA 2MTQA 4EZHA 4B61A 3PE0A 4TZ4C 3HWBA 1IZNA 1Y64B 1LVFA 3UFEA 2F1VA 5CB4E 4FRXA 4C69X 2VKOA 1IZNB 1HXXA 2JMMA 2K4TA 5C8YE 2JPFA 3POQA 2LJLA 3W15B 4EB6E 1AJ3A 5LA6E 4P0BA 3FHNA 1ZKEA 1OWAA 2JRKA 3MA9A 4H9SE 5IHYA 2VASA 4V1Av 4HFVA 3JC6D 3LBXB 2MNHA 2A72A 4AKRB 2CXLA 4E1SA 2RP4A 2XE3A 2CLYB 3PUQA 4PFPA 4XZCA 2PORA 3CX7B 3UU2A 3PDYA 4HKAA 2ODUA 4YFSA 4N58A 3K3QC 4BJMA 3GN5B 2DI4A 3C64A 3PRNA 2LSGA 3L09A 5FY7A 3CQGB 3GWHA 4N78D 5JDFA 4CI3B 2MOZA 3CKDA 4TV9E 3FXDB 2VB6A 4JFBA 5JR9B 4NUVA 2Y2XA 4DNDA 2H3RA 2X9YA 1MIWA 4GF4A 1ZHZA 3K3NA 3KV5A 4O2BE 3Q5WA 3TZGA 2UXXB 3LJCA 2JJ9A 3KV4A 4UIGA 4AYNA 1GFMA 3LK3B 4DMWA 2CE7A 3ONXA 1Q9FA 2ZLDA 2EHOD 3KBTA 3WAKA 2KT9A 2A3DA 3ZMSB 4AQFC 2DCFA 3VKHA 2J1NA 4N59A 5L3EB 2LOSA 1D0ZA 1IAPA 2PG8A 1X79A 4ZI2C 2X68A 3O1IA 6PRNA 2OMFA 2N2MA 3IF8B 2A2FX 5JQGE 2YU1A 1VRBA 4O2AE 3KBUA 3KDSE 4GYSA 3RYHE 2WBLA 4IGUA 4ASKA 1H6S1 1FMVA 3OKQA 5KDMC 5DL7A 5DL6A 4EYUA 4OHFA 4ISSA 2V7IA 4HGAA 4X20E 3RH3A 2HPJA 3O9XA 2KC0A 2KXPB 3F31A 3WI4A 1BT9A 5JREA 1U4QA 4QX7B 3TKLB 3IBPA 4ILUA 3L3PA 4DBRA 2F1TA 1VOMA 4GYRA 3CWZB 3VKGA 5EE2A 2W62A 3NBXX 3V5SA 3AA0B 5IYUA 1G8XA 2W00A 3SY9A 5L3BB 3HI2A 2E9XD 3I1AA 1MMGA 2LFUA 1LRZA 4O8SA 1FIOA 3PU8A 2X9WA 4K0UA 1WR6A 4L0RA 4YLHA 1THQA 5PRNA 3QRCA 5LBQB 5LJMA 4AUIA 5D5DA 2VWAA 3UT5E 2ZLYA 4G2AA 2LSIA 3RBHA 5BMVE 1ZHTA 2XE2A 4I50E 4HN9A 1H7CA 2CLYC 2L3LA 2W63A 2LSYA 1OPFA 4DBQA 5AFUK 2CWYA 2VKJA 4UV8B 1BR2A 3D0TA 2XAGB 2N1GA 4L9IA 3RC3A 2X9XA 3ETUA 4JUYA 4JCHA 1LVKA 4A56A 5A1LA 4PAGA 3PUGA 4EZ4A 5JRCA 4NUUA 3C50A 2V1DB 5JR9C 5HXSA 2Y8DA 3ZYKA 5LBMA 4OK0A 5LP6E 4QXBB 4C90A 4LSEA 5L3FB 3N5LA 3BQLA 2QGSA 4H9OC 1BH3A 3Q2MA 2D5UA 1KK7A 3ETVA 5AFUL 5HYAA 3C4ZA 2J4UP 2WWUA 3MK7C 3VZTX 1FMWA 5LHIB 1QJ8A 1P4TA 3F2EA 3AB3B 4FZNA 2NW9A 4ZS2A 3V8UA 2Y0KA 1HG5A 4TX5A 2M67A 3LK2B 2ODJA 3K3OA 5LHHB 3C4WA 4IE6A 2D0UA 2KWHA 2Q9QD 3N9MA 2XAHB 3M65A 3PTRB 2W0GA 2V26A 3SYBA 3RRCA 1NAFA 2D2SA 3KVDD 4JEHB 3HKDE 5IYZE 3Q9DA 4CI2B 1LKXA 4H9NC 4QHOA 4CI1B 3Q5XA 2W80C 1YKHB 3HR0A 4UVBB 3GA8A 2QTKA 4MHCA 4I4TE 2MBGA 4GCPA 4GCQA 2PFVA 3PU3A 4FUVA 5DJQC 2YEVC 2HPLA 3ZC1A 1MMAA 2IW5B 2Y0HA 1IJ6A 2KMFA 4GOUA 1UX4A 4UF0B 2EHOA 1OSMA 4O4HE 3KVBA 1G90A 2VKHA 4PJLA 2EHOB 3HKCE 5ETWA 3KV9A 1EZ3A 1HX8A 4O4JE 4KRAA 4FSPA 4QKNA 2BVLA 4DVDA 3SWHA 2MHLA 2V7JA 4AYEC 4WNKA 3SS1A 1D1CA 4XNKA 4PK6A 3EDUA 3RKOA 2N9DA 3AVSA 3FYXA 3GP6A 3EVYA 2XAQB 1UCUA 2CEAA 5H6RB 5DABA 3U3IA 3K8PC 4AKLA 4GK0E 2DWGA 4CQIA 5KX5E 5J1GA 4KBMB 5JVDE 1ZHXA 2XAFB 5LGTB 4PNIA 3CQCB 1ZEEA 5LOVE 1Q9GA 1MNEA 5F8PA 2C5JA 3RYFE 3BQIA 3SYSA 2V7MA 5JDNA 4X1IE 3AVRA 5J2UE 1GFPA 2FGQX 4D5UA 2E9XA 2XG6A 2SPCA 2C0SA 3N9LA 5L3DB 2BDEA 2K5BB 2X0LB 5JH7E 5EZYE 3C5OA 1WRDA 4FRTA 2N2LA 5L2LA 3KFWX 4J2CA 4KR8A 3H3AA 1Z0PA 4B6XA 3VZUX 5JDMA 4ZS3A 4WBNE 3DA3A 5KMGP 2NP9A 4QWNB 5FXWA 3C98B 4AXPA 2XASB 3MJXA 3BQKA 3NZPA 2LEHA 5TAOA 3B57A 4OYKA 5FY1A 5LHGB 3B13A 4OFZA 4ZI3D 4O4XA 2NOXA 4EAHA 3ESLA 3WAJA 1PRNA 5GONE 3ZPOA 2CXDA 3RYCE 1QSDA 2YU2A 2K9AA 3LFMA 4RLCA 4GCSA 1NWMX 2Y48B 3C4XA 3AA1A 4FZLA 3OBVE 4H63H 3AA7A 1OXZA 5CA0E 1BR1A 4O3WA 4KMCA 4WBOA 2WM9A 2XHEB 2BZBA 2K24A 3E22E 1YS5A 2N2NA 2EHOC 2XTLA 1WYBA 4CXXA 4MFRA 3QK6A 1HS7A 4UVAB 4WW0A 2X66A 3FBZA 3CMLA 2YPVA 1ZHCA 5HAXA 2VK9A 2Q9QA 3UULA 2KDYA 2HH7A 4UELA 4AKMA 1MPFA 2FGRA 3OYZA 2MYSA 2Q9QB 3LK42 2H7OA 2NTYA 4H9QC 4QXHB 1UX5A 2XAJB 4ISTA 2KZ7A 2KINB 3U78A 2CWOA 1IJ5A 3P8CD 7PRNA 4X1KE 4AYMC 4D64A 3I0QA 4YHJA 4KUMB 2DWKA 3N2OA 4MLKA 4LSIA 3R84B 5FMNA 2M06A 4DO0A 3FB2A 2OA5A 3PQUA 3N9NA 2IC6A 1GFQA 1S35A 1BR4A 1MIYA 5LG4A 2XQYA 4H9RC 3HKEE 3VE2A 4GK5E 3ZCIA 3C51A 4ERRA 5JRCB 5DL8A 4E7SA 3BK9A 4L5GA 1QJPA 2V7LA 2CCQA 3ZMUB 2XE5A 4G75A 4C91A 3WI5A 2H7VC 4O3ZA 4RL9A 4AKIA 4MALA 2Y7SA 2D0TA 3N2KE 2IC9A 2LSJA 4IE4A 3H37A 2O4VA 4O3YA 3VY8X 3AA6A 1D1BA 3UPGA 1HXTA 3AA6B 4PUXA 5LGUB 4JLEA 3V5UA 3SZDA 4FESA 3MZKB 4IIJE 4OYJA 5JDHA 2K0LA 2GE4A 3S4UA 2WMOA 3T24A 2VL8A 2WMNA 4KR4A 5DL5A 3P7IA 4U72A 5FY0A 4BA9A 3EMNX 3AAEA 4F6RC 5LXTE 2P9BA 2XTQA 2L9QA 1D0YA 3J9X1 4KP3C 3ZLIA 2NW7A 2PBIA 4FJOA 4PFOA 5HXEA 3J7Yq 3PORA 5FXXA 1YD8G 2E8IA 2X27X 5CA1E 3AAAA 3EDVA 4AZLA 2X9HA 1KNZA 4IE7A 2C5IT 2ZM8A 3PURA 1FEWA 3DA4A 4G76A 3IHRA 2UXNB 5LGNB 3JTYA 4AQFA 4CZZB 2JMKA 4O4UA 5G26A 4PK5A 1WYCA 5FP3A 1MMDA 3HL6A 4HE8A 2Q9QC 4ZHQE 1ZHWA 3HOEA 3POXA 4AFKA 2J1DG 5HWYA 3E08A 2X51A 2M07A 1US7B 1WLXA 3OYXA 4PJNA 2KWIB 4PK4A 2W61A 3VHLA 3ANWA 2XMXA 2XTRA 2JQQA 3CQXC 3ZYMA 3RC8A 4RJWA 4XAXB 4P0AA 1QUUA 2PJQA 3ZYLA 5M4YA 3O0EA 3ZJ1A 1T98A 3VE1A 4EOZB 2NW8A 4GIWA 2ZMAA 1HG2A 4FZMA 3ZMZB 3SOLA 2V7KA 2XE1A 5H6QB 4LSHA 1CUNA 5L3CB 4YJ3E 3RPUA 3ZCJA 3PUSA 2B1EA 3NSGA 3UUNA 3MXZA 5FYMA 4QXCB 5HWXA 3PUAA 4ANJA 4Z8XA 4M1PA 4HTEA 1HFAA 2E9XB 3LBXA 1PHOA 4XNLA 2RA1A 1ZHYA 3IEEA 4AKRA 1MIVA 2IAKA 3SZVA 3QRAA 5ADXK 5EK4A 4IE0A 5FNVE 3NZQA 2CA5A 3N2GE 3JC6C 4UXNB 2ERVA 2ZM2A 1S94A 4TV8E 3FXEB 2NWBA 3GN5A 1E1HB 3FBLA 4YJ2E 2LSKA 2LHRA 3HA4A 4ZI2D 2LHNA 2BVMA 4BAYB 1V9DA 5JR9A 1HCIA 4IHJE 2ODVA 4P09A 1E54A 4RLBA 4UEMA 3N9PA 3UAQA 2ES0A 3A2SX 2Y0LA 3UUMA 3DTOA 5ADXL 3DP7A 3CPZA 4BJNA 4TUYE 1BXWA 1D0XA 3GMIA 3LK3A 2LOPA 5F3JA 1B7TA 3AA1B 2X67A 3KINB 5LYJE 3AA7B 2ZM0A 3KV6A 4AKHA 3AAIA 2GK9A 1QJ9A 3A5XA 3ZMVB 4IE5A 4UVCB 4RJXA 5HXHA 3O4XE 2Z6EA 5J2TE 2DHRA 4D65A 3T20A 4ZI3C 3VY9X 4EIWA 4EXTA 4XBFB 3OJAA 3T8OA 4O4IE 5EK2A 3E0ZA 5FXVA 5JDGA 4AYID 4BUMX 4F4BA 1SA0E 2NTXA 3N9OA 4PJJA 1GFNA 1MM4A 3CX8B 2Y6XA 3LK41 3POUA 3NRXA 4PW8A 2KZ7B 3I0OA 4ZI7E 5EK3A 2KXPA 8PRNA 1O3XA 2C5KT 3ZJ2A 4O49A 2YINA 3EUHA 4EYYR 2CMRA 2YK0A 5FXZA 1YKEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA0 A;  3AA7 B;  5ADX K;  3LK3 B;  3AAE A;  4AKR B;  3AA0 B;  3AAE B;  3AAA A;  3LK4 2;  5AFU L;  3LK2 A;  2KZ7 A;  3AA6 A;  3AAA B;  1IZN A;  3LK2 B;  3AA6 B;  3LK4 1;  5AFU K;  5ADX L;  2KZ7 B;  2KXP A;  3AA1 A;  3AA7 A;  1IZN B;  3LK3 A;  2KXP B;  4AKR A;  3AA1 B; 
#chains in the Genus database with same CATH topology
 4WYV A;  1SHZ C;  4DR7 T;  1BR0 A;  2R4P A;  2E2A A;  2JQ9 A;  4IDP A;  5E0O A;  2XQ8 A;  3SY7 A;  4FI5 A;  3O1H A;  4DR2 T;  4HWI B;  1HF8 A;  5TIS O;  1ORM A;  1HTJ F;  4TWF A;  5JDL A;  5CGM A;  3N9Q A;  2JQH A;  3ZMT B;  3K19 A;  4AYD C;  3NRY A;  3UUX B;  1ZV4 X;  3QC9 A;  3MKD A;  3UTK A;  5FVN A;  2J62 A;  2YKS A;  4B3R T;  3LK2 A;  3ZN1 B;  3PV0 F;  2QA7 A;  4PJM A;  3VU7 H;  4IDZ A;  4IL6 O;  3DJB A;  4JYA T;  4DV7 T;  4IL9 A;  1U5P A;  2KND A;  3ANW B;  5ABE A;  2UUA T;  4X62 T;  3K1S A;  3UFE A;  2F1V A;  5CB4 E;  4UB8 O;  2VKO A;  2K4T A;  2JPF A;  3B5M A;  2JIW A;  5LA6 E;  3FHN A;  3LBX B;  2MNH A;  2H88 A;  2CLY B;  4PFP A;  4B3M T;  2POR A;  3UU2 A;  3PDY A;  3RF1 A;  5AQT B;  2JQY A;  4BJM A;  3PRN A;  4CI3 B;  4GKK T;  4TV9 E;  5JR9 B;  2W2U A;  2R4N A;  2Y2X A;  3K3N A;  2XSB A;  3Q5W A;  3TZG A;  3KV4 A;  3AE5 A;  3LK3 B;  4U33 A;  1Q9F A;  3KBT A;  4AQF C;  2A3D A;  3VKH A;  4N59 A;  5L3E B;  1UK5 A;  1IAP A;  3RI5 A;  4ZI2 C;  3O1I A;  2OMF A;  2BKP A;  1W0A A;  4O2A E;  5ABG A;  3KDS E;  4U2Z A;  2UXC T;  4ASK A;  3AE7 A;  3F31 A;  4QX7 B;  2VUR A;  3VKG A;  3V5S A;  5C3J A;  4EED A;  2W00 A;  5AQN B;  3VRB A;  3I1A A;  1FIO A;  4K0U A;  3AE8 A;  4JBW F;  5PRN A;  5LJM A;  2VWA A;  4G2A A;  2LSI A;  2XE2 A;  1OPF A;  3PGU A;  5AFU K;  2N1G A;  4NUU A;  4QH4 A;  3C50 A;  3PF1 A;  4QXB B;  4LSE A;  1KFY A;  3Q2M A;  4NIQ A;  1KK7 A;  3C4Z A;  2J4U P;  3VZT X;  1FMW A;  5LHI B;  1QJ8 A;  4FQE A;  1N36 T;  1HG5 A;  5LHH B;  3M65 A;  3PTR B;  2WJR A;  3KVD D;  5IYZ E;  3Q9D A;  4JI4 T;  4QHO A;  3GA8 A;  3OTO T;  4I4T E;  3P50 A;  4GCQ A;  5DJQ C;  2WDR A;  2KMF A;  4UF0 B;  4KHZ F;  1OSM A;  3KVB A;  4Z91 A;  3HKC E;  5FVK A;  4DVD A;  2BVL A;  3SWH A;  4XNK A;  4PK6 A;  3EDU A;  3AE4 A;  3EVY A;  4YHH T;  1UCU A;  2CEA A;  4NPP A;  4AKL A;  2I6H A;  5HCM A;  4PNI A;  3CQC B;  5LOV E;  1Q9G A;  3RYF E;  2V7M A;  2FGQ X;  2C0S A;  5L3D B;  2I0M A;  5AQK B;  3JAE A;  3KFW X;  5KMG P;  4DV3 T;  1VCT A;  5TAO A;  5FY1 A;  4OFZ A;  2NOX A;  3RLF F;  3ESL A;  3WAJ A;  5GON E;  3RYC E;  1QSD A;  4JV5 T;  4I0U A;  5LMN T;  1NWM X;  2Y48 B;  3AA7 A;  1BR1 A;  2WM9 A;  2XHE B;  2N2N A;  3CML A;  1ZHC A;  2Q9Q A;  4AKM A;  2WWV A;  5ABF B;  5AQM B;  4AYM C;  4DR6 T;  4YHJ A;  4KUM B;  3P4S A;  5FMN A;  1X9B A;  3FB2 A;  3CK6 A;  3N9N A;  5LG4 A;  3ZCI A;  5F5W A;  5DL8 A;  3BK9 A;  2CCQ A;  2H7V C;  4LF7 T;  2Y7S A;  2OV9 A;  3H37 A;  1XNQ T;  5HEG A;  3TLW A;  2PTF A;  4U31 A;  3RIF A;  4FES A;  3T24 A;  2WMN A;  5DL5 A;  3P7I A;  4BA9 A;  5FY0 A;  3AAE A;  5LXT E;  2XTQ A;  2L9Q A;  3J9X 1;  1YD8 G;  3AAA A;  2X9H A;  4IE7 A;  2C5I T;  3PUR A;  5LGN B;  4CZZ B;  2JMK A;  4PK5 A;  1MMD A;  4HE8 A;  4ZHQ E;  2Q9Q C;  2X51 A;  2CHO A;  2XMX A;  4PK4 A;  2W61 A;  2R4O A;  2JQQ A;  3VR8 A;  2FJD A;  3ZYM A;  3RC8 A;  3JAF A;  1T98 A;  3VE1 A;  4EOZ B;  1GQE A;  1CUN A;  5L3C B;  3RPU A;  4CN4 A;  1XDO A;  4CN1 A;  2B1E A;  3UU5 A;  3Q5E A;  2AXT O;  4QXC B;  4M1P A;  1HFA A;  4K3C A;  1PHO A;  3ONJ A;  4K0K T;  2V6X A;  3N2G E;  3JC6 C;  3QB5 A;  1S94 A;  3FXE B;  4DV2 T;  3OPC A;  3HA4 A;  4DV5 T;  5AQH B;  2W67 A;  4UEM A;  3N9P A;  1IBM T;  4JI8 T;  1D0X A;  3GMI A;  1B7T A;  3AA1 B;  5L4H A;  4QH1 A;  2ZM0 A;  1WFD A;  5J0Z A;  3RIU C;  4UVC B;  4RJX A;  3TLV A;  5J2T E;  3T20 A;  2BS4 A;  1HR0 T;  1UUR A;  4XBF B;  4NXM T;  3T8O A;  3E0Z A;  5JDG A;  4PJJ A;  5HEJ A;  2KXP A;  3I0O A;  5EK3 A;  3EUH A;  2HN1 A;  2CMR A;  2E5L T;  1G73 A;  2W81 C;  1MM5 A;  3ZN0 B;  1MMN A;  2WAU A;  5DQV A;  2WS3 A;  4TN7 B;  2E9X C;  4Z3T A;  2IIU A;  1OED A;  2XM2 A;  4FMS A;  2ACX A;  4ILC A;  5KAI O;  4A98 A;  1JNZ A;  3KVA A;  2ZFG A;  3PQS A;  3I9Y A;  2OLT A;  2BS3 A;  3T0S A;  3R6N A;  3ZC0 A;  4FOZ A;  2BBJ A;  2VKD A;  2DLR A;  5C2T A;  1I6Z A;  4YY3 T;  3NWI A;  4IDN A;  2UUB T;  2XUE A;  4E1T A;  3H3M A;  5LJN A;  2XJ7 A;  4DUZ T;  3O1J A;  3EHZ A;  2CXF A;  5T5F A;  2LM9 A;  2KLQ A;  2LE8 A;  1SUM B;  2BG9 A;  4P1N A;  3FZM B;  5AQR B;  2L8K A;  2AE9 A;  4LSF A;  4EZH A;  3PE0 A;  4LFC T;  2QVA A;  1IZN A;  1LVF A;  4C69 X;  3UU6 A;  4EB6 E;  1ZKE A;  1JNR A;  4C4V A;  5IHY A;  3JC6 D;  4AKR B;  5AQL B;  2XE3 A;  4HWH A;  1UUS A;  4F8H A;  4YFS A;  1N33 T;  3GN5 B;  3L09 A;  4N78 D;  2MOZ A;  3CKD A;  4JFB A;  2M6B A;  2X9Y A;  1MIW A;  4GF4 A;  3KV5 A;  4UIG A;  2ZLD A;  4N74 A;  3WAK A;  3ZMS B;  2X68 A;  6PRN A;  2N2M A;  3IF8 B;  2A2F X;  5JQG E;  2R6G F;  1HNW T;  3RYH E;  4IGU A;  4LFA T;  4YT0 A;  4DID B;  5KDM C;  4DR3 T;  5DL6 A;  4X20 E;  2V7I A;  3RH3 A;  3O9X A;  1BT9 A;  3IBP A;  4ILU A;  3L3P A;  1VOM A;  4GYR A;  3RGL A;  2W62 A;  3NBX X;  3P4P A;  4LF6 T;  2CRB A;  3AA0 B;  5IYU A;  3SY9 A;  5GTH O;  5L3B B;  3HI2 A;  2E9X D;  5GTI O;  3PU8 A;  1THQ A;  3QRC A;  5LBQ B;  4AUI A;  3RBH A;  5BMV E;  4HN9 A;  1H7C A;  2LSY A;  3P4R A;  2J47 A;  3A8Y C;  2XAG B;  4JCH A;  4JUY A;  4A56 A;  5A1L A;  3AEE A;  5JRC A;  2V1D B;  4DR4 T;  3ZYK A;  5LBM A;  5LP6 E;  3N5L A;  4H9O C;  2D5U A;  2IML A;  2LKH A;  3AEG A;  2WWU A;  5JTG A;  1P4T A;  3AB3 B;  4ZS2 A;  2M67 A;  3C4W A;  4IE6 A;  3RQW A;  2R8A A;  2XQ5 A;  2V26 A;  3SYB A;  4ZZC A;  1NAF A;  2XM1 A;  2D2S A;  3HKD E;  3Q5X A;  2W80 C;  1YKH B;  2QTK A;  2MBG A;  2PFV A;  2IWW A;  3QNU A;  3PU3 A;  4FUV A;  5IUX A;  2Y0H A;  5KAF O;  3UQ4 A;  2EHO A;  1G90 A;  4O4H E;  4PJL A;  4NXN T;  3KV9 A;  1HX8 A;  2BKN A;  3UFG A;  3AE9 A;  4WNK A;  3SS1 A;  1D1C A;  3AVS A;  3GP6 A;  2XAQ B;  1W09 A;  5H6R B;  5KX5 E;  2HHH T;  5J1G A;  4KBM B;  5JVD E;  1ZHX A;  5LGT B;  1XWM A;  2XQ7 A;  4D5U A;  4YTP A;  5J2U E;  3UQ7 A;  2SPC A;  3N9L A;  4UR9 A;  3UU8 A;  4COF A;  2XQ6 A;  4KR8 A;  4LFB T;  4B6X A;  3VZU X;  5JDM A;  4QWN B;  2XAS B;  4N75 A;  3BQK A;  2LEH A;  4OYK A;  3B13 A;  4ZI3 D;  4O4X A;  5AQP B;  3SFE A;  4PJ0 O;  2CXD A;  5B66 O;  2K3W A;  4RLC A;  4FZL A;  3OBV E;  5CA0 E;  4O3W A;  3RHW A;  1YS5 A;  2EHO C;  1WYB A;  4CXX A;  4MFR A;  3VR9 A;  3QK6 A;  2X66 A;  3AXJ A;  5HAX A;  4IT4 A;  2Q9Q B;  4H9Q C;  1UX5 A;  2AXD S;  4LML A;  2XAJ B;  2F1C X;  2CWO A;  4D64 A;  3AE1 A;  2OA5 A;  1MIY A;  4H9R C;  3VE2 A;  4GK5 E;  1N34 T;  3C51 A;  2D9D A;  4E7S A;  1QJP A;  4L5G A;  2V7L A;  3ZMU B;  4MAL A;  2UU9 T;  3AA6 A;  1HXT A;  3QOF A;  4PUX A;  1KEY A;  5LGU B;  4JLE A;  3MZK B;  5JDH A;  2WQY A;  2GE4 A;  3S4U A;  2WMO A;  2M6I A;  3EAB A;  2BS2 A;  4F6R C;  2P9B A;  3POR A;  5HXE A;  2PBI A;  2UXB T;  5FXX A;  2X27 X;  4AZL A;  3IHR A;  2UXN B;  3JTY A;  4O4U A;  4LF9 T;  2V6Y B;  4AFK A;  5HCJ A;  1HNZ T;  5B5E O;  1US7 B;  1WLX A;  1Y01 A;  3ANW A;  4ILA A;  4HWD A;  3EAM A;  5FL1 A;  1KNP A;  3ZJ1 A;  1J5E T;  3AEB A;  4CN6 A;  3ZMZ B;  4LSH A;  3PUS A;  3UUN A;  5FYM A;  5HWX A;  4Z8X A;  2E9X B;  3LBX A;  4XNL A;  2RA1 A;  1ZHY A;  1MIV A;  4TWH A;  4IE0 A;  3NZQ A;  5LB7 B;  2FUP A;  5AQG B;  4ZI2 D;  2LSK A;  4JI7 T;  2LHN A;  4X65 T;  2LRK A;  1V9D A;  5JR9 A;  4P09 A;  3UAQ A;  1IBL T;  2IWV A;  2IUB A;  4Z90 A;  5ADX L;  3DP7 A;  3LK3 A;  5LYJ E;  4AKH A;  3ZST A;  1S5L O;  3PUV F;  2Z6E A;  3VY9 X;  4EXT A;  3OJA A;  4O4I E;  5EK2 A;  4AYI D;  1SA0 E;  1GFN A;  1MM4 A;  4CTD A;  2Y6X A;  1WCR A;  1QLB A;  2KZ7 B;  4ZI7 E;  4TNW A;  4O49 A;  4EYY R;  4X1K E;  2LHF A;  3HOL A;  4QH5 A;  4U3C A;  1GFO A;  5LNK A;  2LM2 A;  3LG7 A;  4QQ1 A;  2QYW A;  3HKB E;  4FSO A;  3G7G A;  4TNV A;  1T8B A;  4FT6 A;  2R4L A;  1XMO T;  3RX6 A;  4AI6 A;  3RRW A;  2X0H A;  2WY2 A;  3JCF A;  2LT3 A;  3AEF A;  3T1Y T;  4AKI A;  5HXC A;  5GV0 A;  3AEA A;  4HFC A;  4OX9 T;  3P4Q A;  4QX8 B;  4GHB A;  2WSS V;  2K48 A;  4HEA A;  1YW0 A;  4X1Y E;  3A0H O;  5JDP A;  4C00 A;  4AKG A;  1E7P A;  2DNX A;  1HXU A;  3L39 A;  4JEU B;  4CXY A;  3CX6 B;  5LCY A;  2FJE A;  4I55 E;  3QB5 K;  4UF0 A;  4DR1 T;  2WVP A;  4EEB A;  2XQA A;  4B61 A;  1IZN B;  1HXX A;  2CPT A;  2JMM A;  1AJ3 A;  4YTM A;  2VL0 A;  4P0B A;  1OWA A;  2HN2 A;  4H9S E;  1NEK A;  4V1A v;  2A72 A;  5ABH A;  3PUQ A;  4XZC A;  3CX7 B;  2ODU A;  4N58 A;  3K3Q C;  1HX1 B;  2DI4 A;  3C64 A;  5JDF A;  5AQQ B;  4A97 A;  2H3R A;  4B3S T;  1ZHZ A;  4O2B E;  2XZE A;  2UXX B;  4LMJ A;  1T7S A;  1GFM A;  2CE7 A;  3ONX A;  3TLT A;  2KT9 A;  2LOS A;  2QRX A;  3PGR A;  3LDQ B;  3RQU A;  2VVS A;  2YU1 A;  3LSV A;  4GYS A;  2WBL A;  4EV6 A;  1FMV A;  4JI1 T;  5DL7 A;  4EYU A;  2HPJ A;  2KC0 A;  4X66 T;  1U4Q A;  3TKL B;  3BS0 A;  2DL1 A;  2F1T A;  3CWZ B;  2FBW A;  4IDO A;  5EE2 A;  4ZXL A;  1G8X A;  5ABF A;  1MMG A;  1LRZ A;  4YLH A;  4L0R A;  4WZX A;  3UT5 E;  2ZLY A;  1ZHT A;  4I50 E;  2L3L A;  2W63 A;  4UV8 B;  4L9I A;  3ETU A;  4PAG A;  3PUY F;  3PUG A;  4EZ4 A;  2WU5 A;  4OK0 A;  4C90 A;  5G3A A;  5L3F B;  3BQL A;  2QGS A;  1BH3 A;  1DU2 A;  3MK7 C;  3F2E A;  2NW9 A;  3V8U A;  1KNR A;  2Y0K A;  4TX5 A;  3LK2 B;  3K3O A;  2KWH A;  2Q9Q D;  3N9M A;  2W0G A;  2RPA A;  2WB5 A;  2B76 A;  4JEH B;  1LKX A;  4H9N C;  4CI1 B;  3HR0 A;  4MHC A;  4GCP A;  3M3Z B;  3ZC1 A;  1MMA A;  2IW5 B;  1IJ6 A;  1UX4 A;  5AQO B;  1XMQ T;  2EHO B;  2UUC T;  5ETW A;  4KRA A;  4FSP A;  4AYE C;  1OED C;  2V7J A;  1FJG T;  2XSA A;  2N9D A;  1XDP A;  3U3I A;  4CQI A;  2DWG A;  4LF5 T;  4UB6 O;  2XAF B;  1ZEE A;  4IRE A;  3JCU O;  3SYS A;  5JDN A;  3AVR A;  3OVU A;  5FKY A;  2X0L B;  5JH7 E;  5EZY E;  1WRD A;  5L2L A;  4J2C A;  3H3A A;  1Z0P A;  1Z8U A;  2NP9 A;  3C98 B;  4AXP A;  3MJX A;  3NZP A;  5LHG B;  3RIA A;  4EAH A;  3ZPO A;  2FJA A;  4A5X A;  4GCS A;  1IBK T;  3C4X A;  3AA1 A;  4H63 H;  1OXZ A;  2XPK A;  2BKO A;  1N32 T;  4KMC A;  2BG9 C;  2BZB A;  2K24 A;  2XTL A;  1HS7 A;  3FBZ A;  5AQS B;  2VK9 A;  3UUL A;  2FGR A;  2MYS A;  2NTY A;  4QXH B;  4IST A;  2KIN B;  1IJ5 A;  3I0Q A;  2ACZ A;  2DWK A;  4MLK A;  4LSI A;  4PR7 A;  4DUY T;  2A9U A;  4DO0 A;  1YQ4 A;  3BRY A;  3PQU A;  2IC6 A;  4LF4 T;  1GFQ A;  2CBI A;  1BR4 A;  1M62 A;  3HKE E;  3ABV A;  3L8R A;  4AQY T;  3WI5 A;  4C91 A;  4O3Z A;  3AE6 A;  5H2F O;  2IC9 A;  4IE4 A;  4K3B A;  5G38 A;  1D1B A;  4YTN A;  3UPG A;  3AA6 B;  3V5U A;  3SZD A;  4IIJ E;  1J1J A;  2BBH A;  3ZSS A;  3EMN X;  4JI6 T;  4KP3 C;  2NW7 A;  4FJO A;  2ZM6 T;  4PFO A;  2E8I A;  3ONL C;  5LMU T;  3DA4 A;  2NR4 A;  1FEW A;  1YXR A;  4G76 A;  4AQF A;  4DV6 T;  1WYC A;  4JI0 T;  3HL6 A;  3NJT A;  1ZHW A;  5HWY A;  3E08 A;  5L4E A;  3VHL A;  3OYX A;  4PJN A;  2KWI B;  2LKG A;  2XTR A;  3CQX C;  2XQ3 A;  3G06 A;  2PJQ A;  3ZYL A;  4GIW A;  2ZMA A;  1HG2 A;  4FZM A;  3SOL A;  2XE1 A;  5H6Q B;  2CHN A;  3NSG A;  4X64 T;  3PUA A;  4AKR A;  3IEE A;  5ADX K;  5EK4 A;  4UXN B;  3AE3 A;  2ZM2 A;  1KF6 A;  2NWB A;  3GN5 A;  1E1H B;  2LHR A;  4BAY B;  5AQF B;  1HCI A;  4RLB A;  1E54 A;  3A2S X;  3DTO A;  5AQV B;  1L0V A;  4BJN A;  4TUY E;  2H89 A;  1HNX T;  3DZM A;  3KIN B;  3AA7 B;  3AAI A;  1QJ9 A;  3A5X A;  3ZMV B;  4IE5 A;  5L47 A;  3NKZ A;  5HXH A;  3O4X E;  4D65 A;  3ZT6 A;  5FXV A;  4F4B A;  4BUM X;  1T72 A;  1ZOY A;  3POU A;  3NRX A;  3ZT5 A;  8PRN A;  3ZJ2 A;  2C5K T;  2YIN A;  3AA0 A;  4AQG A;  2W66 A;  4H63 V;  4ZOL E;  2WZI A;  2G0U A;  4O4L E;  4DV4 T;  2YDQ A;  4I43 B;  3ZT7 A;  4ZZB A;  4G63 A;  1T1L A;  3SRZ A;  1MND A;  1R8I A;  3WU2 O;  3A7M A;  3CVR A;  3F57 A;  4U9C A;  1M7K A;  2YNK A;  2PRN A;  3P4W A;  4MBQ A;  2IDO B;  2CM0 A;  4IDQ A;  3I9W A;  4DMV A;  4H9P C;  3ZEF B;  3MAC A;  4UV9 B;  5CJ5 A;  3AAE B;  5JDQ A;  4DV1 T;  4HFD A;  4ADZ A;  3WI3 A;  3HW9 A;  3AAA B;  2I59 A;  3RYI E;  2V5C A;  2JMH A;  3PUZ F;  4O3X B;  4CXW A;  3IA3 A;  5DQW A;  5HXR A;  2YOE A;  5KXJ A;  4U74 A;  1D1A A;  4E7Z A;  3QUJ A;  5L3G B;  3VZW X;  3BRZ A;  5AQJ B;  2MTQ A;  3FZF B;  4TZ4 C;  3HWB A;  1Y64 B;  4FRX A;  5C8Y E;  3POQ A;  2LJL A;  3W15 B;  1XNR T;  2JRK A;  3MA9 A;  2VAS A;  4HFV A;  2CXL A;  4E1S A;  2RP4 A;  4ILB A;  2MAW A;  4KX6 A;  4HKA A;  3X1D A;  4X5T A;  2LSG A;  5FY7 A;  3CQG B;  3GWH A;  3FXD B;  2VB6 A;  4TWD A;  1J5W A;  4NUV A;  4DND A;  2YDS A;  3TLS A;  2WU2 A;  4AYN A;  1ZP0 A;  2JJ9 A;  3LJC A;  4DMW A;  2EHO D;  2J1N A;  2E5V A;  2DCF A;  4DV0 T;  2IHR 1;  1D0Z A;  2PG8 A;  1X79 A;  4U7Y A;  3AED A;  1NEN A;  1VRB A;  1E2A A;  3SFD A;  3KBU A;  3AEC A;  1UGO A;  1H6S 1;  1W0B A;  3OKQ A;  2V8S V;  4OHF A;  4ISS A;  4HGA A;  3WI4 A;  2KXP B;  5JRE A;  4YSY A;  4DBR A;  1T16 A;  4HFB A;  2LFU A;  4O8S A;  2X9W A;  1WR6 A;  5D5D A;  3A0B O;  1OED B;  2CLY C;  3EI0 A;  2YN6 A;  4DBQ A;  2CWY A;  2VKJ A;  1BR2 A;  3D0T A;  3RC3 A;  2X9X A;  1LVK A;  2UXD T;  2X9K A;  5JR9 C;  5HXS A;  2Y8D A;  1CHU A;  1XZY A;  2WCA A;  4B3T T;  3ETV A;  5AFU L;  3PUX F;  5HYA A;  3FZL B;  4JI5 T;  5LG3 A;  4HFH A;  4FZN A;  4HFE A;  1YQ3 A;  2VQE T;  2ODJ A;  2D0U A;  2XAH B;  2W4X A;  3RRC A;  1WR0 A;  3RKG A;  4CI2 B;  3DWN A;  4UVB B;  4HWF A;  1W9R A;  2YEV C;  2HPL A;  5G39 A;  4GOU A;  2V6Y A;  5HEH A;  2XQ4 A;  2BG9 B;  3RIU A;  3JAD A;  2VKH A;  1EZ3 A;  4O4J E;  4QKN A;  2MHL A;  3RKO A;  3FYX A;  4LF8 T;  2YDR A;  5DAB A;  4C4V B;  3K8P C;  4GK0 E;  2JQK A;  3UUB A;  1MNE A;  5F8P A;  4JI2 T;  2C5J A;  3BQI A;  4X1I E;  1GFP A;  2E9X A;  2XG6 A;  2BDE A;  2K5B B;  3C5O A;  4FRT A;  4GKJ T;  2N2L A;  3PJA A;  2WP9 A;  3FZH B;  2J4G A;  4ZS3 A;  4WBN E;  4YSZ A;  4AIU A;  3DA3 A;  5FXW A;  3PUW F;  3B57 A;  2VVN A;  2XQ9 A;  1PRN A;  2YU2 A;  2LLY A;  2K9A A;  1OED E;  2R89 A;  3KZI O;  3LFM A;  5IWA T;  4WBO A;  3E22 E;  3AE2 A;  4UVA B;  4WW0 A;  5AQU B;  2YPV A;  2XY8 B;  2KDY A;  2HH7 A;  4UEL A;  2VQF T;  1MPF A;  3OYZ A;  3LK4 2;  2H7O A;  2KZ7 A;  3U78 A;  3DWO X;  7PRN A;  3P8C D;  4IL4 A;  1SE7 A;  5CFB A;  3N2O A;  4JI3 T;  3R84 B;  5FVL A;  2M06 A;  1S35 A;  2XQY A;  4KHP T;  2R88 A;  4ERR A;  3PJA J;  5JRC B;  2XE5 A;  4G75 A;  4RL9 A;  2D0T A;  3N2K E;  2LSJ A;  2MPK A;  2O4V A;  4O3Y A;  3VY8 X;  3PGS A;  4EGW A;  2BG9 E;  2F4V T;  4OYJ A;  2K0L A;  4U7I A;  2VL8 A;  4KR4 A;  4YSX A;  3VRA A;  4U72 A;  1VCS A;  3UU4 A;  1D0Y A;  4U2Y A;  3ZLI A;  3J7Y q;  5CA1 E;  3EDV A;  1KNZ A;  2ZM8 A;  4DR5 T;  5G26 A;  4YXD A;  5FP3 A;  3HOE A;  3POX A;  3CIR A;  2J1D G;  2M07 A;  4AIS A;  2WDV A;  4KI0 F;  4RJW A;  4XAX B;  4P0A A;  1QUU A;  3Q5D A;  5M4Y A;  3O0E A;  5HEU A;  2WJQ A;  5HEO A;  4LMK A;  3ZKR A;  2NW8 A;  2V7K A;  3NVO A;  5E79 O;  4YJ3 E;  3TLU A;  3ZCJ A;  3MXZ A;  4ANJ A;  4HTE A;  5BR8 T;  2IAK A;  2KSR A;  3SZV A;  3QRA A;  4HFI A;  5FNV E;  2CA5 A;  4ZEY A;  5FL0 A;  2ERV A;  4TV8 E;  3FBL A;  4YJ2 E;  2BVM A;  4IHJ E;  2ODV A;  2ES0 A;  2Y0L A;  3UUM A;  2FJB A;  3CPZ A;  1BXW A;  2CBJ A;  2WDQ A;  2LOP A;  5F3J A;  4HWC A;  2X67 A;  3T1H T;  3KV6 A;  3UU3 A;  2GK9 A;  2V5D A;  2DHR A;  4ZI3 C;  4EIW A;  2X0Y A;  3AXJ B;  2LRL A;  2NTX A;  3N9O A;  4Q25 A;  3CX8 B;  3LK4 1;  4PW8 A;  3FZK B;  5AQI B;  1I94 T;  1O3X A;  2WZH A;  2YK0 A;  5FXZ A;  1YKE B; 
#chains in the Genus database with same CATH homology
 1G73 A;  3AA0 A;  4AQG A;  2LHF A;  2W81 C;  4H63 V;  3HOL A;  1MM5 A;  3ZN0 B;  1MMN A;  2WAU A;  5DQV A;  4ZOL E;  1GFO A;  1SHZ C;  1BR0 A;  5LNK A;  4TN7 B;  2E9X C;  2G0U A;  4Z3T A;  4O4L E;  3LG7 A;  4I43 B;  4QQ1 A;  4FMS A;  2ACX A;  5E0O A;  3SY7 A;  4FI5 A;  4G63 A;  3O1H A;  3HKB E;  3KVA A;  4FSO A;  2ZFG A;  1HF8 A;  3SRZ A;  3G7G A;  3PQS A;  1MND A;  3I9Y A;  4FT6 A;  3CVR A;  3F57 A;  4U9C A;  1ORM A;  1HTJ F;  3RX6 A;  4AI6 A;  5JDL A;  2YNK A;  2PRN A;  3T0S A;  3N9Q A;  4MBQ A;  3RRW A;  3R6N A;  3ZC0 A;  3ZMT B;  3K19 A;  4AYD C;  2CM0 A;  3I9W A;  4FOZ A;  3NRY A;  4DMV A;  4H9P C;  3UUX B;  2LT3 A;  1ZV4 X;  3MAC A;  3QC9 A;  3ZEF B;  3MKD A;  2VKD A;  2DLR A;  4UV9 B;  3AAE B;  5HXC A;  3UTK A;  5GV0 A;  5JDQ A;  5FVN A;  4QX8 B;  3LK2 A;  4ADZ A;  3WI3 A;  3HW9 A;  4GHB A;  3AAA B;  3ZN1 B;  2I59 A;  2WSS V;  2K48 A;  3RYI E;  4HEA A;  2QA7 A;  4PJM A;  3VU7 H;  2JMH A;  1YW0 A;  2XUE A;  4IDZ A;  4X1Y E;  4O3X B;  4E1T A;  5JDP A;  5LJN A;  3DJB A;  4CXW A;  4AKG A;  1HXU A;  2DNX A;  4JEU B;  4CXY A;  3O1J A;  1U5P A;  2KND A;  2CXF A;  5DQW A;  5T5F A;  5HXR A;  3CX6 B;  3ANW B;  4U74 A;  1D1A A;  5LCY A;  4E7Z A;  2LM9 A;  2KLQ A;  4I55 E;  2LE8 A;  3QUJ A;  4UF0 A;  5L3G B;  3VZW X;  2L8K A;  4LSF A;  2MTQ A;  4EZH A;  4B61 A;  3PE0 A;  4TZ4 C;  3HWB A;  1IZN A;  1Y64 B;  1LVF A;  3UFE A;  2F1V A;  5CB4 E;  4FRX A;  4C69 X;  2VKO A;  1IZN B;  1HXX A;  2JMM A;  2K4T A;  5C8Y E;  2JPF A;  3POQ A;  2LJL A;  3W15 B;  4EB6 E;  1AJ3 A;  5LA6 E;  4P0B A;  3FHN A;  1ZKE A;  1OWA A;  2JRK A;  3MA9 A;  4H9S E;  5IHY A;  2VAS A;  4V1A v;  4HFV A;  3JC6 D;  3LBX B;  2MNH A;  2A72 A;  4AKR B;  2CXL A;  4E1S A;  2RP4 A;  2XE3 A;  2CLY B;  3PUQ A;  4PFP A;  4XZC A;  2POR A;  3CX7 B;  3UU2 A;  3PDY A;  4HKA A;  2ODU A;  4YFS A;  4N58 A;  3K3Q C;  4BJM A;  3GN5 B;  2DI4 A;  3C64 A;  3PRN A;  2LSG A;  3L09 A;  5FY7 A;  3CQG B;  3GWH A;  4N78 D;  5JDF A;  4CI3 B;  2MOZ A;  3CKD A;  4TV9 E;  3FXD B;  2VB6 A;  4JFB A;  5JR9 B;  4NUV A;  2Y2X A;  4DND A;  2H3R A;  2X9Y A;  1MIW A;  4GF4 A;  1ZHZ A;  3K3N A;  3KV5 A;  4O2B E;  3Q5W A;  3TZG A;  2UXX B;  3LJC A;  2JJ9 A;  3KV4 A;  4UIG A;  4AYN A;  1GFM A;  3LK3 B;  4DMW A;  2CE7 A;  3ONX A;  1Q9F A;  2ZLD A;  2EHO D;  3KBT A;  3WAK A;  2KT9 A;  2A3D A;  3ZMS B;  4AQF C;  2DCF A;  3VKH A;  2J1N A;  4N59 A;  5L3E B;  2LOS A;  1D0Z A;  1IAP A;  2PG8 A;  1X79 A;  4ZI2 C;  2X68 A;  3O1I A;  6PRN A;  2OMF A;  2N2M A;  3IF8 B;  2A2F X;  5JQG E;  2YU1 A;  1VRB A;  4O2A E;  3KBU A;  3KDS E;  4GYS A;  3RYH E;  2WBL A;  4IGU A;  4ASK A;  1H6S 1;  1FMV A;  3OKQ A;  5KDM C;  5DL7 A;  5DL6 A;  4EYU A;  4OHF A;  4ISS A;  2V7I A;  4HGA A;  4X20 E;  3RH3 A;  2HPJ A;  3O9X A;  2KC0 A;  2KXP B;  3F31 A;  3WI4 A;  1BT9 A;  5JRE A;  1U4Q A;  4QX7 B;  3TKL B;  3IBP A;  4ILU A;  3L3P A;  4DBR A;  2F1T A;  1VOM A;  4GYR A;  3CWZ B;  3VKG A;  5EE2 A;  2W62 A;  3NBX X;  3V5S A;  3AA0 B;  5IYU A;  1G8X A;  2W00 A;  3SY9 A;  5L3B B;  3HI2 A;  2E9X D;  3I1A A;  1MMG A;  2LFU A;  1LRZ A;  4O8S A;  1FIO A;  3PU8 A;  2X9W A;  4K0U A;  1WR6 A;  4L0R A;  4YLH A;  1THQ A;  5PRN A;  3QRC A;  5LBQ B;  5LJM A;  4AUI A;  5D5D A;  2VWA A;  3UT5 E;  2ZLY A;  4G2A A;  2LSI A;  3RBH A;  5BMV E;  1ZHT A;  2XE2 A;  4I50 E;  4HN9 A;  1H7C A;  2CLY C;  2L3L A;  2W63 A;  2LSY A;  1OPF A;  4DBQ A;  5AFU K;  2CWY A;  2VKJ A;  4UV8 B;  1BR2 A;  3D0T A;  2XAG B;  2N1G A;  4L9I A;  3RC3 A;  2X9X A;  3ETU A;  4JUY A;  4JCH A;  1LVK A;  4A56 A;  5A1L A;  4PAG A;  3PUG A;  4EZ4 A;  5JRC A;  4NUU A;  3C50 A;  2V1D B;  5JR9 C;  5HXS A;  2Y8D A;  3ZYK A;  5LBM A;  4OK0 A;  5LP6 E;  4QXB B;  4C90 A;  4LSE A;  5L3F B;  3N5L A;  3BQL A;  2QGS A;  4H9O C;  1BH3 A;  3Q2M A;  2D5U A;  1KK7 A;  3ETV A;  5AFU L;  5HYA A;  3C4Z A;  2J4U P;  2WWU A;  3MK7 C;  3VZT X;  1FMW A;  5LHI B;  1QJ8 A;  1P4T A;  3F2E A;  3AB3 B;  4FZN A;  2NW9 A;  4ZS2 A;  3V8U A;  2Y0K A;  1HG5 A;  4TX5 A;  2M67 A;  3LK2 B;  2ODJ A;  3K3O A;  5LHH B;  3C4W A;  4IE6 A;  2D0U A;  2KWH A;  2Q9Q D;  3N9M A;  2XAH B;  3M65 A;  3PTR B;  2W0G A;  2V26 A;  3SYB A;  3RRC A;  1NAF A;  2D2S A;  3KVD D;  4JEH B;  3HKD E;  5IYZ E;  3Q9D A;  4CI2 B;  1LKX A;  4H9N C;  4QHO A;  4CI1 B;  3Q5X A;  2W80 C;  1YKH B;  3HR0 A;  4UVB B;  3GA8 A;  2QTK A;  4MHC A;  4I4T E;  2MBG A;  4GCP A;  4GCQ A;  2PFV A;  3PU3 A;  4FUV A;  5DJQ C;  2YEV C;  2HPL A;  3ZC1 A;  1MMA A;  2IW5 B;  2Y0H A;  1IJ6 A;  2KMF A;  4GOU A;  1UX4 A;  4UF0 B;  2EHO A;  1OSM A;  4O4H E;  3KVB A;  1G90 A;  2VKH A;  4PJL A;  2EHO B;  3HKC E;  5ETW A;  3KV9 A;  1EZ3 A;  1HX8 A;  4O4J E;  4KRA A;  4FSP A;  4QKN A;  2BVL A;  4DVD A;  3SWH A;  2MHL A;  2V7J A;  4AYE C;  4WNK A;  3SS1 A;  1D1C A;  4XNK A;  4PK6 A;  3EDU A;  3RKO A;  2N9D A;  3AVS A;  3FYX A;  3GP6 A;  3EVY A;  2XAQ B;  1UCU A;  2CEA A;  5H6R B;  5DAB A;  3U3I A;  3K8P C;  4AKL A;  4GK0 E;  2DWG A;  4CQI A;  5KX5 E;  5J1G A;  4KBM B;  5JVD E;  1ZHX A;  2XAF B;  5LGT B;  4PNI A;  3CQC B;  1ZEE A;  5LOV E;  1Q9G A;  1MNE A;  5F8P A;  2C5J A;  3RYF E;  3BQI A;  3SYS A;  2V7M A;  5JDN A;  4X1I E;  3AVR A;  5J2U E;  1GFP A;  2FGQ X;  4D5U A;  2E9X A;  2XG6 A;  2SPC A;  2C0S A;  3N9L A;  5L3D B;  2BDE A;  2K5B B;  2X0L B;  5JH7 E;  5EZY E;  3C5O A;  1WRD A;  4FRT A;  2N2L A;  5L2L A;  3KFW X;  4J2C A;  4KR8 A;  3H3A A;  1Z0P A;  4B6X A;  3VZU X;  5JDM A;  4ZS3 A;  4WBN E;  3DA3 A;  5KMG P;  2NP9 A;  4QWN B;  5FXW A;  3C98 B;  4AXP A;  2XAS B;  3MJX A;  3BQK A;  3NZP A;  2LEH A;  5TAO A;  3B57 A;  4OYK A;  5FY1 A;  5LHG B;  3B13 A;  4OFZ A;  4ZI3 D;  4O4X A;  2NOX A;  4EAH A;  3ESL A;  3WAJ A;  1PRN A;  5GON E;  3ZPO A;  2CXD A;  3RYC E;  1QSD A;  2YU2 A;  2K9A A;  3LFM A;  4RLC A;  4GCS A;  1NWM X;  2Y48 B;  3C4X A;  3AA1 A;  4FZL A;  3OBV E;  4H63 H;  3AA7 A;  1OXZ A;  5CA0 E;  1BR1 A;  4O3W A;  4KMC A;  4WBO A;  2WM9 A;  2XHE B;  2BZB A;  2K24 A;  3E22 E;  1YS5 A;  2N2N A;  2EHO C;  2XTL A;  1WYB A;  4CXX A;  4MFR A;  3QK6 A;  1HS7 A;  4UVA B;  4WW0 A;  2X66 A;  3FBZ A;  3CML A;  2YPV A;  1ZHC A;  5HAX A;  2VK9 A;  2Q9Q A;  3UUL A;  2KDY A;  2HH7 A;  4UEL A;  4AKM A;  1MPF A;  2FGR A;  3OYZ A;  2MYS A;  2Q9Q B;  3LK4 2;  2H7O A;  2NTY A;  4H9Q C;  4QXH B;  1UX5 A;  2XAJ B;  4IST A;  2KZ7 A;  2KIN B;  3U78 A;  2CWO A;  1IJ5 A;  3P8C D;  7PRN A;  4X1K E;  4AYM C;  4D64 A;  3I0Q A;  4YHJ A;  4KUM B;  2DWK A;  3N2O A;  4MLK A;  4LSI A;  3R84 B;  5FMN A;  2M06 A;  4DO0 A;  3FB2 A;  2OA5 A;  3PQU A;  3N9N A;  2IC6 A;  1GFQ A;  1S35 A;  1BR4 A;  1MIY A;  5LG4 A;  2XQY A;  4H9R C;  3HKE E;  3VE2 A;  4GK5 E;  3ZCI A;  3C51 A;  4ERR A;  5JRC B;  5DL8 A;  4E7S A;  3BK9 A;  4L5G A;  1QJP A;  2V7L A;  2CCQ A;  3ZMU B;  2XE5 A;  4G75 A;  4C91 A;  3WI5 A;  2H7V C;  4O3Z A;  4RL9 A;  4AKI A;  4MAL A;  2Y7S A;  2D0T A;  3N2K E;  2IC9 A;  2LSJ A;  4IE4 A;  3H37 A;  2O4V A;  4O3Y A;  3VY8 X;  3AA6 A;  1D1B A;  3UPG A;  1HXT A;  3AA6 B;  4PUX A;  5LGU B;  4JLE A;  3V5U A;  3SZD A;  4FES A;  3MZK B;  4IIJ E;  4OYJ A;  5JDH A;  2K0L A;  2GE4 A;  3S4U A;  2WMO A;  3T24 A;  2VL8 A;  2WMN A;  4KR4 A;  5DL5 A;  3P7I A;  4U72 A;  5FY0 A;  4BA9 A;  3EMN X;  3AAE A;  4F6R C;  5LXT E;  2P9B A;  2XTQ A;  2L9Q A;  1D0Y A;  3J9X 1;  4KP3 C;  3ZLI A;  2NW7 A;  2PBI A;  4FJO A;  4PFO A;  5HXE A;  3J7Y q;  3POR A;  5FXX A;  1YD8 G;  2E8I A;  2X27 X;  5CA1 E;  3AAA A;  3EDV A;  4AZL A;  2X9H A;  1KNZ A;  4IE7 A;  2C5I T;  2ZM8 A;  3PUR A;  1FEW A;  3DA4 A;  4G76 A;  3IHR A;  2UXN B;  5LGN B;  3JTY A;  4AQF A;  4CZZ B;  2JMK A;  4O4U A;  5G26 A;  4PK5 A;  1WYC A;  5FP3 A;  1MMD A;  3HL6 A;  4HE8 A;  2Q9Q C;  4ZHQ E;  1ZHW A;  3HOE A;  3POX A;  4AFK A;  2J1D G;  5HWY A;  3E08 A;  2X51 A;  2M07 A;  1US7 B;  1WLX A;  3OYX A;  4PJN A;  2KWI B;  4PK4 A;  2W61 A;  3VHL A;  3ANW A;  2XMX A;  2XTR A;  2JQQ A;  3CQX C;  3ZYM A;  3RC8 A;  4RJW A;  4XAX B;  4P0A A;  1QUU A;  2PJQ A;  3ZYL A;  5M4Y A;  3O0E A;  3ZJ1 A;  1T98 A;  3VE1 A;  4EOZ B;  2NW8 A;  4GIW A;  2ZMA A;  1HG2 A;  4FZM A;  3ZMZ B;  3SOL A;  2V7K A;  2XE1 A;  5H6Q B;  4LSH A;  1CUN A;  5L3C B;  4YJ3 E;  3RPU A;  3ZCJ A;  3PUS A;  2B1E A;  3NSG A;  3UUN A;  3MXZ A;  5FYM A;  4QXC B;  5HWX A;  3PUA A;  4ANJ A;  4Z8X A;  4M1P A;  4HTE A;  1HFA A;  2E9X B;  3LBX A;  1PHO A;  4XNL A;  2RA1 A;  1ZHY A;  3IEE A;  4AKR A;  1MIV A;  2IAK A;  3SZV A;  3QRA A;  5ADX K;  5EK4 A;  4IE0 A;  5FNV E;  3NZQ A;  2CA5 A;  3N2G E;  3JC6 C;  4UXN B;  2ERV A;  2ZM2 A;  1S94 A;  4TV8 E;  3FXE B;  2NWB A;  3GN5 A;  1E1H B;  3FBL A;  4YJ2 E;  2LSK A;  2LHR A;  3HA4 A;  4ZI2 D;  2LHN A;  2BVM A;  4BAY B;  1V9D A;  5JR9 A;  1HCI A;  4IHJ E;  2ODV A;  4P09 A;  1E54 A;  4RLB A;  4UEM A;  3N9P A;  3UAQ A;  2ES0 A;  3A2S X;  2Y0L A;  3UUM A;  3DTO A;  5ADX L;  3DP7 A;  3CPZ A;  4BJN A;  4TUY E;  1BXW A;  1D0X A;  3GMI A;  3LK3 A;  2LOP A;  5F3J A;  1B7T A;  3AA1 B;  2X67 A;  3KIN B;  5LYJ E;  3AA7 B;  2ZM0 A;  3KV6 A;  4AKH A;  3AAI A;  2GK9 A;  1QJ9 A;  3A5X A;  3ZMV B;  4IE5 A;  4UVC B;  4RJX A;  5HXH A;  3O4X E;  2Z6E A;  5J2T E;  2DHR A;  4D65 A;  3T20 A;  4ZI3 C;  3VY9 X;  4EIW A;  4EXT A;  4XBF B;  3OJA A;  3T8O A;  4O4I E;  5EK2 A;  3E0Z A;  5FXV A;  5JDG A;  4AYI D;  4BUM X;  4F4B A;  1SA0 E;  2NTX A;  3N9O A;  4PJJ A;  1GFN A;  1MM4 A;  3CX8 B;  2Y6X A;  3LK4 1;  3POU A;  3NRX A;  4PW8 A;  2KZ7 B;  3I0O A;  4ZI7 E;  5EK3 A;  2KXP A;  8PRN A;  1O3X A;  2C5K T;  3ZJ2 A;  4O49 A;  2YIN A;  3EUH A;  4EYY R;  2CMR A;  2YK0 A;  5FXZ A;  1YKE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...