3AAAB

Crystal structure of actin capping protein in complex with v-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 82
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaaB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaaB02
3LK2A 3LK2B 3AA0A 5AFUL 3AA0B 2KZ7A 1IZNA 2KZ7B 5ADXL 3AAEA 1IZNB 3AAEB 3AA7A 3AAAA 3AA7B 3LK41 5AFUK 3AAAB 3AA1A 2KXPA 3AA1B 2KXPB 3LK3A 3LK3B 4AKRA 5ADXK 3AA6A 3LK42 4AKRB 3AA6B
chains in the Genus database with same CATH superfamily
3X1DA 3MA9A 5L3BB 4PJ0O 5F3JA 3RKGA 2X9XA 3CK6A 4AQFC 3B5MA 1QSDA 5AQFB 3ANWB 1GFMA 2X9KA 4AKIA 5JREA 1H7CA 2XY8B 1BH3A 5IWAT 3ONXA 4H9OC 5LGNB 2V1DB 1MMDA 2DNXA 3U78A 3SY7A 1YS5A 4LF8T 2LRKA 3MK7C 2WMOA 4I4TE 3Q5DA 1UCUA 2KWHA 2C5JA 4X5TA 5JRCA 2F1CX 4QQ1A 4UVAB 5EK3A 3RIUC 4JFBA 4BJNA 3JCUO 4PW8A 1HNZT 3R6NA 3UFGA 3P4SA 3BQLA 4J2CA 5AQIB 5GTIO 3RBHA 3UQ7A 1XWMA 4Z91A 2UUCT 2ACZA 3AB3B 2YU2A 3NWIA 5L2LA 5L3DB 5DQWA 4ILBA 5AFUK 4UXNB 4ASKA 2H88A 1BR4A 4U72A 5JDMA 2BS2A 2WDRA 3SZDA 2X0LB 2BKOA 5LBQB 3VE2A 5J2UE 5LJNA 4DMWA 5EK2A 2IAKA 2LT3A 1UUSA 2JQHA 4YXDA 4DV5T 4ANJA 3JADA 1MIWA 1Z0PA 2LHRA 1MM4A 3KINB 4RJXA 2E9XA 4CN4A 2IHR1 2Q9QD 2R4PA 4AYEC 3L09A 1MMAA 3L8RA 4UVCB 4JBWF 4HWHA 4U3CA 2JMMA 2LHNA 4ZI2C 4LSHA 2CXFA 2ZMAA 2FJEA 4RLCA 4IDNA 4G63A 3ZMTB 3MACA 3ZJ1A 3OYZA 2YU1A 3PJAA 3ETUA 5LMUT 3ZSTA 4F6RC 2WQYA 4DO0A 4U9CA 4IL9A 3DP7A 3AA0A 4ZZBA 1XDOA 1MPFA 3FB2A 3JC6D 3KVDD 3FBZA 1JNRA 2X51A 3EVYA 3PGRA 2KLQA 4K3BA 1XMOT 3AE6A 5L3FB 3ZSSA 2CCQA 4KHPT 2CLYB 3ZMSB 2LHFA 3RI5A 2MHLA 4IGUA 4DBRA 2M67A 3NRYA 1MMNA 4DR7T 3ZMZB 1IJ6A 5D5DA 4G2AA 2K5BB 4EZHA 4OHFA 3MZKB 4HEAA 4WBNE 4KR8A 2V8SV 2ZFGA 4KBMB 1L0VA 2YOEA 3JTYA 2CM0A 3PF1A 1BR2A 2QTKA 3KV6A 4KR4A 3AE1A 1V9DA 2LSIA 4HFVA 2LM2A 2QYWA 3LBXA 3FZKB 2CLYC 2BVMA 3CQXC 5L3EB 2ODJA 1U5PA 5J1GA 3NJTA 1AJ3A 2C5IT 5IYZE 2GE4A 5CB4E 5HEGA 1M62A 4JI7T 3KFWX 2Q9QA 2WP9A 1OEDA 4UB8O 5JDGA 2XQ9A 3EAMA 4IE6A 3UQ4A 2VURA 5DQVA 3PUWF 4HFBA 3UUNA 2DHRA 5C3JA 1I6ZA 4GK0E 2MAWA 2X0YA 3K19A 1UGOA 4BUMX 3T1YT 5ADXK 2CEAA 3FHNA 4LFBT 2X9HA 5HEOA 1GFQA 2D9DA 4X64T 3C5OA 5LBMA 3P8CD 7PRNA 4H9RC 4A97A 4JV5T 2DI4A 3PGUA 5CGMA 4HGAA 4OYJA 3VZUX 3HKDE 3UTKA 3LK2A 3ZYLA 4EAHA 4B3TT 3I9WA 4X66T 1FMWA 4YJ3E 2W80C 5DL5A 2X67A 3GWHA 1WR0A 3ONJA 3IA3A 4CXWA 4AYDC 2XZEA 2JJ9A 2MOZA 1BR0A 3PUQA 4EGWA 4AFKA 2V7KA 3AA6A 2E9XB 3WI5A 1J5WA 3POXA 3RRCA 2P9BA 2W67A 5HXEA 4HE8A 2VL0A 3HKBE 1HXTA 4E7SA 1GQEA 5EZYE 1T1LA 2UXXB 3PUAA 5FNVE 1U4QA 2CE7A 4O4UA 3T20A 3PUZF 3SOLA 2J62A 5G26A 2FBWA 4YHHT 2ZLDA 1PRNA 3F31A 1FEWA 1HFAA 2CWOA 2V7LA 3DTOA 2WAUA 2E9XC 4CQIA 3OJAA 2E8IA 4TX5A 3RIAA 4RL9A 3MXZA 4O8SA 4UF0A 3AXJA 4ISSA 3CVRA 2VKJA 4MBQA 3UU5A 4P1NA 5J2TE 1GFNA 2K3WA 3O1IA 5GV0A 2D5UA 2XE3A 2LLYA 2IWVA 3TLTA 1MM5A 1W0AA 2R6GF 5HWYA 1Q9GA 4PNIA 5JR9A 1E1HB 2VL8A 3TKLB 3ZCJA 2VK9A 4DUZT 2BG9A 4OFZA 3B13A 4YTPA 4IE7A 1W9RA 3R84B 3CQCB 1WYCA 3LBXB 2RA1A 3TLSA 3O0EA 5IUXA 5ABEA 4CXXA 2CHNA 2VKOA 1Q9FA 2W63A 4L0RA 2CXDA 4EXTA 1HNXT 4O3XB 2ERVA 4KX6A 4FSPA 4O2AE 3AAAB 2XAHB 3TLVA 2WCAA 3QRAA 3TLWA 4IE0A 4L5GA 4C4VA 1US7B 3P4WA 2Q9QB 4AYID 1OEDB 2X9WA 2IUBA 3PU8A 5HYAA 4JEUB 4AISA 1G90A 2YPVA 3NZPA 4JI4T 1W0BA 3AE3A 3RYFE 5KDMC 2XE5A 3C50A 1ZOYA 3AAIA 5LP6E 3A8YC 2LSGA 3OYXA 2QA7A 2C5KT 3RKOA 4AKLA 3AEGA 2IC6A 2R4OA 1WFDA 4I0UA 2BS3A 4UV9B 4O3ZA 3AAEA 2YN6A 1D0YA 3HKEE 1YKEB 4AXPA 2I6HA 3LG7A 3E0ZA 1N36T 4LF4T 2Q9QC 1WYBA 2VWAA 4O3YA 1OEDC 3OVUA 2ZM6T 3LK42 2CXLA 2W0GA 3LFMA 4G75A 2RP4A 2NOXA 3LK2B 2XQAA 4LMLA 2YINA 4HFHA 4EZ4A 2PRNA 4WNKA 3F2EA 4HWFA 4GYRA 1ZHTA 5CA1E 4IDQA 1BR1A 2WWUA 5JVDE 5F5WA 1W09A 2L9QA 3RYIE 2D2SA 3CPZA 3P7IA 3HWBA 3N9OA 1T7SA 4Q25A 3AA6B 4FSOA 4QX8B 2LE8A 1OPFA 3IBPA 4CN6A 2CBIA 4OX9T 4TV8E 4FRXA 2N2NA 3ZN1B 3SY9A 4HFCA 1IJ5A 5KXJA 2LFUA 2W62A 3F57A 4PFPA 2WJQA 5L4EA 1MIVA 3HR0A 3A0BO 3PORA 2V5DA 4G76A 5J0ZA 4F8HA 5GONE 2ZM8A 1ZKEA 5JTGA 5LHIB 2H7VC 3WI4A 2WDVA 3TLUA 2E5LT 4XAXB 3AVRA 5FY7A 1BT9A 4U2ZA 4U2YA 2J1DG 2YEVC 5G38A 3HL6A 2BBHA 4KRAA 5AQHB 1VCSA 5AQKB 4UF0B 3AXJB 1VCTA 3OTOT 3BK9A 5KAFO 2V6XA 3IF8B 3AEBA 2EHOD 5T5FA 3N5LA 4DR5T 4HN9A 4O4IE 2XPKA 3M3ZB 3RYCE 1SHZC 2L3LA 2PTFA 4LFAT 1HCIA 4UR9A 3EDUA 2K48A 2WU5A 5JR9B 3RLFF 4PR7A 1MMGA 4FRTA 2BG9B 3RX6A 4K0UA 2C0SA 2HPJA 3VKGA 1KK7A 4EYYR 2W66A 1IZNB 2ODUA 4TUYE 3OPCA 1NEKA 1D1CA 1CUNA 4LFCT 5CJ5A 3I0OA 5F8PA 4TNVA 5AQPB 4C4VB 4N74A 4BJMA 4GKKT 2ODVA 5TAOA 4DV3T 4YHJA 3CX7B 3AE4A 2KWIB 3JAFA 1G8XA 4LSIA 3EABA 3WI3A 1VRBA 5JR9C 2UXCT 2DLRA 2E5VA 4IL6O 4N78D 5BMVE 3SS1A 2BG9C 4LSEA 2V6YA 4PFOA 3FZMB 3RQWA 4I50E 3NBXX 3VE1A 5HXSA 1ORMA 4IREA 2M6BA 4EYUA 1Z8UA 4ZI3C 3AAEB 3CKDA 3CX6B 2IMLA 1Y64B 4ZOLE 2HN1A 3E22E 4WYVA 4FI5A 3RIFA 2BDEA 5AQNB 3UT5E 4TNWA 5FVLA 2KDYA 4GK5E 3GN5A 4KI0F 1FIOA 3L39A 3M65A 5C8YE 3ZT5A 3AEEA 3BQIA 8PRNA 5KMGP 3Q5EA 1YQ4A 2SPCA 2EHOA 4TWDA 4IDZA 5FYMA 2PBIA 2I59A 2XAQB 3I1AA 4EV6A 1I94T 1SA0E 2G0UA 3RC3A 3W15B 3KVBA 1HXUA 2NW8A 4O4XA 2DL1A 2FJBA 2IIUA 3ZYMA 4Z90A 4C90A 2V7MA 2QGSA 3J7Yq 1QJPA 2UU9T 2XAGB 2JQYA 4AQYT 2JPFA 5EK4A 5JDQA 2YDRA 3D0TA 3P4PA 3UU3A 4C69X 3QC9A 4H63V 3IHRA 5HEHA 2ES0A 2XTLA 3N9QA 3JCFA 4QH5A 2XG6A 4YT0A 4DIDB 4JI1T 2V7JA 2JQ9A 2J4UP 1UK5A 3FXEB 4H9QC 5LA6E 4D64A 4CTDA 5IHYA 2CBJA 5LNKA 4IIJE 1ZEEA 3SFEA 2NWBA 2WZHA 1WLXA 4QXBB 4QXHB 4AQGA 1UURA 3O4XE 3RH3A 4ZZCA 3UPGA 4BAYB 3DJBA 4UELA 5LCYA 3UU6A 4UB6O 3HI2A 4ADZA 3QNUA 5JRCB 2B76A 3PJAJ 3ZPOA 2R89A 1PHOA 5C2TA 3KBTA 3ZYKA 3AE7A 2VB6A 3ZLIA 4LF9T 4NXMT 3VR8A 2BKPA 4GHBA 3PURA 5FVNA 5LG4A 3O9XA 4C91A 3ZMVB 1UX4A 4U7IA 3UAQA 5H2FO 5JDPA 4N59A 5AQUB 2J4GA 2XQ8A 5BR8T 4QXCB 3C98B 2H89A 3UUXB 3QB5K 2XQ7A 4ZI2D 3POUA 3KV9A 4PJJA 2OLTA 4UEMA 4IE5A 3LK3A 3Q9DA 2CA5A 5ABFA 4CI1B 3N9MA 3RQUA 2XUEA 3N9NA 4NXNT 4O4LE 3RRWA 2HN2A 4YFSA 1MNDA 3SWHA 1EZ3A 2VVNA 3WU2O 4RJWA 2V6YB 4Z8XA 2JMKA 2UXBT 4NUVA 4GOUA 4XZCA 4O3WA 2W4XA 4QH4A 2GK9A 4ZS3A 3UFEA 3AA0B 3ZEFB 2XTQA 4TZ4C 2I0MA 5PRNA 4AYNA 2YNKA 2R88A 3JAEA 4GCPA 2F1VA 4HFIA 2QVAA 2X68A 4FJOA 5H6RB 3GA8A 5LYJE 5AQGB 5HCMA 2VKDA 3ANWA 3GN5B 1XMQT 4B3ST 4FT6A 3ZN0B 1NWMX 4E1SA 5JDLA 3UU4A 2OMFA 5DABA 3ZT6A 4HWIB 3DWNA 2Y7SA 4D65A 3E08A 2W81C 2EHOB 2A2FX 3HKCE 3A2SX 3NRXA 3QUJA 4MFRA 2CRBA 2MPKA 5HWXA 2WY2A 4AUIA 2BS4A 4QKNA 4AKMA 4X20E 2K9AA 1NAFA 4AKHA 1GFPA 2Y0KA 2A9UA 4WZXA 2LRLA 5CFBA 2XJ7A 1KEYA 3UULA 2OA5A 2VKHA 2JQQA 3EMNX 2KINB 5E79O 1R8IA 2EHOC 4X65T 5AQOB 1QUUA 2QRXA 4A5XA 1T8BA 3G06A 1HNWT 4JYAT 2FGQX 2A72A 2O4VA 3VRAA 4CN1A 4EEBA 3SRZA 2A3DA 3CX8B 1HX1B 1SUMB 4H9PC 4LF5T 2PORA 5G39A 1GFOA 3AE9A 3ZT7A 5L3CB 1E54A 3Q5WA 4O49A 3DZMA 2N1GA 5JH7E 5HXHA 2JRKA 4AKGA 1HG5A 1THQA 5DL8A 2J1NA 2D0TA 2UXDT 5H6QB 4V1Av 3PQUA 4WW0A 4DNDA 2ACXA 2XHEB 4C00A 5HXCA 2Y0HA 2F4VT 4QHOA 4O2BE 5M4YA 1XNQT 3Q2MA 3C4XA 1VOMA 2H7OA 1LVKA 1QJ9A 2YK0A 3RHWA 1D0XA 3P4QA 2BG9E 3NSGA 1P4TA 4JI2T 3V8UA 4O4HE 3BQKA 5FKYA 3LK3B 5B66O 4L9IA 1H6S1 5AQSB 3QRCA 3ABVA 5FVKA 2WJRA 5L47A 4TWHA 5HXRA 2WB5A 3PDYA 3QK6A 4MHCA 2L8KA 3JC6C 3KZIO 5DL7A 1XNRT 5G3AA 2VVSA 4H63H 3N9LA 4F4BA 2CPTA 3RYHE 3KDSE 1B7TA 2UUAT 4DR4T 2HH7A 5L3GB 4KP3C 3T1HT 5AQRB 3FYXA 2KSRA 5FL0A 3AE5A 4IDOA 5AQJB 4OK0A 1D0ZA 4E7ZA 3FZFB 4KHZF 5HEJA 4QX7B 1YW0A 4JLEA 4GKJT 3AECA 1Y01A 3J9X1 3K3NA 4JI3T 3ESLA 3CQGB 3P50A 4GYSA 4TWFA 5JDFA 4AZLA 3T8OA 4ERRA 3BRYA 3VKHA 4ZS2A 3C4WA 3PUYF 3K3QC 1E7PA 3H3MA 3A7MA 1UX5A 2VASA 2KT9A 3FZHB 4PK6A 3PUXF 3QOFA 5FXXA 5JDNA 3SFDA 1YQ3A 3N2OA 4JI6T 2ZLYA 4RLBA 2JQKA 3POQA 4ISTA 3EHZA 1YD8G 1MNEA 2UXNB 2XASB 3IEEA 4JI0T 3EDVA 2LKHA 2LOPA 1XZYA 1E2AA 4B3RT 3CWZB 2LOSA 2LEHA 2XTRA 2Y48B 2HPLA 4X62T 2WWVA 1KNPA 4YJ2E 5DL6A 4TN7B 4MLKA 3PUSA 3AVSA 2MBGA 5LXTE 4DUYT 3CIRA 1HF8A 4K3CA 3FXDB 1HG2A 4IE4A 4UVBB 2R8AA 3PGSA 4X1IE 3C51A 4HTEA 2Z6EA 4XNKA 3ETVA 2XE2A 2NTXA 1N34T 3K3OA 5DJQC 2MNHA 4PJNA 1LRZA 4YSYA 2JIWA 2ZM2A 4FESA 2E2AA 1S94A 4GCSA 1IAPA 2WS3A 5AFUL 4DR2T 1LVFA 4FZMA 4Z3TA 5FXZA 3A0HO 2LSJA 2YDSA 4IHJE 5LB7B 2OV9A 3EUHA 3MKDA 5ETWA 2XM1A 3HOEA 4MALA 2FJAA 3G7GA 4X1YE 4HWCA 4NPPA 2CHOA 4JI5T 4ZEYA 4N75A 3ZKRA 3NZQA 4CXYA 4IL4A 5HCJA 3KV5A 5HEUA 3VY9X 4PK5A 3PU3A 2KNDA 1T72A 2CMRA 4ILUA 3SZVA 4PUXA 4X1KE 4EB6E 4KUMB 2FGRA 2FJDA 3NKZA 1FJGT 3C4ZA 4CI3B 2BKNA 3PUVF 4LF7T 1M7KA 1WRDA 4JUYA 3DA3A 1X9BA 1DU2A 4PK4A 5E0OA 5JQGE 2Y8DA 1ZHXA 4YTNA 1ZHYA 4DV6T 4GIWA 3BRZA 2WM9A 1S35A 2VQET 2Y6XA 5FXWA 2W61A 2XSAA 2W00A 1MIYA 1D1AA 2NW7A 1J1JA 1OSMA 4HFEA 2WZIA 2X0HA 2X66A 3T24A 4AI6A 1HTJF 5L4HA 2D0UA 4JCHA 2PFVA 2XQ6A 2XAJB 4DVDA 3RC8A 2IC9A 3VY8X 4B6XA 1JNZA 2KZ7A 2BBJA 2NTYA 2XQ4A 3AA7A 4PAGA 3AAAA 2WVPA 1KF6A 4P0BA 3VRBA 1NENA 5FL1A 2NW9A 1SE7A 2XQ5A 3PRNA 4FZLA 1IBKT 2XMXA 3O1JA 4YSXA 2AXTO 3LDQB 3V5UA 4EIWA 1N33T 3K8PC 2F1TA 2NP9A 1X79A 4DR6T 3LJCA 3N9PA 3AA1A 2KXPA 3VZWX 5B5EO 4U31A 2Y0LA 2WMNA 3GP6A 5KAIO 5JDHA 1J5ET 3C64A 2LSKA 3Q5XA 2DWKA 4XNLA 4K0KT 2V26A 2YDQA 1ZP0A 4U74A 1T98A 4CZZB 3A5XA 4H9SE 2W2UA 3H37A 5AQMB 4FQEA 1S5LO 3N2KE 2K4TA 4E1TA 3EI0A 6PRNA 2HHHT 5LGUB 2WU2A 4I55E 4ILAA 1YXRA 3AE8A 5ADXL 4AQFA 1HX8A 1ZHWA 4LMJA 3S4UA 4ZI3D 4A98A 4HWDA 3HA4A 4FZNA 3KBUA 2R4LA 1OEDE 3OKQA 4QH1A 4ILCA 2PJQA 4YLHA 4DR3T 5FY1A 3UU2A 2AXDS 3O1HA 2Y2XA 3ZJ2A 2IWWA 4YSZA 3GMIA 3I0QA 3PQSA 3ONLC 4P0AA 2KMFA 3ZC0A 3PE0A 4LF6T 2WBLA 4JEHB 5FXVA 1ZV4X 3ZC1A 2N9DA 3AEFA 2X27X 3RIUA 4I43B 4AKRA 4GF4A 2B1EA 5LMNT 3U3IA 5AQQB 4GCQA 3UUBA 4B3MT 4BA9A 2YKSA 3SYSA 4EEDA 3KVAA 3QB5A 2MTQA 4JI8T 4A56A 4P09A 5CA0E 1HS7A 5LGTB 1D1BA 2DWGA 4KMCA 3BS0A 1LKXA 2XAFB 2LM9A 4ZHQE 3K1SA 4DV7T 2ZM0A 4PJLA 4FOZA 4N58A 2M06A 2XM2A 4O4JE 3P4RA 4QWNB 1WR6A 1YKHB 5GTHO 4NIQA 5AQLB 1G73A 2LKGA 1CHUA 1OXZA 1XDPA 3AEAA 4DR1T 2R4NA 5KX5E 2BZBA 1ZHCA 5LOVE 3I9YA 3VR9A 2BVLA 2WSSV 4COFA 3HW9A 4DV0T 4YTMA 1O3XA 3ZMUB 1WCRA 4XBFB 3WAJA 3V5SA 2UUBT 2IDOB 3NVOA 3FZLB 4IDPA 3N2GE 4IT4A 4AYMC 1IZNA 2XQYA 2KZ7B 4LMKA 1KNZA 5LJMA 2VQFT 4TV9E 4AIUA 2XSBA 5ABHA 4DBQA 3AA7B 5A1LA 3RPUA 4HKAA 5FY0A 3UUMA 2KC0A 4ZI7E 1IBMT 4DMVA 3DA4A 4DV4T 4U7YA 4CI2B 4B61A 3SYBA 3PV0F 2V7IA 3DWOX 2N2MA 3HOLA 3VHLA 3KV4A 4H9NC 2JMHA 3MJXA 4HFDA 2N2LA 3LK41 5IYUA 3AA1B 2KXPB 4DV2T 3T0SA 5FP3A 5FMNA 4EOZB 2NR4A 2M6IA 3H3AA 2PG8A 4M1PA 3PUGA 4UIGA 3WAKA 1BXWA 3PTRB 3RF1A 5AQVB 2CWYA 4UV8B 2RPAA 1OWAA 2J47A 2WDQA 2LJLA 3LSVA 1IBLT 1HXXA 5AQTB 2V5CA 3CMLA 4NUUA 4OYKA 3AE2A 2IW5B 4DV1T 5ABFB 3VZTX 4YY3T 3RGLA 4LSFA 3TZGA 1QLBA 3FBLA 3AEDA 5ABGA 1QJ8A 3L3PA 4WBOA 4FUVA 5HAXA 5LHGB 2AE9A 5TISO 2XE1A 2E9XD 4ZXLA 2X9YA 1KFYA 3ZCIA 2FUPA 2DCFA 5LG3A 1HR0T 3B57A 2MYSA 3OBVE 2M07A 4D5UA 4PJMA 4U33A 2XQ3A 1KNRA 2H3RA 3VU7H 2K24A 4FMSA 5LHHB 2LSYA 3UU8A 1ZHZA 2K0LA 1FMVA 1N32T 1T16A 4AKRB 5EE2A
chains in the Genus database with same CATH topology
3G7GA 3LBXB 2RA1A 4X1YE 3O0EA 3UAQA 3MA9A 5L3BB 4CXXA 5F3JA 5JDPA 2X9XA 2VKOA 4AQFC 1QSDA 1Q9FA 4N59A 2W63A 4L0RA 3ANWB 2CXDA 4QXCB 4EXTA 3C98B 4O3XB 3UUXB 3NZQA 4CXYA 1GFMA 2ERVA 4FSPA 4ZI2D 4AKIA 3POUA 3KV9A 5JREA 4PJJA 1H7CA 4O2AE 1BH3A 3AAAB 2XAHB 3KV5A 3ONXA 3VY9X 4H9OC 3QRAA 4PK5A 5LGNB 3PU3A 2KNDA 4IE5A 4UEMA 3Q9DA 2V1DB 3LK3A 2CA5A 4IE0A 4L5GA 1US7B 1MMDA 2CMRA 2DNXA 4ILUA 4PUXA 3SZVA 4CI1B 2Q9QB 3N9MA 4X1KE 4AYID 4EB6E 4KUMB 2FGRA 3U78A 2X9WA 2XUEA 3SY7A 3N9NA 1YS5A 3C4ZA 3MK7C 4CI3B 3PU8A 4O4LE 5HYAA 3RRWA 4JEUB 4YFSA 1G90A 2YPVA 2WMOA 3NZPA 1WRDA 4I4TE 4JUYA 1MNDA 3SWHA 3DA3A 1EZ3A 3RYFE 1UCUA 5KDMC 2KWHA 2C5JA 5JRCA 2XE5A 4RJWA 4PK4A 4QQ1A 4Z8XA 3C50A 3AAIA 4UVAB 5EK3A 5E0OA 5JQGE 4JFBA 2JMKA 2Y8DA 1ZHXA 5LP6E 4BJNA 4NUVA 1ZHYA 4GOUA 4GIWA 4PW8A 4XZCA 4O3WA 2LSGA 2WM9A 1S35A 3OYXA 2GK9A 2QA7A 2C5KT 3RKOA 4AKLA 2Y6XA 5FXWA 4ZS3A 2W61A 3R6NA 3UFEA 2W00A 3BQLA 4J2CA 2IC6A 3AA0B 3ZEFB 1MIYA 2XTQA 4TZ4C 1D1AA 2NW7A 3RBHA 4UV9B 1OSMA 3AAEA 4O3ZA 2YNKA 5PRNA 4AYNA 3AB3B 1D0YA 3HKEE 2YU2A 2X66A 1YKEB 4AXPA 5L2LA 5L3DB 3T24A 5DQWA 3LG7A 4GCPA 3E0ZA 4AI6A 1HTJF 2F1VA 4UXNB 5AFUK 4ASKA 2Q9QC 1WYBA 2VWAA 4O3YA 1BR4A 4U72A 5JDMA 2D0UA 4JCHA 2X68A 2X0LB 3LK42 3SZDA 2CXLA 2PFVA 2W0GA 3LFMA 4FJOA 5H6RB 3GA8A 4G75A 2RP4A 5LBQB 5LYJE 2NOXA 2XAJB 3LK2B 2VKDA 4DVDA 3VE2A 5J2UE 5LJNA 2IC9A 2YINA 4B6XA 4EZ4A 3ANWA 3GN5B 4DMWA 3RC8A 2PRNA 3VY8X 5EK2A 2IAKA 2KZ7A 2LT3A 3F2EA 4WNKA 4FT6A 4GYRA 4ANJA 1ZHTA 5CA1E 1MIWA 2NTYA 1NWMX 3ZN0B 5JDLA 4E1SA 2OMFA 1Z0PA 5DABA 3AA7A 4PAGA 3AAAA 1BR1A 2WWUA 5JVDE 2LHRA 4P0BA 1MM4A 2L9QA 2Y7SA 3KINB 3RYIE 4RJXA 2D2SA 3CPZA 2NW9A 3P7IA 3HWBA 4D65A 2E9XA 3E08A 3N9OA 2W81C 2EHOB 2A2FX 3HKCE 3A2SX 3PRNA 2Q9QD 4FZLA 4AYEC 3L09A 3AA6B 4FSOA 1MMAA 4QX8B 2XMXA 3O1JA 2LE8A 3NRXA 3QUJA 1OPFA 3IBPA 4MFRA 4UVCB 4TV8E 3V5UA 4EIWA 5HWXA 4FRXA 3K8PC 2N2NA 3ZN1B 2F1TA 2JMMA 2LHNA 4AUIA 3SY9A 4QKNA 4AKMA 1IJ5A 4X20E 2K9AA 4ZI2C 2NP9A 1NAFA 2LFUA 4AKHA 1GFPA 1X79A 2W62A 2Y0KA 2CXFA 4LSHA 3F57A 3LJCA 2ZMAA 4PFPA 4RLCA 3N9PA 3AA1A 2KXPA 4G63A 3ZMTB 3MACA 3ZJ1A 3VZWX 3OYZA 2YU1A 2Y0LA 2WMNA 3ETUA 3GP6A 3UULA 2OA5A 5JDHA 1MIVA 4F6RC 3HR0A 4DO0A 3PORA 4U9CA 3DP7A 3C64A 3AA0A 4G76A 2LSKA 3Q5XA 2VKHA 2DWKA 2JQQA 4XNLA 1MPFA 2V26A 5GONE 4U74A 1T98A 3FB2A 4CZZB 2ZM8A 3A5XA 3EMNX 4H9SE 3JC6D 2KINB 1ZKEA 3KVDD 3FBZA 5LHIB 3H37A 2EHOC 2X51A 2H7VC 3EVYA 3WI4A 3N2KE 1QUUA 4XAXB 2KLQA 3AVRA 5FY7A 5L3FB 1BT9A 2K4TA 4E1TA 2J1DG 2CCQA 6PRNA 2FGQX 2A72A 2O4VA 2YEVC 3SRZA 2CLYB 2A3DA 3CX8B 3HL6A 3ZMSB 5LGUB 4H9PC 4KRAA 4I55E 2LHFA 2PORA 5ADXL 4AQFA 1HX8A 1GFOA 1ZHWA 4UF0B 1E54A 5L3CB 3Q5WA 4IGUA 4DBRA 2MHLA 3S4UA 4O49A 2M67A 4ZI3D 3BK9A 3HA4A 3NRYA 2N1GA 4FZNA 1MMNA 3KBUA 5JH7E 5HXHA 2JRKA 3IF8B 3OKQA 3ZMZB 2EHOD 2PJQA 5T5FA 3N5LA 1IJ6A 4YLHA 5D5DA 5FY1A 4HN9A 4O4IE 4AKGA 1HG5A 1THQA 3RYCE 1SHZC 3UU2A 2L3LA 3O1HA 4G2AA 2K5BB 4EZHA 3ZJ2A 2Y2XA 5DL8A 3GMIA 3I0QA 3MZKB 2D0TA 4HEAA 4OHFA 2J1NA 3PQSA 4P0AA 1HCIA 5H6QB 3EDUA 4WBNE 4MALA 2K48A 2KMFA 4V1Av 3PQUA 4WW0A 4DNDA 4KR8A 2ACXA 2XHEB 3ZC0A 2ZFGA 3PE0A 5JR9B 5HXCA 2Y0HA 4KBMB 2WBLA 4JEHB 4QHOA 3JTYA 2CM0A 5FXVA 1ZV4X 1BR2A 3ZC1A 4O2BE 1MMGA 2QTKA 4FRTA 3KV6A 5M4YA 4KR4A 2N9DA 3Q2MA 1V9DA 3RX6A 2LSIA 4HFVA 4K0UA 2X27X 4I43B 3C4XA 4AKRA 1VOMA 4GF4A 3LBXA 2B1EA 2H7OA 1LVKA 2CLYC 2C0SA 3U3IA 2BVMA 3CQXC 1QJ9A 2YK0A 1D0XA 2HPJA 4GCQA 3VKGA 1KK7A 5L3EB 4BA9A 2ODJA 3NSGA 4EYYR 1U5PA 5J1GA 1P4TA 3SYSA 1IZNB 1AJ3A 2C5IT 2ODUA 4TUYE 5IYZE 3KVAA 2GE4A 2MTQA 3V8UA 5CB4E 4A56A 1D1CA 1CUNA 4P09A 5CA0E 4O4HE 3I0OA 1HS7A 3BQKA 5LGTB 5F8PA 1D1BA 2DWGA 4KMCA 3KFWX 3LK3B 4L9IA 1LKXA 2Q9QA 2XAFB 1H6S1 3QRCA 4BJMA 2LM9A 5JDGA 2ODVA 5TAOA 4YHJA 4ZHQE 5HXRA 2ZM0A 3CX7B 2KWIB 3PDYA 1G8XA 3QK6A 4IE6A 4PJLA 4MHCA 3WI3A 1VRBA 5JR9C 4LSIA 2DLRA 2L8KA 3JC6C 4FOZA 4N78D 5DQVA 4N58A 2M06A 3UUNA 5BMVE 5DL7A 4O4JE 2DHRA 4H63H 3SS1A 4LSEA 3N9LA 4F4BA 4PFOA 3RYHE 3KDSE 4GK0E 4QWNB 1WR6A 1B7TA 1YKHB 3K19A 4BUMX 1G73A 2HH7A 5L3GB 4KP3C 5ADXK 2CEAA 4I50E 3FHNA 5EE2A 2X9HA 1OXZA 3NBXX 1GFQA 3VE1A 3C5OA 3FYXA 5LBMA 5HXSA 3P8CD 5KX5E 7PRNA 1ORMA 4H9RC 4EYUA 4OK0A 2BZBA 1ZHCA 4ZI3C 3AAEB 5LOVE 1D0ZA 3CKDA 3CX6B 4E7ZA 3I9YA 1Y64B 2BVLA 2WSSV 4QX7B 2DI4A 1YW0A 4JLEA 3HW9A 4ZOLE 3E22E 1O3XA 4FI5A 4HGAA 2BDEA 4OYJA 3ZMUB 3UT5E 3VZUX 4XBFB 3WAJA 3HKDE 3V5SA 2KDYA 3J9X1 3K3NA 4GK5E 3UTKA 3LK2A 3ESLA 3ZYLA 4EAHA 3GN5A 3CQGB 3I9WA 3N2GE 1FMWA 4AYMC 1IZNA 2XQYA 4YJ3E 2W80C 1FIOA 2KZ7B 3M65A 5C8YE 5DL5A 4GYSA 2X67A 3GWHA 1KNZA 5JDFA 5LJMA 4TV9E 4CXWA 3BQIA 3T8OA 4AYDC 4ERRA 5KMGP 4AZLA 8PRNA 2JJ9A 2MOZA 4DBQA 3AA7B 5A1LA 3RPUA 1BR0A 3VKHA 4ZS2A 4HKAA 5FY0A 3UUMA 2SPCA 3C4WA 3PUQA 2KC0A 3K3QC 2EHOA 4IDZA 5FYMA 4AFKA 1UX5A 2PBIA 2V7KA 2E9XB 4ZI7E 2VASA 3AA6A 4DMVA 2KT9A 3WI5A 3DA4A 2I59A 2XAQB 3I1AA 1SA0E 2G0UA 4PK6A 3POXA 3RRCA 2P9BA 3RC3A 5FXXA 3W15B 3KVBA 5HXEA 4CI2B 2NW8A 5JDNA 3N2OA 1HXUA 4O4XA 4B61A 4HE8A 3SYBA 3HKBE 1HXTA 2ZLYA 3ZYMA 4E7SA 2V7IA 4RLBA 4C90A 2V7MA 2N2MA 3HOLA 3POQA 2QGSA 3VHLA 3KV4A 4H9NC 3J7Yq 1QJPA 2JMHA 3MJXA 4ISTA 2XAGB 5EZYE 1YD8G 2N2LA 3LK41 1MNEA 2JPFA 5EK4A 5IYUA 2UXNB 5JDQA 2XASB 3IEEA 3AA1B 2KXPB 3D0TA 2UXXB 3PUAA 3T0SA 5FNVE 1U4QA 5FP3A 5FMNA 4EOZB 4C69X 3QC9A 2CE7A 3EDVA 3H3AA 2PG8A 4H63V 4M1PA 3PUGA 4O4UA 3T20A 4UIGA 3WAKA 3SOLA 1BXWA 3IHRA 3PTRB 5G26A 2CWYA 2LOPA 2ES0A 2XTLA 3CWZB 3N9QA 2LOSA 4UV8B 2ZLDA 2LEHA 1PRNA 3F31A 2Y48B 2XTRA 1OWAA 2XG6A 2HPLA 2LJLA 1FEWA 1HFAA 2CWOA 2V7LA 3DTOA 4YJ2E 5DL6A 2V7JA 4TN7B 2J4UP 2WAUA 1HXXA 2E9XC 3FXEB 4MLKA 4CQIA 3PUSA 4H9QC 5LA6E 4D64A 3AVSA 3CMLA 2MBGA 4NUUA 4OYKA 5LXTE 5IHYA 2IW5B 1HF8A 3FXDB 1HG2A 3OJAA 4IIJE 1ZEEA 2E8IA 4IE4A 2NWBA 4UVBB 5LNKA 1WLXA 4QXBB 4QXHB 4TX5A 3VZTX 4AQGA 4LSFA 3TZGA 4X1IE 3C51A 4RL9A 3O4XE 3MXZA 4HTEA 3RH3A 4O8SA 2Z6EA 4UF0A 3FBLA 4XNKA 4ISSA 3CVRA 3UPGA 3ETVA 2VKJA 4MBQA 4BAYB 2XE2A 3DJBA 4UELA 2NTXA 5LCYA 1QJ8A 3HI2A 3L3PA 4ADZA 3K3OA 5DJQC 4WBOA 5J2TE 5JRCB 4FUVA 5HAXA 5LHGB 2MNHA 4PJNA 3ZPOA 1GFNA 1LRZA 2XE1A 3O1IA 2E9XD 2ZM2A 1PHOA 2X9YA 5GV0A 4FESA 2D5UA 1S94A 3KBTA 2XE3A 4GCSA 1IAPA 1MM5A 3ZYKA 5AFUL 3ZCIA 2DCFA 5HWYA 1LVFA 3B57A 1Q9GA 4FZMA 2MYSA 4Z3TA 3OBVE 2M07A 4PNIA 5FXZA 2VB6A 4PJMA 5JR9A 1E1HB 4D5UA 3ZLIA 2VL8A 2H3RA 2LSJA 3TKLB 2K24A 3VU7H 4FMSA 3ZCJA 2VK9A 5LHHB 4IHJE 2LSYA 4OFZA 3B13A 4IE7A 1ZHZA 3PURA 4GHBA 2K0LA 5FVNA 3EUHA 5LG4A 1FMVA 3O9XA 4C91A 3MKDA 5ETWA 3HOEA 3R84B 3ZMVB 3CQCB 4AKRB 1WYCA 1UX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK2 A;  3LK2 B;  3AA0 A;  5AFU L;  3AA0 B;  2KZ7 A;  1IZN A;  2KZ7 B;  5ADX L;  3AAE A;  1IZN B;  3AAE B;  3AA7 A;  3AAA A;  3AA7 B;  3LK4 1;  5AFU K;  3AAA B;  3AA1 A;  2KXP A;  3AA1 B;  2KXP B;  3LK3 A;  3LK3 B;  4AKR A;  5ADX K;  3AA6 A;  3LK4 2;  4AKR B;  3AA6 B; 
#chains in the Genus database with same CATH topology
 3X1D A;  3MA9 A;  5L3B B;  4PJ0 O;  5F3J A;  3RKG A;  2X9X A;  3CK6 A;  4AQF C;  3B5M A;  1QSD A;  5AQF B;  3ANW B;  1GFM A;  2X9K A;  4AKI A;  5JRE A;  1H7C A;  2XY8 B;  1BH3 A;  5IWA T;  3ONX A;  4H9O C;  5LGN B;  2V1D B;  1MMD A;  2DNX A;  3U78 A;  3SY7 A;  1YS5 A;  4LF8 T;  2LRK A;  3MK7 C;  2WMO A;  4I4T E;  3Q5D A;  1UCU A;  2KWH A;  2C5J A;  4X5T A;  5JRC A;  2F1C X;  4QQ1 A;  4UVA B;  5EK3 A;  3RIU C;  4JFB A;  4BJN A;  3JCU O;  4PW8 A;  1HNZ T;  3R6N A;  3UFG A;  3P4S A;  3BQL A;  4J2C A;  5AQI B;  5GTI O;  3RBH A;  3UQ7 A;  1XWM A;  4Z91 A;  2UUC T;  2ACZ A;  3AB3 B;  2YU2 A;  3NWI A;  5L2L A;  5L3D B;  5DQW A;  4ILB A;  5AFU K;  4UXN B;  4ASK A;  2H88 A;  1BR4 A;  4U72 A;  5JDM A;  2BS2 A;  2WDR A;  3SZD A;  2X0L B;  2BKO A;  5LBQ B;  3VE2 A;  5J2U E;  5LJN A;  4DMW A;  5EK2 A;  2IAK A;  2LT3 A;  1UUS A;  2JQH A;  4YXD A;  4DV5 T;  4ANJ A;  3JAD A;  1MIW A;  1Z0P A;  2LHR A;  1MM4 A;  3KIN B;  4RJX A;  2E9X A;  4CN4 A;  2IHR 1;  2Q9Q D;  2R4P A;  4AYE C;  3L09 A;  1MMA A;  3L8R A;  4UVC B;  4JBW F;  4HWH A;  4U3C A;  2JMM A;  2LHN A;  4ZI2 C;  4LSH A;  2CXF A;  2ZMA A;  2FJE A;  4RLC A;  4IDN A;  4G63 A;  3ZMT B;  3MAC A;  3ZJ1 A;  3OYZ A;  2YU1 A;  3PJA A;  3ETU A;  5LMU T;  3ZST A;  4F6R C;  2WQY A;  4DO0 A;  4U9C A;  4IL9 A;  3DP7 A;  3AA0 A;  4ZZB A;  1XDO A;  1MPF A;  3FB2 A;  3JC6 D;  3KVD D;  3FBZ A;  1JNR A;  2X51 A;  3EVY A;  3PGR A;  2KLQ A;  4K3B A;  1XMO T;  3AE6 A;  5L3F B;  3ZSS A;  2CCQ A;  4KHP T;  2CLY B;  3ZMS B;  2LHF A;  3RI5 A;  2MHL A;  4IGU A;  4DBR A;  2M67 A;  3NRY A;  1MMN A;  4DR7 T;  3ZMZ B;  1IJ6 A;  5D5D A;  4G2A A;  2K5B B;  4EZH A;  4OHF A;  3MZK B;  4HEA A;  4WBN E;  4KR8 A;  2V8S V;  2ZFG A;  4KBM B;  1L0V A;  2YOE A;  3JTY A;  2CM0 A;  3PF1 A;  1BR2 A;  2QTK A;  3KV6 A;  4KR4 A;  3AE1 A;  1V9D A;  2LSI A;  4HFV A;  2LM2 A;  2QYW A;  3LBX A;  3FZK B;  2CLY C;  2BVM A;  3CQX C;  5L3E B;  2ODJ A;  1U5P A;  5J1G A;  3NJT A;  1AJ3 A;  2C5I T;  5IYZ E;  2GE4 A;  5CB4 E;  5HEG A;  1M62 A;  4JI7 T;  3KFW X;  2Q9Q A;  2WP9 A;  1OED A;  4UB8 O;  5JDG A;  2XQ9 A;  3EAM A;  4IE6 A;  3UQ4 A;  2VUR A;  5DQV A;  3PUW F;  4HFB A;  3UUN A;  2DHR A;  5C3J A;  1I6Z A;  4GK0 E;  2MAW A;  2X0Y A;  3K19 A;  1UGO A;  4BUM X;  3T1Y T;  5ADX K;  2CEA A;  3FHN A;  4LFB T;  2X9H A;  5HEO A;  1GFQ A;  2D9D A;  4X64 T;  3C5O A;  5LBM A;  3P8C D;  7PRN A;  4H9R C;  4A97 A;  4JV5 T;  2DI4 A;  3PGU A;  5CGM A;  4HGA A;  4OYJ A;  3VZU X;  3HKD E;  3UTK A;  3LK2 A;  3ZYL A;  4EAH A;  4B3T T;  3I9W A;  4X66 T;  1FMW A;  4YJ3 E;  2W80 C;  5DL5 A;  2X67 A;  3GWH A;  1WR0 A;  3ONJ A;  3IA3 A;  4CXW A;  4AYD C;  2XZE A;  2JJ9 A;  2MOZ A;  1BR0 A;  3PUQ A;  4EGW A;  4AFK A;  2V7K A;  3AA6 A;  2E9X B;  3WI5 A;  1J5W A;  3POX A;  3RRC A;  2P9B A;  2W67 A;  5HXE A;  4HE8 A;  2VL0 A;  3HKB E;  1HXT A;  4E7S A;  1GQE A;  5EZY E;  1T1L A;  2UXX B;  3PUA A;  5FNV E;  1U4Q A;  2CE7 A;  4O4U A;  3T20 A;  3PUZ F;  3SOL A;  2J62 A;  5G26 A;  2FBW A;  4YHH T;  2ZLD A;  1PRN A;  3F31 A;  1FEW A;  1HFA A;  2CWO A;  2V7L A;  3DTO A;  2WAU A;  2E9X C;  4CQI A;  3OJA A;  2E8I A;  4TX5 A;  3RIA A;  4RL9 A;  3MXZ A;  4O8S A;  4UF0 A;  3AXJ A;  4ISS A;  3CVR A;  2VKJ A;  4MBQ A;  3UU5 A;  4P1N A;  5J2T E;  1GFN A;  2K3W A;  3O1I A;  5GV0 A;  2D5U A;  2XE3 A;  2LLY A;  2IWV A;  3TLT A;  1MM5 A;  1W0A A;  2R6G F;  5HWY A;  1Q9G A;  4PNI A;  5JR9 A;  1E1H B;  2VL8 A;  3TKL B;  3ZCJ A;  2VK9 A;  4DUZ T;  2BG9 A;  4OFZ A;  3B13 A;  4YTP A;  4IE7 A;  1W9R A;  3R84 B;  3CQC B;  1WYC A;  3LBX B;  2RA1 A;  3TLS A;  3O0E A;  5IUX A;  5ABE A;  4CXX A;  2CHN A;  2VKO A;  1Q9F A;  2W63 A;  4L0R A;  2CXD A;  4EXT A;  1HNX T;  4O3X B;  2ERV A;  4KX6 A;  4FSP A;  4O2A E;  3AAA B;  2XAH B;  3TLV A;  2WCA A;  3QRA A;  3TLW A;  4IE0 A;  4L5G A;  4C4V A;  1US7 B;  3P4W A;  2Q9Q B;  4AYI D;  1OED B;  2X9W A;  2IUB A;  3PU8 A;  5HYA A;  4JEU B;  4AIS A;  1G90 A;  2YPV A;  3NZP A;  4JI4 T;  1W0B A;  3AE3 A;  3RYF E;  5KDM C;  2XE5 A;  3C50 A;  1ZOY A;  3AAI A;  5LP6 E;  3A8Y C;  2LSG A;  3OYX A;  2QA7 A;  2C5K T;  3RKO A;  4AKL A;  3AEG A;  2IC6 A;  2R4O A;  1WFD A;  4I0U A;  2BS3 A;  4UV9 B;  4O3Z A;  3AAE A;  2YN6 A;  1D0Y A;  3HKE E;  1YKE B;  4AXP A;  2I6H A;  3LG7 A;  3E0Z A;  1N36 T;  4LF4 T;  2Q9Q C;  1WYB A;  2VWA A;  4O3Y A;  1OED C;  3OVU A;  2ZM6 T;  3LK4 2;  2CXL A;  2W0G A;  3LFM A;  4G75 A;  2RP4 A;  2NOX A;  3LK2 B;  2XQA A;  4LML A;  2YIN A;  4HFH A;  4EZ4 A;  2PRN A;  4WNK A;  3F2E A;  4HWF A;  4GYR A;  1ZHT A;  5CA1 E;  4IDQ A;  1BR1 A;  2WWU A;  5JVD E;  5F5W A;  1W09 A;  2L9Q A;  3RYI E;  2D2S A;  3CPZ A;  3P7I A;  3HWB A;  3N9O A;  1T7S A;  4Q25 A;  3AA6 B;  4FSO A;  4QX8 B;  2LE8 A;  1OPF A;  3IBP A;  4CN6 A;  2CBI A;  4OX9 T;  4TV8 E;  4FRX A;  2N2N A;  3ZN1 B;  3SY9 A;  4HFC A;  1IJ5 A;  5KXJ A;  2LFU A;  2W62 A;  3F57 A;  4PFP A;  2WJQ A;  5L4E A;  1MIV A;  3HR0 A;  3A0B O;  3POR A;  2V5D A;  4G76 A;  5J0Z A;  4F8H A;  5GON E;  2ZM8 A;  1ZKE A;  5JTG A;  5LHI B;  2H7V C;  3WI4 A;  2WDV A;  3TLU A;  2E5L T;  4XAX B;  3AVR A;  5FY7 A;  1BT9 A;  4U2Z A;  4U2Y A;  2J1D G;  2YEV C;  5G38 A;  3HL6 A;  2BBH A;  4KRA A;  5AQH B;  1VCS A;  5AQK B;  4UF0 B;  3AXJ B;  1VCT A;  3OTO T;  3BK9 A;  5KAF O;  2V6X A;  3IF8 B;  3AEB A;  2EHO D;  5T5F A;  3N5L A;  4DR5 T;  4HN9 A;  4O4I E;  2XPK A;  3M3Z B;  3RYC E;  1SHZ C;  2L3L A;  2PTF A;  4LFA T;  1HCI A;  4UR9 A;  3EDU A;  2K48 A;  2WU5 A;  5JR9 B;  3RLF F;  4PR7 A;  1MMG A;  4FRT A;  2BG9 B;  3RX6 A;  4K0U A;  2C0S A;  2HPJ A;  3VKG A;  1KK7 A;  4EYY R;  2W66 A;  1IZN B;  2ODU A;  4TUY E;  3OPC A;  1NEK A;  1D1C A;  1CUN A;  4LFC T;  5CJ5 A;  3I0O A;  5F8P A;  4TNV A;  5AQP B;  4C4V B;  4N74 A;  4BJM A;  4GKK T;  2ODV A;  5TAO A;  4DV3 T;  4YHJ A;  3CX7 B;  3AE4 A;  2KWI B;  3JAF A;  1G8X A;  4LSI A;  3EAB A;  3WI3 A;  1VRB A;  5JR9 C;  2UXC T;  2DLR A;  2E5V A;  4IL6 O;  4N78 D;  5BMV E;  3SS1 A;  2BG9 C;  4LSE A;  2V6Y A;  4PFO A;  3FZM B;  3RQW A;  4I50 E;  3NBX X;  3VE1 A;  5HXS A;  1ORM A;  4IRE A;  2M6B A;  4EYU A;  1Z8U A;  4ZI3 C;  3AAE B;  3CKD A;  3CX6 B;  2IML A;  1Y64 B;  4ZOL E;  2HN1 A;  3E22 E;  4WYV A;  4FI5 A;  3RIF A;  2BDE A;  5AQN B;  3UT5 E;  4TNW A;  5FVL A;  2KDY A;  4GK5 E;  3GN5 A;  4KI0 F;  1FIO A;  3L39 A;  3M65 A;  5C8Y E;  3ZT5 A;  3AEE A;  3BQI A;  8PRN A;  5KMG P;  3Q5E A;  1YQ4 A;  2SPC A;  2EHO A;  4TWD A;  4IDZ A;  5FYM A;  2PBI A;  2I59 A;  2XAQ B;  3I1A A;  4EV6 A;  1I94 T;  1SA0 E;  2G0U A;  3RC3 A;  3W15 B;  3KVB A;  1HXU A;  2NW8 A;  4O4X A;  2DL1 A;  2FJB A;  2IIU A;  3ZYM A;  4Z90 A;  4C90 A;  2V7M A;  2QGS A;  3J7Y q;  1QJP A;  2UU9 T;  2XAG B;  2JQY A;  4AQY T;  2JPF A;  5EK4 A;  5JDQ A;  2YDR A;  3D0T A;  3P4P A;  3UU3 A;  4C69 X;  3QC9 A;  4H63 V;  3IHR A;  5HEH A;  2ES0 A;  2XTL A;  3N9Q A;  3JCF A;  4QH5 A;  2XG6 A;  4YT0 A;  4DID B;  4JI1 T;  2V7J A;  2JQ9 A;  2J4U P;  1UK5 A;  3FXE B;  4H9Q C;  5LA6 E;  4D64 A;  4CTD A;  5IHY A;  2CBJ A;  5LNK A;  4IIJ E;  1ZEE A;  3SFE A;  2NWB A;  2WZH A;  1WLX A;  4QXB B;  4QXH B;  4AQG A;  1UUR A;  3O4X E;  3RH3 A;  4ZZC A;  3UPG A;  4BAY B;  3DJB A;  4UEL A;  5LCY A;  3UU6 A;  4UB6 O;  3HI2 A;  4ADZ A;  3QNU A;  5JRC B;  2B76 A;  3PJA J;  3ZPO A;  2R89 A;  1PHO A;  5C2T A;  3KBT A;  3ZYK A;  3AE7 A;  2VB6 A;  3ZLI A;  4LF9 T;  4NXM T;  3VR8 A;  2BKP A;  4GHB A;  3PUR A;  5FVN A;  5LG4 A;  3O9X A;  4C91 A;  3ZMV B;  1UX4 A;  4U7I A;  3UAQ A;  5H2F O;  5JDP A;  4N59 A;  5AQU B;  2J4G A;  2XQ8 A;  5BR8 T;  4QXC B;  3C98 B;  2H89 A;  3UUX B;  3QB5 K;  2XQ7 A;  4ZI2 D;  3POU A;  3KV9 A;  4PJJ A;  2OLT A;  4UEM A;  4IE5 A;  3LK3 A;  3Q9D A;  2CA5 A;  5ABF A;  4CI1 B;  3N9M A;  3RQU A;  2XUE A;  3N9N A;  4NXN T;  4O4L E;  3RRW A;  2HN2 A;  4YFS A;  1MND A;  3SWH A;  1EZ3 A;  2VVN A;  3WU2 O;  4RJW A;  2V6Y B;  4Z8X A;  2JMK A;  2UXB T;  4NUV A;  4GOU A;  4XZC A;  4O3W A;  2W4X A;  4QH4 A;  2GK9 A;  4ZS3 A;  3UFE A;  3AA0 B;  3ZEF B;  2XTQ A;  4TZ4 C;  2I0M A;  5PRN A;  4AYN A;  2YNK A;  2R88 A;  3JAE A;  4GCP A;  2F1V A;  4HFI A;  2QVA A;  2X68 A;  4FJO A;  5H6R B;  3GA8 A;  5LYJ E;  5AQG B;  5HCM A;  2VKD A;  3ANW A;  3GN5 B;  1XMQ T;  4B3S T;  4FT6 A;  3ZN0 B;  1NWM X;  4E1S A;  5JDL A;  3UU4 A;  2OMF A;  5DAB A;  3ZT6 A;  4HWI B;  3DWN A;  2Y7S A;  4D65 A;  3E08 A;  2W81 C;  2EHO B;  2A2F X;  3HKC E;  3A2S X;  3NRX A;  3QUJ A;  4MFR A;  2CRB A;  2MPK A;  5HWX A;  2WY2 A;  4AUI A;  2BS4 A;  4QKN A;  4AKM A;  4X20 E;  2K9A A;  1NAF A;  4AKH A;  1GFP A;  2Y0K A;  2A9U A;  4WZX A;  2LRL A;  5CFB A;  2XJ7 A;  1KEY A;  3UUL A;  2OA5 A;  2VKH A;  2JQQ A;  3EMN X;  2KIN B;  5E79 O;  1R8I A;  2EHO C;  4X65 T;  5AQO B;  1QUU A;  2QRX A;  4A5X A;  1T8B A;  3G06 A;  1HNW T;  4JYA T;  2FGQ X;  2A72 A;  2O4V A;  3VRA A;  4CN1 A;  4EEB A;  3SRZ A;  2A3D A;  3CX8 B;  1HX1 B;  1SUM B;  4H9P C;  4LF5 T;  2POR A;  5G39 A;  1GFO A;  3AE9 A;  3ZT7 A;  5L3C B;  1E54 A;  3Q5W A;  4O49 A;  3DZM A;  2N1G A;  5JH7 E;  5HXH A;  2JRK A;  4AKG A;  1HG5 A;  1THQ A;  5DL8 A;  2J1N A;  2D0T A;  2UXD T;  5H6Q B;  4V1A v;  3PQU A;  4WW0 A;  4DND A;  2ACX A;  2XHE B;  4C00 A;  5HXC A;  2Y0H A;  2F4V T;  4QHO A;  4O2B E;  5M4Y A;  1XNQ T;  3Q2M A;  3C4X A;  1VOM A;  2H7O A;  1LVK A;  1QJ9 A;  2YK0 A;  3RHW A;  1D0X A;  3P4Q A;  2BG9 E;  3NSG A;  1P4T A;  4JI2 T;  3V8U A;  4O4H E;  3BQK A;  5FKY A;  3LK3 B;  5B66 O;  4L9I A;  1H6S 1;  5AQS B;  3QRC A;  3ABV A;  5FVK A;  2WJR A;  5L47 A;  4TWH A;  5HXR A;  2WB5 A;  3PDY A;  3QK6 A;  4MHC A;  2L8K A;  3JC6 C;  3KZI O;  5DL7 A;  1XNR T;  5G3A A;  2VVS A;  4H63 H;  3N9L A;  4F4B A;  2CPT A;  3RYH E;  3KDS E;  1B7T A;  2UUA T;  4DR4 T;  2HH7 A;  5L3G B;  4KP3 C;  3T1H T;  5AQR B;  3FYX A;  2KSR A;  5FL0 A;  3AE5 A;  4IDO A;  5AQJ B;  4OK0 A;  1D0Z A;  4E7Z A;  3FZF B;  4KHZ F;  5HEJ A;  4QX7 B;  1YW0 A;  4JLE A;  4GKJ T;  3AEC A;  1Y01 A;  3J9X 1;  3K3N A;  4JI3 T;  3ESL A;  3CQG B;  3P50 A;  4GYS A;  4TWF A;  5JDF A;  4AZL A;  3T8O A;  4ERR A;  3BRY A;  3VKH A;  4ZS2 A;  3C4W A;  3PUY F;  3K3Q C;  1E7P A;  3H3M A;  3A7M A;  1UX5 A;  2VAS A;  2KT9 A;  3FZH B;  4PK6 A;  3PUX F;  3QOF A;  5FXX A;  5JDN A;  3SFD A;  1YQ3 A;  3N2O A;  4JI6 T;  2ZLY A;  4RLB A;  2JQK A;  3POQ A;  4IST A;  3EHZ A;  1YD8 G;  1MNE A;  2UXN B;  2XAS B;  3IEE A;  4JI0 T;  3EDV A;  2LKH A;  2LOP A;  1XZY A;  1E2A A;  4B3R T;  3CWZ B;  2LOS A;  2LEH A;  2XTR A;  2Y48 B;  2HPL A;  4X62 T;  2WWV A;  1KNP A;  4YJ2 E;  5DL6 A;  4TN7 B;  4MLK A;  3PUS A;  3AVS A;  2MBG A;  5LXT E;  4DUY T;  3CIR A;  1HF8 A;  4K3C A;  3FXD B;  1HG2 A;  4IE4 A;  4UVB B;  2R8A A;  3PGS A;  4X1I E;  3C51 A;  4HTE A;  2Z6E A;  4XNK A;  3ETV A;  2XE2 A;  2NTX A;  1N34 T;  3K3O A;  5DJQ C;  2MNH A;  4PJN A;  1LRZ A;  4YSY A;  2JIW A;  2ZM2 A;  4FES A;  2E2A A;  1S94 A;  4GCS A;  1IAP A;  2WS3 A;  5AFU L;  4DR2 T;  1LVF A;  4FZM A;  4Z3T A;  5FXZ A;  3A0H O;  2LSJ A;  2YDS A;  4IHJ E;  5LB7 B;  2OV9 A;  3EUH A;  3MKD A;  5ETW A;  2XM1 A;  3HOE A;  4MAL A;  2FJA A;  3G7G A;  4X1Y E;  4HWC A;  4NPP A;  2CHO A;  4JI5 T;  4ZEY A;  4N75 A;  3ZKR A;  3NZQ A;  4CXY A;  4IL4 A;  5HCJ A;  3KV5 A;  5HEU A;  3VY9 X;  4PK5 A;  3PU3 A;  2KND A;  1T72 A;  2CMR A;  4ILU A;  3SZV A;  4PUX A;  4X1K E;  4EB6 E;  4KUM B;  2FGR A;  2FJD A;  3NKZ A;  1FJG T;  3C4Z A;  4CI3 B;  2BKN A;  3PUV F;  4LF7 T;  1M7K A;  1WRD A;  4JUY A;  3DA3 A;  1X9B A;  1DU2 A;  4PK4 A;  5E0O A;  5JQG E;  2Y8D A;  1ZHX A;  4YTN A;  1ZHY A;  4DV6 T;  4GIW A;  3BRZ A;  2WM9 A;  1S35 A;  2VQE T;  2Y6X A;  5FXW A;  2W61 A;  2XSA A;  2W00 A;  1MIY A;  1D1A A;  2NW7 A;  1J1J A;  1OSM A;  4HFE A;  2WZI A;  2X0H A;  2X66 A;  3T24 A;  4AI6 A;  1HTJ F;  5L4H A;  2D0U A;  4JCH A;  2PFV A;  2XQ6 A;  2XAJ B;  4DVD A;  3RC8 A;  2IC9 A;  3VY8 X;  4B6X A;  1JNZ A;  2KZ7 A;  2BBJ A;  2NTY A;  2XQ4 A;  3AA7 A;  4PAG A;  3AAA A;  2WVP A;  1KF6 A;  4P0B A;  3VRB A;  1NEN A;  5FL1 A;  2NW9 A;  1SE7 A;  2XQ5 A;  3PRN A;  4FZL A;  1IBK T;  2XMX A;  3O1J A;  4YSX A;  2AXT O;  3LDQ B;  3V5U A;  4EIW A;  1N33 T;  3K8P C;  2F1T A;  2NP9 A;  1X79 A;  4DR6 T;  3LJC A;  3N9P A;  3AA1 A;  2KXP A;  3VZW X;  5B5E O;  4U31 A;  2Y0L A;  2WMN A;  3GP6 A;  5KAI O;  5JDH A;  1J5E T;  3C64 A;  2LSK A;  3Q5X A;  2DWK A;  4XNL A;  4K0K T;  2V26 A;  2YDQ A;  1ZP0 A;  4U74 A;  1T98 A;  4CZZ B;  3A5X A;  4H9S E;  2W2U A;  3H37 A;  5AQM B;  4FQE A;  1S5L O;  3N2K E;  2K4T A;  4E1T A;  3EI0 A;  6PRN A;  2HHH T;  5LGU B;  2WU2 A;  4I55 E;  4ILA A;  1YXR A;  3AE8 A;  5ADX L;  4AQF A;  1HX8 A;  1ZHW A;  4LMJ A;  3S4U A;  4ZI3 D;  4A98 A;  4HWD A;  3HA4 A;  4FZN A;  3KBU A;  2R4L A;  1OED E;  3OKQ A;  4QH1 A;  4ILC A;  2PJQ A;  4YLH A;  4DR3 T;  5FY1 A;  3UU2 A;  2AXD S;  3O1H A;  2Y2X A;  3ZJ2 A;  2IWW A;  4YSZ A;  3GMI A;  3I0Q A;  3PQS A;  3ONL C;  4P0A A;  2KMF A;  3ZC0 A;  3PE0 A;  4LF6 T;  2WBL A;  4JEH B;  5FXV A;  1ZV4 X;  3ZC1 A;  2N9D A;  3AEF A;  2X27 X;  3RIU A;  4I43 B;  4AKR A;  4GF4 A;  2B1E A;  5LMN T;  3U3I A;  5AQQ B;  4GCQ A;  3UUB A;  4B3M T;  4BA9 A;  2YKS A;  3SYS A;  4EED A;  3KVA A;  3QB5 A;  2MTQ A;  4JI8 T;  4A56 A;  4P09 A;  5CA0 E;  1HS7 A;  5LGT B;  1D1B A;  2DWG A;  4KMC A;  3BS0 A;  1LKX A;  2XAF B;  2LM9 A;  4ZHQ E;  3K1S A;  4DV7 T;  2ZM0 A;  4PJL A;  4FOZ A;  4N58 A;  2M06 A;  2XM2 A;  4O4J E;  3P4R A;  4QWN B;  1WR6 A;  1YKH B;  5GTH O;  4NIQ A;  5AQL B;  1G73 A;  2LKG A;  1CHU A;  1OXZ A;  1XDP A;  3AEA A;  4DR1 T;  2R4N A;  5KX5 E;  2BZB A;  1ZHC A;  5LOV E;  3I9Y A;  3VR9 A;  2BVL A;  2WSS V;  4COF A;  3HW9 A;  4DV0 T;  4YTM A;  1O3X A;  3ZMU B;  1WCR A;  4XBF B;  3WAJ A;  3V5S A;  2UUB T;  2IDO B;  3NVO A;  3FZL B;  4IDP A;  3N2G E;  4IT4 A;  4AYM C;  1IZN A;  2XQY A;  2KZ7 B;  4LMK A;  1KNZ A;  5LJM A;  2VQF T;  4TV9 E;  4AIU A;  2XSB A;  5ABH A;  4DBQ A;  3AA7 B;  5A1L A;  3RPU A;  4HKA A;  5FY0 A;  3UUM A;  2KC0 A;  4ZI7 E;  1IBM T;  4DMV A;  3DA4 A;  4DV4 T;  4U7Y A;  4CI2 B;  4B61 A;  3SYB A;  3PV0 F;  2V7I A;  3DWO X;  2N2M A;  3HOL A;  3VHL A;  3KV4 A;  4H9N C;  2JMH A;  3MJX A;  4HFD A;  2N2L A;  3LK4 1;  5IYU A;  3AA1 B;  2KXP B;  4DV2 T;  3T0S A;  5FP3 A;  5FMN A;  4EOZ B;  2NR4 A;  2M6I A;  3H3A A;  2PG8 A;  4M1P A;  3PUG A;  4UIG A;  3WAK A;  1BXW A;  3PTR B;  3RF1 A;  5AQV B;  2CWY A;  4UV8 B;  2RPA A;  1OWA A;  2J47 A;  2WDQ A;  2LJL A;  3LSV A;  1IBL T;  1HXX A;  5AQT B;  2V5C A;  3CML A;  4NUU A;  4OYK A;  3AE2 A;  2IW5 B;  4DV1 T;  5ABF B;  3VZT X;  4YY3 T;  3RGL A;  4LSF A;  3TZG A;  1QLB A;  3FBL A;  3AED A;  5ABG A;  1QJ8 A;  3L3P A;  4WBO A;  4FUV A;  5HAX A;  5LHG B;  2AE9 A;  5TIS O;  2XE1 A;  2E9X D;  4ZXL A;  2X9Y A;  1KFY A;  3ZCI A;  2FUP A;  2DCF A;  5LG3 A;  1HR0 T;  3B57 A;  2MYS A;  3OBV E;  2M07 A;  4D5U A;  4PJM A;  4U33 A;  2XQ3 A;  1KNR A;  2H3R A;  3VU7 H;  2K24 A;  4FMS A;  5LHH B;  2LSY A;  3UU8 A;  1ZHZ A;  2K0L A;  1FMV A;  1N32 T;  1T16 A;  4AKR B;  5EE2 A; 
#chains in the Genus database with same CATH homology
 3G7G A;  3LBX B;  2RA1 A;  4X1Y E;  3O0E A;  3UAQ A;  3MA9 A;  5L3B B;  4CXX A;  5F3J A;  5JDP A;  2X9X A;  2VKO A;  4AQF C;  1QSD A;  1Q9F A;  4N59 A;  2W63 A;  4L0R A;  3ANW B;  2CXD A;  4QXC B;  4EXT A;  3C98 B;  4O3X B;  3UUX B;  3NZQ A;  4CXY A;  1GFM A;  2ERV A;  4FSP A;  4ZI2 D;  4AKI A;  3POU A;  3KV9 A;  5JRE A;  4PJJ A;  1H7C A;  4O2A E;  1BH3 A;  3AAA B;  2XAH B;  3KV5 A;  3ONX A;  3VY9 X;  4H9O C;  3QRA A;  4PK5 A;  5LGN B;  3PU3 A;  2KND A;  4IE5 A;  4UEM A;  3Q9D A;  2V1D B;  3LK3 A;  2CA5 A;  4IE0 A;  4L5G A;  1US7 B;  1MMD A;  2CMR A;  2DNX A;  4ILU A;  4PUX A;  3SZV A;  4CI1 B;  2Q9Q B;  3N9M A;  4X1K E;  4AYI D;  4EB6 E;  4KUM B;  2FGR A;  3U78 A;  2X9W A;  2XUE A;  3SY7 A;  3N9N A;  1YS5 A;  3C4Z A;  3MK7 C;  4CI3 B;  3PU8 A;  4O4L E;  5HYA A;  3RRW A;  4JEU B;  4YFS A;  1G90 A;  2YPV A;  2WMO A;  3NZP A;  1WRD A;  4I4T E;  4JUY A;  1MND A;  3SWH A;  3DA3 A;  1EZ3 A;  3RYF E;  1UCU A;  5KDM C;  2KWH A;  2C5J A;  5JRC A;  2XE5 A;  4RJW A;  4PK4 A;  4QQ1 A;  4Z8X A;  3C50 A;  3AAI A;  4UVA B;  5EK3 A;  5E0O A;  5JQG E;  4JFB A;  2JMK A;  2Y8D A;  1ZHX A;  5LP6 E;  4BJN A;  4NUV A;  1ZHY A;  4GOU A;  4GIW A;  4PW8 A;  4XZC A;  4O3W A;  2LSG A;  2WM9 A;  1S35 A;  3OYX A;  2GK9 A;  2QA7 A;  2C5K T;  3RKO A;  4AKL A;  2Y6X A;  5FXW A;  4ZS3 A;  2W61 A;  3R6N A;  3UFE A;  2W00 A;  3BQL A;  4J2C A;  2IC6 A;  3AA0 B;  3ZEF B;  1MIY A;  2XTQ A;  4TZ4 C;  1D1A A;  2NW7 A;  3RBH A;  4UV9 B;  1OSM A;  3AAE A;  4O3Z A;  2YNK A;  5PRN A;  4AYN A;  3AB3 B;  1D0Y A;  3HKE E;  2YU2 A;  2X66 A;  1YKE B;  4AXP A;  5L2L A;  5L3D B;  3T24 A;  5DQW A;  3LG7 A;  4GCP A;  3E0Z A;  4AI6 A;  1HTJ F;  2F1V A;  4UXN B;  5AFU K;  4ASK A;  2Q9Q C;  1WYB A;  2VWA A;  4O3Y A;  1BR4 A;  4U72 A;  5JDM A;  2D0U A;  4JCH A;  2X68 A;  2X0L B;  3LK4 2;  3SZD A;  2CXL A;  2PFV A;  2W0G A;  3LFM A;  4FJO A;  5H6R B;  3GA8 A;  4G75 A;  2RP4 A;  5LBQ B;  5LYJ E;  2NOX A;  2XAJ B;  3LK2 B;  2VKD A;  4DVD A;  3VE2 A;  5J2U E;  5LJN A;  2IC9 A;  2YIN A;  4B6X A;  4EZ4 A;  3ANW A;  3GN5 B;  4DMW A;  3RC8 A;  2PRN A;  3VY8 X;  5EK2 A;  2IAK A;  2KZ7 A;  2LT3 A;  3F2E A;  4WNK A;  4FT6 A;  4GYR A;  4ANJ A;  1ZHT A;  5CA1 E;  1MIW A;  2NTY A;  1NWM X;  3ZN0 B;  5JDL A;  4E1S A;  2OMF A;  1Z0P A;  5DAB A;  3AA7 A;  4PAG A;  3AAA A;  1BR1 A;  2WWU A;  5JVD E;  2LHR A;  4P0B A;  1MM4 A;  2L9Q A;  2Y7S A;  3KIN B;  3RYI E;  4RJX A;  2D2S A;  3CPZ A;  2NW9 A;  3P7I A;  3HWB A;  4D65 A;  2E9X A;  3E08 A;  3N9O A;  2W81 C;  2EHO B;  2A2F X;  3HKC E;  3A2S X;  3PRN A;  2Q9Q D;  4FZL A;  4AYE C;  3L09 A;  3AA6 B;  4FSO A;  1MMA A;  4QX8 B;  2XMX A;  3O1J A;  2LE8 A;  3NRX A;  3QUJ A;  1OPF A;  3IBP A;  4MFR A;  4UVC B;  4TV8 E;  3V5U A;  4EIW A;  5HWX A;  4FRX A;  3K8P C;  2N2N A;  3ZN1 B;  2F1T A;  2JMM A;  2LHN A;  4AUI A;  3SY9 A;  4QKN A;  4AKM A;  1IJ5 A;  4X20 E;  2K9A A;  4ZI2 C;  2NP9 A;  1NAF A;  2LFU A;  4AKH A;  1GFP A;  1X79 A;  2W62 A;  2Y0K A;  2CXF A;  4LSH A;  3F57 A;  3LJC A;  2ZMA A;  4PFP A;  4RLC A;  3N9P A;  3AA1 A;  2KXP A;  4G63 A;  3ZMT B;  3MAC A;  3ZJ1 A;  3VZW X;  3OYZ A;  2YU1 A;  2Y0L A;  2WMN A;  3ETU A;  3GP6 A;  3UUL A;  2OA5 A;  5JDH A;  1MIV A;  4F6R C;  3HR0 A;  4DO0 A;  3POR A;  4U9C A;  3DP7 A;  3C64 A;  3AA0 A;  4G76 A;  2LSK A;  3Q5X A;  2VKH A;  2DWK A;  2JQQ A;  4XNL A;  1MPF A;  2V26 A;  5GON E;  4U74 A;  1T98 A;  3FB2 A;  4CZZ B;  2ZM8 A;  3A5X A;  3EMN X;  4H9S E;  3JC6 D;  2KIN B;  1ZKE A;  3KVD D;  3FBZ A;  5LHI B;  3H37 A;  2EHO C;  2X51 A;  2H7V C;  3EVY A;  3WI4 A;  3N2K E;  1QUU A;  4XAX B;  2KLQ A;  3AVR A;  5FY7 A;  5L3F B;  1BT9 A;  2K4T A;  4E1T A;  2J1D G;  2CCQ A;  6PRN A;  2FGQ X;  2A72 A;  2O4V A;  2YEV C;  3SRZ A;  2CLY B;  2A3D A;  3CX8 B;  3HL6 A;  3ZMS B;  5LGU B;  4H9P C;  4KRA A;  4I55 E;  2LHF A;  2POR A;  5ADX L;  4AQF A;  1HX8 A;  1GFO A;  1ZHW A;  4UF0 B;  1E54 A;  5L3C B;  3Q5W A;  4IGU A;  4DBR A;  2MHL A;  3S4U A;  4O49 A;  2M67 A;  4ZI3 D;  3BK9 A;  3HA4 A;  3NRY A;  2N1G A;  4FZN A;  1MMN A;  3KBU A;  5JH7 E;  5HXH A;  2JRK A;  3IF8 B;  3OKQ A;  3ZMZ B;  2EHO D;  2PJQ A;  5T5F A;  3N5L A;  1IJ6 A;  4YLH A;  5D5D A;  5FY1 A;  4HN9 A;  4O4I E;  4AKG A;  1HG5 A;  1THQ A;  3RYC E;  1SHZ C;  3UU2 A;  2L3L A;  3O1H A;  4G2A A;  2K5B B;  4EZH A;  3ZJ2 A;  2Y2X A;  5DL8 A;  3GMI A;  3I0Q A;  3MZK B;  2D0T A;  4HEA A;  4OHF A;  2J1N A;  3PQS A;  4P0A A;  1HCI A;  5H6Q B;  3EDU A;  4WBN E;  4MAL A;  2K48 A;  2KMF A;  4V1A v;  3PQU A;  4WW0 A;  4DND A;  4KR8 A;  2ACX A;  2XHE B;  3ZC0 A;  2ZFG A;  3PE0 A;  5JR9 B;  5HXC A;  2Y0H A;  4KBM B;  2WBL A;  4JEH B;  4QHO A;  3JTY A;  2CM0 A;  5FXV A;  1ZV4 X;  1BR2 A;  3ZC1 A;  4O2B E;  1MMG A;  2QTK A;  4FRT A;  3KV6 A;  5M4Y A;  4KR4 A;  2N9D A;  3Q2M A;  1V9D A;  3RX6 A;  2LSI A;  4HFV A;  4K0U A;  2X27 X;  4I43 B;  3C4X A;  4AKR A;  1VOM A;  4GF4 A;  3LBX A;  2B1E A;  2H7O A;  1LVK A;  2CLY C;  2C0S A;  3U3I A;  2BVM A;  3CQX C;  1QJ9 A;  2YK0 A;  1D0X A;  2HPJ A;  4GCQ A;  3VKG A;  1KK7 A;  5L3E B;  4BA9 A;  2ODJ A;  3NSG A;  4EYY R;  1U5P A;  5J1G A;  1P4T A;  3SYS A;  1IZN B;  1AJ3 A;  2C5I T;  2ODU A;  4TUY E;  5IYZ E;  3KVA A;  2GE4 A;  2MTQ A;  3V8U A;  5CB4 E;  4A56 A;  1D1C A;  1CUN A;  4P09 A;  5CA0 E;  4O4H E;  3I0O A;  1HS7 A;  3BQK A;  5LGT B;  5F8P A;  1D1B A;  2DWG A;  4KMC A;  3KFW X;  3LK3 B;  4L9I A;  1LKX A;  2Q9Q A;  2XAF B;  1H6S 1;  3QRC A;  4BJM A;  2LM9 A;  5JDG A;  2ODV A;  5TAO A;  4YHJ A;  4ZHQ E;  5HXR A;  2ZM0 A;  3CX7 B;  2KWI B;  3PDY A;  1G8X A;  3QK6 A;  4IE6 A;  4PJL A;  4MHC A;  3WI3 A;  1VRB A;  5JR9 C;  4LSI A;  2DLR A;  2L8K A;  3JC6 C;  4FOZ A;  4N78 D;  5DQV A;  4N58 A;  2M06 A;  3UUN A;  5BMV E;  5DL7 A;  4O4J E;  2DHR A;  4H63 H;  3SS1 A;  4LSE A;  3N9L A;  4F4B A;  4PFO A;  3RYH E;  3KDS E;  4GK0 E;  4QWN B;  1WR6 A;  1B7T A;  1YKH B;  3K19 A;  4BUM X;  1G73 A;  2HH7 A;  5L3G B;  4KP3 C;  5ADX K;  2CEA A;  4I50 E;  3FHN A;  5EE2 A;  2X9H A;  1OXZ A;  3NBX X;  1GFQ A;  3VE1 A;  3C5O A;  3FYX A;  5LBM A;  5HXS A;  3P8C D;  5KX5 E;  7PRN A;  1ORM A;  4H9R C;  4EYU A;  4OK0 A;  2BZB A;  1ZHC A;  4ZI3 C;  3AAE B;  5LOV E;  1D0Z A;  3CKD A;  3CX6 B;  4E7Z A;  3I9Y A;  1Y64 B;  2BVL A;  2WSS V;  4QX7 B;  2DI4 A;  1YW0 A;  4JLE A;  3HW9 A;  4ZOL E;  3E22 E;  1O3X A;  4FI5 A;  4HGA A;  2BDE A;  4OYJ A;  3ZMU B;  3UT5 E;  3VZU X;  4XBF B;  3WAJ A;  3HKD E;  3V5S A;  2KDY A;  3J9X 1;  3K3N A;  4GK5 E;  3UTK A;  3LK2 A;  3ESL A;  3ZYL A;  4EAH A;  3GN5 A;  3CQG B;  3I9W A;  3N2G E;  1FMW A;  4AYM C;  1IZN A;  2XQY A;  4YJ3 E;  2W80 C;  1FIO A;  2KZ7 B;  3M65 A;  5C8Y E;  5DL5 A;  4GYS A;  2X67 A;  3GWH A;  1KNZ A;  5JDF A;  5LJM A;  4TV9 E;  4CXW A;  3BQI A;  3T8O A;  4AYD C;  4ERR A;  5KMG P;  4AZL A;  8PRN A;  2JJ9 A;  2MOZ A;  4DBQ A;  3AA7 B;  5A1L A;  3RPU A;  1BR0 A;  3VKH A;  4ZS2 A;  4HKA A;  5FY0 A;  3UUM A;  2SPC A;  3C4W A;  3PUQ A;  2KC0 A;  3K3Q C;  2EHO A;  4IDZ A;  5FYM A;  4AFK A;  1UX5 A;  2PBI A;  2V7K A;  2E9X B;  4ZI7 E;  2VAS A;  3AA6 A;  4DMV A;  2KT9 A;  3WI5 A;  3DA4 A;  2I59 A;  2XAQ B;  3I1A A;  1SA0 E;  2G0U A;  4PK6 A;  3POX A;  3RRC A;  2P9B A;  3RC3 A;  5FXX A;  3W15 B;  3KVB A;  5HXE A;  4CI2 B;  2NW8 A;  5JDN A;  3N2O A;  1HXU A;  4O4X A;  4B61 A;  4HE8 A;  3SYB A;  3HKB E;  1HXT A;  2ZLY A;  3ZYM A;  4E7S A;  2V7I A;  4RLB A;  4C90 A;  2V7M A;  2N2M A;  3HOL A;  3POQ A;  2QGS A;  3VHL A;  3KV4 A;  4H9N C;  3J7Y q;  1QJP A;  2JMH A;  3MJX A;  4IST A;  2XAG B;  5EZY E;  1YD8 G;  2N2L A;  3LK4 1;  1MNE A;  2JPF A;  5EK4 A;  5IYU A;  2UXN B;  5JDQ A;  2XAS B;  3IEE A;  3AA1 B;  2KXP B;  3D0T A;  2UXX B;  3PUA A;  3T0S A;  5FNV E;  1U4Q A;  5FP3 A;  5FMN A;  4EOZ B;  4C69 X;  3QC9 A;  2CE7 A;  3EDV A;  3H3A A;  2PG8 A;  4H63 V;  4M1P A;  3PUG A;  4O4U A;  3T20 A;  4UIG A;  3WAK A;  3SOL A;  1BXW A;  3IHR A;  3PTR B;  5G26 A;  2CWY A;  2LOP A;  2ES0 A;  2XTL A;  3CWZ B;  3N9Q A;  2LOS A;  4UV8 B;  2ZLD A;  2LEH A;  1PRN A;  3F31 A;  2Y48 B;  2XTR A;  1OWA A;  2XG6 A;  2HPL A;  2LJL A;  1FEW A;  1HFA A;  2CWO A;  2V7L A;  3DTO A;  4YJ2 E;  5DL6 A;  2V7J A;  4TN7 B;  2J4U P;  2WAU A;  1HXX A;  2E9X C;  3FXE B;  4MLK A;  4CQI A;  3PUS A;  4H9Q C;  5LA6 E;  4D64 A;  3AVS A;  3CML A;  2MBG A;  4NUU A;  4OYK A;  5LXT E;  5IHY A;  2IW5 B;  1HF8 A;  3FXD B;  1HG2 A;  3OJA A;  4IIJ E;  1ZEE A;  2E8I A;  4IE4 A;  2NWB A;  4UVB B;  5LNK A;  1WLX A;  4QXB B;  4QXH B;  4TX5 A;  3VZT X;  4AQG A;  4LSF A;  3TZG A;  4X1I E;  3C51 A;  4RL9 A;  3O4X E;  3MXZ A;  4HTE A;  3RH3 A;  4O8S A;  2Z6E A;  4UF0 A;  3FBL A;  4XNK A;  4ISS A;  3CVR A;  3UPG A;  3ETV A;  2VKJ A;  4MBQ A;  4BAY B;  2XE2 A;  3DJB A;  4UEL A;  2NTX A;  5LCY A;  1QJ8 A;  3HI2 A;  3L3P A;  4ADZ A;  3K3O A;  5DJQ C;  4WBO A;  5J2T E;  5JRC B;  4FUV A;  5HAX A;  5LHG B;  2MNH A;  4PJN A;  3ZPO A;  1GFN A;  1LRZ A;  2XE1 A;  3O1I A;  2E9X D;  2ZM2 A;  1PHO A;  2X9Y A;  5GV0 A;  4FES A;  2D5U A;  1S94 A;  3KBT A;  2XE3 A;  4GCS A;  1IAP A;  1MM5 A;  3ZYK A;  5AFU L;  3ZCI A;  2DCF A;  5HWY A;  1LVF A;  3B57 A;  1Q9G A;  4FZM A;  2MYS A;  4Z3T A;  3OBV E;  2M07 A;  4PNI A;  5FXZ A;  2VB6 A;  4PJM A;  5JR9 A;  1E1H B;  4D5U A;  3ZLI A;  2VL8 A;  2H3R A;  2LSJ A;  3TKL B;  2K24 A;  3VU7 H;  4FMS A;  3ZCJ A;  2VK9 A;  5LHH B;  4IHJ E;  2LSY A;  4OFZ A;  3B13 A;  4IE7 A;  1ZHZ A;  3PUR A;  4GHB A;  2K0L A;  5FVN A;  3EUH A;  5LG4 A;  1FMV A;  3O9X A;  4C91 A;  3MKD A;  5ETW A;  3HOE A;  3R84 B;  3ZMV B;  3CQC B;  4AKR B;  1WYC A;  1UX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...