3AAAB

Crystal structure of actin capping protein in complex with v-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 82
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaaB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaaB02
3AA0A 3AA6A 3AAAA 3LK41 3AA7B 1IZNB 2KXPA 4AKRB 3LK3A 5AFUK 5ADXL 3AAEB 3AA1A 3AA0B 3AA6B 2KZ7A 3AAAB 2KXPB 3LK2A 3LK3B 5ADXK 3AA7A 3AA1B 5AFUL 1IZNA 4AKRA 2KZ7B 3AAEA 3LK42 3LK2B
chains in the Genus database with same CATH superfamily
5EZYE 3VZTX 3CQCB 5ABFA 1EZ3A 2V7IA 3P8CD 5FKYA 2N1GA 1IAPA 2KT9A 2X66A 5AQUB 4CZZB 4XAXB 2XUEA 5FP3A 4GOUA 4AYID 1LVKA 3ZSSA 3H37A 4UR9A 5CB4E 6PRNA 1BH3A 2UXNB 3AE6A 2V7MA 4U7YA 2R4OA 2VKDA 4X66T 1ZOYA 4DV0T 5FVKA 4O4LE 3AA0B 1OXZA 5JDFA 3I0OA 2NW8A 5FL0A 2PG8A 2CEAA 4HKAA 3PGUA 3NRXA 3I1AA 2I59A 3UU2A 3C51A 3EMNX 2E9XC 4BJNA 3H3AA 2QA7A 4YJ2E 2MOZA 2XM1A 4N74A 1BXWA 3P50A 5L3BB 1T98A 2WWUA 2J47A 4X1YE 5AQRB 3ZT7A 4LFAT 1R8IA 3POXA 2JJ9A 5IUXA 4YTNA 1HNWT 2XQAA 4AQFC 2ACZA 4Z91A 4ZI2D 3PE0A 3ZYKA 4C4VA 4F4BA 3PUYF 2FJEA 2ZM8A 3F31A 4QXCB 2H3RA 3RLFF 2M67A 2HPJA 5TAOA 3T20A 4GCPA 5BR8T 3P7IA 4TV9E 2A3DA 4COFA 1QUUA 4O4UA 5G26A 4OYKA 3OBVE 4IE4A 2BKPA 5AFUL 5F8PA 2X0HA 3O0EA 3KZIO 3EAMA 2H89A 3RIAA 4HWHA 4IDNA 5JREA 1VRBA 2WMNA 4IL6O 3NWIA 5B5EO 4L0RA 4PJMA 4AISA 1T8BA 4BA9A 1WCRA 4JI6T 2ZLYA 4ZHQE 2E9XD 3AAIA 3PU3A 3UUBA 2PJQA 4P09A 2H7OA 4IIJE 4FSOA 3HL6A 1ZHWA 4YTPA 3Q5DA 2XQ9A 1ZHTA 1SHZC 3KBUA 3N2KE 2BBJA 1IBKT 3LK2B 3AE7A 3NSGA 4QXBB 2FUPA 4TWHA 2M6IA 3RGLA 5LG4A 5LYJE 2OV9A 5ABFB 2XAGB 3NZQA 5A1LA 3MA9A 3N9MA 2RA1A 4ILAA 3UFGA 2N2MA 5IWAT 3B57A 4A97A 2L3LA 4LF9T 5FXWA 2RP4A 2D0UA 3KDSE 4DUZT 2IWWA 3ONJA 1HG2A 4FI5A 2NW9A 2WZIA 1H7CA 2QGSA 4G2AA 1OSMA 4U2YA 5F3JA 2CWOA 3BRYA 3L09A 5BMVE 3ANWB 3AB3B 3SWHA 5B66O 2KWIB 2YU2A 2H7VC 3ZMSB 1J5WA 4B3MT 2M6BA 2Y8DA 3RHWA 4DR7T 2KSRA 1GFMA 2UXXB 3LK3A 1UGOA 3P4RA 5E0OA 5EK4A 1Q9GA 2B76A 3K3OA 4PK4A 3RQUA 4FJOA 3C4ZA 4H9PC 3HKEE 1Z0PA 2J1DG 2JMKA 4G75A 3AEGA 4C4VB 2Y0HA 1YQ4A 4HWIB 1GFOA 2DLRA 1X79A 4HE8A 5JDPA 3FZMB 2VQET 4JLEA 3F57A 3CMLA 1KFYA 2DHRA 1T7SA 4K0UA 4GKJT 3F2EA 2LLYA 5L3DB 2WU2A 2WCAA 1YXRA 1M7KA 4NUVA 2W0GA 3KV6A 2WWVA 1E1HB 3QB5A 1G8XA 2YINA 2BZBA 4I0UA 5LA6E 2X9WA 2W00A 1N34T 1T72A 3PUAA 3C5OA 3OPCA 1FIOA 3K3QC 5LHIB 4JI4T 4D64A 2VQFT 5IHYA 3K8PC 2CHNA 3N2GE 1WFDA 3KVBA 4MALA 4GCQA 5LHGB 2V1DB 3UFEA 2XE2A 5D5DA 2WSSV 5DQWA 2NW7A 4OYJA 4QWNB 2ODUA 2PRNA 2FBWA 5KAFO 2XTLA 1T1LA 2PORA 2EHOA 5LMNT 2IC6A 2Y6XA 3ONLC 5F5WA 1JNRA 2LSGA 1XNRT 2CHOA 4F6RC 2ERVA 4CI1B 4EYYR 3NJTA 3VRAA 4MFRA 4DR6T 3POUA 2CXFA 2JPFA 4OHFA 5LG3A 3KVAA 1HNZT 2N9DA 5CGMA 3W15B 2KLQA 4LFCT 3FHNA 5KAIO 4AYMC 2W4XA 4N75A 4OK0A 4H9SE 3MZKB 1ORMA 2V6YA 4HN9A 3FXEB 3PURA 4FOZA 4KBMB 2ZM0A 2L9QA 4B6XA 4AXPA 2YEVC 4ZI3C 2IMLA 2C5IT 5FY1A 4EYUA 2X9KA 4C69X 4IHJE 4O8SA 3VZUX 2LSJA 5ADXK 7PRNA 4QX7B 1OWAA 3T24A 3PV0F 2DNXA 3A2SX 1YS5A 3HOEA 2WY2A 4HFVA 3AE5A 4EZ4A 3VY8X 3QRCA 1HR0T 3N9OA 4DVDA 3CKDA 1D0ZA 4B3ST 3AEBA 4L9IA 4HFBA 1PHOA 4I4TE 2X9XA 4AYDC 3AVRA 2WU5A 3RQWA 4WNKA 1ZHYA 2LM9A 2X68A 2JQ9A 3JCFA 1XDOA 3ZSTA 4MLKA 1HXUA 3AE9A 2XAJB 3DWOX 5EE2A 1Z8UA 5H6RB 1W0AA 2FGQX 2M07A 2QVAA 1OPFA 4GF4A 2A2FX 5HEJA 3PRNA 5E79O 3WAJA 2LOPA 2XSAA 2VKJA 4ZI3D 2IIUA 2FGRA 1D0XA 3O9XA 2QYWA 2V7KA 4O3ZA 4DMWA 3E0ZA 3EABA 1UK5A 1V9DA 5CA1E 2K24A 5LMUT 1FEWA 4C91A 4K3CA 3P4QA 3AA6A 3Q5XA 3VHLA 3IBPA 4KUMB 5GONE 5LGUB 3FXDB 4L5GA 1W0BA 3H3MA 2JQYA 4PJLA 3VE2A 5GV0A 2Y0LA 2NTYA 3MKDA 2MYSA 3I9WA 1BR0A 4UEMA 5AQTB 4LMJA 1D0YA 5JTGA 2YPVA 2W67A 3RKOA 5JQGE 2J1NA 1XMQT 4U7IA 3L39A 4ZS3A 2Y0KA 1ZHXA 2CXDA 3KV4A 1MNEA 4G76A 3CVRA 2IUBA 2CE7A 4M1PA 4HFHA 2IDOB 3GWHA 2CA5A 3PTRB 3RX6A 4XNLA 4KR4A 3QK6A 2CM0A 2V6YB 1FMWA 3HA4A 2NP9A 1QJ9A 1MPFA 3V8UA 4DR2T 4IDQA 2W80C 4CTDA 3U3IA 2YU1A 1YKHB 1HNXT 4I55E 4TX5A 4HFDA 5C2TA 3CIRA 4DIDB 4ZXLA 3PORA 3MK7C 3AAEB 4U74A 4E7SA 3HKCE 3AE4A 3CQXC 4BAYB 2WJRA 5FYMA 4LF8T 3BQKA 1D1AA 2H88A 2HHHT 2GE4A 2MAWA 2C5JA 4AKLA 4EOZB 3NVOA 3RKGA 3PUSA 4AIUA 1SA0E 3R6NA 4DO0A 4DNDA 3LBXB 4JI0T 3GMIA 4O2AE 5LJNA 4IDOA 2A72A 4QH5A 2LHRA 3C4WA 1E2AA 3BK9A 5L47A 3PUXF 1G73A 3OVUA 3ZMVB 2W66A 2Q9QA 4AZLA 2CXLA 1WRDA 1HX8A 4B3RT 4MHCA 3QRAA 3ZKRA 4JV5T 3RIUA 4EEDA 2AXDS 5HXSA 3LJCA 4RJWA 3HR0A 3IF8B 2XPKA 3DTOA 4NIQA 2VKHA 3LK41 3VE1A 3Q5EA 4ILUA 4NPPA 2K9AA 3AEAA 5L4HA 3KV5A 3RIFA 1N32T 4JBWF 2VL8A 2N2NA 3AA6B 4KI0F 1LKXA 4A5XA 2UUBT 2XE3A 2JRKA 1KEYA 4GYRA 1MMNA 2Z6EA 4CI3B 3EI0A 3C4XA 1M62A 4KHPT 3A0BO 3PUGA 2BS4A 3UUXB 2D2SA 4PFPA 3QB5K 2K3WA 2FJDA 2VVNA 5KX5E 5HEGA 4EZHA 4EV6A 2BDEA 4F8HA 2XQ7A 2LJLA 3QOFA 3DJBA 5FVLA 5DJQC 1KF6A 4HWDA 2PFVA 3RH3A 2BKOA 4YHHT 1ZKEA 5JRCB 4O4JE 5TISO 2CLYB 4B3TT 5G3AA 2W63A 1D1CA 4RJXA 5FMNA 3CPZA 4KR8A 4JI2T 2E8IA 2XE1A 2ODVA 4ISSA 5HYAA 2ZM6T 2R8AA 4K3BA 2GK9A 2RPAA 2BG9A 2F1VA 4ADZA 3UU5A 4PJJA 3AEFA 2X27X 2XMXA 1QSDA 2Y2XA 4TUYE 1IBLT 1UCUA 3PJAJ 5M4YA 4TNWA 4FESA 4U9CA 1YKEB 1NEKA 1IZNA 2X51A 4YTMA 3AEDA 2CPTA 4RLCA 4N58A 2YDRA 4EGWA 2G0UA 4KP3C 3N9QA 3K19A 2WS3A 3E08A 2R88A 3PQSA 2K48A 4CN1A 3DZMA 2XQ3A 3K3NA 1KNRA 4P0BA 4KHZF 3ZYMA 4ZOLE 4N59A 2FJAA 4QXHB 2KMFA 3ZJ2A 3UU6A 2Q9QB 4CN4A 3V5SA 2JQQA 3CX8B 2F1TA 4JEHB 4PAGA 2LE8A 3BRZA 5JR9A 3ZN0B 2BG9E 3ZEFB 4JI8T 2LM2A 1SE7A 4P1NA 4H9OC 2CBIA 1VOMA 3AE8A 2W81C 2LHNA 3WI5A 3ZCIA 1B7TA 4PR7A 4LF7T 3U78A 1S5LO 5J2UE 5HXEA 2BVMA 4IGUA 2UXBT 1MMGA 2WVPA 2YOEA 2MNHA 2JMHA 2BS3A 1J1JA 3DA3A 2XHEB 4EIWA 1GFQA 1FMVA 5DL6A 3D0TA 4UB8O 5LB7B 1BR1A 5ADXL 4AKIA 2VASA 1KNPA 1ZEEA 3FZHB 1O3XA 3NBXX 3CQGB 2R89A 5LGTB 2EHOD 4ERRA 4X65T 2WMOA 2NTXA 5C3JA 1P4TA 2LKHA 4EAHA 4WW0A 1W09A 3J9X1 2Y7SA 3T1HT 2I6HA 2QRXA 2K4TA 2V8SV 2V7JA 2UUCT 3G06A 5L4EA 3L8RA 5HCJA 4IREA 5C8YE 4AKRA 3TLVA 2V26A 4NUUA 2LOSA 5LBQB 3AVSA 3KVDD 3ZLIA 2BG9B 2KXPA 2WP9A 4I43B 4U2ZA 4ISTA 3JTYA 4O3XB 5FY0A 1XDPA 2XAHB 4DV6T 4E1SA 5JDMA 2WM9A 2C0SA 5J2TE 3O1JA 1HS7A 1IZNB 5JDQA 1IJ6A 2D0TA 2VKOA 5L3FB 4QQ1A 3JC6C 5AQSB 2LHFA 1VCTA 1NAFA 5FY7A 3UULA 4EEBA 4WZXA 3KBTA 3AA7A 4GK0E 5DL5A 3HOLA 1T16A 4ZEYA 4IL9A 3AAAA 4GKKT 4AYEC 3SZDA 5EK2A 1L0VA 5AQGB 2JIWA 3CK6A 5J0ZA 4E7ZA 1D1BA 4QKNA 3IA3A 2HPLA 4KMCA 4UXNB 4YLHA 3LK3B 4DV7T 3PF1A 4U72A 3A5XA 2BKNA 4ILCA 5JR9B 4CXYA 2KWHA 2UUAT 3UUMA 2R4LA 4U33A 4FQEA 3OTOT 4DBQA 2CLYC 3KV9A 3GN5A 2BBHA 3PUZF 4V1Av 3PJAA 4H9NC 4X64T 3HWBA 5LBMA 4JFBA 3NZPA 5HWXA 5HEOA 1MMAA 3TZGA 4AKHA 1UURA 1UUSA 5IYZE 1W9RA 2AE9A 3JC6D 4G63A 3RF1A 1GFNA 3VR9A 4B61A 4UB6O 3RC8A 1HXXA 2XTQA 1IBMT 2VB6A 3TLUA 3IHRA 2XAFB 2VK9A 1UX4A 4O4HE 2KDYA 5LJMA 5EK3A 1HCIA 2DWKA 5H6QB 5HCMA 2CMRA 4UV9B 3SRZA 2PBIA 4Q25A 3C64A 2X9YA 5JDHA 5H2FO 3HW9A 5AQKB 4FT6A 2CRBA 3K1SA 3RC3A 4HWCA 5AQOB 2XZEA 2DWGA 4H63H 1E54A 1BR2A 4PK5A 4GYSA 3VKHA 3A0HO 4AFKA 3ETVA 1HTJF 4AKRB 4OX9T 1H6S1 5L2LA 3AXJA 2MBGA 4JI5T 3PU8A 4PFOA 5FXZA 3T0SA 2LRLA 2Q9QC 2KXPB 4PNIA 4AKMA 2EHOB 3KFWX 2AXTO 3B13A 4LSFA 4YHJA 2MPKA 1I6ZA 3EDUA 5DL8A 3N2OA 3RIUC 1THQA 5GTIO 3RPUA 4NXNT 3TLSA 3PGSA 3ONXA 2WDQA 3RRWA 4DR1T 2N2LA 2HN1A 5JDLA 2O4VA 5HXCA 3FYXA 4FZMA 1HF8A 4DR5T 2E2AA 3Q9DA 5ETWA 1QJ8A 5DL7A 3RYHE 8PRNA 3ESLA 4U3CA 5AQJB 3PQUA 5KXJA 1DU2A 3AA7B 2LKGA 5AQIB 4O4XA 2MTQA 2XQ5A 3WU2O 3FZFB 5LGNB 4DMVA 3UUNA 5FXXA 4IE7A 1HXTA 1QLBA 5IYUA 4U31A 3ETUA 3Q5WA 3RYCE 1NENA 1U5PA 3VRBA 4LF5T 2CCQA 3T8OA 3UT5E 1LRZA 1WR0A 5AQPB 3EVYA 3E22E 4IE5A 3G7GA 3VKGA 2Q9QD 4JCHA 2XSBA 4DV1T 3GN5B 4NXMT 4JYAT 4QH1A 2JQHA 4RL9A 1CUNA 2I0MA 3UTKA 4PJNA 5KMGP 3NKZA 4JUYA 5CFBA 4C90A 4DR4T 2V6XA 2BG9C 4X62T 5JVDE 4DV4T 3AE2A 4HFCA 1US7B 1MNDA 5CJ5A 4YJ3E 2SPCA 2J4GA 4YSXA 4AYNA 2YDSA 4JEUB 1XNQT 2NOXA 3TKLB 1CHUA 4YSYA 2L8KA 1ZV4X 3TLTA 3LG7A 1AJ3A 2XY8B 3ANWA 1GQEA 5AQNB 5T5FA 2VL0A 2BVLA 3DWNA 3SFEA 2KZ7A 4TZ4C 3GP6A 1KNZA 4DBRA 2HN2A 4UVBB 1JNZA 2XE5A 1QJPA 3QUJA 4CI2B 2A9UA 2V7LA 5HWYA 1OEDA 5DABA 3UAQA 2OA5A 4FUVA 3AE3A 2ZLDA 4ZZCA 2WBLA 3O1HA 2CBJA 2J62A 3NRYA 2WB5A 5KDMC 3I9YA 4UV8B 5JH7E 3AXJB 3DA4A 5AQLB 4LF4T 2XM2A 3WAKA 2XAQB 4LMLA 2JMMA 4FSPA 5JR9C 5ABEA 4GCSA 2HH7A 4BJMA 5G39A 2M06A 4IE6A 2VURA 2ACXA 3L3PA 5HEHA 1J5ET 5ABGA 4TV8E 3OJAA 1IJ5A 3LK42 3EUHA 2Y48B 4X20E 4UIGA 3WI4A 4O2BE 3MACA 3V5UA 1LVFA 2YNKA 3OYZA 4X1IE 4HFEA 5L3CB 2K0LA 3PUVF 4IT4A 3BS0A 4HWFA 3LSVA 3UU3A 1OEDE 1VCSA 3CWZB 3VU7H 2IW5B 2WZHA 2LFUA 2YN6A 3JAEA 2P9BA 2R4PA 1XZYA 1MIVA 3UU8A 3CX7B 5FXVA 3FZLB 4Z90A 3SFDA 3JAFA 3RBHA 1Y01A 1Y64B 3ZCJA 3HI2A 2LSKA 3C98B 4IL4A 4WYVA 2ZM2A 4XBFB 3P4WA 2D9DA 3AA1A 2E9XA 1I94T 3DP7A 5HAXA 4PJ0O 3PGRA 2IWVA 1WYBA 1XMOT 3IEEA 3POQA 1XWMA 1S94A 1WR6A 5LXTE 2EHOC 3FBLA 5CA0E 2KINB 3LDQB 1N36T 3N5LA 4A56A 1MIYA 4AQFA 2LRKA 2XQ4A 5ABHA 2B1EA 2W2UA 3KINB 4D5UA 1BR4A 4BUMX 5AQHB 2XG6A 4LSHA 5HXHA 4A98A 3OKQA 4Z8XA 2KZ7B 3VR8A 2UU9T 3VY9X 3SYBA 5LNKA 2UXCT 1MMDA 2ODJA 5AFUK 4PUXA 3RYIE 4GK5E 3PDYA 4XZCA 3SYSA 1OEDB 3S4UA 4YSZA 2YKSA 1ZHCA 1WYCA 2NWBA 4DV5T 3O4XE 4AI6A 3J7Yq 2R4NA 4PK6A 3C50A 1YQ3A 2WQYA 4AUIA 2WDVA 4HFIA 4C00A 2XJ7A 3ZC1A 4I50E 5LCYA 4AQYT 2ZFGA 4GHBA 5FL1A 2J4UP 2PTFA 4DUYT 2X9HA 4K0KT 3EHZA 3AECA 2X67A 2W61A 4D65A 1MIWA 1WLXA 2XQYA 5FNVE 5LHHB 4YFSA 4P0AA 3WI3A 2MHLA 3RRCA 4UVAB 3P4PA 4IE0A 2KNDA 3PUQA 3ZYLA 3LFMA 4DV3T 4ZZBA 2ZMAA 2XTRA 2LEHA 3O1IA 4DR3T 3RYFE 2LSIA 1Q9FA 4QX8B 4UF0A 2FJBA 3I0QA 3OYXA 4WBOA 1HFAA 4N78D 4FZLA 3UU4A 4IDZA 4WBNE 4ASKA 2F1CX 3ZT5A 3MXZA 4LF6T 2ES0A 4AKGA 4LMKA 1UX5A 3ZMZB 2R6GF 3RI5A 4XNKA 3PUWF 3BQIA 2YDQA 3UQ7A 2K5BB 3SS1A 2X0YA 5AQFB 4UELA 3AA1B 2E9XB 4CQIA 4MBQA 4ZS2A 2XQ8A 4JI3T 1FJGT 2C5KT 3JADA 4UVCB 2IC9A 4JI1T 5AQQB 3ABVA 1YW0A 3T1YT 3M65A 4J2CA 4TWFA 4ILBA 3SY9A 2D5UA 3ZMTB 5JDGA 2OMFA 3ZMUB 4YXDA 2WJQA 3JCUO 3MJXA 4LFBT 4KX6A 2DL1A 2UXDT 3UQ4A 2DCFA 4OFZA 3AAEA 3P4SA 3HKBE 2XQ6A 3TLWA 4FZNA 2VWAA 4HGAA 3AEEA 2LSYA 2E5LT 4LSEA 1KK7A 4YY3T 1N33T 4FRTA 2DI4A 4H9RC 5JDNA 3QNUA 1HX1B 3LBXA 4O4IE 3VZWX 3FB2A 3A8YC 2W62A 3SY7A 5AQMB 3AA0A 4GIWA 1HG5A 1MM4A 4HTEA 5LOVE 3ZT6A 4PW8A 2WDRA 4ZI7E 2X0LB 4CXWA 1NWMX 4X1KE 4AQGA 4X5TA 2CWYA 4H63V 4FMSA 1ZP0A 4HEAA 3M3ZB 3N9LA 3Q2MA 2OLTA 3AE1A 5AQVB 4FRXA 4RLBA 3A7MA 3X1DA 3N9NA 5PRNA 2IHR1 2JQKA 4UF0B 3HKDE 2V5DA 4CN6A 3GA8A 2V5CA 5HXRA 5J1GA 4O49A 2F4VT 5G38A 4O3WA 3ZJ1A 1PRNA 1E7PA 5LP6E 5DQVA 2BS2A 2QTKA 4H9QC 4LSIA 3UPGA 4YT0A 4E1TA 1S35A 3BQLA 3N9PA 3ZPOA 1MM5A 1OEDC 2LT3A 4TNVA 1YD8G 2YK0A 2NR4A 3CX6B 1U4QA 3ZN1B 4Z3TA 1G90A 4KRAA 4EXTA 3B5MA 4QH4A 5GTHO 2E5VA 1ZHZA 4O3YA 3AAAB 3R84B 3SOLA 1BT9A 5JRCA 4TWDA 4CXXA 2XASB 1GFPA 3EDVA 2IAKA 3SZVA 5L3GB 5HEUA 4EB6E 4DV2T 5L3EB 4QHOA 1X9BA 2WAUA 2KC0A 4ANJA 4JI7T 3FBZA 3FZKB 3LK2A 1SUMB 2VVSA 4ZI2C 5FVNA 4IDPA 4TN7B 3ZC0A 3QC9A
chains in the Genus database with same CATH topology
1P4TA 5EZYE 4EAHA 3VZTX 4WW0A 3CQCB 3CWZB 3VU7H 4WNKA 1ZHYA 3J9X1 2IW5B 4I4TE 1EZ3A 2LM9A 2V7IA 2X68A 3P8CD 2Y7SA 2LFUA 2N1GA 1IAPA 2KT9A 2K4TA 2X66A 2P9BA 2V7JA 4MLKA 1HXUA 1MIVA 4CZZB 4XAXB 2XAJB 5EE2A 2XUEA 3CX7B 5FXVA 5FP3A 3RBHA 4GOUA 4AYID 1LVKA 5H6RB 1Y64B 5C8YE 4AKRA 2V26A 4NUUA 3H37A 3ZCJA 2FGQX 3HI2A 2LSKA 3C98B 5CB4E 2M07A 2LOSA 5LBQB 3AVSA 6PRNA 1OPFA 3KVDD 4GF4A 1BH3A 3ZLIA 2UXNB 2ZM2A 2KXPA 4XBFB 2V7MA 2A2FX 3PRNA 4I43B 3WAJA 2LOPA 2VKDA 4ISTA 3JTYA 2VKJA 4ZI3D 3AA1A 4O4LE 3AA0B 2FGRA 4O3XB 2E9XA 1D0XA 3O9XA 1OXZA 3DP7A 5HAXA 5JDFA 3I0OA 2NW8A 5FY0A 2V7KA 2PG8A 4O3ZA 4DMWA 3E0ZA 1WYBA 2CEAA 4HKAA 3NRXA 2XAHB 3IEEA 4E1SA 3I1AA 3POQA 1V9DA 2I59A 3UU2A 1S94A 3C51A 1WR6A 5CA1E 5LXTE 2EHOC 2K24A 5JDMA 3EMNX 1FEWA 2WM9A 2C0SA 3FBLA 2KINB 4C91A 5CA0E 5J2TE 2E9XC 4BJNA 3H3AA 3N5LA 3O1JA 1MIYA 3Q5XA 3VHLA 4A56A 4AQFA 3IBPA 4KUMB 3AA6A 4AYDC 1HS7A 1IZNB 5GONE 2QA7A 5JDQA 1IJ6A 2D0TA 3FXDB 5LGUB 4YJ2E 2MOZA 4L5GA 2B1EA 2VKOA 5L3FB 1BXWA 4QQ1A 5L3BB 1T98A 2WWUA 3JC6C 3KINB 4X1YE 2LHFA 3POXA 1NAFA 4D5UA 2JJ9A 1BR4A 4BUMX 4PJLA 3VE2A 2XG6A 5GV0A 2Y0LA 5FY7A 4AQFC 4LSHA 2NTYA 3MKDA 2MYSA 3I9WA 3UULA 5HXHA 1BR0A 3KBTA 3AA7A 4ZI2D 3OKQA 4GK0E 4Z8XA 2KZ7B 5DL5A 3PE0A 4UEMA 3ZYKA 3HOLA 3VY9X 4F4BA 3SYBA 1D0YA 5LNKA 3AAAA 2ZM8A 2YPVA 3F31A 4QXCB 2H3RA 1MMDA 2M67A 2ODJA 4AYEC 2HPJA 5AFUK 4PUXA 3RKOA 3RYIE 5JQGE 4GK5E 3PDYA 5EK2A 5TAOA 2J1NA 3SZDA 4GCPA 4XZCA 3T20A 3P7IA 4TV9E 4ZS3A 2Y0KA 2A3DA 1ZHXA 1QUUA 4O4UA 4E7ZA 3SYSA 2CXDA 1D1BA 4QKNA 5G26A 2HPLA 3KV4A 1MNEA 4KMCA 3S4UA 4UXNB 4G76A 3CVRA 4YLHA 3LK3B 4OYKA 3OBVE 4U72A 4IE4A 1ZHCA 2CE7A 4M1PA 3A5XA 5AFUL 3GWHA 2CA5A 3PTRB 1WYCA 5F8PA 3RX6A 5JR9B 4CXYA 4XNLA 3O0EA 2KWHA 4KR4A 3QK6A 2CM0A 3UUMA 4D65A 1FMWA 3HA4A 2NWBA 2NP9A 1QJ9A 1MPFA 3V8UA 5JREA 1VRBA 4DBQA 3O4XE 2CLYC 2WMNA 3KV9A 3GN5A 4V1Av 4AI6A 3J7Yq 4H9NC 3HWBA 4PK6A 3C50A 2W80C 4AUIA 5LBMA 3U3IA 4L0RA 2YU1A 4PJMA 1YKHB 3ZC1A 4I50E 5LCYA 4BA9A 3T0SA 2ZFGA 4JFBA 4I55E 4TX5A 3NZPA 4GHBA 2ZLYA 4ZHQE 2E9XD 3AAIA 3PU3A 5HWXA 2PJQA 2J4UP 2X9HA 1MMAA 3PORA 4P09A 2H7OA 3TZGA 4AKHA 3MK7C 2X67A 2W61A 3AAEB 5IYZE 4IIJE 1MIWA 4U74A 1WLXA 3HL6A 4E7SA 1ZHWA 4FSOA 2XQYA 3HKCE 5FNVE 3CQXC 3JC6D 4G63A 4YFSA 4BAYB 5LHHB 4P0AA 1GFNA 3WI3A 5FYMA 2MHLA 1ZHTA 4B61A 3BQKA 1D1AA 1SHZC 3RRCA 2GE4A 2C5JA 3RC8A 4UVAB 1HXXA 2XTQA 4AKLA 2VB6A 4IE0A 2KNDA 3PUQA 3IHRA 3LFMA 3ZYLA 4EOZB 3KBUA 2XAFB 2VK9A 3N2KE 2ZMAA 3PUSA 2XTRA 1SA0E 1UX4A 2LEHA 3O1IA 4O4HE 3R6NA 3LK2B 2KDYA 5LJMA 3RYFE 4QXBB 4DO0A 3NSGA 2LSIA 4DNDA 1Q9FA 3LBXB 5EK3A 1HCIA 3GMIA 4O2AE 4QX8B 2DWKA 4UF0A 5H6QB 5LG4A 5LYJE 3I0QA 3OYXA 4WBOA 5LJNA 2CMRA 1HFAA 4UV9B 3SRZA 2PBIA 2A72A 4N78D 2LHRA 3C64A 3C4WA 4FZLA 2X9YA 4IDZA 2XAGB 3BK9A 5JDHA 4WBNE 3NZQA 3HW9A 1G73A 4FT6A 5A1LA 3MA9A 3N9MA 4ASKA 3ZMVB 2RA1A 3RC3A 2N2MA 3B57A 3MXZA 2DWGA 4H63H 1E54A 1BR2A 2ES0A 4PK5A 2Q9QA 4GYSA 4AKGA 2L3LA 5FXWA 2RP4A 2D0UA 3KDSE 3VKHA 4AZLA 2CXLA 4AFKA 3ETVA 1HTJF 4AKRB 1WRDA 1UX5A 1HX8A 1HG2A 3ZMZB 4FI5A 1H6S1 4XNKA 4MHCA 5L2LA 2NW9A 3BQIA 1H7CA 2QGSA 4G2AA 3QRAA 2MBGA 1OSMA 3PU8A 2K5BB 4PFOA 5FXZA 3SS1A 3LJCA 5HXSA 5F3JA 2Q9QC 4RJWA 2KXPB 3HR0A 4PNIA 2CWOA 4AKMA 2EHOB 3KFWX 3L09A 4UELA 3IF8B 3B13A 5BMVE 3ANWB 3AA1B 4LSFA 2E9XB 3AB3B 4YHJA 3SWHA 2KWIB 3EDUA 5DL8A 3N2OA 2YU2A 4CQIA 3DTOA 2H7VC 3ZMSB 1THQA 2VKHA 2Y8DA 3RPUA 4MBQA 3LK41 3VE1A 3ONXA 4ZS2A 1GFMA 2UXXB 4ILUA 3RRWA 2K9AA 3LK3A 3KV5A 2C5KT 2N2LA 4UVCB 2IC9A 5JDLA 5E0OA 2O4VA 5EK4A 5HXCA 1Q9GA 2VL8A 3FYXA 2N2NA 3AA6B 4FZMA 1LKXA 2XE3A 1HF8A 2JRKA 1YW0A 3M65A 4GYRA 3K3OA 1MMNA 2Z6EA 4J2CA 4PK4A 3Q9DA 4CI3B 3C4XA 5ETWA 1QJ8A 5DL7A 3RYHE 3SY9A 8PRNA 2D5UA 3ESLA 3PUGA 3UUXB 3PQUA 2D2SA 4PFPA 4FJOA 3C4ZA 3ZMTB 4H9PC 3HKEE 1Z0PA 2J1DG 2JMKA 3AA7B 5JDGA 5KX5E 4EZHA 4G75A 4O4XA 2MTQA 2OMFA 3ZMUB 2BDEA 5LGNB 2Y0HA 2LJLA 4DMVA 3UUNA 5FXXA 4IE7A 1HXTA 3DJBA 3MJXA 1GFOA 2DLRA 2DCFA 5IYUA 1X79A 4OFZA 3ETUA 4HE8A 5DJQC 3AAEA 5JDPA 3HKBE 4JLEA 3Q5WA 3F57A 2PFVA 3CMLA 2DHRA 3RH3A 3RYCE 1ZKEA 5JRCB 1U5PA 4O4JE 4FZNA 4K0UA 2CLYB 2CCQA 2VWAA 2W63A 4HGAA 2LSYA 3F2EA 4LSEA 1D1CA 3T8OA 3UT5E 4RJXA 1KK7A 1LRZA 5FMNA 5L3DB 3CPZA 3EVYA 3E22E 4IE5A 4FRTA 4KR8A 3G7GA 3VKGA 2E8IA 2XE1A 2Q9QD 2ODVA 2DI4A 4ISSA 4H9RC 5HYAA 5JDNA 4JCHA 3LBXA 4NUVA 2GK9A 3GN5B 4O4IE 2W0GA 3KV6A 3VZWX 3FB2A 1E1HB 2F1VA 4E1TA 1G8XA 2YINA 4ADZA 2BZBA 2W62A 3SY7A 4RL9A 1CUNA 5LA6E 4GIWA 3AA0A 2X9WA 3UTKA 1HG5A 4PJJA 4PJNA 5KMGP 4JUYA 2W00A 4C90A 1MM4A 4HTEA 2X27X 3PUAA 5LOVE 2XMXA 3C5OA 4PW8A 1FIOA 1QSDA 3K3QC 5JVDE 4ZI7E 2X0LB 4TUYE 2Y2XA 4CXWA 5LHIB 1US7B 1MNDA 1UCUA 4YJ3E 4D64A 2SPCA 4AYNA 1NWMX 4X1KE 4AQGA 5M4YA 5IHYA 3K8PC 4FESA 2CWYA 4JEUB 4U9CA 3N2GE 3KVBA 4H63V 1YKEB 4FMSA 4MALA 4GCQA 1IZNA 5LHGB 2V1DB 2X51A 3UFEA 2XE2A 2WSSV 2NOXA 5D5DA 3TKLB 5DQWA 4HEAA 4N58A 2NW7A 4OYJA 4RLCA 3N9LA 3Q2MA 4QWNB 2ODUA 2PRNA 2L8KA 1ZV4X 2G0UA 3LG7A 4KP3C 1AJ3A 2XTLA 2PORA 2EHOA 3N9QA 4FRXA 4RLBA 3K19A 3E08A 3ANWA 2IC6A 3PQSA 5T5FA 2Y6XA 2BVLA 3N9NA 5PRNA 2KZ7A 2LSGA 4TZ4C 2K48A 3GP6A 4UF0B 4F6RC 2ERVA 3HKDE 1KNZA 4CI1B 3GA8A 4EYYR 4DBRA 3K3NA 4UVBB 5HXRA 5J1GA 4MFRA 4O49A 4P0BA 2XE5A 3ZYMA 3POUA 1QJPA 2CXFA 2JPFA 4ZOLE 4N59A 3QUJA 4O3WA 4OHFA 4CI2B 3KVAA 3ZJ1A 4QXHB 2V7LA 5HWYA 2KMFA 1PRNA 5DABA 5LP6E 2N9DA 5DQVA 3ZJ2A 3UAQA 3W15B 2OA5A 4FUVA 2QTKA 4H9QC 4LSIA 2ZLDA 3UPGA 2KLQA 2Q9QB 3V5SA 2JQQA 2WBLA 3CX8B 1S35A 3BQLA 3N9PA 3O1HA 4JEHB 3FHNA 2LE8A 3NRYA 4PAGA 2F1TA 5JR9A 3ZN0B 3ZPOA 3I9YA 5KDMC 4AYMC 1MM5A 4UV8B 5JH7E 4OK0A 4H9SE 3MZKB 3ZEFB 1ORMA 3DA4A 4H9OC 2LT3A 1VOMA 1YD8G 2YK0A 3WAKA 2XAQB 3CX6B 1U4QA 4HN9A 3FXEB 2LHNA 3ZN1B 3ZCIA 2W81C 4KRAA 3WI5A 4Z3TA 1G90A 1B7TA 2JMMA 4FSPA 3PURA 4FOZA 4EXTA 5JR9C 4KBMB 2ZM0A 3U78A 2L9QA 5J2UE 4B6XA 4AXPA 5HXEA 4GCSA 2BVMA 2HH7A 2YEVC 4ZI3C 4IGUA 4BJMA 1MMGA 1ZHZA 5FY1A 2C5IT 3AAAB 4EYUA 2M06A 4O3YA 4IE6A 3R84B 2JMHA 2MNHA 4C69X 4IHJE 3SOLA 1BT9A 4O8SA 5JRCA 3DA3A 2ACXA 2XHEB 3L3PA 2LSJA 4CXXA 3VZUX 5ADXK 2XASB 1GFPA 4TV8E 4EIWA 3OJAA 1IJ5A 3EDVA 7PRNA 3LK42 2IAKA 1GFQA 1FMVA 3EUHA 3SZVA 4QX7B 2Y48B 5L3GB 5DL6A 1OWAA 3D0TA 3T24A 4EB6E 2DNXA 3A2SX 5L3EB 1YS5A 3HOEA 4X20E 1BR1A 4HFVA 4QHOA 5ADXL 2WAUA 2KC0A 4EZ4A 4AKIA 3VY8X 3QRCA 4ANJA 4UIGA 3WI4A 2VASA 3N9OA 3FBZA 3MACA 4O2BE 1ZEEA 3V5UA 4DVDA 3LK2A 3NBXX 1O3XA 1LVFA 3CKDA 3CQGB 1D0ZA 2YNKA 5LGTB 3OYZA 2EHOD 4X1IE 4L9IA 4ZI2C 4ERRA 1PHOA 5L3CB 2K0LA 5FVNA 4TN7B 3ZC0A 2X9XA 2WMOA 2NTXA 3AVRA 3QC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA0 A;  3AA6 A;  3AAA A;  3LK4 1;  3AA7 B;  1IZN B;  2KXP A;  4AKR B;  3LK3 A;  5AFU K;  5ADX L;  3AAE B;  3AA1 A;  3AA0 B;  3AA6 B;  2KZ7 A;  3AAA B;  2KXP B;  3LK2 A;  3LK3 B;  5ADX K;  3AA7 A;  3AA1 B;  5AFU L;  1IZN A;  4AKR A;  2KZ7 B;  3AAE A;  3LK4 2;  3LK2 B; 
#chains in the Genus database with same CATH topology
 5EZY E;  3VZT X;  3CQC B;  5ABF A;  1EZ3 A;  2V7I A;  3P8C D;  5FKY A;  2N1G A;  1IAP A;  2KT9 A;  2X66 A;  5AQU B;  4CZZ B;  4XAX B;  2XUE A;  5FP3 A;  4GOU A;  4AYI D;  1LVK A;  3ZSS A;  3H37 A;  4UR9 A;  5CB4 E;  6PRN A;  1BH3 A;  2UXN B;  3AE6 A;  2V7M A;  4U7Y A;  2R4O A;  2VKD A;  4X66 T;  1ZOY A;  4DV0 T;  5FVK A;  4O4L E;  3AA0 B;  1OXZ A;  5JDF A;  3I0O A;  2NW8 A;  5FL0 A;  2PG8 A;  2CEA A;  4HKA A;  3PGU A;  3NRX A;  3I1A A;  2I59 A;  3UU2 A;  3C51 A;  3EMN X;  2E9X C;  4BJN A;  3H3A A;  2QA7 A;  4YJ2 E;  2MOZ A;  2XM1 A;  4N74 A;  1BXW A;  3P50 A;  5L3B B;  1T98 A;  2WWU A;  2J47 A;  4X1Y E;  5AQR B;  3ZT7 A;  4LFA T;  1R8I A;  3POX A;  2JJ9 A;  5IUX A;  4YTN A;  1HNW T;  2XQA A;  4AQF C;  2ACZ A;  4Z91 A;  4ZI2 D;  3PE0 A;  3ZYK A;  4C4V A;  4F4B A;  3PUY F;  2FJE A;  2ZM8 A;  3F31 A;  4QXC B;  2H3R A;  3RLF F;  2M67 A;  2HPJ A;  5TAO A;  3T20 A;  4GCP A;  5BR8 T;  3P7I A;  4TV9 E;  2A3D A;  4COF A;  1QUU A;  4O4U A;  5G26 A;  4OYK A;  3OBV E;  4IE4 A;  2BKP A;  5AFU L;  5F8P A;  2X0H A;  3O0E A;  3KZI O;  3EAM A;  2H89 A;  3RIA A;  4HWH A;  4IDN A;  5JRE A;  1VRB A;  2WMN A;  4IL6 O;  3NWI A;  5B5E O;  4L0R A;  4PJM A;  4AIS A;  1T8B A;  4BA9 A;  1WCR A;  4JI6 T;  2ZLY A;  4ZHQ E;  2E9X D;  3AAI A;  3PU3 A;  3UUB A;  2PJQ A;  4P09 A;  2H7O A;  4IIJ E;  4FSO A;  3HL6 A;  1ZHW A;  4YTP A;  3Q5D A;  2XQ9 A;  1ZHT A;  1SHZ C;  3KBU A;  3N2K E;  2BBJ A;  1IBK T;  3LK2 B;  3AE7 A;  3NSG A;  4QXB B;  2FUP A;  4TWH A;  2M6I A;  3RGL A;  5LG4 A;  5LYJ E;  2OV9 A;  5ABF B;  2XAG B;  3NZQ A;  5A1L A;  3MA9 A;  3N9M A;  2RA1 A;  4ILA A;  3UFG A;  2N2M A;  5IWA T;  3B57 A;  4A97 A;  2L3L A;  4LF9 T;  5FXW A;  2RP4 A;  2D0U A;  3KDS E;  4DUZ T;  2IWW A;  3ONJ A;  1HG2 A;  4FI5 A;  2NW9 A;  2WZI A;  1H7C A;  2QGS A;  4G2A A;  1OSM A;  4U2Y A;  5F3J A;  2CWO A;  3BRY A;  3L09 A;  5BMV E;  3ANW B;  3AB3 B;  3SWH A;  5B66 O;  2KWI B;  2YU2 A;  2H7V C;  3ZMS B;  1J5W A;  4B3M T;  2M6B A;  2Y8D A;  3RHW A;  4DR7 T;  2KSR A;  1GFM A;  2UXX B;  3LK3 A;  1UGO A;  3P4R A;  5E0O A;  5EK4 A;  1Q9G A;  2B76 A;  3K3O A;  4PK4 A;  3RQU A;  4FJO A;  3C4Z A;  4H9P C;  3HKE E;  1Z0P A;  2J1D G;  2JMK A;  4G75 A;  3AEG A;  4C4V B;  2Y0H A;  1YQ4 A;  4HWI B;  1GFO A;  2DLR A;  1X79 A;  4HE8 A;  5JDP A;  3FZM B;  2VQE T;  4JLE A;  3F57 A;  3CML A;  1KFY A;  2DHR A;  1T7S A;  4K0U A;  4GKJ T;  3F2E A;  2LLY A;  5L3D B;  2WU2 A;  2WCA A;  1YXR A;  1M7K A;  4NUV A;  2W0G A;  3KV6 A;  2WWV A;  1E1H B;  3QB5 A;  1G8X A;  2YIN A;  2BZB A;  4I0U A;  5LA6 E;  2X9W A;  2W00 A;  1N34 T;  1T72 A;  3PUA A;  3C5O A;  3OPC A;  1FIO A;  3K3Q C;  5LHI B;  4JI4 T;  4D64 A;  2VQF T;  5IHY A;  3K8P C;  2CHN A;  3N2G E;  1WFD A;  3KVB A;  4MAL A;  4GCQ A;  5LHG B;  2V1D B;  3UFE A;  2XE2 A;  5D5D A;  2WSS V;  5DQW A;  2NW7 A;  4OYJ A;  4QWN B;  2ODU A;  2PRN A;  2FBW A;  5KAF O;  2XTL A;  1T1L A;  2POR A;  2EHO A;  5LMN T;  2IC6 A;  2Y6X A;  3ONL C;  5F5W A;  1JNR A;  2LSG A;  1XNR T;  2CHO A;  4F6R C;  2ERV A;  4CI1 B;  4EYY R;  3NJT A;  3VRA A;  4MFR A;  4DR6 T;  3POU A;  2CXF A;  2JPF A;  4OHF A;  5LG3 A;  3KVA A;  1HNZ T;  2N9D A;  5CGM A;  3W15 B;  2KLQ A;  4LFC T;  3FHN A;  5KAI O;  4AYM C;  2W4X A;  4N75 A;  4OK0 A;  4H9S E;  3MZK B;  1ORM A;  2V6Y A;  4HN9 A;  3FXE B;  3PUR A;  4FOZ A;  4KBM B;  2ZM0 A;  2L9Q A;  4B6X A;  4AXP A;  2YEV C;  4ZI3 C;  2IML A;  2C5I T;  5FY1 A;  4EYU A;  2X9K A;  4C69 X;  4IHJ E;  4O8S A;  3VZU X;  2LSJ A;  5ADX K;  7PRN A;  4QX7 B;  1OWA A;  3T24 A;  3PV0 F;  2DNX A;  3A2S X;  1YS5 A;  3HOE A;  2WY2 A;  4HFV A;  3AE5 A;  4EZ4 A;  3VY8 X;  3QRC A;  1HR0 T;  3N9O A;  4DVD A;  3CKD A;  1D0Z A;  4B3S T;  3AEB A;  4L9I A;  4HFB A;  1PHO A;  4I4T E;  2X9X A;  4AYD C;  3AVR A;  2WU5 A;  3RQW A;  4WNK A;  1ZHY A;  2LM9 A;  2X68 A;  2JQ9 A;  3JCF A;  1XDO A;  3ZST A;  4MLK A;  1HXU A;  3AE9 A;  2XAJ B;  3DWO X;  5EE2 A;  1Z8U A;  5H6R B;  1W0A A;  2FGQ X;  2M07 A;  2QVA A;  1OPF A;  4GF4 A;  2A2F X;  5HEJ A;  3PRN A;  5E79 O;  3WAJ A;  2LOP A;  2XSA A;  2VKJ A;  4ZI3 D;  2IIU A;  2FGR A;  1D0X A;  3O9X A;  2QYW A;  2V7K A;  4O3Z A;  4DMW A;  3E0Z A;  3EAB A;  1UK5 A;  1V9D A;  5CA1 E;  2K24 A;  5LMU T;  1FEW A;  4C91 A;  4K3C A;  3P4Q A;  3AA6 A;  3Q5X A;  3VHL A;  3IBP A;  4KUM B;  5GON E;  5LGU B;  3FXD B;  4L5G A;  1W0B A;  3H3M A;  2JQY A;  4PJL A;  3VE2 A;  5GV0 A;  2Y0L A;  2NTY A;  3MKD A;  2MYS A;  3I9W A;  1BR0 A;  4UEM A;  5AQT B;  4LMJ A;  1D0Y A;  5JTG A;  2YPV A;  2W67 A;  3RKO A;  5JQG E;  2J1N A;  1XMQ T;  4U7I A;  3L39 A;  4ZS3 A;  2Y0K A;  1ZHX A;  2CXD A;  3KV4 A;  1MNE A;  4G76 A;  3CVR A;  2IUB A;  2CE7 A;  4M1P A;  4HFH A;  2IDO B;  3GWH A;  2CA5 A;  3PTR B;  3RX6 A;  4XNL A;  4KR4 A;  3QK6 A;  2CM0 A;  2V6Y B;  1FMW A;  3HA4 A;  2NP9 A;  1QJ9 A;  1MPF A;  3V8U A;  4DR2 T;  4IDQ A;  2W80 C;  4CTD A;  3U3I A;  2YU1 A;  1YKH B;  1HNX T;  4I55 E;  4TX5 A;  4HFD A;  5C2T A;  3CIR A;  4DID B;  4ZXL A;  3POR A;  3MK7 C;  3AAE B;  4U74 A;  4E7S A;  3HKC E;  3AE4 A;  3CQX C;  4BAY B;  2WJR A;  5FYM A;  4LF8 T;  3BQK A;  1D1A A;  2H88 A;  2HHH T;  2GE4 A;  2MAW A;  2C5J A;  4AKL A;  4EOZ B;  3NVO A;  3RKG A;  3PUS A;  4AIU A;  1SA0 E;  3R6N A;  4DO0 A;  4DND A;  3LBX B;  4JI0 T;  3GMI A;  4O2A E;  5LJN A;  4IDO A;  2A72 A;  4QH5 A;  2LHR A;  3C4W A;  1E2A A;  3BK9 A;  5L47 A;  3PUX F;  1G73 A;  3OVU A;  3ZMV B;  2W66 A;  2Q9Q A;  4AZL A;  2CXL A;  1WRD A;  1HX8 A;  4B3R T;  4MHC A;  3QRA A;  3ZKR A;  4JV5 T;  3RIU A;  4EED A;  2AXD S;  5HXS A;  3LJC A;  4RJW A;  3HR0 A;  3IF8 B;  2XPK A;  3DTO A;  4NIQ A;  2VKH A;  3LK4 1;  3VE1 A;  3Q5E A;  4ILU A;  4NPP A;  2K9A A;  3AEA A;  5L4H A;  3KV5 A;  3RIF A;  1N32 T;  4JBW F;  2VL8 A;  2N2N A;  3AA6 B;  4KI0 F;  1LKX A;  4A5X A;  2UUB T;  2XE3 A;  2JRK A;  1KEY A;  4GYR A;  1MMN A;  2Z6E A;  4CI3 B;  3EI0 A;  3C4X A;  1M62 A;  4KHP T;  3A0B O;  3PUG A;  2BS4 A;  3UUX B;  2D2S A;  4PFP A;  3QB5 K;  2K3W A;  2FJD A;  2VVN A;  5KX5 E;  5HEG A;  4EZH A;  4EV6 A;  2BDE A;  4F8H A;  2XQ7 A;  2LJL A;  3QOF A;  3DJB A;  5FVL A;  5DJQ C;  1KF6 A;  4HWD A;  2PFV A;  3RH3 A;  2BKO A;  4YHH T;  1ZKE A;  5JRC B;  4O4J E;  5TIS O;  2CLY B;  4B3T T;  5G3A A;  2W63 A;  1D1C A;  4RJX A;  5FMN A;  3CPZ A;  4KR8 A;  4JI2 T;  2E8I A;  2XE1 A;  2ODV A;  4ISS A;  5HYA A;  2ZM6 T;  2R8A A;  4K3B A;  2GK9 A;  2RPA A;  2BG9 A;  2F1V A;  4ADZ A;  3UU5 A;  4PJJ A;  3AEF A;  2X27 X;  2XMX A;  1QSD A;  2Y2X A;  4TUY E;  1IBL T;  1UCU A;  3PJA J;  5M4Y A;  4TNW A;  4FES A;  4U9C A;  1YKE B;  1NEK A;  1IZN A;  2X51 A;  4YTM A;  3AED A;  2CPT A;  4RLC A;  4N58 A;  2YDR A;  4EGW A;  2G0U A;  4KP3 C;  3N9Q A;  3K19 A;  2WS3 A;  3E08 A;  2R88 A;  3PQS A;  2K48 A;  4CN1 A;  3DZM A;  2XQ3 A;  3K3N A;  1KNR A;  4P0B A;  4KHZ F;  3ZYM A;  4ZOL E;  4N59 A;  2FJA A;  4QXH B;  2KMF A;  3ZJ2 A;  3UU6 A;  2Q9Q B;  4CN4 A;  3V5S A;  2JQQ A;  3CX8 B;  2F1T A;  4JEH B;  4PAG A;  2LE8 A;  3BRZ A;  5JR9 A;  3ZN0 B;  2BG9 E;  3ZEF B;  4JI8 T;  2LM2 A;  1SE7 A;  4P1N A;  4H9O C;  2CBI A;  1VOM A;  3AE8 A;  2W81 C;  2LHN A;  3WI5 A;  3ZCI A;  1B7T A;  4PR7 A;  4LF7 T;  3U78 A;  1S5L O;  5J2U E;  5HXE A;  2BVM A;  4IGU A;  2UXB T;  1MMG A;  2WVP A;  2YOE A;  2MNH A;  2JMH A;  2BS3 A;  1J1J A;  3DA3 A;  2XHE B;  4EIW A;  1GFQ A;  1FMV A;  5DL6 A;  3D0T A;  4UB8 O;  5LB7 B;  1BR1 A;  5ADX L;  4AKI A;  2VAS A;  1KNP A;  1ZEE A;  3FZH B;  1O3X A;  3NBX X;  3CQG B;  2R89 A;  5LGT B;  2EHO D;  4ERR A;  4X65 T;  2WMO A;  2NTX A;  5C3J A;  1P4T A;  2LKH A;  4EAH A;  4WW0 A;  1W09 A;  3J9X 1;  2Y7S A;  3T1H T;  2I6H A;  2QRX A;  2K4T A;  2V8S V;  2V7J A;  2UUC T;  3G06 A;  5L4E A;  3L8R A;  5HCJ A;  4IRE A;  5C8Y E;  4AKR A;  3TLV A;  2V26 A;  4NUU A;  2LOS A;  5LBQ B;  3AVS A;  3KVD D;  3ZLI A;  2BG9 B;  2KXP A;  2WP9 A;  4I43 B;  4U2Z A;  4IST A;  3JTY A;  4O3X B;  5FY0 A;  1XDP A;  2XAH B;  4DV6 T;  4E1S A;  5JDM A;  2WM9 A;  2C0S A;  5J2T E;  3O1J A;  1HS7 A;  1IZN B;  5JDQ A;  1IJ6 A;  2D0T A;  2VKO A;  5L3F B;  4QQ1 A;  3JC6 C;  5AQS B;  2LHF A;  1VCT A;  1NAF A;  5FY7 A;  3UUL A;  4EEB A;  4WZX A;  3KBT A;  3AA7 A;  4GK0 E;  5DL5 A;  3HOL A;  1T16 A;  4ZEY A;  4IL9 A;  3AAA A;  4GKK T;  4AYE C;  3SZD A;  5EK2 A;  1L0V A;  5AQG B;  2JIW A;  3CK6 A;  5J0Z A;  4E7Z A;  1D1B A;  4QKN A;  3IA3 A;  2HPL A;  4KMC A;  4UXN B;  4YLH A;  3LK3 B;  4DV7 T;  3PF1 A;  4U72 A;  3A5X A;  2BKN A;  4ILC A;  5JR9 B;  4CXY A;  2KWH A;  2UUA T;  3UUM A;  2R4L A;  4U33 A;  4FQE A;  3OTO T;  4DBQ A;  2CLY C;  3KV9 A;  3GN5 A;  2BBH A;  3PUZ F;  4V1A v;  3PJA A;  4H9N C;  4X64 T;  3HWB A;  5LBM A;  4JFB A;  3NZP A;  5HWX A;  5HEO A;  1MMA A;  3TZG A;  4AKH A;  1UUR A;  1UUS A;  5IYZ E;  1W9R A;  2AE9 A;  3JC6 D;  4G63 A;  3RF1 A;  1GFN A;  3VR9 A;  4B61 A;  4UB6 O;  3RC8 A;  1HXX A;  2XTQ A;  1IBM T;  2VB6 A;  3TLU A;  3IHR A;  2XAF B;  2VK9 A;  1UX4 A;  4O4H E;  2KDY A;  5LJM A;  5EK3 A;  1HCI A;  2DWK A;  5H6Q B;  5HCM A;  2CMR A;  4UV9 B;  3SRZ A;  2PBI A;  4Q25 A;  3C64 A;  2X9Y A;  5JDH A;  5H2F O;  3HW9 A;  5AQK B;  4FT6 A;  2CRB A;  3K1S A;  3RC3 A;  4HWC A;  5AQO B;  2XZE A;  2DWG A;  4H63 H;  1E54 A;  1BR2 A;  4PK5 A;  4GYS A;  3VKH A;  3A0H O;  4AFK A;  3ETV A;  1HTJ F;  4AKR B;  4OX9 T;  1H6S 1;  5L2L A;  3AXJ A;  2MBG A;  4JI5 T;  3PU8 A;  4PFO A;  5FXZ A;  3T0S A;  2LRL A;  2Q9Q C;  2KXP B;  4PNI A;  4AKM A;  2EHO B;  3KFW X;  2AXT O;  3B13 A;  4LSF A;  4YHJ A;  2MPK A;  1I6Z A;  3EDU A;  5DL8 A;  3N2O A;  3RIU C;  1THQ A;  5GTI O;  3RPU A;  4NXN T;  3TLS A;  3PGS A;  3ONX A;  2WDQ A;  3RRW A;  4DR1 T;  2N2L A;  2HN1 A;  5JDL A;  2O4V A;  5HXC A;  3FYX A;  4FZM A;  1HF8 A;  4DR5 T;  2E2A A;  3Q9D A;  5ETW A;  1QJ8 A;  5DL7 A;  3RYH E;  8PRN A;  3ESL A;  4U3C A;  5AQJ B;  3PQU A;  5KXJ A;  1DU2 A;  3AA7 B;  2LKG A;  5AQI B;  4O4X A;  2MTQ A;  2XQ5 A;  3WU2 O;  3FZF B;  5LGN B;  4DMV A;  3UUN A;  5FXX A;  4IE7 A;  1HXT A;  1QLB A;  5IYU A;  4U31 A;  3ETU A;  3Q5W A;  3RYC E;  1NEN A;  1U5P A;  3VRB A;  4LF5 T;  2CCQ A;  3T8O A;  3UT5 E;  1LRZ A;  1WR0 A;  5AQP B;  3EVY A;  3E22 E;  4IE5 A;  3G7G A;  3VKG A;  2Q9Q D;  4JCH A;  2XSB A;  4DV1 T;  3GN5 B;  4NXM T;  4JYA T;  4QH1 A;  2JQH A;  4RL9 A;  1CUN A;  2I0M A;  3UTK A;  4PJN A;  5KMG P;  3NKZ A;  4JUY A;  5CFB A;  4C90 A;  4DR4 T;  2V6X A;  2BG9 C;  4X62 T;  5JVD E;  4DV4 T;  3AE2 A;  4HFC A;  1US7 B;  1MND A;  5CJ5 A;  4YJ3 E;  2SPC A;  2J4G A;  4YSX A;  4AYN A;  2YDS A;  4JEU B;  1XNQ T;  2NOX A;  3TKL B;  1CHU A;  4YSY A;  2L8K A;  1ZV4 X;  3TLT A;  3LG7 A;  1AJ3 A;  2XY8 B;  3ANW A;  1GQE A;  5AQN B;  5T5F A;  2VL0 A;  2BVL A;  3DWN A;  3SFE A;  2KZ7 A;  4TZ4 C;  3GP6 A;  1KNZ A;  4DBR A;  2HN2 A;  4UVB B;  1JNZ A;  2XE5 A;  1QJP A;  3QUJ A;  4CI2 B;  2A9U A;  2V7L A;  5HWY A;  1OED A;  5DAB A;  3UAQ A;  2OA5 A;  4FUV A;  3AE3 A;  2ZLD A;  4ZZC A;  2WBL A;  3O1H A;  2CBJ A;  2J62 A;  3NRY A;  2WB5 A;  5KDM C;  3I9Y A;  4UV8 B;  5JH7 E;  3AXJ B;  3DA4 A;  5AQL B;  4LF4 T;  2XM2 A;  3WAK A;  2XAQ B;  4LML A;  2JMM A;  4FSP A;  5JR9 C;  5ABE A;  4GCS A;  2HH7 A;  4BJM A;  5G39 A;  2M06 A;  4IE6 A;  2VUR A;  2ACX A;  3L3P A;  5HEH A;  1J5E T;  5ABG A;  4TV8 E;  3OJA A;  1IJ5 A;  3LK4 2;  3EUH A;  2Y48 B;  4X20 E;  4UIG A;  3WI4 A;  4O2B E;  3MAC A;  3V5U A;  1LVF A;  2YNK A;  3OYZ A;  4X1I E;  4HFE A;  5L3C B;  2K0L A;  3PUV F;  4IT4 A;  3BS0 A;  4HWF A;  3LSV A;  3UU3 A;  1OED E;  1VCS A;  3CWZ B;  3VU7 H;  2IW5 B;  2WZH A;  2LFU A;  2YN6 A;  3JAE A;  2P9B A;  2R4P A;  1XZY A;  1MIV A;  3UU8 A;  3CX7 B;  5FXV A;  3FZL B;  4Z90 A;  3SFD A;  3JAF A;  3RBH A;  1Y01 A;  1Y64 B;  3ZCJ A;  3HI2 A;  2LSK A;  3C98 B;  4IL4 A;  4WYV A;  2ZM2 A;  4XBF B;  3P4W A;  2D9D A;  3AA1 A;  2E9X A;  1I94 T;  3DP7 A;  5HAX A;  4PJ0 O;  3PGR A;  2IWV A;  1WYB A;  1XMO T;  3IEE A;  3POQ A;  1XWM A;  1S94 A;  1WR6 A;  5LXT E;  2EHO C;  3FBL A;  5CA0 E;  2KIN B;  3LDQ B;  1N36 T;  3N5L A;  4A56 A;  1MIY A;  4AQF A;  2LRK A;  2XQ4 A;  5ABH A;  2B1E A;  2W2U A;  3KIN B;  4D5U A;  1BR4 A;  4BUM X;  5AQH B;  2XG6 A;  4LSH A;  5HXH A;  4A98 A;  3OKQ A;  4Z8X A;  2KZ7 B;  3VR8 A;  2UU9 T;  3VY9 X;  3SYB A;  5LNK A;  2UXC T;  1MMD A;  2ODJ A;  5AFU K;  4PUX A;  3RYI E;  4GK5 E;  3PDY A;  4XZC A;  3SYS A;  1OED B;  3S4U A;  4YSZ A;  2YKS A;  1ZHC A;  1WYC A;  2NWB A;  4DV5 T;  3O4X E;  4AI6 A;  3J7Y q;  2R4N A;  4PK6 A;  3C50 A;  1YQ3 A;  2WQY A;  4AUI A;  2WDV A;  4HFI A;  4C00 A;  2XJ7 A;  3ZC1 A;  4I50 E;  5LCY A;  4AQY T;  2ZFG A;  4GHB A;  5FL1 A;  2J4U P;  2PTF A;  4DUY T;  2X9H A;  4K0K T;  3EHZ A;  3AEC A;  2X67 A;  2W61 A;  4D65 A;  1MIW A;  1WLX A;  2XQY A;  5FNV E;  5LHH B;  4YFS A;  4P0A A;  3WI3 A;  2MHL A;  3RRC A;  4UVA B;  3P4P A;  4IE0 A;  2KND A;  3PUQ A;  3ZYL A;  3LFM A;  4DV3 T;  4ZZB A;  2ZMA A;  2XTR A;  2LEH A;  3O1I A;  4DR3 T;  3RYF E;  2LSI A;  1Q9F A;  4QX8 B;  4UF0 A;  2FJB A;  3I0Q A;  3OYX A;  4WBO A;  1HFA A;  4N78 D;  4FZL A;  3UU4 A;  4IDZ A;  4WBN E;  4ASK A;  2F1C X;  3ZT5 A;  3MXZ A;  4LF6 T;  2ES0 A;  4AKG A;  4LMK A;  1UX5 A;  3ZMZ B;  2R6G F;  3RI5 A;  4XNK A;  3PUW F;  3BQI A;  2YDQ A;  3UQ7 A;  2K5B B;  3SS1 A;  2X0Y A;  5AQF B;  4UEL A;  3AA1 B;  2E9X B;  4CQI A;  4MBQ A;  4ZS2 A;  2XQ8 A;  4JI3 T;  1FJG T;  2C5K T;  3JAD A;  4UVC B;  2IC9 A;  4JI1 T;  5AQQ B;  3ABV A;  1YW0 A;  3T1Y T;  3M65 A;  4J2C A;  4TWF A;  4ILB A;  3SY9 A;  2D5U A;  3ZMT B;  5JDG A;  2OMF A;  3ZMU B;  4YXD A;  2WJQ A;  3JCU O;  3MJX A;  4LFB T;  4KX6 A;  2DL1 A;  2UXD T;  3UQ4 A;  2DCF A;  4OFZ A;  3AAE A;  3P4S A;  3HKB E;  2XQ6 A;  3TLW A;  4FZN A;  2VWA A;  4HGA A;  3AEE A;  2LSY A;  2E5L T;  4LSE A;  1KK7 A;  4YY3 T;  1N33 T;  4FRT A;  2DI4 A;  4H9R C;  5JDN A;  3QNU A;  1HX1 B;  3LBX A;  4O4I E;  3VZW X;  3FB2 A;  3A8Y C;  2W62 A;  3SY7 A;  5AQM B;  3AA0 A;  4GIW A;  1HG5 A;  1MM4 A;  4HTE A;  5LOV E;  3ZT6 A;  4PW8 A;  2WDR A;  4ZI7 E;  2X0L B;  4CXW A;  1NWM X;  4X1K E;  4AQG A;  4X5T A;  2CWY A;  4H63 V;  4FMS A;  1ZP0 A;  4HEA A;  3M3Z B;  3N9L A;  3Q2M A;  2OLT A;  3AE1 A;  5AQV B;  4FRX A;  4RLB A;  3A7M A;  3X1D A;  3N9N A;  5PRN A;  2IHR 1;  2JQK A;  4UF0 B;  3HKD E;  2V5D A;  4CN6 A;  3GA8 A;  2V5C A;  5HXR A;  5J1G A;  4O49 A;  2F4V T;  5G38 A;  4O3W A;  3ZJ1 A;  1PRN A;  1E7P A;  5LP6 E;  5DQV A;  2BS2 A;  2QTK A;  4H9Q C;  4LSI A;  3UPG A;  4YT0 A;  4E1T A;  1S35 A;  3BQL A;  3N9P A;  3ZPO A;  1MM5 A;  1OED C;  2LT3 A;  4TNV A;  1YD8 G;  2YK0 A;  2NR4 A;  3CX6 B;  1U4Q A;  3ZN1 B;  4Z3T A;  1G90 A;  4KRA A;  4EXT A;  3B5M A;  4QH4 A;  5GTH O;  2E5V A;  1ZHZ A;  4O3Y A;  3AAA B;  3R84 B;  3SOL A;  1BT9 A;  5JRC A;  4TWD A;  4CXX A;  2XAS B;  1GFP A;  3EDV A;  2IAK A;  3SZV A;  5L3G B;  5HEU A;  4EB6 E;  4DV2 T;  5L3E B;  4QHO A;  1X9B A;  2WAU A;  2KC0 A;  4ANJ A;  4JI7 T;  3FBZ A;  3FZK B;  3LK2 A;  1SUM B;  2VVS A;  4ZI2 C;  5FVN A;  4IDP A;  4TN7 B;  3ZC0 A;  3QC9 A; 
#chains in the Genus database with same CATH homology
 1P4T A;  5EZY E;  4EAH A;  3VZT X;  4WW0 A;  3CQC B;  3CWZ B;  3VU7 H;  4WNK A;  1ZHY A;  3J9X 1;  2IW5 B;  4I4T E;  1EZ3 A;  2LM9 A;  2V7I A;  2X68 A;  3P8C D;  2Y7S A;  2LFU A;  2N1G A;  1IAP A;  2KT9 A;  2K4T A;  2X66 A;  2P9B A;  2V7J A;  4MLK A;  1HXU A;  1MIV A;  4CZZ B;  4XAX B;  2XAJ B;  5EE2 A;  2XUE A;  3CX7 B;  5FXV A;  5FP3 A;  3RBH A;  4GOU A;  4AYI D;  1LVK A;  5H6R B;  1Y64 B;  5C8Y E;  4AKR A;  2V26 A;  4NUU A;  3H37 A;  3ZCJ A;  2FGQ X;  3HI2 A;  2LSK A;  3C98 B;  5CB4 E;  2M07 A;  2LOS A;  5LBQ B;  3AVS A;  6PRN A;  1OPF A;  3KVD D;  4GF4 A;  1BH3 A;  3ZLI A;  2UXN B;  2ZM2 A;  2KXP A;  4XBF B;  2V7M A;  2A2F X;  3PRN A;  4I43 B;  3WAJ A;  2LOP A;  2VKD A;  4IST A;  3JTY A;  2VKJ A;  4ZI3 D;  3AA1 A;  4O4L E;  3AA0 B;  2FGR A;  4O3X B;  2E9X A;  1D0X A;  3O9X A;  1OXZ A;  3DP7 A;  5HAX A;  5JDF A;  3I0O A;  2NW8 A;  5FY0 A;  2V7K A;  2PG8 A;  4O3Z A;  4DMW A;  3E0Z A;  1WYB A;  2CEA A;  4HKA A;  3NRX A;  2XAH B;  3IEE A;  4E1S A;  3I1A A;  3POQ A;  1V9D A;  2I59 A;  3UU2 A;  1S94 A;  3C51 A;  1WR6 A;  5CA1 E;  5LXT E;  2EHO C;  2K24 A;  5JDM A;  3EMN X;  1FEW A;  2WM9 A;  2C0S A;  3FBL A;  2KIN B;  4C91 A;  5CA0 E;  5J2T E;  2E9X C;  4BJN A;  3H3A A;  3N5L A;  3O1J A;  1MIY A;  3Q5X A;  3VHL A;  4A56 A;  4AQF A;  3IBP A;  4KUM B;  3AA6 A;  4AYD C;  1HS7 A;  1IZN B;  5GON E;  2QA7 A;  5JDQ A;  1IJ6 A;  2D0T A;  3FXD B;  5LGU B;  4YJ2 E;  2MOZ A;  4L5G A;  2B1E A;  2VKO A;  5L3F B;  1BXW A;  4QQ1 A;  5L3B B;  1T98 A;  2WWU A;  3JC6 C;  3KIN B;  4X1Y E;  2LHF A;  3POX A;  1NAF A;  4D5U A;  2JJ9 A;  1BR4 A;  4BUM X;  4PJL A;  3VE2 A;  2XG6 A;  5GV0 A;  2Y0L A;  5FY7 A;  4AQF C;  4LSH A;  2NTY A;  3MKD A;  2MYS A;  3I9W A;  3UUL A;  5HXH A;  1BR0 A;  3KBT A;  3AA7 A;  4ZI2 D;  3OKQ A;  4GK0 E;  4Z8X A;  2KZ7 B;  5DL5 A;  3PE0 A;  4UEM A;  3ZYK A;  3HOL A;  3VY9 X;  4F4B A;  3SYB A;  1D0Y A;  5LNK A;  3AAA A;  2ZM8 A;  2YPV A;  3F31 A;  4QXC B;  2H3R A;  1MMD A;  2M67 A;  2ODJ A;  4AYE C;  2HPJ A;  5AFU K;  4PUX A;  3RKO A;  3RYI E;  5JQG E;  4GK5 E;  3PDY A;  5EK2 A;  5TAO A;  2J1N A;  3SZD A;  4GCP A;  4XZC A;  3T20 A;  3P7I A;  4TV9 E;  4ZS3 A;  2Y0K A;  2A3D A;  1ZHX A;  1QUU A;  4O4U A;  4E7Z A;  3SYS A;  2CXD A;  1D1B A;  4QKN A;  5G26 A;  2HPL A;  3KV4 A;  1MNE A;  4KMC A;  3S4U A;  4UXN B;  4G76 A;  3CVR A;  4YLH A;  3LK3 B;  4OYK A;  3OBV E;  4U72 A;  4IE4 A;  1ZHC A;  2CE7 A;  4M1P A;  3A5X A;  5AFU L;  3GWH A;  2CA5 A;  3PTR B;  1WYC A;  5F8P A;  3RX6 A;  5JR9 B;  4CXY A;  4XNL A;  3O0E A;  2KWH A;  4KR4 A;  3QK6 A;  2CM0 A;  3UUM A;  4D65 A;  1FMW A;  3HA4 A;  2NWB A;  2NP9 A;  1QJ9 A;  1MPF A;  3V8U A;  5JRE A;  1VRB A;  4DBQ A;  3O4X E;  2CLY C;  2WMN A;  3KV9 A;  3GN5 A;  4V1A v;  4AI6 A;  3J7Y q;  4H9N C;  3HWB A;  4PK6 A;  3C50 A;  2W80 C;  4AUI A;  5LBM A;  3U3I A;  4L0R A;  2YU1 A;  4PJM A;  1YKH B;  3ZC1 A;  4I50 E;  5LCY A;  4BA9 A;  3T0S A;  2ZFG A;  4JFB A;  4I55 E;  4TX5 A;  3NZP A;  4GHB A;  2ZLY A;  4ZHQ E;  2E9X D;  3AAI A;  3PU3 A;  5HWX A;  2PJQ A;  2J4U P;  2X9H A;  1MMA A;  3POR A;  4P09 A;  2H7O A;  3TZG A;  4AKH A;  3MK7 C;  2X67 A;  2W61 A;  3AAE B;  5IYZ E;  4IIJ E;  1MIW A;  4U74 A;  1WLX A;  3HL6 A;  4E7S A;  1ZHW A;  4FSO A;  2XQY A;  3HKC E;  5FNV E;  3CQX C;  3JC6 D;  4G63 A;  4YFS A;  4BAY B;  5LHH B;  4P0A A;  1GFN A;  3WI3 A;  5FYM A;  2MHL A;  1ZHT A;  4B61 A;  3BQK A;  1D1A A;  1SHZ C;  3RRC A;  2GE4 A;  2C5J A;  3RC8 A;  4UVA B;  1HXX A;  2XTQ A;  4AKL A;  2VB6 A;  4IE0 A;  2KND A;  3PUQ A;  3IHR A;  3LFM A;  3ZYL A;  4EOZ B;  3KBU A;  2XAF B;  2VK9 A;  3N2K E;  2ZMA A;  3PUS A;  2XTR A;  1SA0 E;  1UX4 A;  2LEH A;  3O1I A;  4O4H E;  3R6N A;  3LK2 B;  2KDY A;  5LJM A;  3RYF E;  4QXB B;  4DO0 A;  3NSG A;  2LSI A;  4DND A;  1Q9F A;  3LBX B;  5EK3 A;  1HCI A;  3GMI A;  4O2A E;  4QX8 B;  2DWK A;  4UF0 A;  5H6Q B;  5LG4 A;  5LYJ E;  3I0Q A;  3OYX A;  4WBO A;  5LJN A;  2CMR A;  1HFA A;  4UV9 B;  3SRZ A;  2PBI A;  2A72 A;  4N78 D;  2LHR A;  3C64 A;  3C4W A;  4FZL A;  2X9Y A;  4IDZ A;  2XAG B;  3BK9 A;  5JDH A;  4WBN E;  3NZQ A;  3HW9 A;  1G73 A;  4FT6 A;  5A1L A;  3MA9 A;  3N9M A;  4ASK A;  3ZMV B;  2RA1 A;  3RC3 A;  2N2M A;  3B57 A;  3MXZ A;  2DWG A;  4H63 H;  1E54 A;  1BR2 A;  2ES0 A;  4PK5 A;  2Q9Q A;  4GYS A;  4AKG A;  2L3L A;  5FXW A;  2RP4 A;  2D0U A;  3KDS E;  3VKH A;  4AZL A;  2CXL A;  4AFK A;  3ETV A;  1HTJ F;  4AKR B;  1WRD A;  1UX5 A;  1HX8 A;  1HG2 A;  3ZMZ B;  4FI5 A;  1H6S 1;  4XNK A;  4MHC A;  5L2L A;  2NW9 A;  3BQI A;  1H7C A;  2QGS A;  4G2A A;  3QRA A;  2MBG A;  1OSM A;  3PU8 A;  2K5B B;  4PFO A;  5FXZ A;  3SS1 A;  3LJC A;  5HXS A;  5F3J A;  2Q9Q C;  4RJW A;  2KXP B;  3HR0 A;  4PNI A;  2CWO A;  4AKM A;  2EHO B;  3KFW X;  3L09 A;  4UEL A;  3IF8 B;  3B13 A;  5BMV E;  3ANW B;  3AA1 B;  4LSF A;  2E9X B;  3AB3 B;  4YHJ A;  3SWH A;  2KWI B;  3EDU A;  5DL8 A;  3N2O A;  2YU2 A;  4CQI A;  3DTO A;  2H7V C;  3ZMS B;  1THQ A;  2VKH A;  2Y8D A;  3RPU A;  4MBQ A;  3LK4 1;  3VE1 A;  3ONX A;  4ZS2 A;  1GFM A;  2UXX B;  4ILU A;  3RRW A;  2K9A A;  3LK3 A;  3KV5 A;  2C5K T;  2N2L A;  4UVC B;  2IC9 A;  5JDL A;  5E0O A;  2O4V A;  5EK4 A;  5HXC A;  1Q9G A;  2VL8 A;  3FYX A;  2N2N A;  3AA6 B;  4FZM A;  1LKX A;  2XE3 A;  1HF8 A;  2JRK A;  1YW0 A;  3M65 A;  4GYR A;  3K3O A;  1MMN A;  2Z6E A;  4J2C A;  4PK4 A;  3Q9D A;  4CI3 B;  3C4X A;  5ETW A;  1QJ8 A;  5DL7 A;  3RYH E;  3SY9 A;  8PRN A;  2D5U A;  3ESL A;  3PUG A;  3UUX B;  3PQU A;  2D2S A;  4PFP A;  4FJO A;  3C4Z A;  3ZMT B;  4H9P C;  3HKE E;  1Z0P A;  2J1D G;  2JMK A;  3AA7 B;  5JDG A;  5KX5 E;  4EZH A;  4G75 A;  4O4X A;  2MTQ A;  2OMF A;  3ZMU B;  2BDE A;  5LGN B;  2Y0H A;  2LJL A;  4DMV A;  3UUN A;  5FXX A;  4IE7 A;  1HXT A;  3DJB A;  3MJX A;  1GFO A;  2DLR A;  2DCF A;  5IYU A;  1X79 A;  4OFZ A;  3ETU A;  4HE8 A;  5DJQ C;  3AAE A;  5JDP A;  3HKB E;  4JLE A;  3Q5W A;  3F57 A;  2PFV A;  3CML A;  2DHR A;  3RH3 A;  3RYC E;  1ZKE A;  5JRC B;  1U5P A;  4O4J E;  4FZN A;  4K0U A;  2CLY B;  2CCQ A;  2VWA A;  2W63 A;  4HGA A;  2LSY A;  3F2E A;  4LSE A;  1D1C A;  3T8O A;  3UT5 E;  4RJX A;  1KK7 A;  1LRZ A;  5FMN A;  5L3D B;  3CPZ A;  3EVY A;  3E22 E;  4IE5 A;  4FRT A;  4KR8 A;  3G7G A;  3VKG A;  2E8I A;  2XE1 A;  2Q9Q D;  2ODV A;  2DI4 A;  4ISS A;  4H9R C;  5HYA A;  5JDN A;  4JCH A;  3LBX A;  4NUV A;  2GK9 A;  3GN5 B;  4O4I E;  2W0G A;  3KV6 A;  3VZW X;  3FB2 A;  1E1H B;  2F1V A;  4E1T A;  1G8X A;  2YIN A;  4ADZ A;  2BZB A;  2W62 A;  3SY7 A;  4RL9 A;  1CUN A;  5LA6 E;  4GIW A;  3AA0 A;  2X9W A;  3UTK A;  1HG5 A;  4PJJ A;  4PJN A;  5KMG P;  4JUY A;  2W00 A;  4C90 A;  1MM4 A;  4HTE A;  2X27 X;  3PUA A;  5LOV E;  2XMX A;  3C5O A;  4PW8 A;  1FIO A;  1QSD A;  3K3Q C;  5JVD E;  4ZI7 E;  2X0L B;  4TUY E;  2Y2X A;  4CXW A;  5LHI B;  1US7 B;  1MND A;  1UCU A;  4YJ3 E;  4D64 A;  2SPC A;  4AYN A;  1NWM X;  4X1K E;  4AQG A;  5M4Y A;  5IHY A;  3K8P C;  4FES A;  2CWY A;  4JEU B;  4U9C A;  3N2G E;  3KVB A;  4H63 V;  1YKE B;  4FMS A;  4MAL A;  4GCQ A;  1IZN A;  5LHG B;  2V1D B;  2X51 A;  3UFE A;  2XE2 A;  2WSS V;  2NOX A;  5D5D A;  3TKL B;  5DQW A;  4HEA A;  4N58 A;  2NW7 A;  4OYJ A;  4RLC A;  3N9L A;  3Q2M A;  4QWN B;  2ODU A;  2PRN A;  2L8K A;  1ZV4 X;  2G0U A;  3LG7 A;  4KP3 C;  1AJ3 A;  2XTL A;  2POR A;  2EHO A;  3N9Q A;  4FRX A;  4RLB A;  3K19 A;  3E08 A;  3ANW A;  2IC6 A;  3PQS A;  5T5F A;  2Y6X A;  2BVL A;  3N9N A;  5PRN A;  2KZ7 A;  2LSG A;  4TZ4 C;  2K48 A;  3GP6 A;  4UF0 B;  4F6R C;  2ERV A;  3HKD E;  1KNZ A;  4CI1 B;  3GA8 A;  4EYY R;  4DBR A;  3K3N A;  4UVB B;  5HXR A;  5J1G A;  4MFR A;  4O49 A;  4P0B A;  2XE5 A;  3ZYM A;  3POU A;  1QJP A;  2CXF A;  2JPF A;  4ZOL E;  4N59 A;  3QUJ A;  4O3W A;  4OHF A;  4CI2 B;  3KVA A;  3ZJ1 A;  4QXH B;  2V7L A;  5HWY A;  2KMF A;  1PRN A;  5DAB A;  5LP6 E;  2N9D A;  5DQV A;  3ZJ2 A;  3UAQ A;  3W15 B;  2OA5 A;  4FUV A;  2QTK A;  4H9Q C;  4LSI A;  2ZLD A;  3UPG A;  2KLQ A;  2Q9Q B;  3V5S A;  2JQQ A;  2WBL A;  3CX8 B;  1S35 A;  3BQL A;  3N9P A;  3O1H A;  4JEH B;  3FHN A;  2LE8 A;  3NRY A;  4PAG A;  2F1T A;  5JR9 A;  3ZN0 B;  3ZPO A;  3I9Y A;  5KDM C;  4AYM C;  1MM5 A;  4UV8 B;  5JH7 E;  4OK0 A;  4H9S E;  3MZK B;  3ZEF B;  1ORM A;  3DA4 A;  4H9O C;  2LT3 A;  1VOM A;  1YD8 G;  2YK0 A;  3WAK A;  2XAQ B;  3CX6 B;  1U4Q A;  4HN9 A;  3FXE B;  2LHN A;  3ZN1 B;  3ZCI A;  2W81 C;  4KRA A;  3WI5 A;  4Z3T A;  1G90 A;  1B7T A;  2JMM A;  4FSP A;  3PUR A;  4FOZ A;  4EXT A;  5JR9 C;  4KBM B;  2ZM0 A;  3U78 A;  2L9Q A;  5J2U E;  4B6X A;  4AXP A;  5HXE A;  4GCS A;  2BVM A;  2HH7 A;  2YEV C;  4ZI3 C;  4IGU A;  4BJM A;  1MMG A;  1ZHZ A;  5FY1 A;  2C5I T;  3AAA B;  4EYU A;  2M06 A;  4O3Y A;  4IE6 A;  3R84 B;  2JMH A;  2MNH A;  4C69 X;  4IHJ E;  3SOL A;  1BT9 A;  4O8S A;  5JRC A;  3DA3 A;  2ACX A;  2XHE B;  3L3P A;  2LSJ A;  4CXX A;  3VZU X;  5ADX K;  2XAS B;  1GFP A;  4TV8 E;  4EIW A;  3OJA A;  1IJ5 A;  3EDV A;  7PRN A;  3LK4 2;  2IAK A;  1GFQ A;  1FMV A;  3EUH A;  3SZV A;  4QX7 B;  2Y48 B;  5L3G B;  5DL6 A;  1OWA A;  3D0T A;  3T24 A;  4EB6 E;  2DNX A;  3A2S X;  5L3E B;  1YS5 A;  3HOE A;  4X20 E;  1BR1 A;  4HFV A;  4QHO A;  5ADX L;  2WAU A;  2KC0 A;  4EZ4 A;  4AKI A;  3VY8 X;  3QRC A;  4ANJ A;  4UIG A;  3WI4 A;  2VAS A;  3N9O A;  3FBZ A;  3MAC A;  4O2B E;  1ZEE A;  3V5U A;  4DVD A;  3LK2 A;  3NBX X;  1O3X A;  1LVF A;  3CKD A;  3CQG B;  1D0Z A;  2YNK A;  5LGT B;  3OYZ A;  2EHO D;  4X1I E;  4L9I A;  4ZI2 C;  4ERR A;  1PHO A;  5L3C B;  2K0L A;  5FVN A;  4TN7 B;  3ZC0 A;  2X9X A;  2WMO A;  2NTX A;  3AVR A;  3QC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...