3AAAB

Crystal structure of actin capping protein in complex with v-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 82
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaaB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaaB02
3AA1A 3LK2B 5ADXK 3AA6B 1IZNB 3AA7B 3AAAB 3AA0B 3AAEB 4AKRB 2KXPA 3LK3B 5AFUL 3LK2A 3AA6A 2KZ7A 3AA1B 3AA7A 3AAAA 5AFUK 3LK42 3LK41 1IZNA 3AAEA 4AKRA 2KXPB 3LK3A 3AA0A 2KZ7B 5ADXL
chains in the Genus database with same CATH superfamily
1N32T 4DV7T 3SFEA 3E08A 2V1DB 4HE8A 3UUNA 4J2CA 4AQFA 1Y64B 5DQVA 3LG7A 3HKBE 3T24A 4GIWA 1XDOA 5HWYA 2JMHA 2CXLA 4FI5A 5LYJE 3CX7B 2NTYA 2Y6XA 4JI3T 1IAPA 2WY2A 3VZTX 2V7KA 4H63V 3KV4A 3JAFA 5L3EB 4I50E 3BS0A 4HKAA 3ONLC 2NW8A 2M07A 3F57A 4QQ1A 3N2GE 2XAGB 4ZI3C 4AKIA 4TWFA 3V8UA 5D5DA 1MMAA 2JMMA 2BDEA 2HPLA 3T1HT 2QA7A 3PF1A 2BG9A 2V26A 4H9PC 3PUYF 3UFEA 2FBWA 5HXRA 2X68A 3VZUX 5JVDE 2W61A 2ODJA 4HWIB 5LHGB 2Q9QB 2I0MA 1CHUA 1MIVA 2UUCT 4RJXA 5H2FO 4JBWF 2X27X 1Y01A 4TNWA 3ZMTB 4AZLA 4X20E 1NENA 2ES0A 3ONJA 2V7IA 2NP9A 2QYWA 4B3TT 3PGUA 2KWIB 3IHRA 1YD8G 1X79A 2DL1A 2KZ7B 2D9DA 4B3RT 4HWCA 3UQ7A 3AA1A 1W0BA 2KWHA 2G0UA 1QJ9A 3AAAB 2C5IT 4YFSA 2IW5B 4U2ZA 2Y48B 1OWAA 3NZQA 2VQET 2BS2A 2DHRA 1IBKT 3SS1A 1FIOA 3MKDA 4Q25A 1VRBA 1E1HB 3PQUA 4HWHA 1O3XA 1KFYA 3JAEA 5DL7A 4D5UA 2IWWA 4YTMA 3VR8A 5B66O 4BAYB 5HEHA 5JQGE 1S5LO 3PUAA 2BBHA 3JTYA 4O4UA 4PFPA 3GN5A 2E5LT 3GWHA 2B1EA 1CUNA 5FXXA 5AQHB 3P4RA 4KR8A 4LF7T 4U3CA 3RYIE 4X62T 2NWBA 3PURA 5HCJA 2PBIA 4I4TE 2H7OA 3PGSA 5JDLA 3HOEA 2KT9A 4A98A 3C4WA 4CXXA 1U4QA 2CPTA 4EV6A 5KXJA 1B7TA 2ACXA 5L3FB 4QH4A 4ZOLE 5AFUK 4EZ4A 1ZP0A 3JCFA 5LG4A 2LJLA 4L5GA 3UUXB 4EGWA 2LSIA 4O3WA 5HYAA 3EAMA 1G90A 1MM5A 2X67A 4DR1T 5HXEA 2AXTO 1Q9GA 4ILCA 4ZI2D 1E2AA 2KINB 3C4ZA 2FJDA 2WB5A 2V8SV 3HA4A 4PJJA 2VWAA 4I43B 4HEAA 2H7VC 4KI0F 3W15B 2R4LA 1BXWA 3AEFA 4HN9A 2FJBA 2BVMA 3AEBA 4UVCB 2H3RA 3QB5K 3NRXA 2B76A 5AQSB 3NRYA 3LBXB 3ETVA 3U3IA 3C98B 3WAJA 5ABEA 3OVUA 3CK6A 3LFMA 2HH7A 2J4GA 3GA8A 4CTDA 2V6YA 2X0YA 3ZN0B 4M1PA 4Z91A 5IUXA 1JNZA 3LK42 2W66A 3AE9A 4EAHA 2P9BA 5KX5E 1MMGA 5JH7E 4IL4A 4FRTA 5AQQB 3N9QA 3ZT7A 3M65A 2XQ8A 4JI0T 2EHOD 4QHOA 1BR4A 1ZHTA 4N74A 2R89A 4O4HE 4ZS2A 3KBUA 4L9IA 4AI6A 2XM1A 4BA9A 3VHLA 4DO0A 3POUA 3N9PA 5TAOA 1D1BA 2N2NA 2CCQA 3A5XA 4FOZA 3HKEE 2XG6A 4OK0A 3OTOT 2V5DA 3P8CD 2N2MA 5F3JA 3SFDA 4XBFB 2R88A 3VR9A 2XQ4A 1HCIA 3RIUC 2CLYB 1LKXA 4UF0B 4O3XB 5E79O 4H9NC 2CWOA 4QXBB 2XQ3A 3HW9A 4QXCB 2JQYA 2KLQA 3BQLA 1OEDA 3VRBA 4AYEC 4O2BE 4MLKA 4JI8T 5F5WA 4IREA 4CXYA 4QKNA 3EI0A 4OX9T 4O4XA 4TUYE 4P0BA 3TLVA 3FZFB 2XTRA 4NIQA 3AAIA 1OEDE 3O1JA 1S35A 4ZI3D 2YEVC 1ZHZA 4O4LE 5ADXK 5T5FA 2PORA 2R4NA 4PK5A 4PFOA 2H88A 3KVBA 2V6XA 2KXPA 4IT4A 4HFEA 3AEGA 2JIWA 2PRNA 4U74A 4O4JE 4FZLA 2MPKA 4GK5E 2IHR1 4PUXA 3PUWF 2CA5A 4D65A 2UXBT 2EHOC 5BR8T 1X9BA 1GFPA 1T72A 3DA3A 2AXDS 2WDQA 2HPJA 4LMJA 3RIAA 2FGQX 2VL0A 3AA7A 3PUXF 3TKLB 3TLSA 3AB3B 5LP6E 4HFHA 4OFZA 3LK41 1LVFA 3T8OA 4ASKA 2J62A 5L3CB 4UIGA 1D1AA 1MM4A 5G3AA 4BJNA 3CQGB 2JPFA 4GYSA 5EK4A 4AISA 3UU4A 4TV8E 1HX1B 2MTQA 2BS4A 5JTGA 3HI2A 3JC6D 2IDOB 2L3LA 2M6IA 3HWBA 2LFUA 2I59A 3ANWB 2IC9A 4TWDA 3J9X1 4DVDA 3RYHE 3NZPA 4U7IA 3AA0A 5LA6E 4AIUA 1IBMT 2LEHA 4MBQA 1H6S1 5FVLA 4PJMA 5LBQB 2ACZA 1G8XA 3PUGA 1ZHCA 3MACA 4OHFA 1ZEEA 1KNZA 4DV3T 2OMFA 3SRZA 1FJGT 3A0BO 3EDVA 5B5EO 3IA3A 2KXPB 2FUPA 2LM9A 2SPCA 4EOZB 4HFCA 1W09A 5LBMA 4Z8XA 2E9XA 3I0OA 3ZEFB 4IDQA 3JCUO 5KAFO 5CJ5A 4DV6T 5LJNA 5L47A 1V9DA 5DL5A 4QH1A 2BG9E 3KINB 4DIDB 2WU2A 5LHIB 2LOSA 3TLTA 5LJMA 1OEDB 2WS3A 3SZDA 4AYMC 4CI1B 3LK2A 2N2LA 2OLTA 1HFAA 4LFCT 2XAQB 4DUYT 3UUMA 3C64A 4YSZA 4YSXA 2WWUA 1LVKA 5FXWA 4C90A 4O3ZA 4AQFC 3VU7H 4IDOA 5GTHO 4KMCA 2YU2A 2A3DA 1THQA 1QLBA 4IDPA 3FB2A 3RKOA 4F8HA 3ABVA 3AE2A 4AKRA 5AQPB 4X65T 2BKPA 3QK6A 2OV9A 4ISSA 5HWXA 3P4QA 3VRAA 2GK9A 2QRXA 2XQ7A 3O0EA 4TWHA 5AFUL 3C51A 1YKEB 1BR2A 4FQEA 5G26A 1OEDC 5EE2A 5FNVE 1KK7A 2V7MA 3FZHB 4XAXB 4YJ2E 3RC8A 2XE5A 4JV5T 3BRYA 2C0SA 4HWFA 4I55E 3HKCE 5HCMA 4AYDC 2JJ9A 2EHOA 3LDQB 2LRKA 4NUUA 4IL6O 4N75A 4A5XA 2LHFA 4CN6A 2X66A 3LK3A 2A2FX 3CVRA 4PJNA 1XMQT 3OPCA 2BKNA 2ZLYA 3I9YA 4D64A 4U7YA 5JDQA 4KX6A 3J7Yq 4PAGA 2KMFA 3DZMA 3ZJ2A 3O1IA 4DNDA 2YDQA 4FESA 4UEMA 4LSHA 1YQ4A 2YNKA 2AE9A 4EYUA 5J0ZA 2HN1A 2XSAA 4ZZCA 5G38A 1W0AA 2CXDA 4KBMB 4WBOA 3CKDA 4H9RC 1M62A 5J2TE 3T0SA 3FHNA 2YKSA 5LB7B 3PU3A 4FT6A 1VCSA 5C3JA 4H9OC 4AYID 4XNKA 5LCYA 4CN4A 1UX4A 3GP6A 2BG9B 2CRBA 3CMLA 2WDVA 4A97A 5G39A 5JDGA 3JC6C 2ODUA 3AXJB 4GYRA 4DV2T 4HTEA 1HNWT 3V5SA 4G75A 3C4XA 2X9HA 5EZYE 5JRCA 4NPPA 5FXZA 4AKHA 2R4PA 5L3BB 4GF4A 2Z6EA 3O4XE 5HEUA 5H6QB 5GV0A 3RX6A 4E7SA 7PRNA 4GOUA 3RHWA 2IC6A 4GK0E 5LGNB 2XE1A 2LSKA 4JI1T 3RQUA 3WI5A 3VY9X 1YXRA 3H3MA 4IDNA 4IE4A 5HXSA 2YDRA 1IZNA 4CI2B 2IWVA 4B6XA 3KZIO 4C4VA 3KV6A 3V5UA 1SA0E 1SE7A 4G2AA 1I6ZA 4JEUB 1YW0A 2J4UP 3ZN1B 4EB6E 2X0HA 4O3YA 4P1NA 4AQYT 3WAKA 3H3AA 5FY7A 5HXCA 5CA1E 4KP3C 3D0TA 1I94T 3KVAA 5DL6A 2WMOA 3HR0A 4AXPA 2RP4A 1NAFA 3ZC1A 4IIJE 4JLEA 4UVAB 5DABA 3E22E 2R8AA 3CWZB 4YTPA 2WWVA 3NVOA 3AVRA 4K0UA 5JR9C 4RL9A 2X9WA 4QX7B 2CM0A 2W80C 5JDPA 4X1KE 3B57A 2CHNA 1PRNA 5LMNT 3ONXA 3SYBA 1MIYA 4PK4A 2M06A 4ZXLA 3N2OA 3EUHA 3MJXA 3R84B 3CX8B 5AQVB 2N1GA 4NXNT 2M6BA 4U2YA 3UU5A 4JI7T 5C2TA 1N33T 4UV9B 3VE2A 2LM2A 5J1GA 4GCPA 1D0YA 4OYJA 4HGAA 3CQCB 3NKZA 3UTKA 3OYZA 1DU2A 2KSRA 3ZPOA 4YTNA 3LK2B 2QVAA 4LF5T 3FZKB 3ANWA 3ZT5A 3ETUA 4K3CA 2L8KA 4KHZF 1YS5A 5AQKB 4O4IE 1KF6A 4EEBA 4ZHQE 4YHJA 2E9XB 3NWIA 2XY8B 4C91A 4PJLA 3UULA 3N9LA 1HXUA 4C00A 5FMNA 3QRCA 5HXHA 2CMRA 2VKDA 4JI2T 5FXVA 4JYAT 5AQRB 2K0LA 2QTKA 3WI4A 5LXTE 1MNEA 3RYFE 5PRNA 3I9WA 4TN7B 4CI3B 2E5VA 2LSYA 3L3PA 3G06A 3X1DA 3AA6B 3N9NA 5JR9A 3CX6B 4E7ZA 4BUMX 4ZI7E 5BMVE 1KNRA 4B3ST 3OBVE 4L0RA 3LJCA 4JI4T 2KZ7A 3HL6A 3UQ4A 2PFVA 4GCSA 3AVSA 2RPAA 4EZHA 3K3OA 4EIWA 3KV5A 2Y7SA 2X9KA 3IF8B 3LSVA 3UU3A 4DR6T 5AQTB 2NW9A 2KNDA 4FSOA 1GFMA 3H37A 3NJTA 2K48A 2W81C 3AA1B 1GFNA 4I0UA 4G63A 3RPUA 4N78D 4YHHT 1BR1A 2XPKA 3FXEB 3RRWA 4LF4T 4WYVA 2PJQA 4JUYA 3BQKA 3AE3A 2LLYA 2YU1A 1QSDA 4DV5T 4A56A 2BS3A 2VASA 2YINA 4ILUA 4U9CA 3Q5WA 3AE5A 1UCUA 4K0KT 2F1TA 2ZM6T 2WSSV 4E1TA 4B3MT 5LOVE 1BR0A 4PR7A 5TISO 4UELA 1HG2A 2F1VA 6PRNA 2VVSA 1QJPA 2ODVA 4X64T 4RJWA 3FYXA 1WRDA 4ZZBA 3WI3A 5FY0A 4QX8B 3R6NA 5E0OA 5AQOB 5JDHA 2JMKA 3SYSA 2XMXA 2W4XA 5JREA 2J1DG 3CPZA 3SZVA 3K8PC 4B61A 5HAXA 2IMLA 4X5TA 1S94A 4ZS3A 2A72A 4C69X 2DI4A 2WMNA 4COFA 4DR4T 1N34T 2XQ6A 4EYYR 4DBRA 4YLHA 2CEAA 3A2SX 3EVYA 4U33A 5JR9B 4HFBA 4YT0A 3AA6A 3Q5DA 1M7KA 3PUQA 2ZMAA 1XDPA 3QUJA 5L4EA 4V1Av 2MOZA 5DQWA 2CHOA 1VCTA 2UXNB 2EHOB 2IAKA 2W2UA 3PDYA 2Y0HA 4TNVA 4HFVA 5CGMA 5LMUT 3KVDD 3N2KE 4ILAA 3RLFF 8PRNA 1J5WA 1SHZC 3SWHA 3I0QA 4IE5A 5HEOA 2VURA 1MIWA 3C50A 1T1LA 2WQYA 5CFBA 3ESLA 1J5ET 4CZZB 4QH5A 1H7CA 3FBZA 3HOLA 2RA1A 2Y8DA 3CIRA 2UXCT 2J47A 5L2LA 2DLRA 5JDFA 3MZKB 4CQIA 5FP3A 2D2SA 2ZM8A 5FL0A 2XSBA 4AKLA 4IE0A 4DBQA 2W62A 5DJQC 3ZJ1A 3OKQA 4IE7A 2BZBA 4QWNB 5IWAT 5AQIB 2WU5A 4H9SE 4JI6T 2W00A 4DR5T 3AE4A 1QUUA 3P50A 2BG9C 2XQAA 4E1SA 4DV4T 3A7MA 1P4TA 3PJAA 4QXHB 2V7LA 4X1IE 3GN5B 3SOLA 2UXDT 4FUVA 2JRKA 2JQHA 4KR4A 2XAFB 2XJ7A 2XZEA 1GQEA 1IJ5A 3UPGA 2K5BB 2MBGA 3BRZA 2ZFGA 4WNKA 4DR7T 3UU2A 1ZHXA 2VK9A 4IE6A 1BH3A 1OPFA 1QJ8A 1SUMB 4IDZA 3CQXC 4NUVA 5L3DB 5EK2A 4FSPA 3AE7A 1KEYA 2N9DA 3ZCIA 5IYUA 3RIUA 2LKHA 2OA5A 3AA7B 4ILBA 5IYZE 1HF8A 2PG8A 5F8PA 3PUSA 3POQA 1VOMA 4Z90A 3PU8A 3K3QC 3F2EA 5JDMA 2XTQA 3PGRA 3RC3A 2WJQA 2WZHA 3VKGA 3ZKRA 4LF6T 3I1AA 2X0LB 1MMNA 5AQGB 4RLCA 3DA4A 4AQGA 2Q9QA 3KFWX 1HNZT 1ZHWA 2WCAA 1GFOA 4WZXA 5FYMA 1ZV4X 2UUAT 2R4OA 2X9XA 1ORMA 4X66T 5FL1A 4G76A 4DUZT 1XZYA 3ZMSB 4JI5T 4YSYA 1IBLT 4KUMB 2XE3A 3ZCJA 2KC0A 1ZOYA 3O9XA 1W9RA 3RQWA 1HXTA 3S4UA 1BT9A 3ZYKA 2NR4A 5GONE 1E7PA 3Q5XA 5CB4E 1D1CA 1T8BA 2ERVA 4AYNA 5J2UE 4DMVA 4FZMA 1OXZA 3U78A 4KHPT 4ISTA 1YKHB 3OYXA 4EXTA 2XASB 3PUVF 1NEKA 1MPFA 2E9XD 1UK5A 1ZKEA 3E0ZA 4LMLA 3ZT6A 2XUEA 1PHOA 1HX8A 4DR2T 1OSMA 2LSJA 2WZIA 5L4HA 2DWKA 5CA0E 2W63A 1XWMA 2VKJA 3DWOX 4WW0A 3RBHA 4DV1T 4GKJT 2JQKA 2L9QA 1UX5A 1WYBA 2LHRA 5JRCB 3DP7A 1U5PA 2LOPA 3VKHA 3AE1A 4IGUA 2MNHA 2D0UA 2WVPA 5A1LA 5GTIO 2CE7A 2UU9T 4ADZA 3TZGA 1XNRT 3DJBA 3QOFA 3KBTA 2FGRA 2F1CX 1LRZA 2HHHT 4LSFA 2CWYA 2R6GF 3RKGA 2Y0LA 3T20A 2ZM0A 5KMGP 2FJAA 3O1HA 2A9UA 3AE8A 2I6HA 2J1NA 5AQLB 3MK7C 2DNXA 2XTLA 5M4YA 4UVBB 2CBJA 3EMNX 2V7JA 3N9MA 3VE1A 2XQ9A 3P7IA 2VQFT 4LFAT 3FZMB 2YN6A 5LGTB 3K19A 5ETWA 4ZI2C 4BJMA 1WYCA 3RRCA 2LKGA 5AQJB 4U31A 3HKDE 2CXFA 3P4PA 3UAQA 4LF9T 4AKGA 2K3WA 3POXA 3EABA 4DV0T 3P4SA 5C8YE 5LNKA 5KAIO 2XQYA 3ZMZB 2LHNA 1ZHYA 2WM9A 5AQNB 1T7SA 3PQSA 5FKYA 5ABFB 3QC9A 1AJ3A 2M67A 4OYKA 4FRXA 2XQ5A 3QNUA 3PRNA 3ZLIA 4MHCA 3RIFA 3F31A 4TV9E 5FY1A 3B5MA 3MA9A 3ZYLA 1J1JA 3ZMVB 2VL8A 2BVLA 1UURA 3WU2O 1D0ZA 3MXZA 3RF1A 3P4WA 2NW7A 5LHHB 4FZNA 4XZCA 2VKOA 2W67A 3K1SA 2UUBT 1T98A 2W0GA 3UT5E 3NSGA 2LRLA 3FXDB 2MHLA 4LMKA 2K9AA 1IJ6A 3VY8X 3RYCE 1UUSA 3G7GA 5DL8A 2YDSA 5ABFA 5IHYA 1HTJF 2JQQA 3AE6A 3JADA 5AQFB 5ABGA 1NWMX 3L09A 1HNXT 3RGLA 2HN2A 2E9XC 3AECA 2JQ9A 4EEDA 2V5CA 2VKHA 2C5JA 4AKMA 4YY3T 3PJAJ 3NBXX 4JCHA 3PUZF 2D0TA 3PV0F 4HFIA 3LK3B 4IHJE 3IEEA 3AEDA 3SY7A 4LSIA 2F4VT 4AFKA 2E8IA 2NOXA 5LG3A 4YJ3E 5FVNA 3ZC0A 1XMOT 3PTRB 5KDMC 3VZWX 3UU8A 5AQMB 4LFBT 3RH3A 1WFDA 4O2AE 4FMSA 2WP9A 3ZMUB 2XHEB 5L3GB 3AA0B 3AAEB 2MAWA 4AKRB 3AEEA 2NTXA 2C5KT 3M3ZB 4GHBA 4CN1A 2Y2XA 3DTOA 2MYSA 2KDYA 3A0HO 3AAEA 1EZ3A 4U72A 2ZM2A 2YPVA 2LSGA 2K24A 4P09A 3BK9A 4H63H 2XE2A 1L0VA 2IIUA 3ZSTA 5ABHA 4PW8A 3LBXA 3C5OA 4PJ0O 3TLUA 1T16A 4UV8B 5AQUB 4KRAA 4UXNB 2O4VA 1HR0T 3N9OA 4K3BA 3TLWA 2WJRA 2UXXB 4UF0A 1D0XA 4UB6O 1Z8UA 3AXJA 4N58A 3QB5A 3B13A 4YXDA 3K3NA 3SY9A 4JFBA 4MFRA 2K4TA 2D5UA 2V6YB 3PE0A 4DR3T 2FJEA 2PTFA 1WR0A 2WAUA 2LT3A 3ZYMA 4GKKT 4ZEYA 1JNRA 1FMWA 5H6RB 4ERRA 3EHZA 2QGSA 4JEHB 4CXWA 1G73A 1WLXA 5HEJA 3Q9DA 1IZNB 3L39A 4HWDA 4PNIA 2LE8A 1WR6A 3Q5EA 4TX5A 4FJOA 4UR9A 2DCFA 5JDNA 1HG5A 3UFGA 3OJAA 4PK6A 3GMIA 1E54A 2DWGA 2VVNA 1US7B 3IBPA 2CBIA 3EDUA 3N5LA 3FZLB 5FVKA 3PORA 4UB8O 1WCRA 3A8YC 4IL9A 2IUBA 3AEAA 3T1YT 3KV9A 3UU6A 4ANJA 4HFDA 1GFQA 2WDRA 4N59A 1KNPA 4X1YE 1XNQT 4RLBA 1Z0PA 4C4VB 4DMWA 2Q9QC 1MMDA 4AUIA 4H9QC 2H89A 2BKOA 3BQIA 2VB6A 1R8IA 4O8SA 2XM2A 3KDSE 3UUBA 3DWNA 1FEWA 5ADXL 2X9YA 1N36T 4O49A 4MALA 3ZSSA 1FMVA 2BBJA 4WBNE 3QRAA 3Q2MA 4TZ4C 2XAJB 2E2AA 4LF8T 3L8RA 1Q9FA 1YQ3A 4GCQA 2ZLDA 2XAHB 5HEGA 2WBLA 3RI5A 2YK0A 2GE4A 4F4BA 4XNLA 4F6RC 2Y0KA 2YOEA 4LSEA 1MNDA 5LGUB 2CLYC 4Z3TA 1HS7A 3FBLA 2Q9QD 3AAAA 5EK3A 1UGOA 1HXXA 4NXMT 4P0AA 2X51A
chains in the Genus database with same CATH topology
2JPFA 3L3PA 2Y0LA 4GYSA 3AA6B 3N9NA 5EK4A 5JR9A 3T20A 2ZM0A 5KMGP 3CX6B 4E7ZA 3E08A 4BUMX 4ZI7E 4TV8E 2MTQA 3O1HA 5BMVE 2V1DB 4HE8A 3UUNA 3HI2A 3OBVE 4L0RA 2J1NA 3LJCA 4J2CA 2KZ7A 3HL6A 3JC6D 2PFVA 2DNXA 2XTLA 1Y64B 3AVSA 3MK7C 5DQVA 4UVBB 2L3LA 3LG7A 4AQFA 3K3OA 4EZHA 4EIWA 3EMNX 3HWBA 3HKBE 2V7JA 2LFUA 2I59A 3KV5A 3N9MA 2Y7SA 3ANWB 3T24A 3VE1A 3IF8B 2IC9A 4GIWA 3P7IA 3J9X1 3RYHE 3NZPA 5HWYA 4DVDA 2JMHA 3AA0A 2CXLA 5LGTB 4FI5A 5ETWA 5LA6E 5LYJE 3K19A 3CX7B 2LEHA 4MBQA 4BJMA 4ZI2C 1H6S1 2NTYA 1WYCA 2Y6XA 3RRCA 1IAPA 4PJMA 5LBQB 3VZTX 2V7KA 4H63V 4FSOA 2NW9A 3KV4A 1G8XA 3PUGA 2KNDA 3HKDE 1ZHCA 2CXFA 3MACA 4I50E 4OHFA 5L3EB 1ZEEA 1KNZA 4HKAA 2OMFA 4AKGA 1GFMA 3UAQA 3H37A 3SRZA 2K48A 2W81C 3AA1B 3POXA 2NW8A 2M07A 3F57A 1GFNA 4QQ1A 3EDVA 3N2GE 2XAGB 4ZI3C 4AKIA 4G63A 3RPUA 2KXPB 3V8UA 5D5DA 4N78D 1MMAA 1BR1A 2JMMA 5C8YE 2BDEA 2HPLA 3FXEB 2LM9A 3RRWA 5LNKA 2SPCA 4EOZB 2QA7A 2V26A 4H9PC 2XQYA 3ZMZB 5LBMA 4Z8XA 2LHNA 2E9XA 3I0OA 3UFEA 2PJQA 4JUYA 3ZEFB 1ZHYA 2WM9A 3BQKA 2YU1A 3PQSA 5HXRA 2X68A 3QC9A 1AJ3A 1QSDA 5JVDE 3VZUX 2W61A 2ODJA 5LHGB 2M67A 4A56A 5LJNA 2Q9QB 2VASA 2YINA 4ILUA 4OYKA 4FRXA 4U9CA 1MIVA 3Q5WA 3PRNA 1V9DA 5DL5A 4RJXA 3ZLIA 4MHCA 3F31A 4TV9E 5FY1A 1UCUA 3KINB 5LHIB 2LOSA 2F1TA 2X27X 3ZMTB 5LJMA 2WSSV 4E1TA 5LOVE 1BR0A 3SZDA 3MA9A 4AYMC 4AZLA 4UELA 4X20E 2ES0A 3ZYLA 3ZMVB 4CI1B 3LK2A 1HG2A 2VL8A 2F1VA 2N2LA 6PRNA 2BVLA 1HFAA 2V7IA 1QJPA 2XAQB 2NP9A 3UUMA 3C64A 2KWIB 2ODVA 3IHRA 4RJWA 3FYXA 1WRDA 1D0ZA 1LVKA 1YD8G 2WWUA 5FXWA 4C90A 4O3ZA 3MXZA 1X79A 2KZ7B 3WI3A 5FY0A 2NW7A 4QX8B 4AQFC 3R6NA 3VU7H 3AA1A 2KWHA 5E0OA 5LHHB 4FZNA 2G0UA 4XZCA 2VKOA 3AAAB 2C5IT 1QJ9A 4YFSA 5JDHA 2JMKA 3SYSA 4KMCA 2XMXA 2IW5B 5JREA 2Y48B 1OWAA 2YU2A 3NZQA 2A3DA 2J1DG 1THQA 1T98A 2W0GA 2DHRA 3CPZA 3FB2A 3SS1A 3UT5E 1FIOA 3RKOA 3NSGA 3MKDA 3SZVA 3K8PC 1VRBA 4B61A 1E1HB 5HAXA 3PQUA 1O3XA 3FXDB 2MHLA 5DL7A 1S94A 4ZS3A 2A72A 4AKRA 2K9AA 1IJ6A 4C69X 4D5UA 2DI4A 2WMNA 3QK6A 3VY8X 3RYCE 4BAYB 4ISSA 5HWXA 3G7GA 4EYYR 5DL8A 5IHYA 1HTJF 5JQGE 4DBRA 2GK9A 3PUAA 4YLHA 3O0EA 2JQQA 2CEAA 3JTYA 4O4UA 4PFPA 3GN5A 3EVYA 3A2SX 3GWHA 5AFUL 3C51A 5JR9B 1YKEB 3AA6A 2B1EA 1CUNA 5FXXA 1NWMX 3L09A 3PUQA 2ZMAA 3QUJA 1BR2A 4KR8A 5G26A 5EE2A 4V1Av 2MOZA 3RYIE 5FNVE 2NWBA 1KK7A 2E9XC 2V7MA 5DQWA 3PURA 2UXNB 2PBIA 4I4TE 4XAXB 4YJ2E 2EHOB 2H7OA 2IAKA 3PDYA 2VKHA 2C5JA 5JDLA 3RC8A 2KT9A 2XE5A 2Y0HA 3HOEA 4HFVA 4AKMA 3C4WA 4CXXA 3KVDD 3N2KE 2C0SA 1U4QA 3NBXX 4I55E 4JCHA 3HKCE 4AYDC 1B7TA 2JJ9A 1SHZC 2ACXA 2D0TA 2EHOA 3I0QA 3LK3B 3IEEA 4IHJE 4IE5A 3SWHA 5L3FB 4ZOLE 3SY7A 1MIWA 4LSIA 4AFKA 5AFUK 2E8IA 4NUUA 2NOXA 3C50A 4YJ3E 4EZ4A 5FVNA 3ESLA 3ZC0A 4CZZB 3PTRB 5LG4A 2LHFA 2X66A 3LK3A 8PRNA 2LJLA 4L5GA 3UUXB 5KDMC 1H7CA 2A2FX 3CVRA 3VZWX 3FBZA 4PJNA 2LSIA 4O3WA 2ZLYA 2RA1A 3I9YA 3RH3A 3HOLA 2Y8DA 4D64A 5JDQA 3J7Yq 4O2AE 5HYAA 4FMSA 4PAGA 3ZMUB 2XHEB 5L3GB 5L2LA 1G90A 3AA0B 1MM5A 2DLRA 2KMFA 5JDFA 3AAEB 4AKRB 2X67A 3MZKB 4CQIA 5FP3A 2D2SA 2NTXA 2ZM8A 3ZJ2A 3O1IA 4AKLA 4DNDA 2C5KT 4IE0A 4DBQA 5HXEA 4GHBA 4FESA 4UEMA 1Q9GA 4LSHA 2W62A 2YNKA 2Y2XA 5DJQC 4EYUA 3DTOA 4ZI2D 2MYSA 2KDYA 2KINB 3AAEA 3ZJ1A 1EZ3A 3C4ZA 3OKQA 2BZBA 4IE7A 4U72A 2ZM2A 2CXDA 4QWNB 2YPVA 4KBMB 4H9SE 3HA4A 2LSGA 3CKDA 4WBOA 4PJJA 2K24A 4H9RC 4P09A 5J2TE 3BK9A 4H63H 3FHNA 3T0SA 3PU3A 2XE2A 2VWAA 4I43B 4FT6A 2W00A 4HEAA 2H7VC 4H9OC 4AYID 1QUUA 4XNKA 3W15B 5LCYA 1UX4A 1BXWA 3GP6A 4HN9A 4PW8A 3LBXA 3C5OA 3CMLA 4E1SA 2BVMA 1P4TA 4UVCB 2H3RA 4QXHB 4UV8B 4KRAA 4UXNB 2V7LA 3NRXA 5JDGA 3JC6C 4X1IE 3GN5B 3SOLA 2ODUA 2O4VA 3N9OA 4GYRA 3NRYA 3LBXB 4FUVA 3ETVA 2JRKA 3U3IA 2UXXB 4UF0A 4HTEA 4KR4A 2XAFB 3C98B 1D0XA 3WAJA 3V5SA 4G75A 1IJ5A 3C4XA 2X9HA 5EZYE 3UPGA 2K5BB 2MBGA 4N58A 3LFMA 5JRCA 3B13A 2ZFGA 2HH7A 5FXZA 3GA8A 4WNKA 4AKHA 1ZHXA 3UU2A 2VK9A 3ZN0B 4M1PA 5L3BB 4IE6A 4GF4A 2Z6EA 3O4XE 1BH3A 3LK42 5H6QB 3K3NA 5GV0A 1OPFA 1QJ8A 3SY9A 3RX6A 4JFBA 4MFRA 2K4TA 2D5UA 4IDZA 4E7SA 7PRNA 4GOUA 3CQXC 4NUVA 4EAHA 3PE0A 5L3DB 2P9BA 5EK2A 5KX5E 1MMGA 4FSPA 5JH7E 2IC6A 2N9DA 4GK0E 5LGNB 3ZCIA 5IYUA 2XE1A 2OA5A 3AA7B 2WAUA 5IYZE 4FRTA 2LSKA 2LT3A 1HF8A 2PG8A 3ZYMA 5F8PA 3PUSA 3POQA 1VOMA 3WI5A 3VY9X 3PU8A 3K3QC 3N9QA 3F2EA 3M65A 4IE4A 5JDMA 2XTQA 1FMWA 5HXSA 3RC3A 5H6RB 1IZNA 4CI2B 4ERRA 2EHOD 2QGSA 4JEHB 4B6XA 4CXWA 4QHOA 1BR4A 3VKGA 3I1AA 2X0LB 3KV6A 1ZHTA 3V5UA 1SA0E 2J4UP 4G2AA 4O4HE 4JEUB 1YW0A 1MMNA 4ZS2A 4RLCA 1WLXA 1G73A 3ZN1B 4EB6E 3DA4A 4O3YA 4AQGA 2Q9QA 3Q9DA 3KBUA 1IZNB 3KFWX 4L9IA 4AI6A 3WAKA 1ZHWA 3H3AA 5FY7A 4BA9A 1GFOA 5HXCA 4PNIA 3VHLA 4DO0A 3POUA 2LE8A 1WR6A 5FYMA 3N9PA 4TX5A 5CA1E 1ZV4X 4KP3C 5TAOA 3D0TA 1D1BA 2N2NA 4FJOA 2X9XA 2CCQA 3A5XA 4FOZA 3KVAA 5DL6A 2WMOA 2DCFA 1ORMA 5JDNA 3HKEE 3HR0A 2XG6A 4OK0A 1HG5A 4AXPA 2RP4A 4G76A 1NAFA 3ZMSB 3P8CD 3OJAA 4IIJE 3ZC1A 4JLEA 4UVAB 2N2MA 4KUMB 5F3JA 2XE3A 5DABA 3ZCJA 2KC0A 4PK6A 3E22E 4XBFB 3GMIA 3O9XA 3CWZB 1E54A 2DWGA 1HXTA 3S4UA 1BT9A 1HCIA 1US7B 3IBPA 3AVRA 4K0UA 3ZYKA 5JR9C 4RL9A 2X9WA 5GONE 2CLYB 4QX7B 3EDUA 3N5LA 2CM0A 1LKXA 3Q5XA 2W80C 5JDPA 4UF0B 5CB4E 3PORA 4H9NC 4O3XB 2CWOA 4QXBB 4X1KE 1D1CA 2ERVA 3HW9A 5J2UE 4AYNA 3B57A 4QXCB 4DMVA 1PRNA 2KLQA 1OXZA 3BQLA 3KV9A 3ONXA 4ISTA 3U78A 4FZMA 3SYBA 1MIYA 1YKHB 3OYXA 4PK4A 4EXTA 4ANJA 2M06A 3N2OA 2XASB 3EUHA 1GFQA 3MJXA 4N59A 3R84B 3CX8B 4X1YE 4RLBA 2N1GA 1MPFA 4AYEC 4O2BE 2E9XD 1Z0PA 1ZKEA 4UV9B 3VE2A 4MLKA 4DMWA 3E0ZA 5J1GA 2Q9QC 1MMDA 4CXYA 4AUIA 4GCPA 1D0YA 4H9QC 4QKNA 4OYJA 4O4XA 2XUEA 4TUYE 1PHOA 4P0BA 1HX8A 4HGAA 3CQCB 3BQIA 3UTKA 2XTRA 3OYZA 2VB6A 1OSMA 3AAIA 4O8SA 2LSJA 5M4YA 3KDSE 2DWKA 1FEWA 5CA0E 2W63A 2X9YA 3O1JA 1S35A 5ADXL 4ZI3D 2YEVC 1ZHZA 4O4LE 3ZPOA 4O49A 3LK2B 5ADXK 4MALA 2VKJA 5T5FA 1FMVA 2PORA 4WBNE 3QRAA 4PK5A 3Q2MA 4TZ4C 4WW0A 4PFOA 2XAJB 3RBHA 3KVBA 2KXPA 3ANWA 3ETUA 1Q9FA 2PRNA 2L8KA 1YS5A 2L9QA 4GCQA 2ZLDA 1UX5A 1WYBA 4O4IE 4U74A 4O4JE 2LHRA 2XAHB 4ZHQE 4FZLA 5JRCB 2WBLA 4GK5E 4YHJA 4PUXA 2YK0A 3DP7A 2CA5A 2E9XB 4D65A 2GE4A 1U5PA 2LOPA 3VKHA 4F4BA 4XNLA 4C91A 4PJLA 2EHOC 4IGUA 4F6RC 2Y0KA 2MNHA 1GFPA 2D0UA 3UULA 3N9LA 1HXUA 4GCSA 4LSEA 3DA3A 1MNDA 5A1LA 5LGUB 2HPJA 5FMNA 2CLYC 4Z3TA 2FGQX 3QRCA 5HXHA 2CE7A 2CMRA 1HS7A 2VKDA 3FBLA 4ADZA 5FXVA 3AA7A 2K0LA 2Q9QD 3TKLB 3AAAA 3TZGA 3AB3B 3DJBA 5EK3A 5LP6E 2QTKA 3WI4A 3KBTA 2FGRA 4OFZA 3LK41 5LXTE 1LVFA 1LRZA 3T8OA 1MNEA 3RYFE 4ASKA 1HXXA 5L3CB 5PRNA 3I9WA 4UIGA 4TN7B 4CI3B 1D1AA 4P0AA 1MM4A 2LSYA 4BJNA 4LSFA 2X51A 3CQGB 2CWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 A;  3LK2 B;  5ADX K;  3AA6 B;  1IZN B;  3AA7 B;  3AAA B;  3AA0 B;  3AAE B;  4AKR B;  2KXP A;  3LK3 B;  5AFU L;  3LK2 A;  3AA6 A;  2KZ7 A;  3AA1 B;  3AA7 A;  3AAA A;  5AFU K;  3LK4 2;  3LK4 1;  1IZN A;  3AAE A;  4AKR A;  2KXP B;  3LK3 A;  3AA0 A;  2KZ7 B;  5ADX L; 
#chains in the Genus database with same CATH topology
 1N32 T;  4DV7 T;  3SFE A;  3E08 A;  2V1D B;  4HE8 A;  3UUN A;  4J2C A;  4AQF A;  1Y64 B;  5DQV A;  3LG7 A;  3HKB E;  3T24 A;  4GIW A;  1XDO A;  5HWY A;  2JMH A;  2CXL A;  4FI5 A;  5LYJ E;  3CX7 B;  2NTY A;  2Y6X A;  4JI3 T;  1IAP A;  2WY2 A;  3VZT X;  2V7K A;  4H63 V;  3KV4 A;  3JAF A;  5L3E B;  4I50 E;  3BS0 A;  4HKA A;  3ONL C;  2NW8 A;  2M07 A;  3F57 A;  4QQ1 A;  3N2G E;  2XAG B;  4ZI3 C;  4AKI A;  4TWF A;  3V8U A;  5D5D A;  1MMA A;  2JMM A;  2BDE A;  2HPL A;  3T1H T;  2QA7 A;  3PF1 A;  2BG9 A;  2V26 A;  4H9P C;  3PUY F;  3UFE A;  2FBW A;  5HXR A;  2X68 A;  3VZU X;  5JVD E;  2W61 A;  2ODJ A;  4HWI B;  5LHG B;  2Q9Q B;  2I0M A;  1CHU A;  1MIV A;  2UUC T;  4RJX A;  5H2F O;  4JBW F;  2X27 X;  1Y01 A;  4TNW A;  3ZMT B;  4AZL A;  4X20 E;  1NEN A;  2ES0 A;  3ONJ A;  2V7I A;  2NP9 A;  2QYW A;  4B3T T;  3PGU A;  2KWI B;  3IHR A;  1YD8 G;  1X79 A;  2DL1 A;  2KZ7 B;  2D9D A;  4B3R T;  4HWC A;  3UQ7 A;  3AA1 A;  1W0B A;  2KWH A;  2G0U A;  1QJ9 A;  3AAA B;  2C5I T;  4YFS A;  2IW5 B;  4U2Z A;  2Y48 B;  1OWA A;  3NZQ A;  2VQE T;  2BS2 A;  2DHR A;  1IBK T;  3SS1 A;  1FIO A;  3MKD A;  4Q25 A;  1VRB A;  1E1H B;  3PQU A;  4HWH A;  1O3X A;  1KFY A;  3JAE A;  5DL7 A;  4D5U A;  2IWW A;  4YTM A;  3VR8 A;  5B66 O;  4BAY B;  5HEH A;  5JQG E;  1S5L O;  3PUA A;  2BBH A;  3JTY A;  4O4U A;  4PFP A;  3GN5 A;  2E5L T;  3GWH A;  2B1E A;  1CUN A;  5FXX A;  5AQH B;  3P4R A;  4KR8 A;  4LF7 T;  4U3C A;  3RYI E;  4X62 T;  2NWB A;  3PUR A;  5HCJ A;  2PBI A;  4I4T E;  2H7O A;  3PGS A;  5JDL A;  3HOE A;  2KT9 A;  4A98 A;  3C4W A;  4CXX A;  1U4Q A;  2CPT A;  4EV6 A;  5KXJ A;  1B7T A;  2ACX A;  5L3F B;  4QH4 A;  4ZOL E;  5AFU K;  4EZ4 A;  1ZP0 A;  3JCF A;  5LG4 A;  2LJL A;  4L5G A;  3UUX B;  4EGW A;  2LSI A;  4O3W A;  5HYA A;  3EAM A;  1G90 A;  1MM5 A;  2X67 A;  4DR1 T;  5HXE A;  2AXT O;  1Q9G A;  4ILC A;  4ZI2 D;  1E2A A;  2KIN B;  3C4Z A;  2FJD A;  2WB5 A;  2V8S V;  3HA4 A;  4PJJ A;  2VWA A;  4I43 B;  4HEA A;  2H7V C;  4KI0 F;  3W15 B;  2R4L A;  1BXW A;  3AEF A;  4HN9 A;  2FJB A;  2BVM A;  3AEB A;  4UVC B;  2H3R A;  3QB5 K;  3NRX A;  2B76 A;  5AQS B;  3NRY A;  3LBX B;  3ETV A;  3U3I A;  3C98 B;  3WAJ A;  5ABE A;  3OVU A;  3CK6 A;  3LFM A;  2HH7 A;  2J4G A;  3GA8 A;  4CTD A;  2V6Y A;  2X0Y A;  3ZN0 B;  4M1P A;  4Z91 A;  5IUX A;  1JNZ A;  3LK4 2;  2W66 A;  3AE9 A;  4EAH A;  2P9B A;  5KX5 E;  1MMG A;  5JH7 E;  4IL4 A;  4FRT A;  5AQQ B;  3N9Q A;  3ZT7 A;  3M65 A;  2XQ8 A;  4JI0 T;  2EHO D;  4QHO A;  1BR4 A;  1ZHT A;  4N74 A;  2R89 A;  4O4H E;  4ZS2 A;  3KBU A;  4L9I A;  4AI6 A;  2XM1 A;  4BA9 A;  3VHL A;  4DO0 A;  3POU A;  3N9P A;  5TAO A;  1D1B A;  2N2N A;  2CCQ A;  3A5X A;  4FOZ A;  3HKE E;  2XG6 A;  4OK0 A;  3OTO T;  2V5D A;  3P8C D;  2N2M A;  5F3J A;  3SFD A;  4XBF B;  2R88 A;  3VR9 A;  2XQ4 A;  1HCI A;  3RIU C;  2CLY B;  1LKX A;  4UF0 B;  4O3X B;  5E79 O;  4H9N C;  2CWO A;  4QXB B;  2XQ3 A;  3HW9 A;  4QXC B;  2JQY A;  2KLQ A;  3BQL A;  1OED A;  3VRB A;  4AYE C;  4O2B E;  4MLK A;  4JI8 T;  5F5W A;  4IRE A;  4CXY A;  4QKN A;  3EI0 A;  4OX9 T;  4O4X A;  4TUY E;  4P0B A;  3TLV A;  3FZF B;  2XTR A;  4NIQ A;  3AAI A;  1OED E;  3O1J A;  1S35 A;  4ZI3 D;  2YEV C;  1ZHZ A;  4O4L E;  5ADX K;  5T5F A;  2POR A;  2R4N A;  4PK5 A;  4PFO A;  2H88 A;  3KVB A;  2V6X A;  2KXP A;  4IT4 A;  4HFE A;  3AEG A;  2JIW A;  2PRN A;  4U74 A;  4O4J E;  4FZL A;  2MPK A;  4GK5 E;  2IHR 1;  4PUX A;  3PUW F;  2CA5 A;  4D65 A;  2UXB T;  2EHO C;  5BR8 T;  1X9B A;  1GFP A;  1T72 A;  3DA3 A;  2AXD S;  2WDQ A;  2HPJ A;  4LMJ A;  3RIA A;  2FGQ X;  2VL0 A;  3AA7 A;  3PUX F;  3TKL B;  3TLS A;  3AB3 B;  5LP6 E;  4HFH A;  4OFZ A;  3LK4 1;  1LVF A;  3T8O A;  4ASK A;  2J62 A;  5L3C B;  4UIG A;  1D1A A;  1MM4 A;  5G3A A;  4BJN A;  3CQG B;  2JPF A;  4GYS A;  5EK4 A;  4AIS A;  3UU4 A;  4TV8 E;  1HX1 B;  2MTQ A;  2BS4 A;  5JTG A;  3HI2 A;  3JC6 D;  2IDO B;  2L3L A;  2M6I A;  3HWB A;  2LFU A;  2I59 A;  3ANW B;  2IC9 A;  4TWD A;  3J9X 1;  4DVD A;  3RYH E;  3NZP A;  4U7I A;  3AA0 A;  5LA6 E;  4AIU A;  1IBM T;  2LEH A;  4MBQ A;  1H6S 1;  5FVL A;  4PJM A;  5LBQ B;  2ACZ A;  1G8X A;  3PUG A;  1ZHC A;  3MAC A;  4OHF A;  1ZEE A;  1KNZ A;  4DV3 T;  2OMF A;  3SRZ A;  1FJG T;  3A0B O;  3EDV A;  5B5E O;  3IA3 A;  2KXP B;  2FUP A;  2LM9 A;  2SPC A;  4EOZ B;  4HFC A;  1W09 A;  5LBM A;  4Z8X A;  2E9X A;  3I0O A;  3ZEF B;  4IDQ A;  3JCU O;  5KAF O;  5CJ5 A;  4DV6 T;  5LJN A;  5L47 A;  1V9D A;  5DL5 A;  4QH1 A;  2BG9 E;  3KIN B;  4DID B;  2WU2 A;  5LHI B;  2LOS A;  3TLT A;  5LJM A;  1OED B;  2WS3 A;  3SZD A;  4AYM C;  4CI1 B;  3LK2 A;  2N2L A;  2OLT A;  1HFA A;  4LFC T;  2XAQ B;  4DUY T;  3UUM A;  3C64 A;  4YSZ A;  4YSX A;  2WWU A;  1LVK A;  5FXW A;  4C90 A;  4O3Z A;  4AQF C;  3VU7 H;  4IDO A;  5GTH O;  4KMC A;  2YU2 A;  2A3D A;  1THQ A;  1QLB A;  4IDP A;  3FB2 A;  3RKO A;  4F8H A;  3ABV A;  3AE2 A;  4AKR A;  5AQP B;  4X65 T;  2BKP A;  3QK6 A;  2OV9 A;  4ISS A;  5HWX A;  3P4Q A;  3VRA A;  2GK9 A;  2QRX A;  2XQ7 A;  3O0E A;  4TWH A;  5AFU L;  3C51 A;  1YKE B;  1BR2 A;  4FQE A;  5G26 A;  1OED C;  5EE2 A;  5FNV E;  1KK7 A;  2V7M A;  3FZH B;  4XAX B;  4YJ2 E;  3RC8 A;  2XE5 A;  4JV5 T;  3BRY A;  2C0S A;  4HWF A;  4I55 E;  3HKC E;  5HCM A;  4AYD C;  2JJ9 A;  2EHO A;  3LDQ B;  2LRK A;  4NUU A;  4IL6 O;  4N75 A;  4A5X A;  2LHF A;  4CN6 A;  2X66 A;  3LK3 A;  2A2F X;  3CVR A;  4PJN A;  1XMQ T;  3OPC A;  2BKN A;  2ZLY A;  3I9Y A;  4D64 A;  4U7Y A;  5JDQ A;  4KX6 A;  3J7Y q;  4PAG A;  2KMF A;  3DZM A;  3ZJ2 A;  3O1I A;  4DND A;  2YDQ A;  4FES A;  4UEM A;  4LSH A;  1YQ4 A;  2YNK A;  2AE9 A;  4EYU A;  5J0Z A;  2HN1 A;  2XSA A;  4ZZC A;  5G38 A;  1W0A A;  2CXD A;  4KBM B;  4WBO A;  3CKD A;  4H9R C;  1M62 A;  5J2T E;  3T0S A;  3FHN A;  2YKS A;  5LB7 B;  3PU3 A;  4FT6 A;  1VCS A;  5C3J A;  4H9O C;  4AYI D;  4XNK A;  5LCY A;  4CN4 A;  1UX4 A;  3GP6 A;  2BG9 B;  2CRB A;  3CML A;  2WDV A;  4A97 A;  5G39 A;  5JDG A;  3JC6 C;  2ODU A;  3AXJ B;  4GYR A;  4DV2 T;  4HTE A;  1HNW T;  3V5S A;  4G75 A;  3C4X A;  2X9H A;  5EZY E;  5JRC A;  4NPP A;  5FXZ A;  4AKH A;  2R4P A;  5L3B B;  4GF4 A;  2Z6E A;  3O4X E;  5HEU A;  5H6Q B;  5GV0 A;  3RX6 A;  4E7S A;  7PRN A;  4GOU A;  3RHW A;  2IC6 A;  4GK0 E;  5LGN B;  2XE1 A;  2LSK A;  4JI1 T;  3RQU A;  3WI5 A;  3VY9 X;  1YXR A;  3H3M A;  4IDN A;  4IE4 A;  5HXS A;  2YDR A;  1IZN A;  4CI2 B;  2IWV A;  4B6X A;  3KZI O;  4C4V A;  3KV6 A;  3V5U A;  1SA0 E;  1SE7 A;  4G2A A;  1I6Z A;  4JEU B;  1YW0 A;  2J4U P;  3ZN1 B;  4EB6 E;  2X0H A;  4O3Y A;  4P1N A;  4AQY T;  3WAK A;  3H3A A;  5FY7 A;  5HXC A;  5CA1 E;  4KP3 C;  3D0T A;  1I94 T;  3KVA A;  5DL6 A;  2WMO A;  3HR0 A;  4AXP A;  2RP4 A;  1NAF A;  3ZC1 A;  4IIJ E;  4JLE A;  4UVA B;  5DAB A;  3E22 E;  2R8A A;  3CWZ B;  4YTP A;  2WWV A;  3NVO A;  3AVR A;  4K0U A;  5JR9 C;  4RL9 A;  2X9W A;  4QX7 B;  2CM0 A;  2W80 C;  5JDP A;  4X1K E;  3B57 A;  2CHN A;  1PRN A;  5LMN T;  3ONX A;  3SYB A;  1MIY A;  4PK4 A;  2M06 A;  4ZXL A;  3N2O A;  3EUH A;  3MJX A;  3R84 B;  3CX8 B;  5AQV B;  2N1G A;  4NXN T;  2M6B A;  4U2Y A;  3UU5 A;  4JI7 T;  5C2T A;  1N33 T;  4UV9 B;  3VE2 A;  2LM2 A;  5J1G A;  4GCP A;  1D0Y A;  4OYJ A;  4HGA A;  3CQC B;  3NKZ A;  3UTK A;  3OYZ A;  1DU2 A;  2KSR A;  3ZPO A;  4YTN A;  3LK2 B;  2QVA A;  4LF5 T;  3FZK B;  3ANW A;  3ZT5 A;  3ETU A;  4K3C A;  2L8K A;  4KHZ F;  1YS5 A;  5AQK B;  4O4I E;  1KF6 A;  4EEB A;  4ZHQ E;  4YHJ A;  2E9X B;  3NWI A;  2XY8 B;  4C91 A;  4PJL A;  3UUL A;  3N9L A;  1HXU A;  4C00 A;  5FMN A;  3QRC A;  5HXH A;  2CMR A;  2VKD A;  4JI2 T;  5FXV A;  4JYA T;  5AQR B;  2K0L A;  2QTK A;  3WI4 A;  5LXT E;  1MNE A;  3RYF E;  5PRN A;  3I9W A;  4TN7 B;  4CI3 B;  2E5V A;  2LSY A;  3L3P A;  3G06 A;  3X1D A;  3AA6 B;  3N9N A;  5JR9 A;  3CX6 B;  4E7Z A;  4BUM X;  4ZI7 E;  5BMV E;  1KNR A;  4B3S T;  3OBV E;  4L0R A;  3LJC A;  4JI4 T;  2KZ7 A;  3HL6 A;  3UQ4 A;  2PFV A;  4GCS A;  3AVS A;  2RPA A;  4EZH A;  3K3O A;  4EIW A;  3KV5 A;  2Y7S A;  2X9K A;  3IF8 B;  3LSV A;  3UU3 A;  4DR6 T;  5AQT B;  2NW9 A;  2KND A;  4FSO A;  1GFM A;  3H37 A;  3NJT A;  2K48 A;  2W81 C;  3AA1 B;  1GFN A;  4I0U A;  4G63 A;  3RPU A;  4N78 D;  4YHH T;  1BR1 A;  2XPK A;  3FXE B;  3RRW A;  4LF4 T;  4WYV A;  2PJQ A;  4JUY A;  3BQK A;  3AE3 A;  2LLY A;  2YU1 A;  1QSD A;  4DV5 T;  4A56 A;  2BS3 A;  2VAS A;  2YIN A;  4ILU A;  4U9C A;  3Q5W A;  3AE5 A;  1UCU A;  4K0K T;  2F1T A;  2ZM6 T;  2WSS V;  4E1T A;  4B3M T;  5LOV E;  1BR0 A;  4PR7 A;  5TIS O;  4UEL A;  1HG2 A;  2F1V A;  6PRN A;  2VVS A;  1QJP A;  2ODV A;  4X64 T;  4RJW A;  3FYX A;  1WRD A;  4ZZB A;  3WI3 A;  5FY0 A;  4QX8 B;  3R6N A;  5E0O A;  5AQO B;  5JDH A;  2JMK A;  3SYS A;  2XMX A;  2W4X A;  5JRE A;  2J1D G;  3CPZ A;  3SZV A;  3K8P C;  4B61 A;  5HAX A;  2IML A;  4X5T A;  1S94 A;  4ZS3 A;  2A72 A;  4C69 X;  2DI4 A;  2WMN A;  4COF A;  4DR4 T;  1N34 T;  2XQ6 A;  4EYY R;  4DBR A;  4YLH A;  2CEA A;  3A2S X;  3EVY A;  4U33 A;  5JR9 B;  4HFB A;  4YT0 A;  3AA6 A;  3Q5D A;  1M7K A;  3PUQ A;  2ZMA A;  1XDP A;  3QUJ A;  5L4E A;  4V1A v;  2MOZ A;  5DQW A;  2CHO A;  1VCT A;  2UXN B;  2EHO B;  2IAK A;  2W2U A;  3PDY A;  2Y0H A;  4TNV A;  4HFV A;  5CGM A;  5LMU T;  3KVD D;  3N2K E;  4ILA A;  3RLF F;  8PRN A;  1J5W A;  1SHZ C;  3SWH A;  3I0Q A;  4IE5 A;  5HEO A;  2VUR A;  1MIW A;  3C50 A;  1T1L A;  2WQY A;  5CFB A;  3ESL A;  1J5E T;  4CZZ B;  4QH5 A;  1H7C A;  3FBZ A;  3HOL A;  2RA1 A;  2Y8D A;  3CIR A;  2UXC T;  2J47 A;  5L2L A;  2DLR A;  5JDF A;  3MZK B;  4CQI A;  5FP3 A;  2D2S A;  2ZM8 A;  5FL0 A;  2XSB A;  4AKL A;  4IE0 A;  4DBQ A;  2W62 A;  5DJQ C;  3ZJ1 A;  3OKQ A;  4IE7 A;  2BZB A;  4QWN B;  5IWA T;  5AQI B;  2WU5 A;  4H9S E;  4JI6 T;  2W00 A;  4DR5 T;  3AE4 A;  1QUU A;  3P50 A;  2BG9 C;  2XQA A;  4E1S A;  4DV4 T;  3A7M A;  1P4T A;  3PJA A;  4QXH B;  2V7L A;  4X1I E;  3GN5 B;  3SOL A;  2UXD T;  4FUV A;  2JRK A;  2JQH A;  4KR4 A;  2XAF B;  2XJ7 A;  2XZE A;  1GQE A;  1IJ5 A;  3UPG A;  2K5B B;  2MBG A;  3BRZ A;  2ZFG A;  4WNK A;  4DR7 T;  3UU2 A;  1ZHX A;  2VK9 A;  4IE6 A;  1BH3 A;  1OPF A;  1QJ8 A;  1SUM B;  4IDZ A;  3CQX C;  4NUV A;  5L3D B;  5EK2 A;  4FSP A;  3AE7 A;  1KEY A;  2N9D A;  3ZCI A;  5IYU A;  3RIU A;  2LKH A;  2OA5 A;  3AA7 B;  4ILB A;  5IYZ E;  1HF8 A;  2PG8 A;  5F8P A;  3PUS A;  3POQ A;  1VOM A;  4Z90 A;  3PU8 A;  3K3Q C;  3F2E A;  5JDM A;  2XTQ A;  3PGR A;  3RC3 A;  2WJQ A;  2WZH A;  3VKG A;  3ZKR A;  4LF6 T;  3I1A A;  2X0L B;  1MMN A;  5AQG B;  4RLC A;  3DA4 A;  4AQG A;  2Q9Q A;  3KFW X;  1HNZ T;  1ZHW A;  2WCA A;  1GFO A;  4WZX A;  5FYM A;  1ZV4 X;  2UUA T;  2R4O A;  2X9X A;  1ORM A;  4X66 T;  5FL1 A;  4G76 A;  4DUZ T;  1XZY A;  3ZMS B;  4JI5 T;  4YSY A;  1IBL T;  4KUM B;  2XE3 A;  3ZCJ A;  2KC0 A;  1ZOY A;  3O9X A;  1W9R A;  3RQW A;  1HXT A;  3S4U A;  1BT9 A;  3ZYK A;  2NR4 A;  5GON E;  1E7P A;  3Q5X A;  5CB4 E;  1D1C A;  1T8B A;  2ERV A;  4AYN A;  5J2U E;  4DMV A;  4FZM A;  1OXZ A;  3U78 A;  4KHP T;  4IST A;  1YKH B;  3OYX A;  4EXT A;  2XAS B;  3PUV F;  1NEK A;  1MPF A;  2E9X D;  1UK5 A;  1ZKE A;  3E0Z A;  4LML A;  3ZT6 A;  2XUE A;  1PHO A;  1HX8 A;  4DR2 T;  1OSM A;  2LSJ A;  2WZI A;  5L4H A;  2DWK A;  5CA0 E;  2W63 A;  1XWM A;  2VKJ A;  3DWO X;  4WW0 A;  3RBH A;  4DV1 T;  4GKJ T;  2JQK A;  2L9Q A;  1UX5 A;  1WYB A;  2LHR A;  5JRC B;  3DP7 A;  1U5P A;  2LOP A;  3VKH A;  3AE1 A;  4IGU A;  2MNH A;  2D0U A;  2WVP A;  5A1L A;  5GTI O;  2CE7 A;  2UU9 T;  4ADZ A;  3TZG A;  1XNR T;  3DJB A;  3QOF A;  3KBT A;  2FGR A;  2F1C X;  1LRZ A;  2HHH T;  4LSF A;  2CWY A;  2R6G F;  3RKG A;  2Y0L A;  3T20 A;  2ZM0 A;  5KMG P;  2FJA A;  3O1H A;  2A9U A;  3AE8 A;  2I6H A;  2J1N A;  5AQL B;  3MK7 C;  2DNX A;  2XTL A;  5M4Y A;  4UVB B;  2CBJ A;  3EMN X;  2V7J A;  3N9M A;  3VE1 A;  2XQ9 A;  3P7I A;  2VQF T;  4LFA T;  3FZM B;  2YN6 A;  5LGT B;  3K19 A;  5ETW A;  4ZI2 C;  4BJM A;  1WYC A;  3RRC A;  2LKG A;  5AQJ B;  4U31 A;  3HKD E;  2CXF A;  3P4P A;  3UAQ A;  4LF9 T;  4AKG A;  2K3W A;  3POX A;  3EAB A;  4DV0 T;  3P4S A;  5C8Y E;  5LNK A;  5KAI O;  2XQY A;  3ZMZ B;  2LHN A;  1ZHY A;  2WM9 A;  5AQN B;  1T7S A;  3PQS A;  5FKY A;  5ABF B;  3QC9 A;  1AJ3 A;  2M67 A;  4OYK A;  4FRX A;  2XQ5 A;  3QNU A;  3PRN A;  3ZLI A;  4MHC A;  3RIF A;  3F31 A;  4TV9 E;  5FY1 A;  3B5M A;  3MA9 A;  3ZYL A;  1J1J A;  3ZMV B;  2VL8 A;  2BVL A;  1UUR A;  3WU2 O;  1D0Z A;  3MXZ A;  3RF1 A;  3P4W A;  2NW7 A;  5LHH B;  4FZN A;  4XZC A;  2VKO A;  2W67 A;  3K1S A;  2UUB T;  1T98 A;  2W0G A;  3UT5 E;  3NSG A;  2LRL A;  3FXD B;  2MHL A;  4LMK A;  2K9A A;  1IJ6 A;  3VY8 X;  3RYC E;  1UUS A;  3G7G A;  5DL8 A;  2YDS A;  5ABF A;  5IHY A;  1HTJ F;  2JQQ A;  3AE6 A;  3JAD A;  5AQF B;  5ABG A;  1NWM X;  3L09 A;  1HNX T;  3RGL A;  2HN2 A;  2E9X C;  3AEC A;  2JQ9 A;  4EED A;  2V5C A;  2VKH A;  2C5J A;  4AKM A;  4YY3 T;  3PJA J;  3NBX X;  4JCH A;  3PUZ F;  2D0T A;  3PV0 F;  4HFI A;  3LK3 B;  4IHJ E;  3IEE A;  3AED A;  3SY7 A;  4LSI A;  2F4V T;  4AFK A;  2E8I A;  2NOX A;  5LG3 A;  4YJ3 E;  5FVN A;  3ZC0 A;  1XMO T;  3PTR B;  5KDM C;  3VZW X;  3UU8 A;  5AQM B;  4LFB T;  3RH3 A;  1WFD A;  4O2A E;  4FMS A;  2WP9 A;  3ZMU B;  2XHE B;  5L3G B;  3AA0 B;  3AAE B;  2MAW A;  4AKR B;  3AEE A;  2NTX A;  2C5K T;  3M3Z B;  4GHB A;  4CN1 A;  2Y2X A;  3DTO A;  2MYS A;  2KDY A;  3A0H O;  3AAE A;  1EZ3 A;  4U72 A;  2ZM2 A;  2YPV A;  2LSG A;  2K24 A;  4P09 A;  3BK9 A;  4H63 H;  2XE2 A;  1L0V A;  2IIU A;  3ZST A;  5ABH A;  4PW8 A;  3LBX A;  3C5O A;  4PJ0 O;  3TLU A;  1T16 A;  4UV8 B;  5AQU B;  4KRA A;  4UXN B;  2O4V A;  1HR0 T;  3N9O A;  4K3B A;  3TLW A;  2WJR A;  2UXX B;  4UF0 A;  1D0X A;  4UB6 O;  1Z8U A;  3AXJ A;  4N58 A;  3QB5 A;  3B13 A;  4YXD A;  3K3N A;  3SY9 A;  4JFB A;  4MFR A;  2K4T A;  2D5U A;  2V6Y B;  3PE0 A;  4DR3 T;  2FJE A;  2PTF A;  1WR0 A;  2WAU A;  2LT3 A;  3ZYM A;  4GKK T;  4ZEY A;  1JNR A;  1FMW A;  5H6R B;  4ERR A;  3EHZ A;  2QGS A;  4JEH B;  4CXW A;  1G73 A;  1WLX A;  5HEJ A;  3Q9D A;  1IZN B;  3L39 A;  4HWD A;  4PNI A;  2LE8 A;  1WR6 A;  3Q5E A;  4TX5 A;  4FJO A;  4UR9 A;  2DCF A;  5JDN A;  1HG5 A;  3UFG A;  3OJA A;  4PK6 A;  3GMI A;  1E54 A;  2DWG A;  2VVN A;  1US7 B;  3IBP A;  2CBI A;  3EDU A;  3N5L A;  3FZL B;  5FVK A;  3POR A;  4UB8 O;  1WCR A;  3A8Y C;  4IL9 A;  2IUB A;  3AEA A;  3T1Y T;  3KV9 A;  3UU6 A;  4ANJ A;  4HFD A;  1GFQ A;  2WDR A;  4N59 A;  1KNP A;  4X1Y E;  1XNQ T;  4RLB A;  1Z0P A;  4C4V B;  4DMW A;  2Q9Q C;  1MMD A;  4AUI A;  4H9Q C;  2H89 A;  2BKO A;  3BQI A;  2VB6 A;  1R8I A;  4O8S A;  2XM2 A;  3KDS E;  3UUB A;  3DWN A;  1FEW A;  5ADX L;  2X9Y A;  1N36 T;  4O49 A;  4MAL A;  3ZSS A;  1FMV A;  2BBJ A;  4WBN E;  3QRA A;  3Q2M A;  4TZ4 C;  2XAJ B;  2E2A A;  4LF8 T;  3L8R A;  1Q9F A;  1YQ3 A;  4GCQ A;  2ZLD A;  2XAH B;  5HEG A;  2WBL A;  3RI5 A;  2YK0 A;  2GE4 A;  4F4B A;  4XNL A;  4F6R C;  2Y0K A;  2YOE A;  4LSE A;  1MND A;  5LGU B;  2CLY C;  4Z3T A;  1HS7 A;  3FBL A;  2Q9Q D;  3AAA A;  5EK3 A;  1UGO A;  1HXX A;  4NXM T;  4P0A A;  2X51 A; 
#chains in the Genus database with same CATH homology
 2JPF A;  3L3P A;  2Y0L A;  4GYS A;  3AA6 B;  3N9N A;  5EK4 A;  5JR9 A;  3T20 A;  2ZM0 A;  5KMG P;  3CX6 B;  4E7Z A;  3E08 A;  4BUM X;  4ZI7 E;  4TV8 E;  2MTQ A;  3O1H A;  5BMV E;  2V1D B;  4HE8 A;  3UUN A;  3HI2 A;  3OBV E;  4L0R A;  2J1N A;  3LJC A;  4J2C A;  2KZ7 A;  3HL6 A;  3JC6 D;  2PFV A;  2DNX A;  2XTL A;  1Y64 B;  3AVS A;  3MK7 C;  5DQV A;  4UVB B;  2L3L A;  3LG7 A;  4AQF A;  3K3O A;  4EZH A;  4EIW A;  3EMN X;  3HWB A;  3HKB E;  2V7J A;  2LFU A;  2I59 A;  3KV5 A;  3N9M A;  2Y7S A;  3ANW B;  3T24 A;  3VE1 A;  3IF8 B;  2IC9 A;  4GIW A;  3P7I A;  3J9X 1;  3RYH E;  3NZP A;  5HWY A;  4DVD A;  2JMH A;  3AA0 A;  2CXL A;  5LGT B;  4FI5 A;  5ETW A;  5LA6 E;  5LYJ E;  3K19 A;  3CX7 B;  2LEH A;  4MBQ A;  4BJM A;  4ZI2 C;  1H6S 1;  2NTY A;  1WYC A;  2Y6X A;  3RRC A;  1IAP A;  4PJM A;  5LBQ B;  3VZT X;  2V7K A;  4H63 V;  4FSO A;  2NW9 A;  3KV4 A;  1G8X A;  3PUG A;  2KND A;  3HKD E;  1ZHC A;  2CXF A;  3MAC A;  4I50 E;  4OHF A;  5L3E B;  1ZEE A;  1KNZ A;  4HKA A;  2OMF A;  4AKG A;  1GFM A;  3UAQ A;  3H37 A;  3SRZ A;  2K48 A;  2W81 C;  3AA1 B;  3POX A;  2NW8 A;  2M07 A;  3F57 A;  1GFN A;  4QQ1 A;  3EDV A;  3N2G E;  2XAG B;  4ZI3 C;  4AKI A;  4G63 A;  3RPU A;  2KXP B;  3V8U A;  5D5D A;  4N78 D;  1MMA A;  1BR1 A;  2JMM A;  5C8Y E;  2BDE A;  2HPL A;  3FXE B;  2LM9 A;  3RRW A;  5LNK A;  2SPC A;  4EOZ B;  2QA7 A;  2V26 A;  4H9P C;  2XQY A;  3ZMZ B;  5LBM A;  4Z8X A;  2LHN A;  2E9X A;  3I0O A;  3UFE A;  2PJQ A;  4JUY A;  3ZEF B;  1ZHY A;  2WM9 A;  3BQK A;  2YU1 A;  3PQS A;  5HXR A;  2X68 A;  3QC9 A;  1AJ3 A;  1QSD A;  5JVD E;  3VZU X;  2W61 A;  2ODJ A;  5LHG B;  2M67 A;  4A56 A;  5LJN A;  2Q9Q B;  2VAS A;  2YIN A;  4ILU A;  4OYK A;  4FRX A;  4U9C A;  1MIV A;  3Q5W A;  3PRN A;  1V9D A;  5DL5 A;  4RJX A;  3ZLI A;  4MHC A;  3F31 A;  4TV9 E;  5FY1 A;  1UCU A;  3KIN B;  5LHI B;  2LOS A;  2F1T A;  2X27 X;  3ZMT B;  5LJM A;  2WSS V;  4E1T A;  5LOV E;  1BR0 A;  3SZD A;  3MA9 A;  4AYM C;  4AZL A;  4UEL A;  4X20 E;  2ES0 A;  3ZYL A;  3ZMV B;  4CI1 B;  3LK2 A;  1HG2 A;  2VL8 A;  2F1V A;  2N2L A;  6PRN A;  2BVL A;  1HFA A;  2V7I A;  1QJP A;  2XAQ B;  2NP9 A;  3UUM A;  3C64 A;  2KWI B;  2ODV A;  3IHR A;  4RJW A;  3FYX A;  1WRD A;  1D0Z A;  1LVK A;  1YD8 G;  2WWU A;  5FXW A;  4C90 A;  4O3Z A;  3MXZ A;  1X79 A;  2KZ7 B;  3WI3 A;  5FY0 A;  2NW7 A;  4QX8 B;  4AQF C;  3R6N A;  3VU7 H;  3AA1 A;  2KWH A;  5E0O A;  5LHH B;  4FZN A;  2G0U A;  4XZC A;  2VKO A;  3AAA B;  2C5I T;  1QJ9 A;  4YFS A;  5JDH A;  2JMK A;  3SYS A;  4KMC A;  2XMX A;  2IW5 B;  5JRE A;  2Y48 B;  1OWA A;  2YU2 A;  3NZQ A;  2A3D A;  2J1D G;  1THQ A;  1T98 A;  2W0G A;  2DHR A;  3CPZ A;  3FB2 A;  3SS1 A;  3UT5 E;  1FIO A;  3RKO A;  3NSG A;  3MKD A;  3SZV A;  3K8P C;  1VRB A;  4B61 A;  1E1H B;  5HAX A;  3PQU A;  1O3X A;  3FXD B;  2MHL A;  5DL7 A;  1S94 A;  4ZS3 A;  2A72 A;  4AKR A;  2K9A A;  1IJ6 A;  4C69 X;  4D5U A;  2DI4 A;  2WMN A;  3QK6 A;  3VY8 X;  3RYC E;  4BAY B;  4ISS A;  5HWX A;  3G7G A;  4EYY R;  5DL8 A;  5IHY A;  1HTJ F;  5JQG E;  4DBR A;  2GK9 A;  3PUA A;  4YLH A;  3O0E A;  2JQQ A;  2CEA A;  3JTY A;  4O4U A;  4PFP A;  3GN5 A;  3EVY A;  3A2S X;  3GWH A;  5AFU L;  3C51 A;  5JR9 B;  1YKE B;  3AA6 A;  2B1E A;  1CUN A;  5FXX A;  1NWM X;  3L09 A;  3PUQ A;  2ZMA A;  3QUJ A;  1BR2 A;  4KR8 A;  5G26 A;  5EE2 A;  4V1A v;  2MOZ A;  3RYI E;  5FNV E;  2NWB A;  1KK7 A;  2E9X C;  2V7M A;  5DQW A;  3PUR A;  2UXN B;  2PBI A;  4I4T E;  4XAX B;  4YJ2 E;  2EHO B;  2H7O A;  2IAK A;  3PDY A;  2VKH A;  2C5J A;  5JDL A;  3RC8 A;  2KT9 A;  2XE5 A;  2Y0H A;  3HOE A;  4HFV A;  4AKM A;  3C4W A;  4CXX A;  3KVD D;  3N2K E;  2C0S A;  1U4Q A;  3NBX X;  4I55 E;  4JCH A;  3HKC E;  4AYD C;  1B7T A;  2JJ9 A;  1SHZ C;  2ACX A;  2D0T A;  2EHO A;  3I0Q A;  3LK3 B;  3IEE A;  4IHJ E;  4IE5 A;  3SWH A;  5L3F B;  4ZOL E;  3SY7 A;  1MIW A;  4LSI A;  4AFK A;  5AFU K;  2E8I A;  4NUU A;  2NOX A;  3C50 A;  4YJ3 E;  4EZ4 A;  5FVN A;  3ESL A;  3ZC0 A;  4CZZ B;  3PTR B;  5LG4 A;  2LHF A;  2X66 A;  3LK3 A;  8PRN A;  2LJL A;  4L5G A;  3UUX B;  5KDM C;  1H7C A;  2A2F X;  3CVR A;  3VZW X;  3FBZ A;  4PJN A;  2LSI A;  4O3W A;  2ZLY A;  2RA1 A;  3I9Y A;  3RH3 A;  3HOL A;  2Y8D A;  4D64 A;  5JDQ A;  3J7Y q;  4O2A E;  5HYA A;  4FMS A;  4PAG A;  3ZMU B;  2XHE B;  5L3G B;  5L2L A;  1G90 A;  3AA0 B;  1MM5 A;  2DLR A;  2KMF A;  5JDF A;  3AAE B;  4AKR B;  2X67 A;  3MZK B;  4CQI A;  5FP3 A;  2D2S A;  2NTX A;  2ZM8 A;  3ZJ2 A;  3O1I A;  4AKL A;  4DND A;  2C5K T;  4IE0 A;  4DBQ A;  5HXE A;  4GHB A;  4FES A;  4UEM A;  1Q9G A;  4LSH A;  2W62 A;  2YNK A;  2Y2X A;  5DJQ C;  4EYU A;  3DTO A;  4ZI2 D;  2MYS A;  2KDY A;  2KIN B;  3AAE A;  3ZJ1 A;  1EZ3 A;  3C4Z A;  3OKQ A;  2BZB A;  4IE7 A;  4U72 A;  2ZM2 A;  2CXD A;  4QWN B;  2YPV A;  4KBM B;  4H9S E;  3HA4 A;  2LSG A;  3CKD A;  4WBO A;  4PJJ A;  2K24 A;  4H9R C;  4P09 A;  5J2T E;  3BK9 A;  4H63 H;  3FHN A;  3T0S A;  3PU3 A;  2XE2 A;  2VWA A;  4I43 B;  4FT6 A;  2W00 A;  4HEA A;  2H7V C;  4H9O C;  4AYI D;  1QUU A;  4XNK A;  3W15 B;  5LCY A;  1UX4 A;  1BXW A;  3GP6 A;  4HN9 A;  4PW8 A;  3LBX A;  3C5O A;  3CML A;  4E1S A;  2BVM A;  1P4T A;  4UVC B;  2H3R A;  4QXH B;  4UV8 B;  4KRA A;  4UXN B;  2V7L A;  3NRX A;  5JDG A;  3JC6 C;  4X1I E;  3GN5 B;  3SOL A;  2ODU A;  2O4V A;  3N9O A;  4GYR A;  3NRY A;  3LBX B;  4FUV A;  3ETV A;  2JRK A;  3U3I A;  2UXX B;  4UF0 A;  4HTE A;  4KR4 A;  2XAF B;  3C98 B;  1D0X A;  3WAJ A;  3V5S A;  4G75 A;  1IJ5 A;  3C4X A;  2X9H A;  5EZY E;  3UPG A;  2K5B B;  2MBG A;  4N58 A;  3LFM A;  5JRC A;  3B13 A;  2ZFG A;  2HH7 A;  5FXZ A;  3GA8 A;  4WNK A;  4AKH A;  1ZHX A;  3UU2 A;  2VK9 A;  3ZN0 B;  4M1P A;  5L3B B;  4IE6 A;  4GF4 A;  2Z6E A;  3O4X E;  1BH3 A;  3LK4 2;  5H6Q B;  3K3N A;  5GV0 A;  1OPF A;  1QJ8 A;  3SY9 A;  3RX6 A;  4JFB A;  4MFR A;  2K4T A;  2D5U A;  4IDZ A;  4E7S A;  7PRN A;  4GOU A;  3CQX C;  4NUV A;  4EAH A;  3PE0 A;  5L3D B;  2P9B A;  5EK2 A;  5KX5 E;  1MMG A;  4FSP A;  5JH7 E;  2IC6 A;  2N9D A;  4GK0 E;  5LGN B;  3ZCI A;  5IYU A;  2XE1 A;  2OA5 A;  3AA7 B;  2WAU A;  5IYZ E;  4FRT A;  2LSK A;  2LT3 A;  1HF8 A;  2PG8 A;  3ZYM A;  5F8P A;  3PUS A;  3POQ A;  1VOM A;  3WI5 A;  3VY9 X;  3PU8 A;  3K3Q C;  3N9Q A;  3F2E A;  3M65 A;  4IE4 A;  5JDM A;  2XTQ A;  1FMW A;  5HXS A;  3RC3 A;  5H6R B;  1IZN A;  4CI2 B;  4ERR A;  2EHO D;  2QGS A;  4JEH B;  4B6X A;  4CXW A;  4QHO A;  1BR4 A;  3VKG A;  3I1A A;  2X0L B;  3KV6 A;  1ZHT A;  3V5U A;  1SA0 E;  2J4U P;  4G2A A;  4O4H E;  4JEU B;  1YW0 A;  1MMN A;  4ZS2 A;  4RLC A;  1WLX A;  1G73 A;  3ZN1 B;  4EB6 E;  3DA4 A;  4O3Y A;  4AQG A;  2Q9Q A;  3Q9D A;  3KBU A;  1IZN B;  3KFW X;  4L9I A;  4AI6 A;  3WAK A;  1ZHW A;  3H3A A;  5FY7 A;  4BA9 A;  1GFO A;  5HXC A;  4PNI A;  3VHL A;  4DO0 A;  3POU A;  2LE8 A;  1WR6 A;  5FYM A;  3N9P A;  4TX5 A;  5CA1 E;  1ZV4 X;  4KP3 C;  5TAO A;  3D0T A;  1D1B A;  2N2N A;  4FJO A;  2X9X A;  2CCQ A;  3A5X A;  4FOZ A;  3KVA A;  5DL6 A;  2WMO A;  2DCF A;  1ORM A;  5JDN A;  3HKE E;  3HR0 A;  2XG6 A;  4OK0 A;  1HG5 A;  4AXP A;  2RP4 A;  4G76 A;  1NAF A;  3ZMS B;  3P8C D;  3OJA A;  4IIJ E;  3ZC1 A;  4JLE A;  4UVA B;  2N2M A;  4KUM B;  5F3J A;  2XE3 A;  5DAB A;  3ZCJ A;  2KC0 A;  4PK6 A;  3E22 E;  4XBF B;  3GMI A;  3O9X A;  3CWZ B;  1E54 A;  2DWG A;  1HXT A;  3S4U A;  1BT9 A;  1HCI A;  1US7 B;  3IBP A;  3AVR A;  4K0U A;  3ZYK A;  5JR9 C;  4RL9 A;  2X9W A;  5GON E;  2CLY B;  4QX7 B;  3EDU A;  3N5L A;  2CM0 A;  1LKX A;  3Q5X A;  2W80 C;  5JDP A;  4UF0 B;  5CB4 E;  3POR A;  4H9N C;  4O3X B;  2CWO A;  4QXB B;  4X1K E;  1D1C A;  2ERV A;  3HW9 A;  5J2U E;  4AYN A;  3B57 A;  4QXC B;  4DMV A;  1PRN A;  2KLQ A;  1OXZ A;  3BQL A;  3KV9 A;  3ONX A;  4IST A;  3U78 A;  4FZM A;  3SYB A;  1MIY A;  1YKH B;  3OYX A;  4PK4 A;  4EXT A;  4ANJ A;  2M06 A;  3N2O A;  2XAS B;  3EUH A;  1GFQ A;  3MJX A;  4N59 A;  3R84 B;  3CX8 B;  4X1Y E;  4RLB A;  2N1G A;  1MPF A;  4AYE C;  4O2B E;  2E9X D;  1Z0P A;  1ZKE A;  4UV9 B;  3VE2 A;  4MLK A;  4DMW A;  3E0Z A;  5J1G A;  2Q9Q C;  1MMD A;  4CXY A;  4AUI A;  4GCP A;  1D0Y A;  4H9Q C;  4QKN A;  4OYJ A;  4O4X A;  2XUE A;  4TUY E;  1PHO A;  4P0B A;  1HX8 A;  4HGA A;  3CQC B;  3BQI A;  3UTK A;  2XTR A;  3OYZ A;  2VB6 A;  1OSM A;  3AAI A;  4O8S A;  2LSJ A;  5M4Y A;  3KDS E;  2DWK A;  1FEW A;  5CA0 E;  2W63 A;  2X9Y A;  3O1J A;  1S35 A;  5ADX L;  4ZI3 D;  2YEV C;  1ZHZ A;  4O4L E;  3ZPO A;  4O49 A;  3LK2 B;  5ADX K;  4MAL A;  2VKJ A;  5T5F A;  1FMV A;  2POR A;  4WBN E;  3QRA A;  4PK5 A;  3Q2M A;  4TZ4 C;  4WW0 A;  4PFO A;  2XAJ B;  3RBH A;  3KVB A;  2KXP A;  3ANW A;  3ETU A;  1Q9F A;  2PRN A;  2L8K A;  1YS5 A;  2L9Q A;  4GCQ A;  2ZLD A;  1UX5 A;  1WYB A;  4O4I E;  4U74 A;  4O4J E;  2LHR A;  2XAH B;  4ZHQ E;  4FZL A;  5JRC B;  2WBL A;  4GK5 E;  4YHJ A;  4PUX A;  2YK0 A;  3DP7 A;  2CA5 A;  2E9X B;  4D65 A;  2GE4 A;  1U5P A;  2LOP A;  3VKH A;  4F4B A;  4XNL A;  4C91 A;  4PJL A;  2EHO C;  4IGU A;  4F6R C;  2Y0K A;  2MNH A;  1GFP A;  2D0U A;  3UUL A;  3N9L A;  1HXU A;  4GCS A;  4LSE A;  3DA3 A;  1MND A;  5A1L A;  5LGU B;  2HPJ A;  5FMN A;  2CLY C;  4Z3T A;  2FGQ X;  3QRC A;  5HXH A;  2CE7 A;  2CMR A;  1HS7 A;  2VKD A;  3FBL A;  4ADZ A;  5FXV A;  3AA7 A;  2K0L A;  2Q9Q D;  3TKL B;  3AAA A;  3TZG A;  3AB3 B;  3DJB A;  5EK3 A;  5LP6 E;  2QTK A;  3WI4 A;  3KBT A;  2FGR A;  4OFZ A;  3LK4 1;  5LXT E;  1LVF A;  1LRZ A;  3T8O A;  1MNE A;  3RYF E;  4ASK A;  1HXX A;  5L3C B;  5PRN A;  3I9W A;  4UIG A;  4TN7 B;  4CI3 B;  1D1A A;  4P0A A;  1MM4 A;  2LSY A;  4BJN A;  4LSF A;  2X51 A;  3CQG B;  2CWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...