3AAAB

Crystal structure of actin capping protein in complex with v-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 82
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaaB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaaB02
4AKRB 3LK41 5ADXL 3AA6B 3LK42 3LK3B 3AAEB 3AA7B 3LK2B 4AKRA 3AA0A 2KZ7B 1IZNA 3AAAA 3AA1B 5AFUL 3AA7A 2KXPB 3AAAB 3LK3A 3AAEA 3LK2A 3AA6A 3AA0B 2KZ7A 1IZNB 5AFUK 3AA1A 5ADXK 2KXPA
chains in the Genus database with same CATH superfamily
2BVLA 2X9XA 5JR9C 1O3XA 1X9BA 1KK7A 3WAKA 3A0BO 4N58A 2IC6A 3VE2A 3UTKA 4EGWA 3AA6A 4ILAA 2XSAA 2UXBT 3VZUX 2H88A 2BS2A 3HW9A 2H89A 2HPJA 5HEOA 4HFDA 3ZT7A 5GTHO 4AQFC 1XMOT 1M7KA 1Q9GA 4H9RC 4UIGA 4PR7A 3K8PC 5LB7B 4JI1T 3M3ZB 1IZNA 2BKNA 1MNEA 3PF1A 3UU6A 4WBNE 2DWGA 2E5VA 4Z90A 5FXZA 2K9AA 3BK9A 4I43B 2BVMA 4FT6A 4DV2T 4FRTA 2WSSV 3GA8A 5AQQB 1Y01A 2WAUA 2OMFA 3AVRA 2J62A 3PU3A 5D5DA 3J9X1 3UU2A 3FZHB 1YKEB 3B5MA 4RLBA 2WMOA 5LP6E 3JC6C 2CEAA 4WZXA 4XZCA 2Q9QC 3KVAA 4K0UA 3RRWA 4GK5E 3I1AA 4DR1T 4QX7B 3HKCE 5HXSA 4O3YA 2JQYA 3POQA 2O4VA 4DIDB 5FP3A 2KZ7B 5LJNA 3B13A 1N33T 3DJBA 2KT9A 2F1CX 4U7IA 5LNKA 4JEUB 4TWHA 5FMNA 4RL9A 3LK41 3P4PA 4PJMA 3ONJA 2BG9A 2X51A 3RC8A 2LSGA 4ZHQE 3U3IA 2NW7A 2K5BB 3SOLA 4OFZA 3C4WA 5JDMA 3MK7C 2ACZA 3ZT5A 4U9CA 2MPKA 3SFDA 5LOVE 4YTPA 4DV1T 4GCQA 2XQ5A 5F8PA 1LVFA 2X0LB 1XMQT 2WZIA 1XDPA 4GIWA 2LOPA 2DCFA 2A9UA 1MIVA 5HWXA 3AA0A 2VASA 2KMFA 2Q9QD 2X0YA 5HXRA 2R89A 5EK2A 3SY7A 2XAJB 3DZMA 4FSPA 1IZNB 2W00A 5L47A 2OV9A 3FBLA 4HWDA 2YDSA 5LYJE 1GQEA 4IE6A 3AVSA 2QVAA 4OYKA 2XG6A 1HNWT 1U5PA 3C5OA 3MXZA 4YHJA 3AECA 5JDQA 3OBVE 5H6RB 3O0EA 2BZBA 1OPFA 3JC6D 2Y6XA 4U31A 3TLTA 1BXWA 2NP9A 3ZMSB 2KSRA 5LHHB 2K0LA 3I9WA 3PORA 2XY8B 4JI0T 3KVBA 4O3ZA 3N9PA 3QB5K 5JREA 5L3DB 4H63V 4HWFA 1G90A 1X79A 5AFUK 2CE7A 2CLYB 5AQRB 3AE9A 1MMAA 3CWZB 3CX8B 5L3CB 2K3WA 3ZYKA 4A5XA 3ZEFB 3QK6A 2VK9A 3CX7B 4YJ2E 4KX6A 3GWHA 4N78D 4YSXA 1GFQA 4H9NC 3O4XE 4ERRA 5LA6E 3K19A 3T1YT 5L3GB 4IDOA 3RGLA 3UULA 4FRXA 3P50A 4PK6A 1SE7A 2D5UA 3RF1A 2MOZA 4DV3T 1HX8A 1D0ZA 4IHJE 4X20E 2XZEA 3L39A 3IA3A 4X1KE 3P7IA 5AQVB 3OTOT 4AKRB 1IAPA 4I4TE 3F57A 3I0OA 4JI2T 2LRKA 2JQQA 2KDYA 2XUEA 4GK0E 2XE1A 3AEGA 4UV9B 3O1JA 3O1HA 1HNZT 1W9RA 2WM9A 2XQ4A 4O2AE 5HEHA 2J1NA 3ETVA 2E8IA 3T1HT 6PRNA 1UUSA 1KFYA 5LG4A 2LKGA 4DBRA 2LJLA 2W61A 4C69X 5IYUA 2LHRA 3CIRA 5GV0A 5J2TE 2J4GA 4TV8E 2Z6EA 2R88A 3B57A 2Y7SA 4KR8A 2KINB 3WI3A 2X66A 3SWHA 4ASKA 4O3XB 4HFCA 3GN5B 2CBIA 4JI4T 2WY2A 1WRDA 4ILBA 2RP4A 4EZHA 2IMLA 4H9OC 4JI8T 4PW8A 3DA4A 5AQHB 5HEUA 1IJ6A 5FY0A 2V7IA 3AE6A 4D64A 4LF6T 4YTNA 1BR0A 1IBLT 3LK2A 4QH5A 1E7PA 1HFAA 2K24A 4ZI3D 4C91A 1ZHZA 3VE1A 2I59A 3E0ZA 2YINA 4CN6A 2Y48B 2CXDA 3LK3B 3AAEB 2MHLA 2X9KA 3ZJ2A 3W15B 5FYMA 2UXXB 3K3QC 3IEEA 4DR3T 2ZM0A 3PV0F 1N34T 2BKPA 3IBPA 2ERVA 4HKAA 2WBLA 3RQWA 1MIWA 4PK4A 2D0UA 3BQLA 5C8YE 3V5UA 1V9DA 5LMNT 1D1BA 2UUAT 2FBWA 3ZN1B 5PRNA 3C98B 4FJOA 4O4HE 4UEMA 3ZMVB 1QJPA 4PAGA 5JRCA 2BBJA 4DO0A 1HCIA 3CMLA 4P09A 1E54A 4DR7T 3GMIA 4DV5T 2EHOB 2PTFA 3QRCA 4GCSA 2M6BA 3J7Yq 1NWMX 2V6YA 4P0BA 4LFBT 3LFMA 4QHOA 2X9HA 1J5WA 2BDEA 3VU7H 4YTMA 4GKKT 5GONE 3Q2MA 3FYXA 2OLTA 3OYZA 3C50A 2QGSA 1T1LA 3PGSA 2A2FX 4UELA 3UT5E 5IYZE 2YU2A 5ADXL 5CA1E 3VZWX 2XQAA 5ABFA 4WNKA 3PU8A 5F3JA 3ZMUB 3IHRA 4D65A 2Q9QA 2UUBT 4YHHT 2XQ6A 3ZC1A 2X9WA 2JQ9A 2VWAA 1Q9FA 2YNKA 4GCPA 2XJ7A 5AQOB 2CHOA 3RIUC 4K0KT 4I55E 3NRXA 4KUMB 3SZVA 2WVPA 3E08A 4YSYA 3PGRA 1GFMA 3ZN0B 3UU3A 4BJMA 2QYWA 2XHEB 5FXWA 4CTDA 3UAQA 3ZC0A 4EEBA 4YXDA 4LSEA 5FXXA 2MNHA 1YQ4A 3L09A 3NZQA 5HYAA 1HG2A 4OX9T 4UXNB 3AA1B 1Z0PA 3EDUA 1ZHCA 3AAEA 1S5LO 4AIUA 4IL6O 4HEAA 4ZZBA 2P9BA 3N9QA 2IAKA 3L8RA 4H63H 2ZLDA 4X5TA 2WWVA 2BKOA 4OK0A 4DR2T 1HX1B 2E9XC 4FI5A 1XNRT 4QX8B 5JVDE 1G73A 4BAYB 5HXCA 2ACXA 2D0TA 5FVKA 4LMLA 5HEJA 2FJBA 3N2GE 2K48A 2PORA 5LGUB 1THQA 3AA7B 2H7OA 3AAAA 4F4BA 3F2EA 2YKSA 3VR9A 4MHCA 5DL6A 4FOZA 2MTQA 3KDSE 3VKGA 3NWIA 4U2ZA 4EB6E 4O4JE 2N2NA 3VKHA 3RI5A 4G63A 1FEWA 5EE2A 5HXHA 4AYNA 2DNXA 2VKDA 4KBMB 3VZTX 4UF0A 2CMRA 4JLEA 3CVRA 2Y8DA 4ZZCA 4PFPA 2CRBA 4B3ST 4HWIB 2ES0A 3AE4A 3MZKB 1KNRA 4OHFA 4FESA 1T72A 3N2OA 5LBMA 5AQFB 5JDHA 4XBFB 4UV8B 4LSFA 2C0SA 2RPAA 2YDRA 4TNVA 2LHNA 2PBIA 3HKBE 5EK3A 3C4ZA 3OPCA 3PQUA 4AKGA 4PUXA 3MJXA 1LRZA 2XTQA 2GE4A 5CJ5A 2B76A 2W0GA 3QUJA 4P0AA 4NXMT 4K3CA 4QQ1A 3KFWX 4TV9E 1NEKA 1H6S1 1QJ9A 4HFVA 4DV6T 7PRNA 3UFEA 4ISSA 3N9MA 5HAXA 1HXUA 2VB6A 3EABA 4ZXLA 1P4TA 3IF8B 3O9XA 4LF8T 3ZCJA 5GTIO 3GN5A 3HWBA 5FXVA 5IUXA 1D1AA 2UU9T 4EV6A 3AE2A 2IDOB 1OEDE 4CN4A 2FJEA 4I50E 4Z8XA 2BG9B 5KMGP 2WP9A 3RPUA 2LSJA 4DMWA 2E9XB 1ZP0A 1KNZA 4UVAB 1MMDA 2X68A 3NKZA 3V8UA 2E2AA 4IE7A 3PUZF 3PRNA 5A1LA 3RIAA 3PJAA 3ZMTB 3N2KE 4CI1B 5AQNB 1WFDA 2LSIA 3OJAA 5J0ZA 3JADA 4GHBA 1ZEEA 3Q5XA 3AA1A 2X27X 4CI3B 2ZM2A 3OKQA 4QWNB 4AFKA 4WBOA 4G2AA 4Z91A 3FBZA 2PRNA 2VQFT 2J4UP 2WJRA 2LFUA 4TNWA 2YOEA 2JRKA 3CQXC 4ZS3A 4O4UA 1Z8UA 3CKDA 4U2YA 4LF4T 4TWFA 4XAXB 2VKJA 4X64T 4UB8O 4FZMA 2XAFB 5ABEA 1YS5A 4WW0A 2H3RA 3HOLA 5FY1A 5T5FA 4B61A 3BQIA 3PGUA 4CQIA 4X62T 4JFBA 3KV5A 5DL5A 4ADZA 4L5GA 1BH3A 4O4LE 3FXDB 2CCQA 3NBXX 1ZV4X 4AQYT 5ABFB 5M4YA 2N9DA 3FZKB 4E1TA 3TKLB 2HPLA 2XTLA 1MM4A 2DLRA 2XMXA 2J1DG 3CQCB 4O3WA 5C3JA 2VKHA 1WCRA 5FL1A 3RIUA 1YKHB 4HFHA 5KDMC 2XM2A 4ZS2A 3E22E 4JYAT 3UQ4A 2CBJA 2IWVA 5FL0A 3SFEA 4IL4A 2V1DB 2W62A 3HI2A 2IW5B 4GYSA 2NOXA 2LLYA 2WS3A 4K3BA 2V5CA 3PUSA 3VRAA 4IE4A 3PTRB 5F5WA 2V5DA 4KR4A 2LHFA 3ETUA 4IIJE 3SY9A 3ZMZB 5CA0E 2JPFA 4HWHA 4IDPA 4EIWA 3TZGA 4JI3T 1T16A 2IC9A 2JJ9A 1FJGT 4LF9T 5JDPA 4DNDA 3RYIE 3PUWF 1DU2A 4F8HA 3P4SA 1XWMA 3RKGA 3AA0B 2L3LA 3UUBA 3CK6A 3KBTA 1D0XA 2VL8A 3K3NA 4JUYA 1HS7A 5FY7A 2KC0A 3LK2B 4FQEA 4HE8A 4DV4T 2LM2A 3DA3A 4YJ3E 4U3CA 3RHWA 4NUVA 1IBKT 4X66T 4G75A 5IWAT 3PUYF 2Y0KA 2WJQA 4MFRA 2WDQA 5KAIO 2YU1A 5KX5E 3FZMB 4OYJA 3KZIO 5JDGA 3HR0A 4LFAT 3AAAB 2KWHA 3V5SA 1FMWA 4ANJA 4AKIA 4FSOA 1WYBA 4HFEA 3AE5A 4LSIA 4KHPT 2M67A 4PJNA 5FNVE 4I0UA 2IHR1 4JCHA 1R8IA 1L0VA 2I0MA 2M07A 3SYSA 5G38A 2ZFGA 4EXTA 4ISTA 5HWYA 3AEDA 3Q5WA 1WR0A 2EHOA 3UPGA 4DR5T 2WMNA 4KHZF 1OEDB 2MBGA 3T24A 1VCSA 4PFOA 3ONXA 4IL9A 1OEDC 4F6RC 2VQET 4O4XA 4NPPA 4DVDA 4NXNT 5L4EA 3HA4A 4DV0T 5LHIB 3EHZA 1GFOA 5L3FB 4UB6O 1ZKEA 2R8AA 4EAHA 2V7JA 4UR9A 3CQGB 3R6NA 2XASB 3P4RA 1FIOA 2QA7A 5LJMA 4C4VB 3F31A 2X67A 2W67A 1S94A 2JMKA 4TN7B 3KV4A 2W66A 3ZSTA 2C5JA 4MALA 4LFCT 3SYBA 3SS1A 3VHLA 4C00A 1LKXA 2W63A 3P4WA 5AQPB 3WI5A 2N2MA 3TLWA 4FUVA 3WAJA 3VY9X 4CZZB 2CHNA 1QUUA 2D2SA 5JDNA 3L3PA 3HKDE 5CGMA 5HCJA 2XTRA 4O8SA 1LVKA 3KV6A 2WU2A 4PJJA 4PNIA 2CXLA 4DUZT 2X9YA 2XAQB 4UVCB 2N1GA 1BR2A 1OXZA 2LSYA 3AA6B 3K1SA 4DUYT 5J2UE 4AYMC 2N2LA 2LOSA 5HEGA 4JI5T 1W0BA 2E9XA 2FGRA 2CA5A 3P8CD 2CLYC 3HOEA 2C5KT 1MMNA 3OVUA 3WU2O 5JDFA 4LMJA 2NWBA 2I6HA 3NSGA 3RQUA 2F1VA 4AISA 4FMSA 4CXXA 1YXRA 4LSHA 3DWNA 2LM9A 2XSBA 4LF7T 4AZLA 4EEDA 4AYDC 5B5EO 2F4VT 4PK5A 4UF0B 2YK0A 3U78A 2IWWA 1T98A 2V7KA 4ZOLE 5FVNA 4HFBA 4P1NA 2RA1A 2R6GF 1KEYA 4MLKA 4QXHB 1XZYA 4JV5T 4N75A 1H7CA 4J2CA 3Q9DA 1UURA 2LEHA 3VY8X 4IREA 3AE1A 1EZ3A 2Y2XA 1IJ5A 5L2LA 4WYVA 2BS4A 2XAHB 3PJAJ 4KMCA 5LGNB 3LJCA 4TUYE 4RJXA 1WR6A 3AA7A 4AI6A 2AXTO 4L9IA 2ZLYA 2B1EA 2KNDA 1VOMA 1ZHXA 5LXTE 3AB3B 2PG8A 2KLQA 4AKRA 3A0HO 1QLBA 2CM0A 3EI0A 3QRAA 5DJQC 5IHYA 4QXBB 3ANWA 3ZYLA 1GFPA 3NVOA 1W0AA 3AEBA 3I9YA 2R4NA 3Q5EA 3UU5A 5HCMA 4BUMX 3P4QA 2F1TA 5LBQB 3FZFB 4A56A 1I6ZA 2XM1A 4U72A 4JI6T 1BR1A 3FB2A 2C5IT 1JNZA 2DHRA 1QSDA 2YDQA 1US7B 4H9PC 2IUBA 4CXWA 3T0SA 1CUNA 3JCFA 1S35A 3UU8A 5AQGB 4PJ0O 5C2TA 1ZHWA 3PURA 4QKNA 4AQFA 2JQHA 3LBXA 3Q5DA 3QB5A 4YFSA 3TLSA 4Z3TA 1SA0E 4EZ4A 2ZMAA 1OSMA 2XE5A 5DL7A 2NTYA 2LKHA 1HXXA 2UXCT 2PJQA 5CFBA 3M65A 4AQGA 1YW0A 2XE3A 2EHOC 4IDNA 4DMVA 2BBHA 3RIFA 4U7YA 2YN6A 4BJNA 2DWKA 3UUMA 1E2AA 3QNUA 3UUNA 3AXJA 3POUA 4Q25A 1Y64B 4C90A 4L0RA 4JEHB 3ZPOA 5BMVE 5AQJB 1G8XA 3T20A 2ZM8A 2W4XA 2JIWA 1D0YA 2A3DA 4EYUA 5DL8A 2WCAA 2ODJA 4U74A 5JRCB 5G3AA 5EZYE 3RYFE 2JMMA 1BR4A 4N59A 3NZPA 3KVDD 3JAFA 3AEFA 4NIQA 5AQMB 1SHZC 2XQYA 3OYXA 2KZ7A 5TISO 3KINB 4GF4A 3EAMA 3FHNA 5L3BB 1PHOA 3FZLB 2VVNA 3A2SX 4MBQA 4IE0A 2LT3A 2V6YB 5L4HA 3H3AA 4C4VA 1YD8G 3CX6B 1QJ8A 3TLVA 4IDQA 4YSZA 4H9QC 2M06A 3RYHE 2VURA 3JTYA 4DR6T 2LSKA 2XQ8A 4PJLA 2UXNB 3VRBA 3DWOX 2FUPA 1AJ3A 5FVLA 1WLXA 4HFIA 3KV9A 2CWYA 5AQUB 3GP6A 3AE7A 2WZHA 5AQSB 5L3EB 5H6QB 5JR9A 5JQGE 1B7TA 4EYYR 1HG5A 4X65T 2V6XA 2X0HA 4B3TT 5KXJA 3JCUO 4B6XA 4QXCB 3X1DA 3NRYA 2MAWA 3N5LA 2W2UA 2Y0HA 3AXJB 1HF8A 1ZHYA 5TAOA 3LBXB 3VR8A 2CWOA 2WWUA 3G7GA 5DQVA 3N9OA 3A8YC 2Y0LA 3PQSA 5JDLA 4IE5A 5AQTB 4E7SA 5FKYA 3SRZA 1GFNA 5G26A 1YQ3A 1MIYA 3RLFF 3QC9A 5LHGB 3SZDA 3RC3A 1E1HB 3UFGA 2BS3A 3ZSSA 2SPCA 4ZI2D 2GK9A 4KRAA 4KI0F 2R4PA 2JQKA 1D1CA 5B66O 1W09A 2D9DA 2XE2A 4D5UA 4DR4T 5JH7E 4AYID 5DQWA 2IIUA 2AE9A 2VKOA 3RYCE 2YPVA 2LRLA 4LF5T 1OEDA 3H37A 5H2FO 3DTOA 4QH1A 1IBMT 1J1JA 4CN1A 3PUAA 3C64A 2V7LA 5AFUL 4ILUA 3ZCIA 4RLCA 1KNPA 4GYRA 2XQ9A 5BR8T 2G0UA 1HTJF 5E0OA 4AKMA 2UXDT 2UUCT 3ZKRA 4ZI7E 5AQIB 2NR4A 3ZLIA 3RH3A 1U4QA 3PE0A 2R4OA 3N9NA 2W81C 1KF6A 2KWIB 1HR0T 4E1SA 4M1PA 1I94T 4ZI2C 2QTKA 2V7MA 2E5LT 3UQ7A 4AUIA 1BT9A 3C4XA 3LSVA 3ESLA 4U33A 2BG9C 2L8KA 4KP3C 1MM5A 2BG9E 2FGQX 2W80C 3H3MA 4DBQA 4O49A 2ODUA 2OA5A 5EK4A 3BRYA 1J5ET 2KXPB 2DL1A 3WI4A 4AXPA 1UGOA 2L9QA 3PUGA 2ODVA 2EHOD 4DV7T 5AQLB 2V8SV 2FJDA 2XPKA 3G06A 3D0TA 3NJTA 3RX6A 4IGUA 4HWCA 2WDVA 3FXEB 4JBWF 5LCYA 4E7ZA 5J1GA 3MACA 3ZT6A 1SUMB 2NW9A 3EMNX 3AEAA 2V26A 4XNKA 5ADXK 1MNDA 1T7SA 3N9LA 4A97A 2XAGB 2XQ7A 3A7MA 4CI2B 4X1YE 5DABA 2M6IA 3QOFA 3LK3A 3RBHA 1MMGA 3PUQA 4CXYA 1MPFA 3RRCA 4AKLA 1ZOYA 3T8OA 5HXEA 4FZLA 5KAFO 4HGAA 4QH4A 2NTXA 1NAFA 2DI4A 4TX5A 1XDOA 2MYSA 2YEVC 5ABGA 5LGTB 2PFVA 2WB5A 3HKEE 2QRXA 4XNLA 4EOZB 4ZEYA 3RKOA 3KBUA 4AKHA 2VL0A 4YLHA 4LMKA 4JI7T 1N32T 5CB4E 1WYCA 4B3RT 3BRZA 3MKDA 3HL6A 2XQ3A 2VVSA 1T8BA 3PDYA 3ZJ1A 4H9SE 3EVYA 2WDRA 1HNXT 3LDQB 4BA9A 3POXA 4FZNA 2E9XD 1UK5A 2CPTA 4ILCA 4G76A 4RJWA 4AYEC 2A72A 4GKJT 4N74A 2R4LA 1CHUA 3LK42 5JTGA 3CPZA 3DP7A 3BQKA 4A98A 1ORMA 2HHHT 4HN9A 2WQYA 8PRNA 1UX5A 1VCTA 2CXFA 4V1Av 3ZYMA 2NW8A 4IT4A 4IDZA 1XNQT 4NUUA 4YT0A 3UUXB 5AQKB 3S4UA 3AAIA 5ABHA 4B3MT 3AEEA 2ZM6T 3ABVA 4HTEA 4ZI3C 1HXTA 5LG3A 2JMHA 4GOUA 4X1IE 1UX4A 3K3OA 1M62A 2H7VC 2J47A 1FMVA 4COFA 3UU4A 3ANWB 5ETWA 3I0QA 3LG7A 1ZHTA 2HH7A 2Q9QB 3A5XA 1PRNA 1UCUA 2WU5A 3O1IA 3BS0A 3AE8A 2AXDS 2K4TA 1N36T 2FJAA 3ONLC 4TZ4C 2KXPA 1JNRA 2HN1A 3EDVA 3C51A 4TWDA 1VRBA 3EUHA 5G39A 5E79O 3JAEA 2HN2A 4O2BE 4UVBB 3AE3A 3TLUA 2LE8A 5LMUT 3MA9A 5JR9B 3PUVF 1OWAA 4O4IE 3R84B 4YY3T 3PUXF 1NENA
chains in the Genus database with same CATH topology
2BVLA 3J7Yq 2VL8A 3K3NA 3FHNA 2X9XA 1NWMX 5JR9C 5L3BB 4P0BA 4JUYA 1HS7A 5FY7A 1O3XA 1PHOA 1KK7A 3LFMA 2KC0A 4QHOA 2X9HA 3LK2B 3WAKA 4HE8A 2BDEA 3VU7H 3A2SX 3DA3A 4MBQA 4N58A 2IC6A 5GONE 3VE2A 3Q2MA 4IE0A 4YJ3E 2LT3A 3UTKA 4NUVA 3FYXA 3OYZA 3C50A 4G75A 3AA6A 2QGSA 3H3AA 2Y0KA 1YD8G 3VZUX 3CX6B 4MFRA 2A2FX 4UELA 3UT5E 3HW9A 1QJ8A 2HPJA 5IYZE 2YU2A 5ADXL 4AQFC 5CA1E 3VZWX 2YU1A 5KX5E 4H9QC 2M06A 1Q9GA 3RYHE 4H9RC 4UIGA 3PU8A 4WNKA 3K8PC 5F3JA 3ZMUB 3IHRA 4OYJA 3JTYA 4D65A 2LSKA 1IZNA 5JDGA 3HR0A 4PJLA 2Q9QA 3AAAB 2KWHA 1MNEA 3V5SA 1FMWA 2UXNB 3ZC1A 4ANJA 2X9WA 4WBNE 4AKIA 4FSOA 1AJ3A 2DWGA 2VWAA 1WYBA 1WLXA 1Q9FA 4LSIA 2YNKA 5FXZA 2M67A 3KV9A 4PJNA 2K9AA 2CWYA 3BK9A 4GCPA 3GP6A 5FNVE 4I43B 2BVMA 4JCHA 5L3EB 4FT6A 2M07A 3SYSA 5H6QB 5JR9A 2ZFGA 5JQGE 4EXTA 4ISTA 1B7TA 4FRTA 5HWYA 4I55E 4EYYR 1HG5A 2WSSV 3GA8A 3Q5WA 2WAUA 3NRXA 2OMFA 2EHOA 4KUMB 3SZVA 3E08A 1GFMA 3AVRA 3UPGA 2WMNA 3ZN0B 3PU3A 5D5DA 3J9X1 4B6XA 3UU2A 4QXCB 1YKEB 2MBGA 3NRYA 4BJMA 3N5LA 2XHEB 3T24A 5FXWA 4PFOA 4RLBA 3ONXA 3UAQA 2WMOA 5LP6E 2Y0HA 3ZC0A 1HF8A 4F6RC 4LSEA 5FXXA 2MNHA 4O4XA 3JC6C 4DVDA 1ZHYA 3L09A 3LBXB 5TAOA 3HA4A 2CEAA 3NZQA 5HYAA 1HG2A 5LHIB 2CWOA 2WWUA 4UXNB 3AA1B 3G7GA 1Z0PA 3EDUA 1ZHCA 3N9OA 4XZCA 5DQVA 3AAEA 1GFOA 2Y0LA 2Q9QC 3PQSA 3KVAA 5JDLA 4IE5A 4E7SA 3SRZA 5L3FB 1GFNA 5G26A 1ZKEA 4K0UA 3RRWA 4EAHA 2V7JA 4HEAA 3CQGB 4GK5E 1MIYA 3R6NA 2XASB 2P9BA 3N9QA 3QC9A 2IAKA 3I1AA 5LHGB 3SZDA 4H63H 1FIOA 2QA7A 3RC3A 4QX7B 5LJMA 2ZLDA 3HKCE 1E1HB 5HXSA 3F31A 3QRCA 4O3YA 2X67A 4OK0A 3POQA 2SPCA 2E9XC 2O4VA 4FI5A 4QX8B 4ZI2D 5JVDE 5FP3A 1S94A 1G73A 2GK9A 2KZ7B 5HXCA 4BAYB 5LJNA 4KRAA 2JMKA 3B13A 1D1CA 2ACXA 2D0TA 3KV4A 2C5JA 4TN7B 4MALA 3SYBA 3SS1A 3DJBA 2KT9A 3N2GE 3VHLA 2XE2A 2K48A 2PORA 5LNKA 4JEUB 5FMNA 4D5UA 5LGUB 1THQA 3AA7B 5JH7E 4AYID 2H7OA 1LKXA 5DQWA 3AAAA 3LK41 2W63A 3F2EA 4RL9A 4F4BA 4PJMA 4MHCA 5DL6A 2X51A 3WI5A 2VKOA 4FOZA 2N2MA 3RC8A 2MTQA 3KDSE 2LSGA 3RYCE 3U3IA 2NW7A 4ZHQE 3VKGA 2YPVA 4EB6E 4FUVA 4O4JE 2K5BB 3SOLA 4OFZA 3WAJA 3VY9X 3H37A 4CZZB 2N2NA 3C4WA 3VKHA 3DTOA 5JDMA 3MK7C 1QUUA 2D2SA 4G63A 5JDNA 3L3PA 3HKDE 3PUAA 3C64A 1FEWA 2V7LA 5AFUL 4U9CA 4ILUA 3ZCIA 4RLCA 5EE2A 5LOVE 2XTRA 5HXHA 4O8SA 4AYNA 1LVKA 4GCQA 3KV6A 5F8PA 2DNXA 2VKDA 1LVFA 4GYRA 4PJJA 4PNIA 2CXLA 4KBMB 3VZTX 4UF0A 2X9YA 2G0UA 1HTJF 2X0LB 5E0OA 2XAQB 4AKMA 4GIWA 2CMRA 4UVCB 4JLEA 3AA6B 2N1GA 1BR2A 1OXZA 2LOPA 2LSYA 2Y8DA 3CVRA 4ZI7E 2DCFA 3ZLIA 5J2UE 4PFPA 3RH3A 1MIVA 1U4QA 3PE0A 3N9NA 4AYMC 5HWXA 2N2LA 3AA0A 2LOSA 2KMFA 2VASA 2Q9QD 2E9XA 5HXRA 2FGRA 2W81C 2CA5A 2KWIB 5EK2A 3P8CD 3SY7A 2CLYC 2XAJB 3HOEA 2C5KT 1MMNA 2ES0A 4FSPA 4E1SA 3MZKB 4M1PA 5JDFA 4OHFA 4ZI2C 2V7MA 2QTKA 2NWBA 4FESA 4AUIA 1IZNB 3N2OA 3NSGA 2W00A 3C4XA 1BT9A 5LBMA 3ESLA 3FBLA 5JDHA 4XBFB 2F1VA 4FMSA 4UV8B 4LSFA 2C0SA 4CXXA 5LYJE 4LSHA 2LM9A 4AZLA 2L8KA 4AYDC 4KP3C 4PK5A 1MM5A 4UF0B 4IE6A 3AVSA 2LHNA 4OYKA 2FGQX 2W80C 4DBQA 2XG6A 2PBIA 2ODUA 2YK0A 3HKBE 4O49A 1U5PA 5EK3A 2OA5A 3C4ZA 3C5OA 3PQUA 5EK4A 2KXPB 3WI4A 4AXPA 4AKGA 3U78A 4PUXA 3MXZA 2L9QA 3PUGA 3MJXA 4YHJA 5JDQA 3OBVE 1LRZA 1T98A 2V7KA 4ZOLE 5H6RB 5FVNA 3O0EA 2ODVA 2EHOD 2XTQA 2BZBA 2GE4A 1OPFA 3JC6D 2Y6XA 2RA1A 4MLKA 2W0GA 4QXHB 2NP9A 3QUJA 1BXWA 3D0TA 4P0AA 4QQ1A 3KFWX 4TV9E 3RX6A 3ZMSB 1H7CA 5LHHB 4IGUA 2K0LA 3I9WA 4J2CA 3PORA 3FXEB 3Q9DA 1H6S1 1QJ9A 4HFVA 3KVBA 4O3ZA 3N9PA 5LCYA 4E7ZA 2LEHA 3VY8X 5J1GA 5JREA 3UFEA 7PRNA 3MACA 5L3DB 4ISSA 1EZ3A 2Y2XA 4H63V 3N9MA 2NW9A 3EMNX 1G90A 1IJ5A 1X79A 2V26A 5AFUK 4XNKA 5L2LA 5HAXA 5ADXK 1MNDA 1HXUA 2CE7A 2VB6A 3N9LA 1P4TA 3IF8B 3O9XA 2CLYB 2XAGB 2XAHB 4CI2B 1MMAA 4KMCA 3ZCJA 5LGNB 4X1YE 3LJCA 3CWZB 4TUYE 3GN5A 3HWBA 4RJXA 1WR6A 3CX8B 5FXVA 5DABA 1D1AA 5L3CB 3AA7A 4AI6A 3LK3A 3ZYKA 4I50E 4Z8XA 5KMGP 4L9IA 1MMGA 3PUQA 3RBHA 2ZLYA 3RPUA 2LSJA 3ZEFB 3QK6A 4CXYA 3RRCA 4DMWA 2E9XB 1MPFA 2B1EA 2VK9A 3CX7B 4YJ2E 2KNDA 4AKLA 3T8OA 5HXEA 1VOMA 1KNZA 1ZHXA 4FZLA 3GWHA 4HGAA 4N78D 1GFQA 5LXTE 4UVAB 1MMDA 2X68A 4H9NC 3O4XE 3V8UA 3AB3B 2PG8A 2KLQA 2NTXA 1NAFA 4IE7A 4AKRA 3PRNA 4ERRA 2DI4A 5LA6E 3K19A 4TX5A 5L3GB 4FRXA 3UULA 2MYSA 2YEVC 4PK6A 3ZMTB 2CM0A 5A1LA 5LGTB 3N2KE 2PFVA 5DJQC 5IHYA 4QXBB 3QRAA 3ANWA 3HKEE 4CI1B 2D5UA 2MOZA 3ZYLA 2LSIA 3OJAA 1HX8A 4XNLA 1D0ZA 4IHJE 4EOZB 1GFPA 4X20E 3RKOA 3KBUA 4AKHA 4GHBA 1ZEEA 4YLHA 3Q5XA 3AA1A 3I9YA 4CI3B 4X1KE 2X27X 2ZM2A 3OKQA 3P7IA 4QWNB 4AFKA 4WBOA 4AKRB 5CB4E 1IAPA 4I4TE 3F57A 3I0OA 4G2AA 3FBZA 1WYCA 4BUMX 3MKDA 2JQQA 2KDYA 3HL6A 2F1TA 2PRNA 2XUEA 4GK0E 5LBQB 2XE1A 2J4UP 4A56A 4UV9B 2LFUA 3O1JA 3O1HA 4U72A 2WM9A 1BR1A 3PDYA 4O2AE 2J1NA 3FB2A 2C5IT 3ETVA 3ZJ1A 2E8IA 4H9SE 2JRKA 2DHRA 1QSDA 3EVYA 1US7B 3CQXC 4H9PC 4CXWA 4ZS3A 4O4UA 4BA9A 3POXA 4FZNA 2E9XD 1CUNA 3T0SA 1S35A 6PRNA 3CKDA 4XAXB 5LG4A 4G76A 2VKJA 4RJWA 1ZHWA 4DBRA 3PURA 4QKNA 2LJLA 4AQFA 4AYEC 2W61A 3LBXA 4FZMA 2LHRA 4C69X 2A72A 5IYUA 2XAFB 3HOLA 1YS5A 4WW0A 2H3RA 4YFSA 5GV0A 5J2TE 5FY1A 3LK42 4TV8E 5T5FA 4Z3TA 1SA0E 4EZ4A 2Z6EA 4B61A 3B57A 3BQIA 4JFBA 4CQIA 2ZMAA 3CPZA 2Y7SA 3KV5A 3DP7A 4KR8A 2KINB 1OSMA 5DL5A 3BQKA 4ADZA 4L5GA 1BH3A 4O4LE 1ORMA 3FXDB 3WI3A 2X66A 2CCQA 4HN9A 8PRNA 1UX5A 1ZV4X 3NBXX 3SWHA 2CXFA 2XE5A 4ASKA 5M4YA 4O3XB 4V1Av 2N9DA 5DL7A 2NTYA 4E1TA 3TKLB 2HPLA 3GN5B 3ZYMA 1HXXA 2NW8A 2XTLA 1MM4A 2DLRA 1WRDA 4IDZA 2XMXA 2J1DG 3CQCB 2RP4A 4NUUA 4O3WA 2PJQA 3UUXB 2VKHA 3M65A 3AAIA 3S4UA 4AQGA 4EZHA 1YKHB 1YW0A 4H9OC 5KDMC 2XE3A 4HTEA 4PW8A 3DA4A 4ZS2A 4ZI3C 3E22E 2EHOC 1HXTA 1IJ6A 5FY0A 2V7IA 4DMVA 2JMHA 4GOUA 4X1IE 4D64A 1UX4A 1BR0A 4BJNA 3LK2A 2DWKA 2V1DB 3K3OA 2W62A 3UUMA 2H7VC 3POUA 3UUNA 1HFAA 2K24A 3HI2A 2IW5B 4ZI3D 4GYSA 4C91A 1FMVA 2NOXA 1Y64B 3ANWB 4L0RA 5ETWA 4JEHB 4C90A 1ZHZA 2I59A 3E0ZA 3I0QA 3ZPOA 5BMVE 3VE1A 2YINA 3LG7A 1ZHTA 2HH7A 3PUSA 2Q9QB 2Y48B 2CXDA 3LK3B 3AAEB 3PTRB 4IE4A 3A5XA 2MHLA 3ZJ2A 1PRNA 4KR4A 1UCUA 3W15B 5FYMA 2LHFA 1G8XA 2UXXB 3ETUA 3K3QC 2ZM8A 3IEEA 3O1IA 3T20A 2ZM0A 4IIJE 3SY9A 3ZMZB 1D0YA 2A3DA 5CA0E 2K4TA 3IBPA 2JPFA 2ERVA 4EYUA 5DL8A 4HKAA 2WBLA 4EIWA 1MIWA 4PK4A 2D0UA 3BQLA 3TZGA 4TZ4C 5C8YE 2ODJA 4U74A 5JRCB 2IC9A 2JJ9A 2KXPA 3EDVA 3C51A 3V5UA 1V9DA 5JDPA 4DNDA 1VRBA 3EUHA 3RYIE 1D1BA 5EZYE 4O2BE 3RYFE 3ZN1B 5PRNA 4UVBB 2JMMA 3C98B 4FJOA 1BR4A 4N59A 4O4HE 2LE8A 4UEMA 3ZMVB 1QJPA 4PAGA 5JRCA 3NZPA 3KVDD 3MA9A 5JR9B 4DO0A 1HCIA 1OWAA 3CMLA 3AA0B 4P09A 1E54A 2L3LA 3GMIA 1SHZC 4O4IE 3R84B 2XQYA 3OYXA 2KZ7A 2EHOB 3KINB 3KBTA 1D0XA 4GF4A 4GCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR B;  3LK4 1;  5ADX L;  3AA6 B;  3LK4 2;  3LK3 B;  3AAE B;  3AA7 B;  3LK2 B;  4AKR A;  3AA0 A;  2KZ7 B;  1IZN A;  3AAA A;  3AA1 B;  5AFU L;  3AA7 A;  2KXP B;  3AAA B;  3LK3 A;  3AAE A;  3LK2 A;  3AA6 A;  3AA0 B;  2KZ7 A;  1IZN B;  5AFU K;  3AA1 A;  5ADX K;  2KXP A; 
#chains in the Genus database with same CATH topology
 2BVL A;  2X9X A;  5JR9 C;  1O3X A;  1X9B A;  1KK7 A;  3WAK A;  3A0B O;  4N58 A;  2IC6 A;  3VE2 A;  3UTK A;  4EGW A;  3AA6 A;  4ILA A;  2XSA A;  2UXB T;  3VZU X;  2H88 A;  2BS2 A;  3HW9 A;  2H89 A;  2HPJ A;  5HEO A;  4HFD A;  3ZT7 A;  5GTH O;  4AQF C;  1XMO T;  1M7K A;  1Q9G A;  4H9R C;  4UIG A;  4PR7 A;  3K8P C;  5LB7 B;  4JI1 T;  3M3Z B;  1IZN A;  2BKN A;  1MNE A;  3PF1 A;  3UU6 A;  4WBN E;  2DWG A;  2E5V A;  4Z90 A;  5FXZ A;  2K9A A;  3BK9 A;  4I43 B;  2BVM A;  4FT6 A;  4DV2 T;  4FRT A;  2WSS V;  3GA8 A;  5AQQ B;  1Y01 A;  2WAU A;  2OMF A;  3AVR A;  2J62 A;  3PU3 A;  5D5D A;  3J9X 1;  3UU2 A;  3FZH B;  1YKE B;  3B5M A;  4RLB A;  2WMO A;  5LP6 E;  3JC6 C;  2CEA A;  4WZX A;  4XZC A;  2Q9Q C;  3KVA A;  4K0U A;  3RRW A;  4GK5 E;  3I1A A;  4DR1 T;  4QX7 B;  3HKC E;  5HXS A;  4O3Y A;  2JQY A;  3POQ A;  2O4V A;  4DID B;  5FP3 A;  2KZ7 B;  5LJN A;  3B13 A;  1N33 T;  3DJB A;  2KT9 A;  2F1C X;  4U7I A;  5LNK A;  4JEU B;  4TWH A;  5FMN A;  4RL9 A;  3LK4 1;  3P4P A;  4PJM A;  3ONJ A;  2BG9 A;  2X51 A;  3RC8 A;  2LSG A;  4ZHQ E;  3U3I A;  2NW7 A;  2K5B B;  3SOL A;  4OFZ A;  3C4W A;  5JDM A;  3MK7 C;  2ACZ A;  3ZT5 A;  4U9C A;  2MPK A;  3SFD A;  5LOV E;  4YTP A;  4DV1 T;  4GCQ A;  2XQ5 A;  5F8P A;  1LVF A;  2X0L B;  1XMQ T;  2WZI A;  1XDP A;  4GIW A;  2LOP A;  2DCF A;  2A9U A;  1MIV A;  5HWX A;  3AA0 A;  2VAS A;  2KMF A;  2Q9Q D;  2X0Y A;  5HXR A;  2R89 A;  5EK2 A;  3SY7 A;  2XAJ B;  3DZM A;  4FSP A;  1IZN B;  2W00 A;  5L47 A;  2OV9 A;  3FBL A;  4HWD A;  2YDS A;  5LYJ E;  1GQE A;  4IE6 A;  3AVS A;  2QVA A;  4OYK A;  2XG6 A;  1HNW T;  1U5P A;  3C5O A;  3MXZ A;  4YHJ A;  3AEC A;  5JDQ A;  3OBV E;  5H6R B;  3O0E A;  2BZB A;  1OPF A;  3JC6 D;  2Y6X A;  4U31 A;  3TLT A;  1BXW A;  2NP9 A;  3ZMS B;  2KSR A;  5LHH B;  2K0L A;  3I9W A;  3POR A;  2XY8 B;  4JI0 T;  3KVB A;  4O3Z A;  3N9P A;  3QB5 K;  5JRE A;  5L3D B;  4H63 V;  4HWF A;  1G90 A;  1X79 A;  5AFU K;  2CE7 A;  2CLY B;  5AQR B;  3AE9 A;  1MMA A;  3CWZ B;  3CX8 B;  5L3C B;  2K3W A;  3ZYK A;  4A5X A;  3ZEF B;  3QK6 A;  2VK9 A;  3CX7 B;  4YJ2 E;  4KX6 A;  3GWH A;  4N78 D;  4YSX A;  1GFQ A;  4H9N C;  3O4X E;  4ERR A;  5LA6 E;  3K19 A;  3T1Y T;  5L3G B;  4IDO A;  3RGL A;  3UUL A;  4FRX A;  3P50 A;  4PK6 A;  1SE7 A;  2D5U A;  3RF1 A;  2MOZ A;  4DV3 T;  1HX8 A;  1D0Z A;  4IHJ E;  4X20 E;  2XZE A;  3L39 A;  3IA3 A;  4X1K E;  3P7I A;  5AQV B;  3OTO T;  4AKR B;  1IAP A;  4I4T E;  3F57 A;  3I0O A;  4JI2 T;  2LRK A;  2JQQ A;  2KDY A;  2XUE A;  4GK0 E;  2XE1 A;  3AEG A;  4UV9 B;  3O1J A;  3O1H A;  1HNZ T;  1W9R A;  2WM9 A;  2XQ4 A;  4O2A E;  5HEH A;  2J1N A;  3ETV A;  2E8I A;  3T1H T;  6PRN A;  1UUS A;  1KFY A;  5LG4 A;  2LKG A;  4DBR A;  2LJL A;  2W61 A;  4C69 X;  5IYU A;  2LHR A;  3CIR A;  5GV0 A;  5J2T E;  2J4G A;  4TV8 E;  2Z6E A;  2R88 A;  3B57 A;  2Y7S A;  4KR8 A;  2KIN B;  3WI3 A;  2X66 A;  3SWH A;  4ASK A;  4O3X B;  4HFC A;  3GN5 B;  2CBI A;  4JI4 T;  2WY2 A;  1WRD A;  4ILB A;  2RP4 A;  4EZH A;  2IML A;  4H9O C;  4JI8 T;  4PW8 A;  3DA4 A;  5AQH B;  5HEU A;  1IJ6 A;  5FY0 A;  2V7I A;  3AE6 A;  4D64 A;  4LF6 T;  4YTN A;  1BR0 A;  1IBL T;  3LK2 A;  4QH5 A;  1E7P A;  1HFA A;  2K24 A;  4ZI3 D;  4C91 A;  1ZHZ A;  3VE1 A;  2I59 A;  3E0Z A;  2YIN A;  4CN6 A;  2Y48 B;  2CXD A;  3LK3 B;  3AAE B;  2MHL A;  2X9K A;  3ZJ2 A;  3W15 B;  5FYM A;  2UXX B;  3K3Q C;  3IEE A;  4DR3 T;  2ZM0 A;  3PV0 F;  1N34 T;  2BKP A;  3IBP A;  2ERV A;  4HKA A;  2WBL A;  3RQW A;  1MIW A;  4PK4 A;  2D0U A;  3BQL A;  5C8Y E;  3V5U A;  1V9D A;  5LMN T;  1D1B A;  2UUA T;  2FBW A;  3ZN1 B;  5PRN A;  3C98 B;  4FJO A;  4O4H E;  4UEM A;  3ZMV B;  1QJP A;  4PAG A;  5JRC A;  2BBJ A;  4DO0 A;  1HCI A;  3CML A;  4P09 A;  1E54 A;  4DR7 T;  3GMI A;  4DV5 T;  2EHO B;  2PTF A;  3QRC A;  4GCS A;  2M6B A;  3J7Y q;  1NWM X;  2V6Y A;  4P0B A;  4LFB T;  3LFM A;  4QHO A;  2X9H A;  1J5W A;  2BDE A;  3VU7 H;  4YTM A;  4GKK T;  5GON E;  3Q2M A;  3FYX A;  2OLT A;  3OYZ A;  3C50 A;  2QGS A;  1T1L A;  3PGS A;  2A2F X;  4UEL A;  3UT5 E;  5IYZ E;  2YU2 A;  5ADX L;  5CA1 E;  3VZW X;  2XQA A;  5ABF A;  4WNK A;  3PU8 A;  5F3J A;  3ZMU B;  3IHR A;  4D65 A;  2Q9Q A;  2UUB T;  4YHH T;  2XQ6 A;  3ZC1 A;  2X9W A;  2JQ9 A;  2VWA A;  1Q9F A;  2YNK A;  4GCP A;  2XJ7 A;  5AQO B;  2CHO A;  3RIU C;  4K0K T;  4I55 E;  3NRX A;  4KUM B;  3SZV A;  2WVP A;  3E08 A;  4YSY A;  3PGR A;  1GFM A;  3ZN0 B;  3UU3 A;  4BJM A;  2QYW A;  2XHE B;  5FXW A;  4CTD A;  3UAQ A;  3ZC0 A;  4EEB A;  4YXD A;  4LSE A;  5FXX A;  2MNH A;  1YQ4 A;  3L09 A;  3NZQ A;  5HYA A;  1HG2 A;  4OX9 T;  4UXN B;  3AA1 B;  1Z0P A;  3EDU A;  1ZHC A;  3AAE A;  1S5L O;  4AIU A;  4IL6 O;  4HEA A;  4ZZB A;  2P9B A;  3N9Q A;  2IAK A;  3L8R A;  4H63 H;  2ZLD A;  4X5T A;  2WWV A;  2BKO A;  4OK0 A;  4DR2 T;  1HX1 B;  2E9X C;  4FI5 A;  1XNR T;  4QX8 B;  5JVD E;  1G73 A;  4BAY B;  5HXC A;  2ACX A;  2D0T A;  5FVK A;  4LML A;  5HEJ A;  2FJB A;  3N2G E;  2K48 A;  2POR A;  5LGU B;  1THQ A;  3AA7 B;  2H7O A;  3AAA A;  4F4B A;  3F2E A;  2YKS A;  3VR9 A;  4MHC A;  5DL6 A;  4FOZ A;  2MTQ A;  3KDS E;  3VKG A;  3NWI A;  4U2Z A;  4EB6 E;  4O4J E;  2N2N A;  3VKH A;  3RI5 A;  4G63 A;  1FEW A;  5EE2 A;  5HXH A;  4AYN A;  2DNX A;  2VKD A;  4KBM B;  3VZT X;  4UF0 A;  2CMR A;  4JLE A;  3CVR A;  2Y8D A;  4ZZC A;  4PFP A;  2CRB A;  4B3S T;  4HWI B;  2ES0 A;  3AE4 A;  3MZK B;  1KNR A;  4OHF A;  4FES A;  1T72 A;  3N2O A;  5LBM A;  5AQF B;  5JDH A;  4XBF B;  4UV8 B;  4LSF A;  2C0S A;  2RPA A;  2YDR A;  4TNV A;  2LHN A;  2PBI A;  3HKB E;  5EK3 A;  3C4Z A;  3OPC A;  3PQU A;  4AKG A;  4PUX A;  3MJX A;  1LRZ A;  2XTQ A;  2GE4 A;  5CJ5 A;  2B76 A;  2W0G A;  3QUJ A;  4P0A A;  4NXM T;  4K3C A;  4QQ1 A;  3KFW X;  4TV9 E;  1NEK A;  1H6S 1;  1QJ9 A;  4HFV A;  4DV6 T;  7PRN A;  3UFE A;  4ISS A;  3N9M A;  5HAX A;  1HXU A;  2VB6 A;  3EAB A;  4ZXL A;  1P4T A;  3IF8 B;  3O9X A;  4LF8 T;  3ZCJ A;  5GTI O;  3GN5 A;  3HWB A;  5FXV A;  5IUX A;  1D1A A;  2UU9 T;  4EV6 A;  3AE2 A;  2IDO B;  1OED E;  4CN4 A;  2FJE A;  4I50 E;  4Z8X A;  2BG9 B;  5KMG P;  2WP9 A;  3RPU A;  2LSJ A;  4DMW A;  2E9X B;  1ZP0 A;  1KNZ A;  4UVA B;  1MMD A;  2X68 A;  3NKZ A;  3V8U A;  2E2A A;  4IE7 A;  3PUZ F;  3PRN A;  5A1L A;  3RIA A;  3PJA A;  3ZMT B;  3N2K E;  4CI1 B;  5AQN B;  1WFD A;  2LSI A;  3OJA A;  5J0Z A;  3JAD A;  4GHB A;  1ZEE A;  3Q5X A;  3AA1 A;  2X27 X;  4CI3 B;  2ZM2 A;  3OKQ A;  4QWN B;  4AFK A;  4WBO A;  4G2A A;  4Z91 A;  3FBZ A;  2PRN A;  2VQF T;  2J4U P;  2WJR A;  2LFU A;  4TNW A;  2YOE A;  2JRK A;  3CQX C;  4ZS3 A;  4O4U A;  1Z8U A;  3CKD A;  4U2Y A;  4LF4 T;  4TWF A;  4XAX B;  2VKJ A;  4X64 T;  4UB8 O;  4FZM A;  2XAF B;  5ABE A;  1YS5 A;  4WW0 A;  2H3R A;  3HOL A;  5FY1 A;  5T5F A;  4B61 A;  3BQI A;  3PGU A;  4CQI A;  4X62 T;  4JFB A;  3KV5 A;  5DL5 A;  4ADZ A;  4L5G A;  1BH3 A;  4O4L E;  3FXD B;  2CCQ A;  3NBX X;  1ZV4 X;  4AQY T;  5ABF B;  5M4Y A;  2N9D A;  3FZK B;  4E1T A;  3TKL B;  2HPL A;  2XTL A;  1MM4 A;  2DLR A;  2XMX A;  2J1D G;  3CQC B;  4O3W A;  5C3J A;  2VKH A;  1WCR A;  5FL1 A;  3RIU A;  1YKH B;  4HFH A;  5KDM C;  2XM2 A;  4ZS2 A;  3E22 E;  4JYA T;  3UQ4 A;  2CBJ A;  2IWV A;  5FL0 A;  3SFE A;  4IL4 A;  2V1D B;  2W62 A;  3HI2 A;  2IW5 B;  4GYS A;  2NOX A;  2LLY A;  2WS3 A;  4K3B A;  2V5C A;  3PUS A;  3VRA A;  4IE4 A;  3PTR B;  5F5W A;  2V5D A;  4KR4 A;  2LHF A;  3ETU A;  4IIJ E;  3SY9 A;  3ZMZ B;  5CA0 E;  2JPF A;  4HWH A;  4IDP A;  4EIW A;  3TZG A;  4JI3 T;  1T16 A;  2IC9 A;  2JJ9 A;  1FJG T;  4LF9 T;  5JDP A;  4DND A;  3RYI E;  3PUW F;  1DU2 A;  4F8H A;  3P4S A;  1XWM A;  3RKG A;  3AA0 B;  2L3L A;  3UUB A;  3CK6 A;  3KBT A;  1D0X A;  2VL8 A;  3K3N A;  4JUY A;  1HS7 A;  5FY7 A;  2KC0 A;  3LK2 B;  4FQE A;  4HE8 A;  4DV4 T;  2LM2 A;  3DA3 A;  4YJ3 E;  4U3C A;  3RHW A;  4NUV A;  1IBK T;  4X66 T;  4G75 A;  5IWA T;  3PUY F;  2Y0K A;  2WJQ A;  4MFR A;  2WDQ A;  5KAI O;  2YU1 A;  5KX5 E;  3FZM B;  4OYJ A;  3KZI O;  5JDG A;  3HR0 A;  4LFA T;  3AAA B;  2KWH A;  3V5S A;  1FMW A;  4ANJ A;  4AKI A;  4FSO A;  1WYB A;  4HFE A;  3AE5 A;  4LSI A;  4KHP T;  2M67 A;  4PJN A;  5FNV E;  4I0U A;  2IHR 1;  4JCH A;  1R8I A;  1L0V A;  2I0M A;  2M07 A;  3SYS A;  5G38 A;  2ZFG A;  4EXT A;  4IST A;  5HWY A;  3AED A;  3Q5W A;  1WR0 A;  2EHO A;  3UPG A;  4DR5 T;  2WMN A;  4KHZ F;  1OED B;  2MBG A;  3T24 A;  1VCS A;  4PFO A;  3ONX A;  4IL9 A;  1OED C;  4F6R C;  2VQE T;  4O4X A;  4NPP A;  4DVD A;  4NXN T;  5L4E A;  3HA4 A;  4DV0 T;  5LHI B;  3EHZ A;  1GFO A;  5L3F B;  4UB6 O;  1ZKE A;  2R8A A;  4EAH A;  2V7J A;  4UR9 A;  3CQG B;  3R6N A;  2XAS B;  3P4R A;  1FIO A;  2QA7 A;  5LJM A;  4C4V B;  3F31 A;  2X67 A;  2W67 A;  1S94 A;  2JMK A;  4TN7 B;  3KV4 A;  2W66 A;  3ZST A;  2C5J A;  4MAL A;  4LFC T;  3SYB A;  3SS1 A;  3VHL A;  4C00 A;  1LKX A;  2W63 A;  3P4W A;  5AQP B;  3WI5 A;  2N2M A;  3TLW A;  4FUV A;  3WAJ A;  3VY9 X;  4CZZ B;  2CHN A;  1QUU A;  2D2S A;  5JDN A;  3L3P A;  3HKD E;  5CGM A;  5HCJ A;  2XTR A;  4O8S A;  1LVK A;  3KV6 A;  2WU2 A;  4PJJ A;  4PNI A;  2CXL A;  4DUZ T;  2X9Y A;  2XAQ B;  4UVC B;  2N1G A;  1BR2 A;  1OXZ A;  2LSY A;  3AA6 B;  3K1S A;  4DUY T;  5J2U E;  4AYM C;  2N2L A;  2LOS A;  5HEG A;  4JI5 T;  1W0B A;  2E9X A;  2FGR A;  2CA5 A;  3P8C D;  2CLY C;  3HOE A;  2C5K T;  1MMN A;  3OVU A;  3WU2 O;  5JDF A;  4LMJ A;  2NWB A;  2I6H A;  3NSG A;  3RQU A;  2F1V A;  4AIS A;  4FMS A;  4CXX A;  1YXR A;  4LSH A;  3DWN A;  2LM9 A;  2XSB A;  4LF7 T;  4AZL A;  4EED A;  4AYD C;  5B5E O;  2F4V T;  4PK5 A;  4UF0 B;  2YK0 A;  3U78 A;  2IWW A;  1T98 A;  2V7K A;  4ZOL E;  5FVN A;  4HFB A;  4P1N A;  2RA1 A;  2R6G F;  1KEY A;  4MLK A;  4QXH B;  1XZY A;  4JV5 T;  4N75 A;  1H7C A;  4J2C A;  3Q9D A;  1UUR A;  2LEH A;  3VY8 X;  4IRE A;  3AE1 A;  1EZ3 A;  2Y2X A;  1IJ5 A;  5L2L A;  4WYV A;  2BS4 A;  2XAH B;  3PJA J;  4KMC A;  5LGN B;  3LJC A;  4TUY E;  4RJX A;  1WR6 A;  3AA7 A;  4AI6 A;  2AXT O;  4L9I A;  2ZLY A;  2B1E A;  2KND A;  1VOM A;  1ZHX A;  5LXT E;  3AB3 B;  2PG8 A;  2KLQ A;  4AKR A;  3A0H O;  1QLB A;  2CM0 A;  3EI0 A;  3QRA A;  5DJQ C;  5IHY A;  4QXB B;  3ANW A;  3ZYL A;  1GFP A;  3NVO A;  1W0A A;  3AEB A;  3I9Y A;  2R4N A;  3Q5E A;  3UU5 A;  5HCM A;  4BUM X;  3P4Q A;  2F1T A;  5LBQ B;  3FZF B;  4A56 A;  1I6Z A;  2XM1 A;  4U72 A;  4JI6 T;  1BR1 A;  3FB2 A;  2C5I T;  1JNZ A;  2DHR A;  1QSD A;  2YDQ A;  1US7 B;  4H9P C;  2IUB A;  4CXW A;  3T0S A;  1CUN A;  3JCF A;  1S35 A;  3UU8 A;  5AQG B;  4PJ0 O;  5C2T A;  1ZHW A;  3PUR A;  4QKN A;  4AQF A;  2JQH A;  3LBX A;  3Q5D A;  3QB5 A;  4YFS A;  3TLS A;  4Z3T A;  1SA0 E;  4EZ4 A;  2ZMA A;  1OSM A;  2XE5 A;  5DL7 A;  2NTY A;  2LKH A;  1HXX A;  2UXC T;  2PJQ A;  5CFB A;  3M65 A;  4AQG A;  1YW0 A;  2XE3 A;  2EHO C;  4IDN A;  4DMV A;  2BBH A;  3RIF A;  4U7Y A;  2YN6 A;  4BJN A;  2DWK A;  3UUM A;  1E2A A;  3QNU A;  3UUN A;  3AXJ A;  3POU A;  4Q25 A;  1Y64 B;  4C90 A;  4L0R A;  4JEH B;  3ZPO A;  5BMV E;  5AQJ B;  1G8X A;  3T20 A;  2ZM8 A;  2W4X A;  2JIW A;  1D0Y A;  2A3D A;  4EYU A;  5DL8 A;  2WCA A;  2ODJ A;  4U74 A;  5JRC B;  5G3A A;  5EZY E;  3RYF E;  2JMM A;  1BR4 A;  4N59 A;  3NZP A;  3KVD D;  3JAF A;  3AEF A;  4NIQ A;  5AQM B;  1SHZ C;  2XQY A;  3OYX A;  2KZ7 A;  5TIS O;  3KIN B;  4GF4 A;  3EAM A;  3FHN A;  5L3B B;  1PHO A;  3FZL B;  2VVN A;  3A2S X;  4MBQ A;  4IE0 A;  2LT3 A;  2V6Y B;  5L4H A;  3H3A A;  4C4V A;  1YD8 G;  3CX6 B;  1QJ8 A;  3TLV A;  4IDQ A;  4YSZ A;  4H9Q C;  2M06 A;  3RYH E;  2VUR A;  3JTY A;  4DR6 T;  2LSK A;  2XQ8 A;  4PJL A;  2UXN B;  3VRB A;  3DWO X;  2FUP A;  1AJ3 A;  5FVL A;  1WLX A;  4HFI A;  3KV9 A;  2CWY A;  5AQU B;  3GP6 A;  3AE7 A;  2WZH A;  5AQS B;  5L3E B;  5H6Q B;  5JR9 A;  5JQG E;  1B7T A;  4EYY R;  1HG5 A;  4X65 T;  2V6X A;  2X0H A;  4B3T T;  5KXJ A;  3JCU O;  4B6X A;  4QXC B;  3X1D A;  3NRY A;  2MAW A;  3N5L A;  2W2U A;  2Y0H A;  3AXJ B;  1HF8 A;  1ZHY A;  5TAO A;  3LBX B;  3VR8 A;  2CWO A;  2WWU A;  3G7G A;  5DQV A;  3N9O A;  3A8Y C;  2Y0L A;  3PQS A;  5JDL A;  4IE5 A;  5AQT B;  4E7S A;  5FKY A;  3SRZ A;  1GFN A;  5G26 A;  1YQ3 A;  1MIY A;  3RLF F;  3QC9 A;  5LHG B;  3SZD A;  3RC3 A;  1E1H B;  3UFG A;  2BS3 A;  3ZSS A;  2SPC A;  4ZI2 D;  2GK9 A;  4KRA A;  4KI0 F;  2R4P A;  2JQK A;  1D1C A;  5B66 O;  1W09 A;  2D9D A;  2XE2 A;  4D5U A;  4DR4 T;  5JH7 E;  4AYI D;  5DQW A;  2IIU A;  2AE9 A;  2VKO A;  3RYC E;  2YPV A;  2LRL A;  4LF5 T;  1OED A;  3H37 A;  5H2F O;  3DTO A;  4QH1 A;  1IBM T;  1J1J A;  4CN1 A;  3PUA A;  3C64 A;  2V7L A;  5AFU L;  4ILU A;  3ZCI A;  4RLC A;  1KNP A;  4GYR A;  2XQ9 A;  5BR8 T;  2G0U A;  1HTJ F;  5E0O A;  4AKM A;  2UXD T;  2UUC T;  3ZKR A;  4ZI7 E;  5AQI B;  2NR4 A;  3ZLI A;  3RH3 A;  1U4Q A;  3PE0 A;  2R4O A;  3N9N A;  2W81 C;  1KF6 A;  2KWI B;  1HR0 T;  4E1S A;  4M1P A;  1I94 T;  4ZI2 C;  2QTK A;  2V7M A;  2E5L T;  3UQ7 A;  4AUI A;  1BT9 A;  3C4X A;  3LSV A;  3ESL A;  4U33 A;  2BG9 C;  2L8K A;  4KP3 C;  1MM5 A;  2BG9 E;  2FGQ X;  2W80 C;  3H3M A;  4DBQ A;  4O49 A;  2ODU A;  2OA5 A;  5EK4 A;  3BRY A;  1J5E T;  2KXP B;  2DL1 A;  3WI4 A;  4AXP A;  1UGO A;  2L9Q A;  3PUG A;  2ODV A;  2EHO D;  4DV7 T;  5AQL B;  2V8S V;  2FJD A;  2XPK A;  3G06 A;  3D0T A;  3NJT A;  3RX6 A;  4IGU A;  4HWC A;  2WDV A;  3FXE B;  4JBW F;  5LCY A;  4E7Z A;  5J1G A;  3MAC A;  3ZT6 A;  1SUM B;  2NW9 A;  3EMN X;  3AEA A;  2V26 A;  4XNK A;  5ADX K;  1MND A;  1T7S A;  3N9L A;  4A97 A;  2XAG B;  2XQ7 A;  3A7M A;  4CI2 B;  4X1Y E;  5DAB A;  2M6I A;  3QOF A;  3LK3 A;  3RBH A;  1MMG A;  3PUQ A;  4CXY A;  1MPF A;  3RRC A;  4AKL A;  1ZOY A;  3T8O A;  5HXE A;  4FZL A;  5KAF O;  4HGA A;  4QH4 A;  2NTX A;  1NAF A;  2DI4 A;  4TX5 A;  1XDO A;  2MYS A;  2YEV C;  5ABG A;  5LGT B;  2PFV A;  2WB5 A;  3HKE E;  2QRX A;  4XNL A;  4EOZ B;  4ZEY A;  3RKO A;  3KBU A;  4AKH A;  2VL0 A;  4YLH A;  4LMK A;  4JI7 T;  1N32 T;  5CB4 E;  1WYC A;  4B3R T;  3BRZ A;  3MKD A;  3HL6 A;  2XQ3 A;  2VVS A;  1T8B A;  3PDY A;  3ZJ1 A;  4H9S E;  3EVY A;  2WDR A;  1HNX T;  3LDQ B;  4BA9 A;  3POX A;  4FZN A;  2E9X D;  1UK5 A;  2CPT A;  4ILC A;  4G76 A;  4RJW A;  4AYE C;  2A72 A;  4GKJ T;  4N74 A;  2R4L A;  1CHU A;  3LK4 2;  5JTG A;  3CPZ A;  3DP7 A;  3BQK A;  4A98 A;  1ORM A;  2HHH T;  4HN9 A;  2WQY A;  8PRN A;  1UX5 A;  1VCT A;  2CXF A;  4V1A v;  3ZYM A;  2NW8 A;  4IT4 A;  4IDZ A;  1XNQ T;  4NUU A;  4YT0 A;  3UUX B;  5AQK B;  3S4U A;  3AAI A;  5ABH A;  4B3M T;  3AEE A;  2ZM6 T;  3ABV A;  4HTE A;  4ZI3 C;  1HXT A;  5LG3 A;  2JMH A;  4GOU A;  4X1I E;  1UX4 A;  3K3O A;  1M62 A;  2H7V C;  2J47 A;  1FMV A;  4COF A;  3UU4 A;  3ANW B;  5ETW A;  3I0Q A;  3LG7 A;  1ZHT A;  2HH7 A;  2Q9Q B;  3A5X A;  1PRN A;  1UCU A;  2WU5 A;  3O1I A;  3BS0 A;  3AE8 A;  2AXD S;  2K4T A;  1N36 T;  2FJA A;  3ONL C;  4TZ4 C;  2KXP A;  1JNR A;  2HN1 A;  3EDV A;  3C51 A;  4TWD A;  1VRB A;  3EUH A;  5G39 A;  5E79 O;  3JAE A;  2HN2 A;  4O2B E;  4UVB B;  3AE3 A;  3TLU A;  2LE8 A;  5LMU T;  3MA9 A;  5JR9 B;  3PUV F;  1OWA A;  4O4I E;  3R84 B;  4YY3 T;  3PUX F;  1NEN A; 
#chains in the Genus database with same CATH homology
 2BVL A;  3J7Y q;  2VL8 A;  3K3N A;  3FHN A;  2X9X A;  1NWM X;  5JR9 C;  5L3B B;  4P0B A;  4JUY A;  1HS7 A;  5FY7 A;  1O3X A;  1PHO A;  1KK7 A;  3LFM A;  2KC0 A;  4QHO A;  2X9H A;  3LK2 B;  3WAK A;  4HE8 A;  2BDE A;  3VU7 H;  3A2S X;  3DA3 A;  4MBQ A;  4N58 A;  2IC6 A;  5GON E;  3VE2 A;  3Q2M A;  4IE0 A;  4YJ3 E;  2LT3 A;  3UTK A;  4NUV A;  3FYX A;  3OYZ A;  3C50 A;  4G75 A;  3AA6 A;  2QGS A;  3H3A A;  2Y0K A;  1YD8 G;  3VZU X;  3CX6 B;  4MFR A;  2A2F X;  4UEL A;  3UT5 E;  3HW9 A;  1QJ8 A;  2HPJ A;  5IYZ E;  2YU2 A;  5ADX L;  4AQF C;  5CA1 E;  3VZW X;  2YU1 A;  5KX5 E;  4H9Q C;  2M06 A;  1Q9G A;  3RYH E;  4H9R C;  4UIG A;  3PU8 A;  4WNK A;  3K8P C;  5F3J A;  3ZMU B;  3IHR A;  4OYJ A;  3JTY A;  4D65 A;  2LSK A;  1IZN A;  5JDG A;  3HR0 A;  4PJL A;  2Q9Q A;  3AAA B;  2KWH A;  1MNE A;  3V5S A;  1FMW A;  2UXN B;  3ZC1 A;  4ANJ A;  2X9W A;  4WBN E;  4AKI A;  4FSO A;  1AJ3 A;  2DWG A;  2VWA A;  1WYB A;  1WLX A;  1Q9F A;  4LSI A;  2YNK A;  5FXZ A;  2M67 A;  3KV9 A;  4PJN A;  2K9A A;  2CWY A;  3BK9 A;  4GCP A;  3GP6 A;  5FNV E;  4I43 B;  2BVM A;  4JCH A;  5L3E B;  4FT6 A;  2M07 A;  3SYS A;  5H6Q B;  5JR9 A;  2ZFG A;  5JQG E;  4EXT A;  4IST A;  1B7T A;  4FRT A;  5HWY A;  4I55 E;  4EYY R;  1HG5 A;  2WSS V;  3GA8 A;  3Q5W A;  2WAU A;  3NRX A;  2OMF A;  2EHO A;  4KUM B;  3SZV A;  3E08 A;  1GFM A;  3AVR A;  3UPG A;  2WMN A;  3ZN0 B;  3PU3 A;  5D5D A;  3J9X 1;  4B6X A;  3UU2 A;  4QXC B;  1YKE B;  2MBG A;  3NRY A;  4BJM A;  3N5L A;  2XHE B;  3T24 A;  5FXW A;  4PFO A;  4RLB A;  3ONX A;  3UAQ A;  2WMO A;  5LP6 E;  2Y0H A;  3ZC0 A;  1HF8 A;  4F6R C;  4LSE A;  5FXX A;  2MNH A;  4O4X A;  3JC6 C;  4DVD A;  1ZHY A;  3L09 A;  3LBX B;  5TAO A;  3HA4 A;  2CEA A;  3NZQ A;  5HYA A;  1HG2 A;  5LHI B;  2CWO A;  2WWU A;  4UXN B;  3AA1 B;  3G7G A;  1Z0P A;  3EDU A;  1ZHC A;  3N9O A;  4XZC A;  5DQV A;  3AAE A;  1GFO A;  2Y0L A;  2Q9Q C;  3PQS A;  3KVA A;  5JDL A;  4IE5 A;  4E7S A;  3SRZ A;  5L3F B;  1GFN A;  5G26 A;  1ZKE A;  4K0U A;  3RRW A;  4EAH A;  2V7J A;  4HEA A;  3CQG B;  4GK5 E;  1MIY A;  3R6N A;  2XAS B;  2P9B A;  3N9Q A;  3QC9 A;  2IAK A;  3I1A A;  5LHG B;  3SZD A;  4H63 H;  1FIO A;  2QA7 A;  3RC3 A;  4QX7 B;  5LJM A;  2ZLD A;  3HKC E;  1E1H B;  5HXS A;  3F31 A;  3QRC A;  4O3Y A;  2X67 A;  4OK0 A;  3POQ A;  2SPC A;  2E9X C;  2O4V A;  4FI5 A;  4QX8 B;  4ZI2 D;  5JVD E;  5FP3 A;  1S94 A;  1G73 A;  2GK9 A;  2KZ7 B;  5HXC A;  4BAY B;  5LJN A;  4KRA A;  2JMK A;  3B13 A;  1D1C A;  2ACX A;  2D0T A;  3KV4 A;  2C5J A;  4TN7 B;  4MAL A;  3SYB A;  3SS1 A;  3DJB A;  2KT9 A;  3N2G E;  3VHL A;  2XE2 A;  2K48 A;  2POR A;  5LNK A;  4JEU B;  5FMN A;  4D5U A;  5LGU B;  1THQ A;  3AA7 B;  5JH7 E;  4AYI D;  2H7O A;  1LKX A;  5DQW A;  3AAA A;  3LK4 1;  2W63 A;  3F2E A;  4RL9 A;  4F4B A;  4PJM A;  4MHC A;  5DL6 A;  2X51 A;  3WI5 A;  2VKO A;  4FOZ A;  2N2M A;  3RC8 A;  2MTQ A;  3KDS E;  2LSG A;  3RYC E;  3U3I A;  2NW7 A;  4ZHQ E;  3VKG A;  2YPV A;  4EB6 E;  4FUV A;  4O4J E;  2K5B B;  3SOL A;  4OFZ A;  3WAJ A;  3VY9 X;  3H37 A;  4CZZ B;  2N2N A;  3C4W A;  3VKH A;  3DTO A;  5JDM A;  3MK7 C;  1QUU A;  2D2S A;  4G63 A;  5JDN A;  3L3P A;  3HKD E;  3PUA A;  3C64 A;  1FEW A;  2V7L A;  5AFU L;  4U9C A;  4ILU A;  3ZCI A;  4RLC A;  5EE2 A;  5LOV E;  2XTR A;  5HXH A;  4O8S A;  4AYN A;  1LVK A;  4GCQ A;  3KV6 A;  5F8P A;  2DNX A;  2VKD A;  1LVF A;  4GYR A;  4PJJ A;  4PNI A;  2CXL A;  4KBM B;  3VZT X;  4UF0 A;  2X9Y A;  2G0U A;  1HTJ F;  2X0L B;  5E0O A;  2XAQ B;  4AKM A;  4GIW A;  2CMR A;  4UVC B;  4JLE A;  3AA6 B;  2N1G A;  1BR2 A;  1OXZ A;  2LOP A;  2LSY A;  2Y8D A;  3CVR A;  4ZI7 E;  2DCF A;  3ZLI A;  5J2U E;  4PFP A;  3RH3 A;  1MIV A;  1U4Q A;  3PE0 A;  3N9N A;  4AYM C;  5HWX A;  2N2L A;  3AA0 A;  2LOS A;  2KMF A;  2VAS A;  2Q9Q D;  2E9X A;  5HXR A;  2FGR A;  2W81 C;  2CA5 A;  2KWI B;  5EK2 A;  3P8C D;  3SY7 A;  2CLY C;  2XAJ B;  3HOE A;  2C5K T;  1MMN A;  2ES0 A;  4FSP A;  4E1S A;  3MZK B;  4M1P A;  5JDF A;  4OHF A;  4ZI2 C;  2V7M A;  2QTK A;  2NWB A;  4FES A;  4AUI A;  1IZN B;  3N2O A;  3NSG A;  2W00 A;  3C4X A;  1BT9 A;  5LBM A;  3ESL A;  3FBL A;  5JDH A;  4XBF B;  2F1V A;  4FMS A;  4UV8 B;  4LSF A;  2C0S A;  4CXX A;  5LYJ E;  4LSH A;  2LM9 A;  4AZL A;  2L8K A;  4AYD C;  4KP3 C;  4PK5 A;  1MM5 A;  4UF0 B;  4IE6 A;  3AVS A;  2LHN A;  4OYK A;  2FGQ X;  2W80 C;  4DBQ A;  2XG6 A;  2PBI A;  2ODU A;  2YK0 A;  3HKB E;  4O49 A;  1U5P A;  5EK3 A;  2OA5 A;  3C4Z A;  3C5O A;  3PQU A;  5EK4 A;  2KXP B;  3WI4 A;  4AXP A;  4AKG A;  3U78 A;  4PUX A;  3MXZ A;  2L9Q A;  3PUG A;  3MJX A;  4YHJ A;  5JDQ A;  3OBV E;  1LRZ A;  1T98 A;  2V7K A;  4ZOL E;  5H6R B;  5FVN A;  3O0E A;  2ODV A;  2EHO D;  2XTQ A;  2BZB A;  2GE4 A;  1OPF A;  3JC6 D;  2Y6X A;  2RA1 A;  4MLK A;  2W0G A;  4QXH B;  2NP9 A;  3QUJ A;  1BXW A;  3D0T A;  4P0A A;  4QQ1 A;  3KFW X;  4TV9 E;  3RX6 A;  3ZMS B;  1H7C A;  5LHH B;  4IGU A;  2K0L A;  3I9W A;  4J2C A;  3POR A;  3FXE B;  3Q9D A;  1H6S 1;  1QJ9 A;  4HFV A;  3KVB A;  4O3Z A;  3N9P A;  5LCY A;  4E7Z A;  2LEH A;  3VY8 X;  5J1G A;  5JRE A;  3UFE A;  7PRN A;  3MAC A;  5L3D B;  4ISS A;  1EZ3 A;  2Y2X A;  4H63 V;  3N9M A;  2NW9 A;  3EMN X;  1G90 A;  1IJ5 A;  1X79 A;  2V26 A;  5AFU K;  4XNK A;  5L2L A;  5HAX A;  5ADX K;  1MND A;  1HXU A;  2CE7 A;  2VB6 A;  3N9L A;  1P4T A;  3IF8 B;  3O9X A;  2CLY B;  2XAG B;  2XAH B;  4CI2 B;  1MMA A;  4KMC A;  3ZCJ A;  5LGN B;  4X1Y E;  3LJC A;  3CWZ B;  4TUY E;  3GN5 A;  3HWB A;  4RJX A;  1WR6 A;  3CX8 B;  5FXV A;  5DAB A;  1D1A A;  5L3C B;  3AA7 A;  4AI6 A;  3LK3 A;  3ZYK A;  4I50 E;  4Z8X A;  5KMG P;  4L9I A;  1MMG A;  3PUQ A;  3RBH A;  2ZLY A;  3RPU A;  2LSJ A;  3ZEF B;  3QK6 A;  4CXY A;  3RRC A;  4DMW A;  2E9X B;  1MPF A;  2B1E A;  2VK9 A;  3CX7 B;  4YJ2 E;  2KND A;  4AKL A;  3T8O A;  5HXE A;  1VOM A;  1KNZ A;  1ZHX A;  4FZL A;  3GWH A;  4HGA A;  4N78 D;  1GFQ A;  5LXT E;  4UVA B;  1MMD A;  2X68 A;  4H9N C;  3O4X E;  3V8U A;  3AB3 B;  2PG8 A;  2KLQ A;  2NTX A;  1NAF A;  4IE7 A;  4AKR A;  3PRN A;  4ERR A;  2DI4 A;  5LA6 E;  3K19 A;  4TX5 A;  5L3G B;  4FRX A;  3UUL A;  2MYS A;  2YEV C;  4PK6 A;  3ZMT B;  2CM0 A;  5A1L A;  5LGT B;  3N2K E;  2PFV A;  5DJQ C;  5IHY A;  4QXB B;  3QRA A;  3ANW A;  3HKE E;  4CI1 B;  2D5U A;  2MOZ A;  3ZYL A;  2LSI A;  3OJA A;  1HX8 A;  4XNL A;  1D0Z A;  4IHJ E;  4EOZ B;  1GFP A;  4X20 E;  3RKO A;  3KBU A;  4AKH A;  4GHB A;  1ZEE A;  4YLH A;  3Q5X A;  3AA1 A;  3I9Y A;  4CI3 B;  4X1K E;  2X27 X;  2ZM2 A;  3OKQ A;  3P7I A;  4QWN B;  4AFK A;  4WBO A;  4AKR B;  5CB4 E;  1IAP A;  4I4T E;  3F57 A;  3I0O A;  4G2A A;  3FBZ A;  1WYC A;  4BUM X;  3MKD A;  2JQQ A;  2KDY A;  3HL6 A;  2F1T A;  2PRN A;  2XUE A;  4GK0 E;  5LBQ B;  2XE1 A;  2J4U P;  4A56 A;  4UV9 B;  2LFU A;  3O1J A;  3O1H A;  4U72 A;  2WM9 A;  1BR1 A;  3PDY A;  4O2A E;  2J1N A;  3FB2 A;  2C5I T;  3ETV A;  3ZJ1 A;  2E8I A;  4H9S E;  2JRK A;  2DHR A;  1QSD A;  3EVY A;  1US7 B;  3CQX C;  4H9P C;  4CXW A;  4ZS3 A;  4O4U A;  4BA9 A;  3POX A;  4FZN A;  2E9X D;  1CUN A;  3T0S A;  1S35 A;  6PRN A;  3CKD A;  4XAX B;  5LG4 A;  4G76 A;  2VKJ A;  4RJW A;  1ZHW A;  4DBR A;  3PUR A;  4QKN A;  2LJL A;  4AQF A;  4AYE C;  2W61 A;  3LBX A;  4FZM A;  2LHR A;  4C69 X;  2A72 A;  5IYU A;  2XAF B;  3HOL A;  1YS5 A;  4WW0 A;  2H3R A;  4YFS A;  5GV0 A;  5J2T E;  5FY1 A;  3LK4 2;  4TV8 E;  5T5F A;  4Z3T A;  1SA0 E;  4EZ4 A;  2Z6E A;  4B61 A;  3B57 A;  3BQI A;  4JFB A;  4CQI A;  2ZMA A;  3CPZ A;  2Y7S A;  3KV5 A;  3DP7 A;  4KR8 A;  2KIN B;  1OSM A;  5DL5 A;  3BQK A;  4ADZ A;  4L5G A;  1BH3 A;  4O4L E;  1ORM A;  3FXD B;  3WI3 A;  2X66 A;  2CCQ A;  4HN9 A;  8PRN A;  1UX5 A;  1ZV4 X;  3NBX X;  3SWH A;  2CXF A;  2XE5 A;  4ASK A;  5M4Y A;  4O3X B;  4V1A v;  2N9D A;  5DL7 A;  2NTY A;  4E1T A;  3TKL B;  2HPL A;  3GN5 B;  3ZYM A;  1HXX A;  2NW8 A;  2XTL A;  1MM4 A;  2DLR A;  1WRD A;  4IDZ A;  2XMX A;  2J1D G;  3CQC B;  2RP4 A;  4NUU A;  4O3W A;  2PJQ A;  3UUX B;  2VKH A;  3M65 A;  3AAI A;  3S4U A;  4AQG A;  4EZH A;  1YKH B;  1YW0 A;  4H9O C;  5KDM C;  2XE3 A;  4HTE A;  4PW8 A;  3DA4 A;  4ZS2 A;  4ZI3 C;  3E22 E;  2EHO C;  1HXT A;  1IJ6 A;  5FY0 A;  2V7I A;  4DMV A;  2JMH A;  4GOU A;  4X1I E;  4D64 A;  1UX4 A;  1BR0 A;  4BJN A;  3LK2 A;  2DWK A;  2V1D B;  3K3O A;  2W62 A;  3UUM A;  2H7V C;  3POU A;  3UUN A;  1HFA A;  2K24 A;  3HI2 A;  2IW5 B;  4ZI3 D;  4GYS A;  4C91 A;  1FMV A;  2NOX A;  1Y64 B;  3ANW B;  4L0R A;  5ETW A;  4JEH B;  4C90 A;  1ZHZ A;  2I59 A;  3E0Z A;  3I0Q A;  3ZPO A;  5BMV E;  3VE1 A;  2YIN A;  3LG7 A;  1ZHT A;  2HH7 A;  3PUS A;  2Q9Q B;  2Y48 B;  2CXD A;  3LK3 B;  3AAE B;  3PTR B;  4IE4 A;  3A5X A;  2MHL A;  3ZJ2 A;  1PRN A;  4KR4 A;  1UCU A;  3W15 B;  5FYM A;  2LHF A;  1G8X A;  2UXX B;  3ETU A;  3K3Q C;  2ZM8 A;  3IEE A;  3O1I A;  3T20 A;  2ZM0 A;  4IIJ E;  3SY9 A;  3ZMZ B;  1D0Y A;  2A3D A;  5CA0 E;  2K4T A;  3IBP A;  2JPF A;  2ERV A;  4EYU A;  5DL8 A;  4HKA A;  2WBL A;  4EIW A;  1MIW A;  4PK4 A;  2D0U A;  3BQL A;  3TZG A;  4TZ4 C;  5C8Y E;  2ODJ A;  4U74 A;  5JRC B;  2IC9 A;  2JJ9 A;  2KXP A;  3EDV A;  3C51 A;  3V5U A;  1V9D A;  5JDP A;  4DND A;  1VRB A;  3EUH A;  3RYI E;  1D1B A;  5EZY E;  4O2B E;  3RYF E;  3ZN1 B;  5PRN A;  4UVB B;  2JMM A;  3C98 B;  4FJO A;  1BR4 A;  4N59 A;  4O4H E;  2LE8 A;  4UEM A;  3ZMV B;  1QJP A;  4PAG A;  5JRC A;  3NZP A;  3KVD D;  3MA9 A;  5JR9 B;  4DO0 A;  1HCI A;  1OWA A;  3CML A;  3AA0 B;  4P09 A;  1E54 A;  2L3L A;  3GMI A;  1SHZ C;  4O4I E;  3R84 B;  2XQY A;  3OYX A;  2KZ7 A;  2EHO B;  3KIN B;  3KBT A;  1D0X A;  4GF4 A;  4GCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...