3AADB

Structure of the histone chaperone cia/asf1-double bromodomain complex linking histone modifications and site-specific histone eviction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
153
structure length
153
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the histone chaperone CIA/ASF1-double bromodomain complex linking histone modifications and site-specific histone eviction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/chaperone
molecule keywords Transcription initiation factor TFIID subunit 1
total genus 21
structure length 153
sequence length 153
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 3aadB00
1WG3A 5C3IA 2HUEA 2IIJA 2IDCA 4ZBJA 4RRPM 5BO0D 2CU9A 2YGVA 1ROCA 1TEYA 2IO5A 2Z34A 5BNXD 2Z3FA 2DZEA 2I32A 4EO5A 3AADB 5EIIG
chains in the Genus database with same CATH superfamily
5KJ7E 3KGSA 4UQ2A 4L9LB 1HC1A 1PY9A 3DX2A 2J56A 3TV3L 3U30C 3QFJD 1Y07A 3O4LA 4CNIA 3B2VH 1HXYA 2C4FT 1OHQA 4RRPM 2DLGA 5IM7B 3PABA 3PJSB 4AG4H 4F91B 4Y5XC 3GSNB 1YJDC 3FONB 4J2XA 4A2MA 4NI3A 2H6PA 1AR1D 5EZPA 3SYPA 4UV7L 3KAAA 5DMJB 2F54B 5T3XD 2QSCH 3DHPA 4DQAA 5C6TH 2EO1A 4AYBA 1OLLA 1WAAF 3BIAX 5GS0H 3EDDA 4UM8B 2E76C 3DRTA 1WG3A 1ID2A 4JFZL 3GMPA 3W38A 3H3KA 4JY4B 2VZ3A 1ZSHA 5EEWA 3IDJA 2VDMH 1NTDA 3K2MC 3ZKND 2EXWC 2A73A 2OI9C 1QTPA 2X2UA 5ANME 5FC9A 4ONFH 1ZMYA 4NZFA 4NP9A 2HN7B 4QRFA 5CINH 2YEVB 3AG1B 5D7IA 1KELL 3HCVA 3H53A 1WGOA 3E2HB 2VXSL 1B4LA 3I75B 4NQVB 3TV3H 3UO1H 1SEQL 1OM3H 1TKWA 4F5CA 4ZFZB 3GM0A 2PWGA 1TNMA 4ANUA 5IMKB 5H2BB 5AOJA 2E3VA 2G75B 4N9OB 5I8OH 5DQDH 4HJEA 4QTHA 2EEXA 4YHKL 1DQLH 1SN2A 3FO1B 4LPTA 4FADA 3UBXI 4EDXA 2IADB 3HBZA 5IP4A 1BBDL 3M6DA 4PGBA 3CAFA 3X1GA 3C9NA 4OQTL 1ZT4B 1GZPB 4XMKL 1U8NA 5IJVB 2A4CA 4YSRA 1QX1A 2G9KA 3IDUA 4JZJA 3HMXA 4OZGA 4R4ND 2OSLB 2A6DB 2W0FA 4PJIB 5B38G 3O11A 2BIOA 4MNQE 1T83A 3MA9H 3MJ9H 4HAFA 3OMNB 3QHZL 3WKNA 4X7FC 3IGAA 3LDBC 4RMBA 2YHGA 4FA8A 1HDMB 4YHYC 2V7HA 2I60H 2Q3ZA 4BZ2A 2C34A 1BF2A 1NOFA 3GSRB 1AHWB 1ZE3H 5DRZB 3DETD 1XTLA 4Z7NF 4ABWA 3RWGA 5DA0B 5LJYH 3TBTB 2NNCA 5JHLA 1UTDA 2W80C 3OZ9H 3QCUH 3UMNA 1MJUL 3D9AH 1CD9B 2GB2A 3BW9A 5IQMA 4ABQA 4ZMAT 3VFRB 2V8MA 3S8FB 1RXLA 1PPIA 4KJWD 5MP6H 3BUQA 12E8H 1SMAA 3O0LA 5E4OA 2BNUA 1KYOJ 2ZPKH 3B34A 3BZDA 5DTFA 1H9DA 1R3KA 4XRCB 1ZHLB 1JGLH 3RWGB 4UT7L 1AQKH 2CHXA 3MNMA 1IIIA 4IJ3C 1JE6A 4KY1L 2V7HB 3LRLA 3NQIA 1C7TA 3PL6D 1B0IA 4Z23A 3W5NA 1Y1UA 4JFEB 3BQUD 2C4FU 4U1KB 4PYGA 5KYWA 4R7NA 4HPYH 3ZE1E 4E41B 5I1IL 1NFDF 2HFGL 4KKAC 3DTXA 2W9EL 2VAJA 4GY4A 5DCCA 4ZDHB 2X2HA 2BP8B 1NDGB 3P0YL 4WJ5B 3DX6A 4JJ5A 2GSIB 4KDVA 4DN3H 3MBWB 2WAQA 1UC6A 4ILDA 2H1LM 4YHLH 5I6XB 5HVWA 4HGMA 4BH7A 5GSVA 3HMXL 3JV4A 1HKLL 1G7PA 1TJGH 2NY0C 1FE8L 1WFUA 2HRPL 3UTOA 1G7LB 2WYTA 4I87A 3QULB 4PJBA 3WNIA 4S10A 4WFEE 5IV2A 3CFEB 4H8VA 5HI5D 5F1NB 4JJOA 4HUKB 2IAMC 1UM4L 3VXSA 4MD4A 4FLOA 4PRPA 3N1FC 1H6EA 2AQ3A 4JLRB 4O2EB 4FQQB 3F01A 1DJWA 3SOBH 1JL8A 1AP2B 2EABA 3ESUF 4ANVA 3GJFA 1EA9C 3T2LA 3UYPB 2IG2L 2W65A 1G7IB 4MMZB 4JW3A 2CMRL 4PREB 4XAKD 3K6OA 1L9MA 5CZKA 2QQLL 3QNXA 1VENA 5E8OB 4ZXBD 1UJ3A 3IDJB 2NCEA 4PCKA 5GRJL 1UWEH 3NCEB 2Z92B 3PWPD 5J6SA 2ZF8A 2YUWA 2F7OA 2QQLH 1I7TB 4NJAL 3EJRA 2PO6B 2D2CC 3RGVD 4G59C 4UBDC 1A1OA 1TETH 4N25A 4X6DE 4P48A 1V7ML 2R2CA 2YA2A 3BWSA 1EEZA 3PQYB 5TPWH 4KFZC 3VWKB 4QF1A 3D51A 4R8WL 4M3HA 1P4IL 1NFIB 4ODUB 4AC4A 3N2JA 4U1HA 3MN8A 3Q1EA 3LKQB 4BXSV 1U3JA 2XWBB 3FUMA 1EVUA 5EIIB 3GBNL 3W3BA 1ND0B 3J27A 3QEHA 5IHUH 1KCUL 1OWWA 2ZKWA 4JM2D 2DKMA 1JGDA 3VA2C 1X4YA 1YEJL 1G9MC 1U8QB 2HSIA 4N0RA 1F58L 1NH6A 2DD8H 3VXRB 3EYFB 2P80A 1KT2A 3MRPB 3LZOA 4JMNA 3GSNL 1OP4A 4OUUB 1ITCA 4JE4B 2PWHA 3EUUA 4KXZH 3MU3A 2P80D 4X6DB 5FO7A 4F57H 4YJZL 3AG3B 1NCNA 3QUYC 3TBYA 4ZD3H 3ZO9A 5IB4B 1T03L 6TAAA 4JB9L 3PDOA 1B3IA 4Y2OA 1JYWA 2B8OT 5AB1A 4AUJA 3TT3L 4UDUA 4JRLA 1NKGA 1RSFA 3NFPB 4Y7MA 1PKOA 1N10A 1MVYA 1X5YA 4UOZA 2EDHA 4KNQA 1IVLA 2EE9A 1KPVB 2ORBH 1QRNB 4H1LH 4WGVB 3KLHC 2HLAA 5CEZD 3CSYA 5KBPA 3WTTA 5GHWL 1VZGA 1YQVH 4JO3H 4V33A 4YEEA 4ODWB 1MFAH 3SDDA 4H8PA 4CW1B 3MBEB 3T08A 3MOBL 3NZ8B 4KKCC 4O2FB 1BPLB 4OD3H 4WCYL 4MFHA 3CH1A 2WXGA 3ML8A 2XVLA 3MRKA 3QXDB 3B8YA 2E56A 1VFAB 1S7WA 1PSKH 2WBWB 5E9DD 2H0FA 5I1CH 2FZ3B 3BOVA 3H3BC 1RJLA 2R4SL 2JK5B 2NR6C 4PS4L 1JTTA 2AGJL 3NFSL 1HKLH 5B1BB 2VR7A 1GIGL 3WOVA 4APQC 3AADB 3ZZLA 2I9LA 5KSBA 1X5KA 3GKZA 1BYPA 4P2RD 5ALBH 3GMRA 3Q6GH 5FGSA 2WPGA 5DUBB 1IGIL 4FG6D 5F3HB 3VXSD 2E4TA 2VTFA 3KBEA 3GTNA 3IT8D 3L9RB 3ABMB 1CLZL 1UT9A 3E9TA 3FSOA 4NKOB 5F2FA 1AG6A 2HFFA 1JHLH 1KXHA 4D8PB 1XV8A 4ZJ9A 3FCTB 4N2BA 1G6RB 4HLZG 3SODB 4NGHL 5DYOA 4DN4L 1DQLL 4G11A 3P4NA 2WY3B 3AFLA 3IJ9A 3RVTC 3D0AA 1CDJA 3EJQA 1AQKL 2VKWA 4IRJA 3R06A 5BV7H 4EI0A 4FFVC 5BO1H 3Q8FA 1IBZA 5DLLA 1JN6B 3GXFA 3CC5A 4HAKA 3MLTA 5EULV 5SX4H 1RK0A 2ZSVB 1F4AA 1HZHH 5HSFA 3AT9A 3QEQB 3ZTNL 2YAEA 5AG9A 1WWAX 2BWQA 3UO1L 1EAPA 5L6YH 4N8CH 3WEXB 1NINA 3AT8A 1X3DA 2V6HA 1TSHA 4P2YA 1MOEA 2IPKA 5EU3A 1S9YB 2ID5A 2P48B 3R4DA 4XNQB 3RWHB 1RFDH 4N8UA 4LCVA 5DR5H 3ABLB 3HR5B 2YOAA 4BWUA 3ARBD 5FF6B 1MNUH 1AFVL 2UZYB 2APVA 1OPGL 3B7RL 4IRJD 3SCMC 2ATAA 1JDDA 1LQBC 1T21A 3HE6B 1L6ZA 1M9SA 3QQXA 5ICUA 4B9JA 4EUPG 5L2KE 4JRXA 4DSYA 4XHQA 1WZAA 3QUZC 4AEHL 1QD0A 4NZJA 4ESKA 2HJKA 4PR5B 4OZFA 5DMKA 1YG9A 4YSUA 1WICA 5F6HJ 5IW1A 2B20A 1GH7A 3TH2T 4BZ1A 3RL2A 3MSPA 5I1HL 1BQUA 2WBXA 3QQ4B 1Q9KA 2EH7H 1CD1A 2BW4A 3FL7A 1MFMA 1MUJA 1XF4B 3ESPA 5FYKL 2FWOB 2DI8A 4N0YH 5DMIL 3OXSA 5I19H 1H8LA 4AYEC 3BWZA 2BS8A 3RIKA 2EKJA 4KXDA 1L9OA 4M7LT 5C92A 3HKFA 5C0BD 1Y6KR 1IGCL 1MCOL 1PLGH 3V4PH 1T21B 5D7SL 3W11C 2FCBA 2VE6A 4HKZA 1DJXA 2NW2B 4XP6H 1SEQH 5I0VA 1WFOA 5IVOA 3GJFK 1FYTE 3IJSB 3GSOA 1CQYA 3AU1B 1WIOA 2ITFA 2VMCA 4MLSA 4NRZA 4PRNA 1N8ZB 2WKOF 1M1SA 2BC4A 2HG5A 3R0NA 4UU9B 2ITCA 1U8CB 3HE7A 1XTMA 1DBKH 1EPFA 2I7OA 3EJJX 5IQLA 4BQ9A 3PQYD 5SX5K 5JQIB 3GKWL 3BP6B 4XNBA 1PQZA 1PU0A 3QPXL 5FXCH 5JOPE 3MNZB 1VA9A 3QORD 1GAFL 1ZXQA 2E9GA 4LNVA 3GMMB 2KLRA 5EIQA 3T1FA 4BZ1L 3U46B 3CDFA 1QEWA 1F4YH 1SYVA 1YDPA 3P1VA 4XXDA 2NQCA 2XKNB 4ZAKA 4NQEA 3ULUD 4HOMA 1RPKA 1SNRA 4L4VE 1MWAA 1L3NA 32C2A 1GGIL 2GJ6D 2BJMH 4G8FB 2HFEA 4TNEA 4A66A 3GHEH 4NQXA 1MREL 4R6UA 5HHME 4X6FB 2FJFB 2HMIC 1CDYA 1S8DA 3BRFA 1YECL 2MCPH 2QKIA 1ECZA 1PEWA 3OLIA 2IXQB 3CCHA 1Z9MA 5DT1H 2Y4SA 3CXDH 2V0AA 1KEGL 4XN5A 1F1GA 1QRND 4YN3A 4Z7IA 5IJCC 2VABA 3QA3B 2Z91A 2FIKB 4Z7VF 4CKVX 3MMEB 2FQEA 2D03L 1WA1X 5DD1H 3OKOA 4PLNC 5KSBB 4UOQA 5I17B 1DLHB 1P4BH 1MLBB 4AMKH 2GTZB 1INQB 2BSDA 4I9WE 3LB6D 4JO2L 1F97A 1MFAL 4U1IA 1UA6L 2EKSB 2XFXB 3DSFL 3RTQC 5IW1B 1BF5A 2HJLB 4KJWC 4OZFB 4NNPH 1NLDH 2OR9H 4NUJA 3REWB 1QO3A 2GY7B 3F7VB 3FU3A 4DK5A 3F5WB 3KJ4B 1IAOB 3TVMC 2CLZB 1LNUB 2LQRA 1I3UA 3SDDB 4LSQH 5D7KE 4MA1C 4NQUA 2KMWA 2AANA 5I1EL 5I26A 1KGCD 1MLBA 4YDIH 4U0RC 5JTWA 5HJDA 4FS0A 1ZANL 1TR7A 4H40A 4K9EL 4DOHB 3L4YA 2HPTA 4DH2A 2HYMA 4NQED 2FJHA 4FNPA 4J7RA 3TGXA 3VXQB 2N7BA 4AMKL 1W15A 2EDOA 1X5IA 3OXRB 3MRRB 1YLBB 3N43B 4WU7A 1CCZA 4H25B 2CKNA 3DX1A 4YBLC 3UTTB 5F9OH 3OLGA 4GQPH 5D71L 5FOBA 1M7DB 4JN1H 1A4KA 4PJEA 4ALAH 3QUMA 4FYTA 2OSYA 5DD6A 2VR4A 5GGVY 1TZHA 1MWAB 2J43A 3QUYD 5BMFL 3GYRA 1L7TH 2L3BA 2BSED 2UX7A 4C4BA 1FL3A 1C9SA 2ERJB 1E8YA 1E50A 4ELKA 1MSPA 3EXLA 4JO4H 2B2XL 4IK7A 4MLIA 4U49A 4FI6A 1A6VL 1U92B 2C3XA 3BKML 1NC2A 5E8NB 4LRNH 5HHNB 2N7SA 2VLLB 3RJQB 4KKZA 1LDPH 3T0EE 2XZQH 3GMOB 4N0FB 3LQMA 3ULUL 5C0GB 1S5HB 3LKPA 4FNRA 4FYRA 1RHHA 1WITA 1NCAL 3QZLA 1OSPL 1DBKL 4GAGH 1JZIA 3L5JA 4ZMQA 1XSIA 4JO1H 4N2NA 4X99A 3S97C 1UWXH 2WD0A 2NW2A 1J0YA 1XGUB 2NY2D 2LFGA 3SY0B 1NGYB 1SDDA 5ANMA 1A6WL 2Q86A 3CZGA 2H3KA 3IDNA 3MRKB 2G2NA 2QSQA 4FLRA 2X87A 2WGXA 3ECBB 3RI5K 2BZ7A 1AJ7H 1YUHA 2AS5M 3ZE0E 4JHWH 3AQXA 2VISA 1DYZA 4MWFB 5IBUB 4X9IA 4PU2A 5INCB 2XVBA 1OP3K 1F00I 3BKCH 3FTGA 4HMCA 2BNQE 3Q01A 2FD6L 4PH8A 3V2AR 4PG9A 3GMOA 4I9XA 4Y5YA 2OZ4L 3B2UD 3GXDA 5TH2B 2AQTA 3SQBA 3KGUA 4Q7DA 2D0GA 1HCYA 1CE1L 1U6AL 3A0OA 5DZNA 1RUML 4PJAB 2ICWJ 3V0EA 4AEHH 1HKFA 4C4KT 1DL7L 5C2BL 2D7NA 2YO3A 4GXUM 3ZK0A 3UZQA 2E86A 1J12A 5IGXH 2IFGA 1JYVA 5AUMA 4LSTH 3ZHDA 2BVPA 2CE6A 2MCG1 5HPMB 5F7AA 2GJ6A 4KH2A 1C1EL 1FL6A 1WFMA 2IPKB 1YY9D 2EILB 4FDWA 3A4EA 4IOFD 1G7JA 1LO5A 3FTUA 4LHUD 1T0NA 5CBEB 2WQRA 3WXWL 4MZIA 4R7NB 4X8JB 2W9DL 3HUJA 4ZSOA 1IEBB 3VXUD 4AJYV 5EIIA 3U0PA 4NUQA 2ZUWA 5B38A 4X8CA 5CGBA 1BJMA 5D7LD 4QLWA 4U6TA 4JL2A 2FHFA 3GBML 5IB2A 1WK0A 1PCSA 2DPKA 3NIDF 3B1TA 5IVNA 2RAMA 3TEZA 5JORB 3EFFA 3QUKB 1OCRB 5HPOA 3V6OA 1ET5A 3LQZA 4R90L 1FIGL 3BDYH 2GJRA 1SF3A 1CTMA 2AK4B 3SBPA 4DEUA 1NBYB 5EO0B 1A3RL 3EO1A 3V7MA 4NPJA 1IKNC 1Z6JT 2C8NA 3FOMA 2F08A 1K4CB 2O6FA 1M7IB 4APQD 3VD3A 3TN0B 2QSVA 3QRGL 2WLNA 1HFUA 4UT9H 5DSCA 5CJ5A 2JI3A 2WXPA 4AQAA 4HUWA 2FX9L 3IETA 4PRBA 4DW2L 1KB9K 3JV6A 2IAMB 5T1KA 5AWNL 3SDAA 4UBDD 1CICB 3Q6FA 2SODB 4JHBA 5D4QA 4NZRL 2BCKA 5E99L 3UTPE 1OGAA 2ZP0T 3QQDA 2VSMB 2AQPA 4UM9A 3UYRL 3PJNA 2VYRE 3F6IA 2Z91B 4CVWA 4NN5C 4Z8FH 1R3LA 4LCIL 2NCMA 3QFDB 2WUBL 4XBPB 4YHPB 3SDYL 1CGXA 3SKJL 4F2FA 5CD5D 2EDEA 5AW0B 2VITB 3VGAC 4A38A 1K85A 1ANUA 1S3KH 2GIYA 1D9KD 3FCUB 1TVDA 1VFMA 1Y1DA 2K6WA 4X9HA 1ZJBA 1CXFA 2TRYA 3MLRL 4KVPA 5I8EB 4C4UA 2EDTA 3KPSE 3LY6A 1Q72L 4BSJA 1HYSC 1M4KA 3O4LD 3NJIA 5HGBA 2PO6C 3BPOC 3C6LB 5KVGE 3U83A 4N1EA 4QD2E 4WTZG 1YNLL 2P3YA 4JR9H 1KCSH 3GQFA 2VWEE 4MD0A 4IKLA 1JPEA 2FAUA 3PHQA 5E6YA 4PJ9C 5BJTB 5EU5B 5D6CB 2ZX9A 3WFEH 1VB9A 3FB8A 3AXHA 5JDSB 2JH2A 1EJFA 3OLEA 3JTSB 4F7MB 1F4XL 2Z93A 1I8KA 5DHVA 2WVVB 4RX4D 2SEBA 5DS8B 3PWPA 2I5YH 2CKBB 3RU8H 2VE6B 2F54A 2QQNL 4F2EA 1OF0A 3L48A 1XB6A 4I5BB 4PWGA 3DTUB 1KENH 3P30L 2X6CA 1QA9A 3APFA 1KF9B 1MHEB 2CO7A 3L4TA 4N2EA 1JHTB 3HZKA 3LDBB 2H6OA 2Z0UA 4YDIL 1UT1A 2Z1PA 3NFNB 4MHHG 1URLA 5I28A 1S7QB 2XWEA 5DLMH 1HH6A 3IGAB 4OLXL 2KZBA 2UZXB 1I8KB 2J1XA 2ERJC 4JPSA 4ZTPH 2AKRB 3VRJB 4MHHI 5JDSA 5ACLA 2C9UA 2C3HA 4GQZA 1Q9OA 4NCDA 2ZTBA 3QS3A 4HIIA 1E4KA 5BJTA 2WWKO 3OJDB 1WWWX 1T66D 3APCA 1K4DA 1CLYH 2E7CA 2VL4A 1WAPA 3MTXA 4BA0A 4Y8DC 3ZUNC 4PRHB 1ZSDB 4MMYA 4QO1A 3ARXA 1FH5H 3CN1A 4LSUH 3PV7A 2R2BB 2L7QA 1BBJB 5IQ7H 3P30H 4J3TA 2CKBH 5I16A 3BZEB 4D9QE 1CGWA 5D72L 1FJ1A 3CG8A 3E2HC 1CB4A 2NXYB 4GBXB 4Q0XL 5I8EA 2BY3A 3WEXA 3OAWA 4NPYB 4EZJA 1RZJH 1N5AB 3VTAA 5ITFA 1A7RH 2QHRL 5DRNA 3DMMB 1GGCL 3IFNL 3LZLA 1XAKA 2JKJA 1LEGB 4P23B 4Z77B 3IU4H 3LZRA 4XHJC 5EU6A 4NS0A 2CRYA 1JZGA 4YE0A 2BP8A 1NBVL 4WEEA 2BM3A 1D6VH 2B9AA 1RZGA 1I1AD 1T6WA 5J6HA 4MXVE 4Z3JA 5BXFB 5K9KA 4KITB 3CSTA 4HUWB 1HHKA 4MNHB 1HWHB 1P7QB 5C0DA 1BJ8A 5DK2A 4KPHH 3JWOC 2RGSA 2W92A 4OJYA 4IBUA 1J1OH 3TH4T 2R0LL 3WHE1 3O2VL 3WKML 5C0JA 1R3KB 4XPBH 2KDGA 4P57B 4S11A 4EI6A 3FT1A 4M6ML 4YR6A 4K3DH 1Q38A 1SBSL 3KYMB 3T4YB 4PN6A 3T9WA 1R1CA 1AMXA 3NK4A 4DP2X 4HKJB 3MAWA 2J5LB 4Y4HC 4QXVA 5IIEB 4EN3C 3LEVH 4KWUA 4KI1A 2OMZA 3U4EB 3D09A 4XC1L 5KS9A 3EBGA 3S34L 3ZMNA 3QZWG 5K9QG 3TASA 4TTDD 4XCNA 5KBKA 1KWGA 4JDZA 1BGXL 3ZL4H 1HYRC 1UFGA 2A3TA 3SE4A 4QJ5B 1ZVYA 1F6LL 5DHYA 3D18B 2UUDH 4Z5RB 1M2VB 3S2CA 2CJ3A 5HHXH 5KZCD 4BUHA 4YHNB 1BX2A 3PF2A 2DYPA 3HAEG 3W39A 4IJ3B 1DVTA 1IFHL 4BDVA 1YN6B 3MHZA 2CR6A 2ICWA 1TJHL 3LH8A 3WUZA 2ODIA 1Z9OA 2FQDA 2FUTA 3DX7B 3BUBA 4XXWA 3NSXA 1NMAH 4FI8A 4G8AC 4KK6C 3NIFE 4X42A 5DGRA 3RZWA 3TC9A 5J7CC 3FRPB 1EVTC 4KTGA 1IM3B 3VD2A 3WIIH 3GSQB 4UV4L 4YHIB 4BM7A 1T22A 3MV9E 2ZWNA 5K93A 5JHAA 4YHKH 5C07D 2ZXCA 2IH3A 2XBZA 3DK2A 2CZNA 4PS3A 1HSBA 2O26U 3Q9QA 4DO4A 1R0AH 2VQ1B 2I9TB 4IBWA 4OI9A 3I75A 4NQVA 1Z3RA 4A2LA 1AIZA 3CMOH 3WFZA 2OTUA 3C60C 5IESL 3ILQD 4NN7C 1RZPA 2X12A 4P3CH 4N0YL 2IGFH 3G3LA 4NCC1 5FYKH 3OJDA 4IMLA 5AAMC 1TVHB 4IKIA 2EDDA 2H0JA 4YDJB 4Z95H 1Q9OB 1CBVL 1ORSB 3MA9L 4P0DA 2PMZA 2PETA 1J9QA 1E27A 3C5JA 2NY7H 3GI9L 3GS0A 4X2UA 3FN0H 3LYRA 3TBWA 1LP9F 1RZFL 1N4XL 4HJ1A 5IZ7A 1I85C 1CLZH 1KCRL 3FTSA 4AMXA 3OJ2C 3CSFA 1P0SE 3NCJL 5AW3B 1S7SA 3GHBH 5EORL 1XVSA 3L9EA 4H1LB 3BP4B 4YDJA 2R69A 4QHKI 1A7BA 1IC5L 2BWIA 3MYJB 1P1ZB 4XPAH 3FUIA 1EZLA 1F41A 1BEYL 4LPWA 5CGYD 4XO5A 5DHVB 4NI6A 3W0WA 3UTSE 1XF5B 3GJFB 3S37L 3JTSA 3K8MA 5IWLA 1AP2A 4BK5C 3QCTL 4P3CL 2W59A 1Z1WA 4APXB 4PWHA 3SDAC 3VXSB 3C2SA 5DD6B 3ZYZA 2O5XL 3E0GA 4U6XB 1EXHA 1TMQA 1IM3A 4K7PL 2V8LA 3D8MA 2WXJA 4IOFC 4BSVB 2UY6A 3HC0B 5GRZA 2IWKA 2VDPH 3MRRA 2BDNL 4JM0A 4UQDA 4TUUA 4FQ1L 1HHHB 3INUL 2GFBB 4FQPA 4YZWA 3IRZA 1FFOB 1CIUA 2XQYK 3AY2A 2QQQA 3VXQA 3ULUH 2PTUA 3DX7A 1NIFA 1ZE3C 2NNAB 4YLQT 4WI8A 4I77L 4XN7A 2ICWB 2CNYA 4GLRH 5IFJB 1NMAL 3SE9H 4JS7A 3STLB 2DIBA 4D9LH 4H0GA 1TYEB 2BSRB 4ZYKA 5EF3A 4E41A 1OCZB 4IMKA 3ATBA 1NC4A 1PG7X 3HBQA 3CDGA 4HC1L 4HT1L 4G71B 2EUZA 3TCTA 3GSVA 3NK3A 3VFSB 2A77L 3THMH 4NKDB 4HWEH 1E5UI 3C8KB 4HSCX 43CAB 4ZG1A 2XN2A 5BUPA 2EC9T 1ET8A 3Q2VA 5D96B 1E4HA 2OTWA 3ZE0B 3KPSD 4N85A 3GIVB 1V3LA 2ZP8A 5KSVB 3BISA 1QBML 2B08A 4XOEA 5BRZE 2C3GA 2XT1B 4WHTA 4EXKA 2Q5BA 1KGUA 1SOKA 2VQUA 4XAWH 1FI8C 4KBPA 4Z7VA 5FO8A 5LWYH 2C26A 5D5ME 2BS9A 4JFDE 3EYQD 4PJDB 2Y7LA 3MX0A 2IBZX 2VABB 3KPPA 3HNVH 2R9HC 3QA3A 5LGYA 3ZIMA 3MBXL 3ILDA 2KI6A 4ZMXA 3BH8A 1ILUA 1J8HA 3LQZB 2CBOA 3GZOA 4JQIA 2YAPA 5FKAA 5C0IB 4I3SH 3O11B 5JIIA 4K3JL 2ZCZA 5E1AB 3QYCA 1KMGA 4NQXB 5EFIB 2OYLA 2R8SL 2ROYA 4GAAA 3OAUH 4O51B 4Z3TA 3IJ8A 4JKLA 3L3OA 3Q06A 3OL2A 2DBLH 3EOBA 3K7UA 4M8QA 2JJUA 1QI3A 4JFEE 4GSRA 3U46A 3NIDB 1AG0A 3G7TA 3OF6A 2UXVA 3OG6B 1JF1A 4Z7NE 3TNNA 4JG0H 4EF3A 3DX8A 4X4XA 4GW1B 1SMOA 3RZCD 2WXMA 4PJ7B 4BH8B 3REVB 1F3DJ 1PW3A 2ENJA 2BC4B 2HG5B 4LLUA 2AZAA 4WNQB 3LKOB 3QO1A 2EEDA 3FZUC 4H1LG 3ZDWA 1FE8H 3IS1X 3N41F 4R0LB 1DVFC 1LD9A 2F1EA 3H0TB 3HCVB 5H37G 4JM4L 2Z8SA 2ILLA 2EACA 1GW6A 2YN3A 2RIKA 1U3NA 3FH8A 1SUJA 2W9EH 3ZGHA 4MA3B 3WD5H 2AKRA 3BEWB 3DTDA 4GS7C 2FWOA 4Q74A 4JRXE 4IHOA 5D7EA 5C08D 3B9DA 3X3GL 5DVPA 2J8UB 3R0MA 3QAQA 2ENQA 2HAZA 5AFAA 3MFGB 2HTKC 3LKNA 2GBVA 1TU2A 4P2RB 1OSYA 4R96B 3FDWA 1HQRB 2B15A 2OX5A 4JPVH 5EG6C 5HYSB 2X89A 4OCXL 3BUYA 3NRFA 4R5VA 5EWIL 4L29B 1OCOB 1X9LA 4ICXA 3FT0A 3TVMA 3C6LD 3G9VA 5JMOC 3T3PE 4X4KA 3RE0A 3FYEB 1IC4L 1JZ4A 5CKGA 1KN4L 2WVVA 3AQZA 3HI6H 2E9IA 3CGTA 1NC4D 1IGCH 2WANA 3HR5A 3O4OC 1JGVH 2ZCKH 2JI1A 4B9CA 3MOAL 2JJSC 4D0CA 1YNTA 2W60B 5IF0B 3D0VA 4EE2A 3RB7A 1FAIL 5T3XH 4PWKA 4YHMH 5EZLA 4J1UB 2LLNA 3WFDL 1BVLA 3WDHA 2FWUA 4G6ML 2W0KA 4MAUL 2OMWA 2XDHA 2GCYA 4WHDA 1ZD6A 2NY5C 3R06B 1TZHB 1LQSR 2FX7L 1FVEA 2R0KH 1IBFA 2KDYA 3CK0H 4S1QL 3BAXA 5ICXB 3WE6A 5EOQH 5KTEL 1BJ1H 4PVLA 5JHBA 2CO2A 2WKLA 2MJWA 1JNNH 1SLXA 4BFOA 1G1CA 2W38A 5E7FA 4M43L 4N87A 3IN2A 3JWDC 3BZFA 5JR1L 2VSDA 4Z7QF 3SKNB 5HGGS 5BZZA 2EYSB 1ETZB 5GJSH 1BMWA 2JJWA 4G7YL 3CLWA 4Y4KB 4QY8A 2BNQA 1XEUA 5EZIH 1BOGB 3PREA 3TV8A 4F1SA 4JFOB 3QDME 1PG7H 3GRWH 3LMJH 3GI8H 4RA0C 5FM8A 2EVHA 4QNPF 5DRWB 1OAZL 2H8PB 2EDNA 4R7VA 4H88H 5CSZB 1WF5A 4S2SB 3WLBA 1T1ZA 2NY2B 1J9RA 1S9XB 2RMNA 3B83A 3SKMB 2XTJE 4P2QE 3F7KA 3QXAA 3QXDA 1WYJA 3GHEL 5L7XL 4HIHA 4AEFA 4KTDL 4ADJA 2QV2A 2VLRA 4RAHA 1S7RA 4HF5H 4E5XA 3NT0A 4YL4A 5CD3B 1OP3H 3QPQD 2H8PA 2OK0H 2P5EB 5I23A 3CVHL 1OAQL 1A4BA 4O4YL 1TQVA 1UXMA 1WDAA 4P05A 5D6DA 5I17A 3T8XB 1UOLA 2AJSL 3QDJD 2BNQB 5FGRA 2F5AL 4IOIA 4J2QA 1OP9A 3QIUC 3VGGA 2EADA 4AG4L 4B9PA 4CJ1A 5ALCL 4KMQA 2ZICA 1UWGL 4ISVA 4NO2A 4GRLD 5JIDA 3MRGA 1E40A 3HC0A 4KK9C 2WCSA 4M5YL 5D1ZA 5ESQA 2XWTB 4BHUA 1DUYB 4QXTA 5G4MA 3RFZB 2MWCA 2BK8A 2XC8A 4TVPH 4O2CA 1JAEA 2FYVA 1KV7A 2YUVA 3HPLA 3DX0A 5HVGB 3V9EA 1N18A 1EO5A 3T3PF 1QZ1A 4K94L 3H8NA 1DN0A 1MJJA 2BVPB 1EDHA 2H2PC 1H3PL 4HEPG 4O58H 5G5DA 3NBNA 1A22B 3ENEA 4TL4A 5T1KD 3NAAL 1YPZF 4ELDA 5I8CB 1T5KA 4IRJC 4R4FL 1B4JH 3SKOA 3ZDXB 4IDLA 3VFGL 1NPUA 3TA3A 3EF7A 1IJ9A 1U8CA 3F7PC 1Q1JH 3HE7B 5C8JA 5FA4A 5JQ6H 4OI7A 3QUZD 2Y07H 3ZYJA 4B3VA 1L5GA 2I27N 2J21A 5C08A 5HDBE 2AXFA 2HTLD 4HKXA 5KJRH 4FQXB 5E2VH 1JNHB 2BVEA 4EQ3A 2A9BA 2AERT 2D31A 4L8SC 4QHKJ 2B3IA 1CD0A 1P5VB 4HHGA 3WS6A 2GJZB 4AV0A 3ZGIA 2G3ZA 1ORQA 3ROLB 1BG9A 1FFTB 2A2QT 3F05A 4P2OD 5L2KA 2DKUA 3BFQG 3UJIL 1JXFA 3VFWB 4TVUA 2CGYA 7PAZA 1OAXL 5KSAB 4TLKA 1SOXA 4RDQG 2FSEB 4NBYB 4QI3A 4K55A 2E47A 1CD1B 2IDFA 2OTUB 4GEJA 4DPBX 2YGQA 4XBGB 3T2NL 1ODAA 5FM5O 1WWBX 5JIPA 4NP4H 4AZUA 2ZX5A 2IH3B 1GL4B 1FZOA 4ZZFA 2DL2A 4P99A 4KJPC 2AQ1A 4PRPB 5F0LB 1VESA 2WXRA 4HUUB 4QRUA 2X4SB 4X80H 3UTSA 1JNLL 1SXAA 1A14H 4Z7NB 4YHIA 2HVJA 4YLBA 1OD9A 5I1AB 4LSTL 2Q7AA 5T5NG 3G6AA 7FABH 1U92A 5E8NA 1ACYH 3CFKB 4KU1A 5BOPA 2DWEB 5MHSD 3PHSA 1JHLL 4DKEL 5ITBL 2Y69B 3LNGA 4QRPB 4BH7B 1HX0A 3MLWL 4GS7B 1P7HL 3U2SB 1G5AA 2DWTA 1HEJC 5D4IA 4RFOL 3NQKA 4ERSL 4G1MB 4J3OC 3K3QA 1EHXA 4NO5A 4PFEA 3KPOB 4BFEA 2YJQA 1A3LL 3K5SA 4PW3A 4EI5D 2YWZA 3BSGA 1BQKA 3PHOA 3MJGX 4Q6YA 1J0JA 4Z5RA 4QRTA 3VMPA 3WDJA 1YMHB 1TQCB 1EX0A 4JFEA 1A9EB 1JPGB 3EOBB 3LXBA 4LRIC 4OY9A 3EFOA 1U0QA 4LB8A 3JWNE 5E94A 3LZNA 4DGIL 3NCMA 4Q4EA 4WY7L 4P3DA 4X6CE 1ZLDA 1IC4H 5CSBA 4AYDC 2VW6A 2DQFB 1CR9H 1MVFA 2AJYH 3STZB 1FFNA 5D1QE 4PCSA 1NPJA 1WZ1H 4I4WB 4HCFA 2CIIB 3OR6A 4X5PA 3FBKA 1PFCA 2XWJB 4FULA 2PR9A 3T4YA 1ZGLA 4GUOA 3HZMB 4EZLA 4AGQA 1FRGH 5IT2L 4AUUA 4EIBA 4CMHB 1RZQA 4PIBA 1ZY9A 5AYUL 4U2YA 3O3AB 3SEPA 4PJFA 1T7ZA 1MCPH 2JLLA 3HLAA 2ITDA 2QADB 2F54D 4GMSL 1I31A 1LK2B 5D5MA 1UZGA 2IV9A 3AT0A 1QI4A 3SJVA 1LEIB 3Q5TA 4KY2A 3DVFA 4NNPL 3H7BA 1OGPA 1RVFH 3KBFA 5EC1A 3QH3A 5HHMD 4HJ0C 2ZE0A 5K9JH 1AGEA 3UZVB 4AYFA 1EJ8A 1NANH 2KQNA 1FG9C 2W0LA 3S98A 3ASWA 4P59H 5E9AA 2YRPA 4XNUH 2VXTL 3UEZA 4F8NA 3BAIA 1WS7A 2OXHA 5TQ2H 2MTAA 1AR1C 4ZYKB 3WNKA 3WKYA 4EKXA 1XQ4A 3QJTB 1A2YB 3ZHKA 3DYOA 2HCZX 1Z9LA 4FFYA 4K9EH 1NQBA 1UCTA 1N7ML 3ESOA 4U6HA 4WWKD 2QV4A 1U2YA 3VGAB 2YZ1A 4DAGH 1EDYA 1KFAL 2Z31A 2XICA 2EXSA 1E5YA 4KO9A 4LHJB 4P5TB 3RKDC 3S96A 4HETA 3TBSA 4BJLA 1NSNH 1J1XL 5EEZA 1RZ8A 3I84A 1B0WA 1JGIA 4NWUH 4Y1SA 5E2TL 5FK9B 4F37F 4Z3IA 4JKNA 4LSRL 4NO0B 4M7LL 2C9AA 3EH4B 1B2WL 2I32A 1LP9E 1PS3A 1QR1B 5AQ0A 3VXRA 3CFCL 1MAJA 3LN5A 1J8KA 2I69A 4IOSA 2VLJB 1BZ7B 1HESA 3PGDA 3UOAB 3FO2A 5ICZA 5JW3H 2UZXA 1YY8B 2PN5A 4OJCA 4MD5A 3L95A 1ZAGA 4G1EB 3LNEA 2ZUTA 4BE5A 2YD0A 3LV3A 1KXQA 1JHTA 2UV3A 3BX7C 3LEYH 4JPIB 3N43F 4U05A 3VI3F 1TVBB 5GZOA 2DLHA 3EGDB 2P7TB 1IGYB 1A3ZA 4NFDA 3SBQA 3PABB 5F7LB 5HVFB 1AXIB 4NM4H 3HUJE 4ZSOE 1CDCA 3TT1L 4Y1TA 4N90D 5HGHA 2EC8A 4KRPB 2VW4A 3PFQA 3DO3A 4I0CC 4XOAA 4UZGA 2XIBA 4W70A 1U95A 3VSVA 4E0RA 2YQ3A 4GXVL 4M62H 1P9MC 5E2WH 3MV9A 4FZEL 1F56A 3RVWD 4JZOA 4W9DC 1HHGA 1RCYA 4G3YL 2R9HD 4NUGL 3FUFA 2UVFA 4BKSC 1IKOP 4JQIL 4LVHC 2WXFA 4FQ1H 5T8IA 5J1SC 3N5AA 4FQQA 3NP4A 5D96C 1DJGA 1MXDA 4XNQA 1PYWB 4KO5A 1S9YA 4ZODA 4HU8A 4HUCA 2Q2EB 4X80L 2C9QA 4GW1A 3LPWA 4XE0A 3QULA 1MQ8A 3TNNB 4N1HB 1AHKA 2FQGA 5J1TC 3C5ZB 3II3A 1MCDA 1BWWA 1HQ4A 4PY8I 2OXHB 4IOSD 1B6DA 1RK0B 1I4FA 3CFDB 1E5BA 2WUCH 3CSGA 4OGXL 4XVUD 1IKNA 5EOTB 3WFBH 2A99A 4FX5A 1YEFH 2ZUVA 1G9EA 3G08B 1CI5A 4HZLA 3D2UB 2JKXA 4Q4IA 4Y5XB 1SEBA 3KYOA 1QKZH 3KM2A 4PRIE 1AZRA 3I6LD 4L8CA 1H19A 1MHHB 3QZPA 5B1CA 2N7AA 3BKYH 2FVNA 4MQ7A 5KBDA 3FQNA 3L5HA 4OSUH 1OTTC 4NDMA 4QHPA 4K3EL 3ARVA 1I9JL 3NACL 3ARYA 3RJOA 1TJHH 2NY0D 2ZG3A 4PG2A 1SQMA 4R90H 3WGVB 4Z7VB 3MRHB 3EO1B 2Z4QA 1TXKA 2DQJL 1VIWA 2K6YA 1F6AB 3I9AA 1GKOA 3VNYA 4PBVC 3ARBA 4XN1A 4A2GA 4W81A 5FX3A 5C08E 4FMFA 2HTKD 4FL4B 3WFBL 3DROA 5IBLD 2K8QA 3LVEA 1J8RA 1U9KA 4Y19E 5TFSH 1IAIH 1NM9A 3LEVL 4NO3B 3D85D 4AM0A 3VD5A 5CGMA 4O02L 2LFEA 2VN4A 5ELIA 5MEOA 3ABZA 4R3SB 5IVZB 3JWNG 3LJ3A 1IEBA 2GUYA 1MHHA 1WD9A 5FGCB 1QG3A 5IFAL 2N1TE 2ARJB 2F19H 4PJHE 5LGJA 4ZOBA 4OZGB 1QUNB 4XCYB 5IB5B 1ADQL 3O2VH 3PQYE 1M6OB 3CHSA 1T5WA 4LXFA 2QFPA 3KDPB 1ZT4A 3T3MB 4X0KA 4UT6H 1TZGL 5K59F 5FUOH 4ZMTA 5BPPA 5KVEL 3ASOB 3HG4A 4PJAA 1FYTD 2NTFA 3RVXD 1W0YT 3PXHA 4FXGB 3L13A 5DXWA 2WM0A 3G6AB 2E6QA 3D1MC 1NLBH 3FUJA 3ALXA 3HFML 2DLEA 4GG8A 4DZBB 3RY5A 5JHDE 4G5AA 3L3JB 2FO4B 4WUUB 4NRYB 3TU6A 3L81A 3KW7A 1I8MA 5CU5A 3ZL4L 4FNSA 5GGSA 1ZSDA 4MMYB 3HB3C 3QHFH 2VM9A 5CN1A 1XAUA 3QEHB 1ZT7A 3AUWB 1RHFA 4HWBA 4PJ8A 4HCGA 4FQLL 1S7TA 1WC7A 4IK6A 1IL1B 2BH0A 2JB5L 3WJJA 3TLRA 5HI5C 4X5XA 4NPKA 3FQRB 3D69A 4LO9A 5AVRB 3RGHA 2K4WA 1ZVSB 1H3UA 3ESVF 4Z7OB 4EUPA 2OMXB 5F93C 4NQCA 4KZDH 1NGWB 2M83A 9PCYA 3TZVC 3V0WH 1UACH 3V79C 1WAEA 4Q6IA 5F97E 3RHWF 3S5LA 5J12B 3G5YA 1J05B 1TMCB 1XH0A 4XMVA 3U6XS 3OKMB 5CJ8A 4CC1A 2HLEB 2ORBL 4N8VG 3N44F 1TJIL 2H6PB 4N9GB 5TDOB 1E6OH 5EUOF 3RQ3A 3U0TA 2CH8A 1ADQA 2B5IB 2WBKA 3RX8A 3BD3A 3FTYA 1DVYA 5EIVA 2BIQA 2E7HA 3X14B 1GZQA 1N59B 4FFYL 4K4KA 2YPLE 4MQXD 1QBLL 2R29H 4TSBH 5JHLH 1ZDSA 4JN1L 3ME0B 4KRPD 3MLYH 4HXBH 2KZWA 2Z3FA 2CMRH 4UTBA 5EU5A 3FTZA 4OIIL 1JV5B 1WLHA 4GAJH 4LSSL 5AB0A 1Q0XL 3QIUD 5F1NA 3MZGB 3ILEA 4GKOA 1T7VA 1SVCP 2O5ZL 1EMTH 3RFZA 1MW0A 2X0VA 4NQSA 5GJTL 2LV4A 2RQ8A 3F65A 4K2UL 5CZXC 4G72B 1S7VB 5BS0E 2IGTA 4F20A 3HI1B 1TCMA 3K4DA 4U1SB 2H26B 3RX5A 1IO4C 3M46A 4X5WA 3K1KC 4QRQA 2DZEA 2YQ2A 4I0PD 1A3LH 5DHMC 4PLJC 1IIKA 1D5ZA 2NUPB 5KSUA 3QWOB 3WCYA 4I0PA 3GXPA 1WV7T 3SE9L 3QZWB 4AL8H 3U9PH 3QIUB 5AYUH 2R1XA 2VN5A 4GPVA 5H35B 5AAPA 5IEHA 1AGCA 1GSKA 2VCOA 2F7PA 1V7NL 4LSPL 3CH8A 5K59E 1D5MB 1R3JA 4WWKB 3GDBA 2FLMA 3PG2A 5LUMA 2ZNXA 5D5MB 1KGIA 1E4KC 1EFXA 3QUZB 2VR5A 4PJ9A 5JIKA 3PRZA 4AQAB 5IOKA 2Z7ZA 4NP4L 4XNXL 4ZMPA 1FVCB 2ISDA 4J28A 3QFJB 4XP1H 1ZEAH 3VFPB 3H6AA 5C0JB 5HI4C 3OC8A 2KC0A 4TTDC 2VXUL 1JZFA 2IC2A 1CZ8L 4F33B 2XYCA 4LE8A 2HX9A 4HU2A 3UIZA 5TE6H 3CFJB 2JFCA 4XXCC 1NBZB 4BQ6A 1MQKH 1EUTA 1Z0MA 2CIIA 3OR6B 1JI2A 3QT2A 4TUJB 2X88A 1KB3A 1R3JB 1KOAA 4RIRA 2DBLL 5DEGA 4MSWB 5J6GB 2NQ3A 4KTEH 2QELA 1IAIM 1HTYA 1W9XA 1PTZA 2H3NA 1NMCB 5I1HH 2WZ6A 3QQ3A 2C4XA 4YUEH 3WY1A 1E9QA 2R27A 4OSUL 2YZ8A 5C86A 1KV3A 4OJFH 5I1IH 2IPUG 4XN9A 5F1KC 4MASA 4GRLB 5AW7B 1I53A 2K7QA 2DN7A 2G75A 4KNUA 3JV5A 4U1MB 3RPIB 3WTVA 4H8HA 2EQDA 5DO2D 5DD5H 4ZUTB 1YNTB 4HUVA 2DQCH 1BXUA 2GJ6B 2NZ1A 2GBAA 3IRCA 4PVMA 1TEYA 3BZ4A 5TDPB 3OKLA 2R23A 3OTTA 5KUKA 1VEOA 2NYKA 2R2BA 3H54A 3P69A 1SHWA 8PAZA 1U42A 2ADFL 1TZIB 1NGXA 3LN4A 3ILQC 4KJYA 3ZTDC 3LSOA 3IFOB 2B7DT 1SN5A 2FLRT 4FQJL 4NUPA 4WRLA 4KZEH 1QFUL 4PG9B 3WI9A 1U8KB 3BXNB 4K9EC 4PVBA 4JCMA 3OV6A 2NLJA 1UWGH 3D6GA 4L1DA 5BO1L 3VSQA 1KTRL 1X4XA 3H9ZA 3LNDA 5BV7L 2LAAA 3AAZB 1DQMH 2OXGB 3D52A 5MERB 3WJLA 3VQMA 3AS0A 3ZKSD 1J1PH 3RJDA 1J0IA 3WELA 1GYAA 2PTTA 1KIUB 2CK0H 3KWWA 4DEPC 1U8OA 4FXGC 3EGXA 1AGDA 4XMLH 1OCWH 4DQOL 5GRVL 2O6DA 1I8IA 4H2AA 4NUGH 3Q7JA 5FFLA 4I5BA 5D7IF 3Q8AA 5F1IB 2YLKA 1NCWL 3EFDL 2V2TB 1TCRA 4N2AA 3NPSB 3PWLB 3DV4B 5IM7A 4JQVA 4KKCD 4KHXL 4CBZA 1OGTA 5ICZB 5HYQB 4A68A 4LL1A 3PGDB 3WL9A 2EH8L 2YUZA 3WUWG 2R7EB 4LEEA 2BRQA 1HL8A 1PNDA 1CI3M 1JPSL 3LKOA 3HRPA 1ZLWK 3R1GL 4M7JH 1DBAH 2OULB 3HUJF 5LXGL 3ETTA 3GSXA 2YRBA 4JRYB 5GGVL 1IL1A 5HHNA 4UAOB 4GB9A 1JMZA 1K8IB 1UH2A 5HJ3B 2B1AH 1DDTA 2X1QA 3GNMH 1DQDH 5D7JC 4WUUE 3W2DH 1YEWA 2F15A 3RWDB 5DQJA 5I1DA 3N41B 2H47C 3QDJA 4N86A 5SWZB 1NAMH 4ZFGL 2NNXA 3KGRA 1DDHB 1E65A 3A5VA 4X6BB 3VA6A 4WFGE 1AGBB 2O72A 2V17L 3PWNB 3OKKA 4NRYA 4BCXA 4E9WA 2JCCA 3ARDC 2H2SC 4QRRD 3L7FB 4JHUA 2VO5A 3CFBB 2OJZL 5E1AA 2Y5EA 3ZDZE 4BQBA 1OOAA 1OAQH 2A5UA 2E27L 5F9WB 2HFFB 3C08H 4ISVB 2G5UA 4HJUA 3ZOAA 2Y5TA 1OIOA 3P3SA 1EUUA 1H6UA 1E9PA 2NY7L 2F53B 3RVUD 1DO5A 1I9RL 2FJHB 1SZNA 2J57A 3IKKA 1MF2L 4UV7H 1FFPB 4MX7B 1AMYA 2F8VA 5CIPB 1R5VA 5BVPH 1QBBA 3ASNB 3C75A 3HRZB 3J07A 3LS4H 1VF5C 2LTQC 2V9UA 2K0RA 4JY5H 1J10A 2R69H 4WENB 2BFGA 2J6WA 2AQNA 3GSNH 4XNMB 1GTFA 1BXXA 4ETYA 4KK5C 2ITDB 1X5GA 4BZYA 2VLRB 1R47A 5DSCB 2JIXB 5HHOA 5E6RB 2AQRA 3GZQA 4G9FB 4OUOA 5LHDA 3S7GA 2EVGA 1T89A 5IHUL 2YOCA 3H1ZA 3SGDI 1G7HA 5EZOH 2E74C 1TTAA 3GB7B 3V6ZA 1YEGH 4L3CB 4HH9B 1OXYA 1NBYA 5DA4A 5EO0A 1CG9A 3BRDA 1GCFA 2EKSA 1BMGA 1H5BB 4WV1B 1UXLA 4CN6A 1INQA 4OR1A 4D9RD 2Z6FA 4LESA 4N24A 1BFOB 1TETL 3JZYA 4P5MB 5EPMB 4AXWA 1WQVT 1D9KA 4XP4L 2D3NA 1XF3A 4JM2F 3I50L 1IGJA 5F7EH 3FB7B 4NOBA 4OZIA 1QI5A 3FU8A 3UBXB 3VAEA 4CBPA 2FIRT 2O6PA 4QIRA 2OFQA 3LN9A 1EJOH 3OKEB 2W07B 1MQKL 4X8JA 2NY6C 2UUDK 5BUGA 1U91B 3ARTA 4RH4A 3ZHNA 5I5RA 2MQ3A 2BY0A 3TIDA 2XRAL 1A4JA 4WQOA 4G8FA 1A7NH 1YPZA 2OYMA 4F9PC 2ICEB 3GGWA 1IBBA 2ICWI 3N91A 3ZKXB 4AENB 2B4CC 4W4OC 3PGCB 5A7BA 4OIIH 4LMQI 4KAQH 1PY0A 3BWUF 1FDLH 3MRDB 3MLSH 3VG0H 5T3ZH 4B95C 4KRMB 3L3KA 4OGQC 5EZLB 4MJ6B 1DCEA 4P07A 5IKCB 2EP6A 4B9KC 1MJ7H 1NCAH 3D5OF 4CC0A 5EBLA 3ZMRA 5L0QB 4W1TA 1KJ2H 2J12B 2JB6A 4UU9A 5KZCB 4FQXD 2YD7A 1F13A 2OSWA 3ZSTA 1AKJB 1YYLL 4P3WA 1RIUL 3AU1A 4TSCL 5DJYB 4AK1A 3EBHA 5T1LA 4Z1PA 5J11B 3I74A 2ENYA 1J48A 4I1PA 1CXIA 4BRJA 3MRCB 4M48L 3PWVB 1RIUH 2P4AB 3N40P 4Z7UA 4A7TA 1X5LA 5G55A 3BUYB 3P3UA 3V95A 1SY6H 1XIWA 4UZUA 5CBAB 1DVFA 2YSTA 3WY4A 3GMQA 4J4PD 2XX0A 5BMFH 1MFDH 4ECNA 3N44B 1HE8A 3PL6A 1NMBH 1AI1L 3F7YB 2OLDA 4G8GE 4U0RB 2KZ1B 1VKXA 1N2RA 4XNYH 2JF1A 2BHUA 2W65B 4DP5X 3MLPA 3D33A 4QXWA 5T1LB 2I85A 1PL3A 4AW4A 5HDWA 1GPOL 3QNFA 1KEGH 4QXUH 4X83A 3WJJC 2BZCA 3LQAH 4L05A 1HOEA 2E7BA 2RACA 3CQQA 5T5FL 1E43A 4J4PA 1LO0H 4HJTA 3ERXA 5GRWA 4H8WC 2OJEA 5I0XA 4JG0L 1TTFA 1X5AA 1XR9A 4QOKA 5LN4A 1JUFA 4D0DA 1BD2D 1GSMA 3LD8C 4M1GH 1SBBA 4I3RL 5E2VL 4H5SA 3HFMH 3BSHA 5FA3B 2E7MA 2V3DA 5GRUH 3US0A 4M1CD 1F6FB 2BIHA 5CU9A 1JXJA 3ATFA 1BZ8A 5KVFH 4NNXA 4NN5B 4N2MA 5F7EL 3TBBA 2ZP9A 5CFAA 2LT9A 3DX6B 4JJ5B 3BP7B 4Y19D 1CVRA 2QPUA 1W91A 2IQ9H 1H9VA 4Y16D 1YN6A 3EKCA 2XXFA 1PAMA 1G6VK 4YDVA 4P4KB 4YK4B 2PR4L 3LEXB 2XWTA 4ZTPL 2EIZB 2NT1A 3ELQA 4N2KA 3VI4B 5CWSB 3EIFA 3NPSC 1CGTA 1JWMB 4LOUD 1J7VR 4P9HH 3UTZB 3SYAA 1DANT 4WEBL 4C59B 1BV8A 1ZHLA 3A23A 4P46C 5DC2A 3MV9D 2OL3B 1G9ML 1OQXA 3AMLA 2WO3B 3OZ9L 4AUYA 2XIDA 3NDZE 3PIQA 2YARA 3MACL 4HWBL 2ZOKB 3LVTA 1LWRA 4L3EB 4YR6B 1XO8A 3A4DA 4OV6F 3K71A 1BYNA 5AVYB 4XMUA 1EAQA 3VU1A 4PM1A 5GPRA 5FB8A 3S36X 3UZVA 4AYFB 4EUPH 3MJ7A 4YSQA 4HWEL 1FZMA 3AG4B 5H4YA 3HG1B 4XVTH 3V5DA 5LDUA 4HPHA 3V6FA 1QSVA 2FB4H 1Z9SA 1SJEA 4FZ8H 4LP8A 4B7LA 4U1IB 2VN6A 4J23A 2AXGA 4XMKH 2ROXA 3W82A 1CS6A 2OSLA 1X6NA 5GGQL 4R4FH 1R3IH 5D1XE 4KTDH 2X0WA 1VFAA 4WI2A 3D3VD 2BHYA 1N19A 3W5MA 1R5VB 2ZONA 4PAZA 3G5ZB 4AWJC 2R1XB 3WTWA 1IQWH 1ADQH 4O2FA 4L3EA 1LE9A 3AXLA 5MHSE 4DHLA 2XG4B 3IXTB 4RAVA 3V4VB 2BVUA 3WBDA 2BNRA 5ID0B 3BZFB 2A74A 4Z95L 2BSRA 3BYTA 3QFGA 4XPHL 4AEEA 2TAAA 3IE4A 1FFNB 3EJUA 4I7ZC 3F7QA 4D8OA 2E7DA 1KJVB 3BQUC 1OTUC 1TEFA 2ADFH 4UDUB 3ULUF 4K23H 4CVZB 4JFPA 2PCFB 1G0DA 3B5TA 2H32H 2VDQH 2XKNA 4QHNB 3V7AE 3ULVE 1KBWA 1BFVL 3RI5F 2A6JA 2B9BA 3NABH 3NJNA 1FPTL 2VDRH 3WN5A 3BESR 5HJ3A 4BQ8A 1UZ8A 1KNOA 3WXVH 1JHKH 3LAFA 3MCLH 3PUCA 2JJTC 1LEKA 1CDIA 4G9DB 2KS0A 1BQSA 3ZKQD 2HX7A 3B9KB 4HDIA 5FDYA 4AVKA 1FA4A 4ETQB 2YD6A 3ZDZF 3RGVB 1X5JA 1DO6A 4F24A 3OB0H 1SLUA 1CFTB 4QGYA 1CFSB 2G30A 1RZFH 5EC2A 2KLTA 2DQHH 1PZBA 1G9NL 3KDMA 1HHIB 5FYKD 1C12A 5A2KH 3ES6B 3I9PA 5TK2A 4F57L 4FP8L 3MTRA 3NTCL 5F1IA 2JCWA 3V8CA 4C4KO 4PRID 5TDOA 1YUKB 3JV0A 4JFQB 4JRYD 3IMRA 3QUML 1BVZA 4YGVA 4YWGH 4Z3FA 4HMEA 1RJCA 3ZQ9A 1I1AB 3U4AA 1TTUA 4K94C 3HN5A 2CKBA 4N8VB 3LEYL 5E0QA 1AY1H 3MYZA 4H26B 3HC3H 3TBWB 4G6KL 5AZ2H 1BPVA 1L3WA 3QQ4A 4HK3J 3C5SB 3C5JB 3HHRB 2BSSB 4FQHB 4EN3A 3VWJB 1A6WH 3VMNA 4UTBL 1P5UB 3NCXA 4PB9L 2RB8A 3P11H 4IBLT 4X8XA 3QNXB 1UOVA 2G9HB 3KH4A 5D2LA 1GS6X 4XNYL 2GC4C 4IRSA 1A6ZA 4POZD 1AI1H 1G7IA 2R59A 4ELMB 4ODVH 2YKLL 4RFNC 4MCNA 3HZYB 5DJYA 2F53E 2I9TA 3MA7B 1LVEA 4L9DA 3QO1B 3FQXA 2OZ4H 4U6YA 3WO4B 3QYMA 2UXTA 4LLUB 4PRHD 1EFXD 5I24A 2X6AA 3CHQA 3I9IA 1FRGL 1P2CA 3WO3B 5IT2H 4KQ0A 4N0CD 1KTLA 1JCVA 2Y2YA 4ZPTB 1A6UL 4EN3D 3TO2A 5F7DA 3SGEI 2PYFB 1NUGA 3BYYA 3E9UA 4N2CA 1SJHB 3JV4B 1OK8A 3GSUB 4KUCD 4XC1H 4X0KB 2ADIA 2IV8A 5DD1L 1GXEA 2IQAB 2X4QB 2YK1L 3O6KL 1FSKB 1E42A 1TTRA 4KOBA 3QIWD 3S34H 3QQDB 3NUKA 1R6VA 1BIHA 1PSKL 2BERA 4PJ5D 4JFYA 1C5BH 5CO1A 4QUOA 5BOZG 3ZZSA 4LP5A 4QXTB 5C07B 2XACC 3QG7H 1IE5A 1CF1A 3ETBJ 2ADJA 4L5FE 1P4LB 2WZPD 4HSAC 4H0IA 5KEZA 1T1XA 2X1XR 4OJDH 1NPNA 2OR7A 5IVXE 1KXVA 3OVUB 1HIML 1KSRA 1E28A 3HI5L 1OAUH 2WLLB 2X9XA 3LPOA 4ZQKA 4KK6D 2WJ7A 2D4DA 4PRAA 4OFQA 2WKGA 4MXWL 1KEMH 4H4NA 4P5MA 1I1YB 2JMRA 5EPMA 4AXWB 4TSCH 1CICC 2B3RA 4U7SA 2XSKA 4GUPB 4L4JA 2Z7UA 2O61A 2GUOA 5KSVA 3U6RB 5I66B 2P8LA 1QFOA 1UB6A 4PW9A 2W9LA 3GIVA 3SQOH 2LW3A 4P57A 5DUML 3FNKA 3CZUB 2K7PA 1C8QA 1NOAA 4OLYL 2A4EA 3GSRA 5DRZA 3MROB 1B0GA 2HKHH 2ZPKL 4X4ZA 2VC2B 3PV6A 2WVUA 1HHKB 2X10A 2XQ0A 4Q89A 5CP3A 3T0XA 3TEYA 1JPFA 4IGBB 3KYOB 4GBXC 2CRZA 1QSEB 2QGDA 3QDGA 2AAAA 3STLA 4GUCA 2DQDL 1UWXK 2JB5H 4ZMWA 1FLTX 3RU8L 2P49B 1WGVA 2WQUA 4UQ3B 2EXYC 4PJAF 5LGKA 4P59L 3ECUA 4LARH 3I3BA 4BA8A 3M17B 1TG8A 1FFOA 2ZOOA 4HFWB 2EYSA 4L4VD 4P5KA 5JW4R 3RDTB 3WTXA 2K3HA 4CN4A 3MLWH 5KVGH 2YGNA 1IV8A 3HG3A 1UKQA 4AT6B 4Y16C 2YPLA 1CK0H 1ES0A 3O3EA 4PJ5E 2G3NA 4U6YB 5EMYA 1AGBA 4YHYB 1I8AA 1ZLUH 2F7IA 3P4OB 4K5PA 1MFCH 3QDJB 4UT7H 3KYAA 5EIIG 3RWDA 4Z78B 1ID5I 2VNCA 4Y5VB 3RVTD 3ALWA 5J57B 4DCQA 5GZNC 4NJ9H 4K73A 3DECA 4AZ8A 1A9VA 2QVFB 2J8HA 4FLQA 4PRIA 4JZNA 3ZDYF 3CJJA 1GC1C 1G6RL 3VWKA 1N0LB 2J5LC 1VERA 5AKVA 4EN3B 4RX4A 2WNWA 2P9RA 4BFFA 1R5IB 3FT4B 4XPHH 3CD4A 5HGDB 1G7QA 3MLZL 3VGHA 4OVUA 3I02B 1MCOH 1PLGL 4IRSC 2WYIA 4FTVB 4AVHA 4Y4FA 1OHZA 3SYOA 1IGYA 3KS0H 2JKLA 2OCCB 4XPAL 5E4EB 5I74B 2F5AH 2WW8A 5GS1B 2JTYA 3C08L 3TZVB 4CGUB 1VGKB 3WUWA 1UM6H 4DP4X 4KKLC 2VDOH 4KH9A 2E7LC 1YSOA 2CUAA 4F58H 5LGHL 2K6ZA 4F1ZA 2LU4A 3NJJA 1BXVA 4JHZA 4LAQH 1BAGA 3Q2WA 1F2QA 4Y5VA 1I75A 3IDYC 3S3JA 1A66A 1W72L 2BVQB 4PD4K 2VLJA 4XTRC 5E2UL 5ABDE 5JHDA 4FKHA 2VLME 3GUTB 3QO0A 4FZEH 1YNTF 3L4CA 4PRPD 1SXCA 3RA7H 4KY1H 1MCSA 4TYUA 5TDNB 3QK0A 1O7DE 3HLKA 3L3JA 3WTSA 4QR7A 3DMMC 3SD5A 1A4KB 4PJEB 1DJIA 2RFXA 1E67A 1JZ5A 4NQDA 2CJTA 4L37B 2R51A 3FRPA 3OGCA 1TENA 4ONHB 2MKWA 4LCIH 2JLPA 1E9OB 2PCFA 4JE0A 3VXNB 4ZXBA 4YNYA 3FU9A 3M17A 3GT6A 4HFWA 3U2JA 1BA9A 1TQSA 1KB5L 5F70A 1SHMA 4ZUTA 2OMVA 5F6IB 3TJEL 2WBJC 4AEIH 4WDIB 5EN2A 3L1OH 3V0GA 4QAWA 4E2OA 3GK8L 3V0AC 1CBJA 1QQDA 2IWGA 3NSFA 1L9NA 5BRZA 4E36A 5JZ7C 3RBSA 1J5OH 1QSED 2V5MA 2XN9B 1XSJA 5MEPA 2WVTA 3O8XC 1M71B 4NHUB 1UCBL 4UM9B 4B9ZA 5AW6B 1N5YH 3NIFF 1D2PA 1FFQA 4JDEA 4JQIH 4GFTB 4G8IB 4KO7A 1TIUA 3FUHA 3BVTA 5E00A 4Z7WF 4XCFH 4MAYC 3BDXA 4MAUH 2TSBA 4WHYG 2D7TH 6PAZA 2F8IA 2EE0A 2Z64C 4HX1B 4FFZA 4BINA 1ZWIB 3BKYL 5DZAA 3ZYOA 4IIQA 4PV8A 2AJVH 4E5XG 4Y4FC 2X9WA 1T2QL 2ICEC 3HOGA 1LDSA 3UJJL 1LO0L 4ELME 1OE3A 3BVNB 5T5FH 4Q56A 1D7BA 1SXBA 3LB6C 2CPCA 3VFTB 1P7QA 1OM3L 2QGBA 3QFJE 5I15L 4LHUA 5KBMA 1KLUB 5K9KB 4G7YH 3NSCA 3GC3A 1C1EH 1CLOH 4KV5F 4GJTB 1NMBL 1B0RA 1P84J 3D05A 4Y5XA 3HNSL 4JFFB 3MV7A 4MA7H 4AYGA 3KR3H 2PWDA 3PY9A 1RUQL 2EDFA 4QAMB 5DHEA 5H35A 3GPEA 4TQHA 2QPSA 3Q05A 3V5KB 1A9EA 1JPGA 1G9HA 4Z77A 5ERWA 1MRFH 3ISRA 4XXDB 1V7NH 5E2UH 3X3GH 4TPRL 5A2CA 4PJFF 4RGNE 3T1FB 2V5SA 2DQGL 3EHBB 3VXMA 3ZL1A 5I76B 1NUDA 3VG9B 1F0LA 3BKMH 2R1YA 5H2BA 1N9PA 2QLVB 2APTA 4X9GA 4E9TA 4NNXB 4K8RC 4CMMA 1R5WB 2Y24A 4ZXBB 4BK8A 4XVSL 5C9JB 2CLVA 5BCAA 2FBJL 3APDA 2WMPA 1R3HB 1JTOA 1OZTG 4OQTA 4HKZB 2YMXL 3KBHE 4BZ2L 1JV5A 3UTSB 1QLFA 2FH8A 5EEUA 3W9DA 1RSYA 4ANKA 4AW7A 2ZSWB 1QYGH 3BT0A 4GW4A 3ZO0A 1JGEB 2I7SA 4BV1A 3VWJA 1IKFL 2DM7A 4FNLH 3T6XA 1GY2A 2K8MA 1YEEH 1X5HA 4YDZA 4FXKC 2VISB 4ENED 5I6NA 1AHMA 3HFFA 3DUHA 2DWSA 4U1GB 4LCYB 5KSAA 3OKYA 4GKNA 4HIJB 3M8OH 4Q6IC 3RRQA 2X4PA 4F7PA 2M1KA 4JFDA 4LK4A 1OGSA 4RISH 5I1EH 2DDQH 5I2IB 4N9GA 3E6FB 2OQJB 3D07A 5HVHB 1VADB 1N12A 1IMHC 5HYJA 2NY2C 3IWVA 2BPBA 3X3FL 1RJZB 1ACYL 2QR0A 4Y8AA 3SPJA 2EYRB 3BPCB 4QKTA 1MJ7L 4GKLA 5DLML 1CL7I 4MNQD 1AKJA 4PS7A 4DEWA 4L9LA 2GSMB 1WBYA 2NDFA 4QXGH 2Q10A 4F2MA 4G6AC 4KI5E 2PP9A 5DEJA 2IG2H 3MZTA 3L2MA 4J3OH 4JO2H 1J5HA 5M94B 3VDAA 2CR0A 5IKCA 3T77A 1TQBB 1VEPA 5SWZD 4XZUA 3S96B 3TBSB 3WSQL 1YYCA 3F7LA 3O6FB 1JZ8A 1G84A 4FQ2L 1JN6A 5HD8D 1AAJA 3O45B 5LNGA 2V9RA 1BDYA 2D4FA 3DIVA 5E9DE 3VXRE 5DZPA 1YJDH 3WNLA 1O6VA 1QHQA 3CXDL 4TQEL 2WOBA 3GSQA 3VRIA 4NO0D 4RGNC 4PJ7F 1NFDB 1SXZA 1Y18A 3HHSB 3QW9A 5GSRA 1AOHA 5HJGA 5A43C 2W07A 3P77B 4BFNA 1V10A 1M7UA 3T2PA 1NDTA 1AS7A 1DQQB 4JPQA 4PJ6A 4HBCH 5A2FA 2RHEA 3B2UC 1EEYB 1MCCA 4IOIB 4AGLA 3ZY7A 4B27A 3E8UL 1E3FA 4QOKD 2CNZA 3MXVL 3QIBC 4M1DH 5CFHA 4PP2B 1A9BA 2OMBA 2VDKB 3EOAA 5J89A 4GRMA 2AXGB 4L3FA 1PKQB 4J6RH 3QI9A 2X6MA 1K6QL 1LL1A 4URTB 2B1AL 3F5WA 3TP4A 3ZQXA 43C9A 4L3CA 1QW9A 2H2PD 2B1HL 5KS9F 1KGJA 4CDHA 2WQXA 2NY0B 2HH0L 3SGEH 3SKMA 3WIFA 5E24E 3SDCD 3O4OB 1S9XA 1G1YA 4I48A 3VFMA 2KH2B 4AGOA 4HW6A 3MODL 4FQIH 2VN3A 3ZR6A 4OM0H 3I2CH 3L2NA 1WFNA 1EO8H 2AK4A 5D1QA 1LTXA 4CILA 3LIUA 4GRMB 4L3ED 3D06A 2IH1B 1YECH 2Q20A 2FBJH 2MCPL 4CVUA 1T89C 2GTZA 4J3XA 4ZK8A 5IOPB 3D50A 1DVUA 2GBTA 3Q44A 3ECWA 3HRZA 4C55A 2B16A 3SDDD 4ZQKB 4OB5H 2IAAC 4Y7OC 1MCJA 2F53A 3MRNA 1BZDA 3N3EA 2P8PB 4JFZH 4L8DB 4O4YH 1HVXA 5DK2B 3ZZ1A 3FPXA 5DJ0B 1XHHA 5KJ4A 1DQIA 1PZ5A 4ODSL 1YC8A 4I3SL 3QEQD 1LGVA 1PDKA 2YD8A 1BD2E 2ADJB 4L8CB 1VACB 1QLRB 2EEAA 3FQTB 1I1RA 3A6BL 4OLEA 4JQXA 3VRIB 2IAND 3F58H 4HGWA 5IFAH 1FLRL 4S1SL 1DJYA 4P23D 2GI0A 4I2XA 3TVMD 3S3CB 4B50A 1N6UA 2C1PA 1LEGA 4M7KH 1XF1A 4P23A 3S8GB 3ABKB 4RWHA 4F27A 1T0PB 4KK9D 1HOCA 2P5WA 1BQHB 3NGBC 3K72B 1K8IA 3OHXC 4PJCE 3G6JA 1XR9B 3S3BB 1KTLB 2QTVA 1IC0A 2HVJB 1NCDL 5CEZE 1JVOA 3NJVA 1WBYB 3NYKA 4WTZA 3EH3B 1VCAA 4NFBA 2ZJSH 4FA7B 1C5CH 1SOSA 1QNZL 2Y23A 3DOIA 3NMEA 2G4GA 4M5SA 4KX8A 5ALCH 4ZTOH 2ZYHA 2F0CA 5AB9A 3NCJH 1RLWA 2VJ0A 4QDGA 3SYQA 2WHVA 3V5HB 3AB0B 5DZVA 2Z92A 3F7YA 2IQ9L 1HEZA 3FQWB 3DOHA 5F9JA 2AXWA 4NC1C 2N1KA 4KQ3L 4ODHH 5DFVC 3KPRE 5DJZA 3SO3B 4H8QA 3EBAA 1UCBH 4LT7A 2Y9RT 1KIUA 5CMAA 5DJ6A 4XPGH 3I9GH 1DTUA 4XP9H 3RY6C 4OU3A 4ES8A 2WQVA 4JFFE 4GRWH 1M7XA 3OG4B 3UYPA 4WSKA 1BFSA 1A7OL 3S4SB 3CZFA 4TMPA 4OLWH 3SGDH 3UCQA 2NY4B 5D6DC 4AVJA 3T2OA 4QRRE 3TTYA 5I30L 1JPTH 3DHUA 1CURA 3NFSH 4F7KA 1KGXA 1RD6A 2JB6B 2DB8A 5FYLH 1TZ8A 3BLKA 5A6MA 2YKKA 4JG1H 5FF6A 3GI8L 1ONQB 1SXNA 3IMSA 4P4RA 4RZCA 5E2JA 4PJGA 2Z93B 1XT5A 4L48A 3S88L 2R23B 2WZ0A 3MUGB 4ETQA 4UTAH 5IHZB 4MJ5B 2F1BA 4L4TA 1RUMH 3PNWB 4K71C 3PL6C 4NO0A 5C71A 1KULA 4ODSH 3EBIA 1A25A 2V2XA 3QUMB 1RZ8B 2WXNA 3RNQB 3FQTA 3ZDZB 4Q9CA 2XNAA 3VI3B 4BXVA 1VACA 3CFCH 4FAAB 3MREB 4H25A 3WHXA 4ELMF 1PAZA 3C6LA 3PAZA 3V5KA 5CJOL 2X2JA 4JO5A 1O7VA 1OM9A 4DP7X 3EZ8A 3QQ3B 3T1WA 3JTBA 2X4OB 3ZJAA 3OKNB 2X5PA 4RAUA 3VDCA 3K4AA 4CKQA 1BP3B 1CBVH 4ORZC 1J0ZA 2ZYSA 3DK0A 3LIZH 3E7JA 4EI5C 1WT5C 5IHZA 1BW8A 3MQIA 4A7SA 4WI3A 1ONQA 1EBPA 1LNUA 2GYSA 3BW9B 2Q8AH 5DEFA 5CJBA 1NEZA 3QYNA 5F9OL 2EEBA 2Q2LA 3V6ZB 1MAML 3BRGC 3NIGB 1G7HB 3WSQH 4ZX4A 4LPYA 2H4EA 3P73A 1EXUA 4J3OF 3LRSB 3WDIA 2D3VA 4WAFA 3GJFH 1NIDA 3PWUB 2BSCA 4HHAB 4ODBD 1LHZA 2YGOA 1IBGH 1UYWL 4RGNB 3N1MC 2JNZA 2C7UA 3BGMB 3OJMB 2DEXX 4YHOL 4LSRH 4OM1H 1OW0A 2NY3B 1A9BB 1PCXA 3M7OA 3QQNA 4CMHC 5CF3A 3OAUL 5A3IC 4JPVL 3INOA 1BJ1J 4JNXA 3U1QA 3E6HA 4XODA 3SCMB 4NHUA 3MMEA 4OW6A 4KVNH 4KRLB 1GZPA 2WLYA 3ALPA 5DEFB 2LVCA 3JVGC 5MEPB 1MAKA 4DK3A 3QWOA 4GIAA 2X89D 3HNVL 4NFCA 3IXAB 5EBWB 5IQ9A 2EO9A 1ZK5A 1BF8A 1IFGA 4K2UH 5B4MC 3U7YH 4U1SA 3ZDXE 3BN3B 1RZKH 3CFTA 4MCZB 4FTVD 3ZRFC 2CDGA 3NZSA 1KCUH 1P7BA 1JFQL 4ZO7A 1YEDB 2XZAH 4YAQA 5K1NA 5KN5B 1J11A 3ULVF 1E9OA 1F02I 2GCYB 4EPSA 1YMHA 1T5XA 2OYPA 3PDOB 1LK3L 3II1A 4NQDB 4UQBA 1KYOK 2V2XB 3OZLA 3RNQA 3CFMA 2RALA 4OLYH 2OW6A 2X4NB 2IOOA 3U9UA 1UURA 4L2LA 4A6YH 2R0LH 3WEBA 4L8SB 1D9KC 3ZRSA 4QRSB 2DWEA 4L8BA 4NQCD 3BAEH 4P9MH 3BE1H 1IUZA 1JXKA 1WZLA 2W88A 3MYJA 1KBGH 5I1AA 1NIEA 2PNDA 3CSBA 2ED8A 4ZUUB 4M02A 3EYVA 4YFLF 5T1JA 3FONA 1JGUH 2HZHA 4AE0A 4XB3A 3KZ8A 3IFNH 1II4E 1MUJB 5BRZD 5T5NF 5B22A 2CRMA 2YAFA 1VKXB 4MDJA 8FABB 1QUPA 2WBJB 3FUKA 3FF7A 1O5DT 2NT0A 4X9YA 2HJKB 1MVUA 2VZSA 4PR5A 1U8HA 2GK0B 4JDVB 1TVHA 3ZDYB 2VUOA 5D93B 5LKNA 4AMWA 5KG9A 4A2FA 1EERB 2X9ZA 3HE6A 3WFEL 3SY0A 1AZVA 2XY1A 3VFVA 3DUSA 1PZAA 1I3GH 2UZYA 2AP2A 3GUFA 3GJEA 4C58B 2FEDC 5ICYB 3P4OA 5F88A 1ZOXA 3Q1SL 3BZ4B 3L5XL 4Q9RH 3ZE1F 2K78A 5C0ND 5HD8C 3IMBA 5DZ9A 3EOTH 5FOJA 2ED7A 1MG2C 4CC4C 5JPMA 3BT2L 4PW4A 3G5XB 1USQA 3BUDA 3SKOB 2DQMA 2I25N 4H0HB 3IU3B 4RGND 3SO3C 1U8PA 3EZJB 3FRPG 4HBQA 2F5BH 3MRIB 4OLXH 5HI3C 5IWLC 1E3XA 4IBYA 2GSIA 2RH0A 1MPAH 1MXGA 5CM1A 1YPZB 4U2ZA 5FUZH 4AKPA 1UHVA 1X7QA 4NB7A 3KNBB 2XOTA 2NOYA 3FRUB 1AOZA 5TF1L 4OGXH 4RIRB 4DGYH 3L4XA 3BPNB 2VERN 1MN4A 5HGAA 5F3BA 3TF4A 4HUXB 4WIQA 3KHQA 4D2NA 3SB3A 4BRVA 3QORB 4XZUB 2AITA 3L3GB 3KPPB 3P4MB 1I85A 4GNKB 4Q6KA 1EGJA 2BCMA 2PCXA 3GINA 5LBVA 4XMTA 1L9PA 1O9ZA 4YLCA 5KYYB 1KC5L 3X12B 4JHAL 5J1AB 3T8XA 2CXKA 3T3PB 1L9RA 2WTRB 3ZE2E 5IOPA 2VL5A 3TIEA 4E42A 3U6RA 4IEFA 5EEVA 1EFXB 2OV0A 3QUZA 1AD0A 1KIQA 1LMIA 1WO2A 3HA0A 4LCUB 4J8RB 2FYYB 2V5YA 4LQ1A 2CJSA 1E8WA 3T3ME 2ICES 2OTWB 1BBDH 2CA4A 1QO3B 5E95B 2OL3H 1FNSH 1PJ9A 4JFDB 4PJDE 2MEJB 5EUKB 4I18C 1U36A 4OT1H 5CZVH 3SOTA 3VXME 1JPST 2VDOB 4H20H 3J2PA 5MENB 1BOYA 4JHWL 2XWZA 1EO8L 3KL0A 4BD4A 1PJWA 1RZGB 3KCWA 4X7SL 4M3KB 2IPTH 4ONOA 2DQIL 3EYQC 4BK5A 3C5ZC 1QRNA 3IF1A 4GSUA 1ZT1B 1AQMA 2H45A 3ARSA 3MACH 4GFXA 4HWBH 3MLZH 4P5TC 4P23C 3JT2A 2VLKA 5CUSL 2A9ML 4MDIA 4OLVH 3GRGA 4M7ZC 4A7VA 3SKNA 3ZHLA 4LLYA 1T1YA 2CJUL 2Z8VC 3K2KA 3M1BB 4K15A 1JGUL 3VWKD 3IVKB 1N0XL 3IPFA 3H6JA 3QB7C 1F1DA 4YSOA 3SY6A 5HVHC 3TBVB 5C2BH 3EFDH 1P2CB 1JWSB 2NY1C 1UVQB 3H9YA 3K5RA 5ICXA 4M9PA 3WE6B 5KW9H 3AWEA 4DPCX 32C2B 3U9PL 4DTGH 2VAAB 4O02B 3K8KA 5E8EA 3S2AA 4WW1B 1DBMH 1RZ7H 4NQEB 4FA6A 5C1MB 3KJ6L 2IFFH 1ITBB 1CTOA 3FCGA 2XZCL 4LCWD 5GS2D 1YQ2A 4EOWL 5KVDL 4WK4B 4Y16A 2IOMA 2DJ4A 3EGSB 2AEQH 1DQML 3NCYP 4NBZB 4PJHB 3FQ2A 3DPBA 3UTTE 1R75A 1RUAL 3IN0A 5HHXL 3WIAA 5DWPA 4GKSB 4HK0B 1AJ7L 4LDCA 3I2CL 2DKSA 4S1DC 3UPRA 3CDZA 4Y5VC 2QPFA 5CJXA 5F7UA 1B0RB 4XCEA 1NFAA 3IJSA 2VDLH 4OIFA 3BPCA 3N04A 1NOLA 1RULL 4H26A 4KI5C 3MFFA 2PLTA 1GKEA 3RURA 2PP7A 4NKIH 5LBSL 1SOQA 5DRXA 4WEUD 2UYLB 3QI9C 3K6DA 5BW7C 2OMXA 4Z6AT 2DQUH 3O3BA 5JR1H 1KWKA 1U8OB 2PP8A 3CDYA 4UYPA 3BJLA 4UV4H 4LVHB 4N5UA 2PTTB 4HJJH 1JK9A 3AQDA 5B1JA 1RZKC 1JNJA 3PJLA 1BD2B 1WBXB 2CSPA 1F4HA 4M7LH 3FO2B 2ATPA 4Q9BA 3ML9A 2OXGA 4FABL 4HX1A 5C6PB 3WNMA 5DUMH 5AD0B 2YAMA 3RGVA 5E00B 2R15A 4GO9A 3CFUA 4KO6A 3ULSB 2MNJB 3MLUH 3O3EB 4I1RA 1E5ZA 1BVOA 4F7TB 2FD6H 3I6SA 4GG8B 4DZBA 4Z7OE 4WTWA 3TBVA 3X1EA 4TQEH 4K07A 1KGCE 4A7GF 4YDNA 1R3HA 3OMAB 5GXBB 1GZHA 1NGZB 2WINA 2DLFH 4XWGL 4LLYB 4A6YL 4DPRA 5MEQA 4WGKA 1KXVC 5C0RL 5E6ID 4U7MA 4B9FA 3P4LA 4WNQA 1K5WA 1XX9C 3T04D 3L1FA 4YBHA 2D03H 1Q0YH 1VGEH 3AQYA 4TUOA 5KYUB 4L1TA 5E1QA 3IF1B 1KG0A 3VB9A 1MEXL 1NA8A 1UEMA 3TEXA 2HRPH 1X9UA 1ZANH 3APMA 4J3WA 3QEQA 5ID0A 1PKQE 5DVNA 4LIQH 4DOHE 3BVDB 1LMKA 4HLZH 5CZXD 4HJSA 3MLXL 1PIFA 1MFDL 1BIIA 4MAZA 4HV8A 2F8XC 4WSJA 5E6UB 5D2LE 5AKRA 3RUGE 1LO2L 3NJKA 5JPNC 1DQTA 5I6MA 2ZOLA 1UJTA 4AV5A 1HAWA 1OV8A 3KD4A 5I66A 3AS3A 1GA2A 1OCCB 3UABA 3BH8B 4TPRH 5L4IA 3DBXB 5AOLA 3F84A 4FNTA 4P9ML 3HI5H 3B1UA 1KTJA 1YYLH 1JK9B 4YVUA 1K3ZA 2X70A 4EDWH 1IGFL 1EEQA 5DJDA 2RD0A 1RUKL 1JD9A 4PRAB 4WFFE 3RIAF 3VFNA 1C8PA 4B0MM 2PF6A 1FVCA 3EJTA 3QS2A 3NJGA 4HIXH 3V6BR 5CHNB 3H9SB 3RUGA 4PJ9B 2VWEC 4PJDF 4Y4FB 2ENSA 1MI5E 2CAKA 2IALA 5PAZA 5JMRA 1G7QB 3GS4A 2QLYA 3EFFB 3QUKA 1OAXH 4RRPA 3KLLA 4TOYH 1FH2A 5JW4M 5TFSL 4G8IA 1Z0NA 4TNWK 4XO3A 3L8QA 5IMMB 3BN9C 43CAA 5CCGE 3FC8A 2VLJE 4AJWA 5HHPA 2QDVA 1BYOA 2BHFA 2WWKT 3NZ8A 5CWSA 3FTVA 5GS0C 4I0PB 3EGSA 4F80A 1WT5A 5JHLL 3FK3A 4EDXB 2GITB 4KUZH 1DSFH 2EEFA 2KBGA 2YGPA 1HXKA 3II2A 2WLHA 4L4TD 1KPUA 2GT9B 4QRQB 3H9SE 1MCLA 1JVLA 4PYHA 1VZHA 2B4CL 2FSDA 2ZXWB 2R2EA 4YDLC 3HI1A 1THAA 3VO0A 2XI9A 4LLMB 2G60L 5JQ6L 3DETC 4U4BA 4GRLC 3TEUA 3GIZH 3HG0A 4OTXH 5CGTA 2OI9B 5E5MA 4HLEA 4M93B 1ECYA 3VG9C 4TSAH 2QGCA 2RFXB 5F0JB 5IMOA 1TITA 4AYMC 4DGVH 5EO9A 4X6DA 1CGSL 1KYUA 3MV01 4JZOB 3TJEH 4P8QA 4AEIL 5FDWB 4BSWA 1QAWA 1XDTT 1ZT1A 3PP4H 5F9WC 3S88H 3EYFA 1MWOA 4JFHD 2F58L 2JKNA 4OGYL 2NRDA 1QPPA 5IVXA 3WNNA 4MDJB 1NEUA 2L4OA 5INCA 5EDSA 2Y25A 2KYIA 2ZXQA 3QE5A 1JBJA 1HZHL 5D5MF 1VPOL 2D0HA 2OW7A 2C9RA 4A67A 4M7ZB 3PL6B 1MJ8H 4MB4A 5ACZB 1FNEA 5FYJL 3VGFA 4FD0A 3GMQB 4XB8A 1OAYL 3HZ3A 4FXLA 1XGPB 1B4RA 1TFHA 1N3NB 3BCDA 4POUB 1TDQA 2H0EA 3MRCA 3WG7B 3UBGA 3DARA 4JFXB 4U1GC 1U2HA 2PO6A 1PEZA 3PWPB 4Q6IB 1AD0B 1KIQB 1XXDC 4L8BB 1HNFA 3VFOB 4XCEB 1THCA 2VL5B 2FNWA 5CS7A 1DBML 1RZ7L 4PGEB 1L5GB 2XN0A 4NQCB 1IGIH 1S5HA 3LKPB 5I75B 3SQRA 3FQRA 1KXQE 4IMLB 2D9CA 3PAYA 1LEKB 4XI5C 1IM3D 3LPPA 2VW7A 1U30A 4PRIB 1Y7VA 4K23L 2GTQA 4MNGA 2JKSA 5D70H 3VD4A 2R0WH 2R2HB 3VW3H 2DIEA 1VPOH 3MRDA 3NCWA 3JUYA 5I1CL 1QRKA 4PWIA 1MJ8L 3PGCA 4N0UA 1FQ9C 4FI7A 3DX9A 1XGQB 4Z7AA 1FZJB 1R19A 1WTGT 2HH0H 3DX3A 1WRFA 2FO4A 3T4AA 4O2CB 2CDEB 1SVBA 1RLBA 2DQIH 1G4RA 4U33A 4KKBC 3RB5A 2Y1VA 3O6FC 3VWKC 4KJQD 2XWDA 1FO0B 2O1AA 2H3XC 5H8DA 3CQPA 5IQ9B 5JUEL 3LOWA 4HZAA 1F11B 3PGFH 3WEAA 1V55B 4RMRA 1XZ0A 2CD0A 2RQEA 1PY4A 1IZJA 3R19A 2UY7B 1LE9B 2ODHA 1D5BB 2L8AA 3BKJH 3DVNA 4UI2A 5ETUA 2WO4A 2GJPA 1L4IA 4WJ5A 3QRLA 1N4XH 3Q2NA 3RG1C 1NDGA 1ZA6A 3GBEA 3P54A 2CHWA 3VRLF 3VXUB 3QH3B 4KHTH 2ZAGA 2EE6A 1J0HA 4NZDA 1OQOA 2DS4A 2XVGA 4WK2B 3W0WE 3NIGF 5IQNA 3OAZH 1LK2A 5TE4L 2YGVA 2ZUXA 4RNRA 3DUSB 4ELMA 5A2JH 5FM5M 2RCSH