3AADB

Structure of the histone chaperone cia/asf1-double bromodomain complex linking histone modifications and site-specific histone eviction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
153
structure length
153
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the histone chaperone CIA/ASF1-double bromodomain complex linking histone modifications and site-specific histone eviction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/chaperone
molecule keywords Transcription initiation factor TFIID subunit 1
total genus 21
structure length 153
sequence length 153
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 3aadB00
2I32A 2IO5A 2Z3FA 2Z34A 2HUEA 1WG3A 4RRPM 2DZEA 3AADB 5BNXD 4EO5A 2CU9A 5C3IA 4ZBJA 5EIIG 1TEYA 2IDCA 5BO0D 2IIJA 1ROCA 2YGVA
chains in the Genus database with same CATH superfamily
1FH5H 2DI7A 2BWQA 2EDDA 1H8NA 5CHNB 1NCHA 1DLFH 3T2LA 1FYTB 1QKZL 4TTGA 4PRIB 3DYOA 5DFVD 3QP3A 2DQTH 3JWDH 3MRPA 2B14A 5EUOB 2XKSA 1PG7H 2YGPA 5AW5B 2AQQA 4FL4B 4I9WE 3JVGC 3WNIA 3DO7B 1IQWH 4TQPA 3V0IA 4J3TA 3FW6A 3ZDYE 2IQAA 4HBQA 3RNQB 4Z0XA 3FN0H 2YARA 1RK1A 3BXNB 3PS6A 2C3VA 1TFHA 3LYRA 4XHQA 3BPCA 2YLHA 2NXYB 2O6CA 4W9GC 5E6SB 3D69A 4KKAD 1FIGH 1ZEAL 2A1WH 3RQ3A 5AAPA 3H9ZA 2FT8A 2MTPA 4FI6A 2NDGA 4NO3A 4PLOB 3QUXD 3CFQA 1YHPA 1BVOA 5DK3A 4Y5YB 5J6GA 1EHLL 2EXWD 4LE8A 4LPWA 1CGTA 3VB8A 4A39A 5DSCB 5JMRA 1B2YA 4HS8L 1DE4B 3GZQA 4FD0A 1F58H 5L2KB 1IKNA 2VXSH 4EUPH 1XZ0B 1JNNL 1OCRB 1EZUA 1I53A 1BD2B 1T20A 2H1LM 3NEEA 4OAWA 4YDKH 2GCYB 3MOAH 1AD9A 3H3PL 2J1WA 3UG4A 3ATBA 5DD3H 3SKUD 3BPOC 1CD9B 2WINB 2VM9A 3C5XA 2ZPKL 2ZKMX 5FM5O 1TVHB 2HFTA 3PFUA 2WVVA 3QWOA 4KRLB 3O6FC 1IKFH 1AGCB 1T5XB 1TEFA 3JXAA 1T03H 2H0EA 3JV6B 5T1DL 2Q76A 2VDOB 4H2CA 4HLZG 3R19A 3ZR5A 3G6DL 1BVKB 1R3IH 2HJFB 3CCHA 3K0YA 3IRPX 3Q44A 1MELA 4B9PA 1A4CA 1MFEL 2FWLB 3T0EB 2Y9RT 3IS0X 2GUYA 3ZMNA 4ZMAT 3AM8C 4HWBH 1KT2A 1TQVA 2AJSH 3HE7C 3OKYA 3HRZA 4PYHA 4Q9RL 1BXVA 4XVTL 3SE3A 4M7ZC 3U1QA 1JPGA 1V54B 1Y6NR 4OV5B 4JFQB 2WCPA 5CP3H 1JHKL 4NI6A 4N2MA 5HHQB 4BQ8A 2VABA 3IKKA 3OR7A 2XKNB 1VEPA 1U8HA 1JZDC 1YN6B 2IOMA 3OXSA 1DBMH 4N2AA 1JNNH 3GI9H 1CBVH 3PNWA 1NFDE 5IFHH 4HIQA 4ZFGH 5T3XH 4HS8H 2J5LC 1ZE3H 4QHNB 3NTCL 2VR6A 4I88A 5AVQB 2JJUA 3CNKA 2HKFL 1D5IL 5GZND 1YVLA 1Y1DA 4XNZB 1QLEH 5I30H 1X7SA 2A1WL 5LQBH 4NKMA 1VKXA 3VRLE 5JHLL 4XXWA 3JWOC 3D85D 3PP4L 1T1YA 1RVFL 1NH6A 2VDML 1I1AD 1PFCA 4WKZB 5CN2A 4QXGL 5IB1B 1FHGA 4IRJA 3NSYA 4GQQA 1T0NB 4PRNB 1FNSL 3FB8A 4OZHA 5F93C 4A67A 4C4KT 1VB9A 3T8XA 3KPOB 2VQUA 1E4XL 3R1GL 4LSDA 2OYKA 3GC3A 4Y4KC 3QI9A 1YUHA 2XU9A 3HMXH 5T5NG 1M6OB 4FI8A 5DO2D 5C0BE 4KY2A 2RB8A 1OT4A 5AVVB 1DFBL 1PZAA 3IN2A 5DMKA 2RA1A 2EEFA 3VI3F 3G6JA 3GSQB 5DZNA 4YDLC 5D6DC 3CBRA 1PNDA 1A3RH 4OIFA 1YDPB 4IGBA 4R9HA 1KNOA 1ET5A 3C09B 4P3CH 4ZNCD 5JW4R 1LO3H 3L5XL 3QUYA 4NRZB 2IAND 2DQFB 5GRXG 4K7PY 1T7VA 5AZ2H 2BOBB 5H4YA 4F9PC 2IO5A 3OAZH 1VEOA 4GNKB 3SOBH 4AGMA 1QZ1A 4UWQB 4Z1PA 1JL8A 3NIFF 1T21A 2OYMA 3QJTB 5EEVA 4BFNA 4DK3A 4KZEL 3X12A 5MENE 3FSWA 5IMOB 2IBBA 3CCHB 4LGRB 3T6ZA 3RWIB 1GAFH 4ZS6D 4U05A 3ZZSA 5C2UB 3K6NA 3PGDB 2KPNA 3C60A 2TRYA 3RUGA 2PXYB 4LDOB 5GRUH 4NNYA 3LJ3A 3GZOA 4Z7WE 4JPKL 4D0CA 5EU6D 3SQRA 4ONFL 1YEHH 4UT9L 1CQYA 3P4NB 4YSUA 4B0MM 2IPUK 2NNCA 2V5SA 1QEWB 2GCYA 2LAAA 4OUUB 4R3SB 3DX2A 2NY0D 3PDOB 4I3SL 3NIFB 1TZAA 4IRSC 2PO6D 2XA3A 5DRNA 3RVVC 5I0YA 1UD3A 3NDZE 4PV8B 5TH2A 1QNZL 4KROC 2FH8A 2OTUB 3F5WA 2NZIA 3JV4B 3IM1A 4FGMA 4LF3B 5DR5H 2EE0A 2W07B 2DQIH 4JRXE 4MMYA 2ZG2A 1KF9B 3BO8A 4B95C 4HV8B 4IQHA 1FRGH 4KVPA 3ZE2B 1VGEH 4N3UA 5D5MA 5FV2A 1AQKL 4ANUA 3QHFH 2IBZX 4FKEA 2H2SC 5IEHA 1UKQA 4DKFL 4J3OH 3FT9A 1AZVA 3LEYL 3IGLA 1JPGB 3OKNB 3AQZA 3ABGA 4Y0GA 5ADOL 2R0ZH 4RLDA 1A9VA 2EDXA 5FYKE 3IDYB 4L1SA 4NPKA 3O9WC 3EJTA 3ARYA 1J8HB 1JHLH 4F57H 4GAGL 2FNBA 1ZT7B 3NCXA 3SDAD 1R47A 2WWKT 3U7AA 2EYTA 4Y4HD 1HQ4A 2CLVA 3H2PA 1DSYA 4WEMB 5JQ6L 3FFCD 3IJHA 4X6CF 4G5ZL 2ZUXA 2PN5A 2X44D 2OKMA 1K5NB 4PS7A 1XF2B 1N7ML 1HN1A 1Z9MA 1I7ZB 4GKLA 2FLBT 5EZIH 4ODVH 3FTYA 5ICXA 4RGMB 2J21A 4YIQA 4KAQL 4NQVA 2VB5A 3FUNA 4PGEA 2VMCA 2K8MA 4YL4A 4CJ1A 1KJ2H 2AGJH 5TE6H 3V9FA 5ITBH 4OFYA 1NFDF 3WS6C 4HDIA 5IVNA 1XWVA 4KMTH 2X6CA 4IIQC 1BQHG 2YKLL 4NN6C 5E4EC 1NPJA 2V8LA 4NWUL 1YUKB 4GMSH 1JGDA 1RAMA 3NIFE 5D1XE 1FNEA 1NCCL 4CRPA 4TUKL 2BWDA 4AMKH 1EUUA 3VFNA 4CUCA 3N9GL 4PH8A 5G5DA 1LO0L 5M7QA 2VC2B 3OB0H 1MW1A 1CI3M 4IJ3C 4YX2H 5F1KC 3MKGA 4Y1AE 4AQEA 1YMMA 5JIPA 4LVNB 4LNVA 3ULVC 1HHIB 4I18B 1SJEB 2EADA 1OB1B 4MA1C 1MCEA 4ZOBA 7PCYA 2WVTA 3QUMH 4GG6E 2VDOH 4QAWA 1U41A 2DWTA 5EORL 2DQUH 2Z1KA 2NY5H 2X89D 1YNTB 4ZX6A 4PTTA 1S2EA 3O4OC 3SE8H 3DTXB 4IGBD 5AL0A 1OPGH 3CN4A 3DV6A 1KYUA 3CDFA 3SGDH 4DKEL 2DQCL 3FQWA 3GYRA 3NIDF 4D3CL 5GHWL 5FDYA 4C59B 3M1BA 4NZFA 1G7MA 1HU8A 1P84K 2J6EL 2QADD 4HKBA 4JQIL 4M43H 5AW4B 2XZAL 3MXWH 2OTUA 3ZYJA 1F3DH 4MNGE 3MJ9A 3QEGL 1U8JA 2JB6A 3ALXA 2CGZA 2Z31A 4J27A 5D1ZC 4U1LB 4TOYL 5EZOL 1DEEA 2CCLA 3SKNB 4QRUA 1JOIA 2DL9A 2YA0A 4FRWA 3O3EB 4FTVE 4HJUA 3NT0A 2XWJA 5IMLB 4M8UA 1OTSC 4OQ1A 1E6OL 4AW7A 3ZHDA 3TA3B 2X38A 1RJZA 4OLUH 4G9FB 2G3XA 2J6EH 1KMGA 5MP6L 2BW5A 4YDNA 3UOAB 4AUJA 2W0PA 5DMIH 1IAIH 4N5UA 5JA9A 3S37H 1ETB1 3PV6A 4P4RB 1E4KC 3E9TA 4M1GH 3SE8L 2Q3ZA 4WTQA 4O00A 4ABQA 5I1IL 2C3HA 1YG9A 4XB7A 2CRIA 4HIIA 3AS2A 5E99L 1QYGH 4FNQA 4I0PC 5EUKB 1R9FA 3VH8A 4HU8A 4AEIH 1QA9B 2F18A 4PLJC 1LL1A 4XN5A 3VGDA 4CMHC 3LHPH 3MCLL 1UEMA 5E94B 5HHOD 3PAYA 2JLPA 2W88A 3E0GA 4LLQB 3QGVA 5F7BA 3SE3C 2NOYA 3U7WH 5C3TA 3A4EA 4AMKL 4U4BA 1DVXA 2ADGB 4PREB 2R0KH 2Z8WC 5CCHE 4D0BA 4HOXA 1DLHB 2E4FA 3VI3E 1S9KC 2BP0B 1C16B 2AQTA 4XVUD 2DLHA 3K7UA 3BH4A 1UTDA 1KJ2L 2CGYA 4PJ8D 2Y3AA 4OFDA 5A2BA 5I5JA 3UIYA 4JY6B 3WOVA 5AG9A 1KLFA 4C56E 2A6IB 2JJSC 3OAWA 1NFIA 4FXKC 2BVEA 5TE7L 4NP4H 4A6YL 4J3SA 4KX8A 5EEYA 5AAMC 1W2KT 4PY7A 4YHOH 1PFOA 1LJMA 2DDQH 2KPWA 4NN7C 2ZUTA 1IJ9A 4P5TB 3L7EB 2Z91A 4A6YH 4BDVA 3PDDA 5F9JA 3GXMA 3QIWC 4M7JL 5FLUA 4GLRI 2GI7A 5JR1H 1BQHB 4UTBA 1OLLA 1HINL 4G9FD 1OP5K 3M07A 5FIEA 4U6HB 2JQAA 3MO1B 1CZ8L 4DERA 3L3OC 2OI9B 4P5SA 4HJJL 3U0PB 1ZGLM 1N64H 3NAAL 3AQYA 1DP0A 3US1A 2XWTB 3EYUL 3BH9A 3N1PC 5CJ8A 5HYFA 3BSGA 3MMEB 4X83A 1CGWA 4LSTL 4KKZA 4WW2F 4B6ZA 5K69A 4B0MB 1DEDA 4HGMA 3QXAA 1DEEB 3ES6B 2G4GA 4UT7L 3WFBH 4Z3GA 4PGBB 5B21A 4IHBA 4HKXB 4RDBA 2X4TA 3PWVB 4X8JB 3ULSB 1GPOH 4YUEH 1EWHA 3CIQA 4GEIA 4KU1A 1K3IA 3OX8B 3BQUC 1QYGL 4G42A 2Q7YA 2OS7A 4HJEA 1CTMA 5CJ5A 1JXDA 1OF2B 1SLWA 2BNRE 3LZRA 3S3PA 1KYDA 2CALA 1LWJA 1MVFA 1PX3A 3WNMA 1A5FL 1E0OB 2Z35B 5MP6H 1CR9H 1P5UB 2DMCA 4HIJA 1TZHA 4PJFA 4KX9A 3H3KA 3CVIH 5E51A 5H37A 4MQSB 1Q0XH 4R90H 4A7QA 5I76A 3TF7C 5EV7A 2OMTA 3QJHA 5KSAD 5KYWB 5ESVA 4JPKH 4JO8A 3QZOA 3BZEB 2FBRA 4UU9A 1LEGB 3HZVA 3FQRB 5E6UB 5GRWA 3WHXA 4RMRA 4JM2C 2P80A 1EBPA 4AV5A 2X4NA 3IDMB 1VA9A 1M2VA 4YHZL 5MEQB 4DF9A 1QUPA 4JHWH 4WVRA 1O7VA 5B1AB 4HG4J 1NICA 2KUTA 2XJKA 4D3CH 4F1ZA 3IXAA 4JFDA 3S34H 3TEXA 4HA1A 2B1AL 3P9LA 4ZO9A 4LLYB 1KDIA 1NPNA 1RZ7H 2FL5A 5BV7H 1CIUA 5EWIH 4MDRA 2E4TA 3NESA 5IESH 2AXJA 2PPEA 3OF6A 1QHOA 3SDXA 4JY5L 1ZSDB 1IB5A 3NACH 4K5NA 1V7ML 1XFPA 2KERA 4TQIA 5I0DA 3QNFA 2ZUWA 2P8PB 4AX3A 3B1TA 2E8YA 1IBGL 4HIIB 4ZMTA 1L7IH 1G0DA 2C9QA 2L4OA 3PWJB 1GRWA 2OMUA 4ETQA 2VN4A 4TUUA 2L7EA 1UFGA 1MHCB 1ZJBA 3FFCE 1N8ZA 2H2SD 3QNYB 5FHBL 2I9TA 5HPMB 1NA8A 5EU5B 4XC1H 5LGJB 1LO2L 3X2QB 5D1ZI 1PEWA 2R2EA 4MBRA 3T2NL 5A2LH 5HI5C 3LZFL 4GW5B 5C97A 2CCWA 4B9CA 1QLFB 4XAWL 5BZDB 1TCMA 3K6SB 2FBJL 4JG0L 4C83A 1A7BA 2GIMA 2N1KA 2NT0A 3AGVA 1YYML 3NCMA 3F12B 1OAKL 3FUIA 4OJEH 3TVMA 2YSSB 3PP4H 1HQRA 2IGFH 2A99A 1NIAA 3CPUA 4IRSD 4LEOB 3RWEA 4U0QB 2Z93A 1J88A 5HYSB 5EO0B 1XZWA 3JUYA 4JJHA 4ZUUB 3FYEB 2HT3C 4PRDA 3VSVA 1YA5A 4ZW8A 3A21A 4JFYB 1NFDA 1XIWA 2EUWA 3R4DA 5KYNA 1KGXA 3ZDZB 2QVMA 1G9NH 3DRQB 1BAWA 3GUFA 2M1KA 2ZONA 3GSOA 1USZA 3CWGA 2F1EA 4HUMB 1IC5L 3UZQA 5I28A 1R5IA 1UM6L 2ZP9A 4BRVA 1HC1A 2AHIA 3DROA 3EKCA 1HILB 5FUCE 1XGYH 4W9FC 1LP9F 3ME0A 3WHE0 4M9OA 1VGEL 4N1CA 4NQDE 5GGUB 1N0LB 2A83A 2BM3A 4GO6B 4DQOH 5LGKA 4BHUI 4FP8H 1NJ9A 3MAWA 1MFEH 2EDWA 1HESA 2K4AA 3P9MB 1B6DA 4PJHF 3P3UA 5FGBA 4KK8C 1G5GA 4OF0A 4Q8BA 5MEQA 1I9RH 3UJIH 4BXVA 1QNZH 3UBXI 3OKDA 5LDSA 1T03L 3QRFM 2PTUA 5E9DB 3ASNB 3BE1H 5EDSA 5J9PA 1TMCB 1Z7JA 1B0GB 1F97A 1NOLA 1EJ8A 2XQBL 4ZOAA 4UAOC 1L3NA 3KAAA 1OO2A 3QDJA 3LRLA 3F7KA 4QAMB 1HNFA 2YHGA 3GLZA 3GSNH 4UV7L 3IU3A 2WOYA 3VH8G 1WBXB 5FS5A 5D7IB 3U79A 1JPSL 3KG5A 3V95A 3FN3A 5F8QC 4A2MA 1PMYA 3T71A 1YEHL 2VYRE 1W0VB 3WXWH 2C3VB 3FPYA 1E4XI 5EU7C 2R1YA 3DVGA 5FUOL 5AZEH 1HK6A 4ZUTA 4OLVL 1ICTA 3LS5H 5B7MA 4DKDC 2W59A 4MS8D 3VXQA 2DJMA 1ZKAA 1CFVL 1MXDA 2WMPA 3IDGA 4K5MA 4G6AD 2YGNA 2IADB 2ZCHL 1IAIM 1NGXA 4P2RB 5FCUH 1ZT4A 2BDNL 5JPMB 1F4WL 4CC4A 1FIGL 1ZEAH 1TJIH 3SO3B 2BO0A 3V5DA 5IT2H 1J9CT 1RUPL 1ZHLB 3UGUA 4JREB 3RAJL 5HHOA 1S3RA 5D5MB 4AQ8C 5KVEH 1FI8C 1ZANL 2G5BA 1EGJL 1MFBL 2I5YH 4PJ7A 5IQMA 3ROOA 3VM5A 5GZNC 3ULUH 1GGYA 1P9MC 4QHLA 4KVNH 2O6DA 4LFHG 2VXQH 4J3BA 3SCMB 2OJEB 3MDJA 4S0TD 3M1BB 1EQWA 4XNXH 2Y06H 1JVLA 1UGNA 3EDDA 1KYOJ 5SWSE 2CKBA 3L3DA 4HFWA 5L9DH 1JRHH 4R26L 5AW8B 3I85A 4OGXH 1GJUA 1NMAL 4OJAA 3J8F7 4MRBA 3C5JA 1NMAH 3DGDA 4Z7UA 4CNIA 5JW3L 3ULVL 1DVFD 4G3YH 3JTSA 4U33A 3NFNB 3Q2CA 4N90E 4YDLB 1GOHA 4XH2B 4XVUC 1Q0EA 3FBKA 4TNFA 3EOYG 3IGAA 1FLTX 3RWJA 2MNWA 1RV6X 4J7RA 2R69H 1ZS8A 5LGJA 3B3BA 1OAXL 5J12B 4WFFE 3JWDC 2EDHA 3MACH 2A74C 4ZPVA 4ERSH 1Q1JH 1CXEA 1DJZA 5F6HI 3E80A 5E2WL 2YN3A 1RUKL 2O5ZL 3FPXA 4GQ9H 2OXHB 5T1KB 5IP4A 2W95A 4GT0A 1QBBA 2EVJA 2MCPH 2ZCHH 4OZIF 3JV0A 4QNPF 2YFNA 1CG9B 1PZUB 1O5PA 3AWEA 3Q06A 3CIAA 5C07A 3ZYZA 3D06A 3F7QA 1RUMH 1WFTA 3UC2A 4E41D 3O41A 4HH9B 4B27A 1AHKA 1S7XB 3MRQB 4Y1AB 1QBAA 5F0JB 5TGBB 3KLQA 3MFGB 1KTDB 2VE6B 3WXWL 4J6RL 5J6HA 5EZLB 4AIZB 1MHPH 1UJTA 1MCDA 2JTYA 4NRZA 3TBSB 4X7TB 3JQOB 1P0SE 2E75C 2ZOKA 5D7JB 3NIDE 4LMQE 3EFDH 3VFPA 3KBEA 4XP5H 3W82A 3TO4B 1EJOL 4EI5A 2ZE0A 4PRPB 2X4PA 3JSSA 3KXFE 4NN5B 4R2GC 4W93A 3G6DH 2OP4L 3CFNA 3FB8B 4OZHB 1IILE 3X3FL 2COVD 2YA2A 1CBJA 4P5TA 5SV4A 2E7LC 3NSJA 3SKNA 1GXEA 3ASOB 3BFOA 5HHOB 3IPFA 3M17A 2A38A 3C87A 1MRFL 2BFVL 4FN0A 1NGZB 1F42A 2YBGA 2BRQA 5ID1B 3DX1A 1XH2A 3H3PH 3MRBA 2W65B 3VGGA 2VUYA 3ULVD 3HCVA 5DRNB 2CBTA 3WTYA 1F58L 2E59A 4IJTA 4LDCA 2DBLH 4AIZA 2JB5L 2LTQB 3K2MC 3U82B 2V33A 4WW1B 1I8IA 1NFAA 3U83A 4KJYA 1U4FA 5D8JL 5BVJB 5I19L 2JF1A 2D2CC 2VXUL 4QT5B 4ZMQA 1HL8A 3G08B 2B15A 2ZKXA 3DX6B 3NA9H 3GMMA 4LSUH 4MDJB 3ZQWA 2OYPA 1KEGH 3TA3C 4NCC1 1UACH 1BD2A 1AG6A 3KPSB 4U7KA 4XWOD 3OXRB 3QH3B 5K9QG 4JFZH 1WFIA 4DVRH 1G84A 4MVBD 3FRUA 3LZFH 1FFNB 5A1AA 3ABLB 3HI1A 1ROCA 1FJ1B 2CE6A 3V4VL 2EO9A 1FYHB 1XEDA 5C0NC 4HWNA 4G8FB 1I3RB 2AEPL 5T3ZL 2YD3A 2ZUUA 1B9ZA 2L8AA 4I4WB 1NFIB 4FG2A 4YFEA 3ORJA 3HRZC 3V0WH 4JQIA 4BEIA 3DNKA 1ILUA 1CFTA 1IBGH 3O9WD 2CPUA 2XN9A 3JTSB 4Y4HB 1J8HE 3TA4D 3UMTA 3MLWL 3WV0A 4XMKL 4I18C 3QEHB 2VDRB 4FNRA 2B77A 3EO9L 4YC2C 5FB8A 3GBLA 5EPMA 5IIEA 3C5ZC 2WIIB 4HUUA 4WK2B 5FYKD 5A7EA 4QOKA 2VRAA 4IMKA 2BSEA 3G9AB 5FHAH 3O8XC 3AGWA 1JGLL 5TDOA 2XTJB 3Q7JA 5CZVH 5ITFB 3WN5B 3Q8AA 2OMXB 1OGPA 2C7FA 2Y1ZA 3MGAA 3E2HB 1NUFA 1HXMA 5CZRA 3WLWC 3NCCB 4XWGH 1URZA 4QDGA 2VTFA 1N6QL 3T3PB 3WGVB 1U21A 1QPPA 3FF8A 2YRZA 2FHFA 2WV3A 2XNAA 3GS7A 3TNNA 3VI4E 1N9PA 1JGEA 1YMMB 2MIZA 1AXTH 1VCAA 1COBA 1M7UA 1NPUA 3FHQA 1E8XA 2BVYA 1LWRA 1PZ5A 1UD5A 3THMH 4XBGA 2WLKA 1HFUA 3P0GB 1J48A 1XO8A 2R27A 3HJ0A 3U4AA 4NJAH 3S98A 3RDTB 3B9DA 5ACLA 4DP5X 3KM2A 5A2IH 4XMZA 3BN9C 1SQMA 3QB7C 4KTYA 2WBJB 1NOFA 4X7TA 3VDAA 1X3DA 4PQXA 2X5PA 4WI3A 2ZOKB 1JI2A 5G2NA 4Z3JA 3HI5L 3O45A 2JMRA 4DJMA 3IAPA 1CLZL 4S2SB 4WTZG 3BW9A 3ARVA 5E56A 2Z31B 3O11A 4FDWA 4GKNA 1WTLA 2FWUA 3KLDA 4HUUB 1ZHLA 3OD3A 1SYVB 3WMSA 1N3NB 4GSRA 4S1SL 3GQFA 2DMHA 5EG6C 3IKCB 1EAOA 1I3GH 2EH7H 1KT2B 1EEZA 5F3HA 3VWJD 2B3IA 2Z0BA 4K9EL 1AXTL 4DGYL 1C16A 1E6JH 4ODWB 1KYAA 2XTJD 4FFTA 4GSXA 5FA3A 1BZ7A 1TO4A 2XPZA 2YXMA 3G5XB 5DJ6A 2I69A 2XUWA 5ISZB 1HHIA 2DTML 2F0CA 1NUDA 4NRYB 3RL2A 5FHAL 2Z7WA 4G8FA 5I6XC 4S10A 2VDKL 1MHHB 2XDHA 4CADB 5JR1L 5E8PB 4FQ2H 1QEXA 4BQCA 5DJYA 4PJ5E 2CCVA 3LN4A 1KTLB 2PNDA 1F86A 4OLYH 2V2XB 3F01A 3T0EE 4HK0B 5JDSB 1S8DB 4NQDB 5B4MC 1ACZA 5T3ZE 1IBHA 4H7VA 1CN4A 4LF3A 1Y0LB 3G5VB 5CMAA 3GM0A 4MDJA 1N4XL 1JCKA 3O11B 4XN1A 3KXFA 1ZVSA 2AEPH 4JG9A 5T3ZH 4EUPB 1M9SA 2JXMB 4G72B 2FHCA 5CILL 4S1QL 3MXVH 2J5WA 3UJTL 4I0KA 1D5XB 1R3KA 2B16A 1Z5LB 3NH7L 3MRGA 4XNZC 4NUJB 2W0KA 2JI2A 4ODTH 1MEXH 4RCAA 3STLB 5KG9B 3LHPL 3US0A 2R1WA 4PEEA 3SGKC 3EXLA 5FLVA 1AVAA 4LCWB 2PCXA 4ZFOL 3HZKA 1TOXA 1YEEH 4PJEB 4W4OA 1SQ2N 3CDZB 1BG1A 2QVKA 1MW3A 4OB5L 3E6FA 5EEWA 3DVNA 3UDWC 2D9CA 2MJWA 1T0MA 1BZEA 1HL4A 1UASA 1PAZA 2A3TA 1RZIA 2IALA 4GKSA 5DMIL 4P04A 4R96A 2PYFA 2Y6SD 4F20A 5I6OA 3JT0A 2DBLL 5C09D 2XWTA 4FQJL 3B9KA 3A67L 5DJCB 3D2UB 2EP6A 1F4XL 1P7QB 1RHHB 1A4JA 2I7OA 1E6OH 3R18A 5T1MB 4U2YA 3GLEA 3ESVF 3UG5A 3MLZL 3IRZA 1GVIA 4FXLA 4PJ9D 4CSZA 4Y2OA 1DUYA 3RRQA 3X17A 4FXKA 1TQBC 3SDCA 4AL8H 5L2JA 5EIIB 4NQEA 5EZOH 2OSLA 3FUKA 5IB2B 1FYTE 2YAEA 4HJTA 5C0CD 3P9MA 2EKSA 4K3JH 5AZUA 1GYUA 1W91A 4TL5A 2F74A 2P8LA 2IXQA 3L3JA 4JRXA 3TEUA 4QHUA 5T5NF 3H3BC 3MGOB 4EOWL 4Q9CA 2AK4E 3K4AA 4RRPA 1EHXA 2CU9A 3P3RA 3MREB 2G2RB 4FQXC 3PG2A 2N7AA 1U92B 1KBWA 3U0WL 2BNRA 3DPDA 2VO5A 2Y4SA 4K7PH 2GAZB 2VLMD 3DX4A 3U9PL 1FL6A 5BQ7A 5IJKA 5CEYA 3EFDL 1U3HD 4F8TA 3FRPB 1AANA 2CRZA 3RWDA 1HWGB 3QUML 4JFFB 4YDJA 5L2KE 4OM1H 1IGTB 1IM9B 4GXFA 3CV5A 3S37X 2HFFA 4HHAA 4WI0A 3TN0A 5F7AA 5HHVH 1AGFA 3KNBB 3IJSB 4X4ZA 1Q9WA 2YQ3A 5TQ0H 3X13A 3WNPA 2X4TB 3PWVA 4J6RH 4NC2B 4CVUA 5DUPL 5ISZD 3BWUC 4QXUL 2RTTA 3D18A 1NCCH 2X89A 3GI8L 3DTUB 1M3JA 4XPHL 4NM8L 1M53A 1QSFD 1OB0A 5I2IA 3VXSE 1NLDL 3VM7A 1OAQH 2NR6C 1AE6L 2ERJB 4XBMA 3F12A 2MCPL 4AYEC 3B43A 1KGUA 2H6PA 4PRHB 4P2OC 3CN0A 1X6LA 3B6SA 3KM1A 3AACA 5D9SB 4LP5A 5A7BA 2XHNA 4LEBA 5E23A 1NCWL 3W3BA 1S7RA 1F11B 3FTGA 4HWZB 4NCC2 4NI3A 3Q05A 1S4IA 3FB7B 1NMCB 3MNVA 1E9OA 1QVOB 4GBXD 2FIKB 1I1CA 3UJJL 2OMNA 2B9AA 1E27B 5BXFA 5FUCC 2YPKB 1F3RB 1MCWW 2MQCA 3ZLQC 3D4CA 5J06A 4HK3J 3MNZB 9PCYA 5C08D 3ZO9A 3HB3C 4GAGH 5KSBB 1JHLL 1XAKA 4ZMVA 4Q56A 3CHSA 1UYWH 1XGPA 4WWKB 4NT6B 3QDGD 3V0FA 4B9IA 4H5SB 4NGHL 1Y18B 3NSDA 5ADOH 5INDB 1G7MB 1KIQA 3CG8A 3VI3A 1OTTD 2NXYC 4YBLC 1IUZA 3JVFC 5A3IC 5I6XB 2H2PC 3CX5J 1SXCA 1UVQB 4P57B 4KXAA 2QQQA 3SJVD 4BFRA 2H41A 2R1XB 4PG9A 4D0BB 4KVNL 4D7BA 4AMWA 5I1GH 1ZTXL 5B8CA 1CVRA 1KB9J 3ARFD 3A47A 5CCJA 3BAWA 4R0LC 3DMMC 2EEXA 1J1XL 4H8WH 2NSMA 1AZRA 3ABMB 2XZQH 4JKWA 4ZS7L 4KPHL 3TIDB 4AGOA 2DQEH 1CXLA 3QCTL 2MRYA 4MB4A 4F1SA 3EDJA 4DWHA 2XIBA 1D5MB 2F53B 2CKNA 3HAEA 4NX0A 3JBG7 5LCVH 3FCSA 2LLGA 3ARDD 3U6XS 4J3WA 5IROC 3SQOL 1MCBA 4E42B 2J1ZA 3QC6X 3FOMA 5DMYA 1EX0A 4OLVH 3DSNB 1RU9L 5LGYA 3U36B 2GVYA 2XY2A 4LFHD 1NCBH 1JMXA 3ZHNA 3GF8A 1KLUA 3O4LA 1W0YT 4XPFL 1JCVA 3KLKA 5DD1H 4BXSV 4DTGH 2EAEA 1E2ZA 4WW2A 3ME0B 3U2SA 4EAEA 1U42A 2BSBA 3FT3B 2J8OA 1MFAL 1NKGA 4TKWA 2UZPA 4X6EB 3CSBA 4JR9H 3S36L 1H6TA 2VAAA 2Q6WA 4W68A 3QJUB 2R23A 4NZUH 4QRUB 3S35X 4WK4B 1ZT1B 4F7EB 2HMID 5GRVL 4Z77B 4P5TD 3GMPA 1DJGA 3OJDA 4P9HL 4F2EA 1MRCL 2DIBA 1D5RA 4L8CB 1F45A 4IRZH 3WNKA 1W15A 4WUKL 3B5HA 3K5SA 4K5OA 4L29A 5DVNA 2VMJA 3K2UL 4PBWD 2BSRB 2X0VA 2XKUA 4EZLA 3FMGL 1IBBA 3ARFB 2GTQA 4YO0A 4P2AA 1JYWA 1RD6A 4RNRA 2WXIA 5ID1A 2FX9L 3MX0A 2BC4A 3CLEH 2OMZA 3ZDZE 1V5JA 4JMNA 4LLVA 3D9AL 4P3CL 4QKXB 5GSVA 1C5DA 5HGDA 1WO2A 2YQGA 4XBPA 1BPLB 1MAKA 3WXVL 5DJ0A 3RVTC 5JDSA 2F19H 3A24A 3BGMA 4RZKA 5E9DD 4PRBA 1CL7L 4MQ7A 2P5EA 4L4VB 5AYTA 1JSYA 5FPIA 1I4FB 4G7YL 4P8QA 4QTIH 1RUQL 5I8EB 3WDHA 1OP5H 1QW9A 3ZE0E 3OR6A 4KDTC 4P2CG 1G9NL 3RL1B 1CFSB 3B5GA 4Z0XB 1UWXH 2HG5B 2K9UA 3VG9B 2W9DH 2RMNA 1E4XH 4HUWA 4MMXA 4YDVB 4HSAC 1J1PH 5KN5B 3LZOA 3QUYC 1KPVB 2K0RA 4Z5RA 1ZXKA 4ES8A 1W16A 1OM3H 2KLRA 4KKLC 4AOFA 4WRLA 2GSMB 4NIYE 4OKVB 2NXZB 1KLGA 2COQA 4FHJA 4KUZH 3BRFA 1WWAX 2QFPA 2QSCL 3FFCB 4LRNL 4ZBJA 5BRZB 2LTQC 3H9SA 2X6MA 3KR3H 2IV9A 2OX5A 3RWHA 3O41B 4PAZA 2N01B 5DK2A 1A7QH 3PWNA 4NO5A 4IMLA 3C12A 4DP7X 2W9DL 5CUSH 3DGGA 4I5BB 4HWEL 2O5XH 1TLMA 4LCIL 4I4WA 2ICCA 2EIKB 4ABUA 3MJGX 3IYLW 4XGZB 2WNXA 4UOQA 4IOSD 5J0BA 4IU3B 1XF4B 3GBMH 4LU5H 5IOPB 4X99B 1MQKH 2C4FT 1NBYA 2FUTA 4FF9A 4LLMA 5JTWA 1ZS8B 3IGKA 2FB4H 5DWUL 3TJEH 1JVKA 3GXIA 3VXPA 3WL9A 5T3ZD 1TIUA 5DMGD 4YR6A 4CC1A 2Y7QA 3OGOE 1KIQB 3RA7L 3VQMA 2BP8B 3O8XD 1V8HA 3NACL 4M48H 1XF1A 3ZGIA 3EW3B 5D71L 3HHSA 1I7RA 1S3KL 3WEXB 4HWBL 2Y0SA 1UZ6F 3C6EA 5IHHA 3UP1A 1SUJA 2B1AH 3O3AA 4FNLH 4M3HA 3BUBA 2V3EA 1Q0YL 3HE7A 5GRZA 4NUPA 3F64A 4P4KD 4ZW5A 2MSPA 3WEOA 1NBVL 4IRZL 2JQMA 4OLWH 1HXMB 4AQOA 1DQTA 4JHWL 3VD4A 4N2FA 3UDWA 4Y16B 1AJ7L 5FGRA 1EEYA 1KN2H 2OX5B 4F33A 1JP5A 2P3YA 3GB7B 4FQPA 3CFDB 3FBQA 1GGIL 1TJXA 3B9KC 3FHAA 4CGTA 1CDBA 5D1QC 2R29A 2GBUA 4CMMA 3MLVL 2NMSA 4ZQTA 3UBXB 2CLZB 3QZWG 5D1XC 4Y1SA 2CMRH 4AMXA 1YEKL 3RB7A 1OZTG 5F6IB 4RMBA 4FXTA 5E95B 2OZ4A 3D50A 4R4ND 3C6SA 3N43B 4OCSL 3L4TA 3TO2B 4DQAA 5JIDA 3FUJA 2XIIA 1BA9A 3L3IA 3ARWA 3LZPA 1FLRH 4L4JA 5ALCL 4X6EA 5EU5A 1ETZB 5B7FA 3MJ9H 1WIPA 2A9MH 2ZSVB 4IDJL 5GS2H 4E9LA 2DQEL 2ZOLB 3QCTH 4JGJA 2VDPL 3KWWB 4Y5XB 1PZCA 1Q9LA 2VDNB 4QY8A 4X7SL 3U9WA 5DLMH 2ZG3A 4JZJA 2VR8A 5FO9B 3EGSB 4QF1B 1T1XB 5DQ9A 5ECJE 5CKGA 1PJ9A 1NBCA 1QFUH 2OK0H 4EIZC 3MZGB 3PQYD 1JFHA 4K5LA 4RNRB 1OSPH 3BHBA 5EOTA 4LSTH 1H8SA 1TQUA 2QL1A 3QYMA 2WTRA 1NEUA 4Y19E 3H7LA 4K0OA 2XWEA 4YBQC 4E9TA 5CCKL 2WLLA 4ODUB 4OIBA 1QQDB 2AJZA 3VMOA 4XN4A 4YHYC 5AOJA 3IFOB 3QFJD 4URTB 3TESA 4NJ9H 5IV2A 5I73C 3BZDA 2UX7A 3N42B 3WSQH 2XG5B 3F7YA 4D9QD 1MHCA 1QFWI 2G60L 2V7HA 4EMZA 1FZJB 5CZKA 3LKQA 4FQLH 4ALAL 4LCWD 4MNGB 2ZX7A 2JELH 1P6FA 4IKNA 5HI3D 1FNGB 4X6BA 3L1OH 4PJGE 1MFDH 4KKPA 5CJOH 4MCZA 1F90H 3AUWB 1JWMB 2WBXA 1TZ8A 2OR9L 3QDMD 2UV3A 2G2RA 2X1QA 2WANA 3HW7A 3MC0A 4XXDA 4DT2A 3FCUB 3KXFB 5T5FH 2IAMC 2KT6A 1KENL 3QNZB 3ARRA 3MJ8B 1UKTA 4K55A 1MWAL 3BPNB 4KBPA 2HRLA 4KV5E 4OLXL 3AREC 1EEUA 2DYPD 3BKYL 3LKNA 3MV8B 4LHUB 1E5ZA 1OAQL 4N0YL 2F54A 4LO9A 5E5RB 5MERB 3MBXL 2P45B 3H9SB 5FYJH 2I25N 2QPSA 4KGJA 1W72H 3GI8H 2P24A 4TMPA 4KNSA 1VESA 2E74C 2HPTA 3STLA 1DBKH 1BEYH 4NFCA 1IT9L 2WNKA 2VM3A 2HJLA 2N56A 1FFOB 5C71A 2YAOA 3KZ8A 3EF7A 3JT2A 1PZDA 3LAFA 4J12A 5IM7B 1D9KA 2R0LH 3LKPB 1I8MA 4N25A 4N2EA 1E5CA 2D3NA 1QLEB 1EEQA 4U1GC 5C6PB 2YZ8A 3DVFA 5D4IA 4YHNA 3LIZA 4KHXL 2YSTA 3BIKB 1BYNA 2BY1A 3GHBH 1G1KA 3APDA 3U0WH 1ZLVK 2PYFB 4OD1L 3Q8FA 1ZPLA 3DO7A 2HYMA 1S7UB 3PHQA 3ARGA 4KUCD 4O02A 4EI0A 1THAA 5AUMB 3TBYB 5E9NA 3U0TA 5C3IA 2E56A 3LNFA 4JFTA 3MOBL 1DO5A 2H3XC 3BPLC 4PBXA 3RFZC 1HH9B 2Y2WA 2ZWLT 4DP6X 4O5LH 1MJUL 4WZ9A 2FX8H 2OMYA 1AC0A 3RVUC 2A7BA 3HUJF 3ARXA 5IFAH 4Y8DC 2FR4A 3KLAA 1U3YA 1FFPB 4AH2B 2ZXGA 2APXA 1JFQH 4PY8J 1OSYA 4P23A 2EQDA 3OKEB 3AB0B 2NXZD 5G4NA 2Q0ZX 2R2BA 3S3DB 3MRFB 1ADQH 1FL5A 5F89B 1A9BB 2GFBA 4OY9A 4PJDE 5CP7A 2YMXH 1BQLH 1FGNH 4N0UA 5IREA 2FT7A 1J0ZA 3EO0A 2E76C 3IU3B 5CJQH 5FM8A 1U8IA 4ADJA 3QDMA 3G04A 5HTSA 1GIGL 5HHOE 1L5GB 1ADWA 4IMKC 2GT9B 2VH5L 3TT1H 4OAWB 2DQJH 4LSRH 4HX1A 2J56A 1CE6B 1OPGL 3Q48A 1RZJL 1S8DA 4GO8A 1IBYA 3PHAA 3ZE2E 3CGTA 4ADIA 4E2OA 4WFGD 1VFMA 3QQXA 1N3NA 3BKML 3VFSA 2J6WA 5E6IA 5I1CH 4H8PA 3SPJA 4A6YA 2G5RA 4N24A 3QIWA 1OGSA 2A4ZA 4LCVA 4YLBA 5FKAB 2CO2A 1NEZG 3BMVA 3ROLA 3VRJA 5ID0A 1J8KA 3VXUD 4MS8C 3FCBA 1KY7A 1YC7A 1UADC 4YAQA 1DHKA 3TJHD 2E47A 3B2VH 3UTQA 2WBJA 1CWVA 2EYRA 3MUZ1 1RPUA 3W0WE 2K1MA 2FX7H 2XG4A 1VFAB 4L9LC 1QR4A 2WN2A 1NCIA 3UPCA 2HFEB 4KMTL 4UMGA 3HZKB 2OR7A 4MD4A 4JFXB 5FYKU 5GGSA 5KVDL 5CEXA 1QQDA 2AJZB 4G7VH 5E2TL 5ADPL 4RMVA 4G7QB 3H53A 1IGIL 3N0PB 4IBUA 2NW3B 4FQ1L 3IN0A 4EO5A 2HLFD 2W0FB 1XCXA 2VNCA 1NGPH 1RSYA 2XX1A 1CF8H 2AQRA 4HWBA 4K7FA 4S2SA 4ZQKA 2UXVA 2YD5A 4UZUA 2OL3B 1CPUA 1UM5H 1A4JB 2OMVB 2XN0A 2I85A 2X41A 3SCMC 1U8JB 2JB6B 4APXA 3BISA 2WWMC 2HRHA 3ARDB 4RA0C 1X4ZA 1I7TA 4PJ8A 1PG7X 5B7EA 3FQTA 5EC1A 2ITEA 5BVPL 3ZXAC 1QNIA 3L2NA 3JUZA 4AYDC 4DN3H 3E8UL 2RGSA 3GKWH 2VERN 1GZHA 3BZ5A 3QDHA 1XL6A 1BZ9A 3TA3A 1QOKA 1RUAL 3QPQC 5E1AA 1HHKA 1NBQA 3EGDB 3ATEA 4HKXA 5FUZH 3BAIA 1SM3H 3G6JE 1CL7I 3UG3A 1KPRA 4JN1H 3TCLB 2JIXD 5C0BB 4FQCL 1F02I 1MZYA 1WWBX 3UBXA 4MHHG 1VF5C 5J12C 2AAVA 3RVWC 2W5PA 4LCCA 2W65A 3F3HA 2A74B 4G1MB 1DQMH 5DR5L 1IQDB 4WHTA 5HHMB 1MLCB 4CW1B 4PJIF 2VAJA 3HN3A 2J57A 4ODSH 1MI5B 2C1PA 4AKPA 1BLNB 2JCCE 4M6AA 3RHWF 5CMAB 3QHZH 4L8SB 4DEUA 1VFBA 3GXNA 4CAGA 4L5FE 5FR3A 5LWYH 1KJMA 2AJ3B 4IOSA 1BX2B 5GRJH 5I66A 5EF0A 4JVUA 1H0DB 2CJSA 5C0CE 5BZWA 1D7CA 1A2YA 3BQUB 5FYKH 5BRQA 4QWWD 2HA1A 4P5MA 1S5IL 3ESNA 4JQXA 2QZQA 4M93C 4KUCF 5GRUL 2OCCB 2AK4D 4X4YA 3L54A 1ED3A 2GY5A 3UTZA 2I9LB 3CC1A 2L7UA 1S78C 1A1OA 2VLKE 4P07A 2IH3B 3F8UB 1FZKB 2B5IB 4UUJA 3A6OA 5DC2A 3VJ6A 2OYLA 3PXHA 1JXJA 3FO9A 2E6PA 3STBA 3ZW3A 4PYGA 4LB8A 3M1OA 4Z0BL 2WUBL 3SOBL 3GSUA 4XOBA 2R8SH 4N85A 1MNUL 1C5BL 3EAKA 3S3SA 3TU6A 2X0WA 1KCVL 5AAWC 2RACA 2ZQKA 5BZXA 3TNNB 3HG3A 1QFOA 3VO0A 5EHFA 1LO3L 3L5XH 2W80C 3L9EA 3VXRD 3ZDYF 1WTGT 2XTLA 1UWGH 3FZUC 5DC4B 3BDXA 3O45B 3S0PA 1IM9D 3ULUC 2ZF8A 1AIFB 2P5ED 1RZ8A 1A3RL 4XZUA 3M6DA 4KTDH 3LPOA 1F8TH 1VFOA 1U8QB 4OI7A 4ANVA 3RWGB 3LH8A 3LN5A 4JZOB 5IEKA 3BKCL 3GSWA 4PB9H 1F5WA 3C9NA 5B1JC 3R7QA 4D8OA 5ETUA 5HHME 2WAHA 4JQVA 1KG0B 2KS0A 3QO0A 2V9UA 1SYSB 2RR3A 3HKFA 2IF7A 1WF5A 4OFYD 1AR2A 4G43A 2YEZA 3C6SB 4XR8C 4L9LA 3ILQC 2I9LA 2QHRL 4KK9C 1DL7L 4Y5VC 2IPTH 4A7UA 1VZGA 4P0DA 5K1NA 2LVCA 5DXWA 1QASA 5D6DA 4MA8L 4AY0A 1EZLA 1KEGL 4JM4L 4FZ8L 1TTAA 1YYCA 4QRQA 2CIKA 2F53E 2WCSA 3CVHL 5KANG 1DVSA 2DLGA 2R56L 4UQ9A 1JF1A 5I1DA 1OT1A 4XP1L 1JZHA 3QRGH 5E0QA 3VYPA 5T3XE 5I1HL 3MA7A 1FNEB 5KVGH 1WA1X 1PLAA 1FORL 5EPMB 5IIEB 1U8OA 3X13B 4XHJC 4PGCA 4PV8A 1WJ3A 1RK7A 4RA3A 2IBZY 3I3DA 1K85A 4ZUVA 5DFTA 1DN0B 4LLMB 1HCYA 3FO2B 3QCUH 3WKYA 4GB9A 1D7BA 1UZ8B 3UTTA 5KSVA 4JM2A 5DT1L 1KTLA 4RESB 4X42A 3SKJH 2CK0L 1VFUA 3CQQA 1HVXA 4L8BB 5AKVA 1HKLH 5TJWK 5TPWH 5BMFH 1E9QA 4TVPE 4AJ0A 3HNVL 1G6RA 4YDZA 3SKMA 4Z7UB 3C60C 3ZE1E 2R2BB 3OGCB 3QUZA 32C2B 1NCDL 3EFFB 4MBOA 4OZGB 2NY5C 3F6IA 2DQHL 2AEQH 4MYPA 2BCKB 5G5DB 4NO0B 1HHKB 3EGDA 1FZJA 1MCQA 2VLRA 4IEFB 2OP4H 5IBUG 4B9KC 5EF2A 5IQ9B 3CZGA 4Y9EA 2ARWA 3N0AA 1YAZA 3V4PA 4E42A 2DH3A 2XWBA 3ZL1A 3QS3A 3FQXA 3IBEA 1TO5A 1IC7L 4HIXL 4ZPVB 4V11A 1I9IL 3LXAA 5C0EB 1VPOL 2Z4TA 1KZQA 3ISWA 3DWTA 3TVMD 4OCMC 4FYQA 2XCMC 4GRLC 2CM5A 2UUDH 3O4LE 5IMLA 5FK9B 2XYBA 1UH2A 3OR6B 4K07A 4JRFA 1MHPL 4JFOB 2OAAA 4YDKL 4PIBA 4NFDA 4U1KB 3OAYK 3OG6B 4R0LA 1IGCH 5E08L 5HGBB 4GG8A 4O2FB 4KJPD 2QKSA 5H94B 3E6FB 2ZAGA 2E27H 1JPFA 4HS6B 4LEXH 4XPBH 4Z7QE 1WV7T 5IK3A 4KMQA 5EIIA 3DLQR 5IM7A 2FECI 2Y7LA 3PV7A 4ACTA 4QTHA 2CLRA 4EXKA 5I1LB 3RKPA 1FZMB 1KCRH 5I5MA 3WYRA 1P7QA 5E2WH 3IDJB 3V5KA 1YPZF 1Z5LA 4NC1C 3ULAB 2G75A 4QOKE 2R4SH 3UC0H 3WIFA 4BHUA 3GJFK 1QSFA 3OF6D 4PJIE 4A63A 1P6WA 2K3TA 1XF3B 4KK6C 1PSKH 1ZAGA 4PJ5A 1HI6B 2NYYC 5I6PA 1FG2B 4WNQA 4YLQT 4DP9X 3P77B 4JFHD 4U31A 5DEFB 1WYJA 2RQ8A 2VDQB 3BZFA 2K6ZA 3OAUL 3Q5TA 2Q6WB 3K71A 4ABVA 1RH8A 1BYOA 2WIIA 5DRZB 2FO4B 4LQ1A 5DF0A 1DLFL 5C0CB 43CAA 3L08A 2NX5D 1LNUB 5E5MB 3EO1B 2EXSA 2X4SA 3L3GA 5FKPB 3D25A 2ALAA 1T21B 5D1ZD 4XCFH 1HILA 3HBZA 4E5XG 4JX0A 4C47A 4M7ZB 2QMJA 4JRYA 2EECA 3GMOA 1ZT1A 4JM0A 1INQA 2QSVA 3U4BH 4M29A 3Q3GA 3QE5A 5HHNA 1NMBL 2OFQA 3TEZA 4E41E 1B0GA 3BUPA 3KYMB 5HDBE 2Y1AA 4L4TD 3RVXD 2ZUSA 3NA4A 4IRJD 2ZZUT 3FTXA 3APFA 5EC2B 2XN1A 2PCFA 1T2QL 3IFLL 3IJSA 4LQFH 3WY2A 3RIKA 2MNJB 4I9XA 5DJXA 5CSZA 3Q6GH 4ETQB 3CDGB 3NFPB 1K72A 3ARSA 3Q5YA 1GZPA 1CUOA 1G94A 2Y24A 4L8DB 5F1IB 1QLRB 4DP0X 1SXBA 3MLUH 1NCJA 2ZCLL 3DHPA 3S3CB 1IBFA 3HMWH 1T0NA 1XSJA 4P5RA 3H4FA 4H20L 4BBWA 4ONGH 3RZCC 2UX6A 4LPYA 1S6NA 5F2FA 2F8VA 2EXYD 4EVNB 4ENEC 2HG5A 4M4RB 1MY5A 1G0XA 4MXQC 2O61B 4YHNB 1UUNA 5BRZA 1IAKA 2ITDA 8FABA 4JM2B 1BBJB 1G0YR 3PJSA 1HAUA 4Y7MA 2ZWNA 2P1YA 3UAEA 4R7LA 3U0TB 4A55A 5M94B 3DRTB 1I9RL 3O8XB 2EH8L 1LYQA 2Q1EA 1AS8A 3UH8A 1SLVA 1IGMH 4JB9L 2F61A 2OJEA 2J8UB 4Y4HC 2EE6A 1Y6KR 2CSPA 1JYNA 1YQ2A 3NN8A 1JZJA 5KBMA 3T0BA 3L1FA 4MDIB 1XGYL 1MCJA 2Z92A 4N0CC 5B8CC 4ZXBB 3BUDA 4N22A 1UM6H 1QVOA 1T6WA 4K9EC 1KB5B 3T77B 1GC1H 2QPEB 4Q2ZA 4N3TA 1AZZC 3LQAC 2C9PA 3UCQA 4BGDA 3UGXA 2YN5A 2W60A 4A1RA 4I0CC 3WL9B 3LOWA 4LVNC 3RUGB 2R56H 3FT1A 3VWKD 2MNUA 3LKQB 2HXAA 1MLBB 1NQBA 2XWXA 3DK2A 1FP5A 1Z32X 3RWGA 3VGFA 4UU9B 2PPFA 3ESUF 5AYUL 4GEJA 4HC1A 3GDBA 4N0FA 3DSNA 1UZ6E 3QZWA 1YCSA 3OPUA 2G2PA 2IGFL 1HSBA 1ZVHA 2I60H 4JKMA 3PIQB 4UTCA 1CLYH 3KJ6L 5C07B 2E46A 3FT3A 3WBDA 1AHWC 1ASQA 4EBQH 2FSEA 5CEZL 1R5VB 4CDHA 1KJ3H 4XAWH 5GGQL 4A66A 2PYED 3V5KB 4XCYA 3ZT7A 5KZCD 5MENA 2E6JA 4HV8A 2UZIH 3D0LA 4PV9B 4Z95H 3AREB 2WQXA 1LO2H 2VN6A 4ABWA 1XGTB 3GSQA 4PIRF 3ARBA 4XC1L 4L1LA 2MTAA 4HT1H 2ITCB 3KHQA 1IC1A 2WZAA 3T08A 2ZSVA 5IB3A 2IPKA 2KYIA 2BVUA 3PJNA 4HZLB 3IWUA 4K23L 5F70A 4ZXBD 4MMZA 5A16B 3SD2A 2OXGB 4EZMA 3A4AA 1AYRA 5IG7B 4AV4A 4PCSA 5B1JA 2H5UA 2R4RL 5I8EA 1KEML 4X98A 5T1JA 2X4UA 4JQVC 3ETBF 5HY9B 5KYWA 2BSSB 1MIMH 4NQXB 5T3XD 4JY5H 2Z31D 2HPOA 2X42A 3AT9A 1AGEB 1EFXD 2CRYA 4PCYA 3IDYC 3KWVA 3VRIA 2JJTC 4LARL 2OZ4H 4PJ8B 1OP9A 1P7HL 3L81A 4FQIH 3HRZB 1TEGA 15C8L 3VSTA 2G0KA 4MSWA 4GYBA 4PJGF 3VWKB 1XX9C 3O2WH 3HFMH 4TUOB 2AK1L 3W0WA 3L5IA 2BHFA 1Z0NA 4WO4B 1CXKA 1EERB 5D7HA 5I6LA 3ULUF 2M8XA 1UWFA 1UT1A 1YMHA 4I9WD 5HYEA 3BSZH 3BUYB 2VRKA 5KSAB 5KBKA 2V5RA 4F9LC 5EU6B 3JVGA 5AVXB 1QBLL 1DBAL 3TFKD 2CQVA 1B2WL 2LGNA 4IRSB 5LWYL 4Q89A 3LV3B 3QHZL 1KBBA 3R0NA 4NZRL 4PGDA 3ZTNL 4AL8C 1RURL 1INEH 4U1SA 5J1AB 2UY7A 3LVTA 4Y4KD 3TPKA 3MRIA 1U6AL 3VFRB 1ZMYA 2OJ1A 2N7SA 5I74C 1W8NA 5CJXC 1NGYA 5CFHA 2DKMA 3CZKA 2XWJB 4IBSA 1NAMA 4F93B 5IMKB 2VN3A 1FAKT 3QNYA 5D5ME 1T7WA 3BFQG 1G9EA 3PY9A 4UTAH 4MB3A 4NBYB 5GGVH 2XXMB 3VRJB 2EACA 3D30A 4AEFA 2PPCA 1MIEL 2DWEA 4YAQB 1JXGA 3MLRH 3L95B 4IBTA 2YUWA 1I3VA 3D7PA 3PWUA 1PTZA 4IDLA 4N8UA 4P5MB 4WI6A 5IOKA 4HIHA 1OL0A 4YZWA 1SJHB 3MJ7B 3QULB 4YWGH 1XGRB 3LB6C 1TUPA 5E9AA 5IFJA 4BZYA 3UTSD 4Y4HA 3IAQA 4KK5C 3ZT5A 2PMZA 1TEYA 1A6WH 4MD4B 5FO2A 4NBXB 4MLSA 4O02L 3I02A 5KYXA 2XN9B 3S3JA 1PKQB 3O2VL 2OA9A 4NQEB 1Z5YD 4OZFB 5E9DE 3GLDA 1A9EB 2YZ1A 4K2UH 4O51A 3IWVA 4XX1E 2A73A 1F13A 2GTZA 4NZTL 4KO5A 3RL1A 1GW0A 1CDYA 4JO4H 4FNUA 4HJIA 3T0XA 4GAAA 2V6HA 3L3JB 4ZG1A 4CVZB 3H7BB 3LRHA 1KB5H 2P5WB 2VDMB 1S7WB 3LCYA 3SY0A 1C12A 2VIRA 1X9RA 3ATFA 3PL6D 3AT0A 3GBEA 1EAQA 4WFED 3MV7B 4D2NA 2H1XA 2HTLD 2V5YA 2L7JA 4HDIB 2HVBA 3CK0H 4ENED 2EXYC 4D8PA 5HGHA 2CIIA 4LOUD 2ZKHL 4N26A 5E4OA 2IANE 2VZ1A 1RQ5A 3EZJB 3COOA 3W57A 1DJYA 1U0QA 1KZYA 1VAHA 2HFGH 1EH9A 4FZEL 4HXAL 5JDJA 2VDLL 2XLLA 4QIRA 2GEQA 4P2OB 1CE1L 1FL3A 5I1CL 4JUTA 4DOHE 2Y36H 3D12B 4FE9A 5EU6A 5CP3A 4HETA 1UXLA 4MTMA 3WNOA 1N5YH 4UIMA 1BW8A 4AEHH 1LP9E 1ZDQA 4LPCA 3DSFL 2MKWA 4U6TA 4P9MH 3RVXC 3V7AG 4AXWA 1AQHA 5BW7C 2QDVA 3GBDA 1D7FA 5MHSD 1K4CB 1PQZA 1KJMB 3IU4H 4AQZA 1UOKA 5D1ZB 2AMGA 4A04A 4LNRB 4OCYL 3WUWB 3VRIB 2GK0B 4EN3B 5IGXH 1JWMA 3P11L 1N26A 2C9XA 2EDOA 3HE7B 4QLWA 3V5DB 2Z91B 4ISVA 2OJZL 1MHHA 4AG4H 1SEBB 2NNRA 2XQYK 1YC8A 1CDHA 1VIWA 2NYYD 3MRRB 4GW4B 4J2QA 3QEHA 43C9B 1HYSD 2D0HA 3PRZA 4KK6D 4UIKH 3BXNA 2W9EH 4QNPE 5L2KD 3K2KA 4XNYL 1BF5A 3QEGH 1RIHL 1OTUD 5AOMA 4ZOEA 2V3FA 1SBBA 2F2HA 4XN9A 2BMKA 1WITA 2DYSB 4OFVA 4U1IA 5GHWH 2CO7B 3DX8B 1TYRA 2NY6D 2MMXA 4Z7QB 1MUJB 2EIMB 2VDRH 3JWNG 4AEHL 3EBGA 4P46C 3CU1A 1ZRUA 2PPDA 4XTRC 2NY5L 1S7XA 4Y1AA 4U6VL 4J3VA 2YPVL 1E28B 4PJXF 2I24N 4BSWB 3QAZC 1IEHA 3OB0K 3DPBB 1WZMA 3MRJB 1DBKL 3CH8A 5L88L 3I6KA 3SDXF 5CSBA 3UCRA 5E8NA 5JZ7C 4X0NA 5ACZB 3MBXH 4HU2A 5IJBC 2MCMA 3FFDB 5DD6B 4RDQF 5ICZB 5IR1A 2YLKA 1TTBA 1Z3GL 1TITA 2ZKHH 3D39A 3FAWA 3PDOA 4FFVC 1JV5B 4J2XA 1P9MA 2VCOA 2R59A 1JZIA 1SEQL 5ANMA 4ZMNA 1R24B 2C34A 2XV2A 3GHEL 5GQBA 1MG2C 1F4YH 1SJEA 3I50H 1JZFA 3QIUC 3FO1A 3UEQA 1I31A 3BAJA 5F97E 2UVEA 3ZT6A 2IANB 4UT6H 4ZUWB 2W81C 4FKKA 2OXGA 4Z7UE 3WS3B 2YOAA 3P4MB 4XNDA 3KPRB 4TM9A 1H6UA 4BUHA 3HR5A 1J5HA 2O5YL 1A21A 2VLKB 3O6LH 2X40A 3V0AC 2ZXCA 5G4OA 1XGQA 4DUXA 5TDPA 1ULVA 3MO1A 4PJAE 4ZUSB 5JQ6H 3ILDA 3WMQA 2B0SH 4PW3A 2B1HL 3RY6C 3P3SA 2ZYSA 1OAZH 3UADA 3O3AB 3MV7A 5AOIA 4BDVB 5EUOE 4N4YB 3F58H 3ARGB 4HS3B 4WENB 3PWPE 5B22A 4XHJD 4KKBC 4C54A 4R5VA 4IIQB 3ZU8A 5B38A 3KPRE 1NLBH 4RSVA 5HHNB 3RX5A 3MREA 5KYYB 1LK3L 3BP4B 2K6WA 4BZ1H 3ZDXB 4IBWA 3ERXA 3MLRL 2VLJD 2X3CA 4QHUB 1QATA 1TQTA 4ZUTB 3VXRE 1N8ZB 2BJMH 3VA2C 3K8KA 4ZTOL 1IKOP 1FVCB 1ROWA 1A6TA 2A0LC 2CDFB 2NY3C 4LSSH 4L8DA 5F1IA 3TO4D 1NCUA 5IMOA 4IS6B 2ATPB 4GP8B 5DHDA 7FABH 3S4SA 1FH2A 1YEKH 5EIVA 1WBZB 3DX8A 2X1WL 4LP4A 3ZDXE 4OVUA 5C09B 3AG4B 2VRQA 1VCBC 3MLVH 4HOZA 5KSVB 4WEUD 2NW2B 4ZFOA 1QBML 3WFEL 3V52H 1YDPA 3LKRB 2QZ5A 4HJ1A 4WY7L 3Q1SH 4KY1H 1GCFA 4RGND 1B0IA 1A7RH 1UCBL 3PCYA 1NCOA 5DTFB 1AJ7H 3V0VA 4WFGE 4Q97A 5AB2A 4JFPA 3K4ZA 1ZCRA 3DO3A 1T1XA 3IMVA 5DQ9B 5EH1A 3IJ8A 5AVSB 3RY4A 1T7ZA 4PJEA 3U9UB 3V0GA 4ISVB 2VUOA 2VC2H 4WJG3 3IDXL 3HN5A 4RFOH 4U1NB 3FS9A 4M02A 2VUKA 2HTKD 2MQGA 5FGSA 1ZOXA 4FFZA 5DI8A 3U1SH 4H8UA 1OCOB 1T3FA 3OV6A 5C9KA 3QZPA 4N8CH 2NZ1A 2YUZA 4M48L 4YVNA 5J13B 1NOAA 4Q4EA 1PLGH 2YPLE 3IFNL 4MAYC 2HB0A 1FG2A 2HT4C 2QSTA 4NB7A 3UTTB 4ELKB 1RP8A 1S78D 1ZHBB 3DX3A 2OQJB 3NG5A 3L5HA 4O4YL 1JZ6A 4JFFD 3CQPA 1KBVA 2X70A 3GIZH 3SYCA 4M61B 1EAPA 4TSBH 3MRNB 1NAKH 2DQDH 3GTTA 3L1EA 3W0WB 3WN6A 1E42A 1BAFH 2ESVD 3MBEA 2UY6A 3DPBA 3V9CA 1EEYB 4U1MA 5JOEA 3VD0A 2DMBA 2JCCB 3CZLA 4XNMA 3NP4A 3A4FA 1FUNA 4TVSa 1ZLUH 5FYLD 4PJ5D 5CEZH 5L0QB 4GSDH 1T2JA 1WBXA 4FFWC 1FE8L 5CS7A 2ADFL 1IMHC 2DKUA 4L48A 4POZD 5DUBB 5EU7E 3U4KA 4UQCA 1FO0A 5CEZE 2XV3A 2R2EB 4J8RB 4H8VA 2EDEA 5DJ6B 2IH9A 2O6EA 3N5AA 1FZKA 3QAZB 1NC4A 1R3LA 1KV3A 4WQOA 4N90D 1LDSA 3AY2A 3IDIB 3DMMB 3ML9A 1G6RH 5DUJA 3FQNA 1L9RA 2DB8A 4GSDL 2PKDA 4UB0H 2F54D 4C56D 3ZIYA 4E9VA 1KWKA 2NSXA 3KLHC 3T0EA 4WCYH 4EF3A 3CD4A 3VXOB 2SEBA 4ZMWA 4TL4A 2CKBH 4ZO8A 1AR1B 5T3XL 1BPVA 3HA0A 2P5WE 1UH3A 4UANA 4XP4L 3BT2L 1GOGA 3WFZA 3T0WA 4PJDA 1MOEA 1DBML 4JO2L 4L8SA 3VFWA 1UKSA 2QPDB 2GSGA 3KHOA 4HS3A 4X8XA 3INUH 1G7JB 1KWGA 5D70L 5DJAA 1JHKH 4LPTA 4I3RL 4OJFL 4KI5C 2Q2EB 3N41B 4ZNEA 4XPGL 3UYOD 4XVJH 4WI9A 4ODHH 3QUKB 1XCTA 4PCTA 1CJYA 4JHAL 2GIXA 5F1NB 1T5WA 3U1SL 3VX0A 3AUVA 4LSPH 5F1OB 5GXBB 3P2BA 4XCNA 5T33L 5I6NA 3B9KB 3TCLA 3ZBMA 2G5UA 2VL5A 1K8DB 1MJJA 4L4VA 4PJ5B 4QMEA 2FRGP 3B9EA 4JLRA 1CGUA 3H9HB 3C2SA 3T65B 3ETSA 1RK1B 2W8CA 3AW5A 2KBGA 1GTFA 4CU8A 4QRPA 1JHTA 1UXWB 1CGXA 4ZFFA 3WDJA 1S7QA 1QFPA 2WQRA 4D8PB 1NCBL 5D2NE 4GRMB 3ZN6A 5C0RL 1ZV5A 2GC7C 2OULB 3KJ4C 4C56B 4OTXL 4HEPA 5DZ9A 3SKOB 3CDYA 2R1WB 3N41F 5DO8A 1U93B 3RKDC 3MRIB 4G9FA 3LZLA 4HF5L 4KKRA 1SZNA 5EBGA 1PIFA 4C57C 3D4YA 5LXVA 2APSA 5KN5A 4H2AA 2Y22A 4N8VB 4U1GB 4XBEH 2X9ZA 3CFCL 4UQ2B 1AC6A 2WZ0A 3IJEB 1PGRB 4WTWA 1A0QH 1WIOA 1U3ZA 4LASL 5KUKA 5K9OA 4JDEB 3DHMA 3GT6A 4JO1H 4WHDA 5IHUH 1AXIB 4JKKA 2WMPB 3IDGB 2VZOA 4U1NA 1UENA 4MA7H 5JOFB 2GJRA 4JFXA 5DK2B 4XVSH 5GGSB 5I1EL 4AQAA 5FB8B 1LE9B 1A8JH 1KIRA 4BZ1L 3GSVB 5ISZE 3HC4H 4OIAA 2BOCB 1KCUH 5IQ9A 1KJ2A 3KPNB 1G7LA 3NFSH 2FEDD 4NDMA 1SOQA 3UBHA 3EFFA 2DQTL 3HBGA 2HKAA 3AXLB 3ZRFC 5CU5A 1LTXA 2B8OT 1P4IL 3D07A 4J3OC 5IG7A 2FQFA 3BPLB 1O9ZA 4KXDA 3AQXA 1OHZA 1F18A 4LVEA 1PSKL 2A73B 4QJ5B 4KH2A 4KI1A 1NIDA 2Y72A 1PY9A 2IQAB 3UO1L 1DJXA 3D39D 4IBYA 4BQBA 4XNMB 4Y19D 1QUNA 1A7NL 1NJ9B 5JHMA 2Y7MA 2R15A 3ZHKA 4LT7A 4EN3C 1EFXB 3MRPB 4H26B 3QEQE 5D72L 3UP6A 3QFJE 4DZBB 2GY7B 2Y5EA 4M3KB 4YHYB 4B9FA 1R5VA 3EJCA 4MLIA 4XPTL 1R34A 3N1GC 5LN8A 2H9GA 2HCZX 4X5WA 1YEFL 4NHCH 1QSFE 2P8MA 4Y1AD 1Y18A 4FXGA 2H3NB 4QHPA 1XF2A 3BP7A 3Q9PA 4FMVA 3BKJH 4KOBA 4POUB 4WI7A 1RZFH 4LAQH 3NCYP 4HHGA 3BZ4A 3VDBA 3F6LA 1WCBB 2DMKA 3F04A 4WV1C 4R8WH 2Q2LA 1P4UA 3ARED 1SDDB 4OT1H 3TIEB 2W60B 4ZW3A 2WGXA 2YPKA 2VDQH 3SYPA 5D2LF 5KZCB 2MPVA 5D96B 4R7XA 4YEEA 4Z8FH 5J11C 3FB7A 4ANKA 3GMQA 4HIXH 2A5UA 3ULSA 5CLYA 1MHEA 3E1ZA 4MJIB 2Z34A 4QHKI 4GUCA 2X12A 5D1XB 4JPIA 5IW1B 3DBSA 3ZY7A 1HQRB 4BA8A 4LLDA 4OU3A 1YN7B 3JYCA 3QWRA 1MVUA 3T1FA 2XA8H 4EOWH 5GIRA 5I0VA 3O2DL 5CF3A 1NCDH 1MREH 3BLPX 3KPQB 4M6OH 5AEAA 5LBSH 2VZUA 2ISDA 1H3UA 2IEPA 2KMWA 2VQ1A 4LIQH 5ERWA 5AL8A 1CB4A 4OV5A 3KBPA 2Q5BA 4HK0A 2FYYB 3GS0A 4TPRL 4I13B 4MMZC 4GT7A 1YYLH 4URKA 5AW2B 3WJJC 5L4FA 3LQAL 1FGVL 3LNGA 1HZHH 4UAOB 2X53A 4A2FA 1A25A 4TVPL 3BDYL 4X5LA 4NQXA 2YAHA 1BZDA 3X12B 3DO4A 3HE6B 5INCA 1AGEA 2FO1A 2GT9A 1I9JH 1CVSC 2LFEA 1T0OA 4OCYH 4LVOC 3II3A 4XNUL 5HYJA 1PYWA 3GMLA 5I1HH 1KCWA 4O51B 2X4UB 8CGTA 4NKIH 3BAEH 3QDJD 4HPOL 2YJQA 4K9JA 4L0PB 4UM9A 4P9ML 3M8OL 2XIDA 1LWHA 3H4HA 1E5YA 4MQXD 4OZHE 5EEXA 4XCCL 4MRCA 4EE2A 5FKAA 5ID0B 1JXFA 3BPOB 3Q1EA 3GMNA 2HP4A 5TK4A 4N28A 4IBLT 1J87A 3LKOA 4UT6A 3LKNB 4LHUA 4L3ED 1I8UA 4M5SA 3MV9A 1NUGA 2OCFD 3PGCB 4TVUA 4QRPD 3BKCH 2PCFB 3F6JA 5HYSG 1M6OA 2IC2A 3B8YA 4Y2DD 5H35A 1PDKB 2LU7A 2WLIA 1F1DA 2YMOA 3SPHA 3ZHFA 1G7QB 4N2IA 4AZ8A 3OLDA 5CGYD 2WLZA 4O9HH 3JTBA 2E9IA 2NY2C 4G70B 4Z7NB 3B5TA 5L7XL 1NCGA 1UWGL 5FM4A 4Z7OB 5LGHL 4FABH 4WUUA 1FAIL 4L3CA 4BFIA 3HE6A 5E6ID 5INCB 3KWWA 4P4KC 1XIWD 1CGSH 5E5MA 1KCVH 3HG0A 5DQDH 1IGFH 3WIHL 3GDCA 2K7PA 4K8RH 3ZKMD 5IHZB 4JJ5B 5FECB 5E1HB 4DPCX 2PO6A 3QK0A 3NJKA 3SIKA 5CNHA 5L0QC 3BAEL 1BVNP 2JKWA 2V17H 4Q74A 1AGDA 1U2YA 2J7LA 1NL0L 2OTWA 3ECUA 2GAZA 5FCSH 5BQ7B 1ZWIA 1ERNA 2Y7NA 3TBTB 4AK2A 4JRLA 4JKPL 2WY3B 2NY4D 4NYLB 2ODHA 1FFTB 4X5WB 4RWYH 4UM8A 4FJZA 4GBXA 4UZGA 1ACYH 1DVQA 1O6SA 1ZLUK 1TJGH 1Y0LA 2HVKA 3G5VA 1GMEA 1RJLB 5GRJL 4WU5B 2ADYA 4QRPB 2C9AA 5EO9A 3B3IB 3PF2A 4MNQB 1WBYB 2XZCH 2HTKC 4XO5A 3L5JA 1OCWL 4L3EB 3R0MA 4UBDD 4AQ1A 2VKXA 3CHOA 1UA6H 1HIML 1IBZA 3V9EA 2FSEB 3ALWA 4J3OG 4KKLD 4U7SA 5HPOA 3ZZQA 2MOVA 1LM8V 4OVVA 2NYZA 3QC5X 3ZSTA 4ATTA 1PCXA 2KQNA 4PGJA 1SBSH 2H8PA 3BFWA 4GXUN 2VZVA 4YR6B 3ARBB 5AAWA 1DANT 4M1DH 1D9KD 1MI5E 1AZNA 4K71B 2F1AA 4QRTA 1RURH 5HVFB 2C4XA 2ESVA 4WFHD 1NEPA 4XX1G 1T20B 3UTSB 4FQXA 2WKOA 2JTDA 1FN4A 3LRMA 1N5AA 4PV1C 3ESOA 4QEGA 1KTJA 4WNJA 1A4KB 4EPSA 4KFZC 35C8L 4Y1TA 1A6AA 4XOCA 2VLME 3QI9D 2H32B 1GHFH 3GZPA 4PP2B 3D2UD 5DZLA 1U8KA 2DQFA 1UZ8A 2JKNA 4X4MA 4AIEA 4L37A 1ITCA 3KEHA 3LHAA 2YPLB 3GXUB 4PJIB 1OW0C 3OB8A 3S5YA 3UTPE 2EYTB 5C7XL 1KN4H 1NEZA 1H19A 2AJXH 4YHMH 1YECH 2VZSA 4IGBB 5D72H 1XQ4A 3VX1A 1LNUA 4LL9A 1ML0A 4MD0A 3VI4A 1CF8L 4D0DB 5DK0A 4QF1A 1JNLH 2Z9TA 3D25B 1XGQB 3TZVC 4FQ1H 3EJZC 3VRLF 3BYTA 3GBNH 3L4VA 3MODL 1IE4A 5FYLL 3IPEA 3TBWB 1KSRA 1RJZB 3M17B 3MRNA 3SCMA 4J28A 1X4YA 2YPVA 4K3HA 1Q94A 1FV1B 3GS4A 5FFOA 4PJAB 4R4FL 3MUHL 5GGRB 3SE6A 2QQNL 4PG2C 5LDUA 2GBVA 4MJID 4GY4A 1RZJC 1A7OL 3O6KH 4WUUE 1J1OH 3X3GL 5FEBA 4HMEA 3X1GA 1QRNB 3W37A 3B2VL 2LU4A 3Q8BA 1EVTC 1E30A 2XVKA 1ZHKB 1G5AA 5KVMC 3AXHA 5F0LB 2WZPD 1RZPA 5HVHC 1B0RA 4ZD3H 1ZE3C 1OOWA 4JFZL 4W9DC 5JXEA 5C0GA 4ZFQA 5EEZA 2OV0A 2FK9A 4P46A 3EJUA 2OMUB 3E9UA 4A7SA 1I9EA 5FF6A 4GG8B 4PUBL 5BOPA 5LXGH 4BWUA 3DDGA 4CSPA 3OKKA 5IY5B 1S46A 2X6AA 2H6OA 2OCJA 3L3HB 5DJ2B 1EBAA 2BP0A 4MX7B 4EI6A 3B56A 1RZKL 3CFEB 2B1OA 4ZTEA 3GKZA 1LEKB 4X6FB 4EN3D 5EULV 1P2CB 4OCXL 1G1CA 1CG9A 3ZE1B 4HPOH 5F96H 4GKNB 2IFGA 2H4EA 3ZL4H 1KXTA 1U8PA 5AWNH 4OGYL 3T4YA 4GUOA 1J8HD 3HN8A 3PWPB 4EDXB 4G7RB 4NXKA 4PLNC 2Q3XA 3BEWA 5H37G 4WWKC 3GSXA 1N18A 1MJ8H 1ZLSL 4OD2A 3RGVC 1T89A 2RFXA 4U3SA 1Q1PA 1Q9LB 1WS8A 2EYSB 3CUPB 2P26A 3RTQB 4RGMC 1E65A 4CVZA 3DA0A 2OW6A 3AS0A 1PCSA 2FATL 4ENZA 4GBXC 5DVPA 3NVQA 1JERA 5D7IF 4XMUA 2O93L 3UZQB 3OBAA 5F0MB 1UEYA 1X7QB 5D1QA 3K8MA 2OZNA 4H0IA 4CU6A 4OCWL 1AKJB 2EDMA 2CG9X 1NBZA 3B7UX 3CLFL 4OGZA 2WLYA 3DXAA 3KYKL 4HSQA 4Y9FA 1PX8A 2NR6D 4OKVA 2A6DB 4M61A 4ZUSA 4N20A 4DP4X 2WQ8A 1IC4H 2VXTH 4YQXH 3S88H 1U93A 2Z93B 3WY4A 3T8MA 4NHUB 2VLLA 3TYGH 1RPQA 3EOBA 1X6NA 4F24A 2EC9T 3H54A 3EF4A 5K59F 1D5MA 2F53A 5AOKA 1X5YA 5IQLA 4DZ8B 3MLUL 5H94A 3NZUA 3RX7A 1NIBA 2PR4L 3L3OA 4HFUH 4JFFE 3QJSB 2OMWA 3BKJL 3QVAA 1DVYA 1NDTA 1YQVH 1JV2B 2B4CL 1F6LL 1XF5B 2V37A 2YPLD 3F84A 4RQQA 2I7SA 1YEFH 4L9LB 4NHCL 1F3DJ 4P3DA 5DMJB 2YEZB 3GMQB 4ERSL 1BIIA 1HSAB 4HISA 4FQXD 1JMZA 1T2QH 1JN6A 3MNVB 3MYJB 2PW2B 3P3YA 1V3MA 3SDDB 1WWCA 5C0GB 2DEWX 3N1MC 1OWRM 4RZCB 5ABZA 4QRPE 5GRYA 1MG3C 3ZTDC 3U4BL 1OE2A 4JFSA 1MDTA 4M3JA 1O7DE 1IZKA 1JZEA 2J4WL 2YAPA 3UO1H 1HT6A 2ADFH 2X1OA 1UA7A 1AKJA 2X2UA 2RD0A 2VSDA 3AXIA 4LOUC 2EIJB 4WLCA 4A2HA 5HDQH 3TCXA 1XEUA 2ICEC 5FYLE 2AV7B 5AB1A 4QXVA 3GIVB 4LLYA 4OGXL 4PWEA 5I8CA 4LSVH 1XV8A 2Q86B 3WEXA 4ZSOA 3Q01A 4OQTA 1T3FB 1GYCA 2Y06L 4U1IB 3S5LA 2FGWL 3VA6A 2WHVA 4NC1E 4KH9A 3F65A 5BV7B 3HKZA 1BM3H 4FFZL 5LCVA 3VG9C 3ULUL 2D31A 4BUGA 3AAZB 1ID2A 3BAYA 32C2A 2EIDA 3EHBC 3P69A 5D5MF 4ZPTA 2BNRB 3QEUA 4HULB 2B3RA 4ZMZA 1YRKA 4BFEA 5JUEH 5IT2L 2VISB 1TJMA 4N8CL 1UM4L 1HZKA 5F71A 3SQBA 4KK5D 5FCUL 1H15A 5DYFA 1WD9A 2R29L 1F6AB 2BY3A 2P7TB 1AP2A 1XGUA 4IBQA 3W81A 4AQ1B 3KPOA 3HAEB 3LZQA 3FU7A 2GUOB 2JCWA 3LS5L 2JLLA 2GTWA 3VXTB 2KDYA 4X7FC 5HDOA 4APQD 3T4AB 3GTNA 1GYAA 1JWSA 5C07E 4F2FA 4HF5H 4FFWD 3MV8E 4PMEA 4HGKC 2BCMA 1Z9SB 4X6CA 3GTVA 3AMKA 1NIEA 5DUMH 1JNJA 4NAQA 2BNQE 1BD2D 2PXYD 1BDYA 1CICC 2J3SA 3HUJE 4XOAA 2C1OB 5KJRH 3KPRA 3IJEA 1XL4A 3ZUNC 4I2XA 3CFIC 4NXSA 5GIRB 1U8NB 5F3BB 4MA3A 1T89C 2ZWYA 3QJXA 2JJVA 3MQIA 4TN9A 1LEIB 1AH1A 2DYPB 3FSOA 3MV8D 3UAJD 3UTTD 1D7DA 1O9VA 4OCRH 4K3EH 3D5OF 5H37H 5BRPA 1W8EA 3FQWB 2H7WA 5D71H 3PXJA 3RUGF 3KPLB 5SX4I 2GSIB 4EQ3A 3FT2B 3VXQB 4U6HA 1ZV2A 4RWHA 1IO4C 2ZOWA 1IZJA 3FU3A 1UD4A 3SJVA 3ETBJ 1NC2A 2ZX6A 5T1MA 1VADB 2NT1A 4RVBA 5DK0B 2CK0H 4NAJA 2R2HB 3C5SB 4NSKA 3L7EA 4OZFH 1XAUA 4N8VG 3IF1B 1HOCB 3KEDA 4PB0L 4D9LH 3BT2H 4WO0A 1QMUA 2E9WA 2AC0A 1MPAL 4PJ7B 1EAJA 4UDUA 3ZTEA 3I84A 3WNLA 3KYMA 2RALA 4GKZB 4JRXB 3SDYH 2J88L 4MKTA 1HJCA 2P24B 3BWZA 4JRYB 4HWUA 1MI5D 2ZT9C 4QRRD 2W9LA 3BAXA 5HDQL 1H0DA 4WHCA 2GI0A 3O6LL 1UC6A 3B3IA 3ECQA 4W6WB 4FC3E 5FOBA 3Q8CA 5B8CB 1WFUA 4U3XA 4H40A 4J3UA 1F41A 2HRPH 3O3BA 1O7SA 4MA3B 3MRLA 4ZYKB 2N4IA 4WSKA 4LLWA 1KGCD 1R0AH 3D85B 4NENB 4P46B 3RDJA 3HB3B 3BN9D 1X7TA 1V3KA 3FOMB 5ES4B 3ULVE 1T1WB 4PJCA 3CBKB 1F4YL 4J4PC 4X5RA 3DX7B 2OMTB 4ZO7A 1K2DB 2AF2A 4OCLC 3FU0A 4FTVB 2DJUA 3JZ7A 1QG3A 3EADA 3V0HA 1A1NB 3CFKB 4PP1C 3V4VB 3VXSD 2D7MA 6PAZA 3NZ8A 4ZUUA 3EOTH 4OCNC 2EE2A 5BJTB 2EIEA 5EOQH 2D4DA 1FIEA 4Z3HA 1E5AA 1J5CA 2WZ5A 1ES0A 3FTGB 4HWZA 1IC4L 1PZ2A 1QRND 3PP3K 3HZVB 2F8XC 4JRYE 4ORZC 1PX4A 2E9BA 3C5ZD 3CSFA 5F3FA 4HPHA 1U8IB 3S34L 1BZOA 2Z8SA 3PUCA 4UINL 5AALA 1YEDB 2P5EE 1CK0H 5AFAA 4ZX4A 5CN3A 2DM4A 5JXAH 4JFDE 1HYRC 2GIYA 1EMTH 2D31B 1MJ7H 4P9HH 3MBEB 1TJHL 3S3BB 4R96B 5A2KH 1DBBH 1B90A 4CC4C 1UOLA 4KKQA 3ARBD 2W9EL 3QIBA 4QRAA 1ZGLA 2V9QA 1T7XA 5D2LE 3VFTB 3BZ4B 4L5FH 2NNAB 3GSWB 1SMAA 2HN7B 4XPAH 2WB1A 4NQED 1JK8B 2HRGA 1E7UA 2CRMA 2GSIA 1Q72L 3HS8A 2GUOA 5SX4H 3TIEA 5LHDA 4W70A 3UPAA 2P8PA 3QQ9D 1GS6X 4FMFA 3TBYA 3D09A 1MJ8L 1ZLSH 3MJ8A 4YHKH 4UDTA 3H9SE 4MVBC 4LEEA 2L3BA 4ADGA 5B1BB 4MJ5A 2AMUA 2EYRB 2YK1L 4GAYB 3FSAA 2QGEA 3QJRB 3NJNA 4QHMA 1J9TA 3I74A 5DYOA 3LQMA 5LCVL 3HZ3A 4GI9A 4WU7A 5LB1A 1EHNA 5CFAA 5T1LA 3PP3H 2AJYH 1WT5A 2VXVL 4AJVA 4FLSA 3A6CH 3BSZA 4ZMOA 5HYQB 4P99A 4E68A 4H26A 2MCG1 4PJGB 3VQ2C 3LIZH 2JKIS 2ADJB 4QO1A 3LKOB 3BEVB 1EO5A 3VXME 3HG5A 4MHHI 5F9OL 1AG0A 3WFCL 1NFDB 1GSKA 5ICYB 3UPRA 5I1GL 2BP3A 1PVHA 3EDFA 2F8IA 4HUNB 5JHBA 5ESVB 2BOBA 5AW1B 2AEOA 4HP5A 1Z9NA 3QJHB 4JY4A 4ZTPL 5A16A 1DYZA 5E1QA 3BZEA 3WJMA 1A6ZB 2EO1A 3N85H 2D03H 1N64L 3NAAH 4DP1X 3VXPB 4NIKB 4A7VA 3GMLB 4N6QA 3IBOA 2BP8A 3VXMD 2FYVA 2EIZA 2GEEA 2IXQB 3OLIA 1HINH 3S36X 2VLRB 4WHYG 2FR4B 1UM5L 3MLYL 4WTZA 4R2GD 4P2QB 2ZYRA 4W6YB 5FA3B 5SWQA 4JDZA 3ULVF 1YSOA 3MYZA 2FYYA 3QUXA 4UQDA 1A14L 4TS6A 1AD0A 2CR3A 5TE7H 4XMVA 4TQEL 1XF3A 4TF4A 4N8VA 3ELQA 1KPUA 3U6RB 1AACA 3A6BL 3CXDL 4X0KB 1MY7A 1YECL 5KVDH 5F9OH 1T1ZA 1UXSA 1QSZA 3GEFA 1C1EH 1MNNA 3TONA 1WZKA 3P4OA 3EUUA 3K81A 4UOW0 3R4RA 1OPOA 4FYTA 4KRNA 1A1MA 4Y5VA 5F7DB 3WUZA 4Y9BA 4PD4K 1UJ3A 1E40A 3F7VB 3SO3C 1KIRB 4KDTA 1XHHA 3K74B 1XGZA 1FA4A 1NGYB 3DARA 2WO3B 3V2AR 5MHSE 1UHVA 1BLIA 1P7BA 5KBNC 4Z18A 4BELD 4GINA 3QXWA 3L3HA 1NZRA 5DJ2A 2Y25A 2XX0A 4UM9B 3LVEA 5ANMB 2HTLC 1TTCA 5IVXB 4B41A 3MUGA 3S37L 1UH4A 3ZE0B 1R19A 2MWCA 4LSRL 4Y5YC 3A6CL 3PAVA 3MA9H 3WUWG 4AGNA 1MSPA 3HAEH 2WVUA 1RIHH 4YGVB 1EMTL 1TTRA 2FJFA 1KDJA 1BWWA 4NNPL 1G9ML 1KCLA 5B3NA 2DM7A 2V2XA 4M9PA 4JO5A 2HT2D 3D4GA 2HZHA 4Z9KB 3H85A 3QRBA 4YHKL 2AV7A 3OHXC 1X5FA 4YIQB 1EO8L 5DRXA 1DANU 3B2UD 3TEYA 2B39A 3HZYB 2K7QA 4DP8X 1Q72H 3MXWL 5IVXF 1OE1A 3LB6D 3QXAB 2B59A 2X87A 5DC0A 3VGBA 2ENYA 5FYJE 4KITB 3IT8D 4XC3L 4PJEF 4F80A 2EEBA 5CSZB 1O5DT 5ACMA 4OD1H 3EYVB 4MFHA 3KMDA 1OGTA 4UMSA 3DIFB 1BAGA 4HJ0D 1ZSHA 3G5WA 3UTZB 4X9FA 5IROA 3EJPA 2R4RH 1S7VA 3FT0A 4W1TA 4MDIA 4PJBF 1BQ5A 3K6OA 1R0AL 1EPFA 3N2JA 3NH7H 1IEBB 2RCSH 1A4KA 1CE1H 4JDEA 3SYOA 5BVJA 4DZ8A 4TUKH 4WWOA 1IJNA 5D7IE 1AAJA 5L7XH 4RBPK 5I73B 3Q2WA 4S1QH 3T0AA 3QORD 5AD0A 5ALBH 2JJSA 5DD0L 4KZDL 3ECBB 2ZCKL 4N0YH 2PUQT