3AAPA

Crystal structure of lp1ntpdase from legionella pneumophila
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
353
structure length
353
Chain Sequence
KHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
total genus 105
structure length 353
sequence length 353
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aapA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aapA02
2P9IB 1NGBA 5KPZA 1NGJA 1NGFA 3H45C 1KAYA 3LDLA 2HF4A 2I7NA 4K43A 4WQ4C 2E2PA 5FPEA 4BRFA 3FE1A 4BROA 4B1VA 3FZKA 3W0LA 1MA9B 4EAHD 1NLVA 5BRDA 2YJEA 5E26A 3GL1A 4K41A 5AQQA 3H3NO 4MLHA 1X3MA 4BG8A 1NGCA 1YVNA 4EHTA 2CH5A 3CQYA 3CERA 5CE3A 1RDWX 3WQUA 2GWKA 2QWNA 4H5VA 4XH4A 1OKJA 2P9PA 3D2EB 1HKGA 5EVZA 1BDGA 3U4LA 3VPZA 2ASPA 2ZF5O 4Z94A 2P9LB 5LJVA 3MN6A 3A5NC 5ADXH 5AQNA 3KHYA 2YHYA 5AZJB 2P9SA 5BREA 3DXKB 1QQMA 2AA4A 3SLCA 1GLJO 3VEOA 4CZGA 5JLFA 4FO0A 3SJHA 5EX5A 3J8AA 2Q97A 4B1YB 4AM7A 5KPTA 4LC9B 3EKUA 5AFUA 1NBWA 1NGDA 5AQHA 1ATNA 2V52B 2GWJA 3VETA 2ZGYA 3CJ7A 4A2BA 1ZC6A 2V7ZA 2V51B 1XUPO 4L3QA 5BPLA 3HSCA 4H0XB 2E2OA 2GTDA 3ATUA 4CI6A 3MN7A 1GLFO 1QZ5A 5AQFA 4ISEA 4BC5A 3WXKA 4A2AA 4BRCA 3GE1A 5KQ8A 4FWSA 3O08A 1DKGD 3P4IA 4Y0WA 1BG3A 5BPNA 4M63C 4I6MB 2YHWA 2ASOA 3SMPA 4BVPA 1WOQA 5I9EB 3VERA 4C23A 4H0YB 1X3NA 5BPMA 3TU5A 3LDOA 4NO7A 4BR9A 2P9KB 2IVOA 4FWKA 2PBDA 4CD1A 3H3OB 3LL3A 4BC3A 5AQZA 1GLLO 1Y64A 4K25A 2FSJA 2J4RA 2YJFA 1E4GT 1BUPA 1G99A 1WUAA 3WEEA 3O1BA 3H1QA 4DHYA 1HKCA 3A0IX 4CJ7A 3O4WA 4CZMA 4BR2A 3BF3A 4PL7A 2OANA 2VWBA 5E84A 4GNIA 2QWPA 1NGAA 1J6ZA 1NMDA 2A6AA 3KVGA 4I6MA 4QS8A 5AR0A 5AQIA 4CZHA 4RCHA 3WXLA 4BRDA 1H1VA 4ISGA 1HX1A 2CGJA 1JCFA 3LM2A 4WQ5C 3I33A 4BGBA 5AZJA 2VCPA 4BRGA 3ZETA 2QM1A 1V4TA 5AQOA 1C0FA 4BC2A 2P9NA 2E88A 1DGKN 1NGIA 2FF6A 2GUPA 4FWOA 4O5FA 3EZWA 1NWKA 2Q0UA 3O1WA 2NRHA 2E2NA 4IWVA 1Z05A 1CZAN 4BQLA 2Q31A 3IDHA 2EWSA 4ISFA 2QWRA 3ATVA 4BRHA 1X9JA 3VOVA 2DPNA 3AAPA 1HPMA 3MN5A 3O6WA 4FSVA 3UB5A 2PAVA 1R59O 2Q0RA 4F9OA 5AQPA 4BR7A 5AQXA 2FF3B 4BGAA 1ATRA 2QXLA 4IO8A 3ZEUA 1IJJA 1D4XA 3EN9A 2FXUA 2E20A 1P8ZA 5ELZA 5BRHA 2CGKA 3D2EA 1SZ2A 3MK6A 3M3ZA 4CBUA 1JCEA 3EO3A 1HJOA 1U6ZA 3A5LC 3D2FB 3CJAA 1XC3A 4IXCA 4XEIA 3RSEA 3CJBA 3O8MA 3AAQA 3EL2A 3UE5A 5KPRA 1ATSA 4FWQA 2V7YA 3QICA 3U9ZA 3LDQA 4YDUA 4KBOA 1BA1A 4JAXA 3L4IA 3O5BA 4PKHA 3VF6A 4BC4A 4EFHA 5AQWA 3VENA 1S3XA 3IFRA 4B9QA 4BRLA 4H0OA 3WXIA 2HMPA 3ID8A 3EKSA 3ULEA 3M1FA 3RSEB 1HUXA 3WT0A 4CZIA 1MDUB 3VEYA 3VEWA 2D0OA 1DEJA 4H0TB 5AQYA 4EIAA 1ZBSA 4B1WB 3G25A 2Q2RA 3WQTA 3BP8A 3UKRA 4FPAA 3WUHA 4B1XB 4H0VB 3MCPA 4IZ9A 1GLEG 4WQ4A 3CHWA 3TPQA 4BVOA 4IJNA 3W3DA 5FPNA 3LDNA 2A5XA 2F9WA 5F0XA 1MWKA 4FWNA 2A3ZA 3GG4A 1K8KA 4JD2B 4BRMA 1SQKA 3KZBA 4H5RA 2A40A 3DAWA 3FR0A 2I7PA 5F1XA 3FLCO 4RWTA 3VGMA 5EY4A 2CH6A 5ADXA 5AQTA 1KXPA 3D2FA 1KAXA 3CI5A 5BRFA 4MO5A 3CQXA 3DXKA 1QHAA 3L6QA 5AQUA 3UKUA 4JNEA 2D1KA 2ITMA 2HF3A 1XQSC 4BREA 5JMVA 2D4WA 1NGEA 3CJ9A 4CBWA 2F9TA 1YAGA 3ZX0A 3ENHA 3FZLA 4FWMA 3IUCA 3U9DA 5BR9A 2QWQA 2P9LA 2H3GX 3A5OC 4YDUC 3B8AX 1Q18A 4A62A 1LCUA 1JCGA 2P9PB 4BRAA 3LM9A 4AM6A 1V4SA 4BRQA 5LJWA 1HKBA 4FWRA 2ASMA 3HTVA 1T6DA 1BOTO 1KAZA 4M7YA 1K8KB 4M7XA 3HM8A 1T44A 4MO4A 5AQSA 4FPBA 3H1VX 4CZFA 4BRPA 5FPDA 2E1ZA 3DJCA 2E8AA 2Q1NA 3JXUA 3HI0A 4PL8A 3QDKA 4BRIA 1SAZA 4B1ZA 5AZIB 4QS7A 4JHDA 3BF1A 2E2QA 2P9KA 2W41A 4DCHA 2UYTA 3UKRB 5F2RA 2WUSA 4HTLA 2ZWHA 1C0GA 1RFQA 2AP1A 4K42A 2HOEA 2QWMA 3AARA 2P9IA 4CZEA 2ZGZA 5FPMA 1YXQA 2QWOA 1BO5O 4NB4A 3WEEB 3UKUB 1TUYA 5AQRA 4IJAA 3FGUA 4XH5A 4B1UB 3WXJA 1TYQA 1LOTB 5BN8A 2P9UA 2D0PA 4FWLA 2E1YA 4BQZA 4H5WA 3U8XA 1TYQB 4BR0A 1GLBG 3C0BA 4DB3A 3VGKA 2GEMA 4FWPA 5JLHA 1U2VA 4CD3A 1ZXOA 1RGIA 4WYBA 3BEXA 1U2VB 2YCHA 2FSKA 3BUZB 1MWMA 1GLCG 3QFPA 1EQYA 2Q36A 3ZEUB 1QQNA 4BG9A 3FZMA 3F9MA 3FFKB 1BA0A 4H5NA 2IVPA 3DXMB 4O8KA 1BU6O 2W40A 3R6MA 3R8EA 3CJCA 5AZIA 1NM1A 4RTFD 5AQJA 4CZJA 3VESA 5TKYA 5KQDA 3SMSA 1NGHA 1NGGA 3SK3A 4CBXA 2FLOA 2YI1A 4BRNA 2P9NB 2NLXA 1TUUA 3A5MC 3VEZA 3MMVA 3VF4A 4PKGA 5AQMA 2IIRA 2KHOA 5EXWA 3H46O 3C7NA 3HBTA 4H5TA 1S22A 2CGLA 2NZTA 4JHDB 3QBWA 3C7NB 1GLAG 5EOYA 4DQ8A 4E1JA 2VYPA 4A61A 5JICA 5AFUH 3QFUA 2BTFA 2QWLA 2QW9A 4XH1A 4JN4A 5AQVA 4BR5A 4H03B 4FOEA 1HLUA 2YHXA 4FL9A 3D7EO 3MN9A 5AQKA 3VF2A 4HWIA 3H6EA 4J8FA 3CETA 3OHRA 3ZX3A 4CZLA 4FOIA 3FZFA 3QMLA 4MLEA 1T6CA 3LDPA 4JD2A 1QZ6A 4BR4A 5LY3A 3DXMA 3HZ6A 2A41A 4WQ5A 3VEVA 1ESVA 3MDQA 1BWFO 3FZHA 3GDQA 3QBXA 3ZETB 3ZX2A 3VEXA 4EHUA 1YUWA 3QB0A 3JS6A 1GLDG 3A8YA 3O80A 3VGLA 4GY2B 4PKIA 4CZKA 5AQGA 3GOIA 3IMXA 2FSNA 3L0QA 5BN9A 3CIPA 1QQOA 3ULEB 3GBTA 2GELA 5AQLA 2A42A 2IVNA 2P9UB 3I8BA 3R9PA 3DWLA 4H0PA 4BRKA 4QS9A 1E4FT 2BUPA 2P9SB 5B8HA 3AY9A 3M6GA 3CJ1A 3ENOA 1Z6RA 1IG8A 3S41A
chains in the Genus database with same CATH superfamily
3NVKA 1W9HA 1NGBA 3KD5E 1JXBA 3THXB 3WXMB 1KAYA 3QINA 3AA5X 4W5RA 2HF4A 3I0RA 4J2DA 4B3RK 1S5JA 2W42A 2F96A 1VHXA 1JLQA 5FPEA 4X62K 3SJJA 1MA9B 4EAHD 3RMBA 4NCAA 1XI1A 5C24A 4B3SK 4B9LA 3ZT3A 3U3YA 2OYQA 3MAQA 4BG8A 1RBUA 5GAGP 2ZJPL 4EHTA 2X6SA 5CE3A 3K0SA 1RDWX 3LZJA 2GWKA 4YOUA 4BE0A 4O4GA 2Y1JA 2WFBA 3SUQA 2NNWA 3U4LA 1RT7A 2ATQA 1XHZA 4Z0UA 2HBKA 3IG1A 5LJVA 1TGOA 3VQQA 3LDSA 5ADXH 4WFBL 1BCOA 5AQNA 3KLHA 5AZJB 3E9PA 1FKOA 3VEOA 2VG5A 4I9QA 4FK0A 2Q97A 4FM0A 4FJLA 3Q7BA 1WAFA 1UWBA 1NGDA 5AQHA 1RDUA 1A5VA 3CJ7A 4DFKA 2HHWA 2V7ZA 1XUPO 3DLKA 4DU3A 3VTHA 3TI0A 3DLHA 1QZ5A 4DUZK 1QTMA 1YT3A 2P5GA 4BC5A 3I8DA 4BRCA 2OPPA 1VQON 4EZ6A 1DKGD 1SUQA 1BG3A 4FLVA 4M63C 4ZTFA 3L3VA 4BVPA 3PSFA 4MDAA 4C23A 4H0YB 4HUFA 5IWAK 3LDOA 1RDBA 4BR9A 2P9KB 4CD1A 3H3OB 5AQZA 4OGEA 4X66K 2IAJA 2YJFA 4JKCA 1BUPA 1G99A 1WUAA 3WEEA 4DSIA 4BR2A 4GNIA 3CPWM 2QWPA 5AQIA 4M3UA 3B6OA 3ZT2A 4KO0A 3WXLA 1N8RO 1H1VA 1HQUA 1HX1A 4C8MA 1JCFA 3LM2A 3ZLJA 3I33A 2VCPA 4BRGA 1L3VA 4FJ9A 4DR1K 1Q9XA 2DFHA 1J5EK 5AQOA 4JK9A 2P9NA 3EZWA 3CF5L 2NRHA 1KFDA 4IWVA 4KKOA 2QK9A 2UXCK 2RE2A 4E3SA 4BQLA 3EE8A 2NRTA 1U49A 4CJ5A 1XMQK 3O6WA 1SKRA 2Q0RA 3K5MA 2HHUA 2NRXA 5AQPA 4BR7A 3HL8A 2QXLA 1T7PA 3ZEUA 1SL2A 2X6NA 1YF5L 5ELZA 5BRHA 5K14A 3K5LA 2CGKA 5LMNK 3SV3A 3OYLA 2RPIA 1U6ZA 3A5LC 4I7FA 1YI2N 4GKJK 3CJBA 4LSLA 1YITN 1ATSA 3PLAA 3A2FA 2BGGA 4CCHA 4OVLA 4AF1A 3U9ZA 4CJFA 1RCHA 3ZYYX 3VF6A 3O5BA 5HRPA 3IFRA 1T05A 3EKSA 4FLWA 3NE6A 3L8BA 4CZIA 3VEWA 5H1SQ 4HTUA 3C6TA 4YOWA 4B1WB 1W7AA 1Q8IA 2RN2A 4DSEA 4FJIA 1WNSA 3BP8A 4FPAA 1JKHA 4B1XB 4YOVA 2YV0X 1GLEG 4I2QA 4FJHA 4WQ4A 3CHWA 4KHQA 2BANA 3W3DA 2A5XA 2F9WA 4B9TA 1MWKA 2A3ZA 2NRZA 2VGNA 4JI7K 1TKZA 2A40A 4M3WA 3FR0A 3QEXA 2I7PA 4RWTA 5ADXA 5LL6Z 4FJXA 3K5OA 3ALYA 4DQQA 3TTFA 2HHSA 4MO5A 3DXKA 3HP9A 1QHAA 4G9ZA 3HPGA 1TKTA 3L6QA 4G1QA 5AQUA 3PUFA 3UKUA 5FRMA 4HUGA 2ITMA 3PIOL 5IT9O 1XQSC 1U47A 5SZTA 4BWMA 3T1YK 5CYQA 1RTHA 4CBWA 1C0TA 3ENHA 3FZLA 3IUCA 3A5OC 3RR8A 1XNRK 1FXXA 3ENBA 4E89A 4DQSA 4BRAA 3LM9A 4AM6A 1N5YA 1ASUA 4BRQA 1W2BM 1TL3A 2ASMA 1KAZA 3M5RA 5CR4A 4FLUA 4KPYA 4FPBA 4R5PA 4DMNA 5D3GA 2E1ZA 4J2AA 1T8EA 2Q1NA 1UA1A 3RRHA 5AZIB 3MXIA 2E2QA 4I2PA 4DCHA 2YHBA 3MXJA 3UKRB 4W5NA 1DTTA 2WUSA 3OBWA 2BDPA 4JKFA 1IKYA 3M8RA 2AP1A 4QCLA 1VRUA 4CFBA 1NKCA 1IBKK 4FJJA 1VSJA 3CFOA 1VQ5N 1EO1A 1C1CA 3AARA 2Z1HA 2OTLN 2QWOA 2UXDK 5I42A 4O44A 2OZSA 3UIQA 4Y1CA 4DTPA 4IJAA 1NOYA 5M1PA 3EZ5A 1LOTB 1JLCA 5BN8A 4CHQA 3DOLA 4Z4EA 4CJLA 3BZKA 3ISNC 1YIJN 4FLTA 1GLBG 3H08A 4IEEA 3C0BA 4DB3A 3VGKA 4FWPA 3CC7N 4JV5K 4CD3A 1RGIA 3LP2A 2KQ2A 2BH1A 3BEXA 4WYBA 4JI8K 2YCHA 4BWJA 3QFPA 4JI4K 3CFRA 3ZEUB 4BDZA 3AV9A 4C8OA 4CGIA 3DXMB 4FW1A 4AHTA 4PY5A 1WSFA 1NJWA 3SI6A 1KQSM 4E7HA 2QTDA 4JYAK 3C95A 3SMSA 2OPRA 3CMAN 3G0ZA 5MLCQ 1IKWA 1J54A 1BHLA 3V4IA 1QSLA 4JLHA 4DTSA 3MMVA 3VF4A 4PKGA 5HROA 5AQMA 1EX4A 2IIRA 2KHOA 3V9WA 3P38A 3H46O 3HBTA 1S22A 1RTIA 2NZTA 4JHDB 5EU7A 4JI0K 1GLAG 1OVQA 4CEFA 3DM2A 5JICA 3NGZA 4WFAL 2QWLA 2FBXA 4AHCA 2YHAA 1HLUA 4K8XA 4FJ5A 1T03A 5HRSA 4FJ7A 4Q5VA 4OX9K 4KHUA 1BI4A 2HNDA 3C6HA 3O9RA 4B9SA 3MWPA 4IFYA 3V9SA 3QMLA 4YOTA 5J2NA 3LDPA 1QZ6A 2LSNA 5LY3A 2BE2A 3HZ6A 2A41A 4WQ5A 4X64K 3PO4A 4B8CA 4KB0A 2G8KA 3MDQA 3AVFA 1LW0A 4O8UA 5TKWA 1WSEA 3AVNA 3QBXA 3V1RA 3ZX2A 1YJ9N 3TSQA 3OY9A 1YUWA 1TK8A 3JS6A 1IKVA 1LAVA 5LMUK 3MEEA 4GY2B 2IGIA 3J81O 4YHHK 5BN9A 2GELA 2IVNA 5KTQA 3I55N 1E4FT 1EP4A 1S72N 2AJQA 2PYJA 3ZSWA 4OO1J 3LPUA 3AY9A 3M6GA 3ENOA 3IS9A 1Z6RA 1IG8A 5C25A 3I0SA 5M1KA 3ZCMA 1NGJA 1KVAA 1N36K 3K5NA 2QKBA 2HBMA 2HHQA 4K43A 4KHPK 4ELUA 2D0AA 2QXFA 4YORA 4CJQA 5HRRA 3OVNA 4BROA 1X9SA 3FZKA 1S6PA 3NF9A 3RRGA 3WNEA 4IDKA 2HHVA 4MDBA 5AQQA 3H3NO 4HUEA 3VA3A 1XMOK 2GX9A 1NGCA 4FVUA 1C1AA 1NJZA 4M41A 1NK8A 3LP1A 4CFAA 2QWNA 4H5VA 4XH4A 4PQUA 4CJ4A 2JWLA 1HKGA 5EVZA 1BDGA 4DTUA 2ASPA 2ZF5O 3G4SN 4L8RB 2F8TA 3QEWA 4CK2A 3DLRA 1LV5A 2KFZA 2OTJN 3KHYA 4CK3A 4A57A 5KI6A 3DXKB 3KIOA 3SLCA 1GLJO 4PUOA 3AVJA 4FO0A 4N56A 4LFBK 2YX6A 3J8AA 3L3UA 1L3SA 3M8SA 4F8RA 4WF9L 4KFBA 1F21A 1JLBA 2ZGYA 3OYNA 4CFDA 3K9JA 5KRTA 2V51B 4CI6A 3ATUA 3VN5A 4B9NA 4DUYK 5AQFA 4BY9C 3VA0A 4AH9A 3NF7A 3KLIA 1P90A 3P4IA 1W0HA 3P5JA 4I6MB 2YHWA 1JLAA 1RDCA 4CEBA 2KZMA 5BPMA 3NHGA 2IVOA 3LL3A 1Y64A 3AVKA 2FSJA 1E4GT 4CHZA 3O1BA 2WTUA 1C0MA 3H1QA 4HCCA 1S1WA 1HKCA 3A0IX 4CZMA 4PL7A 1GOAA 3L2QA 2VWBA 5E84A 3CMEN 5DK5A 2EX3A 3E1YA 1NMDA 2A6AA 3HXMA 1O13A 4DTOA 4BRDA 3CCUN 2CGJA 4KH4A 1RT6A 4M3YA 3CC2N 1V4TA 4BC2A 1C0FA 2UUCK 1DGKN 1VSMA 2O8FA 2Q0UA 1A5XA 2RKIA 3NH1A 1CXQA 4O0IA 4E7LA 1Z05A 4DTRA 1WSHA 2FBVA 2Q31A 3IDHA 2EWSA 4ID1A 4BRHA 3OYJA 3E9OA 1NKBA 3R3LA 3VOVA 3AAPA 3F9KA 1LWFA 1HPMA 4JKGA 1RTDA 3T69A 5GAEP 4OJRA 4FSVA 3MXMA 1SL0A 4CEZA 2JLEA 3NMUA 1ILYA 2B6AA 3PY8A 3RTVA 4DSLA 4FJKA 2HMIA 4IO8A 4LFCK 3EN9A 2FXUA 2E20A 4WFNL 3AVLA 1UOCA 3C94A 3KWIA 4AHUA 4FCYA 3D2EA 5GAHP 4CBUA 4CJPA 4DTJA 1IV0A 1C0UA 1XC3A 4H4MA 3VQ5A 3RSEA 3O8MA 3AAQA 3UE5A 5KPRA 5M1QA 4F3OA 2VWKA 1WBBA 3LANA 3LDQA 4C8NA 3NDKA 4BC4A 1D9DA 4B9QA 2O4IA 4ID5A 2O4GA 4E1MA 3NGIA 1UA0A 3ID8A 4DG1A 4CERA 3WT0A 4H0TB 1Q7YO 3AA4A 1ZBSA 2NRVA 1HYVA 3VQCA 4CECA 3VQAA 3WQTA 1S1TA 4DQIA 2VG6A 4CJSA 5JVHL 3MCPA 3V1OA 2RF2A 2W6KA 4TSXA 3OYHA 1LWCA 5FPNA 3LDNA 3O9TA 3VTIA 5F0XA 4A59A 3SQ2A 3ITHA 2G8VA 3VQ7A 3DAWA 3TAQA 3FLCO 3K59A 1JXEA 5EY4A 3G6EN 3VQ9A 1S1VA 1KXPA 3V81A 1KAXA 4CF1A 3CCLN 1VQMN 4IO9L 3QEPA 4CE9A 2D1KA 4K8ZA 4BE2A 4NYFA 4BREA 1HJRA 4LF7K 3VQPA 1FK9A 4CJKA 1GOBA 1RT3A 3CJ9A 4DR7K 2F9TA 4NYNA 3AVAA 3P1GA 4CHOA 4DV3K 2P9LA 2H3GX 1J9AA 3OYCA 4HHTA 3B8AX 4CF8A 4FVMA 5FLXO 1LCUA 1FW6A 3ZSVA 3OYBA 4EP5A 1V4SA 5LJWA 4RW9A 1HYSA 4OPAA 3S3OA 4FWRA 3T3FA 4M7XA 1K8KB 4M42A 1T44A 3H1VX 3OYKA 1VRTA 4RW4A 4DU1A 3JXUA 3HI0A 1J53A 3QDKA 3NCIA 4BRIA 1SAZA 4B1ZA 3BF1A 2P9KA 3KLGA 4C8KA 2KW4A 1RFQA 3LP0A 4B9UA 3THXA 4K42A 3KWGA 3KK2A 1KTQA 2ZGZA 4CHYA 1VQ8N 1L3TA 5C10A 3WEEB 2E4LA 3WXJA 1ASWA 1TYQA 2P51A 3VQ4A 2G8FA 4RW6A 4RW8A 1KSPA 2X74A 2E1YA 1R0AA 2EHGA 1HR0K 1TYQB 4BR0A 3KK1A 4DFPA 2UU9K 4KTQA 4O0JA 4CGJA 2HHHK 1ITGA 4OLAA 1U2VA 3HPHA 1EWQA 1U2VB 4UY8O 3HVTA 4RG8A 1QQNA 1VK0A 3FZMA 2OA8A 1T3VA 1JL1A 3D6RA 1BU6O 5C12A 2W40A 2HNZA 4IEIA 5AZIA 3AGRA 2DFEA 4RTFD 5BR8K 1XC9A 4CZJA 3OW2M 3QEVA 4DS4A 3E01A 5GINA 2YNFA 4PHTX 1N32K 5A2QO 1VQ4N 2FLOA 4HVJA 4CEQA 4BRNA 2NLXA 1TUUA 3U6FA 3TWHA 2QA4N 3VEZA 3RMAA 4U7BA 3IKMA 4LD0A 4BDYA 3QBWA 3AVHA 4DQ8A 4E1JA 3AA3A 1VQNN 4M3TA 4WCEL 4JN4A 1B9FA 1VAZA 4DR4K 4FJGA 3WNHA 4FL9A 4LH4A 5AQKA 3ZSYA 3CQ8A 4HWIA 1DLOA 1EXQA 4H4OA 4J8FA 2HNYA 3ZX3A 3N4QA 4KREA 1NJYA 1EETA 3CPEA 1VSKA 4MLEA 2OPSA 4DWIA 3P39A 3DXMA 2GUIA 5M1FA 4W5TA 1XNQK 1BWFO 1EKEA 2O8EB 3ZETB 4QOZB 2PY5A 3VEXA 1NJIO 3HOSA 4IDHA 3IAYA 4JS5A 3TTCA 1NKEA 1GLDG 2QEXN 3O80A 3CCSN 1TKDA 4PKIA 4A5BA 4DTMA 4N41A 1N34K 2FSNA 3L0QA 5KGXA 3GBTA 3T1HK 2HVIA 2X78A 3KLFA 4CEDA 1L3UA 4CJWA 4H0PA 4OKEA 3ZT0A 4OKKA 1HRHA 2GBZA 2P9SB 5B8HA 2ZJQL 1OVYA 3CJ1A 3S41A 4XIUA 5J2QA 3MCAB 1NGFA 3H45C 4NXNK 3LDLA 4R79A 1HYZA 3PIPL 3HOTA 5HLFA 2I7NA 1VQKN 2E2PA 1B9DA 3JSMA 1HNZK 4BRFA 1NMNA 3LAKA 1BI4B 4CEAA 3O9QA 1NLVA 3DLGA 3O3HA 2YJEA 4W5OA 3CFPA 3CYMA 4LSNA 1D5AA 5DMRA 1YVNA 4JRQA 3B6PA 4W5QA 3AVIA 2CH5A 3CERA 3CCJN 3WQUA 3TABA 1X9MA 4BE1A 1N6QA 5C42A 4DF4A 3VPZA 3EEQA 2P9LB 1RTJA 1JJ2M 3ZT1A 3MN6A 4F2RA 1VSIA 2VWJA 5JS2A 2IS3A 2P9SA 5BREA 1QQMA 3D45A 2DY4A 1WBDA 4CZGA 4O55A 1OH7A 4GV3A 5EX5A 4B08A 4JKGB 3P31A 1FKPA 4AM7A 4WE1A 4EZ9A 3EKUA 5AFUA 3SQ0A 3N4PA 3OYEA 1ATNA 3OS0A 2GWJA 4DV6K 3S9HA 4Y1DA 4AHSA 3M8PA 1ZC6A 3RVCA 1RILA 4L3QA 2O8BB 5BPLA 3HSCA 2E2OA 4B9VA 4IFEA 1NOZA 3MN7A 2O8EA 4FJNA 4ISEA 1VQPN 5KQ8A 2R7YA 4FWSA 3O08A 4N76A 3HP6A 4Y0WA 5I9EB 1TK5A 1WOQA 1NU0A 3VERA 1S9GA 2Z1JA 3MX2A 2O8CB 3TAFA 2IDOA 3TU5A 2Z1GA 2XY8A 3THVA 2PBDA 4E7JA 4F4KA 2FBYA 5HOOA 4DF8A 1Z25A 5HL7L 1ZBUA 1S1UA 4CJ7A 4DR5K 3O4WA 4OPHA 3BF3A 4Z4FA 1HNXK 2DFFA 1NGAA 4BDPA 4JK7A 1J6ZA 5AR0A 4CEOA 3QERA 4CZHA 4Z4HA 4CVNE 1UAXA 1RT5A 3SYZA 3THWA 2Q3SA 2O8DB 4M3ZA 5JS1A 1HMVA 2O8BA 3ZETA 2QM1A 2QKKA 4LF4K 2E88A 2FF6A 4FWOA 4O5FA 3PX4A 3O1WA 4LY7A 2E2NA 3V1QA 2ZD1A 4IKFA 1VSHA 2QWRA 1KLMA 3J7YP 1NK7A 4ILGB 4GV6A 3QETA 3SQ1A 3DYAA 1R59O 5AQXA 3KLEA 1ATRA 1CZ9A 1IJJA 1D4XA 1D8YA 3QO9A 1P8ZA 3QNOA 3CG7A 3EYZA 1SZ2A 1WLJA 4DQRA 1IG9A 4ILHA 3CM5A 1JCEA 3EO3A 4LF5K 5AJ3K 3HO1A 1HJOA 2G8HA 1Q82O 1QS4A 4IXCA 4XEIA 2I5JA 2YNIA 3TR8A 3E66A 3EL2A 1IH7A 5C0YA 4FWQA 4GW6A 1Z26A 2V7YA 4JI5K 3AVCA 3QICA 4YDUA 1YVUA 4DV2K 3HJFA 5CYMA 3L4IA 4PKHA 4EFHA 3VENA 4H0OA 3WXIA 1NNEA 2HW3A 2HMPA 2HSTA 3ULEA 1VSLA 3M1FA 4JK8A 1HUXA 1MDUB 3VEYA 4OKJA 1IO2A 1Y97A 1DEJA 4EIAA 3AO4A 3G25A 4FK4A 3VQBA 3L2WA 4LF9K 4DV7K 4H0VB 4CJVA 4IZ9A 3AO3A 4BVOA 3VQ8A 4IJNA 3O9UA 3GG4A 1K8KA 1TAUA 1IKXA 1SQKA 4BRMA 3KZBA 4JKHA 3C65A 3BDPA 2CH6A 3THYA 1YJWN 3PO5A 3PV8A 3D2FA 5BRFA 3CI5A 3BY5A 1WSGA 4FLZA 1IBLK 4B3MK 3C6AA 3CC4N 4DLEA 2HF3A 1SKSA 2D4WA 4KTZA 3O9SA 4ELVA 3U9DA 5BR9A 2WBNA 2QWQA 4YDUC 1SV5A 1Q18A 4A62A 1RBSA 3J7AP 2GV9A 4YOYA 4AHRA 4KHYA 1HKBA 3VQEA 3DRPA 2B5JA 1JL2A 1T6DA 4AILC 1BL3A 3SUOA 1U04A 3AO1A 4M7YA 2RHKA 3KKRA 5AQSA 1X1PA 5FPDA 3TAGA 3F73A 2E8AA 1ZBFA 2UUBK 4PL8A 4CIEA 4LF6K 1RBTA 4QS7A 4CJEA 3DLLL 2UYTA 5F2RA 1HNIA 2YNHA 2ZWHA 4CJUA 3KD1E 3CCQN 4DSFA 4JKBA 2QWMA 4E0DA 1VQ6N 3LWLA 1D9FA 4IOAL 1YXQA 4IG3A 3LAMA 3OTOK 4FM2A 4DTNA 1VQLN 1TUYA 5AQRA 1OH5A 4XH5A 4B1UB 3LZIA 3L4QA 2PFUA 3TTDA 2P9UA 4NCGA 4X65K 3U8XA 1Q86O 1N33K 5CZ1A 1KLNA 4DTXA 4FZXC 4ZTJA 2GEMA 5JVGL 5JLHA 1S6QA 4KRFA 4LH5A 1SKWA 2NRRA 3SAHA 4E7KA 3SZ2A 3TSPA 4YNQA 2FSKA 4B8AB 3BUZB 1MWMA 3HRGA 3JYTA 4DU4A 1GLCG 4E7IA 3QIPA 4BG9A 4KHNA 4CF2A 3OS1A 3F9MA 3M8QA 4H5NA 2P1JA 5E41A 4NLBA 5M1NA 3I56N 3R6MA 3R8EA 3CJCA 4DS5A 2WC9A 3WNGA 4MFBA 5AQJA 1ASVA 3VESA 5KQDA 3T1AA 3ZSOA 2OCEA 1NGGA 1I3AA 1VSDA 1IBMK 1DT9A 2KFNA 5HBMA 3HYFA 3SNNA 1DTQA 3NVMA 5FRNA 3OS2A 4DSKA 5EXWA 1A5WA 4H5TA 2CGLA 3OYFA 3THWB 4DV0K 1BGXT 2F4VK 2YKNA 5EOYA 4JKEA 4A61A 4I9LA 1L5UA 2W6LA 1CLQA 2BTFA 2QW9A 3P83D 1KC8O 4H03B 1YTAA 4ZHRA 3D7EO 2UUAK 1KCFA 3JAMO 2A1RA 3H6EA 3OHRA 3AA2A 1REVA 5SWMA 2VG7A 4FOIA 1QSYA 1BCMA 1VQ9N 5GIOA 4JD2A 3O4QA 4NXMK 4M3RA 3T7ZA 3PX6A 1I39A 4C8LA 3OBYA 1B92A 4DV4K 3FZHA 3GDQA 1YJNN 4JI1K 5CHIA 4EHUA 4FM1A 3A8YA 4OPKA 3VGLA 1TVRA 2F7TA 4JKAA 5AQGA 3TSUA 3QNNA 3QLHA 4CGFA 1U45A 3OYMA 3K9KA 2NRWA 3AO2A 3CIPA 1QQOA 2UXBK 5AQLA 4DR6K 2A42A 3I8BA 2P5OA 2ETJA 3RWUA 4BRKA 3KJVA 2F8SA 3MECA 4O5BA 4C1NI 2Y1IA 3ZSRA 1CZBA 4DLGA 2P9IB 4CGGA 3KK7A 4J2EA 4C1NK 5KPZA 2O8CA 3OYIA 3G71N 3RMDA 3SCXA 2A1SA 1C6VA 1WSIA 3HK2A 4WQ4C 1S1XA 4Z4CA 2FC0A 3FE1A 3J80O 4B1VA 3W0LA 2HB5A 5BRDA 5C2FA 3CCMN 5E26A 3GL1A 4K41A 3TARA 4PWDA 1QHTA 1YTUA 4MLHA 2KZZA 1WSJA 1X3MA 3K57A 3K58A 4F2SA 3CQYA 1GOCA 2D0CA 1NK0A 1OKJA 2P9PA 3D2EB 3NBPA 3HSTB 5C2DA 3D0PA 1OH6A 3PSIA 4Z94A 5J2MA 4CESA 1BQNA 4M3XA 3QEIA 3A5NC 4FJMA 2YHYA 4KI4A 3SBTA 2AA4A 5C15A 5JLFA 3SJHA 3LP3A 1JLEA 1RT4A 1BISA 4CIFA 2G8UA 3MWTA 2ZJRL 2IOCA 4B1YB 2XO7A 5KPTA 4LC9B 1RDDA 1NBWA 3EY1A 2V52B 2YNGA 1ZBLA 4DR2K 4KI6A 3VETA 3CM6A 5M1OA 4A2BA 3L2RA 4CK1A 3V9ZA 1C1BA 4H0XB 2GTDA 2D5RA 1GLFO 1QVFM 4KV8A 3WXKA 4A2AA 4EP4A 3GE1A 4YFUA 5FDLA 1EWRA 5BPNA 2ASOA 3SMPA 3SAFA 4CJTA 1X3NA 4CEEA 4JKDA 4GV9A 3OYDA 3AVGA 3NFAA 4NO7A 3DOKA 4FWKA 1X9WA 4BC3A 4DV1K 1GLLO 1NK6A 4K25A 4UQGA 2J4RA 3SBGA 3F5TA 4KH6A 4DHYA 2E6MA 4IOCL 2KKZA 3NF8A 2OANA 3LPTA 4IBNA 3OYGA 4QS8A 4FXDA 3KVGA 4I6MA 3EE9A 1QSSA 4RCHA 2VQEK 1VSEA 3ZT4A 4KHSA 4Z4IA 4ISGA 3R1XA 4WQ5C 4BGBA 5AZJA 4DFJA 1FJGK 3C6UA 1SL1A 2PZSA 2YKMA 3KK3A 2GUPA 1NGIA 5KGWA 4GMJB 1NWKA 4CF9A 3SPYA 4PA1A 3HM9A 1CZAN 3ID6A 4ISFA 4NLCA 3ATVA 1X9JA 2DPNA 5T7BA 3MN5A 4NCBA 3MX5A 5CZ2A 2XY5A 2HHTA 4DQPA 3UB5A 3SQ4A 2PAVA 4F9OA 1WAJA 4OGCA 2FF3B 4BGAA 1NG9A 2DTUA 3O3GA 1KD1O 1ZBIA 1XWLA 1WN7A 3HPOA 1HPZA 4MQ3A 4IOXA 3ULDA 3NGYA 4CW7B 2ZM6K 3MK6A 4FLYA 3M3ZA 1M1KO 4ICLA 4E1NA 4FZYA 4AQYK 3D2FB 3CJAA 3QESA 2HVHA 3SUPA 2ITGA 2B4JA 3CD6N 1KRPA 3ZSQA 4HCBA 1LW2A 4DV5K 4FZZA 5FROA 1RBRA 2OZMA 5J2PA 4GVMA 2XRIA 4RW7A 4KBOA 1BA1A 1SS6A 4JAXA 3FFIA 4CIGA 2VGMA 4KAZA 5AQWA 1S3XA 4M45A 3DRRA 1LAWA 4BRLA 3VQDA 5GADP 2Z1IA 1NK4A 5I3UA 1MU2A 3RSEB 3LALA 1O1WA 2D0OA 5AQYA 4CJ3A 2Q2RA 3AGKA 3S3NA 4YOXA 4V19S 3DI6A 1BQMA 2E5LK 3NF6A 3UKRA 3WUHA 1QVGM 3TPQA 5GIPA 4Q0BA 4JS4A 1Q81O 4FWNA 3QIOA 4JD2B 4H5RA 3CCRN 3ASMA 5F1XA 3VGMA 4AHVA 5AQTA 3WNFA 4KTWA 3Q7CA 3CQXA 3SAGA 3MEGA 4JNEA 3TANA 5CY4A 3KKSA 5JMVA 1K73O 3RR7A 3CXCM 2ZE2A 4GKKK 1NGEA 3T19A 4FJ8A 3V9UA 1YAGA 3ZX0A 4FWMA 4ELTA 3OJSA 4CGDA 4CJRA 2HBJA 1JCGA 2P9PB 3L2VA 4F3TA 1ZBHA 1TAQA 2WONA 3DLEA 1TL1A 2NUBA 4BACA 1U4BA 3HTVA 1BOTO 1RT1A 3HM8A 4MO4A 2HHXA 3NAEA 4DFMA 3NH2A 2XY6A 4KHWA 4CZFA 4BRPA 4CHNA 2JWKA 3DJCA 3OJUA 3V6DA 1NK5A 3F2KA 4JHDA 2W41A 4JI2K 4HTLA 1C0GA 2O8DA 2PYLA 1OH8A 1VQ7N 4CF0A 3AVMA 4K0KK 2QI2A 2HOEA 3OYAA 2P9IA 3TAEA 4CZEA 1I94K 2HBLA 5FPMA 3VQ6A 4FW2A 3HVRA 4IG0A 1BO5O 3LWMA 4NB4A 3CCVN 3UKUB 1K8AO 4FLXA 3FGUA 1HNWK 3ZSXA 3S3MA 3K2PA 2OPQA 1BIUA 2D0PA 1RNHA 3IRXA 4FWLA 1TK0A 4BQZA 2XHBA 4FK2A 4H5WA 3MEDA 3VMFB 4FYDA 4U67L 1VSFA 1JLGA 4KH5A 4DKWA 1ZXOA 3L2UA 1QQCA 2ZQBA 1KVBA 3OA9A 3SV4A 5DM6L 4OLBA 4N47A 2IC3A 3PX0A 1EQYA 2Q36A 3BGRA 1K9MO 1U48A 3AVBA 5HRNA 1TV6A 3DLBA 3FFKB 1BA0A 2IVPA 4O8KA 4DSJA 1KVCA 4DR3K 2KLAA 5KRSA 1S9EA 1G15A 1NM1A 3TAPA 1E3MA 5J1EA 5TKYA 4CFCA 1TKXA 4QAGA 3E9LA 3AO5A 3BZCA 1NGHA 3SK3A 4CBXA 2YI1A 2P9NB 3A5MC 3U3GA 3J7ZO 4ILJA 4JRPA 3C7NA 1CXUA 3C7NB 4CHPA 4OPJA 2WOMA 4GVEA 2VYPA 1BIZA 3NH0A 1RDAA 3DMJA 1JLFA 5AFUH 3QFUA 4XH1A 5AQVA 4N5SA 3HT3A 4BR5A 1M90O 3ZSZA 4YY3K 1XHXA 4FOEA 2JGUA 2YHXA 3G10A 4JI6K 3MN9A 3SUNA 1K6YA 3CCEN 4KB1A 3VF2A 1HNVA 4LFAK 3CETA 4CZLA 3O3FA 3THYB 1QE1A 4H8KA 3FZFA 1T6CA 4J2BA 4B3TK 4BR4A 3SPZA 1W97L 4Z4GA 5DM7L 3VEVA 2O8FB 4LF8K 1ESVA 1ZYQA 2G8IA 4JEPA 5HP1A 4E19A 3DRSA 4CGHA 1RBVA 3QB0A 3KTQA 2XY7A 4CZKA 2KTQA 3TAMA 3RMCA 2G8WA 3GOIA 1NJXA 1HQEA 3IMXA 4A5AA 1YHQN 3ULEB 2E6LA 1RT2A 2FBTA 2VQFK 1NK9A 2P9UB 1LWEA 1Q9YA 1WB9A 4IFVA 3R9PA 1KFSA 3DWLA 4B3OA 2D0BA 4QS9A 1J5OA 4B9MA 4JI3K 2BUPA 3V9XA 3O4NA
chains in the Genus database with same CATH topology
2P9IB 3KK7A 5M1KA 1NGBA 3NVKA 4C1NK 5KPZA 3MCAB 1NGJA 1NGFA 3H45C 3G71N 3WXMB 1KAYA 3LDLA 4R79A 3PIPL 3HOTA 2HBMA 2HF4A 2I7NA 1VQKN 4K43A 4WQ4C 2E2PA 5FPEA 4YORA 4BRFA 3FE1A 4BROA 4B1VA 3FZKA 3W0LA 1MA9B 4EAHD 3O9QA 1NLVA 5BRDA 5C2FA 3CCMN 2YJEA 5E26A 3GL1A 4MDBA 4K41A 5AQQA 3H3NO 4MLHA 1X3MA 2GX9A 4BG8A 1NGCA 1YVNA 4FVUA 5GAGP 2ZJPL 4EHTA 2CH5A 3CQYA 3CERA 5CE3A 3CCJN 1RDWX 3WQUA 2GWKA 4YOUA 2QWNA 4H5VA 4XH4A 1OKJA 2WFBA 2P9PA 2NNWA 2JWLA 1HKGA 3D2EB 1BDGA 5EVZA 3U4LA 5C2DA 3VPZA 2ASPA 2ZF5O 4Z94A 2P9LB 3G4SN 2HBKA 1JJ2M 5LJVA 3MN6A 3A5NC 5ADXH 4WFBL 5AQNA 2OTJN 3KHYA 2YHYA 5AZJB 4A57A 2P9SA 5BREA 3DXKB 3SBTA 1QQMA 2AA4A 3E9PA 3SLCA 1GLJO 5C15A 3VEOA 4CZGA 5JLFA 4GV3A 4FO0A 3SJHA 5EX5A 4JKGB 3P31A 2YX6A 3J8AA 2Q97A 3MWTA 2ZJRL 4B1YB 4AM7A 5KPTA 4LC9B 3EKUA 3Q7BA 5AFUA 1NBWA 3N4PA 1NGDA 5AQHA 4WF9L 1ATNA 2V52B 1RDUA 2GWJA 3VETA 5M1OA 2ZGYA 3CJ7A 3K9JA 4A2BA 1ZC6A 2V7ZA 3RVCA 2V51B 1XUPO 4L3QA 5BPLA 3HSCA 4H0XB 2E2OA 2GTDA 3ATUA 4IFEA 3VTHA 4CI6A 3MN7A 1GLFO 1QZ5A 5AQFA 4BY9C 1QVFM 4ISEA 4BC5A 3WXKA 4A2AA 4BRCA 3GE1A 5KQ8A 1VQPN 1VQON 4FWSA 3O08A 1DKGD 1P90A 3P4IA 4Y0WA 1BG3A 5BPNA 4M63C 4I6MB 2YHWA 2ASOA 3SMPA 4BVPA 1WOQA 5I9EB 3VERA 3SAFA 4MDAA 4C23A 3MX2A 1X3NA 4H0YB 4JKDA 4GV9A 5BPMA 3TU5A 3LDOA 4NO7A 4BR9A 2P9KB 2IVOA 4FWKA 2PBDA 4CD1A 3H3OB 3LL3A 4BC3A 5AQZA 1GLLO 1Y64A 4K25A 2FSJA 2J4RA 2YJFA 4JKCA 1E4GT 5HOOA 3SBGA 3F5TA 1BUPA 1G99A 1WUAA 3WEEA 3O1BA 4KH6A 5HL7L 3H1QA 4DHYA 4IOCL 2KKZA 1HKCA 3A0IX 4CJ7A 3O4WA 4OPHA 4CZMA 4BR2A 3BF3A 4PL7A 2OANA 2VWBA 5E84A 3CMEN 4GNIA 3CPWM 2QWPA 1NGAA 3E1YA 4JK7A 1J6ZA 1NMDA 2A6AA 3KVGA 4I6MA 4QS8A 3EE9A 5AR0A 1O13A 5AQIA 4CZHA 4RCHA 3WXLA 4BRDA 1N8RO 1H1VA 3CCUN 4ISGA 1HX1A 2CGJA 1JCFA 4KH4A 3LM2A 3R1XA 4WQ5C 3I33A 4BGBA 5AZJA 2VCPA 4BRGA 3CC2N 3ZETA 2QM1A 1V4TA 5AQOA 1C0FA 4JK9A 2P9NA 2E88A 1DGKN 1NGIA 2FF6A 2GUPA 4FWOA 4O5FA 3EZWA 1NWKA 3CF5L 2Q0UA 3O1WA 2NRHA 2E2NA 4IWVA 1Z05A 1CZAN 2RE2A 4BQLA 2Q31A 3ID6A 2EWSA 3IDHA 4ISFA 4NLCA 2QWRA 3ATVA 4BRHA 1X9JA 3E9OA 2NRTA 2DPNA 3EE8A 3R3LA 3VOVA 3AAPA 4ILGB 4GV6A 1HPMA 3MN5A 4JKGA 3MX5A 3T69A 5GAEP 3O6WA 4FSVA 3UB5A 2PAVA 3NMUA 1R59O 2Q0RA 4F9OA 1ILYA 2NRXA 5AQPA 5AQXA 4BR7A 2FF3B 4BGAA 1ATRA 2QXLA 4IO8A 3ZEUA 1IJJA 1D4XA 1KD1O 3EN9A 2FXUA 1YF5L 1P8ZA 2E20A 5ELZA 4WFNL 5BRHA 4IOXA 2CGKA 3KWIA 3D2EA 5GAHP 1SZ2A 3MK6A 3M3ZA 1M1KO 4ILHA 4CBUA 1JCEA 3EO3A 1HJOA 1U6ZA 3A5LC 3D2FB 1Q82O 3CJAA 1XC3A 4IXCA 4XEIA 1YI2N 3RSEA 3E66A 3CJBA 3O8MA 3AAQA 3EL2A 3UE5A 5KPRA 1YITN 3CD6N 1ATSA 3PLAA 5C0YA 5M1QA 4FWQA 2V7YA 3QICA 4AF1A 3U9ZA 3LDQA 4YDUA 4KBOA 1BA1A 1SS6A 4JAXA 3ZYYX 3L4IA 3O5BA 4PKHA 3VF6A 4BC4A 2VGMA 4EFHA 5AQWA 3VENA 1S3XA 3IFRA 4B9QA 4BRLA 5GADP 4H0OA 3WXIA 2HMPA 2HSTA 3EKSA 3ID8A 3ULEA 3M1FA 4JK8A 3RSEB 1HUXA 3WT0A 4CZIA 1MDUB 3VEYA 3VEWA 5H1SQ 2D0OA 1DEJA 4H0TB 5AQYA 4EIAA 4YOWA 1Q7YO 1ZBSA 4B1WB 3G25A 2NRVA 2Q2RA 3AGKA 4YOXA 3WQTA 3BP8A 3UKRA 4FPAA 3WUHA 1QVGM 4B1XB 4H0VB 3MCPA 5JVHL 4YOVA 4IZ9A 1GLEG 4WQ4A 3CHWA 3TPQA 4BVOA 5GIPA 4IJNA 3W3DA 5FPNA 3O9UA 3LDNA 2A5XA 2F9WA 3O9TA 3VTIA 1MWKA 5F0XA 4FWNA 2A3ZA 2NRZA 2VGNA 1K8KA 3GG4A 4A59A 4JD2B 4BRMA 1SQKA 3KZBA 4H5RA 3CCRN 2A40A 3DAWA 4JKHA 3FR0A 2I7PA 5F1XA 3C65A 3FLCO 4RWTA 3VGMA 5EY4A 2CH6A 5ADXA 3G6EN 1YJWN 5AQTA 1KXPA 3D2FA 1KAXA 3CI5A 3Q7CA 3TTFA 5BRFA 3CCLN 4MO5A 3CQXA 3DXKA 3SAGA 4IO9L 1VQMN 1QHAA 4G9ZA 3L6QA 5AQUA 3UKUA 3C6AA 4JNEA 2D1KA 3CC4N 2ITMA 3PIOL 2HF3A 1XQSC 4BREA 5JMVA 1K73O 2D4WA 3CXCM 1NGEA 3CJ9A 3O9SA 4CBWA 2F9TA 1YAGA 3ZX0A 3ENHA 3FZLA 2WBNA 3IUCA 4FWMA 3U9DA 5BR9A 2QWQA 2P9LA 2H3GX 3A5OC 4YDUC 3B8AX 3ENBA 1Q18A 4A62A 2HBJA 1LCUA 1JCGA 2P9PB 4BRAA 3LM9A 4AM6A 1V4SA 4YOYA 4BRQA 5LJWA 1W2BM 1HKBA 4OPAA 4FWRA 2ASMA 3HTVA 1T6DA 1BOTO 1KAZA 3M5RA 5CR4A 4M7YA 1K8KB 4M7XA 3HM8A 1T44A 2RHKA 4MO4A 5AQSA 4FPBA 3H1VX 4CZFA 4BRPA 5FPDA 2E1ZA 2JWKA 3DJCA 2E8AA 2Q1NA 3JXUA 3HI0A 4PL8A 3QDKA 4BRIA 1SAZA 3F2KA 4B1ZA 5AZIB 4QS7A 4JHDA 3DLLL 3BF1A 2E2QA 2P9KA 2W41A 4DCHA 2UYTA 3UKRB 5F2RA 2WUSA 4HTLA 3OBWA 2ZWHA 1C0GA 4JKFA 1RFQA 2AP1A 3CCQN 1VQ7N 4JKBA 4K42A 3KWGA 1VQ5N 2QI2A 2HOEA 2QWMA 3AARA 2P9IA 1EO1A 1VQ6N 4CZEA 2ZGZA 2HBLA 5FPMA 2OTLN 4IOAL 1YXQA 2QWOA 1VQ8N 4BC2A 1BO5O 5C10A 4NB4A 3WEEB 3CCVN 1VQLN 3UKUB 1TUYA 5AQRA 1K8AO 4IJAA 3FGUA 4XH5A 5M1PA 4B1UB 3WXJA 1TYQA 3L4QA 1LOTB 5BN8A 2PFUA 3TTDA 2P9UA 2D0PA 4FWLA 2E1YA 4BQZA 4H5WA 1YIJN 3U8XA 1Q86O 3VMFB 1TYQB 4BR0A 1GLBG 4U67L 4IEEA 3C0BA 4DB3A 3VGKA 2GEMA 5JVGL 4FWPA 3CC7N 5JLHA 4KH5A 1U2VA 4DKWA 4CD3A 2NRRA 1ZXOA 3SAHA 1RGIA 4WYBA 3BEXA 2BH1A 3TSPA 1U2VB 3OA9A 4UY8O 5DM6L 2YCHA 2FSKA 3BUZB 1MWMA 3HRGA 1GLCG 3QFPA 1EQYA 2Q36A 3ZEUB 1QQNA 4BG9A 1K9MO 3FZMA 3F9MA 1T3VA 3FFKB 1BA0A 4H5NA 2IVPA 3DXMB 3D6RA 4NLBA 4O8KA 5M1NA 3I56N 1BU6O 5C12A 2W40A 3R6MA 3R8EA 3CJCA 4IEIA 2KLAA 5AZIA 3AGRA 2WC9A 1NM1A 4RTFD 5AQJA 1KQSM 2QTDA 4CZJA 3OW2M 3VESA 5TKYA 5KQDA 5GINA 3SMSA 4PHTX 3E9LA 3CMAN 1NGHA 1NGGA 3SK3A 4CBXA 5MLCQ 1VQ4N 2FLOA 2YI1A 4BRNA 2P9NB 2NLXA 1TUUA 3A5MC 3J7ZO 2QA4N 1DT9A 3VEZA 3MMVA 4ILJA 3VF4A 4PKGA 4U7BA 3NVMA 5AQMA 2IIRA 2KHOA 3IKMA 3P38A 5EXWA 3H46O 3C7NA 3HBTA 4H5TA 1S22A 2CGLA 2NZTA 4JHDB 3QBWA 3C7NB 1GLAG 5EOYA 4DQ8A 4E1JA 4GVEA 2VYPA 4JKEA 4A61A 1VQNN 5JICA 5AFUH 4WFAL 4WCEL 3QFUA 2BTFA 2QWLA 2QW9A 4XH1A 4JN4A 5AQVA 4BR5A 1M90O 1VAZA 1KC8O 4H03B 4FOEA 1HLUA 2YHXA 4FL9A 3D7EO 3MN9A 3CCEN 5AQKA 3VF2A 4HWIA 3H6EA 4J8FA 3CETA 3OHRA 3ZX3A 4CZLA 3N4QA 4FOIA 3C6HA 3O9RA 3MWPA 3FZFA 3CPEA 1VQ9N 3QMLA 4MLEA 1T6CA 4YOTA 3LDPA 5GIOA 4JD2A 1QZ6A 4BR4A 5LY3A 3P39A 3T7ZA 1W97L 3DXMA 5DM7L 5M1FA 3HZ6A 2A41A 4WQ5A 3VEVA 3OBYA 1ESVA 3MDQA 1BWFO 3FZHA 4O8UA 4JEPA 5TKWA 3GDQA 3QBXA 3ZETB 1YJNN 3ZX2A 3VEXA 1YJ9N 3TSQA 5CHIA 4EHUA 1NJIO 1YUWA 3HOSA 3QB0A 3JS6A 4IDHA 3TTCA 1GLDG 3A8YA 3O80A 2QEXN 3VGLA 3CCSN 2F7TA 4GY2B 4JKAA 4PKIA 4CZKA 5AQGA 4A5BA 3GOIA 3IMXA 3TSUA 2FSNA 3K9KA 2NRWA 3L0QA 5BN9A 3CIPA 1QQOA 3ULEB 4A5AA 1YHQN 3GBTA 2GELA 5AQLA 2A42A 2IVNA 2P9UB 3I8BA 3R9PA 3DWLA 4H0PA 4BRKA 3I55N 4QS9A 1E4FT 1S72N 2BUPA 1Q81O 2P9SB 4OO1J 4C1NI 5B8HA 3AY9A 2ZJQL 3M6GA 1OVYA 3CJ1A 3ENOA 1Z6RA 1IG8A 3S41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9I B;  1NGB A;  5KPZ A;  1NGJ A;  1NGF A;  3H45 C;  1KAY A;  3LDL A;  2HF4 A;  2I7N A;  4K43 A;  4WQ4 C;  2E2P A;  5FPE A;  4BRF A;  3FE1 A;  4BRO A;  4B1V A;  3FZK A;  3W0L A;  1MA9 B;  4EAH D;  1NLV A;  5BRD A;  2YJE A;  5E26 A;  3GL1 A;  4K41 A;  5AQQ A;  3H3N O;  4MLH A;  1X3M A;  4BG8 A;  1NGC A;  1YVN A;  4EHT A;  2CH5 A;  3CQY A;  3CER A;  5CE3 A;  1RDW X;  3WQU A;  2GWK A;  2QWN A;  4H5V A;  4XH4 A;  1OKJ A;  2P9P A;  3D2E B;  1HKG A;  5EVZ A;  1BDG A;  3U4L A;  3VPZ A;  2ASP A;  2ZF5 O;  4Z94 A;  2P9L B;  5LJV A;  3MN6 A;  3A5N C;  5ADX H;  5AQN A;  3KHY A;  2YHY A;  5AZJ B;  2P9S A;  5BRE A;  3DXK B;  1QQM A;  2AA4 A;  3SLC A;  1GLJ O;  3VEO A;  4CZG A;  5JLF A;  4FO0 A;  3SJH A;  5EX5 A;  3J8A A;  2Q97 A;  4B1Y B;  4AM7 A;  5KPT A;  4LC9 B;  3EKU A;  5AFU A;  1NBW A;  1NGD A;  5AQH A;  1ATN A;  2V52 B;  2GWJ A;  3VET A;  2ZGY A;  3CJ7 A;  4A2B A;  1ZC6 A;  2V7Z A;  2V51 B;  1XUP O;  4L3Q A;  5BPL A;  3HSC A;  4H0X B;  2E2O A;  2GTD A;  3ATU A;  4CI6 A;  3MN7 A;  1GLF O;  1QZ5 A;  5AQF A;  4ISE A;  4BC5 A;  3WXK A;  4A2A A;  4BRC A;  3GE1 A;  5KQ8 A;  4FWS A;  3O08 A;  1DKG D;  3P4I A;  4Y0W A;  1BG3 A;  5BPN A;  4M63 C;  4I6M B;  2YHW A;  2ASO A;  3SMP A;  4BVP A;  1WOQ A;  5I9E B;  3VER A;  4C23 A;  4H0Y B;  1X3N A;  5BPM A;  3TU5 A;  3LDO A;  4NO7 A;  4BR9 A;  2P9K B;  2IVO A;  4FWK A;  2PBD A;  4CD1 A;  3H3O B;  3LL3 A;  4BC3 A;  5AQZ A;  1GLL O;  1Y64 A;  4K25 A;  2FSJ A;  2J4R A;  2YJF A;  1E4G T;  1BUP A;  1G99 A;  1WUA A;  3WEE A;  3O1B A;  3H1Q A;  4DHY A;  1HKC A;  3A0I X;  4CJ7 A;  3O4W A;  4CZM A;  4BR2 A;  3BF3 A;  4PL7 A;  2OAN A;  2VWB A;  5E84 A;  4GNI A;  2QWP A;  1NGA A;  1J6Z A;  1NMD A;  2A6A A;  3KVG A;  4I6M A;  4QS8 A;  5AR0 A;  5AQI A;  4CZH A;  4RCH A;  3WXL A;  4BRD A;  1H1V A;  4ISG A;  1HX1 A;  2CGJ A;  1JCF A;  3LM2 A;  4WQ5 C;  3I33 A;  4BGB A;  5AZJ A;  2VCP A;  4BRG A;  3ZET A;  2QM1 A;  1V4T A;  5AQO A;  1C0F A;  4BC2 A;  2P9N A;  2E88 A;  1DGK N;  1NGI A;  2FF6 A;  2GUP A;  4FWO A;  4O5F A;  3EZW A;  1NWK A;  2Q0U A;  3O1W A;  2NRH A;  2E2N A;  4IWV A;  1Z05 A;  1CZA N;  4BQL A;  2Q31 A;  3IDH A;  2EWS A;  4ISF A;  2QWR A;  3ATV A;  4BRH A;  1X9J A;  3VOV A;  2DPN A;  3AAP A;  1HPM A;  3MN5 A;  3O6W A;  4FSV A;  3UB5 A;  2PAV A;  1R59 O;  2Q0R A;  4F9O A;  5AQP A;  4BR7 A;  5AQX A;  2FF3 B;  4BGA A;  1ATR A;  2QXL A;  4IO8 A;  3ZEU A;  1IJJ A;  1D4X A;  3EN9 A;  2FXU A;  2E20 A;  1P8Z A;  5ELZ A;  5BRH A;  2CGK A;  3D2E A;  1SZ2 A;  3MK6 A;  3M3Z A;  4CBU A;  1JCE A;  3EO3 A;  1HJO A;  1U6Z A;  3A5L C;  3D2F B;  3CJA A;  1XC3 A;  4IXC A;  4XEI A;  3RSE A;  3CJB A;  3O8M A;  3AAQ A;  3EL2 A;  3UE5 A;  5KPR A;  1ATS A;  4FWQ A;  2V7Y A;  3QIC A;  3U9Z A;  3LDQ A;  4YDU A;  4KBO A;  1BA1 A;  4JAX A;  3L4I A;  3O5B A;  4PKH A;  3VF6 A;  4BC4 A;  4EFH A;  5AQW A;  3VEN A;  1S3X A;  3IFR A;  4B9Q A;  4BRL A;  4H0O A;  3WXI A;  2HMP A;  3ID8 A;  3EKS A;  3ULE A;  3M1F A;  3RSE B;  1HUX A;  3WT0 A;  4CZI A;  1MDU B;  3VEY A;  3VEW A;  2D0O A;  1DEJ A;  4H0T B;  5AQY A;  4EIA A;  1ZBS A;  4B1W B;  3G25 A;  2Q2R A;  3WQT A;  3BP8 A;  3UKR A;  4FPA A;  3WUH A;  4B1X B;  4H0V B;  3MCP A;  4IZ9 A;  1GLE G;  4WQ4 A;  3CHW A;  3TPQ A;  4BVO A;  4IJN A;  3W3D A;  5FPN A;  3LDN A;  2A5X A;  2F9W A;  5F0X A;  1MWK A;  4FWN A;  2A3Z A;  3GG4 A;  1K8K A;  4JD2 B;  4BRM A;  1SQK A;  3KZB A;  4H5R A;  2A40 A;  3DAW A;  3FR0 A;  2I7P A;  5F1X A;  3FLC O;  4RWT A;  3VGM A;  5EY4 A;  2CH6 A;  5ADX A;  5AQT A;  1KXP A;  3D2F A;  1KAX A;  3CI5 A;  5BRF A;  4MO5 A;  3CQX A;  3DXK A;  1QHA A;  3L6Q A;  5AQU A;  3UKU A;  4JNE A;  2D1K A;  2ITM A;  2HF3 A;  1XQS C;  4BRE A;  5JMV A;  2D4W A;  1NGE A;  3CJ9 A;  4CBW A;  2F9T A;  1YAG A;  3ZX0 A;  3ENH A;  3FZL A;  4FWM A;  3IUC A;  3U9D A;  5BR9 A;  2QWQ A;  2P9L A;  2H3G X;  3A5O C;  4YDU C;  3B8A X;  1Q18 A;  4A62 A;  1LCU A;  1JCG A;  2P9P B;  4BRA A;  3LM9 A;  4AM6 A;  1V4S A;  4BRQ A;  5LJW A;  1HKB A;  4FWR A;  2ASM A;  3HTV A;  1T6D A;  1BOT O;  1KAZ A;  4M7Y A;  1K8K B;  4M7X A;  3HM8 A;  1T44 A;  4MO4 A;  5AQS A;  4FPB A;  3H1V X;  4CZF A;  4BRP A;  5FPD A;  2E1Z A;  3DJC A;  2E8A A;  2Q1N A;  3JXU A;  3HI0 A;  4PL8 A;  3QDK A;  4BRI A;  1SAZ A;  4B1Z A;  5AZI B;  4QS7 A;  4JHD A;  3BF1 A;  2E2Q A;  2P9K A;  2W41 A;  4DCH A;  2UYT A;  3UKR B;  5F2R A;  2WUS A;  4HTL A;  2ZWH A;  1C0G A;  1RFQ A;  2AP1 A;  4K42 A;  2HOE A;  2QWM A;  3AAR A;  2P9I A;  4CZE A;  2ZGZ A;  5FPM A;  1YXQ A;  2QWO A;  1BO5 O;  4NB4 A;  3WEE B;  3UKU B;  1TUY A;  5AQR A;  4IJA A;  3FGU A;  4XH5 A;  4B1U B;  3WXJ A;  1TYQ A;  1LOT B;  5BN8 A;  2P9U A;  2D0P A;  4FWL A;  2E1Y A;  4BQZ A;  4H5W A;  3U8X A;  1TYQ B;  4BR0 A;  1GLB G;  3C0B A;  4DB3 A;  3VGK A;  2GEM A;  4FWP A;  5JLH A;  1U2V A;  4CD3 A;  1ZXO A;  1RGI A;  4WYB A;  3BEX A;  1U2V B;  2YCH A;  2FSK A;  3BUZ B;  1MWM A;  1GLC G;  3QFP A;  1EQY A;  2Q36 A;  3ZEU B;  1QQN A;  4BG9 A;  3FZM A;  3F9M A;  3FFK B;  1BA0 A;  4H5N A;  2IVP A;  3DXM B;  4O8K A;  1BU6 O;  2W40 A;  3R6M A;  3R8E A;  3CJC A;  5AZI A;  1NM1 A;  4RTF D;  5AQJ A;  4CZJ A;  3VES A;  5TKY A;  5KQD A;  3SMS A;  1NGH A;  1NGG A;  3SK3 A;  4CBX A;  2FLO A;  2YI1 A;  4BRN A;  2P9N B;  2NLX A;  1TUU A;  3A5M C;  3VEZ A;  3MMV A;  3VF4 A;  4PKG A;  5AQM A;  2IIR A;  2KHO A;  5EXW A;  3H46 O;  3C7N A;  3HBT A;  4H5T A;  1S22 A;  2CGL A;  2NZT A;  4JHD B;  3QBW A;  3C7N B;  1GLA G;  5EOY A;  4DQ8 A;  4E1J A;  2VYP A;  4A61 A;  5JIC A;  5AFU H;  3QFU A;  2BTF A;  2QWL A;  2QW9 A;  4XH1 A;  4JN4 A;  5AQV A;  4BR5 A;  4H03 B;  4FOE A;  1HLU A;  2YHX A;  4FL9 A;  3D7E O;  3MN9 A;  5AQK A;  3VF2 A;  4HWI A;  3H6E A;  4J8F A;  3CET A;  3OHR A;  3ZX3 A;  4CZL A;  4FOI A;  3FZF A;  3QML A;  4MLE A;  1T6C A;  3LDP A;  4JD2 A;  1QZ6 A;  4BR4 A;  5LY3 A;  3DXM A;  3HZ6 A;  2A41 A;  4WQ5 A;  3VEV A;  1ESV A;  3MDQ A;  1BWF O;  3FZH A;  3GDQ A;  3QBX A;  3ZET B;  3ZX2 A;  3VEX A;  4EHU A;  1YUW A;  3QB0 A;  3JS6 A;  1GLD G;  3A8Y A;  3O80 A;  3VGL A;  4GY2 B;  4PKI A;  4CZK A;  5AQG A;  3GOI A;  3IMX A;  2FSN A;  3L0Q A;  5BN9 A;  3CIP A;  1QQO A;  3ULE B;  3GBT A;  2GEL A;  5AQL A;  2A42 A;  2IVN A;  2P9U B;  3I8B A;  3R9P A;  3DWL A;  4H0P A;  4BRK A;  4QS9 A;  1E4F T;  2BUP A;  2P9S B;  5B8H A;  3AY9 A;  3M6G A;  3CJ1 A;  3ENO A;  1Z6R A;  1IG8 A;  3S41 A; 
#chains in the Genus database with same CATH topology
 3NVK A;  1W9H A;  1NGB A;  3KD5 E;  1JXB A;  3THX B;  3WXM B;  1KAY A;  3QIN A;  3AA5 X;  4W5R A;  2HF4 A;  3I0R A;  4J2D A;  4B3R K;  1S5J A;  2W42 A;  2F96 A;  1VHX A;  1JLQ A;  5FPE A;  4X62 K;  3SJJ A;  1MA9 B;  4EAH D;  3RMB A;  4NCA A;  1XI1 A;  5C24 A;  4B3S K;  4B9L A;  3ZT3 A;  3U3Y A;  2OYQ A;  3MAQ A;  4BG8 A;  1RBU A;  5GAG P;  2ZJP L;  4EHT A;  2X6S A;  5CE3 A;  3K0S A;  1RDW X;  3LZJ A;  2GWK A;  4YOU A;  4BE0 A;  4O4G A;  2Y1J A;  2WFB A;  3SUQ A;  2NNW A;  3U4L A;  1RT7 A;  2ATQ A;  1XHZ A;  4Z0U A;  2HBK A;  3IG1 A;  5LJV A;  1TGO A;  3VQQ A;  3LDS A;  5ADX H;  4WFB L;  1BCO A;  5AQN A;  3KLH A;  5AZJ B;  3E9P A;  1FKO A;  3VEO A;  2VG5 A;  4I9Q A;  4FK0 A;  2Q97 A;  4FM0 A;  4FJL A;  3Q7B A;  1WAF A;  1UWB A;  1NGD A;  5AQH A;  1RDU A;  1A5V A;  3CJ7 A;  4DFK A;  2HHW A;  2V7Z A;  1XUP O;  3DLK A;  4DU3 A;  3VTH A;  3TI0 A;  3DLH A;  1QZ5 A;  4DUZ K;  1QTM A;  1YT3 A;  2P5G A;  4BC5 A;  3I8D A;  4BRC A;  2OPP A;  1VQO N;  4EZ6 A;  1DKG D;  1SUQ A;  1BG3 A;  4FLV A;  4M63 C;  4ZTF A;  3L3V A;  4BVP A;  3PSF A;  4MDA A;  4C23 A;  4H0Y B;  4HUF A;  5IWA K;  3LDO A;  1RDB A;  4BR9 A;  2P9K B;  4CD1 A;  3H3O B;  5AQZ A;  4OGE A;  4X66 K;  2IAJ A;  2YJF A;  4JKC A;  1BUP A;  1G99 A;  1WUA A;  3WEE A;  4DSI A;  4BR2 A;  4GNI A;  3CPW M;  2QWP A;  5AQI A;  4M3U A;  3B6O A;  3ZT2 A;  4KO0 A;  3WXL A;  1N8R O;  1H1V A;  1HQU A;  1HX1 A;  4C8M A;  1JCF A;  3LM2 A;  3ZLJ A;  3I33 A;  2VCP A;  4BRG A;  1L3V A;  4FJ9 A;  4DR1 K;  1Q9X A;  2DFH A;  1J5E K;  5AQO A;  4JK9 A;  2P9N A;  3EZW A;  3CF5 L;  2NRH A;  1KFD A;  4IWV A;  4KKO A;  2QK9 A;  2UXC K;  2RE2 A;  4E3S A;  4BQL A;  3EE8 A;  2NRT A;  1U49 A;  4CJ5 A;  1XMQ K;  3O6W A;  1SKR A;  2Q0R A;  3K5M A;  2HHU A;  2NRX A;  5AQP A;  4BR7 A;  3HL8 A;  2QXL A;  1T7P A;  3ZEU A;  1SL2 A;  2X6N A;  1YF5 L;  5ELZ A;  5BRH A;  5K14 A;  3K5L A;  2CGK A;  5LMN K;  3SV3 A;  3OYL A;  2RPI A;  1U6Z A;  3A5L C;  4I7F A;  1YI2 N;  4GKJ K;  3CJB A;  4LSL A;  1YIT N;  1ATS A;  3PLA A;  3A2F A;  2BGG A;  4CCH A;  4OVL A;  4AF1 A;  3U9Z A;  4CJF A;  1RCH A;  3ZYY X;  3VF6 A;  3O5B A;  5HRP A;  3IFR A;  1T05 A;  3EKS A;  4FLW A;  3NE6 A;  3L8B A;  4CZI A;  3VEW A;  5H1S Q;  4HTU A;  3C6T A;  4YOW A;  4B1W B;  1W7A A;  1Q8I A;  2RN2 A;  4DSE A;  4FJI A;  1WNS A;  3BP8 A;  4FPA A;  1JKH A;  4B1X B;  4YOV A;  2YV0 X;  1GLE G;  4I2Q A;  4FJH A;  4WQ4 A;  3CHW A;  4KHQ A;  2BAN A;  3W3D A;  2A5X A;  2F9W A;  4B9T A;  1MWK A;  2A3Z A;  2NRZ A;  2VGN A;  4JI7 K;  1TKZ A;  2A40 A;  4M3W A;  3FR0 A;  3QEX A;  2I7P A;  4RWT A;  5ADX A;  5LL6 Z;  4FJX A;  3K5O A;  3ALY A;  4DQQ A;  3TTF A;  2HHS A;  4MO5 A;  3DXK A;  3HP9 A;  1QHA A;  4G9Z A;  3HPG A;  1TKT A;  3L6Q A;  4G1Q A;  5AQU A;  3PUF A;  3UKU A;  5FRM A;  4HUG A;  2ITM A;  3PIO L;  5IT9 O;  1XQS C;  1U47 A;  5SZT A;  4BWM A;  3T1Y K;  5CYQ A;  1RTH A;  4CBW A;  1C0T A;  3ENH A;  3FZL A;  3IUC A;  3A5O C;  3RR8 A;  1XNR K;  1FXX A;  3ENB A;  4E89 A;  4DQS A;  4BRA A;  3LM9 A;  4AM6 A;  1N5Y A;  1ASU A;  4BRQ A;  1W2B M;  1TL3 A;  2ASM A;  1KAZ A;  3M5R A;  5CR4 A;  4FLU A;  4KPY A;  4FPB A;  4R5P A;  4DMN A;  5D3G A;  2E1Z A;  4J2A A;  1T8E A;  2Q1N A;  1UA1 A;  3RRH A;  5AZI B;  3MXI A;  2E2Q A;  4I2P A;  4DCH A;  2YHB A;  3MXJ A;  3UKR B;  4W5N A;  1DTT A;  2WUS A;  3OBW A;  2BDP A;  4JKF A;  1IKY A;  3M8R A;  2AP1 A;  4QCL A;  1VRU A;  4CFB A;  1NKC A;  1IBK K;  4FJJ A;  1VSJ A;  3CFO A;  1VQ5 N;  1EO1 A;  1C1C A;  3AAR A;  2Z1H A;  2OTL N;  2QWO A;  2UXD K;  5I42 A;  4O44 A;  2OZS A;  3UIQ A;  4Y1C A;  4DTP A;  4IJA A;  1NOY A;  5M1P A;  3EZ5 A;  1LOT B;  1JLC A;  5BN8 A;  4CHQ A;  3DOL A;  4Z4E A;  4CJL A;  3BZK A;  3ISN C;  1YIJ N;  4FLT A;  1GLB G;  3H08 A;  4IEE A;  3C0B A;  4DB3 A;  3VGK A;  4FWP A;  3CC7 N;  4JV5 K;  4CD3 A;  1RGI A;  3LP2 A;  2KQ2 A;  2BH1 A;  3BEX A;  4WYB A;  4JI8 K;  2YCH A;  4BWJ A;  3QFP A;  4JI4 K;  3CFR A;  3ZEU B;  4BDZ A;  3AV9 A;  4C8O A;  4CGI A;  3DXM B;  4FW1 A;  4AHT A;  4PY5 A;  1WSF A;  1NJW A;  3SI6 A;  1KQS M;  4E7H A;  2QTD A;  4JYA K;  3C95 A;  3SMS A;  2OPR A;  3CMA N;  3G0Z A;  5MLC Q;  1IKW A;  1J54 A;  1BHL A;  3V4I A;  1QSL A;  4JLH A;  4DTS A;  3MMV A;  3VF4 A;  4PKG A;  5HRO A;  5AQM A;  1EX4 A;  2IIR A;  2KHO A;  3V9W A;  3P38 A;  3H46 O;  3HBT A;  1S22 A;  1RTI A;  2NZT A;  4JHD B;  5EU7 A;  4JI0 K;  1GLA G;  1OVQ A;  4CEF A;  3DM2 A;  5JIC A;  3NGZ A;  4WFA L;  2QWL A;  2FBX A;  4AHC A;  2YHA A;  1HLU A;  4K8X A;  4FJ5 A;  1T03 A;  5HRS A;  4FJ7 A;  4Q5V A;  4OX9 K;  4KHU A;  1BI4 A;  2HND A;  3C6H A;  3O9R A;  4B9S A;  3MWP A;  4IFY A;  3V9S A;  3QML A;  4YOT A;  5J2N A;  3LDP A;  1QZ6 A;  2LSN A;  5LY3 A;  2BE2 A;  3HZ6 A;  2A41 A;  4WQ5 A;  4X64 K;  3PO4 A;  4B8C A;  4KB0 A;  2G8K A;  3MDQ A;  3AVF A;  1LW0 A;  4O8U A;  5TKW A;  1WSE A;  3AVN A;  3QBX A;  3V1R A;  3ZX2 A;  1YJ9 N;  3TSQ A;  3OY9 A;  1YUW A;  1TK8 A;  3JS6 A;  1IKV A;  1LAV A;  5LMU K;  3MEE A;  4GY2 B;  2IGI A;  3J81 O;  4YHH K;  5BN9 A;  2GEL A;  2IVN A;  5KTQ A;  3I55 N;  1E4F T;  1EP4 A;  1S72 N;  2AJQ A;  2PYJ A;  3ZSW A;  4OO1 J;  3LPU A;  3AY9 A;  3M6G A;  3ENO A;  3IS9 A;  1Z6R A;  1IG8 A;  5C25 A;  3I0S A;  5M1K A;  3ZCM A;  1NGJ A;  1KVA A;  1N36 K;  3K5N A;  2QKB A;  2HBM A;  2HHQ A;  4K43 A;  4KHP K;  4ELU A;  2D0A A;  2QXF A;  4YOR A;  4CJQ A;  5HRR A;  3OVN A;  4BRO A;  1X9S A;  3FZK A;  1S6P A;  3NF9 A;  3RRG A;  3WNE A;  4IDK A;  2HHV A;  4MDB A;  5AQQ A;  3H3N O;  4HUE A;  3VA3 A;  1XMO K;  2GX9 A;  1NGC A;  4FVU A;  1C1A A;  1NJZ A;  4M41 A;  1NK8 A;  3LP1 A;  4CFA A;  2QWN A;  4H5V A;  4XH4 A;  4PQU A;  4CJ4 A;  2JWL A;  1HKG A;  5EVZ A;  1BDG A;  4DTU A;  2ASP A;  2ZF5 O;  3G4S N;  4L8R B;  2F8T A;  3QEW A;  4CK2 A;  3DLR A;  1LV5 A;  2KFZ A;  2OTJ N;  3KHY A;  4CK3 A;  4A57 A;  5KI6 A;  3DXK B;  3KIO A;  3SLC A;  1GLJ O;  4PUO A;  3AVJ A;  4FO0 A;  4N56 A;  4LFB K;  2YX6 A;  3J8A A;  3L3U A;  1L3S A;  3M8S A;  4F8R A;  4WF9 L;  4KFB A;  1F21 A;  1JLB A;  2ZGY A;  3OYN A;  4CFD A;  3K9J A;  5KRT A;  2V51 B;  4CI6 A;  3ATU A;  3VN5 A;  4B9N A;  4DUY K;  5AQF A;  4BY9 C;  3VA0 A;  4AH9 A;  3NF7 A;  3KLI A;  1P90 A;  3P4I A;  1W0H A;  3P5J A;  4I6M B;  2YHW A;  1JLA A;  1RDC A;  4CEB A;  2KZM A;  5BPM A;  3NHG A;  2IVO A;  3LL3 A;  1Y64 A;  3AVK A;  2FSJ A;  1E4G T;  4CHZ A;  3O1B A;  2WTU A;  1C0M A;  3H1Q A;  4HCC A;  1S1W A;  1HKC A;  3A0I X;  4CZM A;  4PL7 A;  1GOA A;  3L2Q A;  2VWB A;  5E84 A;  3CME N;  5DK5 A;  2EX3 A;  3E1Y A;  1NMD A;  2A6A A;  3HXM A;  1O13 A;  4DTO A;  4BRD A;  3CCU N;  2CGJ A;  4KH4 A;  1RT6 A;  4M3Y A;  3CC2 N;  1V4T A;  4BC2 A;  1C0F A;  2UUC K;  1DGK N;  1VSM A;  2O8F A;  2Q0U A;  1A5X A;  2RKI A;  3NH1 A;  1CXQ A;  4O0I A;  4E7L A;  1Z05 A;  4DTR A;  1WSH A;  2FBV A;  2Q31 A;  3IDH A;  2EWS A;  4ID1 A;  4BRH A;  3OYJ A;  3E9O A;  1NKB A;  3R3L A;  3VOV A;  3AAP A;  3F9K A;  1LWF A;  1HPM A;  4JKG A;  1RTD A;  3T69 A;  5GAE P;  4OJR A;  4FSV A;  3MXM A;  1SL0 A;  4CEZ A;  2JLE A;  3NMU A;  1ILY A;  2B6A A;  3PY8 A;  3RTV A;  4DSL A;  4FJK A;  2HMI A;  4IO8 A;  4LFC K;  3EN9 A;  2FXU A;  2E20 A;  4WFN L;  3AVL A;  1UOC A;  3C94 A;  3KWI A;  4AHU A;  4FCY A;  3D2E A;  5GAH P;  4CBU A;  4CJP A;  4DTJ A;  1IV0 A;  1C0U A;  1XC3 A;  4H4M A;  3VQ5 A;  3RSE A;  3O8M A;  3AAQ A;  3UE5 A;  5KPR A;  5M1Q A;  4F3O A;  2VWK A;  1WBB A;  3LAN A;  3LDQ A;  4C8N A;  3NDK A;  4BC4 A;  1D9D A;  4B9Q A;  2O4I A;  4ID5 A;  2O4G A;  4E1M A;  3NGI A;  1UA0 A;  3ID8 A;  4DG1 A;  4CER A;  3WT0 A;  4H0T B;  1Q7Y O;  3AA4 A;  1ZBS A;  2NRV A;  1HYV A;  3VQC A;  4CEC A;  3VQA A;  3WQT A;  1S1T A;  4DQI A;  2VG6 A;  4CJS A;  5JVH L;  3MCP A;  3V1O A;  2RF2 A;  2W6K A;  4TSX A;  3OYH A;  1LWC A;  5FPN A;  3LDN A;  3O9T A;  3VTI A;  5F0X A;  4A59 A;  3SQ2 A;  3ITH A;  2G8V A;  3VQ7 A;  3DAW A;  3TAQ A;  3FLC O;  3K59 A;  1JXE A;  5EY4 A;  3G6E N;  3VQ9 A;  1S1V A;  1KXP A;  3V81 A;  1KAX A;  4CF1 A;  3CCL N;  1VQM N;  4IO9 L;  3QEP A;  4CE9 A;  2D1K A;  4K8Z A;  4BE2 A;  4NYF A;  4BRE A;  1HJR A;  4LF7 K;  3VQP A;  1FK9 A;  4CJK A;  1GOB A;  1RT3 A;  3CJ9 A;  4DR7 K;  2F9T A;  4NYN A;  3AVA A;  3P1G A;  4CHO A;  4DV3 K;  2P9L A;  2H3G X;  1J9A A;  3OYC A;  4HHT A;  3B8A X;  4CF8 A;  4FVM A;  5FLX O;  1LCU A;  1FW6 A;  3ZSV A;  3OYB A;  4EP5 A;  1V4S A;  5LJW A;  4RW9 A;  1HYS A;  4OPA A;  3S3O A;  4FWR A;  3T3F A;  4M7X A;  1K8K B;  4M42 A;  1T44 A;  3H1V X;  3OYK A;  1VRT A;  4RW4 A;  4DU1 A;  3JXU A;  3HI0 A;  1J53 A;  3QDK A;  3NCI A;  4BRI A;  1SAZ A;  4B1Z A;  3BF1 A;  2P9K A;  3KLG A;  4C8K A;  2KW4 A;  1RFQ A;  3LP0 A;  4B9U A;  3THX A;  4K42 A;  3KWG A;  3KK2 A;  1KTQ A;  2ZGZ A;  4CHY A;  1VQ8 N;  1L3T A;  5C10 A;  3WEE B;  2E4L A;  3WXJ A;  1ASW A;  1TYQ A;  2P51 A;  3VQ4 A;  2G8F A;  4RW6 A;  4RW8 A;  1KSP A;  2X74 A;  2E1Y A;  1R0A A;  2EHG A;  1HR0 K;  1TYQ B;  4BR0 A;  3KK1 A;  4DFP A;  2UU9 K;  4KTQ A;  4O0J A;  4CGJ A;  2HHH K;  1ITG A;  4OLA A;  1U2V A;  3HPH A;  1EWQ A;  1U2V B;  4UY8 O;  3HVT A;  4RG8 A;  1QQN A;  1VK0 A;  3FZM A;  2OA8 A;  1T3V A;  1JL1 A;  3D6R A;  1BU6 O;  5C12 A;  2W40 A;  2HNZ A;  4IEI A;  5AZI A;  3AGR A;  2DFE A;  4RTF D;  5BR8 K;  1XC9 A;  4CZJ A;  3OW2 M;  3QEV A;  4DS4 A;  3E01 A;  5GIN A;  2YNF A;  4PHT X;  1N32 K;  5A2Q O;  1VQ4 N;  2FLO A;  4HVJ A;  4CEQ A;  4BRN A;  2NLX A;  1TUU A;  3U6F A;  3TWH A;  2QA4 N;  3VEZ A;  3RMA A;  4U7B A;  3IKM A;  4LD0 A;  4BDY A;  3QBW A;  3AVH A;  4DQ8 A;  4E1J A;  3AA3 A;  1VQN N;  4M3T A;  4WCE L;  4JN4 A;  1B9F A;  1VAZ A;  4DR4 K;  4FJG A;  3WNH A;  4FL9 A;  4LH4 A;  5AQK A;  3ZSY A;  3CQ8 A;  4HWI A;  1DLO A;  1EXQ A;  4H4O A;  4J8F A;  2HNY A;  3ZX3 A;  3N4Q A;  4KRE A;  1NJY A;  1EET A;  3CPE A;  1VSK A;  4MLE A;  2OPS A;  4DWI A;  3P39 A;  3DXM A;  2GUI A;  5M1F A;  4W5T A;  1XNQ K;  1BWF O;  1EKE A;  2O8E B;  3ZET B;  4QOZ B;  2PY5 A;  3VEX A;  1NJI O;  3HOS A;  4IDH A;  3IAY A;  4JS5 A;  3TTC A;  1NKE A;  1GLD G;  2QEX N;  3O80 A;  3CCS N;  1TKD A;  4PKI A;  4A5B A;  4DTM A;  4N41 A;  1N34 K;  2FSN A;  3L0Q A;  5KGX A;  3GBT A;  3T1H K;  2HVI A;  2X78 A;  3KLF A;  4CED A;  1L3U A;  4CJW A;  4H0P A;  4OKE A;  3ZT0 A;  4OKK A;  1HRH A;  2GBZ A;  2P9S B;  5B8H A;  2ZJQ L;  1OVY A;  3CJ1 A;  3S41 A;  4XIU A;  5J2Q A;  3MCA B;  1NGF A;  3H45 C;  4NXN K;  3LDL A;  4R79 A;  1HYZ A;  3PIP L;  3HOT A;  5HLF A;  2I7N A;  1VQK N;  2E2P A;  1B9D A;  3JSM A;  1HNZ K;  4BRF A;  1NMN A;  3LAK A;  1BI4 B;  4CEA A;  3O9Q A;  1NLV A;  3DLG A;  3O3H A;  2YJE A;  4W5O A;  3CFP A;  3CYM A;  4LSN A;  1D5A A;  5DMR A;  1YVN A;  4JRQ A;  3B6P A;  4W5Q A;  3AVI A;  2CH5 A;  3CER A;  3CCJ N;  3WQU A;  3TAB A;  1X9M A;  4BE1 A;  1N6Q A;  5C42 A;  4DF4 A;  3VPZ A;  3EEQ A;  2P9L B;  1RTJ A;  1JJ2 M;  3ZT1 A;  3MN6 A;  4F2R A;  1VSI A;  2VWJ A;  5JS2 A;  2IS3 A;  2P9S A;  5BRE A;  1QQM A;  3D45 A;  2DY4 A;  1WBD A;  4CZG A;  4O55 A;  1OH7 A;  4GV3 A;  5EX5 A;  4B08 A;  4JKG B;  3P31 A;  1FKP A;  4AM7 A;  4WE1 A;  4EZ9 A;  3EKU A;  5AFU A;  3SQ0 A;  3N4P A;  3OYE A;  1ATN A;  3OS0 A;  2GWJ A;  4DV6 K;  3S9H A;  4Y1D A;  4AHS A;  3M8P A;  1ZC6 A;  3RVC A;  1RIL A;  4L3Q A;  2O8B B;  5BPL A;  3HSC A;  2E2O A;  4B9V A;  4IFE A;  1NOZ A;  3MN7 A;  2O8E A;  4FJN A;  4ISE A;  1VQP N;  5KQ8 A;  2R7Y A;  4FWS A;  3O08 A;  4N76 A;  3HP6 A;  4Y0W A;  5I9E B;  1TK5 A;  1WOQ A;  1NU0 A;  3VER A;  1S9G A;  2Z1J A;  3MX2 A;  2O8C B;  3TAF A;  2IDO A;  3TU5 A;  2Z1G A;  2XY8 A;  3THV A;  2PBD A;  4E7J A;  4F4K A;  2FBY A;  5HOO A;  4DF8 A;  1Z25 A;  5HL7 L;  1ZBU A;  1S1U A;  4CJ7 A;  4DR5 K;  3O4W A;  4OPH A;  3BF3 A;  4Z4F A;  1HNX K;  2DFF A;  1NGA A;  4BDP A;  4JK7 A;  1J6Z A;  5AR0 A;  4CEO A;  3QER A;  4CZH A;  4Z4H A;  4CVN E;  1UAX A;  1RT5 A;  3SYZ A;  3THW A;  2Q3S A;  2O8D B;  4M3Z A;  5JS1 A;  1HMV A;  2O8B A;  3ZET A;  2QM1 A;  2QKK A;  4LF4 K;  2E88 A;  2FF6 A;  4FWO A;  4O5F A;  3PX4 A;  3O1W A;  4LY7 A;  2E2N A;  3V1Q A;  2ZD1 A;  4IKF A;  1VSH A;  2QWR A;  1KLM A;  3J7Y P;  1NK7 A;  4ILG B;  4GV6 A;  3QET A;  3SQ1 A;  3DYA A;  1R59 O;  5AQX A;  3KLE A;  1ATR A;  1CZ9 A;  1IJJ A;  1D4X A;  1D8Y A;  3QO9 A;  1P8Z A;  3QNO A;  3CG7 A;  3EYZ A;  1SZ2 A;  1WLJ A;  4DQR A;  1IG9 A;  4ILH A;  3CM5 A;  1JCE A;  3EO3 A;  4LF5 K;  5AJ3 K;  3HO1 A;  1HJO A;  2G8H A;  1Q82 O;  1QS4 A;  4IXC A;  4XEI A;  2I5J A;  2YNI A;  3TR8 A;  3E66 A;  3EL2 A;  1IH7 A;  5C0Y A;  4FWQ A;  4GW6 A;  1Z26 A;  2V7Y A;  4JI5 K;  3AVC A;  3QIC A;  4YDU A;  1YVU A;  4DV2 K;  3HJF A;  5CYM A;  3L4I A;  4PKH A;  4EFH A;  3VEN A;  4H0O A;  3WXI A;  1NNE A;  2HW3 A;  2HMP A;  2HST A;  3ULE A;  1VSL A;  3M1F A;  4JK8 A;  1HUX A;  1MDU B;  3VEY A;  4OKJ A;  1IO2 A;  1Y97 A;  1DEJ A;  4EIA A;  3AO4 A;  3G25 A;  4FK4 A;  3VQB A;  3L2W A;  4LF9 K;  4DV7 K;  4H0V B;  4CJV A;  4IZ9 A;  3AO3 A;  4BVO A;  3VQ8 A;  4IJN A;  3O9U A;  3GG4 A;  1K8K A;  1TAU A;  1IKX A;  1SQK A;  4BRM A;  3KZB A;  4JKH A;  3C65 A;  3BDP A;  2CH6 A;  3THY A;  1YJW N;  3PO5 A;  3PV8 A;  3D2F A;  5BRF A;  3CI5 A;  3BY5 A;  1WSG A;  4FLZ A;  1IBL K;  4B3M K;  3C6A A;  3CC4 N;  4DLE A;  2HF3 A;  1SKS A;  2D4W A;  4KTZ A;  3O9S A;  4ELV A;  3U9D A;  5BR9 A;  2WBN A;  2QWQ A;  4YDU C;  1SV5 A;  1Q18 A;  4A62 A;  1RBS A;  3J7A P;  2GV9 A;  4YOY A;  4AHR A;  4KHY A;  1HKB A;  3VQE A;  3DRP A;  2B5J A;  1JL2 A;  1T6D A;  4AIL C;  1BL3 A;  3SUO A;  1U04 A;  3AO1 A;  4M7Y A;  2RHK A;  3KKR A;  5AQS A;  1X1P A;  5FPD A;  3TAG A;  3F73 A;  2E8A A;  1ZBF A;  2UUB K;  4PL8 A;  4CIE A;  4LF6 K;  1RBT A;  4QS7 A;  4CJE A;  3DLL L;  2UYT A;  5F2R A;  1HNI A;  2YNH A;  2ZWH A;  4CJU A;  3KD1 E;  3CCQ N;  4DSF A;  4JKB A;  2QWM A;  4E0D A;  1VQ6 N;  3LWL A;  1D9F A;  4IOA L;  1YXQ A;  4IG3 A;  3LAM A;  3OTO K;  4FM2 A;  4DTN A;  1VQL N;  1TUY A;  5AQR A;  1OH5 A;  4XH5 A;  4B1U B;  3LZI A;  3L4Q A;  2PFU A;  3TTD A;  2P9U A;  4NCG A;  4X65 K;  3U8X A;  1Q86 O;  1N33 K;  5CZ1 A;  1KLN A;  4DTX A;  4FZX C;  4ZTJ A;  2GEM A;  5JVG L;  5JLH A;  1S6Q A;  4KRF A;  4LH5 A;  1SKW A;  2NRR A;  3SAH A;  4E7K A;  3SZ2 A;  3TSP A;  4YNQ A;  2FSK A;  4B8A B;  3BUZ B;  1MWM A;  3HRG A;  3JYT A;  4DU4 A;  1GLC G;  4E7I A;  3QIP A;  4BG9 A;  4KHN A;  4CF2 A;  3OS1 A;  3F9M A;  3M8Q A;  4H5N A;  2P1J A;  5E41 A;  4NLB A;  5M1N A;  3I56 N;  3R6M A;  3R8E A;  3CJC A;  4DS5 A;  2WC9 A;  3WNG A;  4MFB A;  5AQJ A;  1ASV A;  3VES A;  5KQD A;  3T1A A;  3ZSO A;  2OCE A;  1NGG A;  1I3A A;  1VSD A;  1IBM K;  1DT9 A;  2KFN A;  5HBM A;  3HYF A;  3SNN A;  1DTQ A;  3NVM A;  5FRN A;  3OS2 A;  4DSK A;  5EXW A;  1A5W A;  4H5T A;  2CGL A;  3OYF A;  3THW B;  4DV0 K;  1BGX T;  2F4V K;  2YKN A;  5EOY A;  4JKE A;  4A61 A;  4I9L A;  1L5U A;  2W6L A;  1CLQ A;  2BTF A;  2QW9 A;  3P83 D;  1KC8 O;  4H03 B;  1YTA A;  4ZHR A;  3D7E O;  2UUA K;  1KCF A;  3JAM O;  2A1R A;  3H6E A;  3OHR A;  3AA2 A;  1REV A;  5SWM A;  2VG7 A;  4FOI A;  1QSY A;  1BCM A;  1VQ9 N;  5GIO A;  4JD2 A;  3O4Q A;  4NXM K;  4M3R A;  3T7Z A;  3PX6 A;  1I39 A;  4C8L A;  3OBY A;  1B92 A;  4DV4 K;  3FZH A;  3GDQ A;  1YJN N;  4JI1 K;  5CHI A;  4EHU A;  4FM1 A;  3A8Y A;  4OPK A;  3VGL A;  1TVR A;  2F7T A;  4JKA A;  5AQG A;  3TSU A;  3QNN A;  3QLH A;  4CGF A;  1U45 A;  3OYM A;  3K9K A;  2NRW A;  3AO2 A;  3CIP A;  1QQO A;  2UXB K;  5AQL A;  4DR6 K;  2A42 A;  3I8B A;  2P5O A;  2ETJ A;  3RWU A;  4BRK A;  3KJV A;  2F8S A;  3MEC A;  4O5B A;  4C1N I;  2Y1I A;  3ZSR A;  1CZB A;  4DLG A;  2P9I B;  4CGG A;  3KK7 A;  4J2E A;  4C1N K;  5KPZ A;  2O8C A;  3OYI A;  3G71 N;  3RMD A;  3SCX A;  2A1S A;  1C6V A;  1WSI A;  3HK2 A;  4WQ4 C;  1S1X A;  4Z4C A;  2FC0 A;  3FE1 A;  3J80 O;  4B1V A;  3W0L A;  2HB5 A;  5BRD A;  5C2F A;  3CCM N;  5E26 A;  3GL1 A;  4K41 A;  3TAR A;  4PWD A;  1QHT A;  1YTU A;  4MLH A;  2KZZ A;  1WSJ A;  1X3M A;  3K57 A;  3K58 A;  4F2S A;  3CQY A;  1GOC A;  2D0C A;  1NK0 A;  1OKJ A;  2P9P A;  3D2E B;  3NBP A;  3HST B;  5C2D A;  3D0P A;  1OH6 A;  3PSI A;  4Z94 A;  5J2M A;  4CES A;  1BQN A;  4M3X A;  3QEI A;  3A5N C;  4FJM A;  2YHY A;  4KI4 A;  3SBT A;  2AA4 A;  5C15 A;  5JLF A;  3SJH A;  3LP3 A;  1JLE A;  1RT4 A;  1BIS A;  4CIF A;  2G8U A;  3MWT A;  2ZJR L;  2IOC A;  4B1Y B;  2XO7 A;  5KPT A;  4LC9 B;  1RDD A;  1NBW A;  3EY1 A;  2V52 B;  2YNG A;  1ZBL A;  4DR2 K;  4KI6 A;  3VET A;  3CM6 A;  5M1O A;  4A2B A;  3L2R A;  4CK1 A;  3V9Z A;  1C1B A;  4H0X B;  2GTD A;  2D5R A;  1GLF O;  1QVF M;  4KV8 A;  3WXK A;  4A2A A;  4EP4 A;  3GE1 A;  4YFU A;  5FDL A;  1EWR A;  5BPN A;  2ASO A;  3SMP A;  3SAF A;  4CJT A;  1X3N A;  4CEE A;  4JKD A;  4GV9 A;  3OYD A;  3AVG A;  3NFA A;  4NO7 A;  3DOK A;  4FWK A;  1X9W A;  4BC3 A;  4DV1 K;  1GLL O;  1NK6 A;  4K25 A;  4UQG A;  2J4R A;  3SBG A;  3F5T A;  4KH6 A;  4DHY A;  2E6M A;  4IOC L;  2KKZ A;  3NF8 A;  2OAN A;  3LPT A;  4IBN A;  3OYG A;  4QS8 A;  4FXD A;  3KVG A;  4I6M A;  3EE9 A;  1QSS A;  4RCH A;  2VQE K;  1VSE A;  3ZT4 A;  4KHS A;  4Z4I A;  4ISG A;  3R1X A;  4WQ5 C;  4BGB A;  5AZJ A;  4DFJ A;  1FJG K;  3C6U A;  1SL1 A;  2PZS A;  2YKM A;  3KK3 A;  2GUP A;  1NGI A;  5KGW A;  4GMJ B;  1NWK A;  4CF9 A;  3SPY A;  4PA1 A;  3HM9 A;  1CZA N;  3ID6 A;  4ISF A;  4NLC A;  3ATV A;  1X9J A;  2DPN A;  5T7B A;  3MN5 A;  4NCB A;  3MX5 A;  5CZ2 A;  2XY5 A;  2HHT A;  4DQP A;  3UB5 A;  3SQ4 A;  2PAV A;  4F9O A;  1WAJ A;  4OGC A;  2FF3 B;  4BGA A;  1NG9 A;  2DTU A;  3O3G A;  1KD1 O;  1ZBI A;  1XWL A;  1WN7 A;  3HPO A;  1HPZ A;  4MQ3 A;  4IOX A;  3ULD A;  3NGY A;  4CW7 B;  2ZM6 K;  3MK6 A;  4FLY A;  3M3Z A;  1M1K O;  4ICL A;  4E1N A;  4FZY A;  4AQY K;  3D2F B;  3CJA A;  3QES A;  2HVH A;  3SUP A;  2ITG A;  2B4J A;  3CD6 N;  1KRP A;  3ZSQ A;  4HCB A;  1LW2 A;  4DV5 K;  4FZZ A;  5FRO A;  1RBR A;  2OZM A;  5J2P A;  4GVM A;  2XRI A;  4RW7 A;  4KBO A;  1BA1 A;  1SS6 A;  4JAX A;  3FFI A;  4CIG A;  2VGM A;  4KAZ A;  5AQW A;  1S3X A;  4M45 A;  3DRR A;  1LAW A;  4BRL A;  3VQD A;  5GAD P;  2Z1I A;  1NK4 A;  5I3U A;  1MU2 A;  3RSE B;  3LAL A;  1O1W A;  2D0O A;  5AQY A;  4CJ3 A;  2Q2R A;  3AGK A;  3S3N A;  4YOX A;  4V19 S;  3DI6 A;  1BQM A;  2E5L K;  3NF6 A;  3UKR A;  3WUH A;  1QVG M;  3TPQ A;  5GIP A;  4Q0B A;  4JS4 A;  1Q81 O;  4FWN A;  3QIO A;  4JD2 B;  4H5R A;  3CCR N;  3ASM A;  5F1X A;  3VGM A;  4AHV A;  5AQT A;  3WNF A;  4KTW A;  3Q7C A;  3CQX A;  3SAG A;  3MEG A;  4JNE A;  3TAN A;  5CY4 A;  3KKS A;  5JMV A;  1K73 O;  3RR7 A;  3CXC M;  2ZE2 A;  4GKK K;  1NGE A;  3T19 A;  4FJ8 A;  3V9U A;  1YAG A;  3ZX0 A;  4FWM A;  4ELT A;  3OJS A;  4CGD A;  4CJR A;  2HBJ A;  1JCG A;  2P9P B;  3L2V A;  4F3T A;  1ZBH A;  1TAQ A;  2WON A;  3DLE A;  1TL1 A;  2NUB A;  4BAC A;  1U4B A;  3HTV A;  1BOT O;  1RT1 A;  3HM8 A;  4MO4 A;  2HHX A;  3NAE A;  4DFM A;  3NH2 A;  2XY6 A;  4KHW A;  4CZF A;  4BRP A;  4CHN A;  2JWK A;  3DJC A;  3OJU A;  3V6D A;  1NK5 A;  3F2K A;  4JHD A;  2W41 A;  4JI2 K;  4HTL A;  1C0G A;  2O8D A;  2PYL A;  1OH8 A;  1VQ7 N;  4CF0 A;  3AVM A;  4K0K K;  2QI2 A;  2HOE A;  3OYA A;  2P9I A;  3TAE A;  4CZE A;  1I94 K;  2HBL A;  5FPM A;  3VQ6 A;  4FW2 A;  3HVR A;  4IG0 A;  1BO5 O;  3LWM A;  4NB4 A;  3CCV N;  3UKU B;  1K8A O;  4FLX A;  3FGU A;  1HNW K;  3ZSX A;  3S3M A;  3K2P A;  2OPQ A;  1BIU A;  2D0P A;  1RNH A;  3IRX A;  4FWL A;  1TK0 A;  4BQZ A;  2XHB A;  4FK2 A;  4H5W A;  3MED A;  3VMF B;  4FYD A;  4U67 L;  1VSF A;  1JLG A;  4KH5 A;  4DKW A;  1ZXO A;  3L2U A;  1QQC A;  2ZQB A;  1KVB A;  3OA9 A;  3SV4 A;  5DM6 L;  4OLB A;  4N47 A;  2IC3 A;  3PX0 A;  1EQY A;  2Q36 A;  3BGR A;  1K9M O;  1U48 A;  3AVB A;  5HRN A;  1TV6 A;  3DLB A;  3FFK B;  1BA0 A;  2IVP A;  4O8K A;  4DSJ A;  1KVC A;  4DR3 K;  2KLA A;  5KRS A;  1S9E A;  1G15 A;  1NM1 A;  3TAP A;  1E3M A;  5J1E A;  5TKY A;  4CFC A;  1TKX A;  4QAG A;  3E9L A;  3AO5 A;  3BZC A;  1NGH A;  3SK3 A;  4CBX A;  2YI1 A;  2P9N B;  3A5M C;  3U3G A;  3J7Z O;  4ILJ A;  4JRP A;  3C7N A;  1CXU A;  3C7N B;  4CHP A;  4OPJ A;  2WOM A;  4GVE A;  2VYP A;  1BIZ A;  3NH0 A;  1RDA A;  3DMJ A;  1JLF A;  5AFU H;  3QFU A;  4XH1 A;  5AQV A;  4N5S A;  3HT3 A;  4BR5 A;  1M90 O;  3ZSZ A;  4YY3 K;  1XHX A;  4FOE A;  2JGU A;  2YHX A;  3G10 A;  4JI6 K;  3MN9 A;  3SUN A;  1K6Y A;  3CCE N;  4KB1 A;  3VF2 A;  1HNV A;  4LFA K;  3CET A;  4CZL A;  3O3F A;  3THY B;  1QE1 A;  4H8K A;  3FZF A;  1T6C A;  4J2B A;  4B3T K;  4BR4 A;  3SPZ A;  1W97 L;  4Z4G A;  5DM7 L;  3VEV A;  2O8F B;  4LF8 K;  1ESV A;  1ZYQ A;  2G8I A;  4JEP A;  5HP1 A;  4E19 A;  3DRS A;  4CGH A;  1RBV A;  3QB0 A;  3KTQ A;  2XY7 A;  4CZK A;  2KTQ A;  3TAM A;  3RMC A;  2G8W A;  3GOI A;  1NJX A;  1HQE A;  3IMX A;  4A5A A;  1YHQ N;  3ULE B;  2E6L A;  1RT2 A;  2FBT A;  2VQF K;  1NK9 A;  2P9U B;  1LWE A;  1Q9Y A;  1WB9 A;  4IFV A;  3R9P A;  1KFS A;  3DWL A;  4B3O A;  2D0B A;  4QS9 A;  1J5O A;  4B9M A;  4JI3 K;  2BUP A;  3V9X A;  3O4N A; 
#chains in the Genus database with same CATH homology
 2P9I B;  3KK7 A;  5M1K A;  1NGB A;  3NVK A;  4C1N K;  5KPZ A;  3MCA B;  1NGJ A;  1NGF A;  3H45 C;  3G71 N;  3WXM B;  1KAY A;  3LDL A;  4R79 A;  3PIP L;  3HOT A;  2HBM A;  2HF4 A;  2I7N A;  1VQK N;  4K43 A;  4WQ4 C;  2E2P A;  5FPE A;  4YOR A;  4BRF A;  3FE1 A;  4BRO A;  4B1V A;  3FZK A;  3W0L A;  1MA9 B;  4EAH D;  3O9Q A;  1NLV A;  5BRD A;  5C2F A;  3CCM N;  2YJE A;  5E26 A;  3GL1 A;  4MDB A;  4K41 A;  5AQQ A;  3H3N O;  4MLH A;  1X3M A;  2GX9 A;  4BG8 A;  1NGC A;  1YVN A;  4FVU A;  5GAG P;  2ZJP L;  4EHT A;  2CH5 A;  3CQY A;  3CER A;  5CE3 A;  3CCJ N;  1RDW X;  3WQU A;  2GWK A;  4YOU A;  2QWN A;  4H5V A;  4XH4 A;  1OKJ A;  2WFB A;  2P9P A;  2NNW A;  2JWL A;  1HKG A;  3D2E B;  1BDG A;  5EVZ A;  3U4L A;  5C2D A;  3VPZ A;  2ASP A;  2ZF5 O;  4Z94 A;  2P9L B;  3G4S N;  2HBK A;  1JJ2 M;  5LJV A;  3MN6 A;  3A5N C;  5ADX H;  4WFB L;  5AQN A;  2OTJ N;  3KHY A;  2YHY A;  5AZJ B;  4A57 A;  2P9S A;  5BRE A;  3DXK B;  3SBT A;  1QQM A;  2AA4 A;  3E9P A;  3SLC A;  1GLJ O;  5C15 A;  3VEO A;  4CZG A;  5JLF A;  4GV3 A;  4FO0 A;  3SJH A;  5EX5 A;  4JKG B;  3P31 A;  2YX6 A;  3J8A A;  2Q97 A;  3MWT A;  2ZJR L;  4B1Y B;  4AM7 A;  5KPT A;  4LC9 B;  3EKU A;  3Q7B A;  5AFU A;  1NBW A;  3N4P A;  1NGD A;  5AQH A;  4WF9 L;  1ATN A;  2V52 B;  1RDU A;  2GWJ A;  3VET A;  5M1O A;  2ZGY A;  3CJ7 A;  3K9J A;  4A2B A;  1ZC6 A;  2V7Z A;  3RVC A;  2V51 B;  1XUP O;  4L3Q A;  5BPL A;  3HSC A;  4H0X B;  2E2O A;  2GTD A;  3ATU A;  4IFE A;  3VTH A;  4CI6 A;  3MN7 A;  1GLF O;  1QZ5 A;  5AQF A;  4BY9 C;  1QVF M;  4ISE A;  4BC5 A;  3WXK A;  4A2A A;  4BRC A;  3GE1 A;  5KQ8 A;  1VQP N;  1VQO N;  4FWS A;  3O08 A;  1DKG D;  1P90 A;  3P4I A;  4Y0W A;  1BG3 A;  5BPN A;  4M63 C;  4I6M B;  2YHW A;  2ASO A;  3SMP A;  4BVP A;  1WOQ A;  5I9E B;  3VER A;  3SAF A;  4MDA A;  4C23 A;  3MX2 A;  1X3N A;  4H0Y B;  4JKD A;  4GV9 A;  5BPM A;  3TU5 A;  3LDO A;  4NO7 A;  4BR9 A;  2P9K B;  2IVO A;  4FWK A;  2PBD A;  4CD1 A;  3H3O B;  3LL3 A;  4BC3 A;  5AQZ A;  1GLL O;  1Y64 A;  4K25 A;  2FSJ A;  2J4R A;  2YJF A;  4JKC A;  1E4G T;  5HOO A;  3SBG A;  3F5T A;  1BUP A;  1G99 A;  1WUA A;  3WEE A;  3O1B A;  4KH6 A;  5HL7 L;  3H1Q A;  4DHY A;  4IOC L;  2KKZ A;  1HKC A;  3A0I X;  4CJ7 A;  3O4W A;  4OPH A;  4CZM A;  4BR2 A;  3BF3 A;  4PL7 A;  2OAN A;  2VWB A;  5E84 A;  3CME N;  4GNI A;  3CPW M;  2QWP A;  1NGA A;  3E1Y A;  4JK7 A;  1J6Z A;  1NMD A;  2A6A A;  3KVG A;  4I6M A;  4QS8 A;  3EE9 A;  5AR0 A;  1O13 A;  5AQI A;  4CZH A;  4RCH A;  3WXL A;  4BRD A;  1N8R O;  1H1V A;  3CCU N;  4ISG A;  1HX1 A;  2CGJ A;  1JCF A;  4KH4 A;  3LM2 A;  3R1X A;  4WQ5 C;  3I33 A;  4BGB A;  5AZJ A;  2VCP A;  4BRG A;  3CC2 N;  3ZET A;  2QM1 A;  1V4T A;  5AQO A;  1C0F A;  4JK9 A;  2P9N A;  2E88 A;  1DGK N;  1NGI A;  2FF6 A;  2GUP A;  4FWO A;  4O5F A;  3EZW A;  1NWK A;  3CF5 L;  2Q0U A;  3O1W A;  2NRH A;  2E2N A;  4IWV A;  1Z05 A;  1CZA N;  2RE2 A;  4BQL A;  2Q31 A;  3ID6 A;  2EWS A;  3IDH A;  4ISF A;  4NLC A;  2QWR A;  3ATV A;  4BRH A;  1X9J A;  3E9O A;  2NRT A;  2DPN A;  3EE8 A;  3R3L A;  3VOV A;  3AAP A;  4ILG B;  4GV6 A;  1HPM A;  3MN5 A;  4JKG A;  3MX5 A;  3T69 A;  5GAE P;  3O6W A;  4FSV A;  3UB5 A;  2PAV A;  3NMU A;  1R59 O;  2Q0R A;  4F9O A;  1ILY A;  2NRX A;  5AQP A;  5AQX A;  4BR7 A;  2FF3 B;  4BGA A;  1ATR A;  2QXL A;  4IO8 A;  3ZEU A;  1IJJ A;  1D4X A;  1KD1 O;  3EN9 A;  2FXU A;  1YF5 L;  1P8Z A;  2E20 A;  5ELZ A;  4WFN L;  5BRH A;  4IOX A;  2CGK A;  3KWI A;  3D2E A;  5GAH P;  1SZ2 A;  3MK6 A;  3M3Z A;  1M1K O;  4ILH A;  4CBU A;  1JCE A;  3EO3 A;  1HJO A;  1U6Z A;  3A5L C;  3D2F B;  1Q82 O;  3CJA A;  1XC3 A;  4IXC A;  4XEI A;  1YI2 N;  3RSE A;  3E66 A;  3CJB A;  3O8M A;  3AAQ A;  3EL2 A;  3UE5 A;  5KPR A;  1YIT N;  3CD6 N;  1ATS A;  3PLA A;  5C0Y A;  5M1Q A;  4FWQ A;  2V7Y A;  3QIC A;  4AF1 A;  3U9Z A;  3LDQ A;  4YDU A;  4KBO A;  1BA1 A;  1SS6 A;  4JAX A;  3ZYY X;  3L4I A;  3O5B A;  4PKH A;  3VF6 A;  4BC4 A;  2VGM A;  4EFH A;  5AQW A;  3VEN A;  1S3X A;  3IFR A;  4B9Q A;  4BRL A;  5GAD P;  4H0O A;  3WXI A;  2HMP A;  2HST A;  3EKS A;  3ID8 A;  3ULE A;  3M1F A;  4JK8 A;  3RSE B;  1HUX A;  3WT0 A;  4CZI A;  1MDU B;  3VEY A;  3VEW A;  5H1S Q;  2D0O A;  1DEJ A;  4H0T B;  5AQY A;  4EIA A;  4YOW A;  1Q7Y O;  1ZBS A;  4B1W B;  3G25 A;  2NRV A;  2Q2R A;  3AGK A;  4YOX A;  3WQT A;  3BP8 A;  3UKR A;  4FPA A;  3WUH A;  1QVG M;  4B1X B;  4H0V B;  3MCP A;  5JVH L;  4YOV A;  4IZ9 A;  1GLE G;  4WQ4 A;  3CHW A;  3TPQ A;  4BVO A;  5GIP A;  4IJN A;  3W3D A;  5FPN A;  3O9U A;  3LDN A;  2A5X A;  2F9W A;  3O9T A;  3VTI A;  1MWK A;  5F0X A;  4FWN A;  2A3Z A;  2NRZ A;  2VGN A;  1K8K A;  3GG4 A;  4A59 A;  4JD2 B;  4BRM A;  1SQK A;  3KZB A;  4H5R A;  3CCR N;  2A40 A;  3DAW A;  4JKH A;  3FR0 A;  2I7P A;  5F1X A;  3C65 A;  3FLC O;  4RWT A;  3VGM A;  5EY4 A;  2CH6 A;  5ADX A;  3G6E N;  1YJW N;  5AQT A;  1KXP A;  3D2F A;  1KAX A;  3CI5 A;  3Q7C A;  3TTF A;  5BRF A;  3CCL N;  4MO5 A;  3CQX A;  3DXK A;  3SAG A;  4IO9 L;  1VQM N;  1QHA A;  4G9Z A;  3L6Q A;  5AQU A;  3UKU A;  3C6A A;  4JNE A;  2D1K A;  3CC4 N;  2ITM A;  3PIO L;  2HF3 A;  1XQS C;  4BRE A;  5JMV A;  1K73 O;  2D4W A;  3CXC M;  1NGE A;  3CJ9 A;  3O9S A;  4CBW A;  2F9T A;  1YAG A;  3ZX0 A;  3ENH A;  3FZL A;  2WBN A;  3IUC A;  4FWM A;  3U9D A;  5BR9 A;  2QWQ A;  2P9L A;  2H3G X;  3A5O C;  4YDU C;  3B8A X;  3ENB A;  1Q18 A;  4A62 A;  2HBJ A;  1LCU A;  1JCG A;  2P9P B;  4BRA A;  3LM9 A;  4AM6 A;  1V4S A;  4YOY A;  4BRQ A;  5LJW A;  1W2B M;  1HKB A;  4OPA A;  4FWR A;  2ASM A;  3HTV A;  1T6D A;  1BOT O;  1KAZ A;  3M5R A;  5CR4 A;  4M7Y A;  1K8K B;  4M7X A;  3HM8 A;  1T44 A;  2RHK A;  4MO4 A;  5AQS A;  4FPB A;  3H1V X;  4CZF A;  4BRP A;  5FPD A;  2E1Z A;  2JWK A;  3DJC A;  2E8A A;  2Q1N A;  3JXU A;  3HI0 A;  4PL8 A;  3QDK A;  4BRI A;  1SAZ A;  3F2K A;  4B1Z A;  5AZI B;  4QS7 A;  4JHD A;  3DLL L;  3BF1 A;  2E2Q A;  2P9K A;  2W41 A;  4DCH A;  2UYT A;  3UKR B;  5F2R A;  2WUS A;  4HTL A;  3OBW A;  2ZWH A;  1C0G A;  4JKF A;  1RFQ A;  2AP1 A;  3CCQ N;  1VQ7 N;  4JKB A;  4K42 A;  3KWG A;  1VQ5 N;  2QI2 A;  2HOE A;  2QWM A;  3AAR A;  2P9I A;  1EO1 A;  1VQ6 N;  4CZE A;  2ZGZ A;  2HBL A;  5FPM A;  2OTL N;  4IOA L;  1YXQ A;  2QWO A;  1VQ8 N;  4BC2 A;  1BO5 O;  5C10 A;  4NB4 A;  3WEE B;  3CCV N;  1VQL N;  3UKU B;  1TUY A;  5AQR A;  1K8A O;  4IJA A;  3FGU A;  4XH5 A;  5M1P A;  4B1U B;  3WXJ A;  1TYQ A;  3L4Q A;  1LOT B;  5BN8 A;  2PFU A;  3TTD A;  2P9U A;  2D0P A;  4FWL A;  2E1Y A;  4BQZ A;  4H5W A;  1YIJ N;  3U8X A;  1Q86 O;  3VMF B;  1TYQ B;  4BR0 A;  1GLB G;  4U67 L;  4IEE A;  3C0B A;  4DB3 A;  3VGK A;  2GEM A;  5JVG L;  4FWP A;  3CC7 N;  5JLH A;  4KH5 A;  1U2V A;  4DKW A;  4CD3 A;  2NRR A;  1ZXO A;  3SAH A;  1RGI A;  4WYB A;  3BEX A;  2BH1 A;  3TSP A;  1U2V B;  3OA9 A;  4UY8 O;  5DM6 L;  2YCH A;  2FSK A;  3BUZ B;  1MWM A;  3HRG A;  1GLC G;  3QFP A;  1EQY A;  2Q36 A;  3ZEU B;  1QQN A;  4BG9 A;  1K9M O;  3FZM A;  3F9M A;  1T3V A;  3FFK B;  1BA0 A;  4H5N A;  2IVP A;  3DXM B;  3D6R A;  4NLB A;  4O8K A;  5M1N A;  3I56 N;  1BU6 O;  5C12 A;  2W40 A;  3R6M A;  3R8E A;  3CJC A;  4IEI A;  2KLA A;  5AZI A;  3AGR A;  2WC9 A;  1NM1 A;  4RTF D;  5AQJ A;  1KQS M;  2QTD A;  4CZJ A;  3OW2 M;  3VES A;  5TKY A;  5KQD A;  5GIN A;  3SMS A;  4PHT X;  3E9L A;  3CMA N;  1NGH A;  1NGG A;  3SK3 A;  4CBX A;  5MLC Q;  1VQ4 N;  2FLO A;  2YI1 A;  4BRN A;  2P9N B;  2NLX A;  1TUU A;  3A5M C;  3J7Z O;  2QA4 N;  1DT9 A;  3VEZ A;  3MMV A;  4ILJ A;  3VF4 A;  4PKG A;  4U7B A;  3NVM A;  5AQM A;  2IIR A;  2KHO A;  3IKM A;  3P38 A;  5EXW A;  3H46 O;  3C7N A;  3HBT A;  4H5T A;  1S22 A;  2CGL A;  2NZT A;  4JHD B;  3QBW A;  3C7N B;  1GLA G;  5EOY A;  4DQ8 A;  4E1J A;  4GVE A;  2VYP A;  4JKE A;  4A61 A;  1VQN N;  5JIC A;  5AFU H;  4WFA L;  4WCE L;  3QFU A;  2BTF A;  2QWL A;  2QW9 A;  4XH1 A;  4JN4 A;  5AQV A;  4BR5 A;  1M90 O;  1VAZ A;  1KC8 O;  4H03 B;  4FOE A;  1HLU A;  2YHX A;  4FL9 A;  3D7E O;  3MN9 A;  3CCE N;  5AQK A;  3VF2 A;  4HWI A;  3H6E A;  4J8F A;  3CET A;  3OHR A;  3ZX3 A;  4CZL A;  3N4Q A;  4FOI A;  3C6H A;  3O9R A;  3MWP A;  3FZF A;  3CPE A;  1VQ9 N;  3QML A;  4MLE A;  1T6C A;  4YOT A;  3LDP A;  5GIO A;  4JD2 A;  1QZ6 A;  4BR4 A;  5LY3 A;  3P39 A;  3T7Z A;  1W97 L;  3DXM A;  5DM7 L;  5M1F A;  3HZ6 A;  2A41 A;  4WQ5 A;  3VEV A;  3OBY A;  1ESV A;  3MDQ A;  1BWF O;  3FZH A;  4O8U A;  4JEP A;  5TKW A;  3GDQ A;  3QBX A;  3ZET B;  1YJN N;  3ZX2 A;  3VEX A;  1YJ9 N;  3TSQ A;  5CHI A;  4EHU A;  1NJI O;  1YUW A;  3HOS A;  3QB0 A;  3JS6 A;  4IDH A;  3TTC A;  1GLD G;  3A8Y A;  3O80 A;  2QEX N;  3VGL A;  3CCS N;  2F7T A;  4GY2 B;  4JKA A;  4PKI A;  4CZK A;  5AQG A;  4A5B A;  3GOI A;  3IMX A;  3TSU A;  2FSN A;  3K9K A;  2NRW A;  3L0Q A;  5BN9 A;  3CIP A;  1QQO A;  3ULE B;  4A5A A;  1YHQ N;  3GBT A;  2GEL A;  5AQL A;  2A42 A;  2IVN A;  2P9U B;  3I8B A;  3R9P A;  3DWL A;  4H0P A;  4BRK A;  3I55 N;  4QS9 A;  1E4F T;  1S72 N;  2BUP A;  1Q81 O;  2P9S B;  4OO1 J;  4C1N I;  5B8H A;  3AY9 A;  2ZJQ L;  3M6G A;  1OVY A;  3CJ1 A;  3ENO A;  1Z6R A;  1IG8 A;  3S41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...