3AAPA

Crystal structure of lp1ntpdase from legionella pneumophila
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
353
structure length
353
Chain Sequence
KHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 105
structure length 353
sequence length 353
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aapA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aapA02
3AY9A 2V51B 3VOVA 3W3DA 4FWNA 5ELZA 3CJ7A 1BUPA 1XQSC 2P9LA 1U6ZA 3O8MA 4H5VA 5AQOA 2F9WA 4FPAA 2CH5A 4IZ9A 2QWOA 2Q0UA 3DXMA 5LJVA 2E2PA 1SZ2A 1WOQA 3A5MC 1GLAG 3VEZA 2P9SA 3A5LC 4BG8A 5AZIA 4BR9A 3MMVA 3D2EB 4I6MB 1ZXOA 3U9ZA 4B1XB 1U2VB 2GEMA 4B1VA 3LM9A 2YJFA 1GLLO 3SJHA 4K25A 3BUZB 4EAHD 2GTDA 4F9OA 4RWTA 5AQKA 3HSCA 4BC4A 5BR9A 1J6ZA 2A6AA 3FZFA 5BPNA 3SMPA 4BRCA 2H3GX 4XH4A 1K8KB 1BU6O 5AQSA 1C0FA 3R8EA 2ZGZA 5KPTA 4NO7A 4K43A 3VF6A 4CZEA 1NGCA 4CI6A 4FWOA 3MCPA 3DXKB 2Q1NA 4DHYA 4GY2B 2ASPA 3WEEB 3TU5A 1EQYA 4A2BA 2E8AA 5AQNA 4CJ7A 4NB4A 4IJNA 3FZMA 3CJCA 3ZETA 3P4IA 3S41A 3U4LA 3SLCA 3J8AA 2QWNA 2HOEA 2V7YA 4CD3A 4DB3A 1HUXA 1X9JA 5FPDA 4WQ5A 3HZ6A 4O5FA 1HKGA 3CQYA 3L6QA 4BVPA 1DEJA 3O5BA 3UB5A 2A42A 4JHDB 3LDOA 3MN6A 4FPBA 4HTLA 5BRFA 5FPNA 3ZX2A 5BRHA 5AZIB 3H3NO 3IFRA 3LDPA 4QS9A 4JN4A 4BR5A 4CZIA 2QW9A 2QWPA 2P9UB 1X3NA 1BDGA 4CD1A 5AFUA 2GELA 3C0BA 4QS7A 1Z6RA 1ATSA 1NGJA 3ZX0A 2GUPA 5KPZA 3VF4A 1V4TA 4H0YB 2Q0RA 1KAZA 3EZWA 5CE3A 2YHWA 5KQ8A 2P9NA 4CZHA 2HMPA 1RGIA 1BO5O 1YAGA 2Q36A 4FO0A 2E2OA 5KPRA 4QS8A 1YVNA 2FLOA 2E2QA 3WEEA 4MLEA 3VEVA 4BQLA 3EO3A 3SK3A 3M3ZA 5AQWA 5BN8A 5AQXA 3D7EO 5BREA 3LL3A 3FZLA 2GWKA 3ZETB 4BRDA 5AQUA 4BC5A 1E4FT 1TYQA 4A2AA 4H5RA 5AR0A 3VEXA 2YHXA 3FFKB 1QHAA 3H1QA 3KHYA 3O1WA 2QWMA 2A40A 1BWFO 3VEOA 2VWBA 4BRAA 1T44A 2FSNA 4FWRA 3HM8A 2A3ZA 4C23A 4JHDA 4B1UB 2AP1A 3LDQA 3A8YA 4ISGA 5AQJA 4BGAA 2W40A 5E26A 4CBXA 3CERA 1BOTO 3GOIA 1KXPA 3KVGA 1V4SA 4YDUC 1KAXA 3C7NA 3H6EA 4JAXA 2P9UA 3VENA 3BP8A 1IJJA 3MN9A 3VEYA 3CI5A 2QWRA 1BA1A 4BROA 1ESVA 2YI1A 3QBWA 2CGLA 3FZKA 4CZMA 3JS6A 2P9IB 2IIRA 3HBTA 3L0QA 2EWSA 4AM6A 1QQOA 1NM1A 4H03B 4WQ4C 2P9NB 1OKJA 2WUSA 3M1FA 2UYTA 3WQUA 2J4RA 5ADXH 3ENOA 5EX5A 3UKUA 3VGMA 1NGEA 5FPEA 2PAVA 2ITMA 3TPQA 4B1YB 5AZJB 3CJ9A 2FSKA 3QMLA 2NRHA 4BR7A 4AM7A 3AAQA 4GNIA 4H5WA 1TUUA 4BRNA 3GBTA 1GLFO 4E1JA 3LDLA 3CJAA 1G99A 1TYQB 1NMDA 3VGKA 1ZC6A 2IVNA 3WXJA 4IXCA 5TKYA 3WXIA 2VYPA 2ZWHA 4LC9B 2I7NA 4IJAA 4FWMA 2A41A 3O4WA 3O1BA 2P9PB 3CQXA 4BGBA 4FWKA 3L4IA 1YXQA 3MK6A 5EXWA 1IG8A 3IDHA 1T6CA 2P9KB 4FSVA 1XC3A 5FPMA 1MWMA 2GWJA 5EY4A 4BRLA 1ATNA 3C7NB 3QFPA 3A5OC 4HWIA 4EIAA 3QFUA 3EN9A 3D2FA 4IO8A 4J8FA 1JCFA 2QWQA 3MN7A 4BRFA 4ISFA 1E4GT 4BC3A 5LY3A 1ZBSA 5AQFA 3VESA 1LCUA 1QQNA 3H1VX 1H1VA 1XUPO 3HTVA 3G25A 4H0PA 2A5XA 2KHOA 2YCHA 2P9IA 1NBWA 5EOYA 3MN5A 5F0XA 2CGJA 3SMSA 1QZ5A 3EL2A 4Y0WA 3WXKA 1DGKN 4K42A 1SAZA 2PBDA 3H46O 3H45C 3ATVA 3GG4A 3UKUB 3BF3A 5AZJA 2ZF5O 3BEXA 3ID8A 3EKSA 3I33A 4XH5A 5JLHA 3FE1A 3O80A 2HF4A 2E20A 4PKGA 1HX1A 5BN9A 4Z94A 4M63C 1TUYA 3WT0A 4PKHA 3GL1A 2D0PA 4BR4A 4BRIA 2F9TA 5JLFA 2Q31A 2QXLA 4H0TB 1SQKA 4YDUA 2D0OA 1WUAA 1NGDA 2P9PA 1JCEA 1Q18A 2NZTA 4IWVA 4EHUA 2P9KA 3O08A 1CZAN 3CIPA 2YJEA 4BR2A 4BR0A 1BG3A 1HKCA 3AARA 4JD2A 2BTFA 1MDUB 4MLHA 5AQRA 3KZBA 4B1WB 4BQZA 3H3OB 1KAYA 4M7YA 3A5NC 3VETA 3JXUA 4FOEA 4WQ4A 5AQTA 3D2FB 5LJWA 3WQTA 1MWKA 2Q97A 3W0LA 3HI0A 3F9MA 4ISEA 1JCGA 1C0GA 1T6DA 4B1ZA 3LDNA 4CBWA 3QDKA 1LOTB 3A0IX 2YHYA 3QICA 4L3QA 3VERA 5AQQA 3WUHA 3DJCA 3WXLA 4PL8A 3QBXA 1QZ6A 3ZX3A 1DKGD 2I7PA 3ULEB 4H5NA 5JMVA 2IVOA 3ATUA 5AQMA 3UE5A 5BPLA 3FZHA 2Q2RA 1S22A 3UKRA 4CZKA 3VF2A 1D4XA 3R6MA 3DAWA 4FWLA 4H5TA 5I9EB 3EKUA 4BRQA 3GDQA 1YUWA 2FXUA 3RSEB 3B8AX 4BRHA 4H0XB 2DPNA 5F1XA 3VEWA 5ADXA 2FF3B 4K41A 1HJOA 2D4WA 3ZEUA 4A62A 4CBUA 4H0OA 2QWLA 1NLVA 1GLCG 1NGGA 2VCPA 2V7ZA 3R9PA 1NGBA 5AQPA 1HLUA 4WYBA 2ASMA 1R59O 1NGIA 2D1KA 3OHRA 1Y64A 4JD2B 4DQ8A 4H0VB 4EFHA 5AQGA 4FWPA 1GLDG 2E1ZA 4PKIA 4BRMA 1NGAA 4PL7A 1RDWX 3CJ1A 3I8BA 2P9LB 2E1YA 3LM2A 5B8HA 3FGUA 3DWLA 5AFUH 4B9QA 4BREA 3DXMB 3M6GA 3ENHA 1HPMA 4BVOA 5AQVA 1RFQA 2W41A 3VGLA 4DCHA 2ASOA 3FR0A 1P8ZA 2P9SB 4FL9A 4WQ5C 5AQLA 4A61A 1MA9B 4CZFA 5BRDA 2E88A 3BF1A 3D2EA 2ZGYA 2FSJA 4I6MA 4MO4A 5E84A 5KQDA 2AA4A 1HKBA 2E2NA 1U2VA 5BPMA 4FOIA 3ULEA 3U8XA 1NWKA 4FWSA 2FF6A 1GLEG 3UKRB 1QQMA 3CETA 2HF3A 4RTFD 1ATRA 4JNEA 4BC2A 1NGHA 4XEIA 2OANA 4MO5A 3QB0A 3RSEA 5EVZA 1X3MA 2CH6A 2IVPA 2V52B 1K8KA 4BRGA 3IMXA 3MDQA 3O6WA 3FLCO 3CJBA 4M7XA 5AQIA 5JICA 3CHWA 3ZEUB 4O8KA 4BG9A 3DXKA 1Z05A 3AAPA 4BRKA 2BUPA 4RCHA 5AQHA 1BA0A 3U9DA 4CZLA 1GLJO 1S3XA 2NLXA 3IUCA 5AQYA 3VPZA 4KBOA 4CZGA 2QM1A 5AQZA 4BRPA 4CZJA 4FWQA 4EHTA 3GE1A 4XH1A 1GLBG 5F2RA 2CGKA 1NGFA
chains in the Genus database with same CATH superfamily
2PFUA 3SZ2A 3W3DA 4JI1K 1U6ZA 1DTTA 3CQ8A 1SUQA 3VQ5A 4FPAA 4BWMA 1BGXT 1WBBA 2QWOA 4ID1A 2E2PA 1D9FA 1SZ2A 4OGEA 3K9KA 4BG8A 4BR9A 2P51A 3NAEA 4DU1A 2ATQA 4B1VA 2OZSA 5LMUK 1U48A 2YJFA 4X64K 4U67L 4EAHD 2WFBA 4M3ZA 2D0AA 4F9OA 1JJ2M 1RBSA 4BC4A 2O8DB 1BIUA 3CMEN 3FZFA 1B92A 2Z1IA 1NU0A 1XNQK 4CF1A 2VQEK 1K8KB 5MLCQ 4E7KA 3TTFA 3HM9A 2ZGZA 4NO7A 3VF6A 3SUPA 1NGCA 2F4VK 5BR8K 4JI2K 3DM2A 3DXKB 1P90A 2Q1NA 4DHYA 4GY2B 1J53A 3TU5A 4M42A 1S1XA 1U49A 4A2BA 4V19S 2NUBA 1LWEA 4WFAL 2G8IA 4O55A 4HTUA 1KFDA 4R5PA 3P4IA 3U4LA 1KD1O 2PYJA 3J8AA 2ITGA 1X9JA 4WQ5A 2HHXA 1VHXA 1JLQA 1NK9A 2KTQA 3HK2A 4BVPA 1DEJA 2UXDK 1CZBA 5M1NA 3O5BA 3I0SA 4HTLA 5JVGL 4KKOA 3ZX2A 3IFRA 4JN4A 5KTQA 3CFRA 3OTOK 1QQCA 1X3NA 3BZCA 3HPOA 1BDGA 3SPYA 3K5OA 5AFUA 3AO3A 2HHVA 4QS7A 4PWDA 1NOYA 3SQ4A 4KRFA 3F73A 1V4TA 4OKEA 3NF8A 4H0YB 4CEBA 4FJXA 1KAZA 1VRTA 3NVMA 5KQ8A 1NK5A 1JL1A 1YAGA 2E2OA 5KPRA 2FLOA 3EO3A 4AILC 1HRHA 1KTQA 5BN8A 3LALA 5AQXA 2NRTA 3OYKA 4CF9A 3OA9A 1UAXA 3RMAA 1TYQA 4A2AA 3DLKA 4H5RA 2HNYA 5AR0A 4JI5K 2OYQA 3H1QA 3CFPA 2QWMA 4W5TA 4CGHA 1XNRK 4WF9L 2A1RA 2FSNA 4IG3A 1K73O 3AO5A 2KW4A 2AP1A 3MEEA 2R7YA 3LDQA 3V1RA 1NKBA 4AHSA 4BGAA 4Z0UA 3CERA 1W2BM 1VQNN 1O1WA 1V4SA 4YDUC 1KAXA 4JAXA 2P9UA 3OYDA 2O8FB 1BQMA 3E9OA 4KHNA 1LW2A 4IOAL 3VEYA 3SV3A 1FK9A 2QTDA 2P1JA 1ZYQA 3JS6A 4DR1K 3KLHA 2IIRA 5E41A 3C6AA 5FRNA 5M1PA 3NF6A 3NGYA 1U47A 1TV6A 4DLGA 4IDHA 4H03B 1SKSA 4WQ4C 4Z4CA 3M1FA 4BDPA 4DSIA 1OVYA 3LPUA 3TANA 1N34K 2J4RA 1SL0A 3ENOA 5EX5A 5GINA 3UKUA 4DTMA 1NK8A 3CJ9A 3LZJA 1YHQN 3AVGA 1LAVA 4AM7A 4CFCA 3O9UA 5C42A 4GNIA 3NGIA 4LFBK 3CCQN 2HBKA 4NXMK 1G99A 4DV3K 1X9MA 3VGKA 3F2KA 3WXJA 4DS4A 3WXIA 3DLRA 1GOCA 1YF5L 3WNHA 1IBMK 3LP3A 1HQEA 3R3LA 4BGBA 4FWKA 3AVAA 3T69A 4K8ZA 1N8RO 4Z4HA 3SBGA 5FPMA 1TKDA 4IFVA 3CCVN 1FKPA 3AVKA 4LY7A 4LF7K 4N5SA 3M8QA 3ITHA 4GVEA 4XIUA 1W0HA 1UWBA 4BRFA 4BC3A 3THWA 3VESA 3KWGA 3H1VX 3HTVA 3J7AP 2YCHA 2P9IA 1NK6A 5F0XA 1QZ5A 4F2RA 4GMJB 3EL2A 2RHKA 4GV3A 3RTVA 4CHYA 2KZMA 4DR4K 4KH4A 3ALYA 3I56N 1C1AA 1QSLA 3CM5A 1X9WA 1EO1A 3BF3A 3AVFA 5AZJA 3EKSA 3LP2A 4M3RA 5JLHA 3FE1A 3B6OA 3VTHA 4N47A 1HNZK 3PIOL 4M63C 3KK3A 1TUYA 3WT0A 4DF4A 3DLBA 3HJFA 1J54A 5JLFA 1XC9A 4H4MA 4H0TB 1SQKA 2YV0X 1WUAA 4EP4A 5M1QA 2NZTA 2UU9K 1J5EK 4G9ZA 1KLNA 2P9KA 1XWLA 1WN7A 2AJQA 4GV9A 3TAGA 3TWHA 4E0DA 1HKCA 4JD2A 2BTFA 3I55N 3KZBA 1BCOA 3H3OB 3J80O 4WFBL 3A5NC 2BH1A 3WQTA 4DTUA 3VQ6A 1JCGA 3KLEA 3LDNA 4YOUA 1I39A 2YHYA 3HYFA 3WXMB 4FK0A 3C6HA 1QZ6A 1DKGD 3TABA 3VQ9A 3IG1A 5JMVA 4CCHA 3AV9A 4DTNA 1FXXA 2QA4N 4OLBA 5AQMA 2F7TA 4I2PA 4CZKA 2VGMA 4OKJA 3K5MA 2Z1JA 1DT9A 1VQ4N 2VWKA 5EU7A 3RSEB 2NRRA 1EETA 3B8AX 3MWPA 1N6QA 5F1XA 1WSJA 2JGUA 3ISNC 2FF3B 4CEFA 3NHGA 4B08A 4FJLA 4H0OA 2QWLA 1NLVA 1VQ6N 1J9AA 1RILA 1D5AA 4JK7A 3VQEA 4DUYK 3V9XA 3T1HK 3MXIA 1HLUA 1ITGA 1R59O 1YTUA 1NGIA 2D1KA 3OHRA 3VQCA 4DQ8A 3M8SA 3MX2A 4EFHA 3CCSN 1TK5A 4C8KA 4FWPA 1GLDG 5D3GA 4JKFA 4AHVA 4JK8A 3AVHA 3IKMA 4I2QA 4PL7A 1RDWX 4JI3K 4GKJK 5B8HA 3DYAA 3O3GA 4ZHRA 2O8EA 3OJUA 1HNXK 1RFQA 1SL2A 1QSYA 4KTZA 3O9SA 4DCHA 2VGNA 4FL9A 4TSXA 2KKZA 4WQ5C 3H08A 4NCBA 1MA9B 4FK2A 2E88A 3D2EA 4I6MA 2ZGYA 3AVCA 4DSKA 4MO4A 4FM0A 2WONA 4B8AB 4FOIA 4KHPK 3U8XA 1NWKA 4JKEA 1C1BA 1TAUA 4YFUA 3UKRB 1QQMA 3CETA 2D5RA 4CJWA 4RTFD 4ELUA 3ZCMA 1VSEA 3D0PA 3E1YA 1IBKK 3S3OA 4DV6K 2BGGA 3ZSRA 4BRGA 2HNZA 3O6WA 3FLCO 3KIOA 2ZJPL 3CHWA 4O8KA 4BG9A 4YOYA 2OPRA 3G71N 1W9HA 5A2QO 4BRKA 2JWLA 4C8LA 2BUPA 3MXJA 3L2UA 4A59A 5HP1A 2NLXA 4YNQA 3M8RA 3VPZA 4BRPA 4XH1A 1C0MA 1GLBG 1RNHA 5F2RA 2CGKA 3HVRA 5K14A 4JKGA 3ZT3A 1QE1A 2V51B 1EKEA 3VOVA 5HROA 3CJ7A 4DV0K 1N5YA 4M3YA 2CH5A 3VN5A 3HOTA 3CPWM 4KHWA 5AJ3K 1WOQA 3A5MC 3WNGA 4DTJA 1GLAG 3ZLJA 4I9LA 2P9SA 4UY8O 4G1QA 5AZIA 4LF4K 3MMVA 2HHTA 4DTXA 1S5JA 3CC4N 3TSUA 3LM9A 3LPTA 4KH5A 5C0YA 1Z26A 5AQKA 4YOVA 3N4PA 1NKEA 5M1KA 1NNEA 4LSNA 1ASWA 1S6PA 3OYBA 5C10A 2E5LK 2G8UA 3R8EA 5KPTA 3QEPA 4CF8A 3AVNA 3PX6A 4WE1A 3ZSYA 1EQYA 1JXBA 5HRNA 2QKBA 4FVUA 2D0BA 1JLFA 2QI2A 4BY9C 2KZZA 2IOCA 4NB4A 1ZBLA 1Q8IA 1WLJA 4JRQA 2HOEA 2V7YA 4AH9A 4CD3A 3CCMN 3RVCA 4DB3A 3K2PA 1RDBA 2P5GA 1D8YA 3JSMA 3M8PA 3L6QA 1BL3A 4CJKA 1NJIO 2ETJA 3LDOA 4FPBA 3PO4A 5BRHA 1RDDA 3ZT1A 4CESA 4QS9A 3LDPA 3NVKA 3SQ2A 4BR5A 3PX4A 1T8EA 2QWPA 4DFMA 1VQ5N 2P9UB 4B9MA 2GELA 3C0BA 3PX0A 4CK3A 1IKWA 3MCAB 3TR8A 4ID5A 3KKRA 3OBWA 3ZX0A 4CK2A 2GX9A 3C94A 4IBNA 4NYNA 4JI6K 3EZWA 5CE3A 1IG9A 2YHBA 2O8BB 1GOAA 4KI6A 2Q36A 4FO0A 1NKCA 2E2QA 3KWIA 4CJVA 1UA0A 4A5AA 4FJGA 4ILHA 3HXMA 4NLCA 5AQWA 3THVA 3RWUA 3FZLA 3ZETB 1QVFM 2Q3SA 4BC5A 1E4FT 4KO0A 2X6NA 3VQ4A 1A5VA 4CJTA 3SCXA 1Q7YO 2IC3A 3VEOA 1TGOA 4BRAA 1T44A 3THXB 2NNWA 3SJJA 4OPAA 4PY5A 4DV7K 3HRGA 4JHDA 5KGXA 3AVMA 3O3FA 1RT5A 3A8YA 5C2FA 5AQJA 1M90O 5E26A 4CBXA 2FBTA 1BOTO 4DTSA 3KVGA 4CERA 3QO9A 3H6EA 1IJJA 5TKWA 2YI1A 3THWB 1WSGA 4CZMA 1Q81O 2P9IB 2PZSA 4EP5A 3RMDA 3HBTA 1QQOA 1NM1A 4JKAA 3HOSA 2P9NB 1OKJA 3SV4A 3SPZA 2UYTA 1HPZA 4CEZA 1JXEA 3G10A 3VQAA 4DR2K 5ADXH 3RRGA 3VGMA 2PAVA 2ITMA 5AZJB 4BR7A 4IOXA 4H5WA 4BRNA 4YOTA 4E1JA 4CJRA 4CJ5A 3CJAA 2RF2A 3HVTA 4YY3K 1LWCA 1U45A 1NK7A 4C8OA 1RDAA 2I7NA 4FWMA 2FBVA 3OYEA 3U6FA 1VQLN 1CXUA 3IDHA 3O9RA 2P9KB 4DQPA 3SQ0A 4J2EA 1MWMA 3AO1A 2YKNA 3OYMA 4O8UA 3LWMA 1RTJA 1VSKA 3C7NB 3QFPA 4DLEA 4HWIA 3KJVA 2QWQA 4NYFA 4UQGA 4MQ3A 3DOKA 5AQFA 1QQNA 3WNEA 1H1VA 1HJRA 1TKZA 1XUPO 1QVGM 1RT1A 4B3RK 1NBWA 4CJFA 3MN5A 3ZSZA 3SMSA 4FZXC 3RRHA 3MWTA 3RR8A 3WXKA 1DGKN 1SV5A 3G0ZA 4O0IA 3DLLL 1SAZA 1X1PA 2NRVA 3H46O 3DLHA 3H45C 5GAEP 4JKHA 3NBPA 4DQSA 1T03A 4XH5A 3I33A 1WSEA 3K58A 1HYSA 4KHSA 2E20A 2B6AA 1S6QA 2KLAA 4E89A 4B9LA 4PKHA 3GL1A 1BIZA 1K8AO 4F8RA 4K8XA 1BI4A 1TL1A 4KPYA 3CMAN 4FJ5A 1JCEA 1Q18A 3O08A 4YOXA 4FLUA 1RT3A 3CIPA 4NLBA 2YJEA 4F2SA 2HBLA 4BR0A 1YTAA 4CFAA 3LP1A 1RTHA 5JS2A 5AQRA 4MLHA 3OS0A 4RW8A 3SUOA 4FLXA 4E7LA 1RBUA 2XY6A 3JXUA 3D2FB 4O4GA 1TL3A 1MWKA 2Q97A 3W0LA 3CCUN 3PLAA 3F9MA 3QERA 4DF8A 4KHQA 4B1ZA 2RN2A 1LOTB 4OJRA 2IDOA 3VERA 4JS4A 3C65A 4JEPA 1YITN 1NJWA 2G8WA 4JKBA 2E4LA 4FJ8A 3ATUA 4WFNL 3CCJN 5BPLA 3FZHA 1C0TA 3THYA 5C25A 3DAWA 4H5TA 3EKUA 3GDQA 3T1YK 3VQBA 3ULDA 4BRHA 1IV0A 3K59A 2EHGA 3P38A 4H0XB 3TI0A 1XMOK 1NK4A 3DLGA 2HHSA 5GADP 4J2BA 4KHYA 3K0SA 1EX4A 1RTIA 4W5QA 2D4WA 3C6UA 2HHUA 4CBUA 3QETA 1UA1A 3AA2A 3PY8A 1NGGA 2VCPA 2V7ZA 3R1XA 4WYBA 1HMVA 1KFSA 2EX3A 3V81A 4PKIA 3SQ1A 4BRMA 1NGAA 3G4SN 2E1YA 3VQQA 2OZMA 1KVBA 5AFUH 4O0JA 4BREA 1TK8A 1JL2A 1XHXA 3M6GA 4BVOA 1HPMA 4YOWA 4FXDA 2WOMA 3LP0A 1R0AA 2ASOA 2P9SB 4IFYA 1M1KO 1Z25A 4A61A 5H1SQ 3ZSOA 3QIOA 3HPGA 1IKYA 5BPMA 1E3MA 2Y1IA 4DFPA 4M41A 4HUEA 4BE1A 4FWSA 4W5OA 4DSLA 4RW6A 5GIPA 3ZSXA 4E7JA 3QEVA 1ATRA 4JNEA 1Q9XA 1NGHA 2QKKA 4XEIA 4FJJA 2O8DA 4N76A 2OANA 1S1UA 4MO5A 2CH6A 1K8KA 4CHNA 1IO2A 2XO7A 4DR6K 5AQIA 3MXMA 3AA4A 4KB0A 3ZEUB 4DQQA 3OS2A 3DXKA 1Z05A 5LMNK 5CYQA 3NH0A 3AVBA 3AA3A 4C8NA 4RCHA 5AQHA 3M5RA 1SL1A 5HRPA 2FBYA 1GLJO 1S3XA 3IUCA 4FJ7A 2HSTA 4CZJA 1B9DA 5KGWA 4EHTA 2B4JA 3E66A 5CY4A 4DQIA 3K9JA 1NGFA 4CW7B 4FJNA 1WAJA 2G8VA 4LF8K 5ELZA 1XQSC 3O8MA 4H5VA 5AQOA 2F9WA 3AVIA 4B9UA 5DMRA 5LJVA 4OLAA 4KREA 2BDPA 3K57A 4DV5K 4DU4A 3VEZA 4OPHA 3A5LC 3OYHA 1IBLK 2KFNA 1ZXOA 4CK1A 1U2VB 4FLVA 3OYFA 2FC0A 2DTUA 4B8CA 2PYLA 4C8MA 4K25A 4BDZA 1C1CA 1RT4A 2GTDA 1HQUA 4FM1A 1CZ9A 1J6ZA 2A6AA 3SMPA 3SAGA 4Q0BA 2GV9A 4BRCA 5HLFA 2KQ2A 1BU6O 3IRXA 4CGGA 1TKXA 1WAFA 1C0FA 2DFFA 4FCYA 4K43A 4YORA 3TAMA 4CI6A 4M3WA 5CYMA 2ASPA 4ELVA 1BQNA 5J2MA 2E8AA 5AQNA 1FW6A 3CJCA 2HHQA 3EYZA 3KK2A 4FJ9A 3CC2N 2QWNA 3J7YP 1HUXA 3VQPA 3HZ6A 3ZT0A 4KFBA 1VSFA 3D45A 1HKGA 1NJZA 1VSHA 4JHDB 3MN6A 4A5BA 2ZM6K 2UXCK 3H3NO 3T19A 4MFBA 1T7PA 4PUOA 4CZIA 4OKKA 4RW7A 2O8FA 3JAMO 2HMIA 4CD1A 1CXQA 4DTRA 2YNIA 3N4QA 2DFEA 3NGZA 3B6PA 2WTUA 3SI6A 1Z6RA 4DFJA 4NCAA 5KPZA 4JS5A 3CCLN 3VF4A 1A5WA 2X78A 4CIEA 3AO2A 1ZBIA 3BGRA 3O9QA 3MECA 4K0KK 2YHWA 3DRSA 1OH8A 1ASVA 1RGIA 2YX6A 1LV5A 4QS8A 4IKFA 4OPKA 4U7BA 1NOZA 3WEEA 3ASMA 4MLEA 3VEVA 4MDBA 3VTIA 2O4GA 3CFOA 3M3ZA 4DR3K 5BREA 3D7EO 3CC7N 5FRMA 4CIFA 5SWMA 1ILYA 4BRDA 4CHQA 3LAMA 4GVMA 1C0UA 1OH5A 3VEXA 1QHAA 1G15A 3KHYA 1VSLA 2A40A 1BWFO 2VWBA 1RT7A 4FWRA 2A3ZA 1RBTA 4B1UB 3BY5A 4FW1A 3O4NA 4DMNA 4ISGA 5HRRA 3NMUA 2UUCK 3KTQA 2BANA 4C1NK 2W40A 4CJUA 1KXPA 3VQDA 3KD1E 4A57A 4LD0A 2HVHA 5IWAK 5FDLA 4BE0A 3LAKA 2QWRA 1VQMN 3QBWA 1IKXA 3E01A 3V9SA 2HB5A 5CHIA 3L0QA 1I3AA 2EWSA 4FM2A 1DTQA 3DMJA 3Q7CA 2WUSA 4AHTA 4YHHK 4DSFA 1L3VA 5FPEA 5GIOA 5C12A 4B1YB 4LH4A 3HP9A 3AAQA 5IT9O 3MEDA 4GV6A 1TUUA 3GBTA 3ZT2A 2QK9A 1GLFO 2W6KA 1TYQB 4KH6A 1ZC6A 2IVNA 2X74A 4IXCA 5TKYA 4B9SA 4I9QA 1TAQA 2OCEA 2VYPA 2ZWHA 4RW4A 2LSNA 2IGIA 4IJAA 3O4WA 3O1BA 4Y1CA 4FLWA 3MK6A 4JYAK 3AA5X 1VQ9N 1T6CA 5FROA 4FSVA 3HPHA 4BWJA 4CIGA 5EY4A 2HBMA 1NG9A 1ATNA 3CD6N 1X9SA 1OH6A 5GAHP 3CYMA 3QFUA 4IO8A 4J8FA 1JCFA 3MN7A 4CHPA 4M3TA 4ISFA 1E4GT 2VG5A 1ZBSA 3V4IA 3TAEA 3ENBA 4B3TK 3V6DA 1Q86O 3CPEA 1WSIA 3ZSVA 1SKWA 2ZQBA 4FZZA 4WCEL 2Z1HA 4K42A 4RW9A 4NXNK 2PBDA 4DWIA 1K9MO 1HNWK 3UKUB 5DM6L 3KLIA 1GOBA 3ID8A 4FK4A 3ZSQA 2GBZA 1VQKN 1VK0A 2HF4A 2UXBK 3VA3A 3OVNA 2VG7A 3NFAA 4Z94A 3OYLA 3P5JA 3CG7A 4H8KA 3ZT4A 2D0PA 4JV5K 2F9TA 2QXLA 1Y97A 3DRPA 2D0OA 1NGDA 2P9PA 5M1OA 3ID6A 4DV1K 2F96A 4EHUA 3NCIA 3C95A 3CCEN 1RTDA 4CF0A 1UOCA 2NRXA 2FBXA 4CJLA 3EEQA 4BQZA 4BACA 4M7YA 1NJXA 4HVJA 3E9LA 4FOEA 5AQTA 1Q82O 1VQ8N 5KI6A 5LJWA 2G8HA 3P83D 4I7FA 4DG1A 1C0GA 1T6DA 1BHLA 4CBWA 4KTQA 4DSEA 1J5OA 2XHBA 3A0IX 4CGIA 3QICA 4HCBA 2Z1GA 4CEEA 5AQQA 3WUHA 4QOZB 4QAGA 3DJCA 4B3MK 1YVUA 3CXCM 3K5LA 3QBXA 3RR7A 3ZX3A 4H5NA 1REVA 1S1WA 3UE5A 3UKRA 1S22A 1VQPN 3VA0A 4BDYA 4FWLA 1I94K 2QEXN 1YUWA 4Y1DA 2QXFA 4BE2A 2HVIA 1NK0A 4CFDA 3Q7BA 4K41A 1HJOA 3OW2M 4A62A 3EE8A 1HR0K 4AQYK 3S3NA 2G8KA 2XY8A 2OTJN 4M3XA 4CHZA 4PA1A 2WC9A 3R9PA 5J1EA 3MAQA 1NGBA 3F9KA 3DLEA 1O13A 4CGJA 4IEEA 3DOLA 2B5JA 1S1VA 4JD2B 3DI6A 2E1ZA 5SZTA 4EZ9A 5J2NA 3OS1A 3FGUA 1HNIA 4B9QA 2F8SA 5T7BA 1JLBA 1LWFA 3VGLA 4CEDA 3FR0A 4FYDA 5AQLA 4CZFA 2IS3A 3BF1A 3EZ5A 3LDSA 5E84A 2AA4A 1HKBA 3ZSWA 3OYNA 2XY7A 3I8DA 3ULEA 2E6MA 3PIPL 4E1MA 2HHHK 4OO1J 1VSJA 2W6LA 1EWQA 4DQRA 1QSSA 3A2FA 2Y1JA 4Q5VA 1KLMA 3SNNA 4B9TA 1VQ7N 4NCGA 1U4BA 5EVZA 1X3MA 2V52B 3IMXA 3FFIA 2A1SA 3MDQA 1S9EA 1JLGA 3SAFA 5JICA 4LF6K 3AAPA 3C6TA 1SKRA 4DR5K 4FVMA 4O5BA 1KSPA 4FJIA 1SS6A 5AQYA 2QM1A 5AQZA 1YT3A 3JYTA 1N36K 2OA8A 2E6LA 3AY9A 2XY5A 1N33K 4CECA 4CFBA 4FJHA 4FWNA 1BUPA 2P9LA 3VMFB 1YI2N 3AO4A 4IZ9A 3U3YA 2O8EB 2Q0UA 3DXMA 4FJKA 3TAFA 4FJMA 3IAYA 4E7HA 4ELTA 2ZD1A 3LANA 3D2EB 4I6MB 1FKOA 4JI0K 3U9ZA 4B1XB 2GEMA 3F5TA 4JI8K 1GLLO 3SJHA 3BZKA 3BUZB 3OYIA 2O8CA 3QIPA 4AHUA 4RWTA 2RKIA 3HSCA 3AVLA 5BR9A 3AGKA 5BPNA 1KQSM 4JRPA 2H3GX 3KK7A 3L8BA 4OPJA 4XH4A 2HBJA 2NRZA 5AQSA 3O3HA 1LW0A 4LSLA 1EWRA 3PSIA 3VQ8A 3PV8A 2O8BA 1IKVA 4CZEA 3RMCA 4FWOA 3HL8A 3MCPA 4QCLA 3SBTA 3WEEB 4DKWA 3T3FA 1OH7A 3G6EN 1XHZA 5CZ2A 4CJ7A 4IJNA 3FZMA 1YJNN 1D9DA 3ZETA 3PSFA 3S41A 3SLCA 4OVLA 4JKGB 1N32K 5FPDA 1VQON 2IAJA 1TKTA 4O5FA 1JLCA 4EZ6A 4CEQA 3DRRA 3CQYA 3V1QA 5GAGP 3HT3A 1RDUA 4ZTFA 1RT6A 1BCMA 3THXA 3SUNA 2VG6A 3UB5A 2A42A 4F4KA 2NRWA 2OTLN 5BRFA 3QNNA 1W7AA 2ZJQL 5FPNA 4GW6A 3ZYYX 5AZIB 2QW9A 2WBNA 4DTOA 4HCCA 1QS4A 4IDKA 3TARA 3VQ7A 3SAHA 3CM6A 1XI1A 2VWJA 1ASUA 3I0RA 3NF9A 4HUFA 1ATSA 1NGJA 1U04A 2GUPA 4Z4GA 4B3SK 5HL7L 2Q0RA 1WNSA 4B9NA 2ZJRL 2OPQA 3V9ZA 3QEWA 4DR7K 3PUFA 2P9NA 5HOOA 5I42A 4CZHA 2HMPA 1BO5O 2W42A 3UIQA 1KVAA 2RE2A 1YVNA 3WNFA 4HHTA 4BQLA 1RT2A 4LH5A 3SK3A 4N41A 4LFAK 1VSDA 3AVJA 4KI4A 3LL3A 2GWKA 5AQUA 2XRIA 4CJ3A 2YHXA 3FFKB 4DTPA 1L5UA 3O1WA 3KLGA 4J2AA 3TSQA 3TSPA 1KCFA 3HM8A 2YKMA 3OYAA 2OPSA 4C23A 4CEOA 3P39A 4ILGB 5LL6Z 5HRSA 3HP6A 1VRUA 3GOIA 5JVHL 4ICLA 4IO9L 3EY1A 3C7NA 3MEGA 3VENA 4CGFA 1L3SA 3BP8A 3T1AA 3KK1A 2BE2A 3MN9A 3CI5A 3LZIA 4H4OA 3KKSA 1BA1A 4BROA 1ESVA 2CGLA 4LF5K 3FZKA 1B9FA 2YNGA 4JI4K 4CJQA 2UUBK 1OVQA 4DV4K 3QNOA 1YJ9N 4AM6A 3L2WA 1S1TA 4M45A 2YNHA 3OYGA 3V1OA 1YJWN 1LAWA 4Z4IA 3WQUA 5C24A 3KLFA 4X65K 1NGEA 3TPQA 2FSKA 3QMLA 3V9UA 2NRHA 3NF7A 3L4QA 4DS5A 3LDLA 1NMDA 1QHTA 4JKCA 3QLHA 1NJYA 4X62K 1EXQA 4LC9B 2A41A 2D0CA 2P9PB 3CQXA 3L4IA 1YXQA 3LWLA 4DSJA 3L2RA 5EXWA 1IG8A 4JI7K 1Q9YA 1XC3A 5JS1A 2GWJA 1IH7A 4BRLA 1RCHA 4DU3A 3RMBA 1CLQA 3A5OC 4JLHA 4E7IA 4B3OA 4EIAA 3EN9A 3D2FA 5C15A 4M3UA 1VAZA 4O44A 1VSMA 5LY3A 4DUZK 3TTDA 2GUIA 1LCUA 1WSHA 3TAPA 4IOCL 3G25A 4C1NI 4H0PA 2A5XA 2KHOA 1L3UA 5EOYA 3P1GA 2CGJA 4Y0WA 3L3VA 3J81O 5CR4A 4CGDA 1NMNA 3ATVA 3GG4A 3AGRA 1WB9A 3S9HA 2ZF5O 3BEXA 4N56A 3NH1A 2JWKA 5KRTA 4KAZA 1QTMA 3J7ZO 2I5JA 3O80A 3K5NA 4CVNE 5M1FA 4AHCA 4PKGA 1HX1A 5BN9A 2VQFK 2ZE2A 4E1NA 4FLYA 4R79A 4BR4A 4BRIA 4CF2A 2Q31A 3D6RA 2G8FA 4YDUA 4FLTA 1C6VA 3OBYA 4OGCA 1A5XA 3L2VA 3E9PA 4IWVA 2DY4A 4J2DA 4PHTX 3QEIA 1T05A 3HO1A 1CZAN 1KC8O 3T7ZA 4BR2A 1BG3A 3AARA 4Z4EA 1MDUB 4B1WB 4CJ4A 4L8RB 1KAYA 5DK5A 4AHRA 4FW2A 4MDAA 3VETA 4WQ4A 5C2DA 3SUQA 1T3VA 2JLEA 3HI0A 4ISEA 3NDKA 4Z4FA 1F21A 3QDKA 4ILJA 4F3OA 4LFCK 1ZBUA 1L3TA 4L3QA 3CF5L 2HW3A 3WXLA 4PL8A 3OYCA 4IEIA 2YHAA 2I7PA 3ULEB 1HYZA 2UUAK 2PY5A 1RBVA 2IVOA 2OPPA 5CZ1A 2HHWA 2Q2RA 3VF2A 1D4XA 4PQUA 1FJGK 3R6MA 5I9EB 4CEAA 2RPIA 4FLZA 4BRQA 2FXUA 1JLEA 2DPNA 4W5RA 3VEWA 4GKKK 3HSTB 1W97L 3P31A 5ADXA 2HNDA 3U3GA 1BISA 2F8TA 4B9VA 3ZEUA 1BI4B 3OJSA 1KRPA 4KHUA 3QINA 3IS9A 1GLCG 1TVRA 3EE9A 3QEXA 5I3UA 4W5NA 3S3MA 2KFZA 5AQPA 2ASMA 5FLXO 4E19A 4AF1A 1WSFA 4FZYA 1Y64A 4KTWA 3TTCA 5KRSA 1RBRA 4H0VB 5AQGA 1S9GA 4KV8A 2YNFA 1TK0A 1JKHA 3CJ1A 3I8BA 2P9LB 3LM2A 3DWLA 3O4QA 4X66K 4ZTJA 3DXMB 1WBDA 3ENHA 4OX9K 1JLAA 5AQVA 3CCRN 3V9WA 1ZBHA 2W41A 4CE9A 3BDPA 3TAQA 1P8ZA 5HBMA 4JKDA 5BRDA 1DLOA 2FSJA 1XMQK 5KQDA 4RG8A 2E2NA 1U2VA 4DV2K 3L3UA 4LF9K 3QESA 4HUGA 2FF6A 1GLEG 3PO5A 2O8CB 3THYB 2HF3A 1YIJN 4BC2A 4CJEA 4KB1A 3KD5E 4CJPA 3QB0A 4DFKA 3RSEA 2IVPA 1KVCA 3NH2A 3NE6A 2X6SA 1K6YA 4IFEA 3CJBA 1MU2A 4M7XA 3O9TA 1S72N 4IG0A 5J2PA 1HNVA 3OYJA 3SYZA 4CJSA 2O4IA 5DM7L 4JK9A 1VSIA 3MX5A 3L2QA 4F3TA 2DFHA 3OY9A 1BA0A 3U9DA 4CZLA 4CHOA 4E3SA 1ZBFA 4CZGA 5J2QA 4KBOA 4FWQA 3GE1A 2P5OA 1HYVA 1RDCA 1EP4A
chains in the Genus database with same CATH topology
2PFUA 3AY9A 2V51B 3VOVA 3W3DA 4FWNA 5ELZA 3CJ7A 1BUPA 1XQSC 2P9LA 1U6ZA 3O8MA 4H5VA 5AQOA 3VMFB 1YI2N 2F9WA 4FPAA 2CH5A 4IZ9A 2QWOA 2Q0UA 3DXMA 5LJVA 2E2PA 3HOTA 3CPWM 1SZ2A 1WOQA 3A5MC 1GLAG 3K9KA 3VEZA 4OPHA 2P9SA 4UY8O 3A5LC 4BG8A 5AZIA 4BR9A 3MMVA 3D2EB 4I6MB 1ZXOA 3U9ZA 4B1XB 1U2VB 2GEMA 3F5TA 3TSUA 4B1VA 3CC4N 3LM9A 2YJFA 1GLLO 3SJHA 4K25A 3BUZB 4KH5A 5C0YA 4U67L 4EAHD 2WFBA 2GTDA 4F9OA 4RWTA 5AQKA 1JJ2M 4YOVA 3HSCA 3N4PA 4BC4A 5M1KA 5BR9A 3CMEN 1J6ZA 2A6AA 3AGKA 3FZFA 3SMPA 5BPNA 1KQSM 3SAGA 4BRCA 2H3GX 3KK7A 4XH4A 1K8KB 1BU6O 2HBJA 2NRZA 5AQSA 5C10A 5MLCQ 3TTFA 1C0FA 3R8EA 2ZGZA 5KPTA 4NO7A 4K43A 4YORA 3VF6A 4CZEA 1NGCA 4CI6A 4FWOA 3MCPA 3DXKB 1P90A 2Q1NA 3SBTA 4GY2B 2ASPA 4DHYA 3WEEB 3TU5A 4DKWA 1EQYA 3G6EN 4FVUA 4A2BA 2E8AA 2QI2A 5AQNA 4BY9C 4CJ7A 4NB4A 4IJNA 3FZMA 4WFAL 1YJNN 3CJCA 3ZETA 3P4IA 3S41A 3U4LA 1KD1O 3SLCA 3CC2N 3J8AA 2QWNA 2HOEA 2V7YA 4CD3A 3CCMN 3RVCA 4DB3A 1HUXA 4JKGB 1X9JA 5FPDA 4WQ5A 3HZ6A 1VQON 4O5FA 1HKGA 3CQYA 3L6QA 4BVPA 5GAGP 1DEJA 1RDUA 5M1NA 3O5BA 3UB5A 2A42A 2NRWA 4JHDB 1NJIO 3LDOA 3MN6A 4FPBA 4HTLA 2OTLN 5BRFA 5JVGL 2ZJQL 4A5BA 5FPNA 1M1KO 3ZX2A 5BRHA 3ZYYX 5AZIB 3H3NO 3IFRA 3LDPA 4QS9A 4JN4A 3NVKA 4BR5A 4CZIA 2QW9A 2QWPA 2WBNA 1VQ5N 2P9UB 1X3NA 1BDGA 4CD1A 3SAHA 5AFUA 2GELA 3N4QA 3C0BA 4QS7A 3MCAB 1Z6RA 3OBWA 1ATSA 1NGJA 3ZX0A 2GUPA 5KPZA 3CCLN 2GX9A 3VF4A 1V4TA 3O9QA 4H0YB 5HL7L 2Q0RA 1KAZA 2ZJRL 3NVMA 3EZWA 5CE3A 2YHWA 5KQ8A 2P9NA 5HOOA 4CZHA 2HMPA 1RGIA 1BO5O 1YAGA 2Q36A 4FO0A 2E2OA 2YX6A 5KPRA 4QS8A 2RE2A 1YVNA 2FLOA 2E2QA 3KWIA 4DCHA 4U7BA 3WEEA 4MLEA 3VEVA 4BQLA 4MDBA 3VTIA 4A5AA 3EO3A 4ILHA 3SK3A 3M3ZA 4NLCA 5AQWA 5BN8A 5AQXA 3D7EO 2NRTA 3LL3A 5BREA 3CC7N 3FZLA 2GWKA 3ZETB 4BRDA 1ILYA 3OA9A 1QVFM 5AQUA 4BC5A 1E4FT 1TYQA 4A2AA 4H5RA 5AR0A 3VEXA 2YHXA 3FFKB 1QHAA 3H1QA 3KHYA 3O1WA 2QWMA 2A40A 1Q7YO 1BWFO 3TSQA 3VEOA 2VWBA 4BRAA 4WF9L 3TSPA 1T44A 2FSNA 2NNWA 4FWRA 3HM8A 4OPAA 2A3ZA 4C23A 1K73O 3HRGA 4JHDA 4B1UB 2AP1A 3LDQA 3A8YA 3P39A 4ISGA 5C2FA 4ILGB 5AQJA 3NMUA 4BGAA 4C1NK 2W40A 1M90O 5E26A 4CBXA 3CERA 1W2BM 1VQNN 1BOTO 3GOIA 5JVHL 1KXPA 3KVGA 4IO9L 1V4SA 4YDUC 1KAXA 3C7NA 3H6EA 4A57A 4JAXA 2P9UA 3VENA 3BP8A 3E9OA 1IJJA 3MN9A 4IOAL 3VEYA 3CI5A 2QWRA 1VQMN 5TKWA 1BA1A 4BROA 1ESVA 2YI1A 3QBWA 2CGLA 3FZKA 4CZMA 2QTDA 3JS6A 1Q81O 2P9IB 2IIRA 3HBTA 3C6AA 5CHIA 3L0QA 5M1PA 1YJ9N 2EWSA 4AM6A 1QQOA 1NM1A 4IDHA 3Q7CA 4H03B 4JKAA 3HOSA 4WQ4C 2P9NB 1OKJA 2WUSA 1YJWN 3M1FA 1OVYA 2UYTA 3WQUA 2J4RA 5ADXH 3ENOA 5EX5A 5GINA 3UKUA 3VGMA 1NGEA 5FPEA 2PAVA 2ITMA 3TPQA 4B1YB 5C12A 5AZJB 5GIOA 3CJ9A 2FSKA 3QMLA 1YHQN 2NRHA 4BR7A 4IOXA 4AM7A 3AAQA 3O9UA 4GNIA 4H5WA 1TUUA 4BRNA 4GV6A 3GBTA 1GLFO 3L4QA 4YOTA 4E1JA 3CCQN 2HBKA 3LDLA 3CJAA 1G99A 1TYQB 1NMDA 3VGKA 3F2KA 4KH6A 1ZC6A 2IVNA 3WXJA 4JKCA 4IXCA 5TKYA 3WXIA 2VYPA 2ZWHA 1YF5L 4LC9B 2I7NA 4IJAA 4FWMA 2A41A 3O4WA 3R3LA 3O1BA 2P9PB 3CQXA 4BGBA 4FWKA 3L4IA 1YXQA 3T69A 3MK6A 1VQLN 5EXWA 1N8RO 1VQ9N 1IG8A 3IDHA 1T6CA 3O9RA 3SBGA 2P9KB 4FSVA 1XC3A 5FPMA 1MWMA 2GWJA 5EY4A 2HBMA 4BRLA 3CCVN 4O8UA 1ATNA 3C7NB 3CD6N 3QFPA 3A5OC 4HWIA 4GVEA 5GAHP 4EIAA 3QFUA 3EN9A 3D2FA 4IO8A 4J8FA 1JCFA 2QWQA 3MN7A 4BRFA 1VAZA 5C15A 4ISFA 1E4GT 4BC3A 3TTDA 1ZBSA 5AQFA 5LY3A 3ENBA 3VESA 1LCUA 1QQNA 3KWGA 3K9JA 3H1VX 1H1VA 1XUPO 3HTVA 4IOCL 3G25A 4C1NI 4H0PA 1QVGM 1Q86O 2A5XA 2KHOA 2YCHA 3CPEA 2P9IA 1NBWA 5EOYA 3MN5A 5F0XA 2CGJA 3SMSA 1QZ5A 3EL2A 2RHKA 4Y0WA 3MWTA 4WCEL 4GV3A 3WXKA 5CR4A 1DGKN 3DLLL 4KH4A 4K42A 3I56N 1SAZA 2NRVA 2PBDA 3H46O 3H45C 3ATVA 3GG4A 1K9MO 1EO1A 3AGRA 3UKUB 3BF3A 4JKHA 5GAEP 5DM6L 5AZJA 2ZF5O 3BEXA 3ID8A 2JWKA 3EKSA 3I33A 4XH5A 1VQKN 5JLHA 3J7ZO 3FE1A 3O80A 2HF4A 3VTHA 5M1FA 2E20A 4PKGA 1HX1A 5BN9A 4Z94A 3PIOL 2KLAA 4M63C 1TUYA 4R79A 3WT0A 4PKHA 3GL1A 2D0PA 4BR4A 4BRIA 1K8AO 2F9TA 5JLFA 2Q31A 2QXLA 4H0TB 1SQKA 3D6RA 4YDUA 3CMAN 3OBYA 2D0OA 1WUAA 1NGDA 2P9PA 1JCEA 5M1OA 5M1QA 1Q18A 2NZTA 3ID6A 3E9PA 4IWVA 4EHUA 4PHTX 4G9ZA 2P9KA 3O08A 4YOXA 1CZAN 3CIPA 4NLBA 2YJEA 1KC8O 3CCEN 3T7ZA 4BR2A 4GV9A 2HBLA 4BR0A 1BG3A 1HKCA 2NRXA 3AARA 4JD2A 2BTFA 1MDUB 4MLHA 5AQRA 3KZBA 4B1WB 3I55N 4BQZA 3H3OB 1KAYA 4M7YA 4MDAA 4WFBL 3A5NC 3VETA 3E9LA 3JXUA 4FOEA 4WQ4A 3D2FB 5AQTA 5C2DA 1Q82O 5LJWA 2BH1A 3WQTA 1T3VA 1VQ8N 1MWKA 2Q97A 3W0LA 3CCUN 3HI0A 3PLAA 3F9MA 4ISEA 1JCGA 1C0GA 1T6DA 4B1ZA 3LDNA 4CBWA 3QDKA 4ILJA 4YOUA 1LOTB 3A0IX 2YHYA 3QICA 4L3QA 3WXMB 3VERA 3CF5L 5AQQA 3WUHA 3DJCA 3CXCM 3C65A 4JEPA 3WXLA 4PL8A 1YITN 4IEIA 3C6HA 3QBXA 1QZ6A 3ZX3A 1DKGD 2I7PA 3ULEB 4JKBA 4H5NA 5JMVA 2IVOA 3ATUA 2QA4N 5AQMA 4WFNL 2F7TA 3CCJN 3UE5A 5BPLA 3FZHA 2Q2RA 1S22A 3UKRA 4CZKA 3VF2A 1D4XA 2VGMA 1VQPN 3R6MA 3DAWA 4FWLA 4H5TA 5I9EB 3EKUA 4BRQA 3GDQA 1DT9A 1YUWA 2FXUA 1VQ4N 2QEXN 3RSEB 2NRRA 3B8AX 4BRHA 3MWPA 3P38A 4H0XB 2DPNA 5F1XA 3VEWA 5GADP 1W97L 3P31A 3Q7BA 5ADXA 2FF3B 4K41A 1HJOA 2D4WA 3OW2M 3ZEUA 4A62A 3EE8A 4CBUA 2OTJN 4H0OA 2QWLA 1NLVA 1VQ6N 1GLCG 4JK7A 1NGGA 2VCPA 2V7ZA 3EE9A 2WC9A 3R1XA 3R9PA 1NGBA 5AQPA 1HLUA 1O13A 4WYBA 2ASMA 4IEEA 1R59O 1NGIA 4AF1A 2D1KA 3OHRA 1Y64A 4JD2B 3TTCA 4DQ8A 3MX2A 4H0VB 4EFHA 5AQGA 3CCSN 4FWPA 1GLDG 2E1ZA 4JKFA 4JK8A 4PKIA 4BRMA 3IKMA 1NGAA 4PL7A 1RDWX 3CJ1A 3I8BA 3G4SN 2P9LB 2E1YA 3LM2A 5B8HA 3FGUA 3DWLA 5AFUH 4B9QA 4BREA 3DXMB 3M6GA 3ENHA 1HPMA 4BVOA 5AQVA 4YOWA 1RFQA 3CCRN 2W41A 3VGLA 3O9SA 2ASOA 3FR0A 1P8ZA 2P9SB 2VGNA 2KKZA 4FL9A 4JKDA 4WQ5C 5AQLA 4A61A 5H1SQ 1MA9B 4CZFA 5BRDA 2E88A 3BF1A 3D2EA 2ZGYA 2FSJA 4I6MA 4MO4A 5E84A 5KQDA 2AA4A 1HKBA 2E2NA 1U2VA 5BPMA 4FOIA 3ULEA 3PIPL 4OO1J 3U8XA 1NWKA 4FWSA 2FF6A 4JKEA 1GLEG 3UKRB 1QQMA 3CETA 2HF3A 5GIPA 1YIJN 4RTFD 1ATRA 4JNEA 4BC2A 1NGHA 4XEIA 2OANA 4MO5A 1VQ7N 3E1YA 3QB0A 3RSEA 5EVZA 1X3MA 2CH6A 2IVPA 2V52B 1K8KA 4BRGA 3IMXA 3MDQA 3O6WA 4IFEA 3FLCO 3CJBA 4M7XA 5AQIA 5JICA 3SAFA 3O9TA 1S72N 2ZJPL 3CHWA 3ZEUB 4O8KA 4BG9A 4YOYA 3DXKA 1Z05A 3AAPA 3G71N 5DM7L 4JK9A 4BRKA 2JWLA 3MX5A 2BUPA 4RCHA 5AQHA 3M5RA 1BA0A 4A59A 3U9DA 4CZLA 1GLJO 1SS6A 1S3XA 2NLXA 3IUCA 5AQYA 3VPZA 4KBOA 2HSTA 2QM1A 5AQZA 4CZGA 4BRPA 4CZJA 4FWQA 4EHTA 3GE1A 4XH1A 3E66A 1GLBG 5F2RA 2CGKA 1NGFA 4JKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AY9 A;  2V51 B;  3VOV A;  3W3D A;  4FWN A;  5ELZ A;  3CJ7 A;  1BUP A;  1XQS C;  2P9L A;  1U6Z A;  3O8M A;  4H5V A;  5AQO A;  2F9W A;  4FPA A;  2CH5 A;  4IZ9 A;  2QWO A;  2Q0U A;  3DXM A;  5LJV A;  2E2P A;  1SZ2 A;  1WOQ A;  3A5M C;  1GLA G;  3VEZ A;  2P9S A;  3A5L C;  4BG8 A;  5AZI A;  4BR9 A;  3MMV A;  3D2E B;  4I6M B;  1ZXO A;  3U9Z A;  4B1X B;  1U2V B;  2GEM A;  4B1V A;  3LM9 A;  2YJF A;  1GLL O;  3SJH A;  4K25 A;  3BUZ B;  4EAH D;  2GTD A;  4F9O A;  4RWT A;  5AQK A;  3HSC A;  4BC4 A;  5BR9 A;  1J6Z A;  2A6A A;  3FZF A;  5BPN A;  3SMP A;  4BRC A;  2H3G X;  4XH4 A;  1K8K B;  1BU6 O;  5AQS A;  1C0F A;  3R8E A;  2ZGZ A;  5KPT A;  4NO7 A;  4K43 A;  3VF6 A;  4CZE A;  1NGC A;  4CI6 A;  4FWO A;  3MCP A;  3DXK B;  2Q1N A;  4DHY A;  4GY2 B;  2ASP A;  3WEE B;  3TU5 A;  1EQY A;  4A2B A;  2E8A A;  5AQN A;  4CJ7 A;  4NB4 A;  4IJN A;  3FZM A;  3CJC A;  3ZET A;  3P4I A;  3S41 A;  3U4L A;  3SLC A;  3J8A A;  2QWN A;  2HOE A;  2V7Y A;  4CD3 A;  4DB3 A;  1HUX A;  1X9J A;  5FPD A;  4WQ5 A;  3HZ6 A;  4O5F A;  1HKG A;  3CQY A;  3L6Q A;  4BVP A;  1DEJ A;  3O5B A;  3UB5 A;  2A42 A;  4JHD B;  3LDO A;  3MN6 A;  4FPB A;  4HTL A;  5BRF A;  5FPN A;  3ZX2 A;  5BRH A;  5AZI B;  3H3N O;  3IFR A;  3LDP A;  4QS9 A;  4JN4 A;  4BR5 A;  4CZI A;  2QW9 A;  2QWP A;  2P9U B;  1X3N A;  1BDG A;  4CD1 A;  5AFU A;  2GEL A;  3C0B A;  4QS7 A;  1Z6R A;  1ATS A;  1NGJ A;  3ZX0 A;  2GUP A;  5KPZ A;  3VF4 A;  1V4T A;  4H0Y B;  2Q0R A;  1KAZ A;  3EZW A;  5CE3 A;  2YHW A;  5KQ8 A;  2P9N A;  4CZH A;  2HMP A;  1RGI A;  1BO5 O;  1YAG A;  2Q36 A;  4FO0 A;  2E2O A;  5KPR A;  4QS8 A;  1YVN A;  2FLO A;  2E2Q A;  3WEE A;  4MLE A;  3VEV A;  4BQL A;  3EO3 A;  3SK3 A;  3M3Z A;  5AQW A;  5BN8 A;  5AQX A;  3D7E O;  5BRE A;  3LL3 A;  3FZL A;  2GWK A;  3ZET B;  4BRD A;  5AQU A;  4BC5 A;  1E4F T;  1TYQ A;  4A2A A;  4H5R A;  5AR0 A;  3VEX A;  2YHX A;  3FFK B;  1QHA A;  3H1Q A;  3KHY A;  3O1W A;  2QWM A;  2A40 A;  1BWF O;  3VEO A;  2VWB A;  4BRA A;  1T44 A;  2FSN A;  4FWR A;  3HM8 A;  2A3Z A;  4C23 A;  4JHD A;  4B1U B;  2AP1 A;  3LDQ A;  3A8Y A;  4ISG A;  5AQJ A;  4BGA A;  2W40 A;  5E26 A;  4CBX A;  3CER A;  1BOT O;  3GOI A;  1KXP A;  3KVG A;  1V4S A;  4YDU C;  1KAX A;  3C7N A;  3H6E A;  4JAX A;  2P9U A;  3VEN A;  3BP8 A;  1IJJ A;  3MN9 A;  3VEY A;  3CI5 A;  2QWR A;  1BA1 A;  4BRO A;  1ESV A;  2YI1 A;  3QBW A;  2CGL A;  3FZK A;  4CZM A;  3JS6 A;  2P9I B;  2IIR A;  3HBT A;  3L0Q A;  2EWS A;  4AM6 A;  1QQO A;  1NM1 A;  4H03 B;  4WQ4 C;  2P9N B;  1OKJ A;  2WUS A;  3M1F A;  2UYT A;  3WQU A;  2J4R A;  5ADX H;  3ENO A;  5EX5 A;  3UKU A;  3VGM A;  1NGE A;  5FPE A;  2PAV A;  2ITM A;  3TPQ A;  4B1Y B;  5AZJ B;  3CJ9 A;  2FSK A;  3QML A;  2NRH A;  4BR7 A;  4AM7 A;  3AAQ A;  4GNI A;  4H5W A;  1TUU A;  4BRN A;  3GBT A;  1GLF O;  4E1J A;  3LDL A;  3CJA A;  1G99 A;  1TYQ B;  1NMD A;  3VGK A;  1ZC6 A;  2IVN A;  3WXJ A;  4IXC A;  5TKY A;  3WXI A;  2VYP A;  2ZWH A;  4LC9 B;  2I7N A;  4IJA A;  4FWM A;  2A41 A;  3O4W A;  3O1B A;  2P9P B;  3CQX A;  4BGB A;  4FWK A;  3L4I A;  1YXQ A;  3MK6 A;  5EXW A;  1IG8 A;  3IDH A;  1T6C A;  2P9K B;  4FSV A;  1XC3 A;  5FPM A;  1MWM A;  2GWJ A;  5EY4 A;  4BRL A;  1ATN A;  3C7N B;  3QFP A;  3A5O C;  4HWI A;  4EIA A;  3QFU A;  3EN9 A;  3D2F A;  4IO8 A;  4J8F A;  1JCF A;  2QWQ A;  3MN7 A;  4BRF A;  4ISF A;  1E4G T;  4BC3 A;  5LY3 A;  1ZBS A;  5AQF A;  3VES A;  1LCU A;  1QQN A;  3H1V X;  1H1V A;  1XUP O;  3HTV A;  3G25 A;  4H0P A;  2A5X A;  2KHO A;  2YCH A;  2P9I A;  1NBW A;  5EOY A;  3MN5 A;  5F0X A;  2CGJ A;  3SMS A;  1QZ5 A;  3EL2 A;  4Y0W A;  3WXK A;  1DGK N;  4K42 A;  1SAZ A;  2PBD A;  3H46 O;  3H45 C;  3ATV A;  3GG4 A;  3UKU B;  3BF3 A;  5AZJ A;  2ZF5 O;  3BEX A;  3ID8 A;  3EKS A;  3I33 A;  4XH5 A;  5JLH A;  3FE1 A;  3O80 A;  2HF4 A;  2E20 A;  4PKG A;  1HX1 A;  5BN9 A;  4Z94 A;  4M63 C;  1TUY A;  3WT0 A;  4PKH A;  3GL1 A;  2D0P A;  4BR4 A;  4BRI A;  2F9T A;  5JLF A;  2Q31 A;  2QXL A;  4H0T B;  1SQK A;  4YDU A;  2D0O A;  1WUA A;  1NGD A;  2P9P A;  1JCE A;  1Q18 A;  2NZT A;  4IWV A;  4EHU A;  2P9K A;  3O08 A;  1CZA N;  3CIP A;  2YJE A;  4BR2 A;  4BR0 A;  1BG3 A;  1HKC A;  3AAR A;  4JD2 A;  2BTF A;  1MDU B;  4MLH A;  5AQR A;  3KZB A;  4B1W B;  4BQZ A;  3H3O B;  1KAY A;  4M7Y A;  3A5N C;  3VET A;  3JXU A;  4FOE A;  4WQ4 A;  5AQT A;  3D2F B;  5LJW A;  3WQT A;  1MWK A;  2Q97 A;  3W0L A;  3HI0 A;  3F9M A;  4ISE A;  1JCG A;  1C0G A;  1T6D A;  4B1Z A;  3LDN A;  4CBW A;  3QDK A;  1LOT B;  3A0I X;  2YHY A;  3QIC A;  4L3Q A;  3VER A;  5AQQ A;  3WUH A;  3DJC A;  3WXL A;  4PL8 A;  3QBX A;  1QZ6 A;  3ZX3 A;  1DKG D;  2I7P A;  3ULE B;  4H5N A;  5JMV A;  2IVO A;  3ATU A;  5AQM A;  3UE5 A;  5BPL A;  3FZH A;  2Q2R A;  1S22 A;  3UKR A;  4CZK A;  3VF2 A;  1D4X A;  3R6M A;  3DAW A;  4FWL A;  4H5T A;  5I9E B;  3EKU A;  4BRQ A;  3GDQ A;  1YUW A;  2FXU A;  3RSE B;  3B8A X;  4BRH A;  4H0X B;  2DPN A;  5F1X A;  3VEW A;  5ADX A;  2FF3 B;  4K41 A;  1HJO A;  2D4W A;  3ZEU A;  4A62 A;  4CBU A;  4H0O A;  2QWL A;  1NLV A;  1GLC G;  1NGG A;  2VCP A;  2V7Z A;  3R9P A;  1NGB A;  5AQP A;  1HLU A;  4WYB A;  2ASM A;  1R59 O;  1NGI A;  2D1K A;  3OHR A;  1Y64 A;  4JD2 B;  4DQ8 A;  4H0V B;  4EFH A;  5AQG A;  4FWP A;  1GLD G;  2E1Z A;  4PKI A;  4BRM A;  1NGA A;  4PL7 A;  1RDW X;  3CJ1 A;  3I8B A;  2P9L B;  2E1Y A;  3LM2 A;  5B8H A;  3FGU A;  3DWL A;  5AFU H;  4B9Q A;  4BRE A;  3DXM B;  3M6G A;  3ENH A;  1HPM A;  4BVO A;  5AQV A;  1RFQ A;  2W41 A;  3VGL A;  4DCH A;  2ASO A;  3FR0 A;  1P8Z A;  2P9S B;  4FL9 A;  4WQ5 C;  5AQL A;  4A61 A;  1MA9 B;  4CZF A;  5BRD A;  2E88 A;  3BF1 A;  3D2E A;  2ZGY A;  2FSJ A;  4I6M A;  4MO4 A;  5E84 A;  5KQD A;  2AA4 A;  1HKB A;  2E2N A;  1U2V A;  5BPM A;  4FOI A;  3ULE A;  3U8X A;  1NWK A;  4FWS A;  2FF6 A;  1GLE G;  3UKR B;  1QQM A;  3CET A;  2HF3 A;  4RTF D;  1ATR A;  4JNE A;  4BC2 A;  1NGH A;  4XEI A;  2OAN A;  4MO5 A;  3QB0 A;  3RSE A;  5EVZ A;  1X3M A;  2CH6 A;  2IVP A;  2V52 B;  1K8K A;  4BRG A;  3IMX A;  3MDQ A;  3O6W A;  3FLC O;  3CJB A;  4M7X A;  5AQI A;  5JIC A;  3CHW A;  3ZEU B;  4O8K A;  4BG9 A;  3DXK A;  1Z05 A;  3AAP A;  4BRK A;  2BUP A;  4RCH A;  5AQH A;  1BA0 A;  3U9D A;  4CZL A;  1GLJ O;  1S3X A;  2NLX A;  3IUC A;  5AQY A;  3VPZ A;  4KBO A;  4CZG A;  2QM1 A;  5AQZ A;  4BRP A;  4CZJ A;  4FWQ A;  4EHT A;  3GE1 A;  4XH1 A;  1GLB G;  5F2R A;  2CGK A;  1NGF A; 
#chains in the Genus database with same CATH topology
 2PFU A;  3SZ2 A;  3W3D A;  4JI1 K;  1U6Z A;  1DTT A;  3CQ8 A;  1SUQ A;  3VQ5 A;  4FPA A;  4BWM A;  1BGX T;  1WBB A;  2QWO A;  4ID1 A;  2E2P A;  1D9F A;  1SZ2 A;  4OGE A;  3K9K A;  4BG8 A;  4BR9 A;  2P51 A;  3NAE A;  4DU1 A;  2ATQ A;  4B1V A;  2OZS A;  5LMU K;  1U48 A;  2YJF A;  4X64 K;  4U67 L;  4EAH D;  2WFB A;  4M3Z A;  2D0A A;  4F9O A;  1JJ2 M;  1RBS A;  4BC4 A;  2O8D B;  1BIU A;  3CME N;  3FZF A;  1B92 A;  2Z1I A;  1NU0 A;  1XNQ K;  4CF1 A;  2VQE K;  1K8K B;  5MLC Q;  4E7K A;  3TTF A;  3HM9 A;  2ZGZ A;  4NO7 A;  3VF6 A;  3SUP A;  1NGC A;  2F4V K;  5BR8 K;  4JI2 K;  3DM2 A;  3DXK B;  1P90 A;  2Q1N A;  4DHY A;  4GY2 B;  1J53 A;  3TU5 A;  4M42 A;  1S1X A;  1U49 A;  4A2B A;  4V19 S;  2NUB A;  1LWE A;  4WFA L;  2G8I A;  4O55 A;  4HTU A;  1KFD A;  4R5P A;  3P4I A;  3U4L A;  1KD1 O;  2PYJ A;  3J8A A;  2ITG A;  1X9J A;  4WQ5 A;  2HHX A;  1VHX A;  1JLQ A;  1NK9 A;  2KTQ A;  3HK2 A;  4BVP A;  1DEJ A;  2UXD K;  1CZB A;  5M1N A;  3O5B A;  3I0S A;  4HTL A;  5JVG L;  4KKO A;  3ZX2 A;  3IFR A;  4JN4 A;  5KTQ A;  3CFR A;  3OTO K;  1QQC A;  1X3N A;  3BZC A;  3HPO A;  1BDG A;  3SPY A;  3K5O A;  5AFU A;  3AO3 A;  2HHV A;  4QS7 A;  4PWD A;  1NOY A;  3SQ4 A;  4KRF A;  3F73 A;  1V4T A;  4OKE A;  3NF8 A;  4H0Y B;  4CEB A;  4FJX A;  1KAZ A;  1VRT A;  3NVM A;  5KQ8 A;  1NK5 A;  1JL1 A;  1YAG A;  2E2O A;  5KPR A;  2FLO A;  3EO3 A;  4AIL C;  1HRH A;  1KTQ A;  5BN8 A;  3LAL A;  5AQX A;  2NRT A;  3OYK A;  4CF9 A;  3OA9 A;  1UAX A;  3RMA A;  1TYQ A;  4A2A A;  3DLK A;  4H5R A;  2HNY A;  5AR0 A;  4JI5 K;  2OYQ A;  3H1Q A;  3CFP A;  2QWM A;  4W5T A;  4CGH A;  1XNR K;  4WF9 L;  2A1R A;  2FSN A;  4IG3 A;  1K73 O;  3AO5 A;  2KW4 A;  2AP1 A;  3MEE A;  2R7Y A;  3LDQ A;  3V1R A;  1NKB A;  4AHS A;  4BGA A;  4Z0U A;  3CER A;  1W2B M;  1VQN N;  1O1W A;  1V4S A;  4YDU C;  1KAX A;  4JAX A;  2P9U A;  3OYD A;  2O8F B;  1BQM A;  3E9O A;  4KHN A;  1LW2 A;  4IOA L;  3VEY A;  3SV3 A;  1FK9 A;  2QTD A;  2P1J A;  1ZYQ A;  3JS6 A;  4DR1 K;  3KLH A;  2IIR A;  5E41 A;  3C6A A;  5FRN A;  5M1P A;  3NF6 A;  3NGY A;  1U47 A;  1TV6 A;  4DLG A;  4IDH A;  4H03 B;  1SKS A;  4WQ4 C;  4Z4C A;  3M1F A;  4BDP A;  4DSI A;  1OVY A;  3LPU A;  3TAN A;  1N34 K;  2J4R A;  1SL0 A;  3ENO A;  5EX5 A;  5GIN A;  3UKU A;  4DTM A;  1NK8 A;  3CJ9 A;  3LZJ A;  1YHQ N;  3AVG A;  1LAV A;  4AM7 A;  4CFC A;  3O9U A;  5C42 A;  4GNI A;  3NGI A;  4LFB K;  3CCQ N;  2HBK A;  4NXM K;  1G99 A;  4DV3 K;  1X9M A;  3VGK A;  3F2K A;  3WXJ A;  4DS4 A;  3WXI A;  3DLR A;  1GOC A;  1YF5 L;  3WNH A;  1IBM K;  3LP3 A;  1HQE A;  3R3L A;  4BGB A;  4FWK A;  3AVA A;  3T69 A;  4K8Z A;  1N8R O;  4Z4H A;  3SBG A;  5FPM A;  1TKD A;  4IFV A;  3CCV N;  1FKP A;  3AVK A;  4LY7 A;  4LF7 K;  4N5S A;  3M8Q A;  3ITH A;  4GVE A;  4XIU A;  1W0H A;  1UWB A;  4BRF A;  4BC3 A;  3THW A;  3VES A;  3KWG A;  3H1V X;  3HTV A;  3J7A P;  2YCH A;  2P9I A;  1NK6 A;  5F0X A;  1QZ5 A;  4F2R A;  4GMJ B;  3EL2 A;  2RHK A;  4GV3 A;  3RTV A;  4CHY A;  2KZM A;  4DR4 K;  4KH4 A;  3ALY A;  3I56 N;  1C1A A;  1QSL A;  3CM5 A;  1X9W A;  1EO1 A;  3BF3 A;  3AVF A;  5AZJ A;  3EKS A;  3LP2 A;  4M3R A;  5JLH A;  3FE1 A;  3B6O A;  3VTH A;  4N47 A;  1HNZ K;  3PIO L;  4M63 C;  3KK3 A;  1TUY A;  3WT0 A;  4DF4 A;  3DLB A;  3HJF A;  1J54 A;  5JLF A;  1XC9 A;  4H4M A;  4H0T B;  1SQK A;  2YV0 X;  1WUA A;  4EP4 A;  5M1Q A;  2NZT A;  2UU9 K;  1J5E K;  4G9Z A;  1KLN A;  2P9K A;  1XWL A;  1WN7 A;  2AJQ A;  4GV9 A;  3TAG A;  3TWH A;  4E0D A;  1HKC A;  4JD2 A;  2BTF A;  3I55 N;  3KZB A;  1BCO A;  3H3O B;  3J80 O;  4WFB L;  3A5N C;  2BH1 A;  3WQT A;  4DTU A;  3VQ6 A;  1JCG A;  3KLE A;  3LDN A;  4YOU A;  1I39 A;  2YHY A;  3HYF A;  3WXM B;  4FK0 A;  3C6H A;  1QZ6 A;  1DKG D;  3TAB A;  3VQ9 A;  3IG1 A;  5JMV A;  4CCH A;  3AV9 A;  4DTN A;  1FXX A;  2QA4 N;  4OLB A;  5AQM A;  2F7T A;  4I2P A;  4CZK A;  2VGM A;  4OKJ A;  3K5M A;  2Z1J A;  1DT9 A;  1VQ4 N;  2VWK A;  5EU7 A;  3RSE B;  2NRR A;  1EET A;  3B8A X;  3MWP A;  1N6Q A;  5F1X A;  1WSJ A;  2JGU A;  3ISN C;  2FF3 B;  4CEF A;  3NHG A;  4B08 A;  4FJL A;  4H0O A;  2QWL A;  1NLV A;  1VQ6 N;  1J9A A;  1RIL A;  1D5A A;  4JK7 A;  3VQE A;  4DUY K;  3V9X A;  3T1H K;  3MXI A;  1HLU A;  1ITG A;  1R59 O;  1YTU A;  1NGI A;  2D1K A;  3OHR A;  3VQC A;  4DQ8 A;  3M8S A;  3MX2 A;  4EFH A;  3CCS N;  1TK5 A;  4C8K A;  4FWP A;  1GLD G;  5D3G A;  4JKF A;  4AHV A;  4JK8 A;  3AVH A;  3IKM A;  4I2Q A;  4PL7 A;  1RDW X;  4JI3 K;  4GKJ K;  5B8H A;  3DYA A;  3O3G A;  4ZHR A;  2O8E A;  3OJU A;  1HNX K;  1RFQ A;  1SL2 A;  1QSY A;  4KTZ A;  3O9S A;  4DCH A;  2VGN A;  4FL9 A;  4TSX A;  2KKZ A;  4WQ5 C;  3H08 A;  4NCB A;  1MA9 B;  4FK2 A;  2E88 A;  3D2E A;  4I6M A;  2ZGY A;  3AVC A;  4DSK A;  4MO4 A;  4FM0 A;  2WON A;  4B8A B;  4FOI A;  4KHP K;  3U8X A;  1NWK A;  4JKE A;  1C1B A;  1TAU A;  4YFU A;  3UKR B;  1QQM A;  3CET A;  2D5R A;  4CJW A;  4RTF D;  4ELU A;  3ZCM A;  1VSE A;  3D0P A;  3E1Y A;  1IBK K;  3S3O A;  4DV6 K;  2BGG A;  3ZSR A;  4BRG A;  2HNZ A;  3O6W A;  3FLC O;  3KIO A;  2ZJP L;  3CHW A;  4O8K A;  4BG9 A;  4YOY A;  2OPR A;  3G71 N;  1W9H A;  5A2Q O;  4BRK A;  2JWL A;  4C8L A;  2BUP A;  3MXJ A;  3L2U A;  4A59 A;  5HP1 A;  2NLX A;  4YNQ A;  3M8R A;  3VPZ A;  4BRP A;  4XH1 A;  1C0M A;  1GLB G;  1RNH A;  5F2R A;  2CGK A;  3HVR A;  5K14 A;  4JKG A;  3ZT3 A;  1QE1 A;  2V51 B;  1EKE A;  3VOV A;  5HRO A;  3CJ7 A;  4DV0 K;  1N5Y A;  4M3Y A;  2CH5 A;  3VN5 A;  3HOT A;  3CPW M;  4KHW A;  5AJ3 K;  1WOQ A;  3A5M C;  3WNG A;  4DTJ A;  1GLA G;  3ZLJ A;  4I9L A;  2P9S A;  4UY8 O;  4G1Q A;  5AZI A;  4LF4 K;  3MMV A;  2HHT A;  4DTX A;  1S5J A;  3CC4 N;  3TSU A;  3LM9 A;  3LPT A;  4KH5 A;  5C0Y A;  1Z26 A;  5AQK A;  4YOV A;  3N4P A;  1NKE A;  5M1K A;  1NNE A;  4LSN A;  1ASW A;  1S6P A;  3OYB A;  5C10 A;  2E5L K;  2G8U A;  3R8E A;  5KPT A;  3QEP A;  4CF8 A;  3AVN A;  3PX6 A;  4WE1 A;  3ZSY A;  1EQY A;  1JXB A;  5HRN A;  2QKB A;  4FVU A;  2D0B A;  1JLF A;  2QI2 A;  4BY9 C;  2KZZ A;  2IOC A;  4NB4 A;  1ZBL A;  1Q8I A;  1WLJ A;  4JRQ A;  2HOE A;  2V7Y A;  4AH9 A;  4CD3 A;  3CCM N;  3RVC A;  4DB3 A;  3K2P A;  1RDB A;  2P5G A;  1D8Y A;  3JSM A;  3M8P A;  3L6Q A;  1BL3 A;  4CJK A;  1NJI O;  2ETJ A;  3LDO A;  4FPB A;  3PO4 A;  5BRH A;  1RDD A;  3ZT1 A;  4CES A;  4QS9 A;  3LDP A;  3NVK A;  3SQ2 A;  4BR5 A;  3PX4 A;  1T8E A;  2QWP A;  4DFM A;  1VQ5 N;  2P9U B;  4B9M A;  2GEL A;  3C0B A;  3PX0 A;  4CK3 A;  1IKW A;  3MCA B;  3TR8 A;  4ID5 A;  3KKR A;  3OBW A;  3ZX0 A;  4CK2 A;  2GX9 A;  3C94 A;  4IBN A;  4NYN A;  4JI6 K;  3EZW A;  5CE3 A;  1IG9 A;  2YHB A;  2O8B B;  1GOA A;  4KI6 A;  2Q36 A;  4FO0 A;  1NKC A;  2E2Q A;  3KWI A;  4CJV A;  1UA0 A;  4A5A A;  4FJG A;  4ILH A;  3HXM A;  4NLC A;  5AQW A;  3THV A;  3RWU A;  3FZL A;  3ZET B;  1QVF M;  2Q3S A;  4BC5 A;  1E4F T;  4KO0 A;  2X6N A;  3VQ4 A;  1A5V A;  4CJT A;  3SCX A;  1Q7Y O;  2IC3 A;  3VEO A;  1TGO A;  4BRA A;  1T44 A;  3THX B;  2NNW A;  3SJJ A;  4OPA A;  4PY5 A;  4DV7 K;  3HRG A;  4JHD A;  5KGX A;  3AVM A;  3O3F A;  1RT5 A;  3A8Y A;  5C2F A;  5AQJ A;  1M90 O;  5E26 A;  4CBX A;  2FBT A;  1BOT O;  4DTS A;  3KVG A;  4CER A;  3QO9 A;  3H6E A;  1IJJ A;  5TKW A;  2YI1 A;  3THW B;  1WSG A;  4CZM A;  1Q81 O;  2P9I B;  2PZS A;  4EP5 A;  3RMD A;  3HBT A;  1QQO A;  1NM1 A;  4JKA A;  3HOS A;  2P9N B;  1OKJ A;  3SV4 A;  3SPZ A;  2UYT A;  1HPZ A;  4CEZ A;  1JXE A;  3G10 A;  3VQA A;  4DR2 K;  5ADX H;  3RRG A;  3VGM A;  2PAV A;  2ITM A;  5AZJ B;  4BR7 A;  4IOX A;  4H5W A;  4BRN A;  4YOT A;  4E1J A;  4CJR A;  4CJ5 A;  3CJA A;  2RF2 A;  3HVT A;  4YY3 K;  1LWC A;  1U45 A;  1NK7 A;  4C8O A;  1RDA A;  2I7N A;  4FWM A;  2FBV A;  3OYE A;  3U6F A;  1VQL N;  1CXU A;  3IDH A;  3O9R A;  2P9K B;  4DQP A;  3SQ0 A;  4J2E A;  1MWM A;  3AO1 A;  2YKN A;  3OYM A;  4O8U A;  3LWM A;  1RTJ A;  1VSK A;  3C7N B;  3QFP A;  4DLE A;  4HWI A;  3KJV A;  2QWQ A;  4NYF A;  4UQG A;  4MQ3 A;  3DOK A;  5AQF A;  1QQN A;  3WNE A;  1H1V A;  1HJR A;  1TKZ A;  1XUP O;  1QVG M;  1RT1 A;  4B3R K;  1NBW A;  4CJF A;  3MN5 A;  3ZSZ A;  3SMS A;  4FZX C;  3RRH A;  3MWT A;  3RR8 A;  3WXK A;  1DGK N;  1SV5 A;  3G0Z A;  4O0I A;  3DLL L;  1SAZ A;  1X1P A;  2NRV A;  3H46 O;  3DLH A;  3H45 C;  5GAE P;  4JKH A;  3NBP A;  4DQS A;  1T03 A;  4XH5 A;  3I33 A;  1WSE A;  3K58 A;  1HYS A;  4KHS A;  2E20 A;  2B6A A;  1S6Q A;  2KLA A;  4E89 A;  4B9L A;  4PKH A;  3GL1 A;  1BIZ A;  1K8A O;  4F8R A;  4K8X A;  1BI4 A;  1TL1 A;  4KPY A;  3CMA N;  4FJ5 A;  1JCE A;  1Q18 A;  3O08 A;  4YOX A;  4FLU A;  1RT3 A;  3CIP A;  4NLB A;  2YJE A;  4F2S A;  2HBL A;  4BR0 A;  1YTA A;  4CFA A;  3LP1 A;  1RTH A;  5JS2 A;  5AQR A;  4MLH A;  3OS0 A;  4RW8 A;  3SUO A;  4FLX A;  4E7L A;  1RBU A;  2XY6 A;  3JXU A;  3D2F B;  4O4G A;  1TL3 A;  1MWK A;  2Q97 A;  3W0L A;  3CCU N;  3PLA A;  3F9M A;  3QER A;  4DF8 A;  4KHQ A;  4B1Z A;  2RN2 A;  1LOT B;  4OJR A;  2IDO A;  3VER A;  4JS4 A;  3C65 A;  4JEP A;  1YIT N;  1NJW A;  2G8W A;  4JKB A;  2E4L A;  4FJ8 A;  3ATU A;  4WFN L;  3CCJ N;  5BPL A;  3FZH A;  1C0T A;  3THY A;  5C25 A;  3DAW A;  4H5T A;  3EKU A;  3GDQ A;  3T1Y K;  3VQB A;  3ULD A;  4BRH A;  1IV0 A;  3K59 A;  2EHG A;  3P38 A;  4H0X B;  3TI0 A;  1XMO K;  1NK4 A;  3DLG A;  2HHS A;  5GAD P;  4J2B A;  4KHY A;  3K0S A;  1EX4 A;  1RTI A;  4W5Q A;  2D4W A;  3C6U A;  2HHU A;  4CBU A;  3QET A;  1UA1 A;  3AA2 A;  3PY8 A;  1NGG A;  2VCP A;  2V7Z A;  3R1X A;  4WYB A;  1HMV A;  1KFS A;  2EX3 A;  3V81 A;  4PKI A;  3SQ1 A;  4BRM A;  1NGA A;  3G4S N;  2E1Y A;  3VQQ A;  2OZM A;  1KVB A;  5AFU H;  4O0J A;  4BRE A;  1TK8 A;  1JL2 A;  1XHX A;  3M6G A;  4BVO A;  1HPM A;  4YOW A;  4FXD A;  2WOM A;  3LP0 A;  1R0A A;  2ASO A;  2P9S B;  4IFY A;  1M1K O;  1Z25 A;  4A61 A;  5H1S Q;  3ZSO A;  3QIO A;  3HPG A;  1IKY A;  5BPM A;  1E3M A;  2Y1I A;  4DFP A;  4M41 A;  4HUE A;  4BE1 A;  4FWS A;  4W5O A;  4DSL A;  4RW6 A;  5GIP A;  3ZSX A;  4E7J A;  3QEV A;  1ATR A;  4JNE A;  1Q9X A;  1NGH A;  2QKK A;  4XEI A;  4FJJ A;  2O8D A;  4N76 A;  2OAN A;  1S1U A;  4MO5 A;  2CH6 A;  1K8K A;  4CHN A;  1IO2 A;  2XO7 A;  4DR6 K;  5AQI A;  3MXM A;  3AA4 A;  4KB0 A;  3ZEU B;  4DQQ A;  3OS2 A;  3DXK A;  1Z05 A;  5LMN K;  5CYQ A;  3NH0 A;  3AVB A;  3AA3 A;  4C8N A;  4RCH A;  5AQH A;  3M5R A;  1SL1 A;  5HRP A;  2FBY A;  1GLJ O;  1S3X A;  3IUC A;  4FJ7 A;  2HST A;  4CZJ A;  1B9D A;  5KGW A;  4EHT A;  2B4J A;  3E66 A;  5CY4 A;  4DQI A;  3K9J A;  1NGF A;  4CW7 B;  4FJN A;  1WAJ A;  2G8V A;  4LF8 K;  5ELZ A;  1XQS C;  3O8M A;  4H5V A;  5AQO A;  2F9W A;  3AVI A;  4B9U A;  5DMR A;  5LJV A;  4OLA A;  4KRE A;  2BDP A;  3K57 A;  4DV5 K;  4DU4 A;  3VEZ A;  4OPH A;  3A5L C;  3OYH A;  1IBL K;  2KFN A;  1ZXO A;  4CK1 A;  1U2V B;  4FLV A;  3OYF A;  2FC0 A;  2DTU A;  4B8C A;  2PYL A;  4C8M A;  4K25 A;  4BDZ A;  1C1C A;  1RT4 A;  2GTD A;  1HQU A;  4FM1 A;  1CZ9 A;  1J6Z A;  2A6A A;  3SMP A;  3SAG A;  4Q0B A;  2GV9 A;  4BRC A;  5HLF A;  2KQ2 A;  1BU6 O;  3IRX A;  4CGG A;  1TKX A;  1WAF A;  1C0F A;  2DFF A;  4FCY A;  4K43 A;  4YOR A;  3TAM A;  4CI6 A;  4M3W A;  5CYM A;  2ASP A;  4ELV A;  1BQN A;  5J2M A;  2E8A A;  5AQN A;  1FW6 A;  3CJC A;  2HHQ A;  3EYZ A;  3KK2 A;  4FJ9 A;  3CC2 N;  2QWN A;  3J7Y P;  1HUX A;  3VQP A;  3HZ6 A;  3ZT0 A;  4KFB A;  1VSF A;  3D45 A;  1HKG A;  1NJZ A;  1VSH A;  4JHD B;  3MN6 A;  4A5B A;  2ZM6 K;  2UXC K;  3H3N O;  3T19 A;  4MFB A;  1T7P A;  4PUO A;  4CZI A;  4OKK A;  4RW7 A;  2O8F A;  3JAM O;  2HMI A;  4CD1 A;  1CXQ A;  4DTR A;  2YNI A;  3N4Q A;  2DFE A;  3NGZ A;  3B6P A;  2WTU A;  3SI6 A;  1Z6R A;  4DFJ A;  4NCA A;  5KPZ A;  4JS5 A;  3CCL N;  3VF4 A;  1A5W A;  2X78 A;  4CIE A;  3AO2 A;  1ZBI A;  3BGR A;  3O9Q A;  3MEC A;  4K0K K;  2YHW A;  3DRS A;  1OH8 A;  1ASV A;  1RGI A;  2YX6 A;  1LV5 A;  4QS8 A;  4IKF A;  4OPK A;  4U7B A;  1NOZ A;  3WEE A;  3ASM A;  4MLE A;  3VEV A;  4MDB A;  3VTI A;  2O4G A;  3CFO A;  3M3Z A;  4DR3 K;  5BRE A;  3D7E O;  3CC7 N;  5FRM A;  4CIF A;  5SWM A;  1ILY A;  4BRD A;  4CHQ A;  3LAM A;  4GVM A;  1C0U A;  1OH5 A;  3VEX A;  1QHA A;  1G15 A;  3KHY A;  1VSL A;  2A40 A;  1BWF O;  2VWB A;  1RT7 A;  4FWR A;  2A3Z A;  1RBT A;  4B1U B;  3BY5 A;  4FW1 A;  3O4N A;  4DMN A;  4ISG A;  5HRR A;  3NMU A;  2UUC K;  3KTQ A;  2BAN A;  4C1N K;  2W40 A;  4CJU A;  1KXP A;  3VQD A;  3KD1 E;  4A57 A;  4LD0 A;  2HVH A;  5IWA K;  5FDL A;  4BE0 A;  3LAK A;  2QWR A;  1VQM N;  3QBW A;  1IKX A;  3E01 A;  3V9S A;  2HB5 A;  5CHI A;  3L0Q A;  1I3A A;  2EWS A;  4FM2 A;  1DTQ A;  3DMJ A;  3Q7C A;  2WUS A;  4AHT A;  4YHH K;  4DSF A;  1L3V A;  5FPE A;  5GIO A;  5C12 A;  4B1Y B;  4LH4 A;  3HP9 A;  3AAQ A;  5IT9 O;  3MED A;  4GV6 A;  1TUU A;  3GBT A;  3ZT2 A;  2QK9 A;  1GLF O;  2W6K A;  1TYQ B;  4KH6 A;  1ZC6 A;  2IVN A;  2X74 A;  4IXC A;  5TKY A;  4B9S A;  4I9Q A;  1TAQ A;  2OCE A;  2VYP A;  2ZWH A;  4RW4 A;  2LSN A;  2IGI A;  4IJA A;  3O4W A;  3O1B A;  4Y1C A;  4FLW A;  3MK6 A;  4JYA K;  3AA5 X;  1VQ9 N;  1T6C A;  5FRO A;  4FSV A;  3HPH A;  4BWJ A;  4CIG A;  5EY4 A;  2HBM A;  1NG9 A;  1ATN A;  3CD6 N;  1X9S A;  1OH6 A;  5GAH P;  3CYM A;  3QFU A;  4IO8 A;  4J8F A;  1JCF A;  3MN7 A;  4CHP A;  4M3T A;  4ISF A;  1E4G T;  2VG5 A;  1ZBS A;  3V4I A;  3TAE A;  3ENB A;  4B3T K;  3V6D A;  1Q86 O;  3CPE A;  1WSI A;  3ZSV A;  1SKW A;  2ZQB A;  4FZZ A;  4WCE L;  2Z1H A;  4K42 A;  4RW9 A;  4NXN K;  2PBD A;  4DWI A;  1K9M O;  1HNW K;  3UKU B;  5DM6 L;  3KLI A;  1GOB A;  3ID8 A;  4FK4 A;  3ZSQ A;  2GBZ A;  1VQK N;  1VK0 A;  2HF4 A;  2UXB K;  3VA3 A;  3OVN A;  2VG7 A;  3NFA A;  4Z94 A;  3OYL A;  3P5J A;  3CG7 A;  4H8K A;  3ZT4 A;  2D0P A;  4JV5 K;  2F9T A;  2QXL A;  1Y97 A;  3DRP A;  2D0O A;  1NGD A;  2P9P A;  5M1O A;  3ID6 A;  4DV1 K;  2F96 A;  4EHU A;  3NCI A;  3C95 A;  3CCE N;  1RTD A;  4CF0 A;  1UOC A;  2NRX A;  2FBX A;  4CJL A;  3EEQ A;  4BQZ A;  4BAC A;  4M7Y A;  1NJX A;  4HVJ A;  3E9L A;  4FOE A;  5AQT A;  1Q82 O;  1VQ8 N;  5KI6 A;  5LJW A;  2G8H A;  3P83 D;  4I7F A;  4DG1 A;  1C0G A;  1T6D A;  1BHL A;  4CBW A;  4KTQ A;  4DSE A;  1J5O A;  2XHB A;  3A0I X;  4CGI A;  3QIC A;  4HCB A;  2Z1G A;  4CEE A;  5AQQ A;  3WUH A;  4QOZ B;  4QAG A;  3DJC A;  4B3M K;  1YVU A;  3CXC M;  3K5L A;  3QBX A;  3RR7 A;  3ZX3 A;  4H5N A;  1REV A;  1S1W A;  3UE5 A;  3UKR A;  1S22 A;  1VQP N;  3VA0 A;  4BDY A;  4FWL A;  1I94 K;  2QEX N;  1YUW A;  4Y1D A;  2QXF A;  4BE2 A;  2HVI A;  1NK0 A;  4CFD A;  3Q7B A;  4K41 A;  1HJO A;  3OW2 M;  4A62 A;  3EE8 A;  1HR0 K;  4AQY K;  3S3N A;  2G8K A;  2XY8 A;  2OTJ N;  4M3X A;  4CHZ A;  4PA1 A;  2WC9 A;  3R9P A;  5J1E A;  3MAQ A;  1NGB A;  3F9K A;  3DLE A;  1O13 A;  4CGJ A;  4IEE A;  3DOL A;  2B5J A;  1S1V A;  4JD2 B;  3DI6 A;  2E1Z A;  5SZT A;  4EZ9 A;  5J2N A;  3OS1 A;  3FGU A;  1HNI A;  4B9Q A;  2F8S A;  5T7B A;  1JLB A;  1LWF A;  3VGL A;  4CED A;  3FR0 A;  4FYD A;  5AQL A;  4CZF A;  2IS3 A;  3BF1 A;  3EZ5 A;  3LDS A;  5E84 A;  2AA4 A;  1HKB A;  3ZSW A;  3OYN A;  2XY7 A;  3I8D A;  3ULE A;  2E6M A;  3PIP L;  4E1M A;  2HHH K;  4OO1 J;  1VSJ A;  2W6L A;  1EWQ A;  4DQR A;  1QSS A;  3A2F A;  2Y1J A;  4Q5V A;  1KLM A;  3SNN A;  4B9T A;  1VQ7 N;  4NCG A;  1U4B A;  5EVZ A;  1X3M A;  2V52 B;  3IMX A;  3FFI A;  2A1S A;  3MDQ A;  1S9E A;  1JLG A;  3SAF A;  5JIC A;  4LF6 K;  3AAP A;  3C6T A;  1SKR A;  4DR5 K;  4FVM A;  4O5B A;  1KSP A;  4FJI A;  1SS6 A;  5AQY A;  2QM1 A;  5AQZ A;  1YT3 A;  3JYT A;  1N36 K;  2OA8 A;  2E6L A;  3AY9 A;  2XY5 A;  1N33 K;  4CEC A;  4CFB A;  4FJH A;  4FWN A;  1BUP A;  2P9L A;  3VMF B;  1YI2 N;  3AO4 A;  4IZ9 A;  3U3Y A;  2O8E B;  2Q0U A;  3DXM A;  4FJK A;  3TAF A;  4FJM A;  3IAY A;  4E7H A;  4ELT A;  2ZD1 A;  3LAN A;  3D2E B;  4I6M B;  1FKO A;  4JI0 K;  3U9Z A;  4B1X B;  2GEM A;  3F5T A;  4JI8 K;  1GLL O;  3SJH A;  3BZK A;  3BUZ B;  3OYI A;  2O8C A;  3QIP A;  4AHU A;  4RWT A;  2RKI A;  3HSC A;  3AVL A;  5BR9 A;  3AGK A;  5BPN A;  1KQS M;  4JRP A;  2H3G X;  3KK7 A;  3L8B A;  4OPJ A;  4XH4 A;  2HBJ A;  2NRZ A;  5AQS A;  3O3H A;  1LW0 A;  4LSL A;  1EWR A;  3PSI A;  3VQ8 A;  3PV8 A;  2O8B A;  1IKV A;  4CZE A;  3RMC A;  4FWO A;  3HL8 A;  3MCP A;  4QCL A;  3SBT A;  3WEE B;  4DKW A;  3T3F A;  1OH7 A;  3G6E N;  1XHZ A;  5CZ2 A;  4CJ7 A;  4IJN A;  3FZM A;  1YJN N;  1D9D A;  3ZET A;  3PSF A;  3S41 A;  3SLC A;  4OVL A;  4JKG B;  1N32 K;  5FPD A;  1VQO N;  2IAJ A;  1TKT A;  4O5F A;  1JLC A;  4EZ6 A;  4CEQ A;  3DRR A;  3CQY A;  3V1Q A;  5GAG P;  3HT3 A;  1RDU A;  4ZTF A;  1RT6 A;  1BCM A;  3THX A;  3SUN A;  2VG6 A;  3UB5 A;  2A42 A;  4F4K A;  2NRW A;  2OTL N;  5BRF A;  3QNN A;  1W7A A;  2ZJQ L;  5FPN A;  4GW6 A;  3ZYY X;  5AZI B;  2QW9 A;  2WBN A;  4DTO A;  4HCC A;  1QS4 A;  4IDK A;  3TAR A;  3VQ7 A;  3SAH A;  3CM6 A;  1XI1 A;  2VWJ A;  1ASU A;  3I0R A;  3NF9 A;  4HUF A;  1ATS A;  1NGJ A;  1U04 A;  2GUP A;  4Z4G A;  4B3S K;  5HL7 L;  2Q0R A;  1WNS A;  4B9N A;  2ZJR L;  2OPQ A;  3V9Z A;  3QEW A;  4DR7 K;  3PUF A;  2P9N A;  5HOO A;  5I42 A;  4CZH A;  2HMP A;  1BO5 O;  2W42 A;  3UIQ A;  1KVA A;  2RE2 A;  1YVN A;  3WNF A;  4HHT A;  4BQL A;  1RT2 A;  4LH5 A;  3SK3 A;  4N41 A;  4LFA K;  1VSD A;  3AVJ A;  4KI4 A;  3LL3 A;  2GWK A;  5AQU A;  2XRI A;  4CJ3 A;  2YHX A;  3FFK B;  4DTP A;  1L5U A;  3O1W A;  3KLG A;  4J2A A;  3TSQ A;  3TSP A;  1KCF A;  3HM8 A;  2YKM A;  3OYA A;  2OPS A;  4C23 A;  4CEO A;  3P39 A;  4ILG B;  5LL6 Z;  5HRS A;  3HP6 A;  1VRU A;  3GOI A;  5JVH L;  4ICL A;  4IO9 L;  3EY1 A;  3C7N A;  3MEG A;  3VEN A;  4CGF A;  1L3S A;  3BP8 A;  3T1A A;  3KK1 A;  2BE2 A;  3MN9 A;  3CI5 A;  3LZI A;  4H4O A;  3KKS A;  1BA1 A;  4BRO A;  1ESV A;  2CGL A;  4LF5 K;  3FZK A;  1B9F A;  2YNG A;  4JI4 K;  4CJQ A;  2UUB K;  1OVQ A;  4DV4 K;  3QNO A;  1YJ9 N;  4AM6 A;  3L2W A;  1S1T A;  4M45 A;  2YNH A;  3OYG A;  3V1O A;  1YJW N;  1LAW A;  4Z4I A;  3WQU A;  5C24 A;  3KLF A;  4X65 K;  1NGE A;  3TPQ A;  2FSK A;  3QML A;  3V9U A;  2NRH A;  3NF7 A;  3L4Q A;  4DS5 A;  3LDL A;  1NMD A;  1QHT A;  4JKC A;  3QLH A;  1NJY A;  4X62 K;  1EXQ A;  4LC9 B;  2A41 A;  2D0C A;  2P9P B;  3CQX A;  3L4I A;  1YXQ A;  3LWL A;  4DSJ A;  3L2R A;  5EXW A;  1IG8 A;  4JI7 K;  1Q9Y A;  1XC3 A;  5JS1 A;  2GWJ A;  1IH7 A;  4BRL A;  1RCH A;  4DU3 A;  3RMB A;  1CLQ A;  3A5O C;  4JLH A;  4E7I A;  4B3O A;  4EIA A;  3EN9 A;  3D2F A;  5C15 A;  4M3U A;  1VAZ A;  4O44 A;  1VSM A;  5LY3 A;  4DUZ K;  3TTD A;  2GUI A;  1LCU A;  1WSH A;  3TAP A;  4IOC L;  3G25 A;  4C1N I;  4H0P A;  2A5X A;  2KHO A;  1L3U A;  5EOY A;  3P1G A;  2CGJ A;  4Y0W A;  3L3V A;  3J81 O;  5CR4 A;  4CGD A;  1NMN A;  3ATV A;  3GG4 A;  3AGR A;  1WB9 A;  3S9H A;  2ZF5 O;  3BEX A;  4N56 A;  3NH1 A;  2JWK A;  5KRT A;  4KAZ A;  1QTM A;  3J7Z O;  2I5J A;  3O80 A;  3K5N A;  4CVN E;  5M1F A;  4AHC A;  4PKG A;  1HX1 A;  5BN9 A;  2VQF K;  2ZE2 A;  4E1N A;  4FLY A;  4R79 A;  4BR4 A;  4BRI A;  4CF2 A;  2Q31 A;  3D6R A;  2G8F A;  4YDU A;  4FLT A;  1C6V A;  3OBY A;  4OGC A;  1A5X A;  3L2V A;  3E9P A;  4IWV A;  2DY4 A;  4J2D A;  4PHT X;  3QEI A;  1T05 A;  3HO1 A;  1CZA N;  1KC8 O;  3T7Z A;  4BR2 A;  1BG3 A;  3AAR A;  4Z4E A;  1MDU B;  4B1W B;  4CJ4 A;  4L8R B;  1KAY A;  5DK5 A;  4AHR A;  4FW2 A;  4MDA A;  3VET A;  4WQ4 A;  5C2D A;  3SUQ A;  1T3V A;  2JLE A;  3HI0 A;  4ISE A;  3NDK A;  4Z4F A;  1F21 A;  3QDK A;  4ILJ A;  4F3O A;  4LFC K;  1ZBU A;  1L3T A;  4L3Q A;  3CF5 L;  2HW3 A;  3WXL A;  4PL8 A;  3OYC A;  4IEI A;  2YHA A;  2I7P A;  3ULE B;  1HYZ A;  2UUA K;  2PY5 A;  1RBV A;  2IVO A;  2OPP A;  5CZ1 A;  2HHW A;  2Q2R A;  3VF2 A;  1D4X A;  4PQU A;  1FJG K;  3R6M A;  5I9E B;  4CEA A;  2RPI A;  4FLZ A;  4BRQ A;  2FXU A;  1JLE A;  2DPN A;  4W5R A;  3VEW A;  4GKK K;  3HST B;  1W97 L;  3P31 A;  5ADX A;  2HND A;  3U3G A;  1BIS A;  2F8T A;  4B9V A;  3ZEU A;  1BI4 B;  3OJS A;  1KRP A;  4KHU A;  3QIN A;  3IS9 A;  1GLC G;  1TVR A;  3EE9 A;  3QEX A;  5I3U A;  4W5N A;  3S3M A;  2KFZ A;  5AQP A;  2ASM A;  5FLX O;  4E19 A;  4AF1 A;  1WSF A;  4FZY A;  1Y64 A;  4KTW A;  3TTC A;  5KRS A;  1RBR A;  4H0V B;  5AQG A;  1S9G A;  4KV8 A;  2YNF A;  1TK0 A;  1JKH A;  3CJ1 A;  3I8B A;  2P9L B;  3LM2 A;  3DWL A;  3O4Q A;  4X66 K;  4ZTJ A;  3DXM B;  1WBD A;  3ENH A;  4OX9 K;  1JLA A;  5AQV A;  3CCR N;  3V9W A;  1ZBH A;  2W41 A;  4CE9 A;  3BDP A;  3TAQ A;  1P8Z A;  5HBM A;  4JKD A;  5BRD A;  1DLO A;  2FSJ A;  1XMQ K;  5KQD A;  4RG8 A;  2E2N A;  1U2V A;  4DV2 K;  3L3U A;  4LF9 K;  3QES A;  4HUG A;  2FF6 A;  1GLE G;  3PO5 A;  2O8C B;  3THY B;  2HF3 A;  1YIJ N;  4BC2 A;  4CJE A;  4KB1 A;  3KD5 E;  4CJP A;  3QB0 A;  4DFK A;  3RSE A;  2IVP A;  1KVC A;  3NH2 A;  3NE6 A;  2X6S A;  1K6Y A;  4IFE A;  3CJB A;  1MU2 A;  4M7X A;  3O9T A;  1S72 N;  4IG0 A;  5J2P A;  1HNV A;  3OYJ A;  3SYZ A;  4CJS A;  2O4I A;  5DM7 L;  4JK9 A;  1VSI A;  3MX5 A;  3L2Q A;  4F3T A;  2DFH A;  3OY9 A;  1BA0 A;  3U9D A;  4CZL A;  4CHO A;  4E3S A;  1ZBF A;  4CZG A;  5J2Q A;  4KBO A;  4FWQ A;  3GE1 A;  2P5O A;  1HYV A;  1RDC A;  1EP4 A; 
#chains in the Genus database with same CATH homology
 2PFU A;  3AY9 A;  2V51 B;  3VOV A;  3W3D A;  4FWN A;  5ELZ A;  3CJ7 A;  1BUP A;  1XQS C;  2P9L A;  1U6Z A;  3O8M A;  4H5V A;  5AQO A;  3VMF B;  1YI2 N;  2F9W A;  4FPA A;  2CH5 A;  4IZ9 A;  2QWO A;  2Q0U A;  3DXM A;  5LJV A;  2E2P A;  3HOT A;  3CPW M;  1SZ2 A;  1WOQ A;  3A5M C;  1GLA G;  3K9K A;  3VEZ A;  4OPH A;  2P9S A;  4UY8 O;  3A5L C;  4BG8 A;  5AZI A;  4BR9 A;  3MMV A;  3D2E B;  4I6M B;  1ZXO A;  3U9Z A;  4B1X B;  1U2V B;  2GEM A;  3F5T A;  3TSU A;  4B1V A;  3CC4 N;  3LM9 A;  2YJF A;  1GLL O;  3SJH A;  4K25 A;  3BUZ B;  4KH5 A;  5C0Y A;  4U67 L;  4EAH D;  2WFB A;  2GTD A;  4F9O A;  4RWT A;  5AQK A;  1JJ2 M;  4YOV A;  3HSC A;  3N4P A;  4BC4 A;  5M1K A;  5BR9 A;  3CME N;  1J6Z A;  2A6A A;  3AGK A;  3FZF A;  3SMP A;  5BPN A;  1KQS M;  3SAG A;  4BRC A;  2H3G X;  3KK7 A;  4XH4 A;  1K8K B;  1BU6 O;  2HBJ A;  2NRZ A;  5AQS A;  5C10 A;  5MLC Q;  3TTF A;  1C0F A;  3R8E A;  2ZGZ A;  5KPT A;  4NO7 A;  4K43 A;  4YOR A;  3VF6 A;  4CZE A;  1NGC A;  4CI6 A;  4FWO A;  3MCP A;  3DXK B;  1P90 A;  2Q1N A;  3SBT A;  4GY2 B;  2ASP A;  4DHY A;  3WEE B;  3TU5 A;  4DKW A;  1EQY A;  3G6E N;  4FVU A;  4A2B A;  2E8A A;  2QI2 A;  5AQN A;  4BY9 C;  4CJ7 A;  4NB4 A;  4IJN A;  3FZM A;  4WFA L;  1YJN N;  3CJC A;  3ZET A;  3P4I A;  3S41 A;  3U4L A;  1KD1 O;  3SLC A;  3CC2 N;  3J8A A;  2QWN A;  2HOE A;  2V7Y A;  4CD3 A;  3CCM N;  3RVC A;  4DB3 A;  1HUX A;  4JKG B;  1X9J A;  5FPD A;  4WQ5 A;  3HZ6 A;  1VQO N;  4O5F A;  1HKG A;  3CQY A;  3L6Q A;  4BVP A;  5GAG P;  1DEJ A;  1RDU A;  5M1N A;  3O5B A;  3UB5 A;  2A42 A;  2NRW A;  4JHD B;  1NJI O;  3LDO A;  3MN6 A;  4FPB A;  4HTL A;  2OTL N;  5BRF A;  5JVG L;  2ZJQ L;  4A5B A;  5FPN A;  1M1K O;  3ZX2 A;  5BRH A;  3ZYY X;  5AZI B;  3H3N O;  3IFR A;  3LDP A;  4QS9 A;  4JN4 A;  3NVK A;  4BR5 A;  4CZI A;  2QW9 A;  2QWP A;  2WBN A;  1VQ5 N;  2P9U B;  1X3N A;  1BDG A;  4CD1 A;  3SAH A;  5AFU A;  2GEL A;  3N4Q A;  3C0B A;  4QS7 A;  3MCA B;  1Z6R A;  3OBW A;  1ATS A;  1NGJ A;  3ZX0 A;  2GUP A;  5KPZ A;  3CCL N;  2GX9 A;  3VF4 A;  1V4T A;  3O9Q A;  4H0Y B;  5HL7 L;  2Q0R A;  1KAZ A;  2ZJR L;  3NVM A;  3EZW A;  5CE3 A;  2YHW A;  5KQ8 A;  2P9N A;  5HOO A;  4CZH A;  2HMP A;  1RGI A;  1BO5 O;  1YAG A;  2Q36 A;  4FO0 A;  2E2O A;  2YX6 A;  5KPR A;  4QS8 A;  2RE2 A;  1YVN A;  2FLO A;  2E2Q A;  3KWI A;  4DCH A;  4U7B A;  3WEE A;  4MLE A;  3VEV A;  4BQL A;  4MDB A;  3VTI A;  4A5A A;  3EO3 A;  4ILH A;  3SK3 A;  3M3Z A;  4NLC A;  5AQW A;  5BN8 A;  5AQX A;  3D7E O;  2NRT A;  3LL3 A;  5BRE A;  3CC7 N;  3FZL A;  2GWK A;  3ZET B;  4BRD A;  1ILY A;  3OA9 A;  1QVF M;  5AQU A;  4BC5 A;  1E4F T;  1TYQ A;  4A2A A;  4H5R A;  5AR0 A;  3VEX A;  2YHX A;  3FFK B;  1QHA A;  3H1Q A;  3KHY A;  3O1W A;  2QWM A;  2A40 A;  1Q7Y O;  1BWF O;  3TSQ A;  3VEO A;  2VWB A;  4BRA A;  4WF9 L;  3TSP A;  1T44 A;  2FSN A;  2NNW A;  4FWR A;  3HM8 A;  4OPA A;  2A3Z A;  4C23 A;  1K73 O;  3HRG A;  4JHD A;  4B1U B;  2AP1 A;  3LDQ A;  3A8Y A;  3P39 A;  4ISG A;  5C2F A;  4ILG B;  5AQJ A;  3NMU A;  4BGA A;  4C1N K;  2W40 A;  1M90 O;  5E26 A;  4CBX A;  3CER A;  1W2B M;  1VQN N;  1BOT O;  3GOI A;  5JVH L;  1KXP A;  3KVG A;  4IO9 L;  1V4S A;  4YDU C;  1KAX A;  3C7N A;  3H6E A;  4A57 A;  4JAX A;  2P9U A;  3VEN A;  3BP8 A;  3E9O A;  1IJJ A;  3MN9 A;  4IOA L;  3VEY A;  3CI5 A;  2QWR A;  1VQM N;  5TKW A;  1BA1 A;  4BRO A;  1ESV A;  2YI1 A;  3QBW A;  2CGL A;  3FZK A;  4CZM A;  2QTD A;  3JS6 A;  1Q81 O;  2P9I B;  2IIR A;  3HBT A;  3C6A A;  5CHI A;  3L0Q A;  5M1P A;  1YJ9 N;  2EWS A;  4AM6 A;  1QQO A;  1NM1 A;  4IDH A;  3Q7C A;  4H03 B;  4JKA A;  3HOS A;  4WQ4 C;  2P9N B;  1OKJ A;  2WUS A;  1YJW N;  3M1F A;  1OVY A;  2UYT A;  3WQU A;  2J4R A;  5ADX H;  3ENO A;  5EX5 A;  5GIN A;  3UKU A;  3VGM A;  1NGE A;  5FPE A;  2PAV A;  2ITM A;  3TPQ A;  4B1Y B;  5C12 A;  5AZJ B;  5GIO A;  3CJ9 A;  2FSK A;  3QML A;  1YHQ N;  2NRH A;  4BR7 A;  4IOX A;  4AM7 A;  3AAQ A;  3O9U A;  4GNI A;  4H5W A;  1TUU A;  4BRN A;  4GV6 A;  3GBT A;  1GLF O;  3L4Q A;  4YOT A;  4E1J A;  3CCQ N;  2HBK A;  3LDL A;  3CJA A;  1G99 A;  1TYQ B;  1NMD A;  3VGK A;  3F2K A;  4KH6 A;  1ZC6 A;  2IVN A;  3WXJ A;  4JKC A;  4IXC A;  5TKY A;  3WXI A;  2VYP A;  2ZWH A;  1YF5 L;  4LC9 B;  2I7N A;  4IJA A;  4FWM A;  2A41 A;  3O4W A;  3R3L A;  3O1B A;  2P9P B;  3CQX A;  4BGB A;  4FWK A;  3L4I A;  1YXQ A;  3T69 A;  3MK6 A;  1VQL N;  5EXW A;  1N8R O;  1VQ9 N;  1IG8 A;  3IDH A;  1T6C A;  3O9R A;  3SBG A;  2P9K B;  4FSV A;  1XC3 A;  5FPM A;  1MWM A;  2GWJ A;  5EY4 A;  2HBM A;  4BRL A;  3CCV N;  4O8U A;  1ATN A;  3C7N B;  3CD6 N;  3QFP A;  3A5O C;  4HWI A;  4GVE A;  5GAH P;  4EIA A;  3QFU A;  3EN9 A;  3D2F A;  4IO8 A;  4J8F A;  1JCF A;  2QWQ A;  3MN7 A;  4BRF A;  1VAZ A;  5C15 A;  4ISF A;  1E4G T;  4BC3 A;  3TTD A;  1ZBS A;  5AQF A;  5LY3 A;  3ENB A;  3VES A;  1LCU A;  1QQN A;  3KWG A;  3K9J A;  3H1V X;  1H1V A;  1XUP O;  3HTV A;  4IOC L;  3G25 A;  4C1N I;  4H0P A;  1QVG M;  1Q86 O;  2A5X A;  2KHO A;  2YCH A;  3CPE A;  2P9I A;  1NBW A;  5EOY A;  3MN5 A;  5F0X A;  2CGJ A;  3SMS A;  1QZ5 A;  3EL2 A;  2RHK A;  4Y0W A;  3MWT A;  4WCE L;  4GV3 A;  3WXK A;  5CR4 A;  1DGK N;  3DLL L;  4KH4 A;  4K42 A;  3I56 N;  1SAZ A;  2NRV A;  2PBD A;  3H46 O;  3H45 C;  3ATV A;  3GG4 A;  1K9M O;  1EO1 A;  3AGR A;  3UKU B;  3BF3 A;  4JKH A;  5GAE P;  5DM6 L;  5AZJ A;  2ZF5 O;  3BEX A;  3ID8 A;  2JWK A;  3EKS A;  3I33 A;  4XH5 A;  1VQK N;  5JLH A;  3J7Z O;  3FE1 A;  3O80 A;  2HF4 A;  3VTH A;  5M1F A;  2E20 A;  4PKG A;  1HX1 A;  5BN9 A;  4Z94 A;  3PIO L;  2KLA A;  4M63 C;  1TUY A;  4R79 A;  3WT0 A;  4PKH A;  3GL1 A;  2D0P A;  4BR4 A;  4BRI A;  1K8A O;  2F9T A;  5JLF A;  2Q31 A;  2QXL A;  4H0T B;  1SQK A;  3D6R A;  4YDU A;  3CMA N;  3OBY A;  2D0O A;  1WUA A;  1NGD A;  2P9P A;  1JCE A;  5M1O A;  5M1Q A;  1Q18 A;  2NZT A;  3ID6 A;  3E9P A;  4IWV A;  4EHU A;  4PHT X;  4G9Z A;  2P9K A;  3O08 A;  4YOX A;  1CZA N;  3CIP A;  4NLB A;  2YJE A;  1KC8 O;  3CCE N;  3T7Z A;  4BR2 A;  4GV9 A;  2HBL A;  4BR0 A;  1BG3 A;  1HKC A;  2NRX A;  3AAR A;  4JD2 A;  2BTF A;  1MDU B;  4MLH A;  5AQR A;  3KZB A;  4B1W B;  3I55 N;  4BQZ A;  3H3O B;  1KAY A;  4M7Y A;  4MDA A;  4WFB L;  3A5N C;  3VET A;  3E9L A;  3JXU A;  4FOE A;  4WQ4 A;  3D2F B;  5AQT A;  5C2D A;  1Q82 O;  5LJW A;  2BH1 A;  3WQT A;  1T3V A;  1VQ8 N;  1MWK A;  2Q97 A;  3W0L A;  3CCU N;  3HI0 A;  3PLA A;  3F9M A;  4ISE A;  1JCG A;  1C0G A;  1T6D A;  4B1Z A;  3LDN A;  4CBW A;  3QDK A;  4ILJ A;  4YOU A;  1LOT B;  3A0I X;  2YHY A;  3QIC A;  4L3Q A;  3WXM B;  3VER A;  3CF5 L;  5AQQ A;  3WUH A;  3DJC A;  3CXC M;  3C65 A;  4JEP A;  3WXL A;  4PL8 A;  1YIT N;  4IEI A;  3C6H A;  3QBX A;  1QZ6 A;  3ZX3 A;  1DKG D;  2I7P A;  3ULE B;  4JKB A;  4H5N A;  5JMV A;  2IVO A;  3ATU A;  2QA4 N;  5AQM A;  4WFN L;  2F7T A;  3CCJ N;  3UE5 A;  5BPL A;  3FZH A;  2Q2R A;  1S22 A;  3UKR A;  4CZK A;  3VF2 A;  1D4X A;  2VGM A;  1VQP N;  3R6M A;  3DAW A;  4FWL A;  4H5T A;  5I9E B;  3EKU A;  4BRQ A;  3GDQ A;  1DT9 A;  1YUW A;  2FXU A;  1VQ4 N;  2QEX N;  3RSE B;  2NRR A;  3B8A X;  4BRH A;  3MWP A;  3P38 A;  4H0X B;  2DPN A;  5F1X A;  3VEW A;  5GAD P;  1W97 L;  3P31 A;  3Q7B A;  5ADX A;  2FF3 B;  4K41 A;  1HJO A;  2D4W A;  3OW2 M;  3ZEU A;  4A62 A;  3EE8 A;  4CBU A;  2OTJ N;  4H0O A;  2QWL A;  1NLV A;  1VQ6 N;  1GLC G;  4JK7 A;  1NGG A;  2VCP A;  2V7Z A;  3EE9 A;  2WC9 A;  3R1X A;  3R9P A;  1NGB A;  5AQP A;  1HLU A;  1O13 A;  4WYB A;  2ASM A;  4IEE A;  1R59 O;  1NGI A;  4AF1 A;  2D1K A;  3OHR A;  1Y64 A;  4JD2 B;  3TTC A;  4DQ8 A;  3MX2 A;  4H0V B;  4EFH A;  5AQG A;  3CCS N;  4FWP A;  1GLD G;  2E1Z A;  4JKF A;  4JK8 A;  4PKI A;  4BRM A;  3IKM A;  1NGA A;  4PL7 A;  1RDW X;  3CJ1 A;  3I8B A;  3G4S N;  2P9L B;  2E1Y A;  3LM2 A;  5B8H A;  3FGU A;  3DWL A;  5AFU H;  4B9Q A;  4BRE A;  3DXM B;  3M6G A;  3ENH A;  1HPM A;  4BVO A;  5AQV A;  4YOW A;  1RFQ A;  3CCR N;  2W41 A;  3VGL A;  3O9S A;  2ASO A;  3FR0 A;  1P8Z A;  2P9S B;  2VGN A;  2KKZ A;  4FL9 A;  4JKD A;  4WQ5 C;  5AQL A;  4A61 A;  5H1S Q;  1MA9 B;  4CZF A;  5BRD A;  2E88 A;  3BF1 A;  3D2E A;  2ZGY A;  2FSJ A;  4I6M A;  4MO4 A;  5E84 A;  5KQD A;  2AA4 A;  1HKB A;  2E2N A;  1U2V A;  5BPM A;  4FOI A;  3ULE A;  3PIP L;  4OO1 J;  3U8X A;  1NWK A;  4FWS A;  2FF6 A;  4JKE A;  1GLE G;  3UKR B;  1QQM A;  3CET A;  2HF3 A;  5GIP A;  1YIJ N;  4RTF D;  1ATR A;  4JNE A;  4BC2 A;  1NGH A;  4XEI A;  2OAN A;  4MO5 A;  1VQ7 N;  3E1Y A;  3QB0 A;  3RSE A;  5EVZ A;  1X3M A;  2CH6 A;  2IVP A;  2V52 B;  1K8K A;  4BRG A;  3IMX A;  3MDQ A;  3O6W A;  4IFE A;  3FLC O;  3CJB A;  4M7X A;  5AQI A;  5JIC A;  3SAF A;  3O9T A;  1S72 N;  2ZJP L;  3CHW A;  3ZEU B;  4O8K A;  4BG9 A;  4YOY A;  3DXK A;  1Z05 A;  3AAP A;  3G71 N;  5DM7 L;  4JK9 A;  4BRK A;  2JWL A;  3MX5 A;  2BUP A;  4RCH A;  5AQH A;  3M5R A;  1BA0 A;  4A59 A;  3U9D A;  4CZL A;  1GLJ O;  1SS6 A;  1S3X A;  2NLX A;  3IUC A;  5AQY A;  3VPZ A;  4KBO A;  2HST A;  2QM1 A;  5AQZ A;  4CZG A;  4BRP A;  4CZJ A;  4FWQ A;  4EHT A;  3GE1 A;  4XH1 A;  3E66 A;  1GLB G;  5F2R A;  2CGK A;  1NGF A;  4JKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...