3AAPA

Crystal structure of lp1ntpdase from legionella pneumophila
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
353
structure length
353
Chain Sequence
KHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
total genus 105
structure length 353
sequence length 353
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aapA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aapA02
3O1BA 1NGIA 2CH5A 4BC3A 1WUAA 5EX5A 3EKSA 3A8YA 5BPNA 3CJCA 3FFKB 3FZHA 3MK6A 5EOYA 1S3XA 3U4LA 4BVPA 4BR7A 1LOTB 1U6ZA 2F9TA 4FWQA 3G25A 5AQMA 1K8KA 5FPMA 3U9ZA 5BR9A 3VEYA 4JD2B 4CD3A 5JLFA 4IJNA 2GEMA 4FPAA 2W40A 3ZETB 3BF1A 4BRPA 2P9NA 1G99A 4IZ9A 4EHUA 3EN9A 2PAVA 5AQYA 3D2FA 4BRIA 2IVOA 3ZEUA 3EL2A 5EVZA 2P9UB 2H3GX 3MN6A 4MO4A 4JN4A 1V4SA 2P9KA 1QZ5A 5AQRA 1IJJA 2YJEA 4K43A 2P9NB 4CZJA 4QS8A 1E4GT 3CJ1A 1OKJA 2OANA 3VGLA 4DQ8A 3HM8A 4EAHD 4H0OA 1KXPA 3I8BA 2PBDA 3CHWA 3FGUA 3VESA 3WEEA 2V7ZA 3CJ7A 2P9KB 1TUUA 4H5NA 4PKGA 4CD1A 3M1FA 4H0YB 4K41A 4LC9B 1NM1A 4FWSA 3H3OB 4BREA 3DXMB 3O5BA 2KHOA 3UKRA 2UYTA 2ZF5O 3VOVA 5EXWA 1CZAN 4BRGA 4C23A 4B1ZA 3VEZA 4FWPA 3VF2A 1NGHA 1YUWA 4BRNA 1BG3A 2FSNA 1QQOA 2QWOA 1E4FT 4J8FA 1BU6O 4PKHA 4H5RA 4WQ5A 4BRKA 4CBXA 3IMXA 1JCEA 3CI5A 3ENHA 5AFUA 3J8AA 3WT0A 3FE1A 4YDUC 2GWKA 3WUHA 3DAWA 1NGBA 4BC2A 3BP8A 1IG8A 3HZ6A 2I7NA 3H6EA 2A5XA 2YI1A 5FPEA 3VEVA 3A5LC 5F2RA 4IWVA 1NLVA 2P9UA 1HLUA 4H5WA 4EIAA 5CE3A 3WQTA 1HKGA 3UKUA 3GE1A 5FPDA 1BUPA 1HX1A 1HJOA 3QDKA 2P9PA 1HKCA 1XUPO 5FPNA 2IIRA 3UE5A 4FSVA 3W0LA 4FWNA 1K8KB 3GBTA 3CERA 4CZKA 5ADXH 2QW9A 3GG4A 5AFUH 3EO3A 3DWLA 4BRQA 1ATNA 1MA9B 3TU5A 4RWTA 3A0IX 3H45C 3O80A 4F9OA 2VYPA 3M6GA 4FOIA 3W3DA 2QWMA 2E1YA 5KPRA 5AQHA 3S41A 1Y64A 1MDUB 1GLBG 1QQMA 1X3MA 5AQNA 4JAXA 3VGKA 1H1VA 5JMVA 1NGFA 4HTLA 2P9SB 4CZEA 3ZX3A 4B1WB 3IUCA 2E20A 3LDNA 3B8AX 5F0XA 4BR0A 2ASPA 1U2VB 5LJVA 3SLCA 2YHYA 2GTDA 1NGCA 3TPQA 3ULEA 3DXMA 1GLAG 2VWBA 3GDQA 4IO8A 5BN9A 2ASMA 1LCUA 4BRFA 4GNIA 2QXLA 3FR0A 3HSCA 4FOEA 4B1YB 3BEXA 4WQ5C 3LDQA 4EFHA 1U2VA 4ISEA 1R59O 3QBWA 4FL9A 5BN8A 2J4RA 3DXKB 2CH6A 5AZJB 2Q31A 5E84A 3VEOA 1ZXOA 4BR5A 2Q97A 1ATRA 2Q0RA 2GELA 1ZBSA 2ITMA 4E1JA 2BUPA 3GL1A 1WOQA 4FWOA 4BRAA 2IVNA 5KPZA 4BC5A 3AARA 4PL8A 2E2OA 2CGJA 2YJFA 2A3ZA 3VPZA 1NGDA 4QS9A 2HF3A 1XC3A 5AQFA 5LY3A 5AQZA 1P8ZA 5AQKA 1BOTO 3UKUB 1GLEG 4BRHA 2YHWA 3U8XA 3VF4A 3ID8A 2D1KA 1SZ2A 3D2EA 4ISFA 5B8HA 3QFUA 3WXIA 5AZJA 4B1XB 3LM9A 4M7XA 4FO0A 1Q18A 3QBXA 2FF6A 1QHAA 2ASOA 4BG8A 3WXJA 1MWKA 4JD2A 5AQVA 3RSEA 1BA0A 4RTFD 2E2NA 3D2EB 2A42A 4H5TA 3UB5A 2HOEA 1Z05A 3H1VX 2AP1A 4CBUA 3VEXA 4BVOA 1J6ZA 3WXKA 3D2FB 2CGKA 3ZEUB 1JCGA 2V52B 3MCPA 3O1WA 4WYBA 4K25A 3RSEB 2D0PA 2E2PA 3O08A 3FZFA 2QWPA 3C0BA 3L0QA 5KQDA 4DHYA 4BQZA 5AZIA 4CZGA 3AAQA 2A6AA 2FSKA 5F1XA 4CZMA 2D0OA 5AQJA 2Q2RA 4BRMA 2E2QA 2IVPA 4I6MB 2AA4A 3A5OC 4H0TB 5TKYA 3MDQA 2FF3B 2F9WA 5AZIB 4KBOA 4A61A 4FWRA 3KZBA 4GY2B 4FWKA 4CZLA 1DKGD 3LDOA 4BRCA 3OHRA 5EY4A 3HTVA 2HMPA 2ZGZA 5BREA 2FSJA 2CGLA 4XEIA 5BRHA 3VENA 4H0PA 3JS6A 3O8MA 4ISGA 1JCFA 3CJBA 1GLLO 4M7YA 1D4XA 3IFRA 5BPMA 4JNEA 1DGKN 5ADXA 1BA1A 4CZHA 5KPTA 3O4WA 2P9LB 1MWMA 3H1QA 3F9MA 3ZX0A 5AQSA 3R8EA 1RGIA 2QM1A 4WQ4A 4H5VA 4DB3A 4Z94A 3ZX2A 2QWQA 4MO5A 3I33A 4XH5A 2NRHA 4BGBA 4JHDB 2NLXA 3MN5A 3ZETA 3CJ9A 4BR2A 1BWFO 5AQQA 3R9PA 3WXLA 3GOIA 2NZTA 2V7YA 1KAZA 5AQGA 1NGJA 1HPMA 3QFPA 3BUZB 3UKRB 3SJHA 5ELZA 3CQXA 1TUYA 3ATVA 2DPNA 1Z6RA 3H3NO 2GWJA 3AY9A 3FZMA 5AQOA 3QMLA 4HWIA 1NGEA 1QQNA 5JLHA 1QZ6A 4I6MA 4M63C 3HBTA 4DCHA 2ZWHA 1KAXA 1YVNA 1NMDA 4IJAA 2ZGYA 5BRFA 3SK3A 2HF4A 4BC4A 1EQYA 3U9DA 4MLEA 4A2BA 1NGGA 1HUXA 4CJ7A 4BG9A 5AQXA 3CQYA 4CZFA 1YXQA 3A5MC 2QWNA 3H46O 1BDGA 5BPLA 3VF6A 4L3QA 1ZC6A 2W41A 4AM7A 3ENOA 3LM2A 4IXCA 2EWSA 1GLCG 2P9PB 1YAGA 2P9IA 2Q36A 3A5NC 3DXKA 1GLFO 3SMSA 3C7NA 4QS7A 4BROA 1C0FA 4BR4A 2E88A 1SAZA 3KHYA 1X3NA 4Y0WA 4MLHA 1RFQA 5I9EB 1GLJO 4BRDA 2I7PA 1T6CA 1NWKA 1RDWX 3MMVA 5AR0A 4PKIA 2WUSA 3WEEB 3VERA 3FZLA 4BQLA 1NGAA 4CBWA 2BTFA 5JICA 1TYQB 4B9QA 3L6QA 1ATSA 1KAYA 3DJCA 4PL7A 1V4TA 2P9SA 3D7EO 1BO5O 3M3ZA 3SMPA 2YHXA 2A41A 5AQUA 4BR9A 4BRLA 2GUPA 4WQ4C 1SQKA 2YCHA 3KVGA 4FWMA 3R6MA 4H0VB 2QWLA 2QWRA 1HKBA 1XQSC 4CI6A 1TYQA 4CZIA 4O5FA 3O6WA 4H0XB 3FLCO 5AQPA 3VETA 5BRDA 3WQUA 3MN9A 4YDUA 2FLOA 4JHDA 4A2AA 2FXUA 4EHTA 3EZWA 4NB4A 4A62A 4XH1A 1S22A 4B1VA 1GLDG 3MN7A 1T6DA 3LDPA 4BGAA 2V51B 3BF3A 3FZKA 3IDHA 4O8KA 2E1ZA 1ESVA 2VCPA 2Q0UA 1DEJA 3C7NB 3HI0A 4FWLA 1T44A 3EKUA 2P9IB 3P4IA 1X9JA 3ATUA 4NO7A 4AM6A 3VGMA 4K42A 3CIPA 2D4WA 3LDLA 4H03B 4FPBA 5AQLA 5AQWA 4B1UB 3VEWA 2Q1NA 2A40A 3AAPA 3ULEB 5AQTA 3LL3A 3QB0A 3L4IA 2E8AA 3QICA 4XH4A 5AQIA 1C0GA 5KQ8A 5LJWA 5E26A 2P9LA 3CJAA 3JXUA 4RCHA 3CETA 1NBWA
chains in the Genus database with same CATH superfamily
3N4QA 1UWBA 1YJNN 5EOYA 3OYCA 1KSPA 4QAGA 3KLHA 1LOTB 3ZSVA 4FWQA 3SBGA 1K8KA 3U9ZA 1NK4A 4CK2A 5JLFA 1ASWA 3E01A 4JKGB 1KFDA 2IGIA 2P9NA 1XNQK 1W97L 3RMDA 4JS5A 4CIFA 2HBJA 3DM2A 3D2FA 1NJXA 3PSIA 3AVJA 1JL1A 4JN4A 3V4IA 2P9KA 1QZ5A 4DQIA 2P9NB 4CHPA 2OPRA 3OS1A 2OANA 3NBPA 3HM8A 2W6KA 4EAHD 5C42A 3I56N 4CHZA 3S9HA 1KCFA 3I8BA 4CFDA 3DMJA 3HPGA 5C15A 1IV0A 2P9KB 4H5NA 4PKGA 2UXBK 4LC9B 3L2RA 3SQ0A 2PY5A 4KHQA 3HO1A 1W0HA 3H3OB 3DXMB 4FJ8A 2KHOA 2O8BB 2YKMA 2QKBA 4BDZA 4CESA 4W5TA 3OYDA 4DTSA 4IEIA 3VEZA 4CIEA 5M1FA 3MECA 5KGXA 1S72N 3I8DA 3PLAA 2VG7A 4H5RA 2WBNA 1Z25A 4CBXA 1JCEA 1JXEA 5AFUA 3FE1A 4YDUC 4CJKA 2GWKA 3DAWA 3UIQA 3MXJA 2G8IA 2OA8A 3BP8A 3HZ6A 4DQPA 2KQ2A 5FPEA 3VEVA 3O9TA 3TSPA 1F21A 4CEEA 4JI4K 2P9UA 4H5WA 4ICLA 4DTXA 4KFBA 3KKSA 2AJQA 5GIOA 1HJOA 3TAFA 1K9MO 1UA0A 2D5RA 1HKCA 1KFSA 2IIRA 3QETA 1JLCA 4JI1K 2VG6A 3SQ2A 3AGRA 3KTQA 4DFJA 3EO3A 4FJXA 1SUQA 4YOYA 1S1UA 4RWTA 4HUGA 2JLEA 4V19S 4DQSA 4JK7A 1QS4A 5AQHA 1RDCA 5JS2A 3K59A 4FJNA 1NG9A 3H08A 3HSTB 1RILA 3IRXA 3VGKA 1A5WA 1TK5A 4HTLA 4B9VA 3CQ8A 2P9SB 4DV6K 3ZX3A 3PO4A 2ETJA 1KVCA 2E20A 3LDNA 4CJLA 1BQNA 4KI4A 5F0XA 4LSNA 3VQBA 3IKMA 1VSHA 1U2VB 3NCIA 2KTQA 4JKEA 1VQ9N 1RTJA 2X6NA 1GOBA 3OJSA 3HPHA 1EO1A 1NGCA 4CJ3A 3DYAA 4CK3A 5BN9A 2ASMA 1LCUA 2PFUA 4O44A 4BRFA 3TAMA 1IBLK 1OVQA 4EFHA 1NK9A 2B4JA 2OZSA 2YX6A 5M1PA 4ISEA 4H4MA 1DTQA 3K5LA 3LZJA 1Q82O 1FJGK 4CEAA 5JVHL 4JLHA 2QK9A 2Q0RA 2GELA 1ZBSA 3AV9A 4CIGA 2BUPA 3GL1A 4E1JA 3SAHA 4PY5A 4FJ9A 4FWOA 2O8FB 2IVNA 1NK8A 1EWRA 4OPHA 3RR7A 4JI8K 3T69A 2E2OA 3VQQA 2CGJA 3QO9A 1OH6A 3K9KA 5LY3A 5AQZA 5AQKA 1RT1A 1YITN 3ENBA 1L3TA 3DLGA 1X9MA 3U8XA 2RHKA 3VF4A 3ID8A 3J7AP 1SKSA 3P38A 3D2EA 1XNRK 3WXIA 4CGGA 5AZJA 4B1XB 2X78A 3LM9A 4G1QA 4FO0A 4M7XA 3VA0A 2HHXA 4WCEL 3ZSQA 4JI2K 4BG8A 2HHUA 4O0JA 1NK5A 5AQVA 4RTFD 3LPTA 2FC0A 1CXQA 3RMAA 3D2EB 4BE2A 5M1KA 3TAQA 3SQ1A 4BVOA 3K57A 4Y1CA 3WXKA 3SAGA 2QKKA 1VAZA 4CGIA 1DLOA 1KLNA 3QNNA 4Z4GA 2E2PA 3O08A 3OYLA 5KQDA 4MDAA 4DSEA 1S9GA 4BQZA 2A6AA 2FSKA 1NKEA 2RE2A 5F1XA 4CZMA 3HP6A 2Q2RA 5FRNA 4YOWA 4BRMA 2E2QA 3L2QA 4JI6K 1OH5A 3V81A 3IG1A 3ZT1A 4E7LA 3P83D 2RKIA 4Z4HA 4J2AA 4A61A 4FWRA 1S6PA 4FWKA 2NRWA 3C6HA 1LV5A 3SYZA 3E66A 4BRCA 1JL2A 1C0TA 2HMPA 3F2KA 2W42A 2FSJA 2CGLA 4H0PA 4DV2K 4CJ5A 3ZYYX 4ISGA 1HNVA 3JSMA 1WSIA 3D45A 3VQEA 1DGKN 4JKAA 4CVNE 3O4WA 1YIJN 1LWCA 2P9LB 4LD0A 1I39A 3HXMA 5AQSA 3OYBA 3THYA 4WQ4A 4DB3A 1C1CA 2QWQA 1VHXA 4N76A 3BY5A 4CF8A 1CZBA 4YOUA 3ZSRA 5IWAK 4XH5A 5H1SQ 1VSIA 1ZBFA 1MU2A 1NMNA 2NLXA 4JKGA 1BWFO 1RT3A 5AQQA 3R9PA 3LP1A 1KAZA 3KJVA 5I42A 3I55N 1ASUA 3AVNA 4DV5K 3WNHA 3H3NO 1QSLA 4HWIA 3KLEA 3LP0A 4KB0A 1BI4A 1TV6A 5GIPA 4Z4CA 2JWKA 2E4LA 4DCHA 2Q3SA 5AJ3K 3L3UA 1BIZA 4F4KA 5CY4A 4FXDA 3SK3A 2HF4A 4BC4A 3VQDA 1LWEA 4CHYA 4CZFA 3A5MC 4E0DA 3DOKA 4DLEA 3TTCA 1T7PA 2XO7A 3NF9A 4L3QA 5HRPA 2W41A 4GV6A 4CEQA 2EWSA 2Q36A 3RMCA 1YAGA 4K0KK 1VQ4N 1GLFO 3SMSA 3KD1E 1C0FA 1VQ8N 2BDPA 3P1GA 1HNXK 3OBWA 4B3MK 4NYNA 1TKDA 1NK0A 2ZJQL 1VQKN 3S3NA 4B9MA 1GLJO 4ILJA 4PKIA 4FK4A 3U3GA 1N34K 3KLIA 3K58A 2OYQA 1T03A 1KD1O 3CCQN 1V4TA 1BO5O 4RG8A 4IFVA 2O8CB 4AF1A 4JYAK 1CZ9A 2GUPA 1VQON 3R6MA 1O1WA 3OYEA 1REVA 3VQPA 3AA5X 4KREA 3BZCA 1QE1A 3WQUA 3MN9A 3HVTA 5GAGP 4YDUA 4JHDA 4CERA 5KRTA 2FXUA 5LMUK 3LWMA 1X9WA 4XH1A 4NXMK 3QEVA 3MCAB 1GLDG 3MN7A 1T6DA 4CJVA 5K14A 3ZSWA 5HL7L 1Q86O 4J2EA 3M5RA 4FJJA 3KD5E 3C7NB 3F5TA 4YNQA 3EKUA 3CCRN 3KK2A 1X9JA 3OBYA 1VSEA 2D4WA 5AQWA 4QOZB 5CZ2A 2Q1NA 4KKOA 4E1MA 1A5VA 3AAPA 5AQTA 3QB0A 2E8AA 3QICA 3VQCA 3IAYA 5E26A 2P9LA 4RCHA 3CETA 1NGIA 4I9QA 5BPNA 4CJEA 3FFKB 1YI2N 3ID6A 1S3XA 2HNZA 3SPYA 3R1XA 4BR7A 2F9TA 3G25A 5FPMA 3QIOA 3LP2A 3NE6A 3VEYA 4JD2B 1A5XA 4IJNA 3MEGA 2GEMA 4FPAA 2W40A 3AO5A 3BF1A 4NXNK 4OPAA 3VQ9A 5GAHP 4HHTA 2D0BA 4I7FA 4CK1A 2OPSA 3EE8A 3EL2A 2NUBA 4RW4A 4M3TA 2HB5A 3MXMA 4DTRA 2UXCK 1IJJA 3SAFA 2JWLA 4C8MA 3CJ1A 2XY7A 1OKJA 2NRTA 4FVUA 1HJRA 4ELUA 4DSLA 3CHWA 3TARA 1L3UA 1EX4A 3AVKA 4DS5A 4M3XA 4N41A 1J5OA 1BQMA 3M1FA 4K41A 1NM1A 2O4GA 1UA1A 4FWSA 4KTZA 3O5BA 1Q81O 3CC7N 2NRVA 2KLAA 2NRRA 1BG3A 3LPUA 2JGUA 4LFAK 4IFEA 4OKKA 2QWOA 2D0CA 1BU6O 3CFRA 3DI6A 4BRKA 4DTJA 1BIUA 4R5PA 4E3SA 3J8AA 3WT0A 4B9NA 3L2UA 3WUHA 1XC9A 4CFBA 2HHQA 3T7ZA 4CECA 3OYIA 4E7KA 4KH5A 4DSFA 1HLUA 4RW9A 5FDLA 4EIAA 3SQ4A 1D8YA 2E6MA 3WQTA 1YTUA 5JVGL 1HKGA 3V1RA 3NVMA 1TAQA 1OH8A 3KLGA 1SS6A 5FPDA 1BUPA 1HX1A 2DY4A 3QDKA 1XUPO 1YF5L 4KHWA 4FSVA 4DU1A 3GBTA 4CZKA 4DU4A 5AFUH 4W5OA 1RBTA 3QIPA 4OGEA 1XMOK 2VGNA 4FLYA 3DWLA 4LH5A 1MA9B 1HYVA 4F9OA 2VYPA 3M6GA 1S1TA 3THXB 1HNWK 3BDPA 1U04A 1S1XA 4DTNA 2YV0X 4CEDA 3ASMA 1MDUB 1GLBG 3AA2A 5DMRA 2OPPA 2KZMA 4YFUA 3L2WA 4O8UA 3DLLL 5JMVA 4CZEA 4B1WB 4DV7K 2A1SA 3NGIA 4LFBK 3F9KA 2F8SA 3HOSA 4IO9L 3OYKA 3Q7CA 2Y1JA 4KTQA 3AVMA 1HPZA 1S5JA 3T1YK 2RF2A 3DXMA 1GLAG 3G6EN 3GDQA 2ZQBA 4A57A 3F73A 2X74A 3CMEN 3MWTA 3HSCA 1Q8IA 1WLJA 4OX9K 3BZKA 5BN8A 1R59O 3QBWA 2CH6A 5AZJB 4C8OA 1ZXOA 4GV3A 2Q97A 1ILYA 1J53A 2ITMA 1RDBA 4OPKA 1BGXT 1QSSA 3TWHA 3CC4N 3U3YA 4M3UA 2FBXA 4EZ6A 3AARA 4E1NA 1VSFA 5C0YA 3IS9A 2A3ZA 3VPZA 4G9ZA 2HF3A 1XC3A 5AQFA 1BOTO 3UKUB 4BWMA 2BGGA 1ZBUA 3LAKA 4B3SK 2D1KA 2Z1IA 3AVFA 3BGRA 5B8HA 3MXIA 3QFUA 4FYDA 3O9SA 2F4VK 1UOCA 3CCMN 3QBXA 1QHAA 4GVMA 1VQPN 3ZSZA 4C1NI 3WXJA 1MWKA 4DR5K 1BA0A 5EU7A 1NKCA 2FBTA 4CFAA 2E2NA 4HVJA 3QEWA 2W6LA 4CW7B 1WAFA 4H5TA 3UB5A 2VWJA 2AP1A 2HMIA 4CBUA 4IBNA 1RT2A 1WB9A 1J6ZA 4A59A 1LW2A 3ZEUB 2D0AA 3O1WA 2V52B 4OPJA 3KK1A 5CZ1A 4CGDA 3DRRA 3HP9A 4WF9L 4WYBA 3RR8A 4O4GA 1XWLA 2HVIA 3J80O 3FZFA 1OH7A 1WNSA 3L0QA 4DHYA 2BH1A 5AZIA 4CZGA 5LMNK 3T1HK 2UUCK 1EETA 3EE9A 3RMBA 5HRNA 3A5OC 4AHUA 2FF3B 4IEEA 4JKHA 4AHRA 5I3UA 2F9WA 3I0RA 5AZIB 4KBOA 3NF6A 4AHTA 4DR1K 4HCBA 3D6RA 4YOXA 1DKGD 3LDOA 4JI7K 3OHRA 5EY4A 2YNHA 2HBMA 1BL3A 4NLBA 3OYNA 2ZGZA 5BREA 3VENA 4YOVA 4ELVA 4XIUA 2RN2A 1K73O 1IBKK 2YKNA 5BPMA 3TSUA 4FLZA 3E9LA 4CZHA 5KPTA 2PYJA 4NCBA 2KW4A 1MWMA 3ZX0A 3J7ZO 3QESA 3CFOA 1S1VA 4O55A 3CXCM 1FKOA 4DLGA 1TKTA 4FLTA 4BGBA 1LWFA 3AO3A 3DRSA 4KH6A 3PV8A 2Z1HA 1NOZA 3MN5A 4BR2A 4Z4FA 3GOIA 5A2QO 3SJJA 2V7YA 1Q7YO 2QTDA 4PUOA 2DPNA 1Z6RA 5AQOA 3FZMA 4IOXA 3AO2A 3QMLA 1NGEA 1QQNA 5JLHA 1QZ6A 3OYHA 3SV3A 4FVMA 2HVHA 4X62K 1EP4A 3V9SA 1JXBA 2ZGYA 1KLMA 3K9JA 3ZT0A 1CXUA 3U9DA 4MLEA 1HUXA 4CJ7A 3NH0A 4BG9A 2Y1IA 5AQXA 4M42A 5J1EA 1BDGA 4ILGB 3NFAA 1ZC6A 3O9RA 3LM2A 3OYAA 4OLAA 1GLCG 3DXKA 3HRGA 4M3YA 2E88A 3OJUA 5D3GA 1ITGA 4IFYA 4JEPA 4AQYK 5C24A 1C6VA 3SUOA 4WFBL 4JK9A 4K8XA 1EWQA 1Q9YA 1T6CA 4OLBA 3M8SA 4DSKA 5FROA 2WUSA 3WEEB 3VERA 4BWJA 3FZLA 2VQFK 1NJWA 1NGAA 2BTFA 4GVEA 5JICA 3PIOL 3L6QA 1ATSA 3AVCA 1HQEA 3DJCA 4PL7A 3RRGA 3RVCA 2P9SA 3N4PA 3M3ZA 3SMPA 1HNZK 3AVHA 2A1RA 4B08A 1QSYA 4H0VB 2QWLA 4J2BA 2FBYA 4DFMA 1XQSC 4CI6A 1YT3A 1YVUA 5AQPA 4BY9C 3VETA 4CEOA 2GX9A 3VTIA 3DLKA 2ZD1A 3EZWA 4B1VA 1YTAA 1S22A 1S1WA 3TANA 1EKEA 4FLXA 2E6LA 2P5GA 2E5LK 4BGAA 4M45A 4I2PA 4CJSA 4LF6K 3S3OA 4FJ7A 1T44A 1RT5A 4E19A 3B6OA 2NRXA 3C6TA 3S3MA 3ATUA 4NO7A 3AGKA 1NNEA 3VGMA 3MEEA 1TK0A 1NJZA 4FZXC 3CIPA 4H03B 4FPBA 5AQLA 2G8UA 3AA4A 3TI0A 4B1UB 3CFPA 1WAJA 2KFZA 1L5UA 1VSDA 2UU9K 3AVGA 1RTIA 4IKFA 4XH4A 5AQIA 4X64K 3O3HA 5KQ8A 5LJWA 3J7YP 5CYMA 3ZT4A 3JXUA 4DF8A 3KK3A 1E3MA 2CH5A 4KAZA 4LY7A 5EX5A 5TKWA 3EKSA 1HNIA 3A8YA 1NOYA 2DFEA 4WFNL 3CJCA 3TR8A 1U6ZA 3KLFA 1IBMK 2ATQA 3LZIA 2DFFA 2XHBA 1X1PA 4Q0BA 4CD3A 4HUFA 3O4QA 3ZETB 4BRPA 3L8BA 1ZBIA 1G99A 3PY8A 2IS3A 4IZ9A 4EHUA 3K2PA 2IVOA 2HHVA 2BANA 2P9UB 4JKBA 2H3GX 4HCCA 1SKWA 4EP4A 1V4SA 2YJEA 5FRMA 4YY3K 2IAJA 4CZJA 4QS8A 1E4GT 3VGLA 5SWMA 4H4OA 3TTDA 4CHOA 1KXPA 4JI3K 3OY9A 2I5JA 2O4IA 2PBDA 3FGUA 3VESA 2V7ZA 3CJ7A 3OYFA 4JKDA 2FBVA 1TK8A 1TUUA 5J2QA 3DOLA 4WE1A 1NK7A 3UKRA 3CCSN 4CEBA 1TL1A 4BRGA 4C23A 4B1ZA 4FWPA 1NGHA 1YUWA 1T8EA 4QCLA 1E4FT 5GINA 4J8FA 1VRTA 4F2SA 4PKHA 4WQ5A 3SUQA 4B9LA 1ZYQA 2Z1GA 3P39A 3IMXA 4KHSA 3ENHA 4RW7A 3CMAN 3C94A 4LH4A 4KO0A 1IH7A 5SZTA 2HBLA 3NH1A 2G8HA 2YI1A 3KWIA 4DG1A 1J54A 5F2RA 4IWVA 3M8QA 2UUBK 5CE3A 1TKXA 4O5BA 5J2PA 2F8TA 3CC2N 4GKKK 3GE1A 3SV4A 3RWUA 3SCXA 1N32K 3OYMA 2KFNA 1S9EA 1IKVA 2P9PA 4PQUA 5FPNA 3UE5A 3T19A 3CCUN 4FWNA 4N5SA 1K8KB 3CERA 5ADXH 1C0MA 4LF5K 1P90A 4BRQA 1YHQN 4UY8O 4ZTFA 3TU5A 3H45C 4M41A 4FOIA 4GV9A 3W3DA 2R7YA 2QWMA 1NJIO 2RPIA 5KPRA 4KRFA 3S41A 3VQ7A 3L4QA 3OYJA 3SI6A 1YJWN 1U48A 3NDKA 4JAXA 3CYMA 1OVYA 2OPQA 1VQMN 3EY1A 4LF4K 1NGFA 5KRSA 1VQLN 2DTUA 5C12A 3OVNA 2HBKA 4CHQA 1KTQA 2ASPA 1VQNN 1WSHA 3SLCA 3L3VA 2YHYA 3O4NA 3PX0A 3KKRA 3CM6A 4DWIA 1SL0A 3ULEA 1GOAA 1QTMA 3TAPA 1JLQA 3I0SA 5JS1A 4MDBA 3AVLA 2QXLA 1BISA 3FR0A 4FOEA 4B1YB 3BEXA 4F3TA 4WQ5C 3CG7A 3LDQA 4L8RB 3OS2A 4FL9A 3ULDA 2Q31A 5E84A 1T05A 4PWDA 4BR5A 4IDKA 2HSTA 1ATRA 3MX2A 1N8RO 5GAEP 1C1AA 1WOQA 1KC8O 4BRAA 4BC5A 4DV4K 2HHTA 3U6FA 2YJFA 5M1NA 3HT3A 1P8ZA 4CGFA 3ZSOA 1GLEG 1M1KO 4KPYA 2YHWA 3CPEA 3PSFA 3AVIA 2OCEA 1NU0A 1VSJA 3LP3A 3VA3A 3ZCMA 4RW8A 2HNYA 4C8KA 1KVBA 3ZSXA 2FF6A 1NK6A 2Z1JA 3RSEA 1HQUA 3HVRA 5GADP 3TABA 3FFIA 3CM5A 5DM7L 4H8KA 2HOEA 3H1VX 3HL8A 5BR8K 1VSLA 5HRRA 1VRUA 3VEXA 3D2FB 2CGKA 1JCGA 3AVBA 1G15A 2IC3A 4A5BA 1NJYA 4Z4IA 3RSEB 2D0PA 1D5AA 4DQQA 4X66K 3HOTA 1HMVA 2D0OA 1RT6A 2IVPA 4I6MB 1Z26A 2AA4A 4DUYK 5M1OA 5TKYA 5IT9O 1JJ2M 1WSEA 3KK7A 3VQ8A 4M3ZA 1JKHA 4JRPA 5HOOA 4A5AA 4FLWA 1TVRA 3KZBA 4B9SA 4GY2B 1C0UA 4DUZK 5HP1A 4KHNA 4CZLA 3HTVA 1HR0K 4XEIA 3JS6A 3QLHA 4JKCA 3O8MA 3CJBA 1GLLO 2QXFA 4CJPA 1RTHA 5ADXA 1BA1A 4AH9A 4NCGA 3H1QA 3QINA 5C2FA 2QM1A 4H5VA 3DLHA 2XRIA 4Q5VA 4MO5A 3MEDA 2WFBA 2QI2A 3LDSA 4CJFA 4JHDB 1Q9XA 3KWGA 4FZYA 4M3WA 3ZETA 3CJ9A 4W5QA 2O8DB 4UQGA 2NZTA 3PX4A 4U67L 1NGJA 1HPMA 3Q7BA 3QFPA 4N47A 3UKRB 3QEIA 4TSXA 5ELZA 1S6QA 1TUYA 3CCJN 3ATVA 3V9XA 2GWJA 1RT7A 1BCOA 1QQCA 3HK2A 4M63C 3PX6A 3HYFA 4CGHA 1NKBA 3JAMO 1JLBA 2ZWHA 1XMQK 1KAXA 1YVNA 1NMDA 5BRFA 2YHAA 2P51A 2YNFA 4A2BA 2P5OA 1NGGA 3PIPL 5DM6L 2WONA 3AA3A 4O0IA 1JLEA 5BPLA 3VF6A 4I2QA 1JLGA 3LWLA 1VQ5N 3CCEN 2ZM6K 4AM7A 4KH4A 3ENOA 4CF0A 3G10A 4IXCA 2P9IA 2P9PB 4CJWA 1R0AA 3A5NC 3R3LA 1WBBA 2YHBA 3C7NA 4QS7A 4PA1A 4BROA 3OW2M 1SAZA 4Y0WA 3G71N 2HNDA 4MLHA 3MAQA 1RFQA 4KTWA 3HJFA 5J2NA 5T7BA 5HBMA 3K5NA 1RDWX 5AR0A 4DR7K 3TAEA 1RBVA 1I3AA 3VTHA 4BQLA 4CFCA 4ZHRA 2UXDK 3M8RA 4CBWA 3VQ4A 1FK9A 2F96A 5HRSA 1UAXA 2XY8A 1KAYA 3O3GA 3ZT2A 1T3VA 3D7EO 4DFKA 2YHXA 2A41A 2GBZA 4WQ4C 3KVGA 4CEFA 2QWRA 3WNFA 3THVA 1HKBA 2QA4N 4H0XB 1J9AA 1N33K 4MFBA 4F3OA 4DMNA 2FLOA 4PHTX 3SPZA 3SBTA 1WSFA 4AHVA 2B5JA 3LDPA 2V51B 3FZKA 3O3FA 4O8KA 1RT4A 2LSNA 3B6PA 2VCPA 3HI0A 4FWLA 2VGMA 4ZTJA 4AM6A 5DK5A 1IKYA 1W9HA 4HTUA 3LDLA 2G8VA 3VEWA 1RCHA 4IG0A 2A40A 1WN7A 3LL3A 3NGZA 4JS4A 4B3TK 1KQSM 3V9ZA 3K0SA 4FM2A 1NBWA 3O1BA 4BC3A 1HYZA 1WUAA 4ILHA 3FZHA 3MK6A 3U4LA 4BVPA 3TSQA 1K6YA 4OJRA 3ZT3A 3L2VA 4LF8K 5AQMA 4DF4A 2O8EB 4LF7K 5BR9A 5LL6Z 2HHHK 4FK2A 4CJTA 3PO5A 4FJHA 3WXMB 3OA9A 2NNWA 3EN9A 2PAVA 5AQYA 2PZSA 4BRIA 1W2BM 3ZEUA 5EVZA 3EEQA 2GV9A 3HPOA 3MN6A 4MO4A 4AHCA 5AQRA 3VQAA 4KHPK 4K43A 2OTLN 4Z4EA 4DTUA 5CYQA 1RBRA 4DQ8A 1VK0A 3G4SN 4H0OA 3DLBA 5C25A 1CLQA 1D9DA 4LSLA 2OZMA 4NCAA 3WEEA 4OKJA 3THWB 3CF5L 4CD1A 3SUPA 4H0YB 3NGYA 4BREA 1TGOA 4KHYA 5E41A 2UYTA 2ZF5O 4FJGA 4JKFA 3VOVA 5EXWA 1CZAN 4DR2K 4DV3K 4DV1K 3ALYA 3VF2A 2HW3A 4BRNA 4BDPA 4YOTA 2FSNA 2VG5A 1QQOA 1TL3A 3OTOK 4Z0UA 3QERA 4NLCA 1K8AO 3TAGA 3CI5A 2KZZA 3NH2A 4DR4K 1NGBA 4BC2A 4IG3A 2WOMA 4MQ3A 4BE0A 1KRPA 4CGJA 1IG8A 5M1QA 2I7NA 3H6EA 2A5XA 4F8RA 3NF8A 3A5LC 1RTDA 1NLVA 4FW2A 4FJLA 3UKUA 3VQ6A 4W5RA 3K5MA 4FJ5A 3KIOA 3W0LA 1FXXA 2XY5A 2QW9A 3GG4A 4FLVA 1D9FA 3LAMA 3NF7A 2ZJPL 4FZZA 1ATNA 3O9UA 4FJKA 4RW6A 4B8CA 3A0IX 3O80A 1U47A 4DFPA 3QEXA 1XI1A 4ID1A 2E1YA 2EX3A 4DSJA 1Y64A 4C8LA 4ELTA 1QQMA 1X3MA 4IDHA 5AQNA 2GUIA 1QHTA 1H1VA 3CCLN 1X9SA 3IUCA 4CF1A 3B8AX 3V9UA 4BR0A 2YNIA 4Y1DA 2O8DA 4E7IA 1IKXA 5LJVA 2KKZA 4CJQA 4E7HA 1GOCA 2QEXN 4GW6A 3JYTA 2GTDA 3WNEA 3TPQA 2VWBA 2ZE2A 4IO8A 1N6QA 4DSIA 4GKJK 3LANA 4GNIA 4B3OA 4B9TA 1O13A 1N36K 4KB1A 1ZBHA 4DKWA 1U2VA 2J4RA 3DXKB 3VEOA 4DR6K 2IOCA 1BCMA 4C1NK 1RBSA 1U4BA 1EXQA 1IO2A 4B9UA 3MWPA 3LALA 5KPZA 2HHSA 4FJIA 3D0PA 4PL8A 4OO1J 1NGDA 4QS9A 1M90O 3WNGA 1VQ7N 3E9OA 2WTUA 4JV5K 2ITGA 1TAUA 4U7BA 2VWKA 4OVLA 4BRHA 3OS0A 3A2FA 4BACA 3AO4A 1I94K 2P1JA 4W5NA 1SZ2A 4ISFA 3SUNA 2BE2A 4FLUA 3T3FA 4JK8A 3M8PA 4CJRA 3T1AA 5KTQA 1Q18A 4FK0A 2ASOA 4FM1A 4DTOA 4JD2A 5CR4A 2UUAK 3EYZA 3K5OA 5HROA 1RDAA 2A42A 3DLEA 1Z05A 2XY6A 3MCPA 2F7TA 1XHXA 4FM0A 4K25A 3VN5A 4JI0K 3OYGA 2QWPA 3C0BA 3AO1A 3AAQA 4CCHA 1C1BA 5AQJA 4WFAL 4YORA 4H0TB 1RNHA 4YHHK 1L3VA 3MX5A 4E89A 3E9PA 2PYLA 3MDQA 4DR3K 4CF2A 3ITHA 3NMUA 4DQRA 3RTVA 3HM9A 4M3RA 5KI6A 1J5EK 1LAWA 4DU3A 3ISNC 1DTTA 1JLFA 4FJMA 1QVGM 3NAEA 5BRHA 5FLXO 4IOAL 1JCFA 3O9QA 1U49A 4M7YA 1D4XA 4KHUA 3IFRA 4JNEA 2EHGA 1VQ6N 1SL2A 3F9MA 4CJ4A 1ASVA 2B6AA 4AHSA 1RDUA 2HHWA 3R8EA 4OGCA 1RGIA 1N5YA 4Z94A 4OKEA 1TKZA 3ZX2A 1RDDA 1SKRA 4CF9A 4R79A 4C8NA 4FW1A 3I33A 2NRHA 3G0ZA 4LFCK 3THWA 2G8WA 4LF9K 1WSGA 2WC9A 4IOCL 5J2MA 3WXLA 3CPWM 3VQ5A 5AQGA 3DRPA 4KV8A 5CHIA 3BUZB 3SJHA 3ZSYA 2O8CA 3C6AA 3CQXA 5KGWA 3AY9A 3SNNA 3C6UA 4I6MA 3HBTA 3J81O 4CJUA 1Y97A 4IJAA 3C95A 4E7JA 2IDOA 3THXA 4DS4A 2VQEK 1VSMA 4NYFA 1EQYA 2DFHA 3NVKA 4CEZA 1HRHA 2YNGA 1B9FA 3PUFA 4HUEA 3CQYA 1YJ9N 1U45A 1YXQA 1KVAA 1BI4B 2QWNA 3H46O 4I9LA 2ZJRL 3THYB 1RBUA 1SL1A 4EP5A 3EZ5A 4KI6A 4BR4A 3KHYA 4B8AB 1WBDA 4F2RA 1SV5A 1X3NA 5HLFA 1QVFM 4JI5K 5I9EB 5MLCQ 2G8FA 4BRDA 2I7PA 1IKWA 4GMJB 1JLAA 1NWKA 3MMVA 1B9DA 1XHZA 4N56A 3VMFB 1DT9A 5C10A 4EZ9A 5C2DA 3TTFA 1TYQB 4B9QA 3QEPA 2O8FA 2O8BA 1IG9A 3QNOA 3E1YA 4JRQA 3AVAA 4BRLA 5AQUA 4BR9A 4J2DA 1SQKA 2YCHA 4FWMA 3CD6N 1BHLA 4X65K 4BE1A 3V9WA 1TYQA 4CZIA 4O5FA 3O6WA 1HYSA 3C65A 3FLCO 2G8KA 5BRDA 4DTMA 4A2AA 3CCVN 4EHTA 4NB4A 4A62A 4CE9A 2O8EA 1FW6A 1LW0A 1B92A 3V1QA 4CHNA 3NHGA 3ZLJA 4BDYA 3BF3A 3IDHA 2E1ZA 1ESVA 3RRHA 2Q0UA 1DEJA 4ID5A 4DV0K 3P31A 2P9IB 2NRZA 1ZBLA 3P4IA 4DTPA 1FKPA 4K42A 1WSJA 3V1OA 1W7AA 4K8ZA 2X6SA 4B3RK 3V6DA 3SZ2A 2OTJN 1L3SA 3ULEB 4FCYA 3P5JA 3L4IA 1VSKA 1C0GA 3DLRA 4AILC 3CJAA 1LAVA
chains in the Genus database with same CATH topology
3N4QA 3O1BA 1NGIA 2CH5A 4BC3A 1WUAA 5EX5A 1YJNN 4ILHA 5TKWA 3EKSA 3A8YA 5BPNA 4WFNL 3CJCA 3FFKB 3FZHA 3MK6A 3ID6A 5EOYA 1YI2N 1S3XA 3U4LA 4BVPA 3R1XA 1LOTB 1U6ZA 4BR7A 3TSQA 2F9TA 4FWQA 3G25A 5AQMA 3SBGA 1K8KA 5FPMA 3U9ZA 5BR9A 3VEYA 4JD2B 4CD3A 5JLFA 4IJNA 2GEMA 4FPAA 2W40A 4JKGB 3ZETB 3BF1A 4BRPA 2P9NA 4OPAA 5GAHP 1W97L 3WXMB 1G99A 3OA9A 4IZ9A 2NNWA 4EHUA 3EN9A 2HBJA 2PAVA 5AQYA 3D2FA 4BRIA 2IVOA 3ZEUA 1W2BM 3EE8A 3EL2A 5EVZA 2P9UB 4JKBA 2H3GX 3MN6A 4MO4A 4JN4A 1V4SA 2P9KA 1QZ5A 5AQRA 1IJJA 2YJEA 4K43A 2OTLN 3SAFA 2JWLA 2P9NB 4CZJA 4QS8A 1E4GT 3CJ1A 1OKJA 2NRTA 2OANA 3VGLA 3HM8A 4DQ8A 3G4SN 4FVUA 4EAHD 3TTDA 4H0OA 3I56N 1KXPA 3I8BA 2PBDA 3CHWA 3FGUA 3VESA 3WEEA 2V7ZA 3CJ7A 5C15A 4JKDA 2P9KB 3CF5L 1TUUA 4H5NA 4PKGA 4CD1A 3M1FA 4H0YB 4K41A 4LC9B 1NM1A 4FWSA 3H3OB 4BREA 3DXMB 3O5BA 2KHOA 3UKRA 2UYTA 2ZF5O 1Q81O 3CC7N 3CCSN 2NRVA 4JKFA 3VOVA 5EXWA 1CZAN 4BRGA 4C23A 4B1ZA 4IEIA 3VEZA 2KLAA 2NRRA 4FWPA 3VF2A 1NGHA 1YUWA 4BRNA 1BG3A 5M1FA 4YOTA 1S72N 2FSNA 4IFEA 1QQOA 2QWOA 1E4FT 5GINA 4J8FA 1BU6O 3PLAA 4PKHA 4H5RA 4WQ5A 4BRKA 2WBNA 3P39A 4NLCA 3IMXA 4CBXA 1JCEA 1K8AO 3CI5A 3ENHA 5AFUA 3J8AA 3WT0A 3FE1A 4YDUC 3CMAN 2GWKA 3WUHA 3DAWA 1NGBA 4BC2A 2HBLA 3BP8A 1IG8A 5M1QA 3HZ6A 2I7NA 3H6EA 2A5XA 2YI1A 3KWIA 3VEVA 3T7ZA 5FPEA 3A5LC 3O9TA 4KH5A 3TSPA 5F2RA 4IWVA 1NLVA 2P9UA 1HLUA 4H5WA 4EIAA 5CE3A 3WQTA 5JVGL 1HKGA 3NVMA 3UKUA 3CC2N 3GE1A 1SS6A 5FPDA 1BUPA 1HX1A 5GIOA 1HJOA 3QDKA 1K9MO 2P9PA 1HKCA 1XUPO 1YF5L 5FPNA 2IIRA 3UE5A 3CCUN 4FSVA 3W0LA 4FWNA 1K8KB 3GBTA 3CERA 4CZKA 5ADXH 2QW9A 3GG4A 5AFUH 3AGRA 2VGNA 2ZJPL 3EO3A 1P90A 3DWLA 4BRQA 1ATNA 1YHQN 4UY8O 1MA9B 3O9UA 3TU5A 4YOYA 4RWTA 3A0IX 3H45C 3O80A 4F9OA 2VYPA 3M6GA 4FOIA 4GV9A 3W3DA 2QWMA 4JK7A 2E1YA 1NJIO 5KPRA 5AQHA 3S41A 3L4QA 1Y64A 1MDUB 1GLBG 1YJWN 1QQMA 1X3MA 4IDHA 5AQNA 4JAXA 3VGKA 1OVYA 1VQMN 4O8UA 3DLLL 1H1VA 5JMVA 1NGFA 4HTLA 3CCLN 1VQLN 2P9SB 4CZEA 3ZX3A 4B1WB 3IUCA 5C12A 2HBKA 2E20A 3LDNA 3B8AX 5F0XA 3IKMA 2ASPA 4BR0A 1VQNN 3HOSA 1U2VB 4IO9L 3Q7CA 5LJVA 3SLCA 2KKZA 4JKEA 2YHYA 1VQ9N 2QEXN 2GTDA 1EO1A 1NGCA 3TPQA 3ULEA 3DXMA 1GLAG 3G6EN 2VWBA 3GDQA 4IO8A 5BN9A 4A57A 2ASMA 4MDBA 1LCUA 2PFUA 3CMEN 3MWTA 4GNIA 4BRFA 2QXLA 1O13A 3FR0A 3HSCA 4FOEA 4B1YB 3BEXA 4DKWA 4WQ5C 3LDQA 4EFHA 1U2VA 2YX6A 5M1PA 4ISEA 1R59O 3QBWA 4FL9A 5BN8A 2J4RA 3DXKB 2CH6A 5AZJB 2Q31A 5E84A 3VEOA 1ZXOA 4BR5A 1Q82O 4C1NK 5JVHL 4GV3A 2Q97A 2HSTA 1ILYA 1ATRA 2Q0RA 2GELA 1ZBSA 3MX2A 2ITMA 2BUPA 3GL1A 4E1JA 3SAHA 1N8RO 5GAEP 1WOQA 3MWPA 1KC8O 3CC4N 4FWOA 4BRAA 2IVNA 5KPZA 4BC5A 3AARA 4OPHA 5C0YA 3T69A 4PL8A 2E2OA 4OO1J 2CGJA 2YJFA 2A3ZA 3VPZA 4G9ZA 1NGDA 4QS9A 2HF3A 1XC3A 3K9KA 5AQFA 5AQZA 1P8ZA 5M1NA 3E9OA 5AQKA 5LY3A 1M90O 1VQ7N 1BOTO 3UKUB 4U7BA 1GLEG 1YITN 3ENBA 1M1KO 4BRHA 2YHWA 3CPEA 3U8XA 2RHKA 3VF4A 3ID8A 2D1KA 3P38A 1SZ2A 3D2EA 4ISFA 5B8HA 3QFUA 3WXIA 3O9SA 4JK8A 5AZJA 4B1XB 3LM9A 3CCMN 4M7XA 4FO0A 1Q18A 3QBXA 4WCEL 2FF6A 1QHAA 2ASOA 4BG8A 1VQPN 4C1NI 3WXJA 1MWKA 4JD2A 5CR4A 5AQVA 3RSEA 1BA0A 4RTFD 5GADP 2E2NA 3D2EB 2A42A 4H5TA 5DM7L 3UB5A 2HOEA 1Z05A 5M1KA 3H1VX 2AP1A 4CBUA 3VEXA 4BVOA 1J6ZA 3WXKA 3D2FB 4A59A 2CGKA 3ZEUB 1JCGA 2F7TA 1VAZA 2V52B 3MCPA 3O1WA 3SAGA 4A5BA 4WF9L 4WYBA 4K25A 3RSEB 2D0PA 2E2PA 3O08A 3FZFA 2QWPA 3C0BA 3L0QA 5KQDA 4MDAA 4DHYA 2BH1A 4BQZA 5AZIA 4CZGA 3AAQA 2A6AA 2FSKA 2RE2A 5F1XA 4CZMA 3HOTA 2D0OA 5AQJA 4WFAL 2Q2RA 4YORA 4YOWA 4BRMA 2E2QA 2IVPA 3EE9A 4I6MB 2AA4A 5M1OA 3A5OC 4H0TB 1KQSM 5TKYA 1JJ2M 3MX5A 3E9PA 3KK7A 3MDQA 2FF3B 4IEEA 4JKHA 3NMUA 2F9WA 5HOOA 4A5AA 5AZIB 4KBOA 4A61A 4FWRA 3KZBA 4GY2B 4FWKA 2NRWA 3C6HA 4CZLA 3D6RA 3E66A 4YOXA 1DKGD 3LDOA 4BRCA 3OHRA 5EY4A 3HTVA 1QVGM 2HBMA 4NLBA 2HMPA 2ZGZA 5BREA 3F2KA 2FSJA 2CGLA 4XEIA 5BRHA 3VENA 4IOAL 4H0PA 3JS6A 4YOVA 4JKCA 3O8MA 4ISGA 3ZYYX 1JCFA 3CJBA 1K73O 3O9QA 1GLLO 4M7YA 1D4XA 3IFRA 5BPMA 4JNEA 1DGKN 5ADXA 3TSUA 1BA1A 3E9LA 4JKAA 1VQ6N 4CZHA 5KPTA 3O4WA 1YIJN 2P9LB 1MWMA 3H1QA 3F9MA 3ZX0A 3J7ZO 5AQSA 1RDUA 3R8EA 5C2FA 1RGIA 2QM1A 4WQ4A 4H5VA 4DB3A 4Z94A 3CXCM 3ZX2A 2QWQA 4YOUA 4R79A 4MO5A 3I33A 4XH5A 5H1SQ 2WFBA 2QI2A 2NRHA 4BGBA 4JHDB 4KH6A 3KWGA 2WC9A 2NLXA 3MN5A 4IOCL 4JKGA 3CJ9A 3ZETA 4BR2A 1BWFO 5AQQA 3R9PA 3WXLA 3CPWM 3GOIA 2NZTA 2V7YA 1KAZA 4U67L 5AQGA 1NGJA 1HPMA 3Q7BA 3QFPA 5CHIA 3BUZB 3UKRB 3SJHA 3I55N 5ELZA 3C6AA 3CQXA 1TUYA 3CCJN 3ATVA 1Q7YO 2QTDA 2DPNA 1Z6RA 3H3NO 2GWJA 3AY9A 3FZMA 4IOXA 3QMLA 4HWIA 1NGEA 1QQNA 5JLHA 5GIPA 1QZ6A 4I6MA 4M63C 3HBTA 2JWKA 4DCHA 2ZWHA 1KAXA 1YVNA 1NMDA 4IJAA 2ZGYA 5BRFA 3SK3A 2HF4A 3K9JA 4BC4A 1EQYA 3NVKA 3U9DA 4MLEA 4A2BA 1NGGA 1HUXA 4CJ7A 4BG9A 3PIPL 5AQXA 3CQYA 4CZFA 1YJ9N 1YXQA 3A5MC 5DM6L 2QWNA 3H46O 2ZJRL 1BDGA 5BPLA 3TTCA 4ILGB 3VF6A 4L3QA 1VQ5N 1ZC6A 3CCEN 2W41A 3O9RA 4AM7A 4KH4A 3ENOA 4GV6A 3LM2A 4IXCA 2EWSA 1GLCG 2P9PB 1YAGA 2P9IA 2Q36A 3A5NC 3DXKA 3HRGA 3R3LA 1VQ4N 1GLFO 3SMSA 3C7NA 4QS7A 4BROA 1C0FA 1VQ8N 4BR4A 3OW2M 2E88A 1SAZA 3KHYA 3OBWA 1X3NA 2ZJQL 4Y0WA 1QVFM 3G71N 1VQKN 4JEPA 4MLHA 1RFQA 5I9EB 5MLCQ 1GLJO 4BRDA 2I7PA 4WFBL 4JK9A 1T6CA 1NWKA 1RDWX 3MMVA 5AR0A 4ILJA 4PKIA 3VMFB 1DT9A 2WUSA 5C10A 3WEEB 3VTHA 3VERA 3FZLA 4BQLA 3TTFA 5C2DA 1NGAA 4CBWA 2BTFA 4GVEA 1TYQB 4B9QA 3L6QA 5JICA 3PIOL 3E1YA 1ATSA 1KAYA 1KD1O 3DJCA 4PL7A 3CCQN 3RVCA 1V4TA 1T3VA 2P9SA 1BO5O 3D7EO 3N4PA 3M3ZA 3SMPA 2YHXA 2A41A 5AQUA 4AF1A 4BR9A 2GUPA 4BRLA 1VQON 4WQ4C 1SQKA 2YCHA 3KVGA 4FWMA 3R6MA 3CD6N 4H0VB 2QWLA 2QWRA 1HKBA 2QA4N 1XQSC 4CI6A 1TYQA 4CZIA 4O5FA 3O6WA 5AQOA 4H0XB 3C65A 3FLCO 5AQPA 4BY9C 3VETA 5BRDA 2GX9A 3WQUA 3MN9A 3VTIA 5GAGP 4YDUA 2FLOA 4JHDA 4A2AA 2FXUA 3CCVN 4EHTA 4PHTX 3EZWA 4NB4A 4A62A 4XH1A 1S22A 4B1VA 3MCAB 3SBTA 1GLDG 3MN7A 1T6DA 3LDPA 5HL7L 1Q86O 4BGAA 2V51B 3BF3A 3FZKA 3IDHA 4O8KA 2E1ZA 1ESVA 2VCPA 3M5RA 2Q0UA 1DEJA 3C7NB 3F5TA 3HI0A 4FWLA 1T44A 2VGMA 3P31A 3EKUA 2P9IB 3CCRN 2NRZA 2NRXA 3P4IA 1X9JA 3ATUA 3OBYA 3AGKA 4NO7A 3VGMA 4AM6A 4K42A 3CIPA 2D4WA 3LDLA 4H03B 4FPBA 5AQLA 5AQWA 4B1UB 3VEWA 2OTJN 2Q1NA 2A40A 3AAPA 3ULEB 5AQTA 3LL3A 3QB0A 3L4IA 2E8AA 3QICA 4XH4A 5AQIA 1C0GA 5KQ8A 5LJWA 5E26A 2P9LA 3CJAA 3JXUA 4RCHA 3CETA 1NBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1B A;  1NGI A;  2CH5 A;  4BC3 A;  1WUA A;  5EX5 A;  3EKS A;  3A8Y A;  5BPN A;  3CJC A;  3FFK B;  3FZH A;  3MK6 A;  5EOY A;  1S3X A;  3U4L A;  4BVP A;  4BR7 A;  1LOT B;  1U6Z A;  2F9T A;  4FWQ A;  3G25 A;  5AQM A;  1K8K A;  5FPM A;  3U9Z A;  5BR9 A;  3VEY A;  4JD2 B;  4CD3 A;  5JLF A;  4IJN A;  2GEM A;  4FPA A;  2W40 A;  3ZET B;  3BF1 A;  4BRP A;  2P9N A;  1G99 A;  4IZ9 A;  4EHU A;  3EN9 A;  2PAV A;  5AQY A;  3D2F A;  4BRI A;  2IVO A;  3ZEU A;  3EL2 A;  5EVZ A;  2P9U B;  2H3G X;  3MN6 A;  4MO4 A;  4JN4 A;  1V4S A;  2P9K A;  1QZ5 A;  5AQR A;  1IJJ A;  2YJE A;  4K43 A;  2P9N B;  4CZJ A;  4QS8 A;  1E4G T;  3CJ1 A;  1OKJ A;  2OAN A;  3VGL A;  4DQ8 A;  3HM8 A;  4EAH D;  4H0O A;  1KXP A;  3I8B A;  2PBD A;  3CHW A;  3FGU A;  3VES A;  3WEE A;  2V7Z A;  3CJ7 A;  2P9K B;  1TUU A;  4H5N A;  4PKG A;  4CD1 A;  3M1F A;  4H0Y B;  4K41 A;  4LC9 B;  1NM1 A;  4FWS A;  3H3O B;  4BRE A;  3DXM B;  3O5B A;  2KHO A;  3UKR A;  2UYT A;  2ZF5 O;  3VOV A;  5EXW A;  1CZA N;  4BRG A;  4C23 A;  4B1Z A;  3VEZ A;  4FWP A;  3VF2 A;  1NGH A;  1YUW A;  4BRN A;  1BG3 A;  2FSN A;  1QQO A;  2QWO A;  1E4F T;  4J8F A;  1BU6 O;  4PKH A;  4H5R A;  4WQ5 A;  4BRK A;  4CBX A;  3IMX A;  1JCE A;  3CI5 A;  3ENH A;  5AFU A;  3J8A A;  3WT0 A;  3FE1 A;  4YDU C;  2GWK A;  3WUH A;  3DAW A;  1NGB A;  4BC2 A;  3BP8 A;  1IG8 A;  3HZ6 A;  2I7N A;  3H6E A;  2A5X A;  2YI1 A;  5FPE A;  3VEV A;  3A5L C;  5F2R A;  4IWV A;  1NLV A;  2P9U A;  1HLU A;  4H5W A;  4EIA A;  5CE3 A;  3WQT A;  1HKG A;  3UKU A;  3GE1 A;  5FPD A;  1BUP A;  1HX1 A;  1HJO A;  3QDK A;  2P9P A;  1HKC A;  1XUP O;  5FPN A;  2IIR A;  3UE5 A;  4FSV A;  3W0L A;  4FWN A;  1K8K B;  3GBT A;  3CER A;  4CZK A;  5ADX H;  2QW9 A;  3GG4 A;  5AFU H;  3EO3 A;  3DWL A;  4BRQ A;  1ATN A;  1MA9 B;  3TU5 A;  4RWT A;  3A0I X;  3H45 C;  3O80 A;  4F9O A;  2VYP A;  3M6G A;  4FOI A;  3W3D A;  2QWM A;  2E1Y A;  5KPR A;  5AQH A;  3S41 A;  1Y64 A;  1MDU B;  1GLB G;  1QQM A;  1X3M A;  5AQN A;  4JAX A;  3VGK A;  1H1V A;  5JMV A;  1NGF A;  4HTL A;  2P9S B;  4CZE A;  3ZX3 A;  4B1W B;  3IUC A;  2E20 A;  3LDN A;  3B8A X;  5F0X A;  4BR0 A;  2ASP A;  1U2V B;  5LJV A;  3SLC A;  2YHY A;  2GTD A;  1NGC A;  3TPQ A;  3ULE A;  3DXM A;  1GLA G;  2VWB A;  3GDQ A;  4IO8 A;  5BN9 A;  2ASM A;  1LCU A;  4BRF A;  4GNI A;  2QXL A;  3FR0 A;  3HSC A;  4FOE A;  4B1Y B;  3BEX A;  4WQ5 C;  3LDQ A;  4EFH A;  1U2V A;  4ISE A;  1R59 O;  3QBW A;  4FL9 A;  5BN8 A;  2J4R A;  3DXK B;  2CH6 A;  5AZJ B;  2Q31 A;  5E84 A;  3VEO A;  1ZXO A;  4BR5 A;  2Q97 A;  1ATR A;  2Q0R A;  2GEL A;  1ZBS A;  2ITM A;  4E1J A;  2BUP A;  3GL1 A;  1WOQ A;  4FWO A;  4BRA A;  2IVN A;  5KPZ A;  4BC5 A;  3AAR A;  4PL8 A;  2E2O A;  2CGJ A;  2YJF A;  2A3Z A;  3VPZ A;  1NGD A;  4QS9 A;  2HF3 A;  1XC3 A;  5AQF A;  5LY3 A;  5AQZ A;  1P8Z A;  5AQK A;  1BOT O;  3UKU B;  1GLE G;  4BRH A;  2YHW A;  3U8X A;  3VF4 A;  3ID8 A;  2D1K A;  1SZ2 A;  3D2E A;  4ISF A;  5B8H A;  3QFU A;  3WXI A;  5AZJ A;  4B1X B;  3LM9 A;  4M7X A;  4FO0 A;  1Q18 A;  3QBX A;  2FF6 A;  1QHA A;  2ASO A;  4BG8 A;  3WXJ A;  1MWK A;  4JD2 A;  5AQV A;  3RSE A;  1BA0 A;  4RTF D;  2E2N A;  3D2E B;  2A42 A;  4H5T A;  3UB5 A;  2HOE A;  1Z05 A;  3H1V X;  2AP1 A;  4CBU A;  3VEX A;  4BVO A;  1J6Z A;  3WXK A;  3D2F B;  2CGK A;  3ZEU B;  1JCG A;  2V52 B;  3MCP A;  3O1W A;  4WYB A;  4K25 A;  3RSE B;  2D0P A;  2E2P A;  3O08 A;  3FZF A;  2QWP A;  3C0B A;  3L0Q A;  5KQD A;  4DHY A;  4BQZ A;  5AZI A;  4CZG A;  3AAQ A;  2A6A A;  2FSK A;  5F1X A;  4CZM A;  2D0O A;  5AQJ A;  2Q2R A;  4BRM A;  2E2Q A;  2IVP A;  4I6M B;  2AA4 A;  3A5O C;  4H0T B;  5TKY A;  3MDQ A;  2FF3 B;  2F9W A;  5AZI B;  4KBO A;  4A61 A;  4FWR A;  3KZB A;  4GY2 B;  4FWK A;  4CZL A;  1DKG D;  3LDO A;  4BRC A;  3OHR A;  5EY4 A;  3HTV A;  2HMP A;  2ZGZ A;  5BRE A;  2FSJ A;  2CGL A;  4XEI A;  5BRH A;  3VEN A;  4H0P A;  3JS6 A;  3O8M A;  4ISG A;  1JCF A;  3CJB A;  1GLL O;  4M7Y A;  1D4X A;  3IFR A;  5BPM A;  4JNE A;  1DGK N;  5ADX A;  1BA1 A;  4CZH A;  5KPT A;  3O4W A;  2P9L B;  1MWM A;  3H1Q A;  3F9M A;  3ZX0 A;  5AQS A;  3R8E A;  1RGI A;  2QM1 A;  4WQ4 A;  4H5V A;  4DB3 A;  4Z94 A;  3ZX2 A;  2QWQ A;  4MO5 A;  3I33 A;  4XH5 A;  2NRH A;  4BGB A;  4JHD B;  2NLX A;  3MN5 A;  3ZET A;  3CJ9 A;  4BR2 A;  1BWF O;  5AQQ A;  3R9P A;  3WXL A;  3GOI A;  2NZT A;  2V7Y A;  1KAZ A;  5AQG A;  1NGJ A;  1HPM A;  3QFP A;  3BUZ B;  3UKR B;  3SJH A;  5ELZ A;  3CQX A;  1TUY A;  3ATV A;  2DPN A;  1Z6R A;  3H3N O;  2GWJ A;  3AY9 A;  3FZM A;  5AQO A;  3QML A;  4HWI A;  1NGE A;  1QQN A;  5JLH A;  1QZ6 A;  4I6M A;  4M63 C;  3HBT A;  4DCH A;  2ZWH A;  1KAX A;  1YVN A;  1NMD A;  4IJA A;  2ZGY A;  5BRF A;  3SK3 A;  2HF4 A;  4BC4 A;  1EQY A;  3U9D A;  4MLE A;  4A2B A;  1NGG A;  1HUX A;  4CJ7 A;  4BG9 A;  5AQX A;  3CQY A;  4CZF A;  1YXQ A;  3A5M C;  2QWN A;  3H46 O;  1BDG A;  5BPL A;  3VF6 A;  4L3Q A;  1ZC6 A;  2W41 A;  4AM7 A;  3ENO A;  3LM2 A;  4IXC A;  2EWS A;  1GLC G;  2P9P B;  1YAG A;  2P9I A;  2Q36 A;  3A5N C;  3DXK A;  1GLF O;  3SMS A;  3C7N A;  4QS7 A;  4BRO A;  1C0F A;  4BR4 A;  2E88 A;  1SAZ A;  3KHY A;  1X3N A;  4Y0W A;  4MLH A;  1RFQ A;  5I9E B;  1GLJ O;  4BRD A;  2I7P A;  1T6C A;  1NWK A;  1RDW X;  3MMV A;  5AR0 A;  4PKI A;  2WUS A;  3WEE B;  3VER A;  3FZL A;  4BQL A;  1NGA A;  4CBW A;  2BTF A;  5JIC A;  1TYQ B;  4B9Q A;  3L6Q A;  1ATS A;  1KAY A;  3DJC A;  4PL7 A;  1V4T A;  2P9S A;  3D7E O;  1BO5 O;  3M3Z A;  3SMP A;  2YHX A;  2A41 A;  5AQU A;  4BR9 A;  4BRL A;  2GUP A;  4WQ4 C;  1SQK A;  2YCH A;  3KVG A;  4FWM A;  3R6M A;  4H0V B;  2QWL A;  2QWR A;  1HKB A;  1XQS C;  4CI6 A;  1TYQ A;  4CZI A;  4O5F A;  3O6W A;  4H0X B;  3FLC O;  5AQP A;  3VET A;  5BRD A;  3WQU A;  3MN9 A;  4YDU A;  2FLO A;  4JHD A;  4A2A A;  2FXU A;  4EHT A;  3EZW A;  4NB4 A;  4A62 A;  4XH1 A;  1S22 A;  4B1V A;  1GLD G;  3MN7 A;  1T6D A;  3LDP A;  4BGA A;  2V51 B;  3BF3 A;  3FZK A;  3IDH A;  4O8K A;  2E1Z A;  1ESV A;  2VCP A;  2Q0U A;  1DEJ A;  3C7N B;  3HI0 A;  4FWL A;  1T44 A;  3EKU A;  2P9I B;  3P4I A;  1X9J A;  3ATU A;  4NO7 A;  4AM6 A;  3VGM A;  4K42 A;  3CIP A;  2D4W A;  3LDL A;  4H03 B;  4FPB A;  5AQL A;  5AQW A;  4B1U B;  3VEW A;  2Q1N A;  2A40 A;  3AAP A;  3ULE B;  5AQT A;  3LL3 A;  3QB0 A;  3L4I A;  2E8A A;  3QIC A;  4XH4 A;  5AQI A;  1C0G A;  5KQ8 A;  5LJW A;  5E26 A;  2P9L A;  3CJA A;  3JXU A;  4RCH A;  3CET A;  1NBW A; 
#chains in the Genus database with same CATH topology
 3N4Q A;  1UWB A;  1YJN N;  5EOY A;  3OYC A;  1KSP A;  4QAG A;  3KLH A;  1LOT B;  3ZSV A;  4FWQ A;  3SBG A;  1K8K A;  3U9Z A;  1NK4 A;  4CK2 A;  5JLF A;  1ASW A;  3E01 A;  4JKG B;  1KFD A;  2IGI A;  2P9N A;  1XNQ K;  1W97 L;  3RMD A;  4JS5 A;  4CIF A;  2HBJ A;  3DM2 A;  3D2F A;  1NJX A;  3PSI A;  3AVJ A;  1JL1 A;  4JN4 A;  3V4I A;  2P9K A;  1QZ5 A;  4DQI A;  2P9N B;  4CHP A;  2OPR A;  3OS1 A;  2OAN A;  3NBP A;  3HM8 A;  2W6K A;  4EAH D;  5C42 A;  3I56 N;  4CHZ A;  3S9H A;  1KCF A;  3I8B A;  4CFD A;  3DMJ A;  3HPG A;  5C15 A;  1IV0 A;  2P9K B;  4H5N A;  4PKG A;  2UXB K;  4LC9 B;  3L2R A;  3SQ0 A;  2PY5 A;  4KHQ A;  3HO1 A;  1W0H A;  3H3O B;  3DXM B;  4FJ8 A;  2KHO A;  2O8B B;  2YKM A;  2QKB A;  4BDZ A;  4CES A;  4W5T A;  3OYD A;  4DTS A;  4IEI A;  3VEZ A;  4CIE A;  5M1F A;  3MEC A;  5KGX A;  1S72 N;  3I8D A;  3PLA A;  2VG7 A;  4H5R A;  2WBN A;  1Z25 A;  4CBX A;  1JCE A;  1JXE A;  5AFU A;  3FE1 A;  4YDU C;  4CJK A;  2GWK A;  3DAW A;  3UIQ A;  3MXJ A;  2G8I A;  2OA8 A;  3BP8 A;  3HZ6 A;  4DQP A;  2KQ2 A;  5FPE A;  3VEV A;  3O9T A;  3TSP A;  1F21 A;  4CEE A;  4JI4 K;  2P9U A;  4H5W A;  4ICL A;  4DTX A;  4KFB A;  3KKS A;  2AJQ A;  5GIO A;  1HJO A;  3TAF A;  1K9M O;  1UA0 A;  2D5R A;  1HKC A;  1KFS A;  2IIR A;  3QET A;  1JLC A;  4JI1 K;  2VG6 A;  3SQ2 A;  3AGR A;  3KTQ A;  4DFJ A;  3EO3 A;  4FJX A;  1SUQ A;  4YOY A;  1S1U A;  4RWT A;  4HUG A;  2JLE A;  4V19 S;  4DQS A;  4JK7 A;  1QS4 A;  5AQH A;  1RDC A;  5JS2 A;  3K59 A;  4FJN A;  1NG9 A;  3H08 A;  3HST B;  1RIL A;  3IRX A;  3VGK A;  1A5W A;  1TK5 A;  4HTL A;  4B9V A;  3CQ8 A;  2P9S B;  4DV6 K;  3ZX3 A;  3PO4 A;  2ETJ A;  1KVC A;  2E20 A;  3LDN A;  4CJL A;  1BQN A;  4KI4 A;  5F0X A;  4LSN A;  3VQB A;  3IKM A;  1VSH A;  1U2V B;  3NCI A;  2KTQ A;  4JKE A;  1VQ9 N;  1RTJ A;  2X6N A;  1GOB A;  3OJS A;  3HPH A;  1EO1 A;  1NGC A;  4CJ3 A;  3DYA A;  4CK3 A;  5BN9 A;  2ASM A;  1LCU A;  2PFU A;  4O44 A;  4BRF A;  3TAM A;  1IBL K;  1OVQ A;  4EFH A;  1NK9 A;  2B4J A;  2OZS A;  2YX6 A;  5M1P A;  4ISE A;  4H4M A;  1DTQ A;  3K5L A;  3LZJ A;  1Q82 O;  1FJG K;  4CEA A;  5JVH L;  4JLH A;  2QK9 A;  2Q0R A;  2GEL A;  1ZBS A;  3AV9 A;  4CIG A;  2BUP A;  3GL1 A;  4E1J A;  3SAH A;  4PY5 A;  4FJ9 A;  4FWO A;  2O8F B;  2IVN A;  1NK8 A;  1EWR A;  4OPH A;  3RR7 A;  4JI8 K;  3T69 A;  2E2O A;  3VQQ A;  2CGJ A;  3QO9 A;  1OH6 A;  3K9K A;  5LY3 A;  5AQZ A;  5AQK A;  1RT1 A;  1YIT N;  3ENB A;  1L3T A;  3DLG A;  1X9M A;  3U8X A;  2RHK A;  3VF4 A;  3ID8 A;  3J7A P;  1SKS A;  3P38 A;  3D2E A;  1XNR K;  3WXI A;  4CGG A;  5AZJ A;  4B1X B;  2X78 A;  3LM9 A;  4G1Q A;  4FO0 A;  4M7X A;  3VA0 A;  2HHX A;  4WCE L;  3ZSQ A;  4JI2 K;  4BG8 A;  2HHU A;  4O0J A;  1NK5 A;  5AQV A;  4RTF D;  3LPT A;  2FC0 A;  1CXQ A;  3RMA A;  3D2E B;  4BE2 A;  5M1K A;  3TAQ A;  3SQ1 A;  4BVO A;  3K57 A;  4Y1C A;  3WXK A;  3SAG A;  2QKK A;  1VAZ A;  4CGI A;  1DLO A;  1KLN A;  3QNN A;  4Z4G A;  2E2P A;  3O08 A;  3OYL A;  5KQD A;  4MDA A;  4DSE A;  1S9G A;  4BQZ A;  2A6A A;  2FSK A;  1NKE A;  2RE2 A;  5F1X A;  4CZM A;  3HP6 A;  2Q2R A;  5FRN A;  4YOW A;  4BRM A;  2E2Q A;  3L2Q A;  4JI6 K;  1OH5 A;  3V81 A;  3IG1 A;  3ZT1 A;  4E7L A;  3P83 D;  2RKI A;  4Z4H A;  4J2A A;  4A61 A;  4FWR A;  1S6P A;  4FWK A;  2NRW A;  3C6H A;  1LV5 A;  3SYZ A;  3E66 A;  4BRC A;  1JL2 A;  1C0T A;  2HMP A;  3F2K A;  2W42 A;  2FSJ A;  2CGL A;  4H0P A;  4DV2 K;  4CJ5 A;  3ZYY X;  4ISG A;  1HNV A;  3JSM A;  1WSI A;  3D45 A;  3VQE A;  1DGK N;  4JKA A;  4CVN E;  3O4W A;  1YIJ N;  1LWC A;  2P9L B;  4LD0 A;  1I39 A;  3HXM A;  5AQS A;  3OYB A;  3THY A;  4WQ4 A;  4DB3 A;  1C1C A;  2QWQ A;  1VHX A;  4N76 A;  3BY5 A;  4CF8 A;  1CZB A;  4YOU A;  3ZSR A;  5IWA K;  4XH5 A;  5H1S Q;  1VSI A;  1ZBF A;  1MU2 A;  1NMN A;  2NLX A;  4JKG A;  1BWF O;  1RT3 A;  5AQQ A;  3R9P A;  3LP1 A;  1KAZ A;  3KJV A;  5I42 A;  3I55 N;  1ASU A;  3AVN A;  4DV5 K;  3WNH A;  3H3N O;  1QSL A;  4HWI A;  3KLE A;  3LP0 A;  4KB0 A;  1BI4 A;  1TV6 A;  5GIP A;  4Z4C A;  2JWK A;  2E4L A;  4DCH A;  2Q3S A;  5AJ3 K;  3L3U A;  1BIZ A;  4F4K A;  5CY4 A;  4FXD A;  3SK3 A;  2HF4 A;  4BC4 A;  3VQD A;  1LWE A;  4CHY A;  4CZF A;  3A5M C;  4E0D A;  3DOK A;  4DLE A;  3TTC A;  1T7P A;  2XO7 A;  3NF9 A;  4L3Q A;  5HRP A;  2W41 A;  4GV6 A;  4CEQ A;  2EWS A;  2Q36 A;  3RMC A;  1YAG A;  4K0K K;  1VQ4 N;  1GLF O;  3SMS A;  3KD1 E;  1C0F A;  1VQ8 N;  2BDP A;  3P1G A;  1HNX K;  3OBW A;  4B3M K;  4NYN A;  1TKD A;  1NK0 A;  2ZJQ L;  1VQK N;  3S3N A;  4B9M A;  1GLJ O;  4ILJ A;  4PKI A;  4FK4 A;  3U3G A;  1N34 K;  3KLI A;  3K58 A;  2OYQ A;  1T03 A;  1KD1 O;  3CCQ N;  1V4T A;  1BO5 O;  4RG8 A;  4IFV A;  2O8C B;  4AF1 A;  4JYA K;  1CZ9 A;  2GUP A;  1VQO N;  3R6M A;  1O1W A;  3OYE A;  1REV A;  3VQP A;  3AA5 X;  4KRE A;  3BZC A;  1QE1 A;  3WQU A;  3MN9 A;  3HVT A;  5GAG P;  4YDU A;  4JHD A;  4CER A;  5KRT A;  2FXU A;  5LMU K;  3LWM A;  1X9W A;  4XH1 A;  4NXM K;  3QEV A;  3MCA B;  1GLD G;  3MN7 A;  1T6D A;  4CJV A;  5K14 A;  3ZSW A;  5HL7 L;  1Q86 O;  4J2E A;  3M5R A;  4FJJ A;  3KD5 E;  3C7N B;  3F5T A;  4YNQ A;  3EKU A;  3CCR N;  3KK2 A;  1X9J A;  3OBY A;  1VSE A;  2D4W A;  5AQW A;  4QOZ B;  5CZ2 A;  2Q1N A;  4KKO A;  4E1M A;  1A5V A;  3AAP A;  5AQT A;  3QB0 A;  2E8A A;  3QIC A;  3VQC A;  3IAY A;  5E26 A;  2P9L A;  4RCH A;  3CET A;  1NGI A;  4I9Q A;  5BPN A;  4CJE A;  3FFK B;  1YI2 N;  3ID6 A;  1S3X A;  2HNZ A;  3SPY A;  3R1X A;  4BR7 A;  2F9T A;  3G25 A;  5FPM A;  3QIO A;  3LP2 A;  3NE6 A;  3VEY A;  4JD2 B;  1A5X A;  4IJN A;  3MEG A;  2GEM A;  4FPA A;  2W40 A;  3AO5 A;  3BF1 A;  4NXN K;  4OPA A;  3VQ9 A;  5GAH P;  4HHT A;  2D0B A;  4I7F A;  4CK1 A;  2OPS A;  3EE8 A;  3EL2 A;  2NUB A;  4RW4 A;  4M3T A;  2HB5 A;  3MXM A;  4DTR A;  2UXC K;  1IJJ A;  3SAF A;  2JWL A;  4C8M A;  3CJ1 A;  2XY7 A;  1OKJ A;  2NRT A;  4FVU A;  1HJR A;  4ELU A;  4DSL A;  3CHW A;  3TAR A;  1L3U A;  1EX4 A;  3AVK A;  4DS5 A;  4M3X A;  4N41 A;  1J5O A;  1BQM A;  3M1F A;  4K41 A;  1NM1 A;  2O4G A;  1UA1 A;  4FWS A;  4KTZ A;  3O5B A;  1Q81 O;  3CC7 N;  2NRV A;  2KLA A;  2NRR A;  1BG3 A;  3LPU A;  2JGU A;  4LFA K;  4IFE A;  4OKK A;  2QWO A;  2D0C A;  1BU6 O;  3CFR A;  3DI6 A;  4BRK A;  4DTJ A;  1BIU A;  4R5P A;  4E3S A;  3J8A A;  3WT0 A;  4B9N A;  3L2U A;  3WUH A;  1XC9 A;  4CFB A;  2HHQ A;  3T7Z A;  4CEC A;  3OYI A;  4E7K A;  4KH5 A;  4DSF A;  1HLU A;  4RW9 A;  5FDL A;  4EIA A;  3SQ4 A;  1D8Y A;  2E6M A;  3WQT A;  1YTU A;  5JVG L;  1HKG A;  3V1R A;  3NVM A;  1TAQ A;  1OH8 A;  3KLG A;  1SS6 A;  5FPD A;  1BUP A;  1HX1 A;  2DY4 A;  3QDK A;  1XUP O;  1YF5 L;  4KHW A;  4FSV A;  4DU1 A;  3GBT A;  4CZK A;  4DU4 A;  5AFU H;  4W5O A;  1RBT A;  3QIP A;  4OGE A;  1XMO K;  2VGN A;  4FLY A;  3DWL A;  4LH5 A;  1MA9 B;  1HYV A;  4F9O A;  2VYP A;  3M6G A;  1S1T A;  3THX B;  1HNW K;  3BDP A;  1U04 A;  1S1X A;  4DTN A;  2YV0 X;  4CED A;  3ASM A;  1MDU B;  1GLB G;  3AA2 A;  5DMR A;  2OPP A;  2KZM A;  4YFU A;  3L2W A;  4O8U A;  3DLL L;  5JMV A;  4CZE A;  4B1W B;  4DV7 K;  2A1S A;  3NGI A;  4LFB K;  3F9K A;  2F8S A;  3HOS A;  4IO9 L;  3OYK A;  3Q7C A;  2Y1J A;  4KTQ A;  3AVM A;  1HPZ A;  1S5J A;  3T1Y K;  2RF2 A;  3DXM A;  1GLA G;  3G6E N;  3GDQ A;  2ZQB A;  4A57 A;  3F73 A;  2X74 A;  3CME N;  3MWT A;  3HSC A;  1Q8I A;  1WLJ A;  4OX9 K;  3BZK A;  5BN8 A;  1R59 O;  3QBW A;  2CH6 A;  5AZJ B;  4C8O A;  1ZXO A;  4GV3 A;  2Q97 A;  1ILY A;  1J53 A;  2ITM A;  1RDB A;  4OPK A;  1BGX T;  1QSS A;  3TWH A;  3CC4 N;  3U3Y A;  4M3U A;  2FBX A;  4EZ6 A;  3AAR A;  4E1N A;  1VSF A;  5C0Y A;  3IS9 A;  2A3Z A;  3VPZ A;  4G9Z A;  2HF3 A;  1XC3 A;  5AQF A;  1BOT O;  3UKU B;  4BWM A;  2BGG A;  1ZBU A;  3LAK A;  4B3S K;  2D1K A;  2Z1I A;  3AVF A;  3BGR A;  5B8H A;  3MXI A;  3QFU A;  4FYD A;  3O9S A;  2F4V K;  1UOC A;  3CCM N;  3QBX A;  1QHA A;  4GVM A;  1VQP N;  3ZSZ A;  4C1N I;  3WXJ A;  1MWK A;  4DR5 K;  1BA0 A;  5EU7 A;  1NKC A;  2FBT A;  4CFA A;  2E2N A;  4HVJ A;  3QEW A;  2W6L A;  4CW7 B;  1WAF A;  4H5T A;  3UB5 A;  2VWJ A;  2AP1 A;  2HMI A;  4CBU A;  4IBN A;  1RT2 A;  1WB9 A;  1J6Z A;  4A59 A;  1LW2 A;  3ZEU B;  2D0A A;  3O1W A;  2V52 B;  4OPJ A;  3KK1 A;  5CZ1 A;  4CGD A;  3DRR A;  3HP9 A;  4WF9 L;  4WYB A;  3RR8 A;  4O4G A;  1XWL A;  2HVI A;  3J80 O;  3FZF A;  1OH7 A;  1WNS A;  3L0Q A;  4DHY A;  2BH1 A;  5AZI A;  4CZG A;  5LMN K;  3T1H K;  2UUC K;  1EET A;  3EE9 A;  3RMB A;  5HRN A;  3A5O C;  4AHU A;  2FF3 B;  4IEE A;  4JKH A;  4AHR A;  5I3U A;  2F9W A;  3I0R A;  5AZI B;  4KBO A;  3NF6 A;  4AHT A;  4DR1 K;  4HCB A;  3D6R A;  4YOX A;  1DKG D;  3LDO A;  4JI7 K;  3OHR A;  5EY4 A;  2YNH A;  2HBM A;  1BL3 A;  4NLB A;  3OYN A;  2ZGZ A;  5BRE A;  3VEN A;  4YOV A;  4ELV A;  4XIU A;  2RN2 A;  1K73 O;  1IBK K;  2YKN A;  5BPM A;  3TSU A;  4FLZ A;  3E9L A;  4CZH A;  5KPT A;  2PYJ A;  4NCB A;  2KW4 A;  1MWM A;  3ZX0 A;  3J7Z O;  3QES A;  3CFO A;  1S1V A;  4O55 A;  3CXC M;  1FKO A;  4DLG A;  1TKT A;  4FLT A;  4BGB A;  1LWF A;  3AO3 A;  3DRS A;  4KH6 A;  3PV8 A;  2Z1H A;  1NOZ A;  3MN5 A;  4BR2 A;  4Z4F A;  3GOI A;  5A2Q O;  3SJJ A;  2V7Y A;  1Q7Y O;  2QTD A;  4PUO A;  2DPN A;  1Z6R A;  5AQO A;  3FZM A;  4IOX A;  3AO2 A;  3QML A;  1NGE A;  1QQN A;  5JLH A;  1QZ6 A;  3OYH A;  3SV3 A;  4FVM A;  2HVH A;  4X62 K;  1EP4 A;  3V9S A;  1JXB A;  2ZGY A;  1KLM A;  3K9J A;  3ZT0 A;  1CXU A;  3U9D A;  4MLE A;  1HUX A;  4CJ7 A;  3NH0 A;  4BG9 A;  2Y1I A;  5AQX A;  4M42 A;  5J1E A;  1BDG A;  4ILG B;  3NFA A;  1ZC6 A;  3O9R A;  3LM2 A;  3OYA A;  4OLA A;  1GLC G;  3DXK A;  3HRG A;  4M3Y A;  2E88 A;  3OJU A;  5D3G A;  1ITG A;  4IFY A;  4JEP A;  4AQY K;  5C24 A;  1C6V A;  3SUO A;  4WFB L;  4JK9 A;  4K8X A;  1EWQ A;  1Q9Y A;  1T6C A;  4OLB A;  3M8S A;  4DSK A;  5FRO A;  2WUS A;  3WEE B;  3VER A;  4BWJ A;  3FZL A;  2VQF K;  1NJW A;  1NGA A;  2BTF A;  4GVE A;  5JIC A;  3PIO L;  3L6Q A;  1ATS A;  3AVC A;  1HQE A;  3DJC A;  4PL7 A;  3RRG A;  3RVC A;  2P9S A;  3N4P A;  3M3Z A;  3SMP A;  1HNZ K;  3AVH A;  2A1R A;  4B08 A;  1QSY A;  4H0V B;  2QWL A;  4J2B A;  2FBY A;  4DFM A;  1XQS C;  4CI6 A;  1YT3 A;  1YVU A;  5AQP A;  4BY9 C;  3VET A;  4CEO A;  2GX9 A;  3VTI A;  3DLK A;  2ZD1 A;  3EZW A;  4B1V A;  1YTA A;  1S22 A;  1S1W A;  3TAN A;  1EKE A;  4FLX A;  2E6L A;  2P5G A;  2E5L K;  4BGA A;  4M45 A;  4I2P A;  4CJS A;  4LF6 K;  3S3O A;  4FJ7 A;  1T44 A;  1RT5 A;  4E19 A;  3B6O A;  2NRX A;  3C6T A;  3S3M A;  3ATU A;  4NO7 A;  3AGK A;  1NNE A;  3VGM A;  3MEE A;  1TK0 A;  1NJZ A;  4FZX C;  3CIP A;  4H03 B;  4FPB A;  5AQL A;  2G8U A;  3AA4 A;  3TI0 A;  4B1U B;  3CFP A;  1WAJ A;  2KFZ A;  1L5U A;  1VSD A;  2UU9 K;  3AVG A;  1RTI A;  4IKF A;  4XH4 A;  5AQI A;  4X64 K;  3O3H A;  5KQ8 A;  5LJW A;  3J7Y P;  5CYM A;  3ZT4 A;  3JXU A;  4DF8 A;  3KK3 A;  1E3M A;  2CH5 A;  4KAZ A;  4LY7 A;  5EX5 A;  5TKW A;  3EKS A;  1HNI A;  3A8Y A;  1NOY A;  2DFE A;  4WFN L;  3CJC A;  3TR8 A;  1U6Z A;  3KLF A;  1IBM K;  2ATQ A;  3LZI A;  2DFF A;  2XHB A;  1X1P A;  4Q0B A;  4CD3 A;  4HUF A;  3O4Q A;  3ZET B;  4BRP A;  3L8B A;  1ZBI A;  1G99 A;  3PY8 A;  2IS3 A;  4IZ9 A;  4EHU A;  3K2P A;  2IVO A;  2HHV A;  2BAN A;  2P9U B;  4JKB A;  2H3G X;  4HCC A;  1SKW A;  4EP4 A;  1V4S A;  2YJE A;  5FRM A;  4YY3 K;  2IAJ A;  4CZJ A;  4QS8 A;  1E4G T;  3VGL A;  5SWM A;  4H4O A;  3TTD A;  4CHO A;  1KXP A;  4JI3 K;  3OY9 A;  2I5J A;  2O4I A;  2PBD A;  3FGU A;  3VES A;  2V7Z A;  3CJ7 A;  3OYF A;  4JKD A;  2FBV A;  1TK8 A;  1TUU A;  5J2Q A;  3DOL A;  4WE1 A;  1NK7 A;  3UKR A;  3CCS N;  4CEB A;  1TL1 A;  4BRG A;  4C23 A;  4B1Z A;  4FWP A;  1NGH A;  1YUW A;  1T8E A;  4QCL A;  1E4F T;  5GIN A;  4J8F A;  1VRT A;  4F2S A;  4PKH A;  4WQ5 A;  3SUQ A;  4B9L A;  1ZYQ A;  2Z1G A;  3P39 A;  3IMX A;  4KHS A;  3ENH A;  4RW7 A;  3CMA N;  3C94 A;  4LH4 A;  4KO0 A;  1IH7 A;  5SZT A;  2HBL A;  3NH1 A;  2G8H A;  2YI1 A;  3KWI A;  4DG1 A;  1J54 A;  5F2R A;  4IWV A;  3M8Q A;  2UUB K;  5CE3 A;  1TKX A;  4O5B A;  5J2P A;  2F8T A;  3CC2 N;  4GKK K;  3GE1 A;  3SV4 A;  3RWU A;  3SCX A;  1N32 K;  3OYM A;  2KFN A;  1S9E A;  1IKV A;  2P9P A;  4PQU A;  5FPN A;  3UE5 A;  3T19 A;  3CCU N;  4FWN A;  4N5S A;  1K8K B;  3CER A;  5ADX H;  1C0M A;  4LF5 K;  1P90 A;  4BRQ A;  1YHQ N;  4UY8 O;  4ZTF A;  3TU5 A;  3H45 C;  4M41 A;  4FOI A;  4GV9 A;  3W3D A;  2R7Y A;  2QWM A;  1NJI O;  2RPI A;  5KPR A;  4KRF A;  3S41 A;  3VQ7 A;  3L4Q A;  3OYJ A;  3SI6 A;  1YJW N;  1U48 A;  3NDK A;  4JAX A;  3CYM A;  1OVY A;  2OPQ A;  1VQM N;  3EY1 A;  4LF4 K;  1NGF A;  5KRS A;  1VQL N;  2DTU A;  5C12 A;  3OVN A;  2HBK A;  4CHQ A;  1KTQ A;  2ASP A;  1VQN N;  1WSH A;  3SLC A;  3L3V A;  2YHY A;  3O4N A;  3PX0 A;  3KKR A;  3CM6 A;  4DWI A;  1SL0 A;  3ULE A;  1GOA A;  1QTM A;  3TAP A;  1JLQ A;  3I0S A;  5JS1 A;  4MDB A;  3AVL A;  2QXL A;  1BIS A;  3FR0 A;  4FOE A;  4B1Y B;  3BEX A;  4F3T A;  4WQ5 C;  3CG7 A;  3LDQ A;  4L8R B;  3OS2 A;  4FL9 A;  3ULD A;  2Q31 A;  5E84 A;  1T05 A;  4PWD A;  4BR5 A;  4IDK A;  2HST A;  1ATR A;  3MX2 A;  1N8R O;  5GAE P;  1C1A A;  1WOQ A;  1KC8 O;  4BRA A;  4BC5 A;  4DV4 K;  2HHT A;  3U6F A;  2YJF A;  5M1N A;  3HT3 A;  1P8Z A;  4CGF A;  3ZSO A;  1GLE G;  1M1K O;  4KPY A;  2YHW A;  3CPE A;  3PSF A;  3AVI A;  2OCE A;  1NU0 A;  1VSJ A;  3LP3 A;  3VA3 A;  3ZCM A;  4RW8 A;  2HNY A;  4C8K A;  1KVB A;  3ZSX A;  2FF6 A;  1NK6 A;  2Z1J A;  3RSE A;  1HQU A;  3HVR A;  5GAD P;  3TAB A;  3FFI A;  3CM5 A;  5DM7 L;  4H8K A;  2HOE A;  3H1V X;  3HL8 A;  5BR8 K;  1VSL A;  5HRR A;  1VRU A;  3VEX A;  3D2F B;  2CGK A;  1JCG A;  3AVB A;  1G15 A;  2IC3 A;  4A5B A;  1NJY A;  4Z4I A;  3RSE B;  2D0P A;  1D5A A;  4DQQ A;  4X66 K;  3HOT A;  1HMV A;  2D0O A;  1RT6 A;  2IVP A;  4I6M B;  1Z26 A;  2AA4 A;  4DUY K;  5M1O A;  5TKY A;  5IT9 O;  1JJ2 M;  1WSE A;  3KK7 A;  3VQ8 A;  4M3Z A;  1JKH A;  4JRP A;  5HOO A;  4A5A A;  4FLW A;  1TVR A;  3KZB A;  4B9S A;  4GY2 B;  1C0U A;  4DUZ K;  5HP1 A;  4KHN A;  4CZL A;  3HTV A;  1HR0 K;  4XEI A;  3JS6 A;  3QLH A;  4JKC A;  3O8M A;  3CJB A;  1GLL O;  2QXF A;  4CJP A;  1RTH A;  5ADX A;  1BA1 A;  4AH9 A;  4NCG A;  3H1Q A;  3QIN A;  5C2F A;  2QM1 A;  4H5V A;  3DLH A;  2XRI A;  4Q5V A;  4MO5 A;  3MED A;  2WFB A;  2QI2 A;  3LDS A;  4CJF A;  4JHD B;  1Q9X A;  3KWG A;  4FZY A;  4M3W A;  3ZET A;  3CJ9 A;  4W5Q A;  2O8D B;  4UQG A;  2NZT A;  3PX4 A;  4U67 L;  1NGJ A;  1HPM A;  3Q7B A;  3QFP A;  4N47 A;  3UKR B;  3QEI A;  4TSX A;  5ELZ A;  1S6Q A;  1TUY A;  3CCJ N;  3ATV A;  3V9X A;  2GWJ A;  1RT7 A;  1BCO A;  1QQC A;  3HK2 A;  4M63 C;  3PX6 A;  3HYF A;  4CGH A;  1NKB A;  3JAM O;  1JLB A;  2ZWH A;  1XMQ K;  1KAX A;  1YVN A;  1NMD A;  5BRF A;  2YHA A;  2P51 A;  2YNF A;  4A2B A;  2P5O A;  1NGG A;  3PIP L;  5DM6 L;  2WON A;  3AA3 A;  4O0I A;  1JLE A;  5BPL A;  3VF6 A;  4I2Q A;  1JLG A;  3LWL A;  1VQ5 N;  3CCE N;  2ZM6 K;  4AM7 A;  4KH4 A;  3ENO A;  4CF0 A;  3G10 A;  4IXC A;  2P9I A;  2P9P B;  4CJW A;  1R0A A;  3A5N C;  3R3L A;  1WBB A;  2YHB A;  3C7N A;  4QS7 A;  4PA1 A;  4BRO A;  3OW2 M;  1SAZ A;  4Y0W A;  3G71 N;  2HND A;  4MLH A;  3MAQ A;  1RFQ A;  4KTW A;  3HJF A;  5J2N A;  5T7B A;  5HBM A;  3K5N A;  1RDW X;  5AR0 A;  4DR7 K;  3TAE A;  1RBV A;  1I3A A;  3VTH A;  4BQL A;  4CFC A;  4ZHR A;  2UXD K;  3M8R A;  4CBW A;  3VQ4 A;  1FK9 A;  2F96 A;  5HRS A;  1UAX A;  2XY8 A;  1KAY A;  3O3G A;  3ZT2 A;  1T3V A;  3D7E O;  4DFK A;  2YHX A;  2A41 A;  2GBZ A;  4WQ4 C;  3KVG A;  4CEF A;  2QWR A;  3WNF A;  3THV A;  1HKB A;  2QA4 N;  4H0X B;  1J9A A;  1N33 K;  4MFB A;  4F3O A;  4DMN A;  2FLO A;  4PHT X;  3SPZ A;  3SBT A;  1WSF A;  4AHV A;  2B5J A;  3LDP A;  2V51 B;  3FZK A;  3O3F A;  4O8K A;  1RT4 A;  2LSN A;  3B6P A;  2VCP A;  3HI0 A;  4FWL A;  2VGM A;  4ZTJ A;  4AM6 A;  5DK5 A;  1IKY A;  1W9H A;  4HTU A;  3LDL A;  2G8V A;  3VEW A;  1RCH A;  4IG0 A;  2A40 A;  1WN7 A;  3LL3 A;  3NGZ A;  4JS4 A;  4B3T K;  1KQS M;  3V9Z A;  3K0S A;  4FM2 A;  1NBW A;  3O1B A;  4BC3 A;  1HYZ A;  1WUA A;  4ILH A;  3FZH A;  3MK6 A;  3U4L A;  4BVP A;  3TSQ A;  1K6Y A;  4OJR A;  3ZT3 A;  3L2V A;  4LF8 K;  5AQM A;  4DF4 A;  2O8E B;  4LF7 K;  5BR9 A;  5LL6 Z;  2HHH K;  4FK2 A;  4CJT A;  3PO5 A;  4FJH A;  3WXM B;  3OA9 A;  2NNW A;  3EN9 A;  2PAV A;  5AQY A;  2PZS A;  4BRI A;  1W2B M;  3ZEU A;  5EVZ A;  3EEQ A;  2GV9 A;  3HPO A;  3MN6 A;  4MO4 A;  4AHC A;  5AQR A;  3VQA A;  4KHP K;  4K43 A;  2OTL N;  4Z4E A;  4DTU A;  5CYQ A;  1RBR A;  4DQ8 A;  1VK0 A;  3G4S N;  4H0O A;  3DLB A;  5C25 A;  1CLQ A;  1D9D A;  4LSL A;  2OZM A;  4NCA A;  3WEE A;  4OKJ A;  3THW B;  3CF5 L;  4CD1 A;  3SUP A;  4H0Y B;  3NGY A;  4BRE A;  1TGO A;  4KHY A;  5E41 A;  2UYT A;  2ZF5 O;  4FJG A;  4JKF A;  3VOV A;  5EXW A;  1CZA N;  4DR2 K;  4DV3 K;  4DV1 K;  3ALY A;  3VF2 A;  2HW3 A;  4BRN A;  4BDP A;  4YOT A;  2FSN A;  2VG5 A;  1QQO A;  1TL3 A;  3OTO K;  4Z0U A;  3QER A;  4NLC A;  1K8A O;  3TAG A;  3CI5 A;  2KZZ A;  3NH2 A;  4DR4 K;  1NGB A;  4BC2 A;  4IG3 A;  2WOM A;  4MQ3 A;  4BE0 A;  1KRP A;  4CGJ A;  1IG8 A;  5M1Q A;  2I7N A;  3H6E A;  2A5X A;  4F8R A;  3NF8 A;  3A5L C;  1RTD A;  1NLV A;  4FW2 A;  4FJL A;  3UKU A;  3VQ6 A;  4W5R A;  3K5M A;  4FJ5 A;  3KIO A;  3W0L A;  1FXX A;  2XY5 A;  2QW9 A;  3GG4 A;  4FLV A;  1D9F A;  3LAM A;  3NF7 A;  2ZJP L;  4FZZ A;  1ATN A;  3O9U A;  4FJK A;  4RW6 A;  4B8C A;  3A0I X;  3O80 A;  1U47 A;  4DFP A;  3QEX A;  1XI1 A;  4ID1 A;  2E1Y A;  2EX3 A;  4DSJ A;  1Y64 A;  4C8L A;  4ELT A;  1QQM A;  1X3M A;  4IDH A;  5AQN A;  2GUI A;  1QHT A;  1H1V A;  3CCL N;  1X9S A;  3IUC A;  4CF1 A;  3B8A X;  3V9U A;  4BR0 A;  2YNI A;  4Y1D A;  2O8D A;  4E7I A;  1IKX A;  5LJV A;  2KKZ A;  4CJQ A;  4E7H A;  1GOC A;  2QEX N;  4GW6 A;  3JYT A;  2GTD A;  3WNE A;  3TPQ A;  2VWB A;  2ZE2 A;  4IO8 A;  1N6Q A;  4DSI A;  4GKJ K;  3LAN A;  4GNI A;  4B3O A;  4B9T A;  1O13 A;  1N36 K;  4KB1 A;  1ZBH A;  4DKW A;  1U2V A;  2J4R A;  3DXK B;  3VEO A;  4DR6 K;  2IOC A;  1BCM A;  4C1N K;  1RBS A;  1U4B A;  1EXQ A;  1IO2 A;  4B9U A;  3MWP A;  3LAL A;  5KPZ A;  2HHS A;  4FJI A;  3D0P A;  4PL8 A;  4OO1 J;  1NGD A;  4QS9 A;  1M90 O;  3WNG A;  1VQ7 N;  3E9O A;  2WTU A;  4JV5 K;  2ITG A;  1TAU A;  4U7B A;  2VWK A;  4OVL A;  4BRH A;  3OS0 A;  3A2F A;  4BAC A;  3AO4 A;  1I94 K;  2P1J A;  4W5N A;  1SZ2 A;  4ISF A;  3SUN A;  2BE2 A;  4FLU A;  3T3F A;  4JK8 A;  3M8P A;  4CJR A;  3T1A A;  5KTQ A;  1Q18 A;  4FK0 A;  2ASO A;  4FM1 A;  4DTO A;  4JD2 A;  5CR4 A;  2UUA K;  3EYZ A;  3K5O A;  5HRO A;  1RDA A;  2A42 A;  3DLE A;  1Z05 A;  2XY6 A;  3MCP A;  2F7T A;  1XHX A;  4FM0 A;  4K25 A;  3VN5 A;  4JI0 K;  3OYG A;  2QWP A;  3C0B A;  3AO1 A;  3AAQ A;  4CCH A;  1C1B A;  5AQJ A;  4WFA L;  4YOR A;  4H0T B;  1RNH A;  4YHH K;  1L3V A;  3MX5 A;  4E89 A;  3E9P A;  2PYL A;  3MDQ A;  4DR3 K;  4CF2 A;  3ITH A;  3NMU A;  4DQR A;  3RTV A;  3HM9 A;  4M3R A;  5KI6 A;  1J5E K;  1LAW A;  4DU3 A;  3ISN C;  1DTT A;  1JLF A;  4FJM A;  1QVG M;  3NAE A;  5BRH A;  5FLX O;  4IOA L;  1JCF A;  3O9Q A;  1U49 A;  4M7Y A;  1D4X A;  4KHU A;  3IFR A;  4JNE A;  2EHG A;  1VQ6 N;  1SL2 A;  3F9M A;  4CJ4 A;  1ASV A;  2B6A A;  4AHS A;  1RDU A;  2HHW A;  3R8E A;  4OGC A;  1RGI A;  1N5Y A;  4Z94 A;  4OKE A;  1TKZ A;  3ZX2 A;  1RDD A;  1SKR A;  4CF9 A;  4R79 A;  4C8N A;  4FW1 A;  3I33 A;  2NRH A;  3G0Z A;  4LFC K;  3THW A;  2G8W A;  4LF9 K;  1WSG A;  2WC9 A;  4IOC L;  5J2M A;  3WXL A;  3CPW M;  3VQ5 A;  5AQG A;  3DRP A;  4KV8 A;  5CHI A;  3BUZ B;  3SJH A;  3ZSY A;  2O8C A;  3C6A A;  3CQX A;  5KGW A;  3AY9 A;  3SNN A;  3C6U A;  4I6M A;  3HBT A;  3J81 O;  4CJU A;  1Y97 A;  4IJA A;  3C95 A;  4E7J A;  2IDO A;  3THX A;  4DS4 A;  2VQE K;  1VSM A;  4NYF A;  1EQY A;  2DFH A;  3NVK A;  4CEZ A;  1HRH A;  2YNG A;  1B9F A;  3PUF A;  4HUE A;  3CQY A;  1YJ9 N;  1U45 A;  1YXQ A;  1KVA A;  1BI4 B;  2QWN A;  3H46 O;  4I9L A;  2ZJR L;  3THY B;  1RBU A;  1SL1 A;  4EP5 A;  3EZ5 A;  4KI6 A;  4BR4 A;  3KHY A;  4B8A B;  1WBD A;  4F2R A;  1SV5 A;  1X3N A;  5HLF A;  1QVF M;  4JI5 K;  5I9E B;  5MLC Q;  2G8F A;  4BRD A;  2I7P A;  1IKW A;  4GMJ B;  1JLA A;  1NWK A;  3MMV A;  1B9D A;  1XHZ A;  4N56 A;  3VMF B;  1DT9 A;  5C10 A;  4EZ9 A;  5C2D A;  3TTF A;  1TYQ B;  4B9Q A;  3QEP A;  2O8F A;  2O8B A;  1IG9 A;  3QNO A;  3E1Y A;  4JRQ A;  3AVA A;  4BRL A;  5AQU A;  4BR9 A;  4J2D A;  1SQK A;  2YCH A;  4FWM A;  3CD6 N;  1BHL A;  4X65 K;  4BE1 A;  3V9W A;  1TYQ A;  4CZI A;  4O5F A;  3O6W A;  1HYS A;  3C65 A;  3FLC O;  2G8K A;  5BRD A;  4DTM A;  4A2A A;  3CCV N;  4EHT A;  4NB4 A;  4A62 A;  4CE9 A;  2O8E A;  1FW6 A;  1LW0 A;  1B92 A;  3V1Q A;  4CHN A;  3NHG A;  3ZLJ A;  4BDY A;  3BF3 A;  3IDH A;  2E1Z A;  1ESV A;  3RRH A;  2Q0U A;  1DEJ A;  4ID5 A;  4DV0 K;  3P31 A;  2P9I B;  2NRZ A;  1ZBL A;  3P4I A;  4DTP A;  1FKP A;  4K42 A;  1WSJ A;  3V1O A;  1W7A A;  4K8Z A;  2X6S A;  4B3R K;  3V6D A;  3SZ2 A;  2OTJ N;  1L3S A;  3ULE B;  4FCY A;  3P5J A;  3L4I A;  1VSK A;  1C0G A;  3DLR A;  4AIL C;  3CJA A;  1LAV A; 
#chains in the Genus database with same CATH homology
 3N4Q A;  3O1B A;  1NGI A;  2CH5 A;  4BC3 A;  1WUA A;  5EX5 A;  1YJN N;  4ILH A;  5TKW A;  3EKS A;  3A8Y A;  5BPN A;  4WFN L;  3CJC A;  3FFK B;  3FZH A;  3MK6 A;  3ID6 A;  5EOY A;  1YI2 N;  1S3X A;  3U4L A;  4BVP A;  3R1X A;  1LOT B;  1U6Z A;  4BR7 A;  3TSQ A;  2F9T A;  4FWQ A;  3G25 A;  5AQM A;  3SBG A;  1K8K A;  5FPM A;  3U9Z A;  5BR9 A;  3VEY A;  4JD2 B;  4CD3 A;  5JLF A;  4IJN A;  2GEM A;  4FPA A;  2W40 A;  4JKG B;  3ZET B;  3BF1 A;  4BRP A;  2P9N A;  4OPA A;  5GAH P;  1W97 L;  3WXM B;  1G99 A;  3OA9 A;  4IZ9 A;  2NNW A;  4EHU A;  3EN9 A;  2HBJ A;  2PAV A;  5AQY A;  3D2F A;  4BRI A;  2IVO A;  3ZEU A;  1W2B M;  3EE8 A;  3EL2 A;  5EVZ A;  2P9U B;  4JKB A;  2H3G X;  3MN6 A;  4MO4 A;  4JN4 A;  1V4S A;  2P9K A;  1QZ5 A;  5AQR A;  1IJJ A;  2YJE A;  4K43 A;  2OTL N;  3SAF A;  2JWL A;  2P9N B;  4CZJ A;  4QS8 A;  1E4G T;  3CJ1 A;  1OKJ A;  2NRT A;  2OAN A;  3VGL A;  3HM8 A;  4DQ8 A;  3G4S N;  4FVU A;  4EAH D;  3TTD A;  4H0O A;  3I56 N;  1KXP A;  3I8B A;  2PBD A;  3CHW A;  3FGU A;  3VES A;  3WEE A;  2V7Z A;  3CJ7 A;  5C15 A;  4JKD A;  2P9K B;  3CF5 L;  1TUU A;  4H5N A;  4PKG A;  4CD1 A;  3M1F A;  4H0Y B;  4K41 A;  4LC9 B;  1NM1 A;  4FWS A;  3H3O B;  4BRE A;  3DXM B;  3O5B A;  2KHO A;  3UKR A;  2UYT A;  2ZF5 O;  1Q81 O;  3CC7 N;  3CCS N;  2NRV A;  4JKF A;  3VOV A;  5EXW A;  1CZA N;  4BRG A;  4C23 A;  4B1Z A;  4IEI A;  3VEZ A;  2KLA A;  2NRR A;  4FWP A;  3VF2 A;  1NGH A;  1YUW A;  4BRN A;  1BG3 A;  5M1F A;  4YOT A;  1S72 N;  2FSN A;  4IFE A;  1QQO A;  2QWO A;  1E4F T;  5GIN A;  4J8F A;  1BU6 O;  3PLA A;  4PKH A;  4H5R A;  4WQ5 A;  4BRK A;  2WBN A;  3P39 A;  4NLC A;  3IMX A;  4CBX A;  1JCE A;  1K8A O;  3CI5 A;  3ENH A;  5AFU A;  3J8A A;  3WT0 A;  3FE1 A;  4YDU C;  3CMA N;  2GWK A;  3WUH A;  3DAW A;  1NGB A;  4BC2 A;  2HBL A;  3BP8 A;  1IG8 A;  5M1Q A;  3HZ6 A;  2I7N A;  3H6E A;  2A5X A;  2YI1 A;  3KWI A;  3VEV A;  3T7Z A;  5FPE A;  3A5L C;  3O9T A;  4KH5 A;  3TSP A;  5F2R A;  4IWV A;  1NLV A;  2P9U A;  1HLU A;  4H5W A;  4EIA A;  5CE3 A;  3WQT A;  5JVG L;  1HKG A;  3NVM A;  3UKU A;  3CC2 N;  3GE1 A;  1SS6 A;  5FPD A;  1BUP A;  1HX1 A;  5GIO A;  1HJO A;  3QDK A;  1K9M O;  2P9P A;  1HKC A;  1XUP O;  1YF5 L;  5FPN A;  2IIR A;  3UE5 A;  3CCU N;  4FSV A;  3W0L A;  4FWN A;  1K8K B;  3GBT A;  3CER A;  4CZK A;  5ADX H;  2QW9 A;  3GG4 A;  5AFU H;  3AGR A;  2VGN A;  2ZJP L;  3EO3 A;  1P90 A;  3DWL A;  4BRQ A;  1ATN A;  1YHQ N;  4UY8 O;  1MA9 B;  3O9U A;  3TU5 A;  4YOY A;  4RWT A;  3A0I X;  3H45 C;  3O80 A;  4F9O A;  2VYP A;  3M6G A;  4FOI A;  4GV9 A;  3W3D A;  2QWM A;  4JK7 A;  2E1Y A;  1NJI O;  5KPR A;  5AQH A;  3S41 A;  3L4Q A;  1Y64 A;  1MDU B;  1GLB G;  1YJW N;  1QQM A;  1X3M A;  4IDH A;  5AQN A;  4JAX A;  3VGK A;  1OVY A;  1VQM N;  4O8U A;  3DLL L;  1H1V A;  5JMV A;  1NGF A;  4HTL A;  3CCL N;  1VQL N;  2P9S B;  4CZE A;  3ZX3 A;  4B1W B;  3IUC A;  5C12 A;  2HBK A;  2E20 A;  3LDN A;  3B8A X;  5F0X A;  3IKM A;  2ASP A;  4BR0 A;  1VQN N;  3HOS A;  1U2V B;  4IO9 L;  3Q7C A;  5LJV A;  3SLC A;  2KKZ A;  4JKE A;  2YHY A;  1VQ9 N;  2QEX N;  2GTD A;  1EO1 A;  1NGC A;  3TPQ A;  3ULE A;  3DXM A;  1GLA G;  3G6E N;  2VWB A;  3GDQ A;  4IO8 A;  5BN9 A;  4A57 A;  2ASM A;  4MDB A;  1LCU A;  2PFU A;  3CME N;  3MWT A;  4GNI A;  4BRF A;  2QXL A;  1O13 A;  3FR0 A;  3HSC A;  4FOE A;  4B1Y B;  3BEX A;  4DKW A;  4WQ5 C;  3LDQ A;  4EFH A;  1U2V A;  2YX6 A;  5M1P A;  4ISE A;  1R59 O;  3QBW A;  4FL9 A;  5BN8 A;  2J4R A;  3DXK B;  2CH6 A;  5AZJ B;  2Q31 A;  5E84 A;  3VEO A;  1ZXO A;  4BR5 A;  1Q82 O;  4C1N K;  5JVH L;  4GV3 A;  2Q97 A;  2HST A;  1ILY A;  1ATR A;  2Q0R A;  2GEL A;  1ZBS A;  3MX2 A;  2ITM A;  2BUP A;  3GL1 A;  4E1J A;  3SAH A;  1N8R O;  5GAE P;  1WOQ A;  3MWP A;  1KC8 O;  3CC4 N;  4FWO A;  4BRA A;  2IVN A;  5KPZ A;  4BC5 A;  3AAR A;  4OPH A;  5C0Y A;  3T69 A;  4PL8 A;  2E2O A;  4OO1 J;  2CGJ A;  2YJF A;  2A3Z A;  3VPZ A;  4G9Z A;  1NGD A;  4QS9 A;  2HF3 A;  1XC3 A;  3K9K A;  5AQF A;  5AQZ A;  1P8Z A;  5M1N A;  3E9O A;  5AQK A;  5LY3 A;  1M90 O;  1VQ7 N;  1BOT O;  3UKU B;  4U7B A;  1GLE G;  1YIT N;  3ENB A;  1M1K O;  4BRH A;  2YHW A;  3CPE A;  3U8X A;  2RHK A;  3VF4 A;  3ID8 A;  2D1K A;  3P38 A;  1SZ2 A;  3D2E A;  4ISF A;  5B8H A;  3QFU A;  3WXI A;  3O9S A;  4JK8 A;  5AZJ A;  4B1X B;  3LM9 A;  3CCM N;  4M7X A;  4FO0 A;  1Q18 A;  3QBX A;  4WCE L;  2FF6 A;  1QHA A;  2ASO A;  4BG8 A;  1VQP N;  4C1N I;  3WXJ A;  1MWK A;  4JD2 A;  5CR4 A;  5AQV A;  3RSE A;  1BA0 A;  4RTF D;  5GAD P;  2E2N A;  3D2E B;  2A42 A;  4H5T A;  5DM7 L;  3UB5 A;  2HOE A;  1Z05 A;  5M1K A;  3H1V X;  2AP1 A;  4CBU A;  3VEX A;  4BVO A;  1J6Z A;  3WXK A;  3D2F B;  4A59 A;  2CGK A;  3ZEU B;  1JCG A;  2F7T A;  1VAZ A;  2V52 B;  3MCP A;  3O1W A;  3SAG A;  4A5B A;  4WF9 L;  4WYB A;  4K25 A;  3RSE B;  2D0P A;  2E2P A;  3O08 A;  3FZF A;  2QWP A;  3C0B A;  3L0Q A;  5KQD A;  4MDA A;  4DHY A;  2BH1 A;  4BQZ A;  5AZI A;  4CZG A;  3AAQ A;  2A6A A;  2FSK A;  2RE2 A;  5F1X A;  4CZM A;  3HOT A;  2D0O A;  5AQJ A;  4WFA L;  2Q2R A;  4YOR A;  4YOW A;  4BRM A;  2E2Q A;  2IVP A;  3EE9 A;  4I6M B;  2AA4 A;  5M1O A;  3A5O C;  4H0T B;  1KQS M;  5TKY A;  1JJ2 M;  3MX5 A;  3E9P A;  3KK7 A;  3MDQ A;  2FF3 B;  4IEE A;  4JKH A;  3NMU A;  2F9W A;  5HOO A;  4A5A A;  5AZI B;  4KBO A;  4A61 A;  4FWR A;  3KZB A;  4GY2 B;  4FWK A;  2NRW A;  3C6H A;  4CZL A;  3D6R A;  3E66 A;  4YOX A;  1DKG D;  3LDO A;  4BRC A;  3OHR A;  5EY4 A;  3HTV A;  1QVG M;  2HBM A;  4NLB A;  2HMP A;  2ZGZ A;  5BRE A;  3F2K A;  2FSJ A;  2CGL A;  4XEI A;  5BRH A;  3VEN A;  4IOA L;  4H0P A;  3JS6 A;  4YOV A;  4JKC A;  3O8M A;  4ISG A;  3ZYY X;  1JCF A;  3CJB A;  1K73 O;  3O9Q A;  1GLL O;  4M7Y A;  1D4X A;  3IFR A;  5BPM A;  4JNE A;  1DGK N;  5ADX A;  3TSU A;  1BA1 A;  3E9L A;  4JKA A;  1VQ6 N;  4CZH A;  5KPT A;  3O4W A;  1YIJ N;  2P9L B;  1MWM A;  3H1Q A;  3F9M A;  3ZX0 A;  3J7Z O;  5AQS A;  1RDU A;  3R8E A;  5C2F A;  1RGI A;  2QM1 A;  4WQ4 A;  4H5V A;  4DB3 A;  4Z94 A;  3CXC M;  3ZX2 A;  2QWQ A;  4YOU A;  4R79 A;  4MO5 A;  3I33 A;  4XH5 A;  5H1S Q;  2WFB A;  2QI2 A;  2NRH A;  4BGB A;  4JHD B;  4KH6 A;  3KWG A;  2WC9 A;  2NLX A;  3MN5 A;  4IOC L;  4JKG A;  3CJ9 A;  3ZET A;  4BR2 A;  1BWF O;  5AQQ A;  3R9P A;  3WXL A;  3CPW M;  3GOI A;  2NZT A;  2V7Y A;  1KAZ A;  4U67 L;  5AQG A;  1NGJ A;  1HPM A;  3Q7B A;  3QFP A;  5CHI A;  3BUZ B;  3UKR B;  3SJH A;  3I55 N;  5ELZ A;  3C6A A;  3CQX A;  1TUY A;  3CCJ N;  3ATV A;  1Q7Y O;  2QTD A;  2DPN A;  1Z6R A;  3H3N O;  2GWJ A;  3AY9 A;  3FZM A;  4IOX A;  3QML A;  4HWI A;  1NGE A;  1QQN A;  5JLH A;  5GIP A;  1QZ6 A;  4I6M A;  4M63 C;  3HBT A;  2JWK A;  4DCH A;  2ZWH A;  1KAX A;  1YVN A;  1NMD A;  4IJA A;  2ZGY A;  5BRF A;  3SK3 A;  2HF4 A;  3K9J A;  4BC4 A;  1EQY A;  3NVK A;  3U9D A;  4MLE A;  4A2B A;  1NGG A;  1HUX A;  4CJ7 A;  4BG9 A;  3PIP L;  5AQX A;  3CQY A;  4CZF A;  1YJ9 N;  1YXQ A;  3A5M C;  5DM6 L;  2QWN A;  3H46 O;  2ZJR L;  1BDG A;  5BPL A;  3TTC A;  4ILG B;  3VF6 A;  4L3Q A;  1VQ5 N;  1ZC6 A;  3CCE N;  2W41 A;  3O9R A;  4AM7 A;  4KH4 A;  3ENO A;  4GV6 A;  3LM2 A;  4IXC A;  2EWS A;  1GLC G;  2P9P B;  1YAG A;  2P9I A;  2Q36 A;  3A5N C;  3DXK A;  3HRG A;  3R3L A;  1VQ4 N;  1GLF O;  3SMS A;  3C7N A;  4QS7 A;  4BRO A;  1C0F A;  1VQ8 N;  4BR4 A;  3OW2 M;  2E88 A;  1SAZ A;  3KHY A;  3OBW A;  1X3N A;  2ZJQ L;  4Y0W A;  1QVF M;  3G71 N;  1VQK N;  4JEP A;  4MLH A;  1RFQ A;  5I9E B;  5MLC Q;  1GLJ O;  4BRD A;  2I7P A;  4WFB L;  4JK9 A;  1T6C A;  1NWK A;  1RDW X;  3MMV A;  5AR0 A;  4ILJ A;  4PKI A;  3VMF B;  1DT9 A;  2WUS A;  5C10 A;  3WEE B;  3VTH A;  3VER A;  3FZL A;  4BQL A;  3TTF A;  5C2D A;  1NGA A;  4CBW A;  2BTF A;  4GVE A;  1TYQ B;  4B9Q A;  3L6Q A;  5JIC A;  3PIO L;  3E1Y A;  1ATS A;  1KAY A;  1KD1 O;  3DJC A;  4PL7 A;  3CCQ N;  3RVC A;  1V4T A;  1T3V A;  2P9S A;  1BO5 O;  3D7E O;  3N4P A;  3M3Z A;  3SMP A;  2YHX A;  2A41 A;  5AQU A;  4AF1 A;  4BR9 A;  2GUP A;  4BRL A;  1VQO N;  4WQ4 C;  1SQK A;  2YCH A;  3KVG A;  4FWM A;  3R6M A;  3CD6 N;  4H0V B;  2QWL A;  2QWR A;  1HKB A;  2QA4 N;  1XQS C;  4CI6 A;  1TYQ A;  4CZI A;  4O5F A;  3O6W A;  5AQO A;  4H0X B;  3C65 A;  3FLC O;  5AQP A;  4BY9 C;  3VET A;  5BRD A;  2GX9 A;  3WQU A;  3MN9 A;  3VTI A;  5GAG P;  4YDU A;  2FLO A;  4JHD A;  4A2A A;  2FXU A;  3CCV N;  4EHT A;  4PHT X;  3EZW A;  4NB4 A;  4A62 A;  4XH1 A;  1S22 A;  4B1V A;  3MCA B;  3SBT A;  1GLD G;  3MN7 A;  1T6D A;  3LDP A;  5HL7 L;  1Q86 O;  4BGA A;  2V51 B;  3BF3 A;  3FZK A;  3IDH A;  4O8K A;  2E1Z A;  1ESV A;  2VCP A;  3M5R A;  2Q0U A;  1DEJ A;  3C7N B;  3F5T A;  3HI0 A;  4FWL A;  1T44 A;  2VGM A;  3P31 A;  3EKU A;  2P9I B;  3CCR N;  2NRZ A;  2NRX A;  3P4I A;  1X9J A;  3ATU A;  3OBY A;  3AGK A;  4NO7 A;  3VGM A;  4AM6 A;  4K42 A;  3CIP A;  2D4W A;  3LDL A;  4H03 B;  4FPB A;  5AQL A;  5AQW A;  4B1U B;  3VEW A;  2OTJ N;  2Q1N A;  2A40 A;  3AAP A;  3ULE B;  5AQT A;  3LL3 A;  3QB0 A;  3L4I A;  2E8A A;  3QIC A;  4XH4 A;  5AQI A;  1C0G A;  5KQ8 A;  5LJW A;  5E26 A;  2P9L A;  3CJA A;  3JXU A;  4RCH A;  3CET A;  1NBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...