3AAQA

Crystal structure of lp1ntpdase from legionella pneumophila in complex with the inhibitor arl 67156
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
353
structure length
349
Chain Sequence
b'KHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
molecule tags Hydrolase
source organism Legionella pneumophila
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
total genus 106
structure length 349
sequence length 353
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aaqA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aaqA02
1ATSA 2CGJA 1HKBA 5AQFA 3WXLA 3DXKA 3IUCA 1IG8A 2KHOA 1HKCA 1BU6O 2P9LB 3M6GA 4BRDA 3A5LC 4EIAA 3ZETA 3GE1A 3WQUA 1X3MA 3HBTA 3R8EA 3MN6A 5AQNA 1QHAA 1Z05A 5AQQA 3QDKA 1Y64A 4FWLA 5AZIA 3RSEB 3SMSA 5EXWA 4FWNA 2QWNA 4FSVA 3FZKA 2Q97A 1T6DA 2YI1A 3UE5A 1BDGA 5AFUA 1QZ5A 3SMPA 4BGAA 3O8MA 3I8BA 3BF3A 4JHDB 4DQ8A 1BOTO 2HF3A 2P9UA 4Y0WA 1JCEA 4ISGA 5LJWA 4BRQA 3GDQA 1EQYA 4CJ7A 4YDUC 5BN9A 1TYQB 3A8YA 1IJJA 3AAPA 3JXUA 2P9KB 5FPMA 3CJ7A 2D4WA 3VGMA 3MN7A 3KZBA 3QICA 4FL9A 3G25A 3CJBA 3ZEUB 4CI6A 5BR9A 5F1XA 3U9DA 1QZ6A 5EY4A 3FGUA 2E1YA 3WEEB 3FZMA 3W0LA 1T44A 5E84A 1BA1A 4PKHA 4CD1A 3R9PA 3HI0A 1NGHA 2H3GX 4DCHA 3VEZA 4J8FA 3L4IA 3VEVA 2HOEA 1NGIA 4H5TA 4AM7A 2GWKA 1DKGD 5EOYA 5JLHA 3D2EB 3BP8A 1NGJA 3GL1A 3RSEA 1BG3A 3IFRA 3C7NB 1GLDG 3H3OB 4BR2A 3ZX2A 4CZJA 1K8KB 1NGGA 3ATVA 3CERA 4CBXA 2J4RA 2VYPA 3UKUB 3LDLA 3LDQA 4H03B 3UKRA 2E2PA 5AQRA 4A2AA 3MK6A 3CJ1A 2V7ZA 2ASPA 1HLUA 5BRHA 4CZHA 1HKGA 4E1JA 4O8KA 3VPZA 2CGKA 4I6MB 5JMVA 2NRHA 2Q31A 4FO0A 3GBTA 4B1WB 3HSCA 3QB0A 3WQTA 3VESA 2QWMA 4QS9A 3ULEA 3H3NO 3HZ6A 3VEXA 1WUAA 2A3ZA 4FWPA 3D2FB 4RTFD 2QWQA 4JAXA 5AQOA 4M7XA 4CZGA 2D0PA 3CJCA 3H45C 3TU5A 1ZBSA 3ID8A 1J6ZA 2DPNA 2V52B 5B8HA 5JLFA 1DGKN 3R6MA 1D4XA 3EZWA 2E2NA 1X3NA 4RCHA 4FWKA 2P9NA 4FOEA 4EHUA 3VEWA 2VWBA 2ZF5O 3MMVA 3VGKA 1RFQA 5TKYA 3WXJA 3QMLA 3AARA 2FLOA 5AQSA 1RDWX 3LDOA 2YHXA 4FWSA 5AQWA 4BGBA 2Q0RA 3VOVA 3DXKB 2IVOA 2W40A 3AY9A 3VGLA 3LDNA 4H5NA 1TUYA 1MWKA 4BR7A 1QQNA 2ASOA 5AQIA 2P9PA 5AZJB 1GLCG 2WUSA 1SZ2A 5AQXA 2QM1A 4JNEA 4EAHD 3MDQA 4BG8A 3H1VX 3I33A 4FOIA 3LDPA 4FWMA 5AQMA 5ADXA 4EHTA 3O1WA 3KHYA 3A5NC 3M1FA 1YAGA 3O4WA 2E2OA 3VF4A 2I7NA 3FZFA 3WXIA 4BC3A 4JD2B 5KPZA 4BVPA 3O08A 3U8XA 3DAWA 1NGEA 3EN9A 1Z6RA 4WYBA 1BA0A 4CZMA 4XH4A 1U2VB 3C7NA 3WUHA 5EVZA 2P9SB 3D2EA 4BQZA 2GEMA 3CETA 3QFUA 4H0OA 1NMDA 2Q1NA 4FPBA 2V7YA 3H46O 1K8KA 1OKJA 3IDHA 1RGIA 1S3XA 5AQTA 1HPMA 1HX1A 5KQDA 1YUWA 4BRHA 1MA9B 2YJFA 4GNIA 3DXMB 1Q18A 4FPAA 3LM9A 5BRFA 2P9PB 1R59O 4H5WA 3WXKA 4BR5A 1NGAA 3H6EA 2P9IB 1QQOA 2FSNA 4KBOA 1GLBG 2PBDA 5BRDA 5LY3A 3EKSA 3L0QA 2CGLA 3UKUA 2BTFA 4C23A 4XEIA 5AQKA 3FR0A 4PL8A 4CZIA 4IJAA 3CJ9A 5LJVA 2F9TA 4RWTA 1NWKA 1SAZA 3BF1A 5FPEA 4BRLA 2A6AA 5FPDA 3WT0A 2P9LA 3O5BA 3P4IA 1XQSC 5BN8A 2IIRA 4L3QA 3QBWA 5AQVA 1NLVA 3FZLA 2YHYA 4FWOA 4PKGA 4CZLA 1ZXOA 2ITMA 3VENA 2EWSA 1ZC6A 3J8AA 1YVNA 1TUUA 4IWVA 4K41A 1BWFO 3HM8A 4ISEA 4BVOA 4BC5A 3CQXA 3VETA 4NB4A 4FWRA 4IZ9A 5BREA 2FXUA 4BQLA 1G99A 2BUPA 5KQ8A 3H1QA 2E2QA 4NO7A 1MDUB 4MO4A 3EO3A 1GLEG 2UYTA 3CHWA 3O6WA 4B1UB 1HJOA 3UB5A 4A2BA 5E26A 2GELA 5JICA 4H0VB 4H5RA 1MWMA 3B8AX 3EKUA 2P9KA 3L6QA 2NLXA 4MLEA 3VF2A 5BPLA 4PKIA 1NGBA 2IVNA 4FWQA 1SQKA 3AAQA 2GTDA 2P9IA 2D1KA 4CZEA 4XH1A 1JCFA 3ZEUA 3VEYA 2FSJA 1LCUA 4K25A 3O1BA 2FSKA 5FPNA 4JD2A 4MO5A 1KAZA 4YDUA 3OHRA 4HTLA 1ATNA 1X9JA 4ISFA 3VERA 4B1ZA 4B9QA 3TPQA 1CZAN 3ATUA 4K43A 4BRPA 2IVPA 5AQYA 1P8ZA 4BG9A 4BRFA 4M7YA 2V51B 1LOTB 2AP1A 4CZFA 4F9OA 2HF4A 1ESVA 2FF3B 1C0FA 1NGCA 3FE1A 3M3ZA 3BEXA 4BRCA 2ZGZA 1WOQA 2P9SA 1BUPA 2HMPA 5F0XA 4H5VA 1XC3A 2ASMA 4QS8A 3ZETB 4BC2A 1GLFO 3S41A 4H0YB 4WQ4A 5CE3A 4H0PA 4BROA 1E4FT 1XUPO 1KAXA 3CIPA 5AQGA 4CBWA 3F9MA 4H0TB 2NZTA 1ATRA 3GOIA 5ELZA 5AQLA 5AQPA 3ZX0A 4BR4A 1TYQA 2ZGYA 4CD3A 2Q36A 4A61A 5AQJA 2QXLA 2P9UB 1NGFA 4WQ5C 3SJHA 3QFPA 4B1VA 3LL3A 1U2VA 3DXMA 4DHYA 4M63C 1T6CA 5BPMA 4K42A 3CI5A 4GY2B 2CH6A 2YJEA 5BPNA 2QWPA 4BR0A 1U6ZA 2GUPA 4BRKA 2D0OA 3FFKB 5AR0A 4AM6A 4BRGA 5AFUH 4DB3A 1V4TA 1KXPA 4EFHA 3U4LA 3QBXA 1C0GA 2YHWA 3VEOA 3MCPA 3DJCA 3A0IX 1DEJA 2F9WA 2QW9A 1NBWA 2Q2RA 3CQYA 4BRIA 4WQ5A 3ENHA 2E88A 1NM1A 3D7EO 4BRNA 2GWJA 3C0BA 4HWIA 5AQHA 3SK3A 1HUXA 1JCGA 4MLHA 3MN5A 4PL7A 2I7PA 4WQ4C 1KAYA 4Z94A 1H1VA 4IO8A 4B1YB 4BRAA 4CZKA 5EX5A 3VF6A 5KPRA 1YXQA 4I6MA 5ADXH 3DWLA 4BRMA 2FF6A 4QS7A 4BR9A 5KPTA 3IMXA 3MN9A 2AA4A 2ZWHA 4B1XB 2W41A 3UKRB 4XH5A 1GLJO 5AZJA 4H0XB 1NGDA 2A41A 3A5OC 1V4SA 3CJAA 4A62A 3ENOA 4LC9B 1BO5O 1S22A 3SLCA 2A40A 4BC4A 2E20A 3W3DA 4CBUA 2VCPA 3FZHA 2P9NB 2QWLA 2E1ZA 3EL2A 3ZX3A 3U9ZA 3A5MC 2A42A 4IJNA 1QQMA 5AQZA 1GLLO 2Q0UA 2CH5A 3KVGA 4O5FA 4JHDA 2OANA 4BREA 3LM2A 3JS6A 5F2RA 1GLAG 2QWRA 3ULEB 2A5XA 3HTVA 3O80A 5AQUA 1E4GT 5I9EB 3GG4A 5AZIB 2QWOA 3D2FA 4IXCA 3WEEA 3BUZB 2E8AA 4JN4A 2PAVA 2YCHA 3FLCO
chains in the Genus database with same CATH superfamily
3P5JA 2NRWA 1HKBA 4CECA 2YHBA 5AQFA 3DXKA 1IG8A 1BU6O 4ID5A 4CJ4A 4DR3K 3GE1A 2O4IA 4IDKA 3MN6A 1JXBA 2QTDA 5AQNA 2FBVA 4FWNA 5M1KA 2QWNA 2RE2A 3FZKA 4JI1K 4BDPA 5AFUA 4B3RK 5E41A 3SMPA 1GOAA 3I8DA 3I8BA 4L8RB 2HHXA 4HCBA 2QEXN 4DQ8A 2OTLN 4C8LA 3SCXA 4PHTX 4AHRA 1VRUA 4YDUC 1TYQB 3A8YA 3KK7A 4AHVA 1OVQA 3AV9A 1IJJA 4CEOA 1LWCA 3QEPA 2Y1IA 3VGMA 3MN7A 3PIOL 3IAYA 5HRPA 4KI4A 3QICA 3EEQA 3G25A 5LL6Z 3CYMA 2OTJN 1QZ6A 3VQ5A 3WEEB 1VQLN 1BISA 3TTDA 1T44A 5E84A 4DR5K 2QA4N 1QSYA 3MWTA 3VTIA 1KCFA 4CJQA 3L4IA 5SWMA 1WB9A 1W0HA 5DK5A 4AM7A 1S1TA 2ZM6K 3BGRA 2GWKA 1L3UA 4XIUA 5JLHA 3D2EB 4CK2A 3BP8A 3GL1A 4BR2A 2O8BA 3T1AA 3T1YK 3WNGA 2GX9A 3ZSVA 3PX4A 3OA9A 4E1MA 4DSKA 4JYAK 2X6NA 4YOUA 4I6MB 5JMVA 1N33K 4GVEA 4FO0A 3OYEA 4PY5A 1BIUA 2XRIA 3WQTA 1EP4A 5CR4A 3ULEA 3H3NO 1VHXA 4KH5A 3KKRA 4F3TA 3D2FB 2XHBA 4CZGA 4M7XA 3H45C 4WF9L 3ID8A 1J6ZA 3N4QA 1EXQA 4IG3A 4FYDA 3L2QA 1KLNA 2Z1HA 3V1RA 4KHUA 4FK4A 5GIOA 2P9NA 4FOEA 3M8RA 3QIOA 2R7YA 1RFQA 3L8BA 1RT7A 1YT3A 2FLOA 1WSHA 5AQSA 4M3UA 3B6PA 1RT4A 4PWDA 4FWSA 4KHNA 4KKOA 2Q0RA 3DXKB 2FC0A 2IVOA 3AY9A 3VGLA 3D45A 1VSEA 3LDNA 3VQBA 3KLGA 1NU0A 1OH5A 1UWBA 5AZJB 1TK0A 1GLCG 1S9GA 1SZ2A 5AQXA 3MDQA 3V4IA 1HJRA 1BI4A 1CLQA 2WONA 4FLXA 4FOIA 1S72N 3O1WA 3FFIA 3A5NC 1BI4B 3NE6A 1HMVA 3CC2N 3O4WA 4B9LA 3ZSRA 3VF4A 1NJZA 2I7NA 4I2PA 3FZFA 4A5AA 3M5RA 4WFAL 1NK4A 3EN9A 3SUQA 2VG7A 4X62K 4WYBA 1YTUA 5FRNA 1D9DA 1B9DA 1BCOA 4X66K 2OPQA 3WUHA 3AO1A 1FKPA 2P9SB 3AVKA 2RKIA 3LP3A 4BY9C 2IGIA 4H0OA 4UY8O 3K9JA 4FPBA 4O0JA 1OKJA 2YV0X 5AQTA 3IDHA 1U4BA 4BRHA 1NKBA 1SL2A 1NG9A 2YX6A 1NK9A 4C1NK 4H5WA 2VWKA 1M1KO 4BR5A 3CF5L 1NGAA 3H6EA 4IBNA 3NVMA 2E5LK 1QQOA 3HL8A 4R5PA 3CCSN 5LY3A 4DV7K 3U6FA 3K57A 3V9WA 3LWLA 5DMRA 3ZSOA 3LPUA 3THYB 4IJAA 3ZSWA 5J2QA 1BGXT 1SAZA 4OKEA 1FW6A 3THYA 3VQPA 3CCMN 4L3QA 3S3MA 3QBWA 1NLVA 1BHLA 5CYQA 3I0SA 1VAZA 2UU9K 1LAWA 3VQ9A 1YVNA 3PIPL 1X1PA 4JI6K 4K41A 5CYMA 4CEDA 3VETA 4IZ9A 4K0KK 1G99A 4JK9A 1NOZA 1GOCA 3H1QA 4NO7A 3RRGA 4DF4A 3CHWA 1RDBA 4MQ3A 4WE1A 5GIPA 4KB0A 1ZBUA 2B4JA 1VSIA 2GELA 4H0VB 3PO5A 3VF2A 3EKUA 3L6QA 1A5VA 4MLEA 4DQSA 3SPYA 4ICLA 1NGBA 2IVNA 4NLCA 2D1KA 3OYJA 4M3TA 1NMNA 3VEYA 2FSJA 4CJVA 4DR7K 4K25A 2FBTA 2O4GA 5FPNA 2F8TA 1KLMA 1QSSA 5FDLA 1K8AO 4MO5A 1T3VA 4C8KA 3S9HA 1K6YA 1OH6A 1ATNA 1X9JA 3VERA 4CJSA 4GV6A 1X9WA 4CJ3A 1CZAN 3ATUA 3QNNA 1TK5A 4BRPA 1P8ZA 1VQNN 1XNQK 3WNFA 4W5NA 4O0IA 4CJRA 3I0RA 2O8CB 3NCIA 1MU2A 3L2WA 4CZFA 1O13A 3HT3A 4F9OA 3OS2A 3U3GA 3NGZA 1UAXA 4B9TA 3THVA 2FF3B 4DTXA 3FE1A 3M3ZA 4F2RA 3SUNA 1IBKK 5DM7L 5CZ1A 3PO4A 3O4QA 1WSEA 2ASMA 1TKTA 4FLYA 1SV5A 1GLFO 3S41A 1Q82O 1NK6A 4H0PA 1HNWK 2VWJA 2VGNA 4BE0A 4B08A 3HM9A 5ELZA 1FKOA 3VQQA 1TYQA 3KJVA 3LWMA 3NBPA 3TTCA 4DTRA 1RBTA 3K5LA 1NGFA 3TAPA 1VK0A 2KFNA 4JKGA 1SKWA 4HUGA 4FLUA 3C95A 1T6CA 3CI5A 3HOTA 4GY2B 1RBSA 1U45A 4JI8K 4BR0A 1OVYA 2GUPA 3FFKB 4AM6A 4BRGA 3LAKA 3PV8A 3E9LA 3VA3A 1RDCA 3ZSQA 3DM2A 3G10A 3MCPA 3AO5A 3A0IX 1I39A 4JKEA 3AO4A 1DEJA 1EX4A 1KFSA 1CXUA 2B6AA 4Z4IA 1VSMA 4QOZB 2OYQA 3C0BA 4HWIA 3VQ7A 2HHSA 1HUXA 2F8SA 3DLLL 2W42A 4WQ4C 1KAYA 4IO8A 4CIEA 5MLCQ 4I6MA 3DWLA 3C6AA 4QS7A 4BR9A 5KPTA 1QVFM 3P1GA 2ZWHA 4I7FA 1Q9XA 5AZJA 3P31A 2RHKA 4F3OA 3A5OC 3ENOA 1BO5O 1S22A 2GV9A 4E7HA 4DG1A 5GAEP 5CHIA 5C24A 2P9NB 1C0TA 1N32K 2O8DA 2A42A 4IJNA 3AVFA 4AH9A 2CH5A 4FM1A 4FJHA 4JHDA 2OANA 1IV0A 3THWA 1NJIO 3JS6A 5F2RA 3VQAA 2DFFA 2XY6A 2A5XA 3OYMA 1J5OA 3SAGA 3CCQN 3RMCA 1QVGM 5AZIB 4RW6A 3D2FA 3WNHA 1C6VA 3KK1A 4JI4K 1JLEA 1R0AA 3SUPA 2PAVA 5IT9O 4E3SA 3IUCA 4EIAA 5FRMA 3VN5A 1RBVA 5AQQA 3QDKA 4FWLA 3SMSA 4OPHA 5EXWA 1RT6A 4FSVA 4W5TA 3AA4A 3CC4N 4FVMA 3PLAA 3UE5A 3OYHA 4GW6A 4BGAA 3O8MA 4B8CA 3SI6A 4HVJA 1ITGA 2P9UA 1VSLA 4OPAA 4ISGA 5LJWA 1ZBHA 3GDQA 4FVUA 1EQYA 1RTIA 4CJ7A 3HXMA 4GVMA 3SBTA 3RMAA 1D5AA 3JXUA 4CEFA 4JKAA 2YNIA 1TAQA 4IKFA 3SQ0A 1YF5L 3KZBA 4FL9A 5BR9A 3CJBA 3U9DA 3V1QA 3FZMA 3KLFA 3W0LA 3OYDA 3TTFA 3R9PA 1KFDA 2BH1A 3E01A 3HI0A 3E66A 4DUZK 3MWPA 4M41A 1X9SA 4FJIA 4M42A 4J8FA 3G6EN 3VEVA 2HOEA 1NGIA 4JK7A 4H5TA 3JSMA 5C0YA 4ID1A 2HVIA 1DKGD 1XMOK 4E89A 4YOWA 1NK8A 1TK8A 4BE2A 1IKYA 3C7NB 1GLDG 3VQ8A 3ZX2A 4DWIA 1VQKN 3CERA 3LDQA 1Z26A 4H03B 2E2PA 3CJ1A 2V7ZA 2NNWA 4DQPA 4CZHA 1HKGA 4O8KA 2CGKA 5J1EA 2IOCA 3LANA 1N6QA 1XMQK 3QB0A 1WBDA 1WSFA 4O4GA 2LSNA 4W5OA 5A2QO 2JWKA 4QS9A 3VQEA 4CFCA 4LFAK 4DFJA 3SV3A 3HZ6A 4B8AB 4FWPA 5AQOA 4B3OA 2JGUA 1ZBSA 1UA0A 2DPNA 5B8HA 4RCHA 4FWKA 2IC3A 3AVIA 4E7IA 4FJNA 4GKJK 3SBGA 4F8RA 3O9TA 3AARA 2KLAA 1T8EA 3AVMA 1KVCA 1RDWX 2OPPA 2YHXA 5AQWA 4O5BA 3QIPA 2EHGA 4LH5A 3LPTA 3THXB 3KK2A 2X78A 2P9PA 5HBMA 4RW9A 4EZ6A 2QM1A 4CEQA 4CHZA 3NH1A 4DR1K 5IWAK 1HRHA 4KB1A 3MAQA 3DLBA 1KC8O 1NNEA 3KHYA 1DT9A 1F21A 3QEVA 4MDAA 3B6OA 2E2OA 1D8YA 4KV8A 4BC3A 3PY8A 1JLQA 4NYNA 4BVPA 4FLZA 1RTHA 2NRZA 3U8XA 1JLGA 1NGEA 4CF9A 4DFMA 4C1NI 5JS1A 1YITN 3CCLN 2O8FB 1BA0A 3HPOA 2Z1IA 4XH4A 4JKGB 3BY5A 1J9AA 3OYAA 1SS6A 2GEMA 3OBYA 1XHZA 3QFUA 3K9KA 2WOMA 5C10A 4FJMA 5J2NA 1K8KA 4LF6K 2EX3A 2NRXA 4N56A 1S6QA 1OH7A 4GNIA 3DXMB 1Q18A 3IG1A 5BRFA 2ZJRL 5JVGL 3TANA 3PX6A 2YNGA 2YKNA 2P9IB 4LF5K 4Z4GA 3SJJA 2FSNA 4RW4A 2BTFA 4XEIA 2HW3A 3J81O 4DSFA 2G8FA 4CZIA 3P38A 2O8BB 5LJVA 3D0PA 4RG8A 5FPEA 3QETA 3HRGA 1I94K 4BRLA 1SUQA 4IEIA 2A6AA 3WT0A 3P4IA 1XQSC 1Y97A 1ZBIA 3FZLA 2YHYA 4PKGA 2ITMA 3TSUA 3V1OA 2EWSA 4DQIA 2HBJA 1TUUA 1C1BA 4IWVA 1FK9A 1BWFO 4WCEL 3R1XA 4GKKK 2E4LA 3V9UA 4GV9A 2XY7A 4FWRA 3Q7CA 5BREA 3TAQA 1VQ7N 2JLEA 1BQMA 2FXUA 4BQLA 3RVCA 2OA8A 4F2SA 1ASWA 5HOOA 4HCCA 2E2QA 4HUEA 4MO4A 4CHOA 4CGHA 2OPRA 3O6WA 4JK8A 3L2RA 3UB5A 3TR8A 4KHYA 4ZTJA 3AA3A 3DLRA 4CFAA 4IFEA 2P9KA 2RN2A 1RCHA 2NLXA 4DV2K 1SL1A 4PKIA 1QS4A 3VQ6A 1SQKA 3AAQA 4OKJA 2NRRA 4XH1A 3ZEUA 5M1PA 3O1BA 2GUIA 4CIFA 4OLBA 3OYFA 4FM0A 4C8OA 4YNQA 1LWFA 2P1JA 3H08A 4AHUA 3CCVN 4RW8A 3ZT2A 1JL1A 1Q81O 1BIZA 5AQYA 3ZT3A 3KLHA 4M7YA 4JI3K 4X65K 2A1SA 3VMFB 2ZD1A 2HF4A 3CXCM 3CCEN 1ESVA 4HUFA 4O8UA 1NGCA 5KGXA 4BRCA 2UXCK 1WOQA 4MFBA 2HMPA 1XC3A 3ZETB 1C0MA 2UUAK 3NF9A 4H0YB 5FROA 1YJNN 3AVLA 4ZTFA 4BROA 1E4FT 4OGCA 4CBWA 3F9MA 4H0TB 1S5JA 4J2AA 1O1WA 3GOIA 3O9RA 5AQPA 3HP9A 4CD3A 3KKSA 4A61A 4FJKA 5KTQA 3SJHA 2KTQA 3QFPA 2PYJA 1U2VA 4JI7K 3VQ4A 3DXMA 4DHYA 4C8MA 4CK1A 4YOYA 4M63C 4KHQA 4K42A 4DU3A 4JI0K 3AGKA 1VSFA 2QWPA 4KRFA 2PYLA 4W5QA 4FLWA 4JRPA 3RMDA 4EFHA 3U4LA 2KQ2A 2XY8A 3R3LA 3SAFA 2YHWA 5JS2A 1J54A 3RWUA 4OVLA 1VQ4N 4ELVA 2QW9A 3CQYA 4ILJA 4BRIA 4WQ5A 3OYKA 5H1SQ 5J2MA 1NM1A 2GWJA 5AQHA 3HOSA 4JRQA 3MN5A 4OGEA 3CD6N 1YVUA 2PFUA 2BGGA 1QE1A 4FZXC 4CZKA 5KPRA 1YXQA 4BRMA 2FF6A 3THXA 1LW2A 3IMXA 3ASMA 3ZT1A 4HTUA 3AVAA 1RDDA 1GLJO 4H0XB 1U48A 2A41A 3T7ZA 4ILHA 3CJAA 4A62A 5GAHP 3CPWM 4BDZA 3CQ8A 5JVHL 3SLCA 3K5MA 2A40A 1EWRA 4JLHA 1XWLA 1EO1A 4EP4A 3PSFA 3TWHA 1TVRA 4E19A 1XC9A 4CEEA 3A5MC 2Q0UA 3KIOA 3KVGA 4O5FA 4ELTA 4FCYA 4DLEA 2HNYA 3LM2A 1REVA 3ULEB 4C8NA 3HTVA 4YORA 2HNDA 2QWOA 3OJSA 1BL3A 3K0SA 3FLCO 1ATSA 4CF1A 4DV4K 3IRXA 4DKWA 3IS9A 2IAJA 2KHOA 1HKCA 1HNIA 4BRDA 3M6GA 1Q9YA 1IKVA 1RTDA 4DFPA 1VQ9N 3ZETA 2VG6A 3HYFA 3M8SA 1S1XA 3R8EA 1HNZK 5AZIA 1QHAA 3RSEB 3V6DA 3ZSYA 2Q97A 1T6DA 4FJ9A 2NRTA 3MXJA 4FJLA 3SQ2A 3QO9A 1IH7A 4I9QA 1C1CA 4LF7K 4Y0WA 1JCEA 3LAMA 4BRQA 2OZMA 4FJ8A 4DUYK 4Q5VA 2BDPA 4B9SA 1D9FA 2RF2A 3AAPA 1NJYA 1IO2A 3TSPA 4LSLA 3ZSZA 3NDKA 2P9KB 5FPMA 4KHWA 2RPIA 4K8ZA 4HHTA 3T69A 4CI6A 3ZEUB 4EP5A 3FGUA 2QXFA 4OPKA 1C0UA 4CGJA 4WFNL 3CM6A 2ZJQL 3AA2A 1NGHA 2H3GX 4DCHA 1HQEA 4LFCK 1W2BM 3NMUA 5EOYA 4KTWA 4OO1J 4FW2A 1NGJA 1LV5A 4AILC 3NH0A 4E1NA 3IFRA 3H3OB 2O8DB 4DV6K 3DRPA 4CZJA 1K8KB 4CJUA 4J2BA 3P83D 4DTOA 2VYPA 3LDLA 5AQRA 3MK6A 5BRHA 4JI2K 1QHTA 5KI6A 4IOAL 2YKMA 1FJGK 4DU1A 1EWQA 2O8EA 1TKDA 2NRHA 3LALA 2Q31A 4B1WB 1JLFA 4CEZA 3VESA 2G8VA 2QWMA 4U7BA 1WUAA 3QEWA 1VQ8N 4CK3A 4IO9L 2D0PA 3CJCA 4M45A 3TU5A 3DLHA 1IKWA 1KRPA 3BDPA 5JLFA 2E2NA 1X3NA 1W97L 4CFBA 1L3TA 3OYCA 3VEWA 3K5NA 3VGKA 1KTQA 4DLGA 1L3SA 4BGBA 3HP6A 3SV4A 3VOVA 4KH6A 3HJFA 4F4KA 5M1OA 4DS4A 3I55N 2YNFA 1YTAA 3OYLA 1MWKA 1W9HA 3MEDA 2ASOA 4MDBA 4DMNA 4KHPK 3A2FA 5GAGP 4LSNA 3M8QA 1XI1A 4JNEA 3P39A 1VQMN 4CGFA 4BG8A 4BWMA 3ZYYX 4CESA 3I33A 5ADXA 4FWMA 1J53A 2GBZA 3L2UA 2Z1JA 2HHVA 1P90A 1YAGA 1J5EK 4JD2B 3QEIA 4OJRA 3OTOK 2D0BA 3DAWA 5C2DA 3DI6A 3CM5A 3DLGA 3AGRA 3LDSA 3AVHA 3CC7N 4J2DA 4CZMA 1U2VB 3EE9A 1HPZA 3C7NA 5EVZA 1IG9A 1QSLA 3HSTB 3CETA 3S3NA 1NMDA 2Q1NA 2V7YA 1NKCA 4FJ5A 1NJWA 1RGIA 1HPMA 1HX1A 1TL1A 1UOCA 1YUWA 4BWJA 5KQDA 1MA9B 4CGIA 2YJFA 1RBRA 3LZIA 4FPAA 3LM9A 3KLEA 2P9PB 1R59O 3WXKA 5M1FA 3OS1A 4IOXA 4DV1K 4NXNK 3ALYA 2PBDA 3EKSA 3L0QA 4A57A 4C23A 1X9MA 2VQEK 3O3GA 4PL8A 3LZJA 3CJ9A 2X74A 5CZ2A 2D0CA 5LMUK 5FPDA 2WC9A 3OVNA 2P9LA 3O5BA 1YJ9N 4DSLA 5BN8A 2IIRA 3MCAB 3F9KA 1HNXK 5HL7L 1UA1A 1OH8A 4FJJA 1ZXOA 1XHXA 3J8AA 2UXBK 2F4VK 1L3VA 1TKZA 3HM8A 4QCLA 4BVOA 3CQXA 1DTQA 3JAMO 1TL3A 4OPJA 1RBUA 1EKEA 4DV3K 3NGYA 1RDAA 2BUPA 4V19S 1A5WA 1HYZA 3EO3A 3T19A 2UYTA 4Y1CA 4CF8A 4B1UB 1HJOA 4FZYA 4A2BA 5E26A 3CMEN 3NFAA 5JICA 4LD0A 4H5RA 1MWMA 5BPLA 3KD1E 4JV5K 4CVNE 2P9IA 1LW0A 1JCFA 4CJFA 3TAFA 3HPHA 1ZBLA 4OX9K 2FSKA 4FK0A 4KPYA 4JKCA 4CFDA 2P51A 1QTMA 3MEGA 1LWEA 1KAZA 5BR8K 4CE9A 4E0DA 3OHRA 4HTLA 4CJTA 4ISFA 4B1ZA 4B9QA 4H8KA 3DLKA 4DU4A 4DF8A 2KW4A 1T7PA 4K43A 4KI6A 1S9EA 3C94A 4N47A 3OYNA 2IVPA 2JWLA 1SKRA 4BRFA 2VQFK 3L4QA 1B92A 3DYAA 4KAZA 3DRRA 3EE8A 2XY5A 3ZCMA 1C0FA 1KD1O 3PSIA 3DMJA 1E3MA 1NK0A 4LF9K 2P9SA 1YIJN 4YOXA 4H5VA 5K14A 4BC2A 2OZSA 1DTTA 3E9OA 3MXIA 3M8PA 4EZ9A 4NCAA 2IDOA 3TARA 1ATRA 5AQLA 2FBXA 3ZX0A 4BR4A 4X64K 4JEPA 2ZGYA 2D0AA 2Q36A 1SL0A 2QXLA 3AVGA 2VGMA 4B1VA 3LL3A 1Q7YO 2ETJA 1ASVA 1WSGA 4Z4CA 3O3HA 3LP2A 5M1NA 3SYZA 5KRSA 3MEEA 2VG5A 5BPMA 4OKKA 1JKHA 3CCJN 2NUBA 2DFEA 4DSEA 5LMNK 4B9MA 1HYVA 4CJLA 4BRKA 2D0OA 5AR0A 5GINA 3E1YA 2UXDK 3BZKA 2W6LA 1N8RO 1CZBA 5AFUH 4DB3A 1V4TA 1KXPA 2QI2A 1JLAA 3F5TA 3CFRA 1VSDA 3QBXA 3DOLA 2F96A 3VEOA 1YI2N 3DJCA 3WNEA 4QAGA 1NBWA 3J80O 3KK3A 2G8KA 3ENHA 3THWB 4JI5K 3O9QA 4NCBA 4IFYA 4CJPA 3SK3A 1JCGA 4MLHA 3EZ5A 4DTSA 3ULDA 2I7PA 4Z94A 1KVAA 4KH4A 4FLTA 1RT2A 2ZQBA 2G8IA 2HHTA 4I2QA 4Y1DA 3MN9A 2Z1GA 2AA4A 2W41A 3UKRB 4XH5A 1YJWN 4TSXA 3LP1A 1FXXA 1NK7A 3RMBA 1NGDA 2HVHA 4CEBA 2HMIA 5C25A 4YHHK 1V4SA 3OJUA 4LC9B 3NGIA 4FJ7A 5C15A 4LFBK 2E20A 4CBUA 3SPZA 3RR7A 4YFUA 5T7BA 2QWLA 1YHQN 2BANA 3NH2A 3EL2A 3ZX3A 2DFHA 1T03A 5AQZA 1QQMA 4AHTA 4LH4A 1S1VA 1RDUA 2HHQA 2E6MA 5M1QA 4CHYA 3QESA 4BREA 1Q86O 2O8EB 2YNHA 2QWRA 4CGDA 1B9FA 1WBBA 4PUOA 5EU7A 3O80A 1E4GT 5I9EB 4BDYA 2ATQA 5J2PA 1S6PA 5C42A 3WEEA 2E8AA 4JN4A 3AO3A 4DV5K 4H4OA 1T05A 4FLVA 2CGJA 1NKEA 3WXLA 4PQUA 2HBMA 3RRHA 3HVTA 1RT1A 3EYZA 2P9LB 4FXDA 4O44A 3A5LC 1IBLK 3WQUA 1IBMK 3QLHA 1X3MA 3HBTA 1Z05A 1Y64A 4IG0A 3SUOA 3AVBA 1KSPA 4KHSA 2YI1A 1BDGA 1QZ5A 2W6KA 3ZSXA 4DFKA 4CHPA 4B3MK 4CGGA 3BF3A 2OCEA 4YOTA 4CJ5A 3NF6A 4JHDB 3ID6A 1KQSM 1BOTO 2HF3A 1JXEA 4BE1A 2KZZA 5BN9A 4LF8K 1NJXA 1WAJA 3BZCA 4B3TK 4B9UA 3NVKA 2OPSA 1A5XA 3JYTA 4IEEA 3CJ7A 2D4WA 1XNRK 3O9SA 4Q0BA 4G1QA 3HPGA 5F1XA 4K8XA 5EY4A 1VQ6N 4PA1A 4CJKA 3AVCA 2E1YA 3MX5A 2A1RA 1GOBA 1I3AA 2BE2A 1RTJA 3N4PA 1BA1A 4PKHA 4CD1A 3V9XA 1NK5A 2HBLA 2NRVA 3ISNC 3VEZA 2X6SA 3RR8A 4H4MA 4DTPA 3RSEA 1BG3A 3ITHA 4AHCA 3TABA 1HR0K 2G8HA 4JKHA 1NGGA 3ATVA 4DTJA 3RTVA 3F2KA 4CBXA 1IKXA 3MXMA 2J4RA 2HHWA 3UKUB 3O9UA 3UKRA 4CERA 4GV3A 3VQCA 4A2AA 3NF7A 2ASPA 3L3UA 1HLUA 1M90O 2ITGA 4CCHA 4JS5A 4ELUA 1U04A 4CJEA 3K5OA 3L3VA 4E1JA 1N36K 3VPZA 1ASUA 4N5SA 3K59A 4N76A 3SQ4A 3GBTA 4YY3K 3HSCA 3D6RA 5HP1A 4W5RA 3TI0A 3CCUN 3T3FA 2HHHK 3VEXA 3SZ2A 2A3ZA 4RTFD 3CFOA 2QWQA 4JAXA 3I56N 1K73O 2QKBA 2V52B 1DGKN 3R6MA 2PZSA 3TAMA 1D4XA 3EZWA 4Z4FA 4KTQA 3LP0A 4CW7B 4EHUA 4IDHA 2VWBA 2ZF5O 3MMVA 5TKYA 3WXJA 1WNSA 3QMLA 4DR4K 2KFZA 4E7KA 5D3GA 2ZE2A 3LDOA 3DRSA 3ENBA 4DTMA 1HNVA 4DQQA 2W40A 3NAEA 3SQ1A 4ILGB 4H5NA 2YHAA 3KD5E 3WXMB 3IKMA 2HBKA 4DR2K 1TUYA 4BR7A 1QQNA 5AQIA 3DLEA 2WUSA 5GADP 4EAHD 3MX2A 5HRNA 3HK2A 2IS3A 4DV0K 4YOVA 4IFVA 3OYIA 3H1VX 4CF0A 4JS4A 3LDPA 4NXMK 5AQMA 5I3UA 1HYSA 3AVNA 4EHTA 4DSIA 2WBNA 4N41A 3M1FA 3PUFA 1JL2A 1ZBFA 4AF1A 5HRRA 3EY1A 4CHNA 3WXIA 4A5BA 5KPZA 3CCRN 3OYGA 3O08A 1TGOA 3O3FA 1Z6RA 2ZJPL 1WN7A 1U47A 2E6LA 1TAUA 3MECA 2I5JA 5CY4A 4M3XA 1LAVA 3D2EA 2PY5A 4BQZA 3ZT0A 3DOKA 2O8CA 3TAGA 5HROA 4CEAA 1VSHA 4E7LA 3E9PA 3CPEA 3HO1A 3H46O 3SAHA 1S3XA 4CJWA 4O55A 2G8WA 2WTUA 4LF4K 2XO7A 1DLOA 4DS5A 5FLXO 5C12A 4LY7A 4Z4EA 4OLAA 3AVJA 4KBOA 1GLBG 5BRDA 4FM2A 4DR6K 1QQCA 2CGLA 3UKUA 5AQKA 3FR0A 4RWTA 2F9TA 1NWKA 3BF1A 3TSQA 1TKXA 1VRTA 4R79A 3OYBA 3L2VA 5AQVA 4FWOA 4CZLA 2HSTA 3VENA 1ZC6A 3ZT4A 4FK2A 1JLCA 1HQUA 4ISEA 4BC5A 4JKDA 4NB4A 3OBWA 4KREA 4I9LA 3VTHA 3AA5X 1KVBA 4ZHRA 3KWGA 4CF2A 1RT3A 1WAFA 2KKZA 4DTUA 2P5OA 3SNNA 5KQ8A 2B5JA 4B9VA 1MDUB 4KO0A 1SKSA 1GLEG 4B3SK 4DQRA 1EETA 4G9ZA 1VSKA 3F73A 3NF8A 4IOCL 4WFBL 1U49A 5KRTA 3K58A 3B8AX 4FWQA 3VQDA 2GTDA 4CZEA 3J7AP 1S1UA 1LCUA 4DTNA 4NCGA 1G15A 3VA0A 3V9ZA 4JD2A 3AO2A 4YDUA 1CXQA 1Q8IA 4AHSA 3CFPA 3TPQA 4FJXA 2DY4A 1RNHA 1WSJA 4FZZA 4U67L 4BG9A 3OS0A 2WFBA 5HRSA 2D5RA 3KLIA 2Y1JA 2V51B 1N34K 1LOTB 2AP1A 4CHQA 3OY9A 2O8FA 2UUCK 3V81A 5KGWA 3QEXA 3BEXA 3CMAN 1Z25A 2ZGZA 1BUPA 5F0XA 5TKWA 5I42A 4QS8A 1L5UA 2F7TA 4WQ4A 5CE3A 3PX0A 2DTUA 1S1WA 4NYFA 1XUPO 5HLFA 1KAXA 3CIPA 5AQGA 3V9SA 2NZTA 3G4SN 4GMJB 2QKKA 1NOYA 4E7JA 5AQJA 4WQ5C 1WLJA 2P9UB 4KFBA 4RW7A 1JLBA 3TAEA 2CH6A 2YJEA 3J7ZO 4B9NA 5BPNA 1U6ZA 3KTQA 1VQPN 3HVRA 1TV6A 3C6TA 5C2FA 3Q7BA 1WSIA 3C65A 3S3OA 3KWIA 4Z0UA 3QERA 2G8UA 1C0GA 3NHGA 2F9WA 4NLBA 5AJ3K 2Q2RA 5SZTA 4M3YA 2E88A 3D7EO 3K2PA 4BRNA 3QNOA 4CIGA 1JJ2M 3U3YA 1RT5A 4PL7A 1ILYA 1H1VA 4B1YB 4FW1A 4JKFA 4BRAA 4J2EA 5EX5A 3VF6A 5ADXH 2FBYA 4B1XB 1BQNA 4FJGA 2HNZA 3C6UA 1ZYQA 1K9MO 3CG7A 4M3WA 3G71N 2QK9A 1W7AA 1RILA 1N5YA 2AJQA 4AQYK 3OW2M 4M3RA 4BC4A 3W3DA 1C1AA 4Z4HA 2VCPA 3FZHA 4JKBA 2HHUA 3T1HK 2E1ZA 2KZMA 4DSJA 4UQGA 3U9ZA 4M3ZA 1GLLO 3QINA 4A59A 3C6HA 3UIQA 3ZLJA 1GLAG 3J7YP 2P5GA 3O4NA 1VQ5N 2Q3SA 5AQUA 1VQON 4KTZA 5DM6L 2HB5A 4BACA 3GG4A 3G0ZA 4IXCA 1CZ9A 3BUZB 1BCMA 1VSJA 2UUBK 2YCHA
chains in the Genus database with same CATH topology
1ATSA 2CGJA 2NRWA 1HKBA 5AQFA 4DKWA 3WXLA 3DXKA 2HBMA 1IG8A 2KHOA 3IUCA 1HKCA 1BU6O 2P9LB 3M6GA 4BRDA 3A5LC 4EIAA 1VQ9N 3ZETA 3GE1A 3WQUA 1X3MA 3HBTA 3R8EA 3MN6A 2QTDA 1QHAA 1Z05A 5AQNA 3QDKA 1Y64A 4FWLA 5AQQA 5AZIA 3RSEB 3SMSA 4OPHA 5EXWA 4FWNA 5M1KA 2QWNA 2RE2A 4FSVA 3FZKA 3CC4N 2Q97A 1T6DA 3PLAA 2NRTA 2YI1A 3UE5A 1BDGA 5AFUA 1QZ5A 3SMPA 4BGAA 3O8MA 3I8BA 3BF3A 4YOTA 2QEXN 4JHDB 4DQ8A 3ID6A 1KQSM 2OTLN 1BOTO 2HF3A 2P9UA 4OPAA 1JCEA 4Y0WA 4PHTX 4ISGA 5LJWA 4BRQA 3GDQA 4FVUA 1EQYA 4CJ7A 4YDUC 5BN9A 1TYQB 3A8YA 3KK7A 3SBTA 1IJJA 3AAPA 3JXUA 3TSPA 3NVKA 4JKAA 4IEEA 2P9KB 5FPMA 3CJ7A 2D4WA 3VGMA 3MN7A 3O9SA 3PIOL 1YF5L 3T69A 3KZBA 3QICA 4FL9A 3G25A 3CJBA 3ZEUB 4CI6A 5BR9A 5F1XA 3U9DA 1QZ6A 5EY4A 2OTJN 1VQ6N 3FGUA 2E1YA 3MX5A 3WEEB 1VQLN 3FZMA 3TTDA 3W0LA 1T44A 5E84A 3N4PA 3TTFA 1BA1A 4PKHA 4CD1A 2QA4N 3R9PA 4WFNL 2BH1A 3HI0A 2ZJQL 3E66A 1NGHA 2H3GX 3MWTA 3MWPA 4DCHA 2HBLA 2NRVA 3VEZA 3VTIA 4J8FA 3G6EN 3L4IA 3VEVA 2HOEA 1NGIA 4JK7A 4H5TA 4AM7A 1W2BM 5C0YA 3NMUA 2GWKA 1DKGD 5EOYA 5JLHA 3D2EB 4OO1J 3BP8A 1NGJA 3GL1A 3RSEA 4YOWA 1BG3A 3IFRA 3C7NB 1GLDG 3H3OB 4BR2A 4JKHA 3ZX2A 4CZJA 1K8KB 1NGGA 1VQKN 3ATVA 3CERA 3F2KA 2GX9A 4CBXA 2J4RA 2VYPA 3UKUB 3LDLA 3O9UA 3LDQA 3OA9A 4H03B 3UKRA 2E2PA 4GV3A 5AQRA 4A2AA 3MK6A 3CJ1A 2V7ZA 2NNWA 2ASPA 1HLUA 1M90O 5BRHA 4CZHA 4YOUA 1HKGA 4E1JA 4O8KA 3VPZA 2CGKA 4IOAL 4I6MB 5JMVA 2NRHA 4GVEA 2Q31A 4FO0A 3GBTA 4B1WB 3HSCA 3D6RA 3QB0A 3WQTA 3VESA 5CR4A 2JWKA 2QWMA 4QS9A 3ULEA 3H3NO 3CCUN 4KH5A 4U7BA 3HZ6A 3VEXA 1WUAA 2A3ZA 4FWPA 3D2FB 4RTFD 2QWQA 4JAXA 3I56N 4IO9L 5AQOA 4M7XA 4CZGA 1K73O 2D0PA 3CJCA 3H45C 3TU5A 1ZBSA 4WF9L 3ID8A 1J6ZA 3N4QA 2DPNA 2V52B 5B8HA 5JLFA 1DGKN 3R6MA 1D4XA 3EZWA 2E2NA 1X3NA 1W97L 4RCHA 4FWKA 5GIOA 2P9NA 4FOEA 4EHUA 3VEWA 3SBGA 4IDHA 2VWBA 2ZF5O 3O9TA 3MMVA 3VGKA 1RFQA 5TKYA 3WXJA 3QMLA 3AARA 2FLOA 2KLAA 5AQSA 1RDWX 3LDOA 2YHXA 3ENBA 4FWSA 5AQWA 4BGBA 2Q0RA 3VOVA 3DXKB 4KH6A 2IVOA 2W40A 3AY9A 5M1OA 3VGLA 4ILGB 3LDNA 4H5NA 3WXMB 3IKMA 2HBKA 3I55N 1TUYA 1MWKA 4BR7A 1QQNA 2ASOA 4MDBA 2P9PA 5AQIA 1GLCG 5AZJB 2WUSA 1SZ2A 5AQXA 5GADP 2QM1A 5GAGP 4JNEA 4EAHD 3MDQA 3MX2A 3P39A 1VQMN 4YOVA 4BG8A 3H1VX 3ZYYX 3I33A 4FOIA 3LDPA 4FWMA 5AQMA 5ADXA 1S72N 1KC8O 4EHTA 3O1WA 3KHYA 2WBNA 1DT9A 3A5NC 3CC2N 1P90A 3M1FA 1YAGA 3O4WA 4MDAA 2E2OA 3VF4A 4AF1A 2I7NA 3FZFA 3WXIA 4A5AA 4BC3A 4JD2B 4A5BA 5KPZA 4BVPA 3M5RA 3CCRN 4WFAL 2NRZA 3O08A 3DAWA 3U8XA 5C2DA 1NGEA 3EN9A 4C1NI 1Z6RA 2ZJPL 3AGRA 4WYBA 1YITN 3CCLN 1BA0A 3CC7N 4CZMA 4XH4A 1U2VB 4JKGB 3EE9A 3C7NA 3WUHA 5EVZA 2P9SB 3D2EA 1SS6A 4BQZA 2GEMA 3CETA 3OBYA 4BY9C 3QFUA 3K9KA 4H0OA 1NMDA 4UY8O 3K9JA 2Q1NA 4FPBA 5C10A 3E9PA 2V7YA 3CPEA 3H46O 1K8KA 1OKJA 3SAHA 3IDHA 1RGIA 1S3XA 5AQTA 1HPMA 1HX1A 2NRXA 5KQDA 1YUWA 4BRHA 1MA9B 2YJFA 4GNIA 3DXMB 1Q18A 4FPAA 3LM9A 5BRFA 2YX6A 2P9PB 2ZJRL 4C1NK 1R59O 4H5WA 3WXKA 5JVGL 1M1KO 5M1FA 5C12A 4BR5A 3CF5L 1NGAA 3H6EA 2P9IB 3NVMA 4IOXA 1QQOA 2FSNA 3CCSN 4KBOA 1GLBG 2PBDA 5BRDA 5LY3A 3EKSA 3L0QA 4A57A 2CGLA 3UKUA 2BTFA 4C23A 4XEIA 5AQKA 3FR0A 4PL8A 4CZIA 3P38A 4IJAA 3CJ9A 5LJVA 2F9TA 4RWTA 1NWKA 1SAZA 3BF1A 3HRGA 3TSQA 4BRLA 5FPEA 4IEIA 2A6AA 4R79A 5FPDA 2WC9A 3WT0A 2P9LA 3O5BA 1YJ9N 3CCMN 3P4IA 1XQSC 5BN8A 2IIRA 4L3QA 3MCAB 3QBWA 5AQVA 1NLVA 3FZLA 2YHYA 4FWOA 4PKGA 4CZLA 5HL7L 1ZXOA 1VAZA 2ITMA 2HSTA 3VENA 3TSUA 2EWSA 1ZC6A 2HBJA 1YVNA 1TUUA 3J8AA 3PIPL 4IWVA 4K41A 1BWFO 3HM8A 3R1XA 4ISEA 4WCEL 4BVOA 4BC5A 3CQXA 3VETA 4GV9A 4JKDA 4NB4A 3OBWA 4FWRA 3VTHA 4IZ9A 3Q7CA 5BREA 1VQ7N 3KWGA 2KKZA 2FXUA 4BQLA 1G99A 4JK9A 3RVCA 2BUPA 5KQ8A 5HOOA 3H1QA 2E2QA 4NO7A 1MDUB 4MO4A 3EO3A 1GLEG 2UYTA 3CHWA 3O6WA 4JK8A 4B1UB 5GIPA 4G9ZA 1HJOA 3UB5A 4A2BA 5E26A 2GELA 4IOCL 5JICA 4WFBL 4H0VB 4H5RA 4IFEA 1MWMA 3CMEN 3B8AX 3EKUA 2P9KA 3L6QA 2NLXA 4MLEA 3VF2A 5BPLA 4PKIA 1NGBA 2IVNA 4FWQA 1SQKA 4NLCA 3AAQA 2GTDA 2P9IA 2D1KA 2NRRA 4CZEA 4XH1A 1JCFA 3ZEUA 5M1PA 3VEYA 2FSJA 1LCUA 4K25A 3O1BA 2FSKA 5FPNA 4JKCA 4JD2A 1K8AO 4MO5A 1KAZA 1T3VA 3CCVN 4YDUA 3OHRA 4HTLA 1ATNA 1X9JA 4ISFA 3VERA 4B1ZA 4B9QA 1Q81O 4GV6A 3TPQA 1CZAN 3ATUA 4K43A 4BRPA 2IVPA 5AQYA 1P8ZA 2JWLA 1VQNN 4U67L 4BG9A 2WFBA 4BRFA 4M7YA 2V51B 3VMFB 3L4QA 1LOTB 2AP1A 4CZFA 1O13A 3EE8A 4F9OA 2HF4A 3CXCM 3CCEN 1ESVA 2FF3B 1C0FA 4O8UA 1NGCA 3FE1A 1KD1O 3M3ZA 3BEXA 3CMAN 4BRCA 2ZGZA 1WOQA 2P9SA 1BUPA 2HMPA 5F0XA 5TKWA 4H5VA 5DM7L 4YOXA 1YIJN 1XC3A 2ASMA 4QS8A 3ZETB 4BC2A 1GLFO 3S41A 2F7TA 1Q82O 3E9OA 4H0YB 4WQ4A 1YJNN 5CE3A 4H0PA 4BROA 1E4FT 2VGNA 1XUPO 1KAXA 3CIPA 5AQGA 4CBWA 3F9MA 4H0TB 2NZTA 1ATRA 3GOIA 3O9RA 5ELZA 5AQLA 5AQPA 3ZX0A 4BR4A 1TYQA 3G4SN 4JEPA 2ZGYA 3TTCA 4CD3A 2Q36A 4A61A 5AQJA 2QXLA 2P9UB 1NGFA 2VGMA 4WQ5C 3SJHA 3QFPA 4B1VA 3LL3A 1Q7YO 1U2VA 4JKGA 5M1NA 3DXMA 4DHYA 4YOYA 4M63C 1T6CA 5BPMA 3CCJN 4K42A 3CI5A 3AGKA 3HOTA 4GY2B 2CH6A 2YJEA 3J7ZO 5BPNA 2QWPA 4BR0A 1OVYA 1U6ZA 2GUPA 4BRKA 2D0OA 3FFKB 5AR0A 4AM6A 4BRGA 3E1YA 5GINA 1VQPN 1N8RO 5C2FA 5AFUH 3E9LA 3Q7BA 1V4TA 1KXPA 3C65A 4DB3A 4EFHA 2QI2A 3KWIA 3U4LA 3F5TA 3R3LA 3QBXA 3SAFA 1C0GA 2YHWA 3VEOA 1YI2N 3MCPA 3DJCA 3A0IX 4JKEA 1VQ8N 1VQ4N 1DEJA 2F9WA 4NLBA 2QW9A 1NBWA 2Q2RA 3CQYA 4ILJA 4WQ5A 4BRIA 5H1SQ 3ENHA 2E88A 3O9QA 1NM1A 3D7EO 4BRNA 2GWJA 3C0BA 4HWIA 5AQHA 3SK3A 1HUXA 1JCGA 4MLHA 1JJ2M 3HOSA 3DLLL 3MN5A 3CD6N 4PL7A 2I7PA 2PFUA 1ILYA 4WQ4C 1KAYA 4Z94A 1H1VA 4IO8A 4B1YB 5MLCQ 4JKFA 4BRAA 4CZKA 5EX5A 4KH4A 3VF6A 5KPRA 1YXQA 4I6MA 5ADXH 3DWLA 4BRMA 3C6AA 2FF6A 4QS7A 4BR9A 5KPTA 3IMXA 1QVFM 3MN9A 2AA4A 2ZWHA 4B1XB 2W41A 3UKRB 4XH5A 1YJWN 1K9MO 1GLJO 3G71N 5AZJA 4H0XB 1NGDA 3P31A 2A41A 3T7ZA 2RHKA 4ILHA 3A5OC 1V4SA 3CJAA 4A62A 5GAHP 3CPWM 3ENOA 4LC9B 1BO5O 3OW2M 5JVHL 1S22A 5C15A 3SLCA 2A40A 4BC4A 2E20A 3W3DA 4CBUA 1EO1A 2VCPA 5GAEP 5CHIA 3FZHA 4JKBA 2P9NB 2QWLA 2E1ZA 1YHQN 3EL2A 3ZX3A 3U9ZA 3A5MC 2A42A 4IJNA 1QQMA 5AQZA 1GLLO 2Q0UA 2CH5A 3KVGA 4A59A 4O5FA 1RDUA 3C6HA 4JHDA 5M1QA 2OANA 4BREA 1Q86O 3LM2A 1NJIO 3JS6A 5F2RA 1GLAG 2QWRA 3ULEB 1VQ5N 2A5XA 3HTVA 3O80A 5AQUA 1VQON 4YORA 3SAGA 3CCQN 1E4GT 5I9EB 5DM6L 1QVGM 3GG4A 5AZIB 2QWOA 3D2FA 4IXCA 3WEEA 3BUZB 2E8AA 4JN4A 2PAVA 2YCHA 3FLCO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATS A;  2CGJ A;  1HKB A;  5AQF A;  3WXL A;  3DXK A;  3IUC A;  1IG8 A;  2KHO A;  1HKC A;  1BU6 O;  2P9L B;  3M6G A;  4BRD A;  3A5L C;  4EIA A;  3ZET A;  3GE1 A;  3WQU A;  1X3M A;  3HBT A;  3R8E A;  3MN6 A;  5AQN A;  1QHA A;  1Z05 A;  5AQQ A;  3QDK A;  1Y64 A;  4FWL A;  5AZI A;  3RSE B;  3SMS A;  5EXW A;  4FWN A;  2QWN A;  4FSV A;  3FZK A;  2Q97 A;  1T6D A;  2YI1 A;  3UE5 A;  1BDG A;  5AFU A;  1QZ5 A;  3SMP A;  4BGA A;  3O8M A;  3I8B A;  3BF3 A;  4JHD B;  4DQ8 A;  1BOT O;  2HF3 A;  2P9U A;  4Y0W A;  1JCE A;  4ISG A;  5LJW A;  4BRQ A;  3GDQ A;  1EQY A;  4CJ7 A;  4YDU C;  5BN9 A;  1TYQ B;  3A8Y A;  1IJJ A;  3AAP A;  3JXU A;  2P9K B;  5FPM A;  3CJ7 A;  2D4W A;  3VGM A;  3MN7 A;  3KZB A;  3QIC A;  4FL9 A;  3G25 A;  3CJB A;  3ZEU B;  4CI6 A;  5BR9 A;  5F1X A;  3U9D A;  1QZ6 A;  5EY4 A;  3FGU A;  2E1Y A;  3WEE B;  3FZM A;  3W0L A;  1T44 A;  5E84 A;  1BA1 A;  4PKH A;  4CD1 A;  3R9P A;  3HI0 A;  1NGH A;  2H3G X;  4DCH A;  3VEZ A;  4J8F A;  3L4I A;  3VEV A;  2HOE A;  1NGI A;  4H5T A;  4AM7 A;  2GWK A;  1DKG D;  5EOY A;  5JLH A;  3D2E B;  3BP8 A;  1NGJ A;  3GL1 A;  3RSE A;  1BG3 A;  3IFR A;  3C7N B;  1GLD G;  3H3O B;  4BR2 A;  3ZX2 A;  4CZJ A;  1K8K B;  1NGG A;  3ATV A;  3CER A;  4CBX A;  2J4R A;  2VYP A;  3UKU B;  3LDL A;  3LDQ A;  4H03 B;  3UKR A;  2E2P A;  5AQR A;  4A2A A;  3MK6 A;  3CJ1 A;  2V7Z A;  2ASP A;  1HLU A;  5BRH A;  4CZH A;  1HKG A;  4E1J A;  4O8K A;  3VPZ A;  2CGK A;  4I6M B;  5JMV A;  2NRH A;  2Q31 A;  4FO0 A;  3GBT A;  4B1W B;  3HSC A;  3QB0 A;  3WQT A;  3VES A;  2QWM A;  4QS9 A;  3ULE A;  3H3N O;  3HZ6 A;  3VEX A;  1WUA A;  2A3Z A;  4FWP A;  3D2F B;  4RTF D;  2QWQ A;  4JAX A;  5AQO A;  4M7X A;  4CZG A;  2D0P A;  3CJC A;  3H45 C;  3TU5 A;  1ZBS A;  3ID8 A;  1J6Z A;  2DPN A;  2V52 B;  5B8H A;  5JLF A;  1DGK N;  3R6M A;  1D4X A;  3EZW A;  2E2N A;  1X3N A;  4RCH A;  4FWK A;  2P9N A;  4FOE A;  4EHU A;  3VEW A;  2VWB A;  2ZF5 O;  3MMV A;  3VGK A;  1RFQ A;  5TKY A;  3WXJ A;  3QML A;  3AAR A;  2FLO A;  5AQS A;  1RDW X;  3LDO A;  2YHX A;  4FWS A;  5AQW A;  4BGB A;  2Q0R A;  3VOV A;  3DXK B;  2IVO A;  2W40 A;  3AY9 A;  3VGL A;  3LDN A;  4H5N A;  1TUY A;  1MWK A;  4BR7 A;  1QQN A;  2ASO A;  5AQI A;  2P9P A;  5AZJ B;  1GLC G;  2WUS A;  1SZ2 A;  5AQX A;  2QM1 A;  4JNE A;  4EAH D;  3MDQ A;  4BG8 A;  3H1V X;  3I33 A;  4FOI A;  3LDP A;  4FWM A;  5AQM A;  5ADX A;  4EHT A;  3O1W A;  3KHY A;  3A5N C;  3M1F A;  1YAG A;  3O4W A;  2E2O A;  3VF4 A;  2I7N A;  3FZF A;  3WXI A;  4BC3 A;  4JD2 B;  5KPZ A;  4BVP A;  3O08 A;  3U8X A;  3DAW A;  1NGE A;  3EN9 A;  1Z6R A;  4WYB A;  1BA0 A;  4CZM A;  4XH4 A;  1U2V B;  3C7N A;  3WUH A;  5EVZ A;  2P9S B;  3D2E A;  4BQZ A;  2GEM A;  3CET A;  3QFU A;  4H0O A;  1NMD A;  2Q1N A;  4FPB A;  2V7Y A;  3H46 O;  1K8K A;  1OKJ A;  3IDH A;  1RGI A;  1S3X A;  5AQT A;  1HPM A;  1HX1 A;  5KQD A;  1YUW A;  4BRH A;  1MA9 B;  2YJF A;  4GNI A;  3DXM B;  1Q18 A;  4FPA A;  3LM9 A;  5BRF A;  2P9P B;  1R59 O;  4H5W A;  3WXK A;  4BR5 A;  1NGA A;  3H6E A;  2P9I B;  1QQO A;  2FSN A;  4KBO A;  1GLB G;  2PBD A;  5BRD A;  5LY3 A;  3EKS A;  3L0Q A;  2CGL A;  3UKU A;  2BTF A;  4C23 A;  4XEI A;  5AQK A;  3FR0 A;  4PL8 A;  4CZI A;  4IJA A;  3CJ9 A;  5LJV A;  2F9T A;  4RWT A;  1NWK A;  1SAZ A;  3BF1 A;  5FPE A;  4BRL A;  2A6A A;  5FPD A;  3WT0 A;  2P9L A;  3O5B A;  3P4I A;  1XQS C;  5BN8 A;  2IIR A;  4L3Q A;  3QBW A;  5AQV A;  1NLV A;  3FZL A;  2YHY A;  4FWO A;  4PKG A;  4CZL A;  1ZXO A;  2ITM A;  3VEN A;  2EWS A;  1ZC6 A;  3J8A A;  1YVN A;  1TUU A;  4IWV A;  4K41 A;  1BWF O;  3HM8 A;  4ISE A;  4BVO A;  4BC5 A;  3CQX A;  3VET A;  4NB4 A;  4FWR A;  4IZ9 A;  5BRE A;  2FXU A;  4BQL A;  1G99 A;  2BUP A;  5KQ8 A;  3H1Q A;  2E2Q A;  4NO7 A;  1MDU B;  4MO4 A;  3EO3 A;  1GLE G;  2UYT A;  3CHW A;  3O6W A;  4B1U B;  1HJO A;  3UB5 A;  4A2B A;  5E26 A;  2GEL A;  5JIC A;  4H0V B;  4H5R A;  1MWM A;  3B8A X;  3EKU A;  2P9K A;  3L6Q A;  2NLX A;  4MLE A;  3VF2 A;  5BPL A;  4PKI A;  1NGB A;  2IVN A;  4FWQ A;  1SQK A;  3AAQ A;  2GTD A;  2P9I A;  2D1K A;  4CZE A;  4XH1 A;  1JCF A;  3ZEU A;  3VEY A;  2FSJ A;  1LCU A;  4K25 A;  3O1B A;  2FSK A;  5FPN A;  4JD2 A;  4MO5 A;  1KAZ A;  4YDU A;  3OHR A;  4HTL A;  1ATN A;  1X9J A;  4ISF A;  3VER A;  4B1Z A;  4B9Q A;  3TPQ A;  1CZA N;  3ATU A;  4K43 A;  4BRP A;  2IVP A;  5AQY A;  1P8Z A;  4BG9 A;  4BRF A;  4M7Y A;  2V51 B;  1LOT B;  2AP1 A;  4CZF A;  4F9O A;  2HF4 A;  1ESV A;  2FF3 B;  1C0F A;  1NGC A;  3FE1 A;  3M3Z A;  3BEX A;  4BRC A;  2ZGZ A;  1WOQ A;  2P9S A;  1BUP A;  2HMP A;  5F0X A;  4H5V A;  1XC3 A;  2ASM A;  4QS8 A;  3ZET B;  4BC2 A;  1GLF O;  3S41 A;  4H0Y B;  4WQ4 A;  5CE3 A;  4H0P A;  4BRO A;  1E4F T;  1XUP O;  1KAX A;  3CIP A;  5AQG A;  4CBW A;  3F9M A;  4H0T B;  2NZT A;  1ATR A;  3GOI A;  5ELZ A;  5AQL A;  5AQP A;  3ZX0 A;  4BR4 A;  1TYQ A;  2ZGY A;  4CD3 A;  2Q36 A;  4A61 A;  5AQJ A;  2QXL A;  2P9U B;  1NGF A;  4WQ5 C;  3SJH A;  3QFP A;  4B1V A;  3LL3 A;  1U2V A;  3DXM A;  4DHY A;  4M63 C;  1T6C A;  5BPM A;  4K42 A;  3CI5 A;  4GY2 B;  2CH6 A;  2YJE A;  5BPN A;  2QWP A;  4BR0 A;  1U6Z A;  2GUP A;  4BRK A;  2D0O A;  3FFK B;  5AR0 A;  4AM6 A;  4BRG A;  5AFU H;  4DB3 A;  1V4T A;  1KXP A;  4EFH A;  3U4L A;  3QBX A;  1C0G A;  2YHW A;  3VEO A;  3MCP A;  3DJC A;  3A0I X;  1DEJ A;  2F9W A;  2QW9 A;  1NBW A;  2Q2R A;  3CQY A;  4BRI A;  4WQ5 A;  3ENH A;  2E88 A;  1NM1 A;  3D7E O;  4BRN A;  2GWJ A;  3C0B A;  4HWI A;  5AQH A;  3SK3 A;  1HUX A;  1JCG A;  4MLH A;  3MN5 A;  4PL7 A;  2I7P A;  4WQ4 C;  1KAY A;  4Z94 A;  1H1V A;  4IO8 A;  4B1Y B;  4BRA A;  4CZK A;  5EX5 A;  3VF6 A;  5KPR A;  1YXQ A;  4I6M A;  5ADX H;  3DWL A;  4BRM A;  2FF6 A;  4QS7 A;  4BR9 A;  5KPT A;  3IMX A;  3MN9 A;  2AA4 A;  2ZWH A;  4B1X B;  2W41 A;  3UKR B;  4XH5 A;  1GLJ O;  5AZJ A;  4H0X B;  1NGD A;  2A41 A;  3A5O C;  1V4S A;  3CJA A;  4A62 A;  3ENO A;  4LC9 B;  1BO5 O;  1S22 A;  3SLC A;  2A40 A;  4BC4 A;  2E20 A;  3W3D A;  4CBU A;  2VCP A;  3FZH A;  2P9N B;  2QWL A;  2E1Z A;  3EL2 A;  3ZX3 A;  3U9Z A;  3A5M C;  2A42 A;  4IJN A;  1QQM A;  5AQZ A;  1GLL O;  2Q0U A;  2CH5 A;  3KVG A;  4O5F A;  4JHD A;  2OAN A;  4BRE A;  3LM2 A;  3JS6 A;  5F2R A;  1GLA G;  2QWR A;  3ULE B;  2A5X A;  3HTV A;  3O80 A;  5AQU A;  1E4G T;  5I9E B;  3GG4 A;  5AZI B;  2QWO A;  3D2F A;  4IXC A;  3WEE A;  3BUZ B;  2E8A A;  4JN4 A;  2PAV A;  2YCH A;  3FLC O; 
#chains in the Genus database with same CATH topology
 3P5J A;  2NRW A;  1HKB A;  4CEC A;  2YHB A;  5AQF A;  3DXK A;  1IG8 A;  1BU6 O;  4ID5 A;  4CJ4 A;  4DR3 K;  3GE1 A;  2O4I A;  4IDK A;  3MN6 A;  1JXB A;  2QTD A;  5AQN A;  2FBV A;  4FWN A;  5M1K A;  2QWN A;  2RE2 A;  3FZK A;  4JI1 K;  4BDP A;  5AFU A;  4B3R K;  5E41 A;  3SMP A;  1GOA A;  3I8D A;  3I8B A;  4L8R B;  2HHX A;  4HCB A;  2QEX N;  4DQ8 A;  2OTL N;  4C8L A;  3SCX A;  4PHT X;  4AHR A;  1VRU A;  4YDU C;  1TYQ B;  3A8Y A;  3KK7 A;  4AHV A;  1OVQ A;  3AV9 A;  1IJJ A;  4CEO A;  1LWC A;  3QEP A;  2Y1I A;  3VGM A;  3MN7 A;  3PIO L;  3IAY A;  5HRP A;  4KI4 A;  3QIC A;  3EEQ A;  3G25 A;  5LL6 Z;  3CYM A;  2OTJ N;  1QZ6 A;  3VQ5 A;  3WEE B;  1VQL N;  1BIS A;  3TTD A;  1T44 A;  5E84 A;  4DR5 K;  2QA4 N;  1QSY A;  3MWT A;  3VTI A;  1KCF A;  4CJQ A;  3L4I A;  5SWM A;  1WB9 A;  1W0H A;  5DK5 A;  4AM7 A;  1S1T A;  2ZM6 K;  3BGR A;  2GWK A;  1L3U A;  4XIU A;  5JLH A;  3D2E B;  4CK2 A;  3BP8 A;  3GL1 A;  4BR2 A;  2O8B A;  3T1A A;  3T1Y K;  3WNG A;  2GX9 A;  3ZSV A;  3PX4 A;  3OA9 A;  4E1M A;  4DSK A;  4JYA K;  2X6N A;  4YOU A;  4I6M B;  5JMV A;  1N33 K;  4GVE A;  4FO0 A;  3OYE A;  4PY5 A;  1BIU A;  2XRI A;  3WQT A;  1EP4 A;  5CR4 A;  3ULE A;  3H3N O;  1VHX A;  4KH5 A;  3KKR A;  4F3T A;  3D2F B;  2XHB A;  4CZG A;  4M7X A;  3H45 C;  4WF9 L;  3ID8 A;  1J6Z A;  3N4Q A;  1EXQ A;  4IG3 A;  4FYD A;  3L2Q A;  1KLN A;  2Z1H A;  3V1R A;  4KHU A;  4FK4 A;  5GIO A;  2P9N A;  4FOE A;  3M8R A;  3QIO A;  2R7Y A;  1RFQ A;  3L8B A;  1RT7 A;  1YT3 A;  2FLO A;  1WSH A;  5AQS A;  4M3U A;  3B6P A;  1RT4 A;  4PWD A;  4FWS A;  4KHN A;  4KKO A;  2Q0R A;  3DXK B;  2FC0 A;  2IVO A;  3AY9 A;  3VGL A;  3D45 A;  1VSE A;  3LDN A;  3VQB A;  3KLG A;  1NU0 A;  1OH5 A;  1UWB A;  5AZJ B;  1TK0 A;  1GLC G;  1S9G A;  1SZ2 A;  5AQX A;  3MDQ A;  3V4I A;  1HJR A;  1BI4 A;  1CLQ A;  2WON A;  4FLX A;  4FOI A;  1S72 N;  3O1W A;  3FFI A;  3A5N C;  1BI4 B;  3NE6 A;  1HMV A;  3CC2 N;  3O4W A;  4B9L A;  3ZSR A;  3VF4 A;  1NJZ A;  2I7N A;  4I2P A;  3FZF A;  4A5A A;  3M5R A;  4WFA L;  1NK4 A;  3EN9 A;  3SUQ A;  2VG7 A;  4X62 K;  4WYB A;  1YTU A;  5FRN A;  1D9D A;  1B9D A;  1BCO A;  4X66 K;  2OPQ A;  3WUH A;  3AO1 A;  1FKP A;  2P9S B;  3AVK A;  2RKI A;  3LP3 A;  4BY9 C;  2IGI A;  4H0O A;  4UY8 O;  3K9J A;  4FPB A;  4O0J A;  1OKJ A;  2YV0 X;  5AQT A;  3IDH A;  1U4B A;  4BRH A;  1NKB A;  1SL2 A;  1NG9 A;  2YX6 A;  1NK9 A;  4C1N K;  4H5W A;  2VWK A;  1M1K O;  4BR5 A;  3CF5 L;  1NGA A;  3H6E A;  4IBN A;  3NVM A;  2E5L K;  1QQO A;  3HL8 A;  4R5P A;  3CCS N;  5LY3 A;  4DV7 K;  3U6F A;  3K57 A;  3V9W A;  3LWL A;  5DMR A;  3ZSO A;  3LPU A;  3THY B;  4IJA A;  3ZSW A;  5J2Q A;  1BGX T;  1SAZ A;  4OKE A;  1FW6 A;  3THY A;  3VQP A;  3CCM N;  4L3Q A;  3S3M A;  3QBW A;  1NLV A;  1BHL A;  5CYQ A;  3I0S A;  1VAZ A;  2UU9 K;  1LAW A;  3VQ9 A;  1YVN A;  3PIP L;  1X1P A;  4JI6 K;  4K41 A;  5CYM A;  4CED A;  3VET A;  4IZ9 A;  4K0K K;  1G99 A;  4JK9 A;  1NOZ A;  1GOC A;  3H1Q A;  4NO7 A;  3RRG A;  4DF4 A;  3CHW A;  1RDB A;  4MQ3 A;  4WE1 A;  5GIP A;  4KB0 A;  1ZBU A;  2B4J A;  1VSI A;  2GEL A;  4H0V B;  3PO5 A;  3VF2 A;  3EKU A;  3L6Q A;  1A5V A;  4MLE A;  4DQS A;  3SPY A;  4ICL A;  1NGB A;  2IVN A;  4NLC A;  2D1K A;  3OYJ A;  4M3T A;  1NMN A;  3VEY A;  2FSJ A;  4CJV A;  4DR7 K;  4K25 A;  2FBT A;  2O4G A;  5FPN A;  2F8T A;  1KLM A;  1QSS A;  5FDL A;  1K8A O;  4MO5 A;  1T3V A;  4C8K A;  3S9H A;  1K6Y A;  1OH6 A;  1ATN A;  1X9J A;  3VER A;  4CJS A;  4GV6 A;  1X9W A;  4CJ3 A;  1CZA N;  3ATU A;  3QNN A;  1TK5 A;  4BRP A;  1P8Z A;  1VQN N;  1XNQ K;  3WNF A;  4W5N A;  4O0I A;  4CJR A;  3I0R A;  2O8C B;  3NCI A;  1MU2 A;  3L2W A;  4CZF A;  1O13 A;  3HT3 A;  4F9O A;  3OS2 A;  3U3G A;  3NGZ A;  1UAX A;  4B9T A;  3THV A;  2FF3 B;  4DTX A;  3FE1 A;  3M3Z A;  4F2R A;  3SUN A;  1IBK K;  5DM7 L;  5CZ1 A;  3PO4 A;  3O4Q A;  1WSE A;  2ASM A;  1TKT A;  4FLY A;  1SV5 A;  1GLF O;  3S41 A;  1Q82 O;  1NK6 A;  4H0P A;  1HNW K;  2VWJ A;  2VGN A;  4BE0 A;  4B08 A;  3HM9 A;  5ELZ A;  1FKO A;  3VQQ A;  1TYQ A;  3KJV A;  3LWM A;  3NBP A;  3TTC A;  4DTR A;  1RBT A;  3K5L A;  1NGF A;  3TAP A;  1VK0 A;  2KFN A;  4JKG A;  1SKW A;  4HUG A;  4FLU A;  3C95 A;  1T6C A;  3CI5 A;  3HOT A;  4GY2 B;  1RBS A;  1U45 A;  4JI8 K;  4BR0 A;  1OVY A;  2GUP A;  3FFK B;  4AM6 A;  4BRG A;  3LAK A;  3PV8 A;  3E9L A;  3VA3 A;  1RDC A;  3ZSQ A;  3DM2 A;  3G10 A;  3MCP A;  3AO5 A;  3A0I X;  1I39 A;  4JKE A;  3AO4 A;  1DEJ A;  1EX4 A;  1KFS A;  1CXU A;  2B6A A;  4Z4I A;  1VSM A;  4QOZ B;  2OYQ A;  3C0B A;  4HWI A;  3VQ7 A;  2HHS A;  1HUX A;  2F8S A;  3DLL L;  2W42 A;  4WQ4 C;  1KAY A;  4IO8 A;  4CIE A;  5MLC Q;  4I6M A;  3DWL A;  3C6A A;  4QS7 A;  4BR9 A;  5KPT A;  1QVF M;  3P1G A;  2ZWH A;  4I7F A;  1Q9X A;  5AZJ A;  3P31 A;  2RHK A;  4F3O A;  3A5O C;  3ENO A;  1BO5 O;  1S22 A;  2GV9 A;  4E7H A;  4DG1 A;  5GAE P;  5CHI A;  5C24 A;  2P9N B;  1C0T A;  1N32 K;  2O8D A;  2A42 A;  4IJN A;  3AVF A;  4AH9 A;  2CH5 A;  4FM1 A;  4FJH A;  4JHD A;  2OAN A;  1IV0 A;  3THW A;  1NJI O;  3JS6 A;  5F2R A;  3VQA A;  2DFF A;  2XY6 A;  2A5X A;  3OYM A;  1J5O A;  3SAG A;  3CCQ N;  3RMC A;  1QVG M;  5AZI B;  4RW6 A;  3D2F A;  3WNH A;  1C6V A;  3KK1 A;  4JI4 K;  1JLE A;  1R0A A;  3SUP A;  2PAV A;  5IT9 O;  4E3S A;  3IUC A;  4EIA A;  5FRM A;  3VN5 A;  1RBV A;  5AQQ A;  3QDK A;  4FWL A;  3SMS A;  4OPH A;  5EXW A;  1RT6 A;  4FSV A;  4W5T A;  3AA4 A;  3CC4 N;  4FVM A;  3PLA A;  3UE5 A;  3OYH A;  4GW6 A;  4BGA A;  3O8M A;  4B8C A;  3SI6 A;  4HVJ A;  1ITG A;  2P9U A;  1VSL A;  4OPA A;  4ISG A;  5LJW A;  1ZBH A;  3GDQ A;  4FVU A;  1EQY A;  1RTI A;  4CJ7 A;  3HXM A;  4GVM A;  3SBT A;  3RMA A;  1D5A A;  3JXU A;  4CEF A;  4JKA A;  2YNI A;  1TAQ A;  4IKF A;  3SQ0 A;  1YF5 L;  3KZB A;  4FL9 A;  5BR9 A;  3CJB A;  3U9D A;  3V1Q A;  3FZM A;  3KLF A;  3W0L A;  3OYD A;  3TTF A;  3R9P A;  1KFD A;  2BH1 A;  3E01 A;  3HI0 A;  3E66 A;  4DUZ K;  3MWP A;  4M41 A;  1X9S A;  4FJI A;  4M42 A;  4J8F A;  3G6E N;  3VEV A;  2HOE A;  1NGI A;  4JK7 A;  4H5T A;  3JSM A;  5C0Y A;  4ID1 A;  2HVI A;  1DKG D;  1XMO K;  4E89 A;  4YOW A;  1NK8 A;  1TK8 A;  4BE2 A;  1IKY A;  3C7N B;  1GLD G;  3VQ8 A;  3ZX2 A;  4DWI A;  1VQK N;  3CER A;  3LDQ A;  1Z26 A;  4H03 B;  2E2P A;  3CJ1 A;  2V7Z A;  2NNW A;  4DQP A;  4CZH A;  1HKG A;  4O8K A;  2CGK A;  5J1E A;  2IOC A;  3LAN A;  1N6Q A;  1XMQ K;  3QB0 A;  1WBD A;  1WSF A;  4O4G A;  2LSN A;  4W5O A;  5A2Q O;  2JWK A;  4QS9 A;  3VQE A;  4CFC A;  4LFA K;  4DFJ A;  3SV3 A;  3HZ6 A;  4B8A B;  4FWP A;  5AQO A;  4B3O A;  2JGU A;  1ZBS A;  1UA0 A;  2DPN A;  5B8H A;  4RCH A;  4FWK A;  2IC3 A;  3AVI A;  4E7I A;  4FJN A;  4GKJ K;  3SBG A;  4F8R A;  3O9T A;  3AAR A;  2KLA A;  1T8E A;  3AVM A;  1KVC A;  1RDW X;  2OPP A;  2YHX A;  5AQW A;  4O5B A;  3QIP A;  2EHG A;  4LH5 A;  3LPT A;  3THX B;  3KK2 A;  2X78 A;  2P9P A;  5HBM A;  4RW9 A;  4EZ6 A;  2QM1 A;  4CEQ A;  4CHZ A;  3NH1 A;  4DR1 K;  5IWA K;  1HRH A;  4KB1 A;  3MAQ A;  3DLB A;  1KC8 O;  1NNE A;  3KHY A;  1DT9 A;  1F21 A;  3QEV A;  4MDA A;  3B6O A;  2E2O A;  1D8Y A;  4KV8 A;  4BC3 A;  3PY8 A;  1JLQ A;  4NYN A;  4BVP A;  4FLZ A;  1RTH A;  2NRZ A;  3U8X A;  1JLG A;  1NGE A;  4CF9 A;  4DFM A;  4C1N I;  5JS1 A;  1YIT N;  3CCL N;  2O8F B;  1BA0 A;  3HPO A;  2Z1I A;  4XH4 A;  4JKG B;  3BY5 A;  1J9A A;  3OYA A;  1SS6 A;  2GEM A;  3OBY A;  1XHZ A;  3QFU A;  3K9K A;  2WOM A;  5C10 A;  4FJM A;  5J2N A;  1K8K A;  4LF6 K;  2EX3 A;  2NRX A;  4N56 A;  1S6Q A;  1OH7 A;  4GNI A;  3DXM B;  1Q18 A;  3IG1 A;  5BRF A;  2ZJR L;  5JVG L;  3TAN A;  3PX6 A;  2YNG A;  2YKN A;  2P9I B;  4LF5 K;  4Z4G A;  3SJJ A;  2FSN A;  4RW4 A;  2BTF A;  4XEI A;  2HW3 A;  3J81 O;  4DSF A;  2G8F A;  4CZI A;  3P38 A;  2O8B B;  5LJV A;  3D0P A;  4RG8 A;  5FPE A;  3QET A;  3HRG A;  1I94 K;  4BRL A;  1SUQ A;  4IEI A;  2A6A A;  3WT0 A;  3P4I A;  1XQS C;  1Y97 A;  1ZBI A;  3FZL A;  2YHY A;  4PKG A;  2ITM A;  3TSU A;  3V1O A;  2EWS A;  4DQI A;  2HBJ A;  1TUU A;  1C1B A;  4IWV A;  1FK9 A;  1BWF O;  4WCE L;  3R1X A;  4GKK K;  2E4L A;  3V9U A;  4GV9 A;  2XY7 A;  4FWR A;  3Q7C A;  5BRE A;  3TAQ A;  1VQ7 N;  2JLE A;  1BQM A;  2FXU A;  4BQL A;  3RVC A;  2OA8 A;  4F2S A;  1ASW A;  5HOO A;  4HCC A;  2E2Q A;  4HUE A;  4MO4 A;  4CHO A;  4CGH A;  2OPR A;  3O6W A;  4JK8 A;  3L2R A;  3UB5 A;  3TR8 A;  4KHY A;  4ZTJ A;  3AA3 A;  3DLR A;  4CFA A;  4IFE A;  2P9K A;  2RN2 A;  1RCH A;  2NLX A;  4DV2 K;  1SL1 A;  4PKI A;  1QS4 A;  3VQ6 A;  1SQK A;  3AAQ A;  4OKJ A;  2NRR A;  4XH1 A;  3ZEU A;  5M1P A;  3O1B A;  2GUI A;  4CIF A;  4OLB A;  3OYF A;  4FM0 A;  4C8O A;  4YNQ A;  1LWF A;  2P1J A;  3H08 A;  4AHU A;  3CCV N;  4RW8 A;  3ZT2 A;  1JL1 A;  1Q81 O;  1BIZ A;  5AQY A;  3ZT3 A;  3KLH A;  4M7Y A;  4JI3 K;  4X65 K;  2A1S A;  3VMF B;  2ZD1 A;  2HF4 A;  3CXC M;  3CCE N;  1ESV A;  4HUF A;  4O8U A;  1NGC A;  5KGX A;  4BRC A;  2UXC K;  1WOQ A;  4MFB A;  2HMP A;  1XC3 A;  3ZET B;  1C0M A;  2UUA K;  3NF9 A;  4H0Y B;  5FRO A;  1YJN N;  3AVL A;  4ZTF A;  4BRO A;  1E4F T;  4OGC A;  4CBW A;  3F9M A;  4H0T B;  1S5J A;  4J2A A;  1O1W A;  3GOI A;  3O9R A;  5AQP A;  3HP9 A;  4CD3 A;  3KKS A;  4A61 A;  4FJK A;  5KTQ A;  3SJH A;  2KTQ A;  3QFP A;  2PYJ A;  1U2V A;  4JI7 K;  3VQ4 A;  3DXM A;  4DHY A;  4C8M A;  4CK1 A;  4YOY A;  4M63 C;  4KHQ A;  4K42 A;  4DU3 A;  4JI0 K;  3AGK A;  1VSF A;  2QWP A;  4KRF A;  2PYL A;  4W5Q A;  4FLW A;  4JRP A;  3RMD A;  4EFH A;  3U4L A;  2KQ2 A;  2XY8 A;  3R3L A;  3SAF A;  2YHW A;  5JS2 A;  1J54 A;  3RWU A;  4OVL A;  1VQ4 N;  4ELV A;  2QW9 A;  3CQY A;  4ILJ A;  4BRI A;  4WQ5 A;  3OYK A;  5H1S Q;  5J2M A;  1NM1 A;  2GWJ A;  5AQH A;  3HOS A;  4JRQ A;  3MN5 A;  4OGE A;  3CD6 N;  1YVU A;  2PFU A;  2BGG A;  1QE1 A;  4FZX C;  4CZK A;  5KPR A;  1YXQ A;  4BRM A;  2FF6 A;  3THX A;  1LW2 A;  3IMX A;  3ASM A;  3ZT1 A;  4HTU A;  3AVA A;  1RDD A;  1GLJ O;  4H0X B;  1U48 A;  2A41 A;  3T7Z A;  4ILH A;  3CJA A;  4A62 A;  5GAH P;  3CPW M;  4BDZ A;  3CQ8 A;  5JVH L;  3SLC A;  3K5M A;  2A40 A;  1EWR A;  4JLH A;  1XWL A;  1EO1 A;  4EP4 A;  3PSF A;  3TWH A;  1TVR A;  4E19 A;  1XC9 A;  4CEE A;  3A5M C;  2Q0U A;  3KIO A;  3KVG A;  4O5F A;  4ELT A;  4FCY A;  4DLE A;  2HNY A;  3LM2 A;  1REV A;  3ULE B;  4C8N A;  3HTV A;  4YOR A;  2HND A;  2QWO A;  3OJS A;  1BL3 A;  3K0S A;  3FLC O;  1ATS A;  4CF1 A;  4DV4 K;  3IRX A;  4DKW A;  3IS9 A;  2IAJ A;  2KHO A;  1HKC A;  1HNI A;  4BRD A;  3M6G A;  1Q9Y A;  1IKV A;  1RTD A;  4DFP A;  1VQ9 N;  3ZET A;  2VG6 A;  3HYF A;  3M8S A;  1S1X A;  3R8E A;  1HNZ K;  5AZI A;  1QHA A;  3RSE B;  3V6D A;  3ZSY A;  2Q97 A;  1T6D A;  4FJ9 A;  2NRT A;  3MXJ A;  4FJL A;  3SQ2 A;  3QO9 A;  1IH7 A;  4I9Q A;  1C1C A;  4LF7 K;  4Y0W A;  1JCE A;  3LAM A;  4BRQ A;  2OZM A;  4FJ8 A;  4DUY K;  4Q5V A;  2BDP A;  4B9S A;  1D9F A;  2RF2 A;  3AAP A;  1NJY A;  1IO2 A;  3TSP A;  4LSL A;  3ZSZ A;  3NDK A;  2P9K B;  5FPM A;  4KHW A;  2RPI A;  4K8Z A;  4HHT A;  3T69 A;  4CI6 A;  3ZEU B;  4EP5 A;  3FGU A;  2QXF A;  4OPK A;  1C0U A;  4CGJ A;  4WFN L;  3CM6 A;  2ZJQ L;  3AA2 A;  1NGH A;  2H3G X;  4DCH A;  1HQE A;  4LFC K;  1W2B M;  3NMU A;  5EOY A;  4KTW A;  4OO1 J;  4FW2 A;  1NGJ A;  1LV5 A;  4AIL C;  3NH0 A;  4E1N A;  3IFR A;  3H3O B;  2O8D B;  4DV6 K;  3DRP A;  4CZJ A;  1K8K B;  4CJU A;  4J2B A;  3P83 D;  4DTO A;  2VYP A;  3LDL A;  5AQR A;  3MK6 A;  5BRH A;  4JI2 K;  1QHT A;  5KI6 A;  4IOA L;  2YKM A;  1FJG K;  4DU1 A;  1EWQ A;  2O8E A;  1TKD A;  2NRH A;  3LAL A;  2Q31 A;  4B1W B;  1JLF A;  4CEZ A;  3VES A;  2G8V A;  2QWM A;  4U7B A;  1WUA A;  3QEW A;  1VQ8 N;  4CK3 A;  4IO9 L;  2D0P A;  3CJC A;  4M45 A;  3TU5 A;  3DLH A;  1IKW A;  1KRP A;  3BDP A;  5JLF A;  2E2N A;  1X3N A;  1W97 L;  4CFB A;  1L3T A;  3OYC A;  3VEW A;  3K5N A;  3VGK A;  1KTQ A;  4DLG A;  1L3S A;  4BGB A;  3HP6 A;  3SV4 A;  3VOV A;  4KH6 A;  3HJF A;  4F4K A;  5M1O A;  4DS4 A;  3I55 N;  2YNF A;  1YTA A;  3OYL A;  1MWK A;  1W9H A;  3MED A;  2ASO A;  4MDB A;  4DMN A;  4KHP K;  3A2F A;  5GAG P;  4LSN A;  3M8Q A;  1XI1 A;  4JNE A;  3P39 A;  1VQM N;  4CGF A;  4BG8 A;  4BWM A;  3ZYY X;  4CES A;  3I33 A;  5ADX A;  4FWM A;  1J53 A;  2GBZ A;  3L2U A;  2Z1J A;  2HHV A;  1P90 A;  1YAG A;  1J5E K;  4JD2 B;  3QEI A;  4OJR A;  3OTO K;  2D0B A;  3DAW A;  5C2D A;  3DI6 A;  3CM5 A;  3DLG A;  3AGR A;  3LDS A;  3AVH A;  3CC7 N;  4J2D A;  4CZM A;  1U2V B;  3EE9 A;  1HPZ A;  3C7N A;  5EVZ A;  1IG9 A;  1QSL A;  3HST B;  3CET A;  3S3N A;  1NMD A;  2Q1N A;  2V7Y A;  1NKC A;  4FJ5 A;  1NJW A;  1RGI A;  1HPM A;  1HX1 A;  1TL1 A;  1UOC A;  1YUW A;  4BWJ A;  5KQD A;  1MA9 B;  4CGI A;  2YJF A;  1RBR A;  3LZI A;  4FPA A;  3LM9 A;  3KLE A;  2P9P B;  1R59 O;  3WXK A;  5M1F A;  3OS1 A;  4IOX A;  4DV1 K;  4NXN K;  3ALY A;  2PBD A;  3EKS A;  3L0Q A;  4A57 A;  4C23 A;  1X9M A;  2VQE K;  3O3G A;  4PL8 A;  3LZJ A;  3CJ9 A;  2X74 A;  5CZ2 A;  2D0C A;  5LMU K;  5FPD A;  2WC9 A;  3OVN A;  2P9L A;  3O5B A;  1YJ9 N;  4DSL A;  5BN8 A;  2IIR A;  3MCA B;  3F9K A;  1HNX K;  5HL7 L;  1UA1 A;  1OH8 A;  4FJJ A;  1ZXO A;  1XHX A;  3J8A A;  2UXB K;  2F4V K;  1L3V A;  1TKZ A;  3HM8 A;  4QCL A;  4BVO A;  3CQX A;  1DTQ A;  3JAM O;  1TL3 A;  4OPJ A;  1RBU A;  1EKE A;  4DV3 K;  3NGY A;  1RDA A;  2BUP A;  4V19 S;  1A5W A;  1HYZ A;  3EO3 A;  3T19 A;  2UYT A;  4Y1C A;  4CF8 A;  4B1U B;  1HJO A;  4FZY A;  4A2B A;  5E26 A;  3CME N;  3NFA A;  5JIC A;  4LD0 A;  4H5R A;  1MWM A;  5BPL A;  3KD1 E;  4JV5 K;  4CVN E;  2P9I A;  1LW0 A;  1JCF A;  4CJF A;  3TAF A;  3HPH A;  1ZBL A;  4OX9 K;  2FSK A;  4FK0 A;  4KPY A;  4JKC A;  4CFD A;  2P51 A;  1QTM A;  3MEG A;  1LWE A;  1KAZ A;  5BR8 K;  4CE9 A;  4E0D A;  3OHR A;  4HTL A;  4CJT A;  4ISF A;  4B1Z A;  4B9Q A;  4H8K A;  3DLK A;  4DU4 A;  4DF8 A;  2KW4 A;  1T7P A;  4K43 A;  4KI6 A;  1S9E A;  3C94 A;  4N47 A;  3OYN A;  2IVP A;  2JWL A;  1SKR A;  4BRF A;  2VQF K;  3L4Q A;  1B92 A;  3DYA A;  4KAZ A;  3DRR A;  3EE8 A;  2XY5 A;  3ZCM A;  1C0F A;  1KD1 O;  3PSI A;  3DMJ A;  1E3M A;  1NK0 A;  4LF9 K;  2P9S A;  1YIJ N;  4YOX A;  4H5V A;  5K14 A;  4BC2 A;  2OZS A;  1DTT A;  3E9O A;  3MXI A;  3M8P A;  4EZ9 A;  4NCA A;  2IDO A;  3TAR A;  1ATR A;  5AQL A;  2FBX A;  3ZX0 A;  4BR4 A;  4X64 K;  4JEP A;  2ZGY A;  2D0A A;  2Q36 A;  1SL0 A;  2QXL A;  3AVG A;  2VGM A;  4B1V A;  3LL3 A;  1Q7Y O;  2ETJ A;  1ASV A;  1WSG A;  4Z4C A;  3O3H A;  3LP2 A;  5M1N A;  3SYZ A;  5KRS A;  3MEE A;  2VG5 A;  5BPM A;  4OKK A;  1JKH A;  3CCJ N;  2NUB A;  2DFE A;  4DSE A;  5LMN K;  4B9M A;  1HYV A;  4CJL A;  4BRK A;  2D0O A;  5AR0 A;  5GIN A;  3E1Y A;  2UXD K;  3BZK A;  2W6L A;  1N8R O;  1CZB A;  5AFU H;  4DB3 A;  1V4T A;  1KXP A;  2QI2 A;  1JLA A;  3F5T A;  3CFR A;  1VSD A;  3QBX A;  3DOL A;  2F96 A;  3VEO A;  1YI2 N;  3DJC A;  3WNE A;  4QAG A;  1NBW A;  3J80 O;  3KK3 A;  2G8K A;  3ENH A;  3THW B;  4JI5 K;  3O9Q A;  4NCB A;  4IFY A;  4CJP A;  3SK3 A;  1JCG A;  4MLH A;  3EZ5 A;  4DTS A;  3ULD A;  2I7P A;  4Z94 A;  1KVA A;  4KH4 A;  4FLT A;  1RT2 A;  2ZQB A;  2G8I A;  2HHT A;  4I2Q A;  4Y1D A;  3MN9 A;  2Z1G A;  2AA4 A;  2W41 A;  3UKR B;  4XH5 A;  1YJW N;  4TSX A;  3LP1 A;  1FXX A;  1NK7 A;  3RMB A;  1NGD A;  2HVH A;  4CEB A;  2HMI A;  5C25 A;  4YHH K;  1V4S A;  3OJU A;  4LC9 B;  3NGI A;  4FJ7 A;  5C15 A;  4LFB K;  2E20 A;  4CBU A;  3SPZ A;  3RR7 A;  4YFU A;  5T7B A;  2QWL A;  1YHQ N;  2BAN A;  3NH2 A;  3EL2 A;  3ZX3 A;  2DFH A;  1T03 A;  5AQZ A;  1QQM A;  4AHT A;  4LH4 A;  1S1V A;  1RDU A;  2HHQ A;  2E6M A;  5M1Q A;  4CHY A;  3QES A;  4BRE A;  1Q86 O;  2O8E B;  2YNH A;  2QWR A;  4CGD A;  1B9F A;  1WBB A;  4PUO A;  5EU7 A;  3O80 A;  1E4G T;  5I9E B;  4BDY A;  2ATQ A;  5J2P A;  1S6P A;  5C42 A;  3WEE A;  2E8A A;  4JN4 A;  3AO3 A;  4DV5 K;  4H4O A;  1T05 A;  4FLV A;  2CGJ A;  1NKE A;  3WXL A;  4PQU A;  2HBM A;  3RRH A;  3HVT A;  1RT1 A;  3EYZ A;  2P9L B;  4FXD A;  4O44 A;  3A5L C;  1IBL K;  3WQU A;  1IBM K;  3QLH A;  1X3M A;  3HBT A;  1Z05 A;  1Y64 A;  4IG0 A;  3SUO A;  3AVB A;  1KSP A;  4KHS A;  2YI1 A;  1BDG A;  1QZ5 A;  2W6K A;  3ZSX A;  4DFK A;  4CHP A;  4B3M K;  4CGG A;  3BF3 A;  2OCE A;  4YOT A;  4CJ5 A;  3NF6 A;  4JHD B;  3ID6 A;  1KQS M;  1BOT O;  2HF3 A;  1JXE A;  4BE1 A;  2KZZ A;  5BN9 A;  4LF8 K;  1NJX A;  1WAJ A;  3BZC A;  4B3T K;  4B9U A;  3NVK A;  2OPS A;  1A5X A;  3JYT A;  4IEE A;  3CJ7 A;  2D4W A;  1XNR K;  3O9S A;  4Q0B A;  4G1Q A;  3HPG A;  5F1X A;  4K8X A;  5EY4 A;  1VQ6 N;  4PA1 A;  4CJK A;  3AVC A;  2E1Y A;  3MX5 A;  2A1R A;  1GOB A;  1I3A A;  2BE2 A;  1RTJ A;  3N4P A;  1BA1 A;  4PKH A;  4CD1 A;  3V9X A;  1NK5 A;  2HBL A;  2NRV A;  3ISN C;  3VEZ A;  2X6S A;  3RR8 A;  4H4M A;  4DTP A;  3RSE A;  1BG3 A;  3ITH A;  4AHC A;  3TAB A;  1HR0 K;  2G8H A;  4JKH A;  1NGG A;  3ATV A;  4DTJ A;  3RTV A;  3F2K A;  4CBX A;  1IKX A;  3MXM A;  2J4R A;  2HHW A;  3UKU B;  3O9U A;  3UKR A;  4CER A;  4GV3 A;  3VQC A;  4A2A A;  3NF7 A;  2ASP A;  3L3U A;  1HLU A;  1M90 O;  2ITG A;  4CCH A;  4JS5 A;  4ELU A;  1U04 A;  4CJE A;  3K5O A;  3L3V A;  4E1J A;  1N36 K;  3VPZ A;  1ASU A;  4N5S A;  3K59 A;  4N76 A;  3SQ4 A;  3GBT A;  4YY3 K;  3HSC A;  3D6R A;  5HP1 A;  4W5R A;  3TI0 A;  3CCU N;  3T3F A;  2HHH K;  3VEX A;  3SZ2 A;  2A3Z A;  4RTF D;  3CFO A;  2QWQ A;  4JAX A;  3I56 N;  1K73 O;  2QKB A;  2V52 B;  1DGK N;  3R6M A;  2PZS A;  3TAM A;  1D4X A;  3EZW A;  4Z4F A;  4KTQ A;  3LP0 A;  4CW7 B;  4EHU A;  4IDH A;  2VWB A;  2ZF5 O;  3MMV A;  5TKY A;  3WXJ A;  1WNS A;  3QML A;  4DR4 K;  2KFZ A;  4E7K A;  5D3G A;  2ZE2 A;  3LDO A;  3DRS A;  3ENB A;  4DTM A;  1HNV A;  4DQQ A;  2W40 A;  3NAE A;  3SQ1 A;  4ILG B;  4H5N A;  2YHA A;  3KD5 E;  3WXM B;  3IKM A;  2HBK A;  4DR2 K;  1TUY A;  4BR7 A;  1QQN A;  5AQI A;  3DLE A;  2WUS A;  5GAD P;  4EAH D;  3MX2 A;  5HRN A;  3HK2 A;  2IS3 A;  4DV0 K;  4YOV A;  4IFV A;  3OYI A;  3H1V X;  4CF0 A;  4JS4 A;  3LDP A;  4NXM K;  5AQM A;  5I3U A;  1HYS A;  3AVN A;  4EHT A;  4DSI A;  2WBN A;  4N41 A;  3M1F A;  3PUF A;  1JL2 A;  1ZBF A;  4AF1 A;  5HRR A;  3EY1 A;  4CHN A;  3WXI A;  4A5B A;  5KPZ A;  3CCR N;  3OYG A;  3O08 A;  1TGO A;  3O3F A;  1Z6R A;  2ZJP L;  1WN7 A;  1U47 A;  2E6L A;  1TAU A;  3MEC A;  2I5J A;  5CY4 A;  4M3X A;  1LAV A;  3D2E A;  2PY5 A;  4BQZ A;  3ZT0 A;  3DOK A;  2O8C A;  3TAG A;  5HRO A;  4CEA A;  1VSH A;  4E7L A;  3E9P A;  3CPE A;  3HO1 A;  3H46 O;  3SAH A;  1S3X A;  4CJW A;  4O55 A;  2G8W A;  2WTU A;  4LF4 K;  2XO7 A;  1DLO A;  4DS5 A;  5FLX O;  5C12 A;  4LY7 A;  4Z4E A;  4OLA A;  3AVJ A;  4KBO A;  1GLB G;  5BRD A;  4FM2 A;  4DR6 K;  1QQC A;  2CGL A;  3UKU A;  5AQK A;  3FR0 A;  4RWT A;  2F9T A;  1NWK A;  3BF1 A;  3TSQ A;  1TKX A;  1VRT A;  4R79 A;  3OYB A;  3L2V A;  5AQV A;  4FWO A;  4CZL A;  2HST A;  3VEN A;  1ZC6 A;  3ZT4 A;  4FK2 A;  1JLC A;  1HQU A;  4ISE A;  4BC5 A;  4JKD A;  4NB4 A;  3OBW A;  4KRE A;  4I9L A;  3VTH A;  3AA5 X;  1KVB A;  4ZHR A;  3KWG A;  4CF2 A;  1RT3 A;  1WAF A;  2KKZ A;  4DTU A;  2P5O A;  3SNN A;  5KQ8 A;  2B5J A;  4B9V A;  1MDU B;  4KO0 A;  1SKS A;  1GLE G;  4B3S K;  4DQR A;  1EET A;  4G9Z A;  1VSK A;  3F73 A;  3NF8 A;  4IOC L;  4WFB L;  1U49 A;  5KRT A;  3K58 A;  3B8A X;  4FWQ A;  3VQD A;  2GTD A;  4CZE A;  3J7A P;  1S1U A;  1LCU A;  4DTN A;  4NCG A;  1G15 A;  3VA0 A;  3V9Z A;  4JD2 A;  3AO2 A;  4YDU A;  1CXQ A;  1Q8I A;  4AHS A;  3CFP A;  3TPQ A;  4FJX A;  2DY4 A;  1RNH A;  1WSJ A;  4FZZ A;  4U67 L;  4BG9 A;  3OS0 A;  2WFB A;  5HRS A;  2D5R A;  3KLI A;  2Y1J A;  2V51 B;  1N34 K;  1LOT B;  2AP1 A;  4CHQ A;  3OY9 A;  2O8F A;  2UUC K;  3V81 A;  5KGW A;  3QEX A;  3BEX A;  3CMA N;  1Z25 A;  2ZGZ A;  1BUP A;  5F0X A;  5TKW A;  5I42 A;  4QS8 A;  1L5U A;  2F7T A;  4WQ4 A;  5CE3 A;  3PX0 A;  2DTU A;  1S1W A;  4NYF A;  1XUP O;  5HLF A;  1KAX A;  3CIP A;  5AQG A;  3V9S A;  2NZT A;  3G4S N;  4GMJ B;  2QKK A;  1NOY A;  4E7J A;  5AQJ A;  4WQ5 C;  1WLJ A;  2P9U B;  4KFB A;  4RW7 A;  1JLB A;  3TAE A;  2CH6 A;  2YJE A;  3J7Z O;  4B9N A;  5BPN A;  1U6Z A;  3KTQ A;  1VQP N;  3HVR A;  1TV6 A;  3C6T A;  5C2F A;  3Q7B A;  1WSI A;  3C65 A;  3S3O A;  3KWI A;  4Z0U A;  3QER A;  2G8U A;  1C0G A;  3NHG A;  2F9W A;  4NLB A;  5AJ3 K;  2Q2R A;  5SZT A;  4M3Y A;  2E88 A;  3D7E O;  3K2P A;  4BRN A;  3QNO A;  4CIG A;  1JJ2 M;  3U3Y A;  1RT5 A;  4PL7 A;  1ILY A;  1H1V A;  4B1Y B;  4FW1 A;  4JKF A;  4BRA A;  4J2E A;  5EX5 A;  3VF6 A;  5ADX H;  2FBY A;  4B1X B;  1BQN A;  4FJG A;  2HNZ A;  3C6U A;  1ZYQ A;  1K9M O;  3CG7 A;  4M3W A;  3G71 N;  2QK9 A;  1W7A A;  1RIL A;  1N5Y A;  2AJQ A;  4AQY K;  3OW2 M;  4M3R A;  4BC4 A;  3W3D A;  1C1A A;  4Z4H A;  2VCP A;  3FZH A;  4JKB A;  2HHU A;  3T1H K;  2E1Z A;  2KZM A;  4DSJ A;  4UQG A;  3U9Z A;  4M3Z A;  1GLL O;  3QIN A;  4A59 A;  3C6H A;  3UIQ A;  3ZLJ A;  1GLA G;  3J7Y P;  2P5G A;  3O4N A;  1VQ5 N;  2Q3S A;  5AQU A;  1VQO N;  4KTZ A;  5DM6 L;  2HB5 A;  4BAC A;  3GG4 A;  3G0Z A;  4IXC A;  1CZ9 A;  3BUZ B;  1BCM A;  1VSJ A;  2UUB K;  2YCH A; 
#chains in the Genus database with same CATH homology
 1ATS A;  2CGJ A;  2NRW A;  1HKB A;  5AQF A;  4DKW A;  3WXL A;  3DXK A;  2HBM A;  1IG8 A;  2KHO A;  3IUC A;  1HKC A;  1BU6 O;  2P9L B;  3M6G A;  4BRD A;  3A5L C;  4EIA A;  1VQ9 N;  3ZET A;  3GE1 A;  3WQU A;  1X3M A;  3HBT A;  3R8E A;  3MN6 A;  2QTD A;  1QHA A;  1Z05 A;  5AQN A;  3QDK A;  1Y64 A;  4FWL A;  5AQQ A;  5AZI A;  3RSE B;  3SMS A;  4OPH A;  5EXW A;  4FWN A;  5M1K A;  2QWN A;  2RE2 A;  4FSV A;  3FZK A;  3CC4 N;  2Q97 A;  1T6D A;  3PLA A;  2NRT A;  2YI1 A;  3UE5 A;  1BDG A;  5AFU A;  1QZ5 A;  3SMP A;  4BGA A;  3O8M A;  3I8B A;  3BF3 A;  4YOT A;  2QEX N;  4JHD B;  4DQ8 A;  3ID6 A;  1KQS M;  2OTL N;  1BOT O;  2HF3 A;  2P9U A;  4OPA A;  1JCE A;  4Y0W A;  4PHT X;  4ISG A;  5LJW A;  4BRQ A;  3GDQ A;  4FVU A;  1EQY A;  4CJ7 A;  4YDU C;  5BN9 A;  1TYQ B;  3A8Y A;  3KK7 A;  3SBT A;  1IJJ A;  3AAP A;  3JXU A;  3TSP A;  3NVK A;  4JKA A;  4IEE A;  2P9K B;  5FPM A;  3CJ7 A;  2D4W A;  3VGM A;  3MN7 A;  3O9S A;  3PIO L;  1YF5 L;  3T69 A;  3KZB A;  3QIC A;  4FL9 A;  3G25 A;  3CJB A;  3ZEU B;  4CI6 A;  5BR9 A;  5F1X A;  3U9D A;  1QZ6 A;  5EY4 A;  2OTJ N;  1VQ6 N;  3FGU A;  2E1Y A;  3MX5 A;  3WEE B;  1VQL N;  3FZM A;  3TTD A;  3W0L A;  1T44 A;  5E84 A;  3N4P A;  3TTF A;  1BA1 A;  4PKH A;  4CD1 A;  2QA4 N;  3R9P A;  4WFN L;  2BH1 A;  3HI0 A;  2ZJQ L;  3E66 A;  1NGH A;  2H3G X;  3MWT A;  3MWP A;  4DCH A;  2HBL A;  2NRV A;  3VEZ A;  3VTI A;  4J8F A;  3G6E N;  3L4I A;  3VEV A;  2HOE A;  1NGI A;  4JK7 A;  4H5T A;  4AM7 A;  1W2B M;  5C0Y A;  3NMU A;  2GWK A;  1DKG D;  5EOY A;  5JLH A;  3D2E B;  4OO1 J;  3BP8 A;  1NGJ A;  3GL1 A;  3RSE A;  4YOW A;  1BG3 A;  3IFR A;  3C7N B;  1GLD G;  3H3O B;  4BR2 A;  4JKH A;  3ZX2 A;  4CZJ A;  1K8K B;  1NGG A;  1VQK N;  3ATV A;  3CER A;  3F2K A;  2GX9 A;  4CBX A;  2J4R A;  2VYP A;  3UKU B;  3LDL A;  3O9U A;  3LDQ A;  3OA9 A;  4H03 B;  3UKR A;  2E2P A;  4GV3 A;  5AQR A;  4A2A A;  3MK6 A;  3CJ1 A;  2V7Z A;  2NNW A;  2ASP A;  1HLU A;  1M90 O;  5BRH A;  4CZH A;  4YOU A;  1HKG A;  4E1J A;  4O8K A;  3VPZ A;  2CGK A;  4IOA L;  4I6M B;  5JMV A;  2NRH A;  4GVE A;  2Q31 A;  4FO0 A;  3GBT A;  4B1W B;  3HSC A;  3D6R A;  3QB0 A;  3WQT A;  3VES A;  5CR4 A;  2JWK A;  2QWM A;  4QS9 A;  3ULE A;  3H3N O;  3CCU N;  4KH5 A;  4U7B A;  3HZ6 A;  3VEX A;  1WUA A;  2A3Z A;  4FWP A;  3D2F B;  4RTF D;  2QWQ A;  4JAX A;  3I56 N;  4IO9 L;  5AQO A;  4M7X A;  4CZG A;  1K73 O;  2D0P A;  3CJC A;  3H45 C;  3TU5 A;  1ZBS A;  4WF9 L;  3ID8 A;  1J6Z A;  3N4Q A;  2DPN A;  2V52 B;  5B8H A;  5JLF A;  1DGK N;  3R6M A;  1D4X A;  3EZW A;  2E2N A;  1X3N A;  1W97 L;  4RCH A;  4FWK A;  5GIO A;  2P9N A;  4FOE A;  4EHU A;  3VEW A;  3SBG A;  4IDH A;  2VWB A;  2ZF5 O;  3O9T A;  3MMV A;  3VGK A;  1RFQ A;  5TKY A;  3WXJ A;  3QML A;  3AAR A;  2FLO A;  2KLA A;  5AQS A;  1RDW X;  3LDO A;  2YHX A;  3ENB A;  4FWS A;  5AQW A;  4BGB A;  2Q0R A;  3VOV A;  3DXK B;  4KH6 A;  2IVO A;  2W40 A;  3AY9 A;  5M1O A;  3VGL A;  4ILG B;  3LDN A;  4H5N A;  3WXM B;  3IKM A;  2HBK A;  3I55 N;  1TUY A;  1MWK A;  4BR7 A;  1QQN A;  2ASO A;  4MDB A;  2P9P A;  5AQI A;  1GLC G;  5AZJ B;  2WUS A;  1SZ2 A;  5AQX A;  5GAD P;  2QM1 A;  5GAG P;  4JNE A;  4EAH D;  3MDQ A;  3MX2 A;  3P39 A;  1VQM N;  4YOV A;  4BG8 A;  3H1V X;  3ZYY X;  3I33 A;  4FOI A;  3LDP A;  4FWM A;  5AQM A;  5ADX A;  1S72 N;  1KC8 O;  4EHT A;  3O1W A;  3KHY A;  2WBN A;  1DT9 A;  3A5N C;  3CC2 N;  1P90 A;  3M1F A;  1YAG A;  3O4W A;  4MDA A;  2E2O A;  3VF4 A;  4AF1 A;  2I7N A;  3FZF A;  3WXI A;  4A5A A;  4BC3 A;  4JD2 B;  4A5B A;  5KPZ A;  4BVP A;  3M5R A;  3CCR N;  4WFA L;  2NRZ A;  3O08 A;  3DAW A;  3U8X A;  5C2D A;  1NGE A;  3EN9 A;  4C1N I;  1Z6R A;  2ZJP L;  3AGR A;  4WYB A;  1YIT N;  3CCL N;  1BA0 A;  3CC7 N;  4CZM A;  4XH4 A;  1U2V B;  4JKG B;  3EE9 A;  3C7N A;  3WUH A;  5EVZ A;  2P9S B;  3D2E A;  1SS6 A;  4BQZ A;  2GEM A;  3CET A;  3OBY A;  4BY9 C;  3QFU A;  3K9K A;  4H0O A;  1NMD A;  4UY8 O;  3K9J A;  2Q1N A;  4FPB A;  5C10 A;  3E9P A;  2V7Y A;  3CPE A;  3H46 O;  1K8K A;  1OKJ A;  3SAH A;  3IDH A;  1RGI A;  1S3X A;  5AQT A;  1HPM A;  1HX1 A;  2NRX A;  5KQD A;  1YUW A;  4BRH A;  1MA9 B;  2YJF A;  4GNI A;  3DXM B;  1Q18 A;  4FPA A;  3LM9 A;  5BRF A;  2YX6 A;  2P9P B;  2ZJR L;  4C1N K;  1R59 O;  4H5W A;  3WXK A;  5JVG L;  1M1K O;  5M1F A;  5C12 A;  4BR5 A;  3CF5 L;  1NGA A;  3H6E A;  2P9I B;  3NVM A;  4IOX A;  1QQO A;  2FSN A;  3CCS N;  4KBO A;  1GLB G;  2PBD A;  5BRD A;  5LY3 A;  3EKS A;  3L0Q A;  4A57 A;  2CGL A;  3UKU A;  2BTF A;  4C23 A;  4XEI A;  5AQK A;  3FR0 A;  4PL8 A;  4CZI A;  3P38 A;  4IJA A;  3CJ9 A;  5LJV A;  2F9T A;  4RWT A;  1NWK A;  1SAZ A;  3BF1 A;  3HRG A;  3TSQ A;  4BRL A;  5FPE A;  4IEI A;  2A6A A;  4R79 A;  5FPD A;  2WC9 A;  3WT0 A;  2P9L A;  3O5B A;  1YJ9 N;  3CCM N;  3P4I A;  1XQS C;  5BN8 A;  2IIR A;  4L3Q A;  3MCA B;  3QBW A;  5AQV A;  1NLV A;  3FZL A;  2YHY A;  4FWO A;  4PKG A;  4CZL A;  5HL7 L;  1ZXO A;  1VAZ A;  2ITM A;  2HST A;  3VEN A;  3TSU A;  2EWS A;  1ZC6 A;  2HBJ A;  1YVN A;  1TUU A;  3J8A A;  3PIP L;  4IWV A;  4K41 A;  1BWF O;  3HM8 A;  3R1X A;  4ISE A;  4WCE L;  4BVO A;  4BC5 A;  3CQX A;  3VET A;  4GV9 A;  4JKD A;  4NB4 A;  3OBW A;  4FWR A;  3VTH A;  4IZ9 A;  3Q7C A;  5BRE A;  1VQ7 N;  3KWG A;  2KKZ A;  2FXU A;  4BQL A;  1G99 A;  4JK9 A;  3RVC A;  2BUP A;  5KQ8 A;  5HOO A;  3H1Q A;  2E2Q A;  4NO7 A;  1MDU B;  4MO4 A;  3EO3 A;  1GLE G;  2UYT A;  3CHW A;  3O6W A;  4JK8 A;  4B1U B;  5GIP A;  4G9Z A;  1HJO A;  3UB5 A;  4A2B A;  5E26 A;  2GEL A;  4IOC L;  5JIC A;  4WFB L;  4H0V B;  4H5R A;  4IFE A;  1MWM A;  3CME N;  3B8A X;  3EKU A;  2P9K A;  3L6Q A;  2NLX A;  4MLE A;  3VF2 A;  5BPL A;  4PKI A;  1NGB A;  2IVN A;  4FWQ A;  1SQK A;  4NLC A;  3AAQ A;  2GTD A;  2P9I A;  2D1K A;  2NRR A;  4CZE A;  4XH1 A;  1JCF A;  3ZEU A;  5M1P A;  3VEY A;  2FSJ A;  1LCU A;  4K25 A;  3O1B A;  2FSK A;  5FPN A;  4JKC A;  4JD2 A;  1K8A O;  4MO5 A;  1KAZ A;  1T3V A;  3CCV N;  4YDU A;  3OHR A;  4HTL A;  1ATN A;  1X9J A;  4ISF A;  3VER A;  4B1Z A;  4B9Q A;  1Q81 O;  4GV6 A;  3TPQ A;  1CZA N;  3ATU A;  4K43 A;  4BRP A;  2IVP A;  5AQY A;  1P8Z A;  2JWL A;  1VQN N;  4U67 L;  4BG9 A;  2WFB A;  4BRF A;  4M7Y A;  2V51 B;  3VMF B;  3L4Q A;  1LOT B;  2AP1 A;  4CZF A;  1O13 A;  3EE8 A;  4F9O A;  2HF4 A;  3CXC M;  3CCE N;  1ESV A;  2FF3 B;  1C0F A;  4O8U A;  1NGC A;  3FE1 A;  1KD1 O;  3M3Z A;  3BEX A;  3CMA N;  4BRC A;  2ZGZ A;  1WOQ A;  2P9S A;  1BUP A;  2HMP A;  5F0X A;  5TKW A;  4H5V A;  5DM7 L;  4YOX A;  1YIJ N;  1XC3 A;  2ASM A;  4QS8 A;  3ZET B;  4BC2 A;  1GLF O;  3S41 A;  2F7T A;  1Q82 O;  3E9O A;  4H0Y B;  4WQ4 A;  1YJN N;  5CE3 A;  4H0P A;  4BRO A;  1E4F T;  2VGN A;  1XUP O;  1KAX A;  3CIP A;  5AQG A;  4CBW A;  3F9M A;  4H0T B;  2NZT A;  1ATR A;  3GOI A;  3O9R A;  5ELZ A;  5AQL A;  5AQP A;  3ZX0 A;  4BR4 A;  1TYQ A;  3G4S N;  4JEP A;  2ZGY A;  3TTC A;  4CD3 A;  2Q36 A;  4A61 A;  5AQJ A;  2QXL A;  2P9U B;  1NGF A;  2VGM A;  4WQ5 C;  3SJH A;  3QFP A;  4B1V A;  3LL3 A;  1Q7Y O;  1U2V A;  4JKG A;  5M1N A;  3DXM A;  4DHY A;  4YOY A;  4M63 C;  1T6C A;  5BPM A;  3CCJ N;  4K42 A;  3CI5 A;  3AGK A;  3HOT A;  4GY2 B;  2CH6 A;  2YJE A;  3J7Z O;  5BPN A;  2QWP A;  4BR0 A;  1OVY A;  1U6Z A;  2GUP A;  4BRK A;  2D0O A;  3FFK B;  5AR0 A;  4AM6 A;  4BRG A;  3E1Y A;  5GIN A;  1VQP N;  1N8R O;  5C2F A;  5AFU H;  3E9L A;  3Q7B A;  1V4T A;  1KXP A;  3C65 A;  4DB3 A;  4EFH A;  2QI2 A;  3KWI A;  3U4L A;  3F5T A;  3R3L A;  3QBX A;  3SAF A;  1C0G A;  2YHW A;  3VEO A;  1YI2 N;  3MCP A;  3DJC A;  3A0I X;  4JKE A;  1VQ8 N;  1VQ4 N;  1DEJ A;  2F9W A;  4NLB A;  2QW9 A;  1NBW A;  2Q2R A;  3CQY A;  4ILJ A;  4WQ5 A;  4BRI A;  5H1S Q;  3ENH A;  2E88 A;  3O9Q A;  1NM1 A;  3D7E O;  4BRN A;  2GWJ A;  3C0B A;  4HWI A;  5AQH A;  3SK3 A;  1HUX A;  1JCG A;  4MLH A;  1JJ2 M;  3HOS A;  3DLL L;  3MN5 A;  3CD6 N;  4PL7 A;  2I7P A;  2PFU A;  1ILY A;  4WQ4 C;  1KAY A;  4Z94 A;  1H1V A;  4IO8 A;  4B1Y B;  5MLC Q;  4JKF A;  4BRA A;  4CZK A;  5EX5 A;  4KH4 A;  3VF6 A;  5KPR A;  1YXQ A;  4I6M A;  5ADX H;  3DWL A;  4BRM A;  3C6A A;  2FF6 A;  4QS7 A;  4BR9 A;  5KPT A;  3IMX A;  1QVF M;  3MN9 A;  2AA4 A;  2ZWH A;  4B1X B;  2W41 A;  3UKR B;  4XH5 A;  1YJW N;  1K9M O;  1GLJ O;  3G71 N;  5AZJ A;  4H0X B;  1NGD A;  3P31 A;  2A41 A;  3T7Z A;  2RHK A;  4ILH A;  3A5O C;  1V4S A;  3CJA A;  4A62 A;  5GAH P;  3CPW M;  3ENO A;  4LC9 B;  1BO5 O;  3OW2 M;  5JVH L;  1S22 A;  5C15 A;  3SLC A;  2A40 A;  4BC4 A;  2E20 A;  3W3D A;  4CBU A;  1EO1 A;  2VCP A;  5GAE P;  5CHI A;  3FZH A;  4JKB A;  2P9N B;  2QWL A;  2E1Z A;  1YHQ N;  3EL2 A;  3ZX3 A;  3U9Z A;  3A5M C;  2A42 A;  4IJN A;  1QQM A;  5AQZ A;  1GLL O;  2Q0U A;  2CH5 A;  3KVG A;  4A59 A;  4O5F A;  1RDU A;  3C6H A;  4JHD A;  5M1Q A;  2OAN A;  4BRE A;  1Q86 O;  3LM2 A;  1NJI O;  3JS6 A;  5F2R A;  1GLA G;  2QWR A;  3ULE B;  1VQ5 N;  2A5X A;  3HTV A;  3O80 A;  5AQU A;  1VQO N;  4YOR A;  3SAG A;  3CCQ N;  1E4G T;  5I9E B;  5DM6 L;  1QVG M;  3GG4 A;  5AZI B;  2QWO A;  3D2F A;  4IXC A;  3WEE A;  3BUZ B;  2E8A A;  4JN4 A;  2PAV A;  2YCH A;  3FLC O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...