3AAQA

Crystal structure of lp1ntpdase from legionella pneumophila in complex with the inhibitor arl 67156
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
353
structure length
349
Chain Sequence
KHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
total genus 106
structure length 349
sequence length 353
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aaqA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aaqA02
3MN9A 2QWLA 3VEOA 2A41A 2ZWHA 5EX5A 4BRGA 3CHWA 3MMVA 5BPLA 2FF6A 1ATRA 4CD1A 1KXPA 4IXCA 2YCHA 3O4WA 1BU6O 4DHYA 1K8KA 5KQDA 2ASOA 1S22A 3WXKA 1XC3A 2E2QA 2E2OA 3CJ9A 4YDUA 3C0BA 1BA0A 4BRNA 2I7PA 4IZ9A 4BVOA 1JCFA 2FXUA 5AQRA 3QMLA 5AQGA 1G99A 2GTDA 2FSKA 2FLOA 1E4FT 4K42A 3BEXA 4B1WB 4PKIA 2F9WA 2P9NB 2D0OA 3CJCA 1HPMA 5KPTA 3VEYA 3FZHA 4BGAA 5AFUA 3SK3A 2ASPA 3TPQA 3GG4A 3VETA 5AZIB 3LM2A 3ZEUA 5AQZA 4XEIA 3QICA 2HMPA 1NGHA 2VYPA 2D0PA 1NGJA 3CJAA 4FL9A 2ITMA 1Y64A 3M1FA 1YVNA 5E26A 1BWFO 1H1VA 1TUUA 2E20A 4M7XA 2A5XA 3IUCA 4GY2B 4QS8A 3ID8A 2I7NA 4BRIA 4Z94A 5EY4A 3DAWA 3R6MA 4QS7A 4FO0A 3W3DA 2V52B 2YJEA 4LC9B 5BRFA 3R9PA 4WQ5A 3W0LA 1SQKA 2YHYA 2V51B 4B9QA 4BC3A 4BRAA 2E2PA 3C7NB 3WEEA 3WXJA 3OHRA 4H0YB 2YJFA 4YDUC 2Q36A 4JHDA 3VOVA 5JLFA 4WQ4A 4CI6A 2V7YA 1C0GA 3SMSA 1BG3A 2OANA 3D2FB 1GLFO 3QBXA 4F9OA 2AA4A 1QQOA 1DGKN 3DXMA 3LDLA 2HOEA 1KAZA 1TYQB 3VGLA 3ZEUB 4EAHD 4CZHA 1HLUA 1GLEG 3GL1A 2Q31A 3A5NC 5TKYA 3U4LA 1S3XA 2CGJA 1JCEA 3I8BA 1ZBSA 4ISEA 3TU5A 3A5LC 3IFRA 3CQYA 2ZGYA 4A2AA 2KHOA 1U2VA 3AAQA 4A62A 4A2BA 4CZIA 3DXKA 4BGBA 5JLHA 1X3NA 1T44A 3WQTA 2YHXA 4BRQA 3LDQA 1DKGD 3F9MA 4JN4A 5BPMA 2VWBA 4JD2A 4L3QA 1RGIA 4BRHA 5ADXH 4Y0WA 2GEMA 5F2RA 1NGDA 4CZEA 1MWKA 3DJCA 4BR4A 1MWMA 1NGFA 1ESVA 1LCUA 2BUPA 5AQJA 5KQ8A 2E88A 2F9TA 3JXUA 5F1XA 2IVOA 3EKUA 3FFKB 5LJVA 1HUXA 1JCGA 4RWTA 4A61A 1HX1A 1EQYA 3CJ1A 3FGUA 3L4IA 4H5TA 1XUPO 2NZTA 2V7ZA 2P9IB 1D4XA 3QB0A 1NGBA 3FZLA 2P9PA 4H0VB 4PKGA 4BR0A 1BO5O 3QFPA 3CJBA 4BRPA 3G25A 3FZKA 4XH1A 3WXIA 4MO4A 2P9UB 3O80A 1IG8A 4FWNA 4CBWA 3AY9A 1MA9B 3U9ZA 1X3MA 1YAGA 1NGCA 3ENHA 3SLCA 4O5FA 4BG9A 3J8AA 4FWPA 1P8ZA 4FOEA 2ZF5O 3MCPA 1U6ZA 2BTFA 4CZKA 1R59O 5AZIA 1HKBA 2W40A 3BF1A 2NRHA 3P4IA 5EOYA 1BOTO 5AQNA 1HKCA 4KBOA 5FPEA 4WQ4C 3EN9A 2E8AA 2Q1NA 2P9LB 5AQHA 3VGMA 4NB4A 3HZ6A 4M63C 5F0XA 3KHYA 4QS9A 4HTLA 4MO5A 3SJHA 3QBWA 3H46O 4HWIA 2A42A 5AQOA 3U9DA 2GUPA 1NGGA 2D1KA 2AP1A 3DXKB 1XQSC 2J4RA 4FWMA 4H0XB 5AQYA 1Z6RA 4FPAA 3O6WA 1NGEA 4BQLA 4BR9A 3RSEB 4B1YB 4CBXA 2QWQA 4I6MB 2PAVA 4JD2B 4O8KA 3O1BA 4CBUA 3WQUA 5FPDA 3GOIA 3D2EA 3GDQA 3KZBA 3H6EA 2P9KA 2CH6A 3BUZB 3O08A 3UKRA 3FLCO 4H5NA 2EWSA 3BF3A 4BC2A 2YHWA 2QWNA 3H3NO 3MDQA 3ULEB 4DB3A 3A5OC 3CJ7A 3EO3A 3IMXA 3ENOA 5AQTA 1V4TA 2P9LA 3QFUA 2P9NA 5AQVA 1RFQA 5E84A 3UE5A 3VEVA 3WXLA 1TYQA 2FSJA 1GLAG 1V4SA 5BN9A 1GLJO 2GELA 3GE1A 3ZX0A 2ZGZA 4FWSA 3GBTA 3H3OB 3VPZA 1NGIA 4JNEA 4H0PA 2QM1A 3ZX3A 4BC4A 5AQPA 1ZXOA 5EXWA 2IVNA 5AQWA 3MN7A 4IWVA 5BN8A 1U2VB 4BC5A 3VENA 5AFUH 5AR0A 4BRKA 5AZJA 3VEWA 4NO7A 4CJ7A 3RSEA 5BRDA 5FPMA 3H1VX 4I6MA 3BP8A 3MK6A 1LOTB 4RTFD 4CZGA 4BROA 1GLDG 3S41A 3CETA 4WYBA 4H5VA 4BRCA 4C23A 2Q0UA 3WUHA 2P9SB 1T6CA 3D7EO 5CE3A 4FSVA 5AQQA 3VF6A 2GWKA 1NMDA 3ATVA 1QZ6A 3L0QA 1ATNA 1Q18A 3HTVA 4B1VA 3H45C 2E2NA 2P9IA 1K8KB 3EKSA 2DPNA 3U8XA 1RDWX 5KPZA 1DEJA 3EL2A 4MLEA 3VESA 5LJWA 4H03B 2YI1A 3VEZA 4CZLA 5AQMA 2E1ZA 4K43A 3VGKA 1QHAA 4BR5A 1NGAA 3C7NA 3WEEB 4DQ8A 4BG8A 4B1ZA 1NLVA 3QDKA 3LL3A 4FPBA 3ZETA 3M3ZA 5JMVA 1HJOA 3LDNA 3WT0A 3UKUB 2P9PB 3B8AX 5AQXA 1NM1A 2H3GX 3DXMB 4XH4A 3MN6A 4B1UB 3L6QA 4J8FA 5KPRA 1GLBG 4BRFA 2WUSA 4FWOA 2D4WA 2FF3B 2QWMA 5FPNA 4FWLA 5AZJB 2UYTA 3LDOA 4H5RA 4BVPA 5ADXA 4DCHA 3ZX2A 4ISFA 1BA1A 4K25A 3HI0A 3IDHA 4PKHA 5LY3A 4M7YA 3UB5A 1SZ2A 2HF4A 4BR7A 5EVZA 2NLXA 1NWKA 3I33A 1WOQA 3AARA 4MLHA 3R8EA 2A6AA 1WUAA 2QXLA 3DWLA 4BRLA 1SAZA 3JS6A 5BREA 2GWJA 2HF3A 3HSCA 2CH5A 1QQMA 4EIAA 4ISGA 2Q97A 3D2EB 5AQSA 1TUYA 3ZETB 2Q2RA 2VCPA 4H5WA 2QWRA 4IJNA 1X9JA 4RCHA 1E4GT 3D2FA 3UKRB 1GLCG 3CQXA 3SMPA 2W41A 4EFHA 4XH5A 1BUPA 2PBDA 3LM9A 1BDGA 4AM7A 4CZMA 4CZJA 3A0IX 2QW9A 4FOIA 3FR0A 1MDUB 1HKGA 3ATUA 4H0TB 2FSNA 5AQIA 1Z05A 3HBTA 1ZC6A 4EHTA 3VF2A 1QZ5A 4E1JA 4PL8A 4BR2A 3O8MA 3CIPA 4AM6A 4H0OA 3H1QA 1J6ZA 3O1WA 4WQ5C 5AQFA 3A8YA 3LDPA 1IJJA 4CD3A 2IVPA 3VF4A 2ASMA 3ULEA 4CZFA 4JAXA 4PL7A 1QQNA 3CERA 2A40A 4K41A 3UKUA 3FZFA 3AAPA 4FWRA 3M6GA 4FWKA 3A5MC 4EHUA 1YXQA 4BRDA 3VEXA 1C0FA 2E1YA 3CI5A 5AQLA 3EZWA 1ATSA 1NBWA 4B1XB 3MN5A 5I9EB 4IJAA 5B8HA 2A3ZA 2QWOA 5BRHA 2P9KB 4BREA 4FWQA 2IIRA 1KAXA 3KVGA 4IO8A 4GNIA 1YUWA 4BQZA 2P9UA 5JICA 3FE1A 5BR9A 1CZAN 2Q0RA 3O5BA 4JHDB 4BRMA 5ELZA 5AQUA 3FZMA 1T6DA 2CGLA 1GLLO 2CGKA 1OKJA 2QWPA 3VERA 5BPNA 3HM8A 2P9SA 1KAYA 5AQKA
chains in the Genus database with same CATH superfamily
3C6TA 4YOVA 1JLEA 3L8BA 2QWLA 5KGXA 4DQQA 1J5OA 4BRGA 3OS2A 4FW1A 3G6EN 3MMVA 2BANA 3D45A 1VSJA 3AA4A 3HVTA 4IXCA 3DOLA 2QI2A 4DHYA 4DV0K 2NRVA 4CJPA 3NGYA 1XC3A 3CJ9A 2E2OA 3Q7BA 1VSMA 1OH7A 4LF4K 4KB1A 4IZ9A 1EKEA 4J2BA 3M8QA 1HMVA 3WXMB 4LF9K 2ZD1A 1SKRA 5CR4A 3DRSA 4PKIA 4NYFA 1HPMA 1IBLK 3P5JA 3SK3A 1Z26A 4YNQA 1NJXA 4CHQA 3VQCA 2HMPA 1VAZA 1QVGM 1NGHA 2JLEA 1VQON 2VYPA 3CFPA 4JKAA 2D0PA 4JKCA 3KKRA 4GKJK 3RRGA 1UA1A 4IFYA 1YVNA 3CXCM 4JV5K 1H1VA 1BIZA 2E20A 3BZCA 1LWEA 4JEPA 1X9MA 2I7NA 4BE2A 3OYDA 4DLEA 1LV5A 4O55A 5EY4A 1RTDA 1SKSA 4DS4A 2KQ2A 4OX9K 4ILJA 3W3DA 3OYGA 4BDYA 1N34K 5BRFA 2FBXA 3LWLA 3W0LA 3PSFA 3K5NA 4N47A 4AHSA 4DTOA 2HHTA 2D0CA 1N36K 2VG7A 4JHDA 1C1CA 5JLFA 1BL3A 2GV9A 4M41A 3SMSA 3D2FB 4PA1A 3K58A 1QQOA 1HQUA 3VQEA 3LDLA 3NCIA 2HOEA 1C1BA 5M1FA 3VGLA 3TANA 3ZEUB 1S1XA 1HLUA 3M5RA 2Q31A 5TKYA 4GV3A 3SAGA 3U4LA 3QNNA 4OO1J 2HBKA 3I8BA 3LP2A 4WFNL 4CJ4A 4ISEA 4DFPA 3IFRA 4CJRA 2BDPA 3ZSZA 4A2AA 4IBNA 4K0KK 1JLCA 4GVMA 4B9VA 3DXKA 3BDPA 3VTIA 4CF2A 2YHXA 4AHRA 2DFEA 1S1WA 3SUNA 3K5LA 3RR7A 3G0ZA 4DUYK 4L3QA 4CERA 3KD1E 1MWKA 4NXMK 4JI2K 1VSHA 1NGFA 1RNHA 5KQ8A 3SQ2A 3FFKB 3DLHA 3E9OA 1JCGA 4RWTA 4WF9L 1Q86O 4H5TA 1XUPO 3NF6A 4EP5A 3PUFA 4FLYA 5I3UA 2P9IB 4KHPK 2HVIA 2HW3A 3C6HA 4ELUA 4PKGA 1BO5O 4FJ9A 3QFPA 3G25A 4E7IA 3FZKA 2FBYA 3FFIA 2G8UA 1IKXA 2EHGA 4KPYA 1MA9B 4CECA 4R5PA 4K8XA 3SLCA 5J2NA 3S3MA 3V1QA 2NRRA 4FWPA 4N76A 4FOEA 3AVHA 2GBZA 1HKBA 3ZSWA 3QNOA 3P38A 5AQNA 4KI4A 3EN9A 5AQHA 3HZ6A 4MDAA 1WAFA 4M63C 4EP4A 4CK3A 3IKMA 2JGUA 4HTLA 1U47A 4FM0A 3OYAA 3QBWA 5LMNK 1WSGA 2GUPA 2IAJA 2AP1A 2J4RA 4CFBA 1GOCA 1TAUA 3O6WA 4BQLA 4BR9A 4B1YB 3CC2N 2PAVA 3V1RA 3WQUA 3GOIA 3D2EA 4MFBA 3KZBA 1D9DA 3SPYA 2YNHA 3BUZB 1N32K 4Z4FA 3O08A 4C8NA 1GOBA 3HRGA 2HBLA 5SWMA 3MDQA 3TAQA 4E89A 4DB3A 3VA0A 3KK7A 3C6AA 3QFUA 2P9NA 3AVNA 5AQVA 2X6NA 4C8KA 4IG3A 3T1YK 3MXIA 3PX6A 1DLOA 1QSLA 3RR8A 3OJSA 1XNRK 4IO9L 4JNEA 5C24A 4DR1K 2O4GA 1N5YA 4DV4K 4Z4CA 1ZBIA 2JWKA 3MN7A 3AVLA 5C2FA 1U49A 4B9UA 4BC5A 1VQ7N 5AFUH 4N5SA 1W97L 1BCMA 3VEWA 3LZJA 1VQ4N 3SNNA 3I55N 2W6KA 1B9DA 1QS4A 5BRDA 3DOKA 4I6MA 4FVUA 3QINA 4DMNA 4FJGA 4RTFD 3C95A 1WNSA 1KVBA 4CZGA 3VTHA 3CCSN 1GLDG 4DTNA 4WYBA 4H5VA 4BRCA 3SQ0A 4LF5K 3THYB 1T6CA 3NVKA 3D7EO 3T3FA 3O9RA 3AA3A 4LH4A 5LL6Z 3NMUA 2R7YA 1NMDA 3ATVA 4LFBK 1QZ6A 3CCVN 2G8KA 2ZM6K 4CGDA 3HTVA 4KHWA 1OVYA 4M3WA 1RDWX 5LJWA 3P83D 1VRUA 3QESA 3VEZA 5C42A 3MXJA 1VQNN 4DR6K 3SV4A 5AQMA 4PHTX 2O8CA 2RHKA 1NGAA 2HBJA 3ZETA 4DSKA 1TK5A 3AA2A 3WT0A 3UKUB 3NBPA 1YJNN 3THWB 5AQXA 1NM1A 3PSIA 3ZLJA 4FZYA 3JAMO 2H3GX 1KVAA 4XH4A 3OA9A 1UA0A 3L6QA 1REVA 3WNFA 3CYMA 1VQ9N 3O9SA 4FWLA 3LDOA 2DFFA 3QEPA 1S1TA 3U3YA 1VSLA 4KH6A 4M7YA 1SZ2A 3OYEA 4A5AA 4YOYA 3C6UA 1RDAA 1VSDA 3G10A 4FJNA 3JS6A 2GWJA 4ILGB 2ITGA 3SJJA 2ZJQL 4FYDA 3OW2M 1JLGA 4CCHA 2WC9A 5T7BA 3KK1A 2Q2RA 2QWRA 5DMRA 4IFEA 3D2FA 1GLCG 3SMPA 4NCAA 2W41A 2O8BA 4XH5A 2PBDA 3CCRN 1S72N 5FROA 4HCCA 1YT3A 4CZMA 5C2DA 4FOIA 1HKGA 3ATUA 3NFAA 2OYQA 4EHTA 2O8DB 4PL8A 4FJXA 3O8MA 2YHBA 3H1QA 3OYKA 3ZT0A 4E7KA 1FW6A 3A8YA 3LDPA 1L3VA 2ASMA 1HNXK 4FM1A 3RMCA 4CFDA 4PL7A 1QQNA 3CCUN 1NKEA 1L3UA 4B3SK 3V81A 1N6QA 4FWRA 3VQ5A 2G8HA 1HJRA 4FWKA 5BR8K 3LWMA 4R79A 2B5JA 1JLFA 2HNYA 2YHAA 3OYCA 2VQEK 1FJGK 2QEXN 4E1NA 1C0FA 3CMEN 1M1KO 4M45A 4CJEA 3MN5A 1U4BA 4DU4A 3V6DA 4I9QA 2A3ZA 4KHNA 1NKBA 3Q7CA 2P9KB 4BREA 1VQ8N 4FWQA 2IIRA 3HP6A 2G8FA 1YUWA 1NU0A 5BR9A 1SUQA 5I42A 3CCLN 4K8ZA 4DQPA 1T6DA 1ZBUA 2CGLA 5BPNA 2P9SA 3VQPA 3O9TA 1KAYA 5AQKA 3DLEA 4DTRA 5H1SQ 3ZCMA 5C15A 3L2QA 3CHWA 4B9SA 1WB9A 1IG9A 5JVHL 4KTQA 2IOCA 1BU6O 4C8OA 1K8KA 5AJ3K 1C6VA 4E0DA 3V9UA 2A1SA 4BRNA 5C12A 3G71N 2I7PA 2AJQA 1G99A 1TL1A 2FSKA 2FLOA 4DS5A 4K42A 3AVCA 1FK9A 2F9WA 1LAVA 3CJCA 1NJIO 4LH5A 1EP4A 4DTJA 4F8RA 3GG4A 3TTFA 5FRNA 3TTDA 2VWKA 3E01A 4XEIA 3OYMA 4RW6A 1RTHA 4OJRA 3OYFA 1NGJA 4FL9A 5E26A 4F4KA 1BWFO 1JKHA 3HPHA 4CJSA 3IUCA 4J2EA 1Y97A 1HRHA 3ID8A 4X65K 1S6QA 4MDBA 3D0PA 3O3HA 1YTUA 5JS1A 1BIUA 5J2PA 4L8RB 4W5NA 4NLBA 3R9PA 1SQKA 3E9LA 5CYQA 4FXDA 4B9QA 4BC3A 3WEEA 3QEXA 3RRHA 1K6YA 3N4PA 3DI6A 1BG3A 3ISNC 1KRPA 1K8AO 1JXEA 3DXMA 1S1VA 1KAZA 1TYQB 4AQYK 2QKBA 2HHWA 4IOXA 1GLEG 3RMAA 3NGZA 3MXMA 2BE2A 3A5NC 4LD0A 3J7ZO 4JI4K 1TK8A 1S3XA 2CGJA 4NXNK 1JCEA 2O8BB 1ZBSA 4DSFA 3TU5A 1TKDA 3BZKA 4OKEA 3AVKA 3R1XA 1G15A 2KFZA 3SPZA 4A62A 3PY8A 3ZSOA 4M42A 1IO2A 4AILC 4IDHA 3LDQA 1JL1A 5BPMA 2VWBA 1SKWA 4DFKA 4PUOA 4PY5A 1RGIA 1NGDA 3OYIA 3U3GA 2F9TA 3JXUA 3F5TA 3EEQA 5LJVA 1T7PA 3FGUA 4HUGA 3THXB 4EZ6A 3TAMA 2P9PA 1KTQA 4E7JA 3AVAA 5HP1A 1R0AA 3N4QA 2LSNA 3WXIA 1Q81O 3AVIA 4Y1DA 4FWNA 4KH5A 4LFCK 1NG9A 1X3MA 3NVMA 4LSNA 2QA4N 3U6FA 2I5JA 4CFCA 5E41A 3ZT2A 2UUBK 3HK2A 3AVJA 3EY1A 2X74A 4G9ZA 4UY8O 4OLAA 4CHOA 2E4LA 4FJ7A 5HBMA 3P4IA 5EOYA 2OPPA 1HKCA 1L3SA 2IDOA 1O13A 4KBOA 5FPEA 4WQ4C 3KWGA 2E8AA 2Q1NA 2P9LB 4NB4A 2Y1IA 4FLZA 5F0XA 3KLFA 3KHYA 4MO5A 4LF6K 1QVFM 1J53A 4HWIA 1BI4A 4DWIA 1YHQN 2QXFA 5KTQA 3CCJN 1IV0A 1NK7A 4W5TA 2YNGA 4H8KA 4JRPA 1QSYA 4CESA 1KVCA 5GIPA 4DLGA 3RSEB 3S3OA 4KB0A 2QWQA 1B92A 4JD2B 1WSHA 3OBWA 4M3UA 3HYFA 4DSEA 3SZ2A 3H6EA 2P9KA 3DMJA 1QSSA 3FLCO 4OKJA 1RT1A 4GMJB 2BGGA 4CF0A 3DLGA 3TI0A 1HYVA 3A5OC 3CJ7A 3EO3A 3IMXA 4CHYA 3ENOA 5AQTA 1V4TA 3BY5A 3O9QA 1RFQA 3QIPA 4NLCA 4CJWA 2O8CB 3TSPA 4JKHA 4E19A 2IC3A 3CCQN 1GLJO 1D9FA 3GE1A 5DM7L 5M1QA 3V4IA 5K14A 4J2AA 3KD5E 4M3RA 1NGIA 4BDPA 2HHVA 3ALYA 1TAQA 1ZXOA 1NK8A 1JL2A 4JS4A 4IWVA 1LWCA 2D0BA 4B08A 1U2VB 1NJZA 4BRKA 1Q9YA 3SBTA 1P90A 4NO7A 3IS9A 1VQ5N 4CJ5A 3NH1A 2E5LK 5FPMA 4OVLA 2ATQA 3LP1A 2D5RA 1LOTB 4AHCA 4BROA 4KFBA 3VQBA 4C23A 3WNEA 4CJKA 3AO4A 2P9SB 3WUHA 1SL2A 4FLUA 3KIOA 4O0JA 3VF6A 4KH4A 2GWKA 1M90O 3L0QA 1ATNA 4H4OA 1DTTA 5JVGL 4JKEA 4B1VA 3HJFA 1WSFA 3EKSA 5HLFA 4Q5VA 4BY9C 4M3TA 5TKWA 4FVMA 4ICLA 2FBTA 1C1AA 3AO1A 1RT7A 1TL3A 3WEEB 5HRPA 4DV5K 4BG8A 4B1ZA 1NLVA 5A2QO 3AO2A 3IAYA 5J1EA 3UIQA 5JMVA 1HJOA 3LDNA 2P9PB 2QKKA 4FZXC 3G4SN 2OZMA 4JI1K 3MN6A 4B1UB 4CEFA 3HOSA 5DM6L 4BRFA 2DY4A 2Z1GA 2D4WA 3AVGA 2FF3B 5C10A 2RKIA 5AZJB 2UYTA 3T19A 4YOWA 4AH9A 3ZSYA 4GKKK 4Z4IA 3ZX2A 5IT9O 1JXBA 4ISFA 3HI0A 4CIFA 3MX5A 4RW9A 3IDHA 5LY3A 5CZ1A 3DYAA 2HF4A 5EVZA 3QO9A 2NLXA 3KLGA 3M8SA 2OTLN 4MLHA 3R8EA 4KKOA 2A6AA 3P39A 1WUAA 4DF4A 3JYTA 3ENBA 3KLIA 4BRLA 5BREA 5KGWA 3KK2A 3PX0A 4OLBA 1QQMA 4EIAA 2KZZA 3TSQA 4LY7A 3LAKA 4IJNA 2W42A 2KZMA 1X9JA 1TK0A 3UKRB 5HROA 4NCGA 2X6SA 3CQXA 1OH5A 4CHNA 3VQ6A 4EFHA 1ASVA 4X64K 3LM9A 2OTJN 2WBNA 4AM7A 3A0IX 4FJHA 5CY4A 1MDUB 2FSNA 5AQIA 4DTMA 2OZSA 3HBTA 1YF5L 3HPGA 3AO3A 3VF2A 1Q8IA 1QZ5A 4CEDA 4BR2A 3QEWA 4RG8A 4AM6A 1UAXA 4H0OA 1NKCA 1JLAA 2WOMA 3O1WA 5AQFA 4YORA 4YHHK 5GINA 3ULEA 4B3TK 2VQFK 4DKWA 2O8EA 4K41A 3AAPA 3M6GA 3RVCA 2PZSA 2B4JA 2ZQBA 4AHUA 2G8IA 4ELVA 2E1YA 3VQ9A 3EZWA 4FJKA 4B1XB 2ETJA 4C8LA 2G8WA 2QWOA 5BRHA 4AHVA 3RMBA 2VG6A 4GNIA 4BQZA 4Z4GA 1CZ9A 3L2UA 3F2KA 2Q0RA 4JHDB 5ELZA 5AQUA 4Y0WA 3HM8A 4WFBL 4FLTA 3SQ1A 3HSTB 3P1GA 2A41A 2ZWHA 5EX5A 2FF6A 1ATRA 3THXA 4QCLA 2YCHA 3O4WA 1XHZA 2ASOA 4OPJA 2VG5A 3WXKA 3WNGA 4YDUA 3C0BA 1BA0A 1EETA 2FC0A 4BVOA 1GOAA 1VQLN 2W6LA 2YX6A 2FXUA 5AQRA 3KTQA 1EWQA 3I0RA 1OVQA 2GTDA 4PQUA 4DV3K 5C0YA 3SCXA 1E4FT 5FDLA 1KQSM 4JK8A 3BEXA 4CGFA 2P9NB 1LAWA 4Z0UA 3VEYA 4BGAA 5AFUA 1ZBLA 3VETA 1U48A 2YKMA 4KAZA 3ZEUA 1JLQA 3V9ZA 3PLAA 1VSEA 1NK5A 3DLLL 2ITMA 1Y64A 1D5AA 4I9LA 4I2PA 1TUUA 4M7XA 4YY3K 4QS8A 4IOAL 3I56N 3CC4N 1UOCA 2F4VK 4CJLA 4BRIA 4Z94A 2UUCK 1X1PA 4FO0A 1VSFA 1D8YA 2V52B 2YJEA 3OYBA 5LMUK 1A5VA 4IG0A 2YHYA 1TGOA 2V51B 5EU7A 4BRAA 2E2PA 3C7NB 3WXJA 3K57A 2YJFA 3V9XA 3MECA 2GUIA 4WQ4A 4CI6A 1RBUA 1NJYA 2XO7A 2F96A 2OANA 2Z1JA 4GW6A 5KRTA 4GV9A 4DV2K 3TSUA 4KHSA 3DRRA 4KO0A 1XC9A 5M1KA 3GL1A 1YITN 1W7AA 3HPOA 4CJ3A 4OPAA 2E6LA 5HOOA 3K9JA 4LSLA 4YOTA 4FK2A 4M3ZA 4JI0K 3MX2A 3RWUA 3MAQA 4OGEA 1U2VA 4UQGA 4BGBA 3L2RA 4M3XA 2YKNA 3S3NA 1BISA 1X3NA 1T44A 4MQ3A 3WQTA 4BRQA 4NCBA 3F9MA 4JN4A 2O8FA 3TABA 4M3YA 3T1AA 3SAFA 3KLEA 4BRHA 2XY6A 2GEMA 3K5OA 1SS6A 3DJCA 4BR4A 1MWMA 3KJVA 1ESVA 2BUPA 2E88A 3OS1A 3EKUA 3HXMA 1HUXA 1WAJA 3L4IA 1EQYA 2B6AA 1KSPA 2HHSA 4U7BA 2HHQA 3ID6A 2NZTA 3VQDA 2WTUA 5J2MA 4TSXA 1D4XA 1NGBA 3FZLA 4H0VB 4BR0A 3CJBA 1CLQA 4DQRA 3CF5L 1RBVA 2P9UB 1IG8A 3CG7A 4Q0BA 1XMQK 4CVNE 4C8MA 3O3FA 3ENHA 1QHTA 4O5FA 3J8AA 3R3LA 2ZF5O 4DV1K 1U6ZA 1IBKK 2BTFA 4CZKA 1R59O 5KI6A 5AZIA 3SI6A 2HMIA 1O1WA 2W40A 5JS2A 1Q9XA 3HP9A 4KHYA 3EZ5A 3NF9A 2RF2A 3SAHA 4CK2A 2O4IA 1MU2A 3SJHA 1NMNA 3OTOK 3H46O 2A42A 1T3VA 1LW2A 3U9DA 3MEEA 3OYNA 2D1KA 3NAEA 3DXKB 1XQSC 3THYA 4DR4K 5HRSA 5AQYA 4DTSA 4FPAA 2UUAK 2YV0X 4AF1A 4CJQA 4W5QA 2XHBA 1QTMA 3AA5X 4CBXA 3JSMA 4I6MB 4O8KA 2KTQA 4J2DA 3O1BA 4BE0A 4CBUA 4DSIA 3J80O 3GDQA 2Y1JA 1WBDA 5KRSA 3H08A 3UKRA 4H5NA 1ILYA 4WCEL 4A59A 3AVMA 2EWSA 3RTVA 2GX9A 4BC2A 3ULEB 4O5BA 5CYMA 3VQ4A 1TVRA 2HNDA 4DR7K 5E84A 3VEVA 3WXLA 3VMFB 1VSKA 5M1NA 1GLAG 4JS5A 1V4SA 1RT6A 5BN9A 2GELA 4CGGA 3TWHA 3NE6A 2NNWA 3GBTA 1CXUA 3VPZA 3ZX3A 1ASWA 3TAGA 3THVA 1RBSA 3CCMN 3VENA 4IEIA 2NRTA 1NOZA 3LPTA 4CJFA 1RDBA 3T7ZA 1LWFA 4CJ7A 1YTAA 2WFBA 3BP8A 3MK6A 5C25A 1BI4B 1LW0A 3CPEA 3S41A 3CETA 1S6PA 3K5MA 2Q0UA 4FM2A 4FSVA 4F3OA 3NH0A 5AQQA 1CZBA 4JLHA 3QLHA 2E6MA 3SYZA 1Q18A 2OPQA 4X62K 3H45C 4CGHA 1K8KB 2DPNA 3U8XA 5KPZA 1DEJA 3EL2A 4MLEA 4E3SA 3VQQA 4H03B 3QIOA 3P31A 2E1ZA 4K43A 3VGKA 1QHAA 3LALA 4BR5A 4Y1CA 3D6RA 2XRIA 3C7NA 4F3TA 5GADP 2PYJA 3OS0A 3PV8A 3QDKA 4FPBA 4DV7K 1UWBA 3ZT4A 5J2QA 1YJWN 1QE1A 3B6OA 1JJ2M 1RILA 3O4QA 4CGIA 2VWJA 3DXMB 4W5OA 2PFUA 4J8FA 3SUOA 4E1MA 5HL7L 4OPKA 5FPNA 1X9WA 4CF1A 3DLKA 3KK3A 4H5RA 1HNZK 4DCHA 2OCEA 1IH7A 2D0AA 4CEAA 4BR7A 4YOXA 2KLAA 3PIPL 4FK0A 3I33A 1I94K 1XMOK 4KRFA 4G1QA 5GAHP 3O3GA 3M8PA 1SAZA 3E9PA 2HHXA 1ASUA 3AVFA 3NDKA 1J54A 2Q97A 3ZETB 3ZT1A 2NRXA 4OKKA 4FJ8A 4O44A 3O9UA 2HBMA 2OPSA 1E4GT 3SBGA 1CXQA 1WBBA 1BUPA 1EX4A 4BWJA 2DTUA 2XY7A 1BDGA 4JI3K 4X66K 4FW2A 4CZJA 4FJJA 2QW9A 3FR0A 4HUEA 2HHUA 3K2PA 4ILHA 3L2WA 3V9WA 4BWMA 4CF8A 2YNFA 3AGKA 3CIPA 4JI6K 4CF9A 4LF8K 1TKTA 1J6ZA 3EE8A 2EX3A 1DT9A 4HHTA 3ZSRA 1RT3A 4CD3A 2O8FB 4CZFA 4KV8A 1SV5A 4JAXA 3NF7A 4DFMA 4ID1A 2XY8A 3DRPA 3UKUA 1A5WA 1Q7YO 4A57A 3A5MC 4CK1A 5M1OA 4BRDA 3VEXA 3CI5A 5AQLA 3O4NA 1NBWA 5I9EB 1J9AA 4IJAA 5B8HA 3CM5A 2RPIA 4DR2K 1KFSA 1KAXA 4B3OA 4IO8A 3L2VA 3LPUA 3S9HA 4DTUA 2P9UA 1ZYQA 1BCOA 5JICA 2NRWA 4DUZK 1SL1A 3O5BA 3SQ4A 2XY5A 1W0HA 2CGKA 2QWPA 3V1OA 1OKJA 3I0SA 3VERA 4JK7A 3MN9A 4PWDA 3VEOA 3DLRA 5SZTA 4JKGA 5BPLA 1K9MO 4CD1A 1KXPA 5D3GA 3VN5A 3F9KA 5KQDA 1S22A 2E2QA 1HNVA 1T05A 1VQMN 5GIOA 2UXBK 4I2QA 1JCFA 3OYLA 3QMLA 5AQGA 4CJTA 4LFAK 3SV3A 4CIGA 4DSLA 1EO1A 3SUPA 3PO4A 1RT5A 4B1WB 1BQNA 1VQPN 3ITHA 3HOTA 1A5XA 2D0OA 4JKFA 2ZJPL 1KC8O 5KPTA 3FZHA 1NNEA 2ASPA 3TPQA 3K59A 4Z4EA 5AZIB 3DM2A 1C0MA 3LM2A 5AQZA 4E7LA 1YIJN 3QICA 4JI5K 4FJIA 3CJAA 4RW8A 1HYSA 3M1FA 4ZTJA 3PO5A 1SL0A 2A5XA 2YNIA 4GY2B 4NYNA 3OBYA 3LZIA 3OYJA 1RTJA 3J7AP 1FKPA 1ITGA 3DAWA 3MWTA 3R6MA 2HB5A 4QS7A 3C65A 4IEEA 4JYAK 1RCHA 4LC9B 4QOZB 4DQSA 4WQ5A 3CPWM 3AVBA 4DV6K 4B3RK 3OHRA 4H0YB 3TR8A 1IBMK 5FLXO 4Z4HA 4YDUC 2Q36A 2P51A 3VOVA 4KTZA 2V7YA 1C0GA 1L3TA 1HNIA 1GLFO 3QBXA 4F9OA 2AA4A 5CZ2A 3E1YA 4C1NI 1DGKN 4B9NA 1T03A 3CMAN 1Q82O 4GVEA 4EAHD 4CZHA 4JRQA 2O8DA 2PYLA 1RT4A 3OYHA 1YVUA 2Z1IA 3KWIA 3J7YP 1BGXT 4HTUA 4FLVA 3QETA 3NHGA 3A5LC 1S9EA 3CQYA 2ZGYA 3CC7N 4FJLA 3IRXA 2KHOA 4IFVA 3AAQA 1KFDA 3ZT3A 4A2BA 4CZIA 1QQCA 3J81O 3MEGA 3MWPA 5JLHA 3C94A 3KLHA 1IKVA 4B9LA 1BHLA 1DKGD 4HCBA 3HL8A 1K73O 4E7HA 4JD2A 2VGNA 5ADXH 5GAGP 5F2RA 4CZEA 4EZ9A 1X9SA 1LCUA 3CQ8A 5AQJA 4FLWA 4DF8A 5F1XA 2UXDK 2IVOA 4QAGA 1RT2A 3A2FA 2WONA 4N56A 4A61A 1HX1A 3CJ1A 1HNWK 4CJVA 2KKZA 1XNQK 1VK0A 4U67L 4CW7B 2V7ZA 4CEZA 4DTPA 2HSTA 3QB0A 1OH6A 3TARA 4BRPA 4XH1A 3VQAA 4MO4A 5HRRA 3ZSQA 3O80A 3AV9A 3HO1A 2F8TA 4CBWA 3AY9A 4CGJA 3AO5A 1RBRA 3U9ZA 4DU3A 4DFJA 1RDUA 5M1PA 1YAGA 1NGCA 3ZYYX 1WSJA 1YI2N 3ZSXA 3E66A 4BG9A 1P8ZA 3MCAB 3IG1A 3MEDA 3MCPA 1TKXA 3NF8A 1BQMA 1I3AA 3CCEN 3BF1A 2NRHA 4FJMA 3LAMA 1BOTO 2UU9K 3CFRA 1NK9A 4LF7K 3OY9A 4JI7K 2G8VA 3VGMA 3PIOL 1VQ6N 1W2BM 1NJWA 3ULDA 4QS9A 3K0SA 1FXXA 2KW4A 3EE9A 2KFNA 4DTXA 3V9SA 4HUFA 5AQOA 3SUQA 1NGGA 1NK4A 4FWMA 3QEIA 4H0XB 4OPHA 4O8UA 4N41A 4KHQA 1RTIA 4JI8K 1Z6RA 1NGEA 2ZE2A 1OH8A 4BE1A 2OA8A 5FPDA 2ZJRL 4KI6A 2HVHA 2Q3SA 2CH6A 4DG1A 1WLJA 4DSJA 4KHUA 3ASMA 4V19S 3B6PA 4CFAA 4CEBA 4CHPA 4BACA 1HR0K 3BGRA 2DFHA 3BF3A 2NUBA 4FK4A 1ZBHA 4B8AB 4YOUA 2YHWA 2QWNA 3H3NO 1FKOA 4W5RA 3HVRA 4JKBA 2P9LA 3CM6A 5MLCQ 2BH1A 3UE5A 4HVJA 1YJ9N 4ZHRA 4AHTA 1TYQA 2FSJA 2VGMA 4XIUA 1WSIA 3ZX0A 2IGIA 2ZGZA 2A1RA 4FWSA 3ZSVA 3H3OB 4ZTFA 4H0PA 2QM1A 4BC4A 5GAEP 5AQPA 5EXWA 2IVNA 3OJUA 5DK5A 1XI1A 1S1UA 5AQWA 1HQEA 5BN8A 4YFUA 1N8RO 4ID5A 5AR0A 1VQKN 5AZJA 1TV6A 1IKYA 2P5GA 3RSEA 3DLBA 4CEOA 4OGCA 3H1VX 4FZZA 3VQ7A 2P5OA 5CE3A 4O0IA 2FBVA 2Z1HA 4BDZA 4IKFA 2E2NA 4WE1A 1VSIA 2P9IA 1NOYA 1HYZA 1ZBFA 4B9MA 1IKWA 3I8DA 3VESA 4F2RA 4FJ5A 4JK9A 2YI1A 4B9TA 4CZLA 4DR3K 3L4QA 4DQ8A 3HT3A 3K9KA 3LL3A 3WNHA 3M3ZA 1VRTA 1S9GA 3L3UA 2O8EB 1I39A 3L3VA 1RDCA 3B8AX 4IDKA 5CHIA 3TAPA 1B9FA 3RMDA 4A5BA 1W9HA 2JWLA 4CEEA 5KPRA 1GLBG 4CEQA 2WUSA 4FWOA 1KLNA 3QEVA 3LP0A 2QWMA 1Z25A 4RW7A 4ELTA 4BVPA 5ADXA 1J5EK 1BA1A 4K25A 4B8CA 1KCFA 3LANA 4PKHA 3VA3A 1TKZA 3OVNA 3UB5A 2F8SA 1NK6A 3LP3A 1NWKA 1WOQA 3AARA 3KKSA 1N33K 2RN2A 3CD6N 2QXLA 2NRZA 4KTWA 4RW4A 1RDDA 3DWLA 2HF3A 2QTDA 3HSCA 2CH5A 3F73A 5IWAK 4ISGA 4CHZA 4CE9A 1S5JA 2F7TA 3D2EB 3PX4A 5AQSA 1TUYA 1U04A 5HRNA 2VCPA 4H5WA 1L5UA 1E3MA 4RCHA 4I7FA 2QK9A 3EYZA 3AGRA 4JKDA 2IS3A 3QERA 4JKGB 2PY5A 4DQIA 4H0TB 1Z05A 1XHXA 1T8EA 3NGIA 1ZC6A 4O4GA 1U45A 3M8RA 4E1JA 3LDSA 2HNZA 2OPRA 3THWA 4DR5K 3TAFA 1NK0A 4B3MK 4WQ5C 3HM9A 1IJJA 4FLXA 2IVPA 3VF4A 1WN7A 1DTQA 2X78A 3VQ8A 1EWRA 3CERA 3TAEA 2A40A 3FZFA 1JLBA 3CFOA 4CIEA 4EHUA 1YXQA 4KREA 2P1JA 1F21A 3T69A 4F2SA 4IOCL 3NH2A 1ATSA 4FCYA 5FRMA 1KD1O 1HPZA 1C0UA 4CJUA 2RE2A 1RBTA 1C0TA 1VHXA 1XWLA 3KVGA 4C1NK 3T1HK 1WSEA 2UXCK 4DU1A 3FE1A 4H4MA 1CZAN 1KLMA 4WFAL 2HHHK 4BRMA 3FZMA 3TTCA 1GLLO 1EXQA 4GV6A
chains in the Genus database with same CATH topology
4YOVA 5H1SQ 3MN9A 2QWLA 3VEOA 5C15A 2A41A 2ZWHA 5EX5A 4BRGA 3CHWA 4JKGA 3MMVA 5BPLA 2FF6A 3G6EN 1ATRA 1K9MO 5JVHL 4CD1A 1KXPA 4IXCA 2YCHA 3O4WA 1BU6O 2QI2A 4DHYA 1K8KA 5KQDA 2ASOA 2NRVA 1S22A 3WXKA 1XC3A 2E2QA 2E2OA 3CJ9A 3Q7BA 3C0BA 4YDUA 1BA0A 4BRNA 5C12A 3G71N 1VQMN 2I7PA 5GIOA 4IZ9A 4BVOA 1VQLN 1JCFA 2YX6A 2FXUA 5AQRA 3QMLA 5AQGA 1G99A 2GTDA 3WXMB 5C0YA 2FSKA 2FLOA 1EO1A 1E4FT 4K42A 1KQSM 4JK8A 3BEXA 4B1WB 5CR4A 1VQPN 4PKIA 3HOTA 2F9WA 2P9NB 2D0OA 4JKFA 3CJCA 2ZJPL 1HPMA 1KC8O 5KPTA 3VEYA 3FZHA 4BGAA 5AFUA 3SK3A 1NJIO 2ASPA 3TPQA 3GG4A 3TTFA 3VETA 3TTDA 5AZIB 3LM2A 3ZEUA 5AQZA 4XEIA 3QICA 1YIJN 2HMPA 1VAZA 1QVGM 3PLAA 1NGHA 1VQON 2VYPA 4JKAA 2D0PA 4JKCA 3DLLL 1NGJA 3CJAA 4FL9A 2ITMA 1Y64A 3M1FA 1YVNA 5E26A 3CXCM 1BWFO 1H1VA 1TUUA 2E20A 4M7XA 2A5XA 3IUCA 4GY2B 4QS8A 4IOAL 3ID8A 4JEPA 3I56N 3CC4N 3OBYA 2I7NA 4BRIA 4Z94A 4MDBA 5EY4A 3DAWA 3MWTA 3R6MA 4QS7A 4FO0A 3C65A 4IEEA 4ILJA 3W3DA 2V52B 2YJEA 4LC9B 5BRFA 4NLBA 3R9PA 4WQ5A 3W0LA 1SQKA 3CPWM 3E9LA 2YHYA 2V51B 4B9QA 4BC3A 4BRAA 2E2PA 3C7NB 3WEEA 3WXJA 3OHRA 4H0YB 2YJFA 4YDUC 2Q36A 4JHDA 3VOVA 5JLFA 4WQ4A 4CI6A 2V7YA 1C0GA 3SMSA 3N4PA 1BG3A 2OANA 3D2FB 1K8AO 1GLFO 3QBXA 4F9OA 2AA4A 1QQOA 3E1YA 4C1NI 4GV9A 1DGKN 3DXMA 3LDLA 2HOEA 1KAZA 1TYQB 3TSUA 3CMAN 5M1FA 3VGLA 1Q82O 4GVEA 3ZEUB 4EAHD 4IOXA 4CZHA 1HLUA 1GLEG 5M1KA 3GL1A 3M5RA 1YITN 2Q31A 3A5NC 5TKYA 4OPAA 3SAGA 3J7ZO 3U4LA 4GV3A 1S3XA 2CGJA 5HOOA 3KWIA 1JCEA 3K9JA 2HBKA 3I8BA 4OO1J 1ZBSA 4WFNL 4YOTA 4ISEA 3TU5A 3A5LC 3IFRA 3CQYA 2ZGYA 3MX2A 3CC7N 4A2AA 3R1XA 2KHOA 1U2VA 3AAQA 4A62A 4A2BA 4CZIA 3DXKA 3MWPA 4BGBA 3VTIA 5JLHA 4IDHA 1X3NA 1T44A 3WQTA 2YHXA 4BRQA 3LDQA 1DKGD 3F9MA 4JN4A 1K73O 5BPMA 2VWBA 4JD2A 4L3QA 2VGNA 1RGIA 3SAFA 4BRHA 5ADXH 4Y0WA 5GAGP 2GEMA 5F2RA 1NGDA 4CZEA 1MWKA 1SS6A 3DJCA 4BR4A 1MWMA 1NGFA 1ESVA 1LCUA 2BUPA 5AQJA 5KQ8A 2E88A 2F9TA 3JXUA 5F1XA 3F5TA 2IVOA 3EKUA 3FFKB 3E9OA 5LJVA 1HUXA 1JCGA 4RWTA 4WF9L 4A61A 1HX1A 1EQYA 3CJ1A 3FGUA 3L4IA 1Q86O 4H5TA 4U7BA 1XUPO 2KKZA 3ID6A 4U67L 2NZTA 2V7ZA 2P9IB 1D4XA 2HSTA 3QB0A 1NGBA 3FZLA 3C6HA 2P9PA 4H0VB 4PKGA 4BR0A 1BO5O 3QFPA 3CJBA 4BRPA 3G25A 3N4QA 3FZKA 4XH1A 3WXIA 4MO4A 3CF5L 2P9UB 1Q81O 3O80A 1IG8A 4FWNA 4KH5A 4CBWA 3AY9A 1MA9B 3U9ZA 1X3MA 1RDUA 3NVMA 5M1PA 1YAGA 1NGCA 2QA4N 3ZYYX 3ENHA 1YI2N 3SLCA 3E66A 4O5FA 4BG9A 3J8AA 2NRRA 4FWPA 1P8ZA 3MCAB 3R3LA 4FOEA 2ZF5O 4UY8O 4G9ZA 3MCPA 1U6ZA 2BTFA 4CZKA 1R59O 3O9TA 5AZIA 1HKBA 2W40A 3CCEN 3BF1A 2NRHA 3P4IA 5EOYA 1BOTO 3P38A 5AQNA 1HKCA 1O13A 4KBOA 5FPEA 4WQ4C 3EN9A 3KWGA 2E8AA 2Q1NA 2P9LB 5AQHA 3VGMA 4NB4A 3PIOL 3HZ6A 4MDAA 1W2BM 1VQ6N 4M63C 5F0XA 3SAHA 3IKMA 3KHYA 4QS9A 4HTLA 4MO5A 1QVFM 3SJHA 3EE9A 3QBWA 3H46O 4HWIA 2A42A 1T3VA 5AQOA 1YHQN 3U9DA 2GUPA 1NGGA 2D1KA 3CCJN 2AP1A 3DXKB 1XQSC 2J4RA 4FWMA 4H0XB 4OPHA 4O8UA 5AQYA 1Z6RA 4FPAA 3O6WA 4AF1A 1NGEA 4BQLA 5GIPA 4BR9A 3RSEB 4B1YB 4CBXA 2QWQA 3CC2N 4I6MB 2PAVA 4JD2B 4O8KA 3O1BA 4CBUA 3WQUA 5FPDA 2ZJRL 3OBWA 3GOIA 3D2EA 3GDQA 3KZBA 3H6EA 2P9KA 2CH6A 3BUZB 3O08A 3UKRA 3FLCO 4H5NA 1ILYA 4WCEL 4A59A 2EWSA 2GX9A 3BF3A 3HRGA 4BC2A 2HBLA 4YOUA 2YHWA 2QWNA 3H3NO 3MDQA 3ULEB 4DB3A 3A5OC 3CJ7A 3EO3A 3IMXA 3KK7A 3C6AA 3ENOA 5AQTA 1V4TA 4JKBA 2P9LA 3QFUA 2P9NA 3O9QA 5AQVA 1RFQA 5MLCQ 2BH1A 4NLCA 5E84A 3UE5A 3VEVA 3TSPA 1YJ9N 4JKHA 3WXLA 3VMFB 1TYQA 2FSJA 2VGMA 5M1NA 1GLAG 3CCQN 1V4SA 5BN9A 1GLJO 2GELA 3GE1A 3ZX0A 5DM7L 2ZGZA 5M1QA 4FWSA 4IO9L 2NNWA 3GBTA 3H3OB 3VPZA 1NGIA 4JNEA 4H0PA 2QM1A 3ZX3A 4BC4A 5GAEP 5AQPA 1ZXOA 5EXWA 2IVNA 2JWKA 5AQWA 3MN7A 4IWVA 5BN8A 3CCMN 5C2FA 1U2VB 1N8RO 4BC5A 1VQ7N 3VENA 5AFUH 4IEIA 5AR0A 4BRKA 1VQKN 1W97L 2NRTA 5AZJA 3VEWA 3SBTA 3T7ZA 1P90A 4NO7A 4CJ7A 1VQ4N 1VQ5N 3I55N 3RSEA 2WFBA 5BRDA 5FPMA 3H1VX 4I6MA 4FVUA 3BP8A 3MK6A 1LOTB 4RTFD 4CZGA 3VTHA 4BROA 3CCSN 1GLDG 3CPEA 3S41A 3CETA 4WYBA 4H5VA 4BRCA 4C23A 2Q0UA 3WUHA 2P9SB 1T6CA 3NVKA 3D7EO 5CE3A 4FSVA 5AQQA 3VF6A 3O9RA 4KH4A 2GWKA 1M90O 1NMDA 3NMUA 3ATVA 1QZ6A 3L0QA 3CCVN 1ATNA 1Q18A 5JVGL 4JKEA 3HTVA 4B1VA 3H45C 2E2NA 2P9IA 1K8KB 3EKSA 1OVYA 2DPNA 3U8XA 4BY9C 1RDWX 5TKWA 5KPZA 1DEJA 3EL2A 4MLEA 3VESA 5LJWA 4H03B 4JK9A 2YI1A 3VEZA 3P31A 1VQNN 4CZLA 5AQMA 2E1ZA 4K43A 3VGKA 1QHAA 4JK7A 4BR5A 2RHKA 4PHTX 3D6RA 1NGAA 3C7NA 3L4QA 3WEEB 4DQ8A 4BG8A 4B1ZA 5GADP 2HBJA 1NLVA 3K9KA 3LL3A 3QDKA 4FPBA 3ZETA 3M3ZA 5JMVA 1HJOA 3LDNA 3WT0A 3UKUB 2P9PB 1YJWN 1YJNN 3B8AX 1JJ2M 5AQXA 1NM1A 3G4SN 5CHIA 2H3GX 4A5BA 3DXMB 4XH4A 2PFUA 3MN6A 3OA9A 4B1UB 3HOSA 2JWLA 3L6QA 4J8FA 1GLBG 5KPRA 5DM6L 4BRFA 2WUSA 4FWOA 5HL7L 2D4WA 1VQ9N 2FF3B 2QWMA 5FPNA 5C10A 3O9SA 4FWLA 5AZJB 2UYTA 3LDOA 4H5RA 4BVPA 5ADXA 4YOWA 4DCHA 3ZX2A 4ISFA 1BA1A 4K25A 3HI0A 3MX5A 3IDHA 4PKHA 4KH6A 5LY3A 4M7YA 3UB5A 1SZ2A 2HF4A 4BR7A 5EVZA 4A5AA 2NLXA 4YOYA 2KLAA 4YOXA 1NWKA 3PIPL 3I33A 1WOQA 2OTLN 3AARA 4MLHA 3R8EA 2A6AA 3P39A 3CD6N 1WUAA 2QXLA 2NRZA 5GAHP 3ENBA 3DWLA 4BRLA 1SAZA 3E9PA 3JS6A 5BREA 2GWJA 2HF3A 4ILGB 2QTDA 3HSCA 2CH5A 1QQMA 4EIAA 4ISGA 3TSQA 2ZJQL 3OW2M 2F7TA 2Q97A 3D2EB 2WC9A 5AQSA 1TUYA 3ZETB 2Q2RA 2VCPA 4H5WA 2QWRA 2NRXA 4IJNA 3O9UA 2HBMA 1X9JA 4IFEA 4RCHA 1E4GT 3D2FA 3UKRB 1GLCG 3CQXA 3AGRA 3SBGA 3SMPA 2W41A 4JKDA 4EFHA 4XH5A 1BUPA 2PBDA 3LM9A 3CCRN 1S72N 2OTJN 2WBNA 1BDGA 4AM7A 4JKGB 4CZMA 5C2DA 4CZJA 3A0IX 2QW9A 4FOIA 3FR0A 1MDUB 1HKGA 3ATUA 4H0TB 2FSNA 5AQIA 1Z05A 1YF5L 3HBTA 4ILHA 1ZC6A 4EHTA 3VF2A 1QZ5A 4E1JA 4PL8A 4BR2A 3O8MA 3AGKA 3CIPA 4H0OA 4AM6A 3H1QA 1J6ZA 3O1WA 3EE8A 1DT9A 4WQ5C 5AQFA 3A8YA 3LDPA 4YORA 1IJJA 4CD3A 2IVPA 3VF4A 5GINA 2ASMA 3ULEA 4CZFA 4JAXA 4PL7A 1QQNA 3CCUN 3CERA 4DKWA 2A40A 4K41A 3UKUA 3FZFA 3AAPA 4FWRA 3M6GA 3RVCA 1Q7YO 4FWKA 4A57A 4R79A 3A5MC 5M1OA 1YXQA 4BRDA 4EHUA 3VEXA 2QEXN 1C0FA 2E1YA 3CI5A 3T69A 5AQLA 3CMEN 1M1KO 3EZWA 4IOCL 1ATSA 1NBWA 4B1XB 3MN5A 5I9EB 1KD1O 4IJAA 5B8HA 2A3ZA 2QWOA 5BRHA 3Q7CA 2P9KB 2RE2A 4BREA 1VQ8N 4FWQA 2IIRA 1KAXA 3KVGA 4C1NK 4IO8A 4GNIA 1YUWA 4BQZA 2P9UA 5JICA 2NRWA 3FE1A 5BR9A 1CZAN 2Q0RA 3F2KA 3O5BA 4JHDB 4WFAL 3CCLN 4BRMA 5ELZA 5AQUA 1T6DA 2QWPA 2CGLA 1GLLO 2CGKA 1OKJA 3FZMA 3TTCA 3VERA 3HM8A 5BPNA 2P9SA 4GV6A 1KAYA 5AQKA 4WFBL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MN9 A;  2QWL A;  3VEO A;  2A41 A;  2ZWH A;  5EX5 A;  4BRG A;  3CHW A;  3MMV A;  5BPL A;  2FF6 A;  1ATR A;  4CD1 A;  1KXP A;  4IXC A;  2YCH A;  3O4W A;  1BU6 O;  4DHY A;  1K8K A;  5KQD A;  2ASO A;  1S22 A;  3WXK A;  1XC3 A;  2E2Q A;  2E2O A;  3CJ9 A;  4YDU A;  3C0B A;  1BA0 A;  4BRN A;  2I7P A;  4IZ9 A;  4BVO A;  1JCF A;  2FXU A;  5AQR A;  3QML A;  5AQG A;  1G99 A;  2GTD A;  2FSK A;  2FLO A;  1E4F T;  4K42 A;  3BEX A;  4B1W B;  4PKI A;  2F9W A;  2P9N B;  2D0O A;  3CJC A;  1HPM A;  5KPT A;  3VEY A;  3FZH A;  4BGA A;  5AFU A;  3SK3 A;  2ASP A;  3TPQ A;  3GG4 A;  3VET A;  5AZI B;  3LM2 A;  3ZEU A;  5AQZ A;  4XEI A;  3QIC A;  2HMP A;  1NGH A;  2VYP A;  2D0P A;  1NGJ A;  3CJA A;  4FL9 A;  2ITM A;  1Y64 A;  3M1F A;  1YVN A;  5E26 A;  1BWF O;  1H1V A;  1TUU A;  2E20 A;  4M7X A;  2A5X A;  3IUC A;  4GY2 B;  4QS8 A;  3ID8 A;  2I7N A;  4BRI A;  4Z94 A;  5EY4 A;  3DAW A;  3R6M A;  4QS7 A;  4FO0 A;  3W3D A;  2V52 B;  2YJE A;  4LC9 B;  5BRF A;  3R9P A;  4WQ5 A;  3W0L A;  1SQK A;  2YHY A;  2V51 B;  4B9Q A;  4BC3 A;  4BRA A;  2E2P A;  3C7N B;  3WEE A;  3WXJ A;  3OHR A;  4H0Y B;  2YJF A;  4YDU C;  2Q36 A;  4JHD A;  3VOV A;  5JLF A;  4WQ4 A;  4CI6 A;  2V7Y A;  1C0G A;  3SMS A;  1BG3 A;  2OAN A;  3D2F B;  1GLF O;  3QBX A;  4F9O A;  2AA4 A;  1QQO A;  1DGK N;  3DXM A;  3LDL A;  2HOE A;  1KAZ A;  1TYQ B;  3VGL A;  3ZEU B;  4EAH D;  4CZH A;  1HLU A;  1GLE G;  3GL1 A;  2Q31 A;  3A5N C;  5TKY A;  3U4L A;  1S3X A;  2CGJ A;  1JCE A;  3I8B A;  1ZBS A;  4ISE A;  3TU5 A;  3A5L C;  3IFR A;  3CQY A;  2ZGY A;  4A2A A;  2KHO A;  1U2V A;  3AAQ A;  4A62 A;  4A2B A;  4CZI A;  3DXK A;  4BGB A;  5JLH A;  1X3N A;  1T44 A;  3WQT A;  2YHX A;  4BRQ A;  3LDQ A;  1DKG D;  3F9M A;  4JN4 A;  5BPM A;  2VWB A;  4JD2 A;  4L3Q A;  1RGI A;  4BRH A;  5ADX H;  4Y0W A;  2GEM A;  5F2R A;  1NGD A;  4CZE A;  1MWK A;  3DJC A;  4BR4 A;  1MWM A;  1NGF A;  1ESV A;  1LCU A;  2BUP A;  5AQJ A;  5KQ8 A;  2E88 A;  2F9T A;  3JXU A;  5F1X A;  2IVO A;  3EKU A;  3FFK B;  5LJV A;  1HUX A;  1JCG A;  4RWT A;  4A61 A;  1HX1 A;  1EQY A;  3CJ1 A;  3FGU A;  3L4I A;  4H5T A;  1XUP O;  2NZT A;  2V7Z A;  2P9I B;  1D4X A;  3QB0 A;  1NGB A;  3FZL A;  2P9P A;  4H0V B;  4PKG A;  4BR0 A;  1BO5 O;  3QFP A;  3CJB A;  4BRP A;  3G25 A;  3FZK A;  4XH1 A;  3WXI A;  4MO4 A;  2P9U B;  3O80 A;  1IG8 A;  4FWN A;  4CBW A;  3AY9 A;  1MA9 B;  3U9Z A;  1X3M A;  1YAG A;  1NGC A;  3ENH A;  3SLC A;  4O5F A;  4BG9 A;  3J8A A;  4FWP A;  1P8Z A;  4FOE A;  2ZF5 O;  3MCP A;  1U6Z A;  2BTF A;  4CZK A;  1R59 O;  5AZI A;  1HKB A;  2W40 A;  3BF1 A;  2NRH A;  3P4I A;  5EOY A;  1BOT O;  5AQN A;  1HKC A;  4KBO A;  5FPE A;  4WQ4 C;  3EN9 A;  2E8A A;  2Q1N A;  2P9L B;  5AQH A;  3VGM A;  4NB4 A;  3HZ6 A;  4M63 C;  5F0X A;  3KHY A;  4QS9 A;  4HTL A;  4MO5 A;  3SJH A;  3QBW A;  3H46 O;  4HWI A;  2A42 A;  5AQO A;  3U9D A;  2GUP A;  1NGG A;  2D1K A;  2AP1 A;  3DXK B;  1XQS C;  2J4R A;  4FWM A;  4H0X B;  5AQY A;  1Z6R A;  4FPA A;  3O6W A;  1NGE A;  4BQL A;  4BR9 A;  3RSE B;  4B1Y B;  4CBX A;  2QWQ A;  4I6M B;  2PAV A;  4JD2 B;  4O8K A;  3O1B A;  4CBU A;  3WQU A;  5FPD A;  3GOI A;  3D2E A;  3GDQ A;  3KZB A;  3H6E A;  2P9K A;  2CH6 A;  3BUZ B;  3O08 A;  3UKR A;  3FLC O;  4H5N A;  2EWS A;  3BF3 A;  4BC2 A;  2YHW A;  2QWN A;  3H3N O;  3MDQ A;  3ULE B;  4DB3 A;  3A5O C;  3CJ7 A;  3EO3 A;  3IMX A;  3ENO A;  5AQT A;  1V4T A;  2P9L A;  3QFU A;  2P9N A;  5AQV A;  1RFQ A;  5E84 A;  3UE5 A;  3VEV A;  3WXL A;  1TYQ A;  2FSJ A;  1GLA G;  1V4S A;  5BN9 A;  1GLJ O;  2GEL A;  3GE1 A;  3ZX0 A;  2ZGZ A;  4FWS A;  3GBT A;  3H3O B;  3VPZ A;  1NGI A;  4JNE A;  4H0P A;  2QM1 A;  3ZX3 A;  4BC4 A;  5AQP A;  1ZXO A;  5EXW A;  2IVN A;  5AQW A;  3MN7 A;  4IWV A;  5BN8 A;  1U2V B;  4BC5 A;  3VEN A;  5AFU H;  5AR0 A;  4BRK A;  5AZJ A;  3VEW A;  4NO7 A;  4CJ7 A;  3RSE A;  5BRD A;  5FPM A;  3H1V X;  4I6M A;  3BP8 A;  3MK6 A;  1LOT B;  4RTF D;  4CZG A;  4BRO A;  1GLD G;  3S41 A;  3CET A;  4WYB A;  4H5V A;  4BRC A;  4C23 A;  2Q0U A;  3WUH A;  2P9S B;  1T6C A;  3D7E O;  5CE3 A;  4FSV A;  5AQQ A;  3VF6 A;  2GWK A;  1NMD A;  3ATV A;  1QZ6 A;  3L0Q A;  1ATN A;  1Q18 A;  3HTV A;  4B1V A;  3H45 C;  2E2N A;  2P9I A;  1K8K B;  3EKS A;  2DPN A;  3U8X A;  1RDW X;  5KPZ A;  1DEJ A;  3EL2 A;  4MLE A;  3VES A;  5LJW A;  4H03 B;  2YI1 A;  3VEZ A;  4CZL A;  5AQM A;  2E1Z A;  4K43 A;  3VGK A;  1QHA A;  4BR5 A;  1NGA A;  3C7N A;  3WEE B;  4DQ8 A;  4BG8 A;  4B1Z A;  1NLV A;  3QDK A;  3LL3 A;  4FPB A;  3ZET A;  3M3Z A;  5JMV A;  1HJO A;  3LDN A;  3WT0 A;  3UKU B;  2P9P B;  3B8A X;  5AQX A;  1NM1 A;  2H3G X;  3DXM B;  4XH4 A;  3MN6 A;  4B1U B;  3L6Q A;  4J8F A;  5KPR A;  1GLB G;  4BRF A;  2WUS A;  4FWO A;  2D4W A;  2FF3 B;  2QWM A;  5FPN A;  4FWL A;  5AZJ B;  2UYT A;  3LDO A;  4H5R A;  4BVP A;  5ADX A;  4DCH A;  3ZX2 A;  4ISF A;  1BA1 A;  4K25 A;  3HI0 A;  3IDH A;  4PKH A;  5LY3 A;  4M7Y A;  3UB5 A;  1SZ2 A;  2HF4 A;  4BR7 A;  5EVZ A;  2NLX A;  1NWK A;  3I33 A;  1WOQ A;  3AAR A;  4MLH A;  3R8E A;  2A6A A;  1WUA A;  2QXL A;  3DWL A;  4BRL A;  1SAZ A;  3JS6 A;  5BRE A;  2GWJ A;  2HF3 A;  3HSC A;  2CH5 A;  1QQM A;  4EIA A;  4ISG A;  2Q97 A;  3D2E B;  5AQS A;  1TUY A;  3ZET B;  2Q2R A;  2VCP A;  4H5W A;  2QWR A;  4IJN A;  1X9J A;  4RCH A;  1E4G T;  3D2F A;  3UKR B;  1GLC G;  3CQX A;  3SMP A;  2W41 A;  4EFH A;  4XH5 A;  1BUP A;  2PBD A;  3LM9 A;  1BDG A;  4AM7 A;  4CZM A;  4CZJ A;  3A0I X;  2QW9 A;  4FOI A;  3FR0 A;  1MDU B;  1HKG A;  3ATU A;  4H0T B;  2FSN A;  5AQI A;  1Z05 A;  3HBT A;  1ZC6 A;  4EHT A;  3VF2 A;  1QZ5 A;  4E1J A;  4PL8 A;  4BR2 A;  3O8M A;  3CIP A;  4AM6 A;  4H0O A;  3H1Q A;  1J6Z A;  3O1W A;  4WQ5 C;  5AQF A;  3A8Y A;  3LDP A;  1IJJ A;  4CD3 A;  2IVP A;  3VF4 A;  2ASM A;  3ULE A;  4CZF A;  4JAX A;  4PL7 A;  1QQN A;  3CER A;  2A40 A;  4K41 A;  3UKU A;  3FZF A;  3AAP A;  4FWR A;  3M6G A;  4FWK A;  3A5M C;  4EHU A;  1YXQ A;  4BRD A;  3VEX A;  1C0F A;  2E1Y A;  3CI5 A;  5AQL A;  3EZW A;  1ATS A;  1NBW A;  4B1X B;  3MN5 A;  5I9E B;  4IJA A;  5B8H A;  2A3Z A;  2QWO A;  5BRH A;  2P9K B;  4BRE A;  4FWQ A;  2IIR A;  1KAX A;  3KVG A;  4IO8 A;  4GNI A;  1YUW A;  4BQZ A;  2P9U A;  5JIC A;  3FE1 A;  5BR9 A;  1CZA N;  2Q0R A;  3O5B A;  4JHD B;  4BRM A;  5ELZ A;  5AQU A;  3FZM A;  1T6D A;  2CGL A;  1GLL O;  2CGK A;  1OKJ A;  2QWP A;  3VER A;  5BPN A;  3HM8 A;  2P9S A;  1KAY A;  5AQK A; 
#chains in the Genus database with same CATH topology
 3C6T A;  4YOV A;  1JLE A;  3L8B A;  2QWL A;  5KGX A;  4DQQ A;  1J5O A;  4BRG A;  3OS2 A;  4FW1 A;  3G6E N;  3MMV A;  2BAN A;  3D45 A;  1VSJ A;  3AA4 A;  3HVT A;  4IXC A;  3DOL A;  2QI2 A;  4DHY A;  4DV0 K;  2NRV A;  4CJP A;  3NGY A;  1XC3 A;  3CJ9 A;  2E2O A;  3Q7B A;  1VSM A;  1OH7 A;  4LF4 K;  4KB1 A;  4IZ9 A;  1EKE A;  4J2B A;  3M8Q A;  1HMV A;  3WXM B;  4LF9 K;  2ZD1 A;  1SKR A;  5CR4 A;  3DRS A;  4PKI A;  4NYF A;  1HPM A;  1IBL K;  3P5J A;  3SK3 A;  1Z26 A;  4YNQ A;  1NJX A;  4CHQ A;  3VQC A;  2HMP A;  1VAZ A;  1QVG M;  1NGH A;  2JLE A;  1VQO N;  2VYP A;  3CFP A;  4JKA A;  2D0P A;  4JKC A;  3KKR A;  4GKJ K;  3RRG A;  1UA1 A;  4IFY A;  1YVN A;  3CXC M;  4JV5 K;  1H1V A;  1BIZ A;  2E20 A;  3BZC A;  1LWE A;  4JEP A;  1X9M A;  2I7N A;  4BE2 A;  3OYD A;  4DLE A;  1LV5 A;  4O55 A;  5EY4 A;  1RTD A;  1SKS A;  4DS4 A;  2KQ2 A;  4OX9 K;  4ILJ A;  3W3D A;  3OYG A;  4BDY A;  1N34 K;  5BRF A;  2FBX A;  3LWL A;  3W0L A;  3PSF A;  3K5N A;  4N47 A;  4AHS A;  4DTO A;  2HHT A;  2D0C A;  1N36 K;  2VG7 A;  4JHD A;  1C1C A;  5JLF A;  1BL3 A;  2GV9 A;  4M41 A;  3SMS A;  3D2F B;  4PA1 A;  3K58 A;  1QQO A;  1HQU A;  3VQE A;  3LDL A;  3NCI A;  2HOE A;  1C1B A;  5M1F A;  3VGL A;  3TAN A;  3ZEU B;  1S1X A;  1HLU A;  3M5R A;  2Q31 A;  5TKY A;  4GV3 A;  3SAG A;  3U4L A;  3QNN A;  4OO1 J;  2HBK A;  3I8B A;  3LP2 A;  4WFN L;  4CJ4 A;  4ISE A;  4DFP A;  3IFR A;  4CJR A;  2BDP A;  3ZSZ A;  4A2A A;  4IBN A;  4K0K K;  1JLC A;  4GVM A;  4B9V A;  3DXK A;  3BDP A;  3VTI A;  4CF2 A;  2YHX A;  4AHR A;  2DFE A;  1S1W A;  3SUN A;  3K5L A;  3RR7 A;  3G0Z A;  4DUY K;  4L3Q A;  4CER A;  3KD1 E;  1MWK A;  4NXM K;  4JI2 K;  1VSH A;  1NGF A;  1RNH A;  5KQ8 A;  3SQ2 A;  3FFK B;  3DLH A;  3E9O A;  1JCG A;  4RWT A;  4WF9 L;  1Q86 O;  4H5T A;  1XUP O;  3NF6 A;  4EP5 A;  3PUF A;  4FLY A;  5I3U A;  2P9I B;  4KHP K;  2HVI A;  2HW3 A;  3C6H A;  4ELU A;  4PKG A;  1BO5 O;  4FJ9 A;  3QFP A;  3G25 A;  4E7I A;  3FZK A;  2FBY A;  3FFI A;  2G8U A;  1IKX A;  2EHG A;  4KPY A;  1MA9 B;  4CEC A;  4R5P A;  4K8X A;  3SLC A;  5J2N A;  3S3M A;  3V1Q A;  2NRR A;  4FWP A;  4N76 A;  4FOE A;  3AVH A;  2GBZ A;  1HKB A;  3ZSW A;  3QNO A;  3P38 A;  5AQN A;  4KI4 A;  3EN9 A;  5AQH A;  3HZ6 A;  4MDA A;  1WAF A;  4M63 C;  4EP4 A;  4CK3 A;  3IKM A;  2JGU A;  4HTL A;  1U47 A;  4FM0 A;  3OYA A;  3QBW A;  5LMN K;  1WSG A;  2GUP A;  2IAJ A;  2AP1 A;  2J4R A;  4CFB A;  1GOC A;  1TAU A;  3O6W A;  4BQL A;  4BR9 A;  4B1Y B;  3CC2 N;  2PAV A;  3V1R A;  3WQU A;  3GOI A;  3D2E A;  4MFB A;  3KZB A;  1D9D A;  3SPY A;  2YNH A;  3BUZ B;  1N32 K;  4Z4F A;  3O08 A;  4C8N A;  1GOB A;  3HRG A;  2HBL A;  5SWM A;  3MDQ A;  3TAQ A;  4E89 A;  4DB3 A;  3VA0 A;  3KK7 A;  3C6A A;  3QFU A;  2P9N A;  3AVN A;  5AQV A;  2X6N A;  4C8K A;  4IG3 A;  3T1Y K;  3MXI A;  3PX6 A;  1DLO A;  1QSL A;  3RR8 A;  3OJS A;  1XNR K;  4IO9 L;  4JNE A;  5C24 A;  4DR1 K;  2O4G A;  1N5Y A;  4DV4 K;  4Z4C A;  1ZBI A;  2JWK A;  3MN7 A;  3AVL A;  5C2F A;  1U49 A;  4B9U A;  4BC5 A;  1VQ7 N;  5AFU H;  4N5S A;  1W97 L;  1BCM A;  3VEW A;  3LZJ A;  1VQ4 N;  3SNN A;  3I55 N;  2W6K A;  1B9D A;  1QS4 A;  5BRD A;  3DOK A;  4I6M A;  4FVU A;  3QIN A;  4DMN A;  4FJG A;  4RTF D;  3C95 A;  1WNS A;  1KVB A;  4CZG A;  3VTH A;  3CCS N;  1GLD G;  4DTN A;  4WYB A;  4H5V A;  4BRC A;  3SQ0 A;  4LF5 K;  3THY B;  1T6C A;  3NVK A;  3D7E O;  3T3F A;  3O9R A;  3AA3 A;  4LH4 A;  5LL6 Z;  3NMU A;  2R7Y A;  1NMD A;  3ATV A;  4LFB K;  1QZ6 A;  3CCV N;  2G8K A;  2ZM6 K;  4CGD A;  3HTV A;  4KHW A;  1OVY A;  4M3W A;  1RDW X;  5LJW A;  3P83 D;  1VRU A;  3QES A;  3VEZ A;  5C42 A;  3MXJ A;  1VQN N;  4DR6 K;  3SV4 A;  5AQM A;  4PHT X;  2O8C A;  2RHK A;  1NGA A;  2HBJ A;  3ZET A;  4DSK A;  1TK5 A;  3AA2 A;  3WT0 A;  3UKU B;  3NBP A;  1YJN N;  3THW B;  5AQX A;  1NM1 A;  3PSI A;  3ZLJ A;  4FZY A;  3JAM O;  2H3G X;  1KVA A;  4XH4 A;  3OA9 A;  1UA0 A;  3L6Q A;  1REV A;  3WNF A;  3CYM A;  1VQ9 N;  3O9S A;  4FWL A;  3LDO A;  2DFF A;  3QEP A;  1S1T A;  3U3Y A;  1VSL A;  4KH6 A;  4M7Y A;  1SZ2 A;  3OYE A;  4A5A A;  4YOY A;  3C6U A;  1RDA A;  1VSD A;  3G10 A;  4FJN A;  3JS6 A;  2GWJ A;  4ILG B;  2ITG A;  3SJJ A;  2ZJQ L;  4FYD A;  3OW2 M;  1JLG A;  4CCH A;  2WC9 A;  5T7B A;  3KK1 A;  2Q2R A;  2QWR A;  5DMR A;  4IFE A;  3D2F A;  1GLC G;  3SMP A;  4NCA A;  2W41 A;  2O8B A;  4XH5 A;  2PBD A;  3CCR N;  1S72 N;  5FRO A;  4HCC A;  1YT3 A;  4CZM A;  5C2D A;  4FOI A;  1HKG A;  3ATU A;  3NFA A;  2OYQ A;  4EHT A;  2O8D B;  4PL8 A;  4FJX A;  3O8M A;  2YHB A;  3H1Q A;  3OYK A;  3ZT0 A;  4E7K A;  1FW6 A;  3A8Y A;  3LDP A;  1L3V A;  2ASM A;  1HNX K;  4FM1 A;  3RMC A;  4CFD A;  4PL7 A;  1QQN A;  3CCU N;  1NKE A;  1L3U A;  4B3S K;  3V81 A;  1N6Q A;  4FWR A;  3VQ5 A;  2G8H A;  1HJR A;  4FWK A;  5BR8 K;  3LWM A;  4R79 A;  2B5J A;  1JLF A;  2HNY A;  2YHA A;  3OYC A;  2VQE K;  1FJG K;  2QEX N;  4E1N A;  1C0F A;  3CME N;  1M1K O;  4M45 A;  4CJE A;  3MN5 A;  1U4B A;  4DU4 A;  3V6D A;  4I9Q A;  2A3Z A;  4KHN A;  1NKB A;  3Q7C A;  2P9K B;  4BRE A;  1VQ8 N;  4FWQ A;  2IIR A;  3HP6 A;  2G8F A;  1YUW A;  1NU0 A;  5BR9 A;  1SUQ A;  5I42 A;  3CCL N;  4K8Z A;  4DQP A;  1T6D A;  1ZBU A;  2CGL A;  5BPN A;  2P9S A;  3VQP A;  3O9T A;  1KAY A;  5AQK A;  3DLE A;  4DTR A;  5H1S Q;  3ZCM A;  5C15 A;  3L2Q A;  3CHW A;  4B9S A;  1WB9 A;  1IG9 A;  5JVH L;  4KTQ A;  2IOC A;  1BU6 O;  4C8O A;  1K8K A;  5AJ3 K;  1C6V A;  4E0D A;  3V9U A;  2A1S A;  4BRN A;  5C12 A;  3G71 N;  2I7P A;  2AJQ A;  1G99 A;  1TL1 A;  2FSK A;  2FLO A;  4DS5 A;  4K42 A;  3AVC A;  1FK9 A;  2F9W A;  1LAV A;  3CJC A;  1NJI O;  4LH5 A;  1EP4 A;  4DTJ A;  4F8R A;  3GG4 A;  3TTF A;  5FRN A;  3TTD A;  2VWK A;  3E01 A;  4XEI A;  3OYM A;  4RW6 A;  1RTH A;  4OJR A;  3OYF A;  1NGJ A;  4FL9 A;  5E26 A;  4F4K A;  1BWF O;  1JKH A;  3HPH A;  4CJS A;  3IUC A;  4J2E A;  1Y97 A;  1HRH A;  3ID8 A;  4X65 K;  1S6Q A;  4MDB A;  3D0P A;  3O3H A;  1YTU A;  5JS1 A;  1BIU A;  5J2P A;  4L8R B;  4W5N A;  4NLB A;  3R9P A;  1SQK A;  3E9L A;  5CYQ A;  4FXD A;  4B9Q A;  4BC3 A;  3WEE A;  3QEX A;  3RRH A;  1K6Y A;  3N4P A;  3DI6 A;  1BG3 A;  3ISN C;  1KRP A;  1K8A O;  1JXE A;  3DXM A;  1S1V A;  1KAZ A;  1TYQ B;  4AQY K;  2QKB A;  2HHW A;  4IOX A;  1GLE G;  3RMA A;  3NGZ A;  3MXM A;  2BE2 A;  3A5N C;  4LD0 A;  3J7Z O;  4JI4 K;  1TK8 A;  1S3X A;  2CGJ A;  4NXN K;  1JCE A;  2O8B B;  1ZBS A;  4DSF A;  3TU5 A;  1TKD A;  3BZK A;  4OKE A;  3AVK A;  3R1X A;  1G15 A;  2KFZ A;  3SPZ A;  4A62 A;  3PY8 A;  3ZSO A;  4M42 A;  1IO2 A;  4AIL C;  4IDH A;  3LDQ A;  1JL1 A;  5BPM A;  2VWB A;  1SKW A;  4DFK A;  4PUO A;  4PY5 A;  1RGI A;  1NGD A;  3OYI A;  3U3G A;  2F9T A;  3JXU A;  3F5T A;  3EEQ A;  5LJV A;  1T7P A;  3FGU A;  4HUG A;  3THX B;  4EZ6 A;  3TAM A;  2P9P A;  1KTQ A;  4E7J A;  3AVA A;  5HP1 A;  1R0A A;  3N4Q A;  2LSN A;  3WXI A;  1Q81 O;  3AVI A;  4Y1D A;  4FWN A;  4KH5 A;  4LFC K;  1NG9 A;  1X3M A;  3NVM A;  4LSN A;  2QA4 N;  3U6F A;  2I5J A;  4CFC A;  5E41 A;  3ZT2 A;  2UUB K;  3HK2 A;  3AVJ A;  3EY1 A;  2X74 A;  4G9Z A;  4UY8 O;  4OLA A;  4CHO A;  2E4L A;  4FJ7 A;  5HBM A;  3P4I A;  5EOY A;  2OPP A;  1HKC A;  1L3S A;  2IDO A;  1O13 A;  4KBO A;  5FPE A;  4WQ4 C;  3KWG A;  2E8A A;  2Q1N A;  2P9L B;  4NB4 A;  2Y1I A;  4FLZ A;  5F0X A;  3KLF A;  3KHY A;  4MO5 A;  4LF6 K;  1QVF M;  1J53 A;  4HWI A;  1BI4 A;  4DWI A;  1YHQ N;  2QXF A;  5KTQ A;  3CCJ N;  1IV0 A;  1NK7 A;  4W5T A;  2YNG A;  4H8K A;  4JRP A;  1QSY A;  4CES A;  1KVC A;  5GIP A;  4DLG A;  3RSE B;  3S3O A;  4KB0 A;  2QWQ A;  1B92 A;  4JD2 B;  1WSH A;  3OBW A;  4M3U A;  3HYF A;  4DSE A;  3SZ2 A;  3H6E A;  2P9K A;  3DMJ A;  1QSS A;  3FLC O;  4OKJ A;  1RT1 A;  4GMJ B;  2BGG A;  4CF0 A;  3DLG A;  3TI0 A;  1HYV A;  3A5O C;  3CJ7 A;  3EO3 A;  3IMX A;  4CHY A;  3ENO A;  5AQT A;  1V4T A;  3BY5 A;  3O9Q A;  1RFQ A;  3QIP A;  4NLC A;  4CJW A;  2O8C B;  3TSP A;  4JKH A;  4E19 A;  2IC3 A;  3CCQ N;  1GLJ O;  1D9F A;  3GE1 A;  5DM7 L;  5M1Q A;  3V4I A;  5K14 A;  4J2A A;  3KD5 E;  4M3R A;  1NGI A;  4BDP A;  2HHV A;  3ALY A;  1TAQ A;  1ZXO A;  1NK8 A;  1JL2 A;  4JS4 A;  4IWV A;  1LWC A;  2D0B A;  4B08 A;  1U2V B;  1NJZ A;  4BRK A;  1Q9Y A;  3SBT A;  1P90 A;  4NO7 A;  3IS9 A;  1VQ5 N;  4CJ5 A;  3NH1 A;  2E5L K;  5FPM A;  4OVL A;  2ATQ A;  3LP1 A;  2D5R A;  1LOT B;  4AHC A;  4BRO A;  4KFB A;  3VQB A;  4C23 A;  3WNE A;  4CJK A;  3AO4 A;  2P9S B;  3WUH A;  1SL2 A;  4FLU A;  3KIO A;  4O0J A;  3VF6 A;  4KH4 A;  2GWK A;  1M90 O;  3L0Q A;  1ATN A;  4H4O A;  1DTT A;  5JVG L;  4JKE A;  4B1V A;  3HJF A;  1WSF A;  3EKS A;  5HLF A;  4Q5V A;  4BY9 C;  4M3T A;  5TKW A;  4FVM A;  4ICL A;  2FBT A;  1C1A A;  3AO1 A;  1RT7 A;  1TL3 A;  3WEE B;  5HRP A;  4DV5 K;  4BG8 A;  4B1Z A;  1NLV A;  5A2Q O;  3AO2 A;  3IAY A;  5J1E A;  3UIQ A;  5JMV A;  1HJO A;  3LDN A;  2P9P B;  2QKK A;  4FZX C;  3G4S N;  2OZM A;  4JI1 K;  3MN6 A;  4B1U B;  4CEF A;  3HOS A;  5DM6 L;  4BRF A;  2DY4 A;  2Z1G A;  2D4W A;  3AVG A;  2FF3 B;  5C10 A;  2RKI A;  5AZJ B;  2UYT A;  3T19 A;  4YOW A;  4AH9 A;  3ZSY A;  4GKK K;  4Z4I A;  3ZX2 A;  5IT9 O;  1JXB A;  4ISF A;  3HI0 A;  4CIF A;  3MX5 A;  4RW9 A;  3IDH A;  5LY3 A;  5CZ1 A;  3DYA A;  2HF4 A;  5EVZ A;  3QO9 A;  2NLX A;  3KLG A;  3M8S A;  2OTL N;  4MLH A;  3R8E A;  4KKO A;  2A6A A;  3P39 A;  1WUA A;  4DF4 A;  3JYT A;  3ENB A;  3KLI A;  4BRL A;  5BRE A;  5KGW A;  3KK2 A;  3PX0 A;  4OLB A;  1QQM A;  4EIA A;  2KZZ A;  3TSQ A;  4LY7 A;  3LAK A;  4IJN A;  2W42 A;  2KZM A;  1X9J A;  1TK0 A;  3UKR B;  5HRO A;  4NCG A;  2X6S A;  3CQX A;  1OH5 A;  4CHN A;  3VQ6 A;  4EFH A;  1ASV A;  4X64 K;  3LM9 A;  2OTJ N;  2WBN A;  4AM7 A;  3A0I X;  4FJH A;  5CY4 A;  1MDU B;  2FSN A;  5AQI A;  4DTM A;  2OZS A;  3HBT A;  1YF5 L;  3HPG A;  3AO3 A;  3VF2 A;  1Q8I A;  1QZ5 A;  4CED A;  4BR2 A;  3QEW A;  4RG8 A;  4AM6 A;  1UAX A;  4H0O A;  1NKC A;  1JLA A;  2WOM A;  3O1W A;  5AQF A;  4YOR A;  4YHH K;  5GIN A;  3ULE A;  4B3T K;  2VQF K;  4DKW A;  2O8E A;  4K41 A;  3AAP A;  3M6G A;  3RVC A;  2PZS A;  2B4J A;  2ZQB A;  4AHU A;  2G8I A;  4ELV A;  2E1Y A;  3VQ9 A;  3EZW A;  4FJK A;  4B1X B;  2ETJ A;  4C8L A;  2G8W A;  2QWO A;  5BRH A;  4AHV A;  3RMB A;  2VG6 A;  4GNI A;  4BQZ A;  4Z4G A;  1CZ9 A;  3L2U A;  3F2K A;  2Q0R A;  4JHD B;  5ELZ A;  5AQU A;  4Y0W A;  3HM8 A;  4WFB L;  4FLT A;  3SQ1 A;  3HST B;  3P1G A;  2A41 A;  2ZWH A;  5EX5 A;  2FF6 A;  1ATR A;  3THX A;  4QCL A;  2YCH A;  3O4W A;  1XHZ A;  2ASO A;  4OPJ A;  2VG5 A;  3WXK A;  3WNG A;  4YDU A;  3C0B A;  1BA0 A;  1EET A;  2FC0 A;  4BVO A;  1GOA A;  1VQL N;  2W6L A;  2YX6 A;  2FXU A;  5AQR A;  3KTQ A;  1EWQ A;  3I0R A;  1OVQ A;  2GTD A;  4PQU A;  4DV3 K;  5C0Y A;  3SCX A;  1E4F T;  5FDL A;  1KQS M;  4JK8 A;  3BEX A;  4CGF A;  2P9N B;  1LAW A;  4Z0U A;  3VEY A;  4BGA A;  5AFU A;  1ZBL A;  3VET A;  1U48 A;  2YKM A;  4KAZ A;  3ZEU A;  1JLQ A;  3V9Z A;  3PLA A;  1VSE A;  1NK5 A;  3DLL L;  2ITM A;  1Y64 A;  1D5A A;  4I9L A;  4I2P A;  1TUU A;  4M7X A;  4YY3 K;  4QS8 A;  4IOA L;  3I56 N;  3CC4 N;  1UOC A;  2F4V K;  4CJL A;  4BRI A;  4Z94 A;  2UUC K;  1X1P A;  4FO0 A;  1VSF A;  1D8Y A;  2V52 B;  2YJE A;  3OYB A;  5LMU K;  1A5V A;  4IG0 A;  2YHY A;  1TGO A;  2V51 B;  5EU7 A;  4BRA A;  2E2P A;  3C7N B;  3WXJ A;  3K57 A;  2YJF A;  3V9X A;  3MEC A;  2GUI A;  4WQ4 A;  4CI6 A;  1RBU A;  1NJY A;  2XO7 A;  2F96 A;  2OAN A;  2Z1J A;  4GW6 A;  5KRT A;  4GV9 A;  4DV2 K;  3TSU A;  4KHS A;  3DRR A;  4KO0 A;  1XC9 A;  5M1K A;  3GL1 A;  1YIT N;  1W7A A;  3HPO A;  4CJ3 A;  4OPA A;  2E6L A;  5HOO A;  3K9J A;  4LSL A;  4YOT A;  4FK2 A;  4M3Z A;  4JI0 K;  3MX2 A;  3RWU A;  3MAQ A;  4OGE A;  1U2V A;  4UQG A;  4BGB A;  3L2R A;  4M3X A;  2YKN A;  3S3N A;  1BIS A;  1X3N A;  1T44 A;  4MQ3 A;  3WQT A;  4BRQ A;  4NCB A;  3F9M A;  4JN4 A;  2O8F A;  3TAB A;  4M3Y A;  3T1A A;  3SAF A;  3KLE A;  4BRH A;  2XY6 A;  2GEM A;  3K5O A;  1SS6 A;  3DJC A;  4BR4 A;  1MWM A;  3KJV A;  1ESV A;  2BUP A;  2E88 A;  3OS1 A;  3EKU A;  3HXM A;  1HUX A;  1WAJ A;  3L4I A;  1EQY A;  2B6A A;  1KSP A;  2HHS A;  4U7B A;  2HHQ A;  3ID6 A;  2NZT A;  3VQD A;  2WTU A;  5J2M A;  4TSX A;  1D4X A;  1NGB A;  3FZL A;  4H0V B;  4BR0 A;  3CJB A;  1CLQ A;  4DQR A;  3CF5 L;  1RBV A;  2P9U B;  1IG8 A;  3CG7 A;  4Q0B A;  1XMQ K;  4CVN E;  4C8M A;  3O3F A;  3ENH A;  1QHT A;  4O5F A;  3J8A A;  3R3L A;  2ZF5 O;  4DV1 K;  1U6Z A;  1IBK K;  2BTF A;  4CZK A;  1R59 O;  5KI6 A;  5AZI A;  3SI6 A;  2HMI A;  1O1W A;  2W40 A;  5JS2 A;  1Q9X A;  3HP9 A;  4KHY A;  3EZ5 A;  3NF9 A;  2RF2 A;  3SAH A;  4CK2 A;  2O4I A;  1MU2 A;  3SJH A;  1NMN A;  3OTO K;  3H46 O;  2A42 A;  1T3V A;  1LW2 A;  3U9D A;  3MEE A;  3OYN A;  2D1K A;  3NAE A;  3DXK B;  1XQS C;  3THY A;  4DR4 K;  5HRS A;  5AQY A;  4DTS A;  4FPA A;  2UUA K;  2YV0 X;  4AF1 A;  4CJQ A;  4W5Q A;  2XHB A;  1QTM A;  3AA5 X;  4CBX A;  3JSM A;  4I6M B;  4O8K A;  2KTQ A;  4J2D A;  3O1B A;  4BE0 A;  4CBU A;  4DSI A;  3J80 O;  3GDQ A;  2Y1J A;  1WBD A;  5KRS A;  3H08 A;  3UKR A;  4H5N A;  1ILY A;  4WCE L;  4A59 A;  3AVM A;  2EWS A;  3RTV A;  2GX9 A;  4BC2 A;  3ULE B;  4O5B A;  5CYM A;  3VQ4 A;  1TVR A;  2HND A;  4DR7 K;  5E84 A;  3VEV A;  3WXL A;  3VMF B;  1VSK A;  5M1N A;  1GLA G;  4JS5 A;  1V4S A;  1RT6 A;  5BN9 A;  2GEL A;  4CGG A;  3TWH A;  3NE6 A;  2NNW A;  3GBT A;  1CXU A;  3VPZ A;  3ZX3 A;  1ASW A;  3TAG A;  3THV A;  1RBS A;  3CCM N;  3VEN A;  4IEI A;  2NRT A;  1NOZ A;  3LPT A;  4CJF A;  1RDB A;  3T7Z A;  1LWF A;  4CJ7 A;  1YTA A;  2WFB A;  3BP8 A;  3MK6 A;  5C25 A;  1BI4 B;  1LW0 A;  3CPE A;  3S41 A;  3CET A;  1S6P A;  3K5M A;  2Q0U A;  4FM2 A;  4FSV A;  4F3O A;  3NH0 A;  5AQQ A;  1CZB A;  4JLH A;  3QLH A;  2E6M A;  3SYZ A;  1Q18 A;  2OPQ A;  4X62 K;  3H45 C;  4CGH A;  1K8K B;  2DPN A;  3U8X A;  5KPZ A;  1DEJ A;  3EL2 A;  4MLE A;  4E3S A;  3VQQ A;  4H03 B;  3QIO A;  3P31 A;  2E1Z A;  4K43 A;  3VGK A;  1QHA A;  3LAL A;  4BR5 A;  4Y1C A;  3D6R A;  2XRI A;  3C7N A;  4F3T A;  5GAD P;  2PYJ A;  3OS0 A;  3PV8 A;  3QDK A;  4FPB A;  4DV7 K;  1UWB A;  3ZT4 A;  5J2Q A;  1YJW N;  1QE1 A;  3B6O A;  1JJ2 M;  1RIL A;  3O4Q A;  4CGI A;  2VWJ A;  3DXM B;  4W5O A;  2PFU A;  4J8F A;  3SUO A;  4E1M A;  5HL7 L;  4OPK A;  5FPN A;  1X9W A;  4CF1 A;  3DLK A;  3KK3 A;  4H5R A;  1HNZ K;  4DCH A;  2OCE A;  1IH7 A;  2D0A A;  4CEA A;  4BR7 A;  4YOX A;  2KLA A;  3PIP L;  4FK0 A;  3I33 A;  1I94 K;  1XMO K;  4KRF A;  4G1Q A;  5GAH P;  3O3G A;  3M8P A;  1SAZ A;  3E9P A;  2HHX A;  1ASU A;  3AVF A;  3NDK A;  1J54 A;  2Q97 A;  3ZET B;  3ZT1 A;  2NRX A;  4OKK A;  4FJ8 A;  4O44 A;  3O9U A;  2HBM A;  2OPS A;  1E4G T;  3SBG A;  1CXQ A;  1WBB A;  1BUP A;  1EX4 A;  4BWJ A;  2DTU A;  2XY7 A;  1BDG A;  4JI3 K;  4X66 K;  4FW2 A;  4CZJ A;  4FJJ A;  2QW9 A;  3FR0 A;  4HUE A;  2HHU A;  3K2P A;  4ILH A;  3L2W A;  3V9W A;  4BWM A;  4CF8 A;  2YNF A;  3AGK A;  3CIP A;  4JI6 K;  4CF9 A;  4LF8 K;  1TKT A;  1J6Z A;  3EE8 A;  2EX3 A;  1DT9 A;  4HHT A;  3ZSR A;  1RT3 A;  4CD3 A;  2O8F B;  4CZF A;  4KV8 A;  1SV5 A;  4JAX A;  3NF7 A;  4DFM A;  4ID1 A;  2XY8 A;  3DRP A;  3UKU A;  1A5W A;  1Q7Y O;  4A57 A;  3A5M C;  4CK1 A;  5M1O A;  4BRD A;  3VEX A;  3CI5 A;  5AQL A;  3O4N A;  1NBW A;  5I9E B;  1J9A A;  4IJA A;  5B8H A;  3CM5 A;  2RPI A;  4DR2 K;  1KFS A;  1KAX A;  4B3O A;  4IO8 A;  3L2V A;  3LPU A;  3S9H A;  4DTU A;  2P9U A;  1ZYQ A;  1BCO A;  5JIC A;  2NRW A;  4DUZ K;  1SL1 A;  3O5B A;  3SQ4 A;  2XY5 A;  1W0H A;  2CGK A;  2QWP A;  3V1O A;  1OKJ A;  3I0S A;  3VER A;  4JK7 A;  3MN9 A;  4PWD A;  3VEO A;  3DLR A;  5SZT A;  4JKG A;  5BPL A;  1K9M O;  4CD1 A;  1KXP A;  5D3G A;  3VN5 A;  3F9K A;  5KQD A;  1S22 A;  2E2Q A;  1HNV A;  1T05 A;  1VQM N;  5GIO A;  2UXB K;  4I2Q A;  1JCF A;  3OYL A;  3QML A;  5AQG A;  4CJT A;  4LFA K;  3SV3 A;  4CIG A;  4DSL A;  1EO1 A;  3SUP A;  3PO4 A;  1RT5 A;  4B1W B;  1BQN A;  1VQP N;  3ITH A;  3HOT A;  1A5X A;  2D0O A;  4JKF A;  2ZJP L;  1KC8 O;  5KPT A;  3FZH A;  1NNE A;  2ASP A;  3TPQ A;  3K59 A;  4Z4E A;  5AZI B;  3DM2 A;  1C0M A;  3LM2 A;  5AQZ A;  4E7L A;  1YIJ N;  3QIC A;  4JI5 K;  4FJI A;  3CJA A;  4RW8 A;  1HYS A;  3M1F A;  4ZTJ A;  3PO5 A;  1SL0 A;  2A5X A;  2YNI A;  4GY2 B;  4NYN A;  3OBY A;  3LZI A;  3OYJ A;  1RTJ A;  3J7A P;  1FKP A;  1ITG A;  3DAW A;  3MWT A;  3R6M A;  2HB5 A;  4QS7 A;  3C65 A;  4IEE A;  4JYA K;  1RCH A;  4LC9 B;  4QOZ B;  4DQS A;  4WQ5 A;  3CPW M;  3AVB A;  4DV6 K;  4B3R K;  3OHR A;  4H0Y B;  3TR8 A;  1IBM K;  5FLX O;  4Z4H A;  4YDU C;  2Q36 A;  2P51 A;  3VOV A;  4KTZ A;  2V7Y A;  1C0G A;  1L3T A;  1HNI A;  1GLF O;  3QBX A;  4F9O A;  2AA4 A;  5CZ2 A;  3E1Y A;  4C1N I;  1DGK N;  4B9N A;  1T03 A;  3CMA N;  1Q82 O;  4GVE A;  4EAH D;  4CZH A;  4JRQ A;  2O8D A;  2PYL A;  1RT4 A;  3OYH A;  1YVU A;  2Z1I A;  3KWI A;  3J7Y P;  1BGX T;  4HTU A;  4FLV A;  3QET A;  3NHG A;  3A5L C;  1S9E A;  3CQY A;  2ZGY A;  3CC7 N;  4FJL A;  3IRX A;  2KHO A;  4IFV A;  3AAQ A;  1KFD A;  3ZT3 A;  4A2B A;  4CZI A;  1QQC A;  3J81 O;  3MEG A;  3MWP A;  5JLH A;  3C94 A;  3KLH A;  1IKV A;  4B9L A;  1BHL A;  1DKG D;  4HCB A;  3HL8 A;  1K73 O;  4E7H A;  4JD2 A;  2VGN A;  5ADX H;  5GAG P;  5F2R A;  4CZE A;  4EZ9 A;  1X9S A;  1LCU A;  3CQ8 A;  5AQJ A;  4FLW A;  4DF8 A;  5F1X A;  2UXD K;  2IVO A;  4QAG A;  1RT2 A;  3A2F A;  2WON A;  4N56 A;  4A61 A;  1HX1 A;  3CJ1 A;  1HNW K;  4CJV A;  2KKZ A;  1XNQ K;  1VK0 A;  4U67 L;  4CW7 B;  2V7Z A;  4CEZ A;  4DTP A;  2HST A;  3QB0 A;  1OH6 A;  3TAR A;  4BRP A;  4XH1 A;  3VQA A;  4MO4 A;  5HRR A;  3ZSQ A;  3O80 A;  3AV9 A;  3HO1 A;  2F8T A;  4CBW A;  3AY9 A;  4CGJ A;  3AO5 A;  1RBR A;  3U9Z A;  4DU3 A;  4DFJ A;  1RDU A;  5M1P A;  1YAG A;  1NGC A;  3ZYY X;  1WSJ A;  1YI2 N;  3ZSX A;  3E66 A;  4BG9 A;  1P8Z A;  3MCA B;  3IG1 A;  3MED A;  3MCP A;  1TKX A;  3NF8 A;  1BQM A;  1I3A A;  3CCE N;  3BF1 A;  2NRH A;  4FJM A;  3LAM A;  1BOT O;  2UU9 K;  3CFR A;  1NK9 A;  4LF7 K;  3OY9 A;  4JI7 K;  2G8V A;  3VGM A;  3PIO L;  1VQ6 N;  1W2B M;  1NJW A;  3ULD A;  4QS9 A;  3K0S A;  1FXX A;  2KW4 A;  3EE9 A;  2KFN A;  4DTX A;  3V9S A;  4HUF A;  5AQO A;  3SUQ A;  1NGG A;  1NK4 A;  4FWM A;  3QEI A;  4H0X B;  4OPH A;  4O8U A;  4N41 A;  4KHQ A;  1RTI A;  4JI8 K;  1Z6R A;  1NGE A;  2ZE2 A;  1OH8 A;  4BE1 A;  2OA8 A;  5FPD A;  2ZJR L;  4KI6 A;  2HVH A;  2Q3S A;  2CH6 A;  4DG1 A;  1WLJ A;  4DSJ A;  4KHU A;  3ASM A;  4V19 S;  3B6P A;  4CFA A;  4CEB A;  4CHP A;  4BAC A;  1HR0 K;  3BGR A;  2DFH A;  3BF3 A;  2NUB A;  4FK4 A;  1ZBH A;  4B8A B;  4YOU A;  2YHW A;  2QWN A;  3H3N O;  1FKO A;  4W5R A;  3HVR A;  4JKB A;  2P9L A;  3CM6 A;  5MLC Q;  2BH1 A;  3UE5 A;  4HVJ A;  1YJ9 N;  4ZHR A;  4AHT A;  1TYQ A;  2FSJ A;  2VGM A;  4XIU A;  1WSI A;  3ZX0 A;  2IGI A;  2ZGZ A;  2A1R A;  4FWS A;  3ZSV A;  3H3O B;  4ZTF A;  4H0P A;  2QM1 A;  4BC4 A;  5GAE P;  5AQP A;  5EXW A;  2IVN A;  3OJU A;  5DK5 A;  1XI1 A;  1S1U A;  5AQW A;  1HQE A;  5BN8 A;  4YFU A;  1N8R O;  4ID5 A;  5AR0 A;  1VQK N;  5AZJ A;  1TV6 A;  1IKY A;  2P5G A;  3RSE A;  3DLB A;  4CEO A;  4OGC A;  3H1V X;  4FZZ A;  3VQ7 A;  2P5O A;  5CE3 A;  4O0I A;  2FBV A;  2Z1H A;  4BDZ A;  4IKF A;  2E2N A;  4WE1 A;  1VSI A;  2P9I A;  1NOY A;  1HYZ A;  1ZBF A;  4B9M A;  1IKW A;  3I8D A;  3VES A;  4F2R A;  4FJ5 A;  4JK9 A;  2YI1 A;  4B9T A;  4CZL A;  4DR3 K;  3L4Q A;  4DQ8 A;  3HT3 A;  3K9K A;  3LL3 A;  3WNH A;  3M3Z A;  1VRT A;  1S9G A;  3L3U A;  2O8E B;  1I39 A;  3L3V A;  1RDC A;  3B8A X;  4IDK A;  5CHI A;  3TAP A;  1B9F A;  3RMD A;  4A5B A;  1W9H A;  2JWL A;  4CEE A;  5KPR A;  1GLB G;  4CEQ A;  2WUS A;  4FWO A;  1KLN A;  3QEV A;  3LP0 A;  2QWM A;  1Z25 A;  4RW7 A;  4ELT A;  4BVP A;  5ADX A;  1J5E K;  1BA1 A;  4K25 A;  4B8C A;  1KCF A;  3LAN A;  4PKH A;  3VA3 A;  1TKZ A;  3OVN A;  3UB5 A;  2F8S A;  1NK6 A;  3LP3 A;  1NWK A;  1WOQ A;  3AAR A;  3KKS A;  1N33 K;  2RN2 A;  3CD6 N;  2QXL A;  2NRZ A;  4KTW A;  4RW4 A;  1RDD A;  3DWL A;  2HF3 A;  2QTD A;  3HSC A;  2CH5 A;  3F73 A;  5IWA K;  4ISG A;  4CHZ A;  4CE9 A;  1S5J A;  2F7T A;  3D2E B;  3PX4 A;  5AQS A;  1TUY A;  1U04 A;  5HRN A;  2VCP A;  4H5W A;  1L5U A;  1E3M A;  4RCH A;  4I7F A;  2QK9 A;  3EYZ A;  3AGR A;  4JKD A;  2IS3 A;  3QER A;  4JKG B;  2PY5 A;  4DQI A;  4H0T B;  1Z05 A;  1XHX A;  1T8E A;  3NGI A;  1ZC6 A;  4O4G A;  1U45 A;  3M8R A;  4E1J A;  3LDS A;  2HNZ A;  2OPR A;  3THW A;  4DR5 K;  3TAF A;  1NK0 A;  4B3M K;  4WQ5 C;  3HM9 A;  1IJJ A;  4FLX A;  2IVP A;  3VF4 A;  1WN7 A;  1DTQ A;  2X78 A;  3VQ8 A;  1EWR A;  3CER A;  3TAE A;  2A40 A;  3FZF A;  1JLB A;  3CFO A;  4CIE A;  4EHU A;  1YXQ A;  4KRE A;  2P1J A;  1F21 A;  3T69 A;  4F2S A;  4IOC L;  3NH2 A;  1ATS A;  4FCY A;  5FRM A;  1KD1 O;  1HPZ A;  1C0U A;  4CJU A;  2RE2 A;  1RBT A;  1C0T A;  1VHX A;  1XWL A;  3KVG A;  4C1N K;  3T1H K;  1WSE A;  2UXC K;  4DU1 A;  3FE1 A;  4H4M A;  1CZA N;  1KLM A;  4WFA L;  2HHH K;  4BRM A;  3FZM A;  3TTC A;  1GLL O;  1EXQ A;  4GV6 A; 
#chains in the Genus database with same CATH homology
 4YOV A;  5H1S Q;  3MN9 A;  2QWL A;  3VEO A;  5C15 A;  2A41 A;  2ZWH A;  5EX5 A;  4BRG A;  3CHW A;  4JKG A;  3MMV A;  5BPL A;  2FF6 A;  3G6E N;  1ATR A;  1K9M O;  5JVH L;  4CD1 A;  1KXP A;  4IXC A;  2YCH A;  3O4W A;  1BU6 O;  2QI2 A;  4DHY A;  1K8K A;  5KQD A;  2ASO A;  2NRV A;  1S22 A;  3WXK A;  1XC3 A;  2E2Q A;  2E2O A;  3CJ9 A;  3Q7B A;  3C0B A;  4YDU A;  1BA0 A;  4BRN A;  5C12 A;  3G71 N;  1VQM N;  2I7P A;  5GIO A;  4IZ9 A;  4BVO A;  1VQL N;  1JCF A;  2YX6 A;  2FXU A;  5AQR A;  3QML A;  5AQG A;  1G99 A;  2GTD A;  3WXM B;  5C0Y A;  2FSK A;  2FLO A;  1EO1 A;  1E4F T;  4K42 A;  1KQS M;  4JK8 A;  3BEX A;  4B1W B;  5CR4 A;  1VQP N;  4PKI A;  3HOT A;  2F9W A;  2P9N B;  2D0O A;  4JKF A;  3CJC A;  2ZJP L;  1HPM A;  1KC8 O;  5KPT A;  3VEY A;  3FZH A;  4BGA A;  5AFU A;  3SK3 A;  1NJI O;  2ASP A;  3TPQ A;  3GG4 A;  3TTF A;  3VET A;  3TTD A;  5AZI B;  3LM2 A;  3ZEU A;  5AQZ A;  4XEI A;  3QIC A;  1YIJ N;  2HMP A;  1VAZ A;  1QVG M;  3PLA A;  1NGH A;  1VQO N;  2VYP A;  4JKA A;  2D0P A;  4JKC A;  3DLL L;  1NGJ A;  3CJA A;  4FL9 A;  2ITM A;  1Y64 A;  3M1F A;  1YVN A;  5E26 A;  3CXC M;  1BWF O;  1H1V A;  1TUU A;  2E20 A;  4M7X A;  2A5X A;  3IUC A;  4GY2 B;  4QS8 A;  4IOA L;  3ID8 A;  4JEP A;  3I56 N;  3CC4 N;  3OBY A;  2I7N A;  4BRI A;  4Z94 A;  4MDB A;  5EY4 A;  3DAW A;  3MWT A;  3R6M A;  4QS7 A;  4FO0 A;  3C65 A;  4IEE A;  4ILJ A;  3W3D A;  2V52 B;  2YJE A;  4LC9 B;  5BRF A;  4NLB A;  3R9P A;  4WQ5 A;  3W0L A;  1SQK A;  3CPW M;  3E9L A;  2YHY A;  2V51 B;  4B9Q A;  4BC3 A;  4BRA A;  2E2P A;  3C7N B;  3WEE A;  3WXJ A;  3OHR A;  4H0Y B;  2YJF A;  4YDU C;  2Q36 A;  4JHD A;  3VOV A;  5JLF A;  4WQ4 A;  4CI6 A;  2V7Y A;  1C0G A;  3SMS A;  3N4P A;  1BG3 A;  2OAN A;  3D2F B;  1K8A O;  1GLF O;  3QBX A;  4F9O A;  2AA4 A;  1QQO A;  3E1Y A;  4C1N I;  4GV9 A;  1DGK N;  3DXM A;  3LDL A;  2HOE A;  1KAZ A;  1TYQ B;  3TSU A;  3CMA N;  5M1F A;  3VGL A;  1Q82 O;  4GVE A;  3ZEU B;  4EAH D;  4IOX A;  4CZH A;  1HLU A;  1GLE G;  5M1K A;  3GL1 A;  3M5R A;  1YIT N;  2Q31 A;  3A5N C;  5TKY A;  4OPA A;  3SAG A;  3J7Z O;  3U4L A;  4GV3 A;  1S3X A;  2CGJ A;  5HOO A;  3KWI A;  1JCE A;  3K9J A;  2HBK A;  3I8B A;  4OO1 J;  1ZBS A;  4WFN L;  4YOT A;  4ISE A;  3TU5 A;  3A5L C;  3IFR A;  3CQY A;  2ZGY A;  3MX2 A;  3CC7 N;  4A2A A;  3R1X A;  2KHO A;  1U2V A;  3AAQ A;  4A62 A;  4A2B A;  4CZI A;  3DXK A;  3MWP A;  4BGB A;  3VTI A;  5JLH A;  4IDH A;  1X3N A;  1T44 A;  3WQT A;  2YHX A;  4BRQ A;  3LDQ A;  1DKG D;  3F9M A;  4JN4 A;  1K73 O;  5BPM A;  2VWB A;  4JD2 A;  4L3Q A;  2VGN A;  1RGI A;  3SAF A;  4BRH A;  5ADX H;  4Y0W A;  5GAG P;  2GEM A;  5F2R A;  1NGD A;  4CZE A;  1MWK A;  1SS6 A;  3DJC A;  4BR4 A;  1MWM A;  1NGF A;  1ESV A;  1LCU A;  2BUP A;  5AQJ A;  5KQ8 A;  2E88 A;  2F9T A;  3JXU A;  5F1X A;  3F5T A;  2IVO A;  3EKU A;  3FFK B;  3E9O A;  5LJV A;  1HUX A;  1JCG A;  4RWT A;  4WF9 L;  4A61 A;  1HX1 A;  1EQY A;  3CJ1 A;  3FGU A;  3L4I A;  1Q86 O;  4H5T A;  4U7B A;  1XUP O;  2KKZ A;  3ID6 A;  4U67 L;  2NZT A;  2V7Z A;  2P9I B;  1D4X A;  2HST A;  3QB0 A;  1NGB A;  3FZL A;  3C6H A;  2P9P A;  4H0V B;  4PKG A;  4BR0 A;  1BO5 O;  3QFP A;  3CJB A;  4BRP A;  3G25 A;  3N4Q A;  3FZK A;  4XH1 A;  3WXI A;  4MO4 A;  3CF5 L;  2P9U B;  1Q81 O;  3O80 A;  1IG8 A;  4FWN A;  4KH5 A;  4CBW A;  3AY9 A;  1MA9 B;  3U9Z A;  1X3M A;  1RDU A;  3NVM A;  5M1P A;  1YAG A;  1NGC A;  2QA4 N;  3ZYY X;  3ENH A;  1YI2 N;  3SLC A;  3E66 A;  4O5F A;  4BG9 A;  3J8A A;  2NRR A;  4FWP A;  1P8Z A;  3MCA B;  3R3L A;  4FOE A;  2ZF5 O;  4UY8 O;  4G9Z A;  3MCP A;  1U6Z A;  2BTF A;  4CZK A;  1R59 O;  3O9T A;  5AZI A;  1HKB A;  2W40 A;  3CCE N;  3BF1 A;  2NRH A;  3P4I A;  5EOY A;  1BOT O;  3P38 A;  5AQN A;  1HKC A;  1O13 A;  4KBO A;  5FPE A;  4WQ4 C;  3EN9 A;  3KWG A;  2E8A A;  2Q1N A;  2P9L B;  5AQH A;  3VGM A;  4NB4 A;  3PIO L;  3HZ6 A;  4MDA A;  1W2B M;  1VQ6 N;  4M63 C;  5F0X A;  3SAH A;  3IKM A;  3KHY A;  4QS9 A;  4HTL A;  4MO5 A;  1QVF M;  3SJH A;  3EE9 A;  3QBW A;  3H46 O;  4HWI A;  2A42 A;  1T3V A;  5AQO A;  1YHQ N;  3U9D A;  2GUP A;  1NGG A;  2D1K A;  3CCJ N;  2AP1 A;  3DXK B;  1XQS C;  2J4R A;  4FWM A;  4H0X B;  4OPH A;  4O8U A;  5AQY A;  1Z6R A;  4FPA A;  3O6W A;  4AF1 A;  1NGE A;  4BQL A;  5GIP A;  4BR9 A;  3RSE B;  4B1Y B;  4CBX A;  2QWQ A;  3CC2 N;  4I6M B;  2PAV A;  4JD2 B;  4O8K A;  3O1B A;  4CBU A;  3WQU A;  5FPD A;  2ZJR L;  3OBW A;  3GOI A;  3D2E A;  3GDQ A;  3KZB A;  3H6E A;  2P9K A;  2CH6 A;  3BUZ B;  3O08 A;  3UKR A;  3FLC O;  4H5N A;  1ILY A;  4WCE L;  4A59 A;  2EWS A;  2GX9 A;  3BF3 A;  3HRG A;  4BC2 A;  2HBL A;  4YOU A;  2YHW A;  2QWN A;  3H3N O;  3MDQ A;  3ULE B;  4DB3 A;  3A5O C;  3CJ7 A;  3EO3 A;  3IMX A;  3KK7 A;  3C6A A;  3ENO A;  5AQT A;  1V4T A;  4JKB A;  2P9L A;  3QFU A;  2P9N A;  3O9Q A;  5AQV A;  1RFQ A;  5MLC Q;  2BH1 A;  4NLC A;  5E84 A;  3UE5 A;  3VEV A;  3TSP A;  1YJ9 N;  4JKH A;  3WXL A;  3VMF B;  1TYQ A;  2FSJ A;  2VGM A;  5M1N A;  1GLA G;  3CCQ N;  1V4S A;  5BN9 A;  1GLJ O;  2GEL A;  3GE1 A;  3ZX0 A;  5DM7 L;  2ZGZ A;  5M1Q A;  4FWS A;  4IO9 L;  2NNW A;  3GBT A;  3H3O B;  3VPZ A;  1NGI A;  4JNE A;  4H0P A;  2QM1 A;  3ZX3 A;  4BC4 A;  5GAE P;  5AQP A;  1ZXO A;  5EXW A;  2IVN A;  2JWK A;  5AQW A;  3MN7 A;  4IWV A;  5BN8 A;  3CCM N;  5C2F A;  1U2V B;  1N8R O;  4BC5 A;  1VQ7 N;  3VEN A;  5AFU H;  4IEI A;  5AR0 A;  4BRK A;  1VQK N;  1W97 L;  2NRT A;  5AZJ A;  3VEW A;  3SBT A;  3T7Z A;  1P90 A;  4NO7 A;  4CJ7 A;  1VQ4 N;  1VQ5 N;  3I55 N;  3RSE A;  2WFB A;  5BRD A;  5FPM A;  3H1V X;  4I6M A;  4FVU A;  3BP8 A;  3MK6 A;  1LOT B;  4RTF D;  4CZG A;  3VTH A;  4BRO A;  3CCS N;  1GLD G;  3CPE A;  3S41 A;  3CET A;  4WYB A;  4H5V A;  4BRC A;  4C23 A;  2Q0U A;  3WUH A;  2P9S B;  1T6C A;  3NVK A;  3D7E O;  5CE3 A;  4FSV A;  5AQQ A;  3VF6 A;  3O9R A;  4KH4 A;  2GWK A;  1M90 O;  1NMD A;  3NMU A;  3ATV A;  1QZ6 A;  3L0Q A;  3CCV N;  1ATN A;  1Q18 A;  5JVG L;  4JKE A;  3HTV A;  4B1V A;  3H45 C;  2E2N A;  2P9I A;  1K8K B;  3EKS A;  1OVY A;  2DPN A;  3U8X A;  4BY9 C;  1RDW X;  5TKW A;  5KPZ A;  1DEJ A;  3EL2 A;  4MLE A;  3VES A;  5LJW A;  4H03 B;  4JK9 A;  2YI1 A;  3VEZ A;  3P31 A;  1VQN N;  4CZL A;  5AQM A;  2E1Z A;  4K43 A;  3VGK A;  1QHA A;  4JK7 A;  4BR5 A;  2RHK A;  4PHT X;  3D6R A;  1NGA A;  3C7N A;  3L4Q A;  3WEE B;  4DQ8 A;  4BG8 A;  4B1Z A;  5GAD P;  2HBJ A;  1NLV A;  3K9K A;  3LL3 A;  3QDK A;  4FPB A;  3ZET A;  3M3Z A;  5JMV A;  1HJO A;  3LDN A;  3WT0 A;  3UKU B;  2P9P B;  1YJW N;  1YJN N;  3B8A X;  1JJ2 M;  5AQX A;  1NM1 A;  3G4S N;  5CHI A;  2H3G X;  4A5B A;  3DXM B;  4XH4 A;  2PFU A;  3MN6 A;  3OA9 A;  4B1U B;  3HOS A;  2JWL A;  3L6Q A;  4J8F A;  1GLB G;  5KPR A;  5DM6 L;  4BRF A;  2WUS A;  4FWO A;  5HL7 L;  2D4W A;  1VQ9 N;  2FF3 B;  2QWM A;  5FPN A;  5C10 A;  3O9S A;  4FWL A;  5AZJ B;  2UYT A;  3LDO A;  4H5R A;  4BVP A;  5ADX A;  4YOW A;  4DCH A;  3ZX2 A;  4ISF A;  1BA1 A;  4K25 A;  3HI0 A;  3MX5 A;  3IDH A;  4PKH A;  4KH6 A;  5LY3 A;  4M7Y A;  3UB5 A;  1SZ2 A;  2HF4 A;  4BR7 A;  5EVZ A;  4A5A A;  2NLX A;  4YOY A;  2KLA A;  4YOX A;  1NWK A;  3PIP L;  3I33 A;  1WOQ A;  2OTL N;  3AAR A;  4MLH A;  3R8E A;  2A6A A;  3P39 A;  3CD6 N;  1WUA A;  2QXL A;  2NRZ A;  5GAH P;  3ENB A;  3DWL A;  4BRL A;  1SAZ A;  3E9P A;  3JS6 A;  5BRE A;  2GWJ A;  2HF3 A;  4ILG B;  2QTD A;  3HSC A;  2CH5 A;  1QQM A;  4EIA A;  4ISG A;  3TSQ A;  2ZJQ L;  3OW2 M;  2F7T A;  2Q97 A;  3D2E B;  2WC9 A;  5AQS A;  1TUY A;  3ZET B;  2Q2R A;  2VCP A;  4H5W A;  2QWR A;  2NRX A;  4IJN A;  3O9U A;  2HBM A;  1X9J A;  4IFE A;  4RCH A;  1E4G T;  3D2F A;  3UKR B;  1GLC G;  3CQX A;  3AGR A;  3SBG A;  3SMP A;  2W41 A;  4JKD A;  4EFH A;  4XH5 A;  1BUP A;  2PBD A;  3LM9 A;  3CCR N;  1S72 N;  2OTJ N;  2WBN A;  1BDG A;  4AM7 A;  4JKG B;  4CZM A;  5C2D A;  4CZJ A;  3A0I X;  2QW9 A;  4FOI A;  3FR0 A;  1MDU B;  1HKG A;  3ATU A;  4H0T B;  2FSN A;  5AQI A;  1Z05 A;  1YF5 L;  3HBT A;  4ILH A;  1ZC6 A;  4EHT A;  3VF2 A;  1QZ5 A;  4E1J A;  4PL8 A;  4BR2 A;  3O8M A;  3AGK A;  3CIP A;  4H0O A;  4AM6 A;  3H1Q A;  1J6Z A;  3O1W A;  3EE8 A;  1DT9 A;  4WQ5 C;  5AQF A;  3A8Y A;  3LDP A;  4YOR A;  1IJJ A;  4CD3 A;  2IVP A;  3VF4 A;  5GIN A;  2ASM A;  3ULE A;  4CZF A;  4JAX A;  4PL7 A;  1QQN A;  3CCU N;  3CER A;  4DKW A;  2A40 A;  4K41 A;  3UKU A;  3FZF A;  3AAP A;  4FWR A;  3M6G A;  3RVC A;  1Q7Y O;  4FWK A;  4A57 A;  4R79 A;  3A5M C;  5M1O A;  1YXQ A;  4BRD A;  4EHU A;  3VEX A;  2QEX N;  1C0F A;  2E1Y A;  3CI5 A;  3T69 A;  5AQL A;  3CME N;  1M1K O;  3EZW A;  4IOC L;  1ATS A;  1NBW A;  4B1X B;  3MN5 A;  5I9E B;  1KD1 O;  4IJA A;  5B8H A;  2A3Z A;  2QWO A;  5BRH A;  3Q7C A;  2P9K B;  2RE2 A;  4BRE A;  1VQ8 N;  4FWQ A;  2IIR A;  1KAX A;  3KVG A;  4C1N K;  4IO8 A;  4GNI A;  1YUW A;  4BQZ A;  2P9U A;  5JIC A;  2NRW A;  3FE1 A;  5BR9 A;  1CZA N;  2Q0R A;  3F2K A;  3O5B A;  4JHD B;  4WFA L;  3CCL N;  4BRM A;  5ELZ A;  5AQU A;  1T6D A;  2QWP A;  2CGL A;  1GLL O;  2CGK A;  1OKJ A;  3FZM A;  3TTC A;  3VER A;  3HM8 A;  5BPN A;  2P9S A;  4GV6 A;  1KAY A;  5AQK A;  4WFB L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...