3AAQA

Crystal structure of lp1ntpdase from legionella pneumophila in complex with the inhibitor arl 67156
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
353
structure length
349
Chain Sequence
KHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
total genus 106
structure length 349
sequence length 353
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aaqA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aaqA02
1ESVA 4BRAA 2VYPA 2F9TA 5AQVA 5KPRA 4JHDB 2CH5A 4HTLA 1SAZA 3D2FA 3DXKB 1MDUB 2P9IB 2IVPA 2GUPA 1MWKA 2VCPA 4K41A 1E4GT 3LM9A 4FWPA 1ATNA 2GEMA 3D2EB 3A5MC 1QQNA 3MK6A 4K25A 5F2RA 3WXIA 1K8KB 3FZLA 5KPTA 2A41A 2P9NB 3QICA 1BA0A 3AY9A 5FPNA 4C23A 3ZX0A 2ZGZA 3C7NA 3MN9A 4H5TA 5AQLA 2DPNA 2OANA 3R9PA 3CJ1A 2QWQA 4XH5A 3UKRB 1C0FA 3O1WA 3D7EO 3JXUA 2P9NA 1NGBA 5BRHA 4EFHA 4A2AA 4I6MB 2E2OA 2V52B 4CZGA 2GWKA 3VGKA 4FWMA 1WUAA 3D2EA 1R59O 4RWTA 5AQSA 3A0IX 1V4TA 5AQRA 3MN5A 2QWOA 3VEYA 5BRDA 3FE1A 3M6GA 3A5NC 3FZMA 3VENA 4FSVA 5AFUH 2FXUA 2Q0RA 1GLBG 2D0PA 2F9WA 4B1UB 3HZ6A 4DQ8A 3DWLA 3DXMA 2FSNA 3OHRA 2QWPA 4L3QA 4B1ZA 3ID8A 4NO7A 2E20A 4BRDA 3VF2A 4DCHA 3BP8A 2IVNA 3VOVA 2A42A 3EKSA 1K8KA 2QWLA 1QQMA 4BQLA 3ATVA 5AQIA 4FOIA 1MA9B 4JD2A 5AQWA 2P9SA 2P9LA 1TUUA 1KXPA 4A62A 1ZXOA 2PAVA 4FPBA 1T44A 3LDQA 5BN8A 4LC9B 2GTDA 4BRPA 3QBWA 1U2VA 3ENOA 1G99A 2FF6A 3VEOA 4GNIA 3AARA 1JCGA 4F9OA 2QWRA 5AZIA 2H3GX 1T6DA 3W3DA 4H5VA 3ZEUB 2E1YA 2ZF5O 1NGFA 3VEWA 3RSEA 3O08A 2ZWHA 4ISFA 5KQ8A 1Q18A 1XQSC 2I7PA 3SMSA 5F0XA 2E8AA 3WEEB 3ZX2A 4WQ5A 2AA4A 4CBUA 4J8FA 3FFKB 4K43A 5CE3A 1NGAA 1V4SA 2AP1A 3CETA 3ENHA 4QS9A 3GBTA 5JMVA 3ATUA 3FZFA 2YHXA 4FWKA 4BG9A 1IJJA 3EN9A 1HPMA 2NRHA 2UYTA 3H45C 4H0YB 2PBDA 5EY4A 4BR5A 2QXLA 3A8YA 3EL2A 2P9PB 4CZHA 2IIRA 4BGBA 3SJHA 4RTFD 4YDUC 1BU6O 5AZIB 2A6AA 4BC4A 4AM6A 1GLFO 2W41A 1ZC6A 2W40A 3HTVA 4BRLA 3SK3A 3LDNA 1RFQA 2E2QA 2Q2RA 5LJWA 4EAHD 3O6WA 4A61A 1NGHA 1RDWX 4H0OA 4M7YA 5AQNA 2P9SB 5EOYA 2ASOA 1HKCA 2J4RA 1NBWA 4CI6A 4BVOA 3IDHA 3AAPA 1BDGA 3HM8A 3WXJA 4CD1A 1ATRA 4CD3A 3CHWA 4BRHA 4FWLA 4B1XB 5BPLA 1DKGD 5BN9A 3M1FA 2FF3B 3UKUB 2YJEA 2FSKA 4BROA 3DXMB 3VGMA 4H0VB 2I7NA 1E4FT 1TUYA 3CERA 2E88A 3LL3A 3U8XA 3U9ZA 1GLAG 3LM2A 4B1VA 5BR9A 3CJ7A 5ELZA 4CZMA 5AQFA 1RGIA 1NGEA 5I9EB 1GLJO 3HSCA 4HWIA 1TYQA 3VPZA 3EKUA 1QHAA 4WYBA 2GELA 5JLHA 4QS8A 5EX5A 1BG3A 3CJBA 5KQDA 3CJ9A 3A5OC 3L6QA 4I6MA 2BUPA 1YVNA 1P8ZA 1BA1A 3QB0A 3SMPA 3UKRA 4CZLA 2CGJA 3SLCA 4CZJA 3UKUA 4IO8A 1C0GA 2V51B 1DGKN 4H0PA 3BUZB 2HF4A 2QW9A 4BRMA 4YDUA 1NGDA 3ZETA 4BRIA 3H1QA 3LDPA 1SZ2A 4IWVA 5AQQA 3B8AX 3JS6A 5B8HA 4M7XA 1NLVA 1Z05A 1YXQA 2P9IA 1S3XA 3I8BA 2HMPA 1JCFA 3D2FB 3DXKA 3BF3A 4FWSA 4H0XB 2FLOA 5AQXA 4JHDA 1NGGA 2EWSA 3EZWA 3DAWA 2QWMA 4MO5A 4BRGA 3VGLA 2Q31A 3I33A 4BRNA 1HKGA 1QQOA 3G25A 1OKJA 4BR9A 5BPNA 4ISEA 3O8MA 2P9UA 4BG8A 1H1VA 3CJCA 4BREA 5E26A 2D1KA 4DB3A 4BR2A 5AZJA 2WUSA 1NGIA 1HX1A 3VEVA 3MDQA 1NGJA 5AQKA 3L0QA 4B1YB 4H5NA 4FO0A 2NZTA 3MN6A 3O1BA 3QBXA 3MN7A 2V7ZA 2GWJA 4WQ5C 1NGCA 3HI0A 5FPMA 1GLDG 4A2BA 2IVOA 3FZHA 3WEEA 3HBTA 4BR7A 1GLCG 4BRKA 2QM1A 3KHYA 1MWMA 5BREA 1BWFO 3AAQA 4M63C 5LJVA 4FL9A 3H6EA 3WUHA 1JCEA 1BO5O 3F9MA 4CBWA 4BRCA 3U9DA 3QDKA 3WQUA 4BR4A 1J6ZA 1IG8A 3GL1A 1ZBSA 3GOIA 1X3NA 3ULEB 1D4XA 3FZKA 2ITMA 5BRFA 3MCPA 2Q97A 5JLFA 4JD2B 4ISGA 2Q0UA 4EHTA 5F1XA 2Q1NA 4BC5A 1ATSA 1WOQA 2YHYA 4BRFA 3ZETB 4JNEA 5AQPA 2D4WA 1HUXA 3WT0A 1X9JA 4MLHA 5E84A 3R6MA 5TKYA 2A3ZA 2YHWA 4H03B 2P9UB 4Y0WA 1X3MA 4BVPA 5JICA 4MO4A 2KHOA 3VETA 3A5LC 2Q36A 4XEIA 1HJOA 3IFRA 5EXWA 3IUCA 4CBXA 3H1VX 1YAGA 3H3OB 3LDLA 1NWKA 3J8AA 1T6CA 2CGKA 4IJNA 4EHUA 4XH1A 3R8EA 3KZBA 3VEXA 1Y64A 1U6ZA 4IXCA 1SQKA 2FSJA 4JAXA 1S22A 3O4WA 2NLXA 3DJCA 5AQTA 2VWBA 5BPMA 2A40A 4K42A 4PKHA 4O8KA 4FOEA 2CH6A 5ADXA 3CQXA 3UB5A 3CJAA 4MLEA 4PKIA 3GDQA 5FPEA 2ASMA 3H3NO 5AQUA 3C7NB 4KBOA 4FWRA 5AQHA 5AQGA 3GG4A 1KAXA 3P4IA 1KAYA 1GLLO 5AQMA 1YUWA 1NMDA 2E2NA 4RCHA 4BGAA 5LY3A 1TYQB 1LOTB 3WQTA 3BF1A 3VEZA 4BR0A 4CJ7A 5AR0A 2E2PA 5FPDA 3WXKA 1QZ5A 5AQYA 3BEXA 1LCUA 4BC3A 4E1JA 3LDOA 2YJFA 5AQJA 2YCHA 4JN4A 1QZ6A 4FWQA 5AQZA 2HOEA 2CGLA 3GE1A 4DHYA 1HLUA 2A5XA 3EO3A 3TU5A 4FWNA 5EVZA 3C0BA 4BRQA 1XUPO 3FR0A 1CZAN 4WQ4C 1Z6RA 3FLCO 4XH4A 2E1ZA 3MMVA 4PL8A 2YI1A 3VESA 2P9KA 3ZX3A 4H0TB 3FGUA 3O80A 3VF4A 4B1WB 3ULEA 4CZEA 3QMLA 4PKGA 1GLEG 4B9QA 4O5FA 4CZIA 3VF6A 3RSEB 4AM7A 4GY2B 2D0OA 3L4IA 4H5WA 4NB4A 2BTFA 4FPAA 3ZEUA 3UE5A 4FWOA 3M3ZA 3QFUA 5AQOA 5ADXH 1HKBA 4IZ9A 3U4LA 2P9PA 3TPQA 1BOTO 1U2VB 2HF3A 2V7YA 2ZGYA 4EIAA 4BC2A 2ASPA 3S41A 2QWNA 1NM1A 4WQ4A 3CI5A 4BQZA 2P9LB 1XC3A 4PL7A 3VERA 5AFUA 4CZKA 3QFPA 2P9KB 3O5BA 3CIPA 4CZFA 3KVGA 1DEJA 5AZJB 4QS7A 5KPZA 3W0LA 1BUPA 3IMXA 3WXLA 3CQYA 4IJAA 4H5RA 4Z94A 1KAZA 3H46O 1EQYA
chains in the Genus database with same CATH superfamily
3AO2A 1XNQK 4JKBA 2VYPA 5AQVA 4JHDB 2P9IB 2IVPA 2VCPA 1E4GT 1ZBLA 1YIJN 3ZT0A 3A5MC 1S72N 4CF1A 4DFJA 3WXIA 5KPTA 2A41A 4DU1A 1BHLA 3QICA 4ID5A 4GKKK 3ZX0A 3C7NA 3MN9A 3C94A 5AQLA 3LAMA 3CMEN 3LZIA 1NOZA 1X9MA 4OO1J 3QIPA 1J5EK 5BRHA 3PX0A 2E6LA 3CD6N 2V52B 1KQSM 2GWKA 1R59O 4RWTA 4M3YA 5AQSA 4NLBA 3A0IX 3J7ZO 3MN5A 1N34K 5GINA 3QEWA 3VENA 1NK6A 1VK0A 4FSVA 1RDBA 5AFUH 1QVFM 2D0PA 2ZM6K 1BI4B 1VQ5N 3DWLA 3OHRA 4B1ZA 3ID8A 4NO7A 2E20A 4ID1A 4DSJA 1DT9A 2G8UA 3DLHA 3OS1A 4DCHA 3L3VA 3HRGA 3KK7A 2A42A 1SKSA 5AQIA 2X78A 1HYZA 1MA9B 4DR5K 1U48A 2IS3A 2P9LA 1TUUA 4A62A 4E19A 4DKWA 4FPBA 3LDQA 4BRPA 1S6QA 3ENOA 4CF9A 1G99A 3O9QA 1TL3A 1U04A 3AARA 3ZCMA 5AZIA 1T6DA 4IG3A 4H5VA 3R1XA 4JKFA 3VEWA 4X62K 1QSYA 3RSEA 2HHVA 4NYFA 4C8OA 2JWLA 4ISFA 5KQ8A 3SMSA 1WSJA 3QINA 4FJMA 2OTJN 1XI1A 3QEXA 3RTVA 4K43A 4QOZB 1V4SA 3CETA 1L3TA 4QS9A 4B3SK 3FZFA 2YHXA 4UQGA 1KRPA 1IJJA 4FLYA 3T1HK 4CEOA 4H8KA 4Z0UA 3DMJA 1SL2A 3TARA 2P9PB 1B92A 5CR4A 4C1NK 1BIUA 1VHXA 5HBMA 2QKBA 2A6AA 1EX4A 2YX6A 1GLFO 5C2DA 3E01A 2W40A 3KJVA 3CG7A 4F3OA 1VQMN 4CF2A 2Q2RA 2P5GA 4A61A 4HVJA 2O4IA 2OPRA 3KIOA 3OS2A 4CCHA 1Q9YA 1E3MA 1HKCA 1OH7A 2HHQA 1RT1A 1T03A 1JLEA 4CD1A 1ATRA 2W42A 4GVMA 2BDPA 3O3HA 3CHWA 4BRHA 1JLCA 3HK2A 4CJ5A 1KVBA 1NU0A 4KTWA 2YHBA 1DKGD 5BN9A 4LF8K 4O44A 2OYQA 1TV6A 4AHTA 3AA3A 4FJ7A 4H0VB 4NCAA 3CERA 3AO5A 3P5JA 2E88A 3OBYA 3LL3A 4KB0A 2VWJA 1ITGA 1FK9A 3CJ7A 1DLOA 3BY5A 5DMRA 3HSCA 4J2DA 3VPZA 1QHAA 1LW0A 2GELA 3DLGA 4QS8A 1HNZK 3CJBA 4E1NA 5KQDA 3CJ9A 1VSDA 3A5OC 3CYMA 4I6MA 4B8CA 3TSQA 3RR7A 4OPJA 2HMIA 3BDPA 1WNSA 2KW4A 3QESA 3SAHA 3SLCA 3KLHA 4CZJA 2YNGA 4CW7B 2V51B 5K14A 4B3TK 1KFDA 3L4QA 1HYSA 4GVEA 4CJLA 5LL6Z 3ZETA 3ZSZA 4DV2K 4CHQA 3THXB 1SZ2A 3TAPA 1Z05A 2KQ2A 4FZXC 4DV5K 3NMUA 5SZTA 3WNHA 1VSEA 2HMPA 3D2FB 3DXKA 1Q9XA 4J2EA 3OYBA 2EWSA 3EZWA 3LP1A 2FBTA 3I56N 3OVNA 4BRGA 4MO5A 4Q0BA 4DS5A 3MAQA 2OPQA 2Q31A 3NF6A 1HKGA 3G25A 3VQPA 1T05A 4IOAL 4ISEA 3O8MA 5MLCQ 3SV4A 4B9UA 1HX1A 3VEVA 1NGJA 5AQKA 4CF8A 1W0HA 4FO0A 5HRRA 2NZTA 3MN6A 3O1BA 1VQLN 2VGNA 2OZSA 1Q81O 4DLEA 4WQ5C 2HHSA 4O0JA 3T19A 4A2BA 2IVOA 4CHYA 1LAWA 1TAQA 4J2BA 3TAFA 1HPZA 5CZ1A 2QM1A 2P5OA 1HNIA 1BWFO 4FL9A 1TGOA 4KH6A 3AVFA 3OYAA 3SNNA 1G15A 4MDBA 3DLBA 3BGRA 3SUPA 4JKGB 3V1QA 1J6ZA 1KCFA 1IG8A 3GOIA 3CF5L 1UA0A 3RWUA 2O8EB 2RHKA 4AHUA 1VQKN 1ATSA 3ZLJA 1W9HA 3PX4A 4HUEA 4JNEA 5AQPA 1W97L 2P51A 1RDCA 3AVIA 2FBVA 4Y0WA 1X3MA 4BVPA 4MO4A 1NK7A 4XEIA 3AVJA 4CBXA 1YAGA 3H3OB 3LDLA 3L2QA 3Q7BA 2UXBK 2F8TA 5J2NA 4HUGA 4B9MA 4M41A 4WFBL 3KZBA 4BDPA 1Y64A 1LAVA 1U47A 1SQKA 3OYCA 4KPYA 3WNEA 3O4WA 1C0UA 3DJCA 3CCSN 4CEEA 4FOEA 5ADXA 3TSUA 3O9SA 3M8RA 1S1UA 3OTOK 1UAXA 4CJPA 2NRXA 2XRIA 3CJAA 2W6LA 3GDQA 2ASMA 3H3NO 3SAGA 5T7BA 5HL7L 3GG4A 3CQ8A 4JEPA 1NJXA 2G8FA 4RG8A 4NYNA 4LY7A 5JS1A 3VEZA 2QKKA 4CJ7A 3WXMB 2NRVA 1VSFA 3MX5A 2KLAA 2QK9A 3BEXA 4BC3A 3CXCM 3AGRA 2E4LA 3VN5A 3LALA 4DWIA 3OBWA 3L2RA 4IG0A 2CGLA 3GE1A 5A2QO 1HLUA 3EO3A 1ZBFA 4CHZA 3QLHA 5I42A 1L3UA 3FR0A 3KKSA 3PUFA 4YOXA 3AA4A 4KHUA 1VRUA 2P9KA 4H0TB 1KC8O 4A5AA 4J2AA 4E7JA 4B1WB 4CEBA 3ULEA 3L2VA 4FCYA 1GLEG 3SV3A 3V9ZA 4ILJA 4O5FA 1HNWK 3VF6A 1C0MA 3NGZA 4GY2B 2IAJA 4H5WA 1CLQA 4RW6A 2UUCK 1T7PA 2KKZA 3HPHA 4Z4HA 3QFUA 3SQ4A 5FRMA 3V4IA 2P9PA 4E3SA 2IC3A 1U2VB 2V7YA 2ZGYA 4EIAA 1HMVA 2JGUA 4DSIA 1NM1A 3RVCA 3SUOA 3CI5A 3OA9A 3VERA 3QFPA 1WLJA 2P9KB 3IG1A 4CJFA 2X74A 4FYDA 4FK0A 1YTAA 1FJGK 1SL0A 3KVGA 5DM7L 1DEJA 1Y97A 4GV6A 5KPZA 5KGXA 3W0LA 4CGIA 1HR0K 4Z94A 3C65A 4KB1A 1TKZA 3THWA 1VSLA 2HHHK 4BRAA 5KPRA 2CH5A 4HTLA 4BE1A 1MDUB 3HYFA 4KREA 4K41A 2YNFA 3LM9A 3G71N 4Y1CA 4EP4A 4ZTFA 1QSSA 4E7LA 4KRFA 1NK8A 1BQNA 3MK6A 4K25A 3KKRA 4CVNE 4LF4K 1BA0A 5FPNA 4C23A 4CGJA 2DPNA 5GAHP 4M45A 2UUAK 3OS0A 1U45A 3E66A 4FLXA 4O5BA 3NVKA 1C0FA 4DTRA 4DTNA 2HBKA 2DFHA 4X65K 4A2AA 3OYIA 3VGKA 4IFYA 3D2EA 1TKTA 4U7BA 3MX2A 3MCAB 3I8DA 1YJ9N 2XHBA 2QWOA 2JWKA 3VEYA 5BRDA 3CC4N 4KHQA 1LWFA 3A5NC 3FZMA 4OVLA 3V9XA 3MXIA 4DLGA 1M90O 1WBBA 2E5LK 3KK1A 3HZ6A 4DQRA 3DXMA 2VG6A 4OLAA 4LFCK 3NDKA 3BP8A 5C15A 3S9HA 3SQ0A 5I3UA 3EKSA 1ASWA 3T7ZA 4BQLA 1CZ9A 3M8PA 1QHTA 1SS6A 3SYZA 4CJEA 4CHPA 2O8EA 3LDSA 2P9SA 3CCUN 2PAVA 3J80O 1B9DA 2WBNA 3P31A 2VG7A 5M1NA 2GTDA 3QBWA 3DM2A 5C24A 4DU3A 2FF6A 4LSNA 2KFNA 4AH9A 4FM2A 4GNIA 1TK0A 1JCGA 2QWRA 1TKXA 1WSFA 3ZEUB 1IKXA 2ZF5O 3THYA 1NGFA 4YOWA 4DR6K 1YITN 4FM0A 2E8AA 4CK2A 3SBGA 1WSIA 3MEDA 4WCEL 4DFMA 1L3SA 2AA4A 3ZT4A 2VQFK 4DV4K 1NGAA 2AP1A 3QO9A 2WOMA 3ENHA 3AVLA 1EKEA 5SWMA 3ATUA 5C10A 4CJSA 3EN9A 3DLKA 2UYTA 3EL2A 5DM6L 2IIRA 2YKNA 5C12A 3R3LA 2HVHA 2OPPA 4EZ9A 4KI4A 2GV9A 1S5JA 1VSJA 2BGGA 3QEVA 4BC4A 1HQEA 4DTOA 2W41A 1ZC6A 1NJYA 1HQUA 3LDNA 5M1FA 1NK9A 4CK3A 4EAHD 1LWEA 3O6WA 5AQNA 2ASOA 2J4RA 2D5RA 3TSPA 3IDHA 4FJ8A 1C0TA 3HM8A 3WXJA 1BCOA 4A57A 4FWLA 2FF3B 4AHSA 2YJEA 1VSMA 3VQ4A 3VA3A 4FZYA 3ZSRA 5E41A 3U8XA 1RILA 1GLAG 1T3VA 5BR9A 2HNZA 4AQYK 4JI6K 4XIUA 4DV0K 1NGEA 3SUNA 5HLFA 3CM6A 1IBLK 1JLQA 1J53A 4LD0A 1TYQA 4WYBA 5JLHA 2HHXA 1BG3A 2F7TA 1NK4A 1DTQA 3L6QA 2XY8A 1Z26A 2BUPA 4NCBA 3QEIA 1YVNA 1VSKA 1EXQA 4HHTA 3UKRA 4DSKA 4CZLA 1D9FA 1SKWA 3T1AA 5C42A 3OYNA 3CCVN 4LH4A 4IO8A 3HVTA 3MECA 2O4GA 4JK8A 2QW9A 2G8WA 4F2SA 2YNIA 3VQDA 3LDPA 4KTZA 5AQQA 2IDOA 3B8AX 4V19S 4Z4EA 2LSNA 4IFVA 1NLVA 1NG9A 1S3XA 3BF3A 4FWSA 3KLGA 2FLOA 3U6FA 1F21A 3KWGA 3TI0A 3KWIA 1IBKK 2A1RA 3VGLA 3I33A 4AF1A 1IKWA 3UIQA 5BPNA 4BG8A 1H1VA 4BREA 4JYAK 2D1KA 1S1XA 4BR2A 1HJRA 2WUSA 5CZ2A 3KK2A 4JI8K 2HHTA 2Z1GA 3CPWM 3K59A 1NKBA 1NNEA 1XNRK 1RTJA 3QBXA 4CHNA 4NXNK 3L2UA 3IS9A 2ZQBA 2GWJA 3NF8A 1NGCA 1RBSA 5FPMA 4I7FA 5JVHL 3J7YP 2ATQA 3KHYA 1MWMA 1A5XA 1NJIO 5LJVA 3VTHA 5HP1A 1JCEA 3SI6A 3U9DA 1OVQA 1JLFA 4B9SA 4JKCA 4B3RK 1X9SA 5KGWA 4YY3K 1XMOK 2G8IA 5FDLA 4FLVA 1TL1A 3AV9A 2B6AA 4ELTA 1S1VA 2ITMA 5BRFA 4DUZK 4JRPA 1Q86O 1IKYA 1GOAA 2Q97A 5TKWA 1L3VA 3VQ7A 1KSPA 2Q0UA 4IFEA 4EHTA 1VQ7N 3RRHA 4BC5A 1WOQA 1C1BA 1WBDA 2FBYA 4M3XA 4CERA 1JXBA 1I39A 2D4WA 3F9KA 3WT0A 1X9JA 4CECA 2Z1HA 3VQ8A 5TKYA 4O0IA 2P9UB 5JICA 1JJ2M 4IDHA 2KHOA 1ZBHA 1FW6A 3U3GA 2O8FA 1RDAA 3DRSA 1T6CA 4DR4K 4B3OA 4EP5A 2UXDK 4QAGA 4JV5K 2RF2A 4I2PA 1X1PA 3R8EA 3J81O 1XWLA 1BCMA 4BWMA 3O9UA 3OYFA 2XO7A 2FSJA 2UU9K 4JAXA 3N4QA 4PHTX 5AQTA 3NH1A 4K42A 4JI4K 3LWMA 4O8KA 1KD1O 5HRNA 3OYGA 1WSEA 1OVYA 5FPEA 4YFUA 3TABA 1YJNN 4F3TA 5KTQA 1WSGA 3C7NB 4M3UA 4KBOA 1BQMA 3AVCA 3ASMA 1N36K 4EZ6A 2IOCA 3P4IA 3CC2N 3PIOL 2QTDA 1VQ6N 4DR1K 2EHGA 5AQMA 4RCHA 4BGAA 3WQTA 3HXMA 3J7AP 4BR0A 3OY9A 1LWCA 1JLAA 4DMNA 4KTQA 5JS2A 5AR0A 5KRTA 5IT9O 4DR2K 4ICLA 1J5OA 5AQYA 4X66K 2O8FB 4JN4A 3VQCA 3CCLN 4KHWA 2VG5A 4CF0A 4ZHRA 1Q82O 3WNGA 3K57A 4K8ZA 1S6PA 5LMUK 2EX3A 4NCGA 3C6HA 4KH4A 3C0BA 4BRQA 4WF9L 4FK4A 1XUPO 4W5OA 4PL8A 3VESA 4LF9K 3ZX3A 4DSEA 3KLEA 4PKGA 4FJKA 3Q7CA 2ITGA 4AHVA 1XHZA 3L4IA 1LV5A 4M3ZA 2NRZA 4KHNA 3CPEA 4CK1A 4FJJA 4FWOA 3ZSYA 1ASUA 2YHAA 5AQOA 5ADXH 3K5OA 4PY5A 4I9QA 3HOSA 2P1JA 1BOTO 4CHOA 4LF6K 4WE1A 3KLFA 3D6RA 3G0ZA 3S41A 3MEEA 4M3WA 4WQ4A 3HO1A 3F73A 4PL7A 4CZKA 3PLAA 3O5BA 1EETA 3LPTA 3EZ5A 4QS7A 4Y1DA 3RMCA 2KTQA 1BUPA 1U4BA 1JLGA 3CQYA 1P90A 1KAZA 3H46O 2F9TA 3AVNA 5H1SQ 1Z25A 1UWBA 4W5RA 5M1KA 4CFBA 4FWPA 3HPGA 1ATNA 3MEGA 2GEMA 4AHCA 5GAGP 2KZZA 2O8DA 2HVIA 2O8CA 3VQEA 4KAZA 1XMQK 3CCMN 1K8KB 2HNDA 3SPZA 4N5SA 2P9NB 3K5LA 3VMFB 2Y1IA 3AY9A 2Z1IA 4ZTJA 3AO4A 2ZGZA 3N4PA 4KV8A 4H5TA 1RBTA 2OANA 3CJ1A 1SL1A 2B4JA 1BIZA 3UKRB 4LF7K 3O1WA 3D7EO 2P9NA 1CZBA 4EFHA 3NE6A 4N76A 4CZGA 2O8CB 3O4QA 2O8DB 4FWMA 2IGIA 2HSTA 4C8MA 4G9ZA 5AQRA 1Q8IA 1S9GA 1DTTA 1TVRA 2ZD1A 2PYJA 2FXUA 2PFUA 3HT3A 4N47A 3SUQA 1SV5A 2F9WA 3BZKA 4DQ8A 4C8LA 2UXCK 3HPOA 1YI2N 1VQON 5CY4A 5C2FA 4JI5K 4CJKA 2GUIA 5J2MA 4BRDA 3VF2A 4H4OA 4FW1A 3OYJA 5DK5A 3P1GA 3ALYA 4JS5A 3VOVA 4OX9K 4KH5A 4CFCA 3HM9A 3ATVA 4F4KA 3QEPA 4FOIA 4YOUA 4FLUA 3K5MA 4F2RA 5GADP 2BE2A 3LZJA 1O1WA 4R5PA 1T44A 5BN8A 4LC9B 1N8RO 3PX6A 3OYMA 3V81A 3RR8A 3VEOA 4Z4CA 4F9OA 3S3NA 3W3DA 2E1YA 3NGYA 3EE8A 1UOCA 4DTPA 4FJ9A 1REVA 4RW8A 3O08A 2ZWHA 2OPSA 5F0XA 2I7PA 3ZSVA 4CJTA 3WEEB 3JAMO 3CC7N 3VA0A 3FFKB 2X6SA 4DR7K 1HYVA 5JMVA 4BG9A 4JKEA 1RBUA 4YNQA 4FJLA 1HPMA 2NRHA 5EY4A 1J9AA 4ELUA 4BR5A 2QXLA 4BE0A 2FBXA 2ETJA 4CZHA 2NRRA 3THYB 4BGBA 4M3RA 2OCEA 3M5RA 1U49A 4AM6A 1IKVA 3V9UA 4H4MA 5AJ3K 4BRLA 3SK3A 4K0KK 2E2QA 1N32K 1IO2A 1RDWX 4M7YA 3PV8A 2P9SB 5EOYA 1NKEA 2RN2A 1RTDA 4ILHA 4CI6A 4HUFA 3SQ2A 3QERA 3AAPA 4JS4A 1BDGA 3KLIA 3O9TA 5BPLA 1CXUA 1ZYQA 3KTQA 4OPHA 3K9JA 3UKUB 4C1NI 3T3FA 5HRSA 4JI2K 3DXMB 1I94K 2I7NA 1E4FT 4W5NA 1TUYA 3VTIA 4DUYK 5LMNK 1EO1A 1UA1A 5GIPA 4OJRA 3U9ZA 3LM2A 4CZMA 1RT3A 5AQFA 1GLJO 5GIOA 1YHQN 4CE9A 3H08A 4HWIA 3PY8A 4DR3K 5EX5A 3SCXA 1P8ZA 1QE1A 1BA1A 3PSIA 3SMPA 1D9DA 1J54A 4IDKA 4LSLA 2JLEA 5CYQA 3TAEA 3EEQA 3O9RA 4H0PA 3EE9A 4TSXA 3BUZB 5CHIA 4BRMA 4BRIA 3NH0A 4IWVA 2RE2A 4DU4A 2O8BB 3TWHA 5KI6A 3JS6A 5B8HA 4M7XA 1YXQA 3QIOA 3OW2M 1JL1A 5AQXA 1JCFA 4H0XB 4DQPA 1LW2A 4E0DA 3CM5A 4CEAA 1EWRA 1NGGA 4DV7K 3RMBA 3I0SA 2WTUA 4E7KA 1RT6A 3THWB 4KI6A 1OKJA 4OLBA 2G8HA 3K9KA 4DQSA 4DTXA 2NNWA 5E26A 4DB3A 1RTIA 3E9LA 1NGIA 3HOTA 1K9MO 3F5TA 3TR8A 3VQ5A 4DFKA 4B1YB 4PQUA 3HSTB 2DFFA 3MN7A 3DLRA 2HBJA 3HI0A 1GLDG 2DY4A 3IAYA 3HBTA 2X6NA 4BR7A 4BRKA 3AGKA 5BREA 2E6MA 1XHXA 3AAQA 1YT3A 3H6EA 5J2QA 3RMDA 4LF5K 3L8BA 3F9MA 2Y1JA 4FJHA 4BRCA 1WAFA 4B9LA 4BR4A 1M1KO 4OKKA 3NGIA 1VQNN 1ZBSA 2AJQA 4IEEA 4M3TA 4ELVA 4JRQA 3ULEB 3FZKA 3MCPA 4KHPK 4JK9A 4FLTA 5JLFA 4JD2B 3M8SA 2Q1NA 3QNNA 4BRFA 5M1PA 1HUXA 3SAFA 4JI7K 1JL2A 1HNVA 5E84A 1RDUA 3D0PA 3R6MA 2A3ZA 2YHWA 4H03B 3KD1E 3KD5E 3P83D 3A5LC 4JI0K 3IFRA 3ZT3A 3IUCA 3OJUA 1VAZA 4DQIA 3SBTA 3J8AA 2VWKA 4LFBK 1KLNA 4PUOA 3S3MA 4EHUA 4XH1A 4O8UA 3VEXA 1S9EA 3G4SN 2O8BA 1U6ZA 4DSLA 4ILGB 3HP9A 3D45A 3AVHA 1GOBA 4E89A 2NLXA 5BPMA 1L5UA 3NBPA 2G8KA 2CH6A 2KZMA 3O3FA 3CQXA 3UB5A 4MLEA 3T69A 2Z1JA 3AA2A 4QCLA 4O4GA 5AQUA 3CCQN 4OKEA 2PZSA 4JI3K 4FWRA 5AQGA 4OPKA 1KTQA 1FKPA 1KAYA 3LP2A 1YTUA 4GMJB 4WFNL 2E2NA 1YVUA 2D0AA 4Z4GA 1LOTB 3BF1A 4HCBA 2E2PA 3NAEA 4YOYA 4B08A 5FPDA 3WXKA 5HROA 1QZ5A 4IOCL 1CXQA 1LCUA 4NXMK 4E1JA 2YJFA 5AQJA 4KFBA 5C25A 3AVBA 4FWQA 5AQZA 2XY7A 2HOEA 3NVMA 4DHYA 3ENBA 4CEDA 1NMNA 3OYLA 2A5XA 3TU5A 1ILYA 4R79A 5EVZA 4CEFA 1CZAN 4I9LA 1TK8A 1Z6RA 3FLCO 4CGHA 2E1ZA 3OJSA 4G1QA 4DTSA 3OYHA 4GV3A 4CIFA 3L3UA 4E1MA 3TTDA 4NLCA 5FRNA 4RW4A 3P39A 3FGUA 3O80A 3ZSWA 4DV1K 4CZEA 3QMLA 1K6YA 5FLXO 1WAJA 4PWDA 3AA5X 1QQCA 4NB4A 3NFAA 2BTFA 4FPAA 4BWJA 3ZEUA 1NK0A 1WB9A 1EP4A 3UE5A 1N33K 1QSLA 3LANA 1HKBA 3E1YA 2HF3A 1I3AA 4Z4FA 4BDYA 3K5NA 4BC2A 2ASPA 3CCJN 1NKCA 2QWNA 3MWPA 4CIGA 1C6VA 1RCHA 3P38A 4CIEA 3IKMA 4DTJA 5AFUA 1NK5A 3THVA 4CEQA 3CIPA 4CZFA 1QTMA 4B8AB 3TANA 4CGDA 3HJFA 4OGEA 1KVAA 3WXLA 3LPUA 4H5RA 4IKFA 3NF7A 5HOOA 1VQ4N 4LH5A 1ESVA 3K0SA 1IBMK 2HNYA 1SAZA 3D2FA 3DXKB 1TK5A 3CMAN 2GUPA 1MWKA 4BACA 4IOXA 1ZBUA 5J2PA 2WFBA 4C8KA 4OPAA 3D2EB 1QQNA 5F2RA 4BDZA 3FZLA 3V1OA 3DLLL 4JKDA 1K73O 3IRXA 3S3OA 4DF8A 1YF5L 3DRPA 4AHRA 3KK3A 1BGXT 4FJ5A 3R9PA 1ASVA 3PO5A 1NJWA 4M42A 3DOKA 2QWQA 4XH5A 2QI2A 3JXUA 1NGBA 5KRSA 3MXMA 4I6MB 2E2OA 1FXXA 3FFIA 2UUBK 1WUAA 4B9VA 3CFOA 1WN7A 4RW7A 3G6EN 1JLBA 1V4TA 4YORA 4CJWA 2D0BA 1OH8A 1JXEA 3FE1A 3M6GA 2Q0RA 4CESA 1HNXK 3DYAA 3TAGA 1GLBG 4B1UB 2R7YA 1N5YA 2FSNA 4X64K 2QWPA 4CFAA 1VQ9N 4L3QA 3JYTA 3VQQA 3L2WA 5GAEP 1SUQA 2HBMA 5EU7A 1RT7A 4FVUA 2IVNA 3V6DA 4IBNA 1K8KA 1D5AA 2QWLA 1QQMA 5HRPA 4KHSA 4JD2A 1BISA 2HHUA 5AQWA 1VSHA 1YJWN 3AVKA 1KXPA 2BH1A 1ZXOA 1RT5A 2VQEK 3AO3A 3NF9A 1NOYA 1WSHA 3G10A 1U2VA 3VQAA 4FVMA 4FLWA 1T8EA 2H3GX 2NUBA 4B9NA 3WNFA 1O13A 4I2QA 1Q18A 1XQSC 3ISNC 3ZX2A 1ZBIA 4WQ5A 4CBUA 4J8FA 3ZSOA 5CE3A 1RTHA 3GBTA 4CJQA 4DF4A 4FWKA 1BL3A 1OH5A 3H45C 1A5VA 4H0YB 2PBDA 3RMAA 3A8YA 1RBRA 4K8XA 2YKMA 4CJ3A 3SJHA 4RTFD 3LP3A 4YDUC 1BU6O 3CCRN 5AZIB 2ZJQL 4JLHA 3V9WA 3CCEN 3HTVA 5BR8K 1RFQA 2HW3A 4WFAL 5LJWA 1NGHA 4H0OA 4KKOA 2WONA 1NBWA 4Z4IA 4BVOA 2QEXN 4L8RB 3B6OA 4FXDA 2XY5A 1KLMA 4YOVA 4CD3A 2YV0X 4B1XB 2PYLA 3M1FA 3K58A 2HB5A 2FSKA 4BROA 3VGMA 4DS4A 4MDAA 3AVMA 4B1VA 3O3GA 5ELZA 5C0YA 1VSIA 3VQ9A 2XY6A 4HCCA 4JK7A 1RGIA 4KO0A 5I9EB 5M1OA 2DTUA 3OYDA 3TTFA 4W5TA 3EKUA 4U67L 3F2KA 2GBZA 3DLEA 1EWQA 3A2FA 3QB0A 2DFEA 1S1TA 3TAMA 3NHGA 2CGJA 1X9WA 3QETA 3UKUA 3JSMA 3BZCA 1C0GA 1DGKN 1RT4A 4CJUA 1B9FA 5M1QA 2HF4A 3M8QA 1R0AA 4MQ3A 4E7HA 4YDUA 1NGDA 2YNHA 1C1CA 3ZSXA 2ZJPL 3H1QA 3LAKA 1RBVA 3E9PA 1S1WA 1JKHA 4F8RA 3DI6A 1IH7A 1KFSA 2P9IA 4FK2A 3I8BA 4JHDA 4GKJK 3NCIA 3O4NA 1HRHA 2KFZA 3DOLA 4JKGA 3DAWA 2QWMA 4B3MK 3MXJA 4BRNA 4DQQA 1QQOA 4DG1A 4BR9A 4CJ4A 2P9UA 3CJCA 3C6AA 1D8YA 4FJIA 4CJVA 5AZJA 4CEZA 3MDQA 2QXFA 3PSFA 3L0QA 5JVGL 4H5NA 2ZE2A 2V7ZA 2D0CA 2NRWA 3VQBA 5CYMA 3FZHA 3WEEA 1Q7YO 1GLCG 4FZZA 3EY1A 2RKIA 4M63C 4DTMA 3WUHA 1BO5O 4JI1K 4CBWA 3ID6A 3ZYYX 3QDKA 4FW2A 4B9TA 3WQUA 3ZT1A 3GL1A 3AO1A 2HHWA 4DSFA 1X3NA 1D4XA 4DV3K 3TTCA 1C1AA 4ISGA 1GOCA 3THXA 5F1XA 2F96A 2YHYA 2I5JA 1RDDA 2NRTA 3ZETB 3HL8A 4OGCA 3NH2A 2WC9A 4MLHA 1VQ8N 4UY8O 4FM1A 4FLZA 3ITHA 3VETA 2Q36A 1HJOA 4W5QA 5EXWA 3OYKA 2PY5A 3AVAA 2F8SA 3H1VX 1A5WA 3E9OA 1NWKA 1RT2A 4KHYA 2CGKA 1MU2A 4O55A 4IJNA 4RW9A 1K8AO 3C6UA 4HTUA 5FROA 4CGFA 2W6KA 4IXCA 2RPIA 1RNHA 3ZSQA 3SZ2A 4JKAA 1S22A 3CFPA 3B6PA 4FJXA 2VWBA 2A40A 4PKHA 4A5BA 4OKJA 3AVGA 4PKIA 2Q3SA 3EYZA 5IWAK 3MWTA 4YOTA 2G8VA 5AQHA 1FKOA 1KAXA 4FJNA 3TAQA 5D3GA 4CFDA 1QS4A 3K2PA 3SJJA 4FJGA 1GLLO 1SKRA 1YUWA 1NMDA 4JKHA 5LY3A 1TYQB 4PA1A 2OA8A 2BANA 3RRGA 4BE2A 3LDOA 2YCHA 4AILC 1QZ6A 3QNOA 4MFBA 1IV0A 2VGMA 3OYEA 2FC0A 4N56A 2OTLN 1QVGM 3DRRA 2ZJRL 1W7AA 4FWNA 3PO4A 1OH6A 4DFPA 4LFAK 3ZT2A 4WQ4C 3LP0A 4XH4A 4N41A 3MMVA 1IG9A 4IEIA 2YI1A 2HBLA 4A59A 3LWLA 3SQ1A 3VF4A 4YHHK 4E7IA 2OZMA 2F4VK 4B9QA 4CZIA 3CFRA 3RSEB 4DTUA 4AM7A 1XC9A 2D0OA 3V1RA 3I55N 2B5JA 4Q5VA 1W2BM 5J1EA 2GX9A 1TAUA 3I0RA 3M3ZA 3U3YA 4BY9C 4IZ9A 3U4LA 2QA4N 1NJZA 3TPQA 2A1SA 1N6QA 4CJRA 3T1YK 3PIPL 4CGGA 4BQZA 2P9LB 1TKDA 1XC3A 3HP6A 3VQ6A 4DV6K 1KVCA 3HVRA 3V9SA 5AZJB 4C8NA 3C95A 1VQPN 4GW6A 3ULDA 3IMXA 3C6TA 4IJAA 3SPYA 1BI4A 1EQYA 4IO9L 1VRTA 4GV9A
chains in the Genus database with same CATH topology
1VQ4N 1ESVA 4BRAA 4JKBA 2VYPA 2F9TA 5AQVA 5KPRA 4JHDB 2CH5A 5H1SQ 4HTLA 1SAZA 3D2FA 3DXKB 1MDUB 2P9IB 3CMAN 2IVPA 2GUPA 1MWKA 2VCPA 4IOXA 5M1KA 4K41A 1E4GT 3LM9A 4FWPA 3G71N 2WFBA 1YIJN 4OPAA 1ATNA 2GEMA 3D2EB 5GAGP 3A5MC 1QQNA 1S72N 3MK6A 4K25A 5F2RA 3WXIA 3CCMN 1K8KB 3FZLA 5KPTA 2A41A 2P9NB 3VMFB 3QICA 3DLLL 1BA0A 3AY9A 4JKDA 1K73O 5FPNA 4C23A 3ZX0A 2ZGZA 3N4PA 3C7NA 3MN9A 1YF5L 4H5TA 5AQLA 2DPNA 2OANA 3R9PA 3CMEN 5GAHP 3CJ1A 4OO1J 3E66A 2QWQA 4XH5A 3NVKA 3UKRB 1C0FA 3O1WA 2QI2A 3D7EO 2HBKA 3JXUA 2P9NA 1NGBA 5BRHA 4EFHA 4A2AA 4I6MB 2E2OA 3CD6N 2V52B 4CZGA 1KQSM 2GWKA 3VGKA 4FWMA 1WUAA 3D2EA 2HSTA 4U7BA 1R59O 4RWTA 3G6EN 3MX2A 5AQSA 4NLBA 3MCAB 4G9ZA 3A0IX 1V4TA 4YORA 1YJ9N 5AQRA 3J7ZO 3MN5A 3CC4N 2QWOA 2JWKA 3VEYA 5BRDA 3FE1A 3M6GA 5GINA 3A5NC 3FZMA 3VENA 4FSVA 5AFUH 2FXUA 2PFUA 2Q0RA 1M90O 1QVFM 1GLBG 2D0PA 2F9WA 4B1UB 3HZ6A 4DQ8A 1VQ5N 3DWLA 3DXMA 2FSNA 3OHRA 2QWPA 1YI2N 1VQON 1VQ9N 4L3QA 4B1ZA 3ID8A 5C2FA 4NO7A 2E20A 1DT9A 4BRDA 3VF2A 5GAEP 2HBMA 4DCHA 3BP8A 5C15A 3HRGA 4FVUA 2IVNA 3KK7A 3VOVA 2A42A 3EKSA 1K8KA 2QWLA 4KH5A 1QQMA 3T7ZA 4BQLA 3ATVA 5AQIA 4FOIA 4YOUA 1SS6A 1MA9B 4JD2A 5AQWA 3CCUN 2P9SA 2P9LA 1YJWN 1TUUA 1KXPA 2BH1A 4A62A 5GADP 1ZXOA 2PAVA 4DKWA 4FPBA 2WBNA 3P31A 1T44A 3LDQA 5BN8A 4LC9B 5M1NA 2GTDA 1N8RO 4BRPA 3QBWA 1U2VA 3ENOA 1G99A 2FF6A 3O9QA 3VEOA 4GNIA 3AARA 1JCGA 4F9OA 2QWRA 5AZIA 2H3GX 1T6DA 3W3DA 4H5VA 3ZEUB 2E1YA 2ZF5O 1NGFA 3EE8A 3R1XA 4JKFA 1O13A 3VEWA 4YOWA 3RSEA 3O08A 2ZWHA 2JWLA 4ISFA 5KQ8A 1Q18A 1XQSC 2I7PA 3SMSA 5F0XA 1YITN 2E8AA 3WEEB 3ZX2A 2OTJN 4WQ5A 3SBGA 4WCEL 3CC7N 2AA4A 4CBUA 4J8FA 3FFKB 4K43A 5CE3A 1NGAA 1V4SA 2AP1A 3CETA 3ENHA 4QS9A 3GBTA 5JMVA 3ATUA 5C10A 3FZFA 2YHXA 4FWKA 4BG9A 1IJJA 4JKEA 3EN9A 1HPMA 2NRHA 2UYTA 3H45C 4H0YB 2PBDA 5EY4A 4BR5A 2QXLA 3A8YA 3EL2A 5DM6L 2P9PB 4CZHA 2IIRA 2NRRA 5CR4A 4BGBA 3R3LA 5C12A 3SJHA 4C1NK 3M5RA 4RTFD 4YDUC 1BU6O 3CCRN 5AZIB 2A6AA 2ZJQL 2YX6A 4BC4A 4AM6A 1GLFO 2W41A 1ZC6A 5C2DA 2W40A 3CCEN 3HTVA 4BRLA 1VQMN 3SK3A 3LDNA 1RFQA 2E2QA 5M1FA 2Q2RA 4WFAL 5LJWA 4EAHD 3O6WA 4A61A 1NGHA 1RDWX 4H0OA 4M7YA 5AQNA 2P9SB 5EOYA 2ASOA 1HKCA 2J4RA 3TSPA 1NBWA 4ILHA 4CI6A 4BVOA 3IDHA 3AAPA 2QEXN 1BDGA 3HM8A 3WXJA 4CD1A 1ATRA 4YOVA 4CD3A 3CHWA 4BRHA 4A57A 4FWLA 4B1XB 3O9TA 5BPLA 1DKGD 5BN9A 3M1FA 2FF3B 4OPHA 3K9JA 3UKUB 4C1NI 2YJEA 2FSKA 4BROA 3DXMB 3VGMA 4H0VB 2I7NA 1E4FT 4MDAA 1TUYA 3CERA 3VTIA 2E88A 3OBYA 1EO1A 5GIPA 3LL3A 3U8XA 3U9ZA 1GLAG 1T3VA 3LM2A 4B1VA 5BR9A 3CJ7A 5ELZA 4CZMA 5C0YA 5AQFA 4JK7A 1RGIA 1NGEA 5I9EB 1GLJO 5GIOA 1YHQN 5M1OA 3HSCA 3TTFA 4HWIA 1TYQA 3VPZA 3EKUA 1QHAA 4WYBA 2GELA 5JLHA 4QS8A 5EX5A 1BG3A 3CJBA 2F7TA 5KQDA 3CJ9A 3A5OC 3L6QA 4I6MA 3F2KA 2BUPA 3TSQA 4U67L 1YVNA 1P8ZA 1BA1A 3QB0A 3SMPA 3UKRA 4CZLA 2CGJA 3SAHA 3SLCA 4CZJA 3CCVN 3UKUA 4IO8A 1C0GA 2V51B 1DGKN 3O9RA 4H0PA 3EE9A 3L4QA 4JK8A 3BUZB 5M1QA 2HF4A 4GVEA 5CHIA 2QW9A 4BRMA 4YDUA 1NGDA 3ZETA 4BRIA 2ZJPL 3H1QA 3E9PA 3LDPA 1SZ2A 4IWVA 2RE2A 5AQQA 3B8AX 3JS6A 5B8HA 4M7XA 1NLVA 1Z05A 1YXQA 3NMUA 2P9IA 1S3XA 3OW2M 3I8BA 2HMPA 1JCFA 3D2FB 3DXKA 3BF3A 4FWSA 4H0XB 2FLOA 5AQXA 4JHDA 1NGGA 2EWSA 3EZWA 3KWGA 3KWIA 3I56N 4JKGA 3DAWA 2QWMA 4MO5A 4BRGA 3VGLA 2Q31A 3I33A 4BRNA 1HKGA 4AF1A 1QQOA 3G25A 1OKJA 4BR9A 4IOAL 5BPNA 4ISEA 3O8MA 2P9UA 3K9KA 4BG8A 1H1VA 3CJCA 3C6AA 4BREA 2NNWA 2D1KA 5E26A 4DB3A 5MLCQ 4BR2A 5AZJA 2WUSA 3E9LA 1NGIA 1HX1A 3HOTA 3VEVA 1K9MO 3MDQA 1NGJA 3F5TA 5AQKA 3CPWM 3L0QA 4B1YB 5JVGL 4H5NA 4FO0A 2NZTA 3MN6A 3O1BA 3QBXA 1VQLN 3MN7A 2VGNA 2V7ZA 1Q81O 2NRWA 2GWJA 2HBJA 4WQ5C 1NGCA 3HI0A 5FPMA 1GLDG 4A2BA 2IVOA 3FZHA 3WEEA 1Q7YO 5JVHL 3HBTA 4BR7A 1GLCG 4BRKA 2QM1A 3KHYA 3AGKA 1MWMA 5BREA 1BWFO 3AAQA 4M63C 3VTHA 5LJVA 1NJIO 4FL9A 3H6EA 4KH6A 1JCEA 3WUHA 1BO5O 3F9MA 4CBWA 4BRCA 3U9DA 4MDBA 3ID6A 3ZYYX 3QDKA 4JKCA 3WQUA 4JKGB 4BR4A 1J6ZA 1M1KO 1IG8A 3GL1A 1VQNN 1ZBSA 3GOIA 3CF5L 4IEEA 1X3NA 3ULEB 1D4XA 3FZKA 2ITMA 5BRFA 3MCPA 1Q86O 3TTCA 2Q97A 4JK9A 5TKWA 5JLFA 2RHKA 4ISGA 4JD2B 2Q0UA 4IFEA 4EHTA 5F1XA 2Q1NA 1VQ7N 1VQKN 4BC5A 1ATSA 1WOQA 2YHYA 4BRFA 2NRTA 3ZETB 4JNEA 5AQPA 1W97L 2D4WA 1HUXA 5M1PA 3SAFA 3WT0A 1X9JA 2WC9A 4MLHA 5E84A 1VQ8N 1RDUA 4UY8O 3R6MA 5TKYA 2A3ZA 2YHWA 4H03B 2P9UB 4Y0WA 1X3MA 4BVPA 5JICA 1JJ2M 4IDHA 4MO4A 2KHOA 3VETA 3A5LC 2Q36A 4XEIA 1HJOA 3IFRA 5EXWA 3IUCA 1VAZA 4CBXA 3H1VX 1YAGA 3E9OA 3SBTA 3H3OB 3LDLA 1NWKA 3J8AA 1T6CA 2CGKA 3Q7BA 4IJNA 4EHUA 4XH1A 3R8EA 1K8AO 4O8UA 4WFBL 3KZBA 3VEXA 1Y64A 3G4SN 1U6ZA 4ILGB 3O9UA 4IXCA 1SQKA 2FSJA 4JKAA 4JAXA 1S22A 3N4QA 3O4WA 4PHTX 2NLXA 3DJCA 5AQTA 2VWBA 5BPMA 2A40A 4K42A 4PKHA 4A5BA 3CCSN 4O8KA 4FOEA 2CH6A 5ADXA 3TSUA 3O9SA 1KD1O 3CQXA 3UB5A 2NRXA 3CJAA 4MLEA 4PKIA 3T69A 1OVYA 3GDQA 5FPEA 1YJNN 2ASMA 3H3NO 3MWTA 5AQUA 4YOTA 3C7NB 3CCQN 4KBOA 3SAGA 5HL7L 4FWRA 5AQHA 5AQGA 3GG4A 1KAXA 4JEPA 3P4IA 3CC2N 1KAYA 3PIOL 2QTDA 1VQ6N 1GLLO 5AQMA 1YUWA 1NMDA 4WFNL 4JKHA 2E2NA 4RCHA 4BGAA 5LY3A 1TYQB 1LOTB 3WQTA 3BF1A 3VEZA 4BR0A 4CJ7A 3WXMB 2NRVA 2E2PA 5AR0A 4YOYA 5FPDA 3MX5A 3WXKA 1QZ5A 2KLAA 5AQYA 4IOCL 3BEXA 1LCUA 4BC3A 4E1JA 3LDOA 2YJFA 3AGRA 2YCHA 4JN4A 5AQJA 3CXCM 1QZ6A 3CCLN 2VGMA 4FWQA 5AQZA 1Q82O 3OBWA 2HOEA 2CGLA 3GE1A 3NVMA 4DHYA 3ENBA 1HLUA 1QVGM 2OTLN 2A5XA 3EO3A 3TU5A 2ZJRL 1ILYA 4R79A 4FWNA 3C6HA 4KH4A 5EVZA 3C0BA 4BRQA 4WF9L 1XUPO 3FR0A 1CZAN 4WQ4C 1Z6RA 3FLCO 4XH4A 4YOXA 2E1ZA 3MMVA 4PL8A 4IEIA 2YI1A 3VESA 2HBLA 4GV3A 4A59A 2P9KA 3ZX3A 3TTDA 4NLCA 4H0TB 1KC8O 4A5AA 3P39A 3FGUA 3O80A 3VF4A 4B1WB 3ULEA 4CZEA 3QMLA 4PKGA 1GLEG 4B9QA 4ILJA 4O5FA 4CZIA 3VF6A 3RSEB 3Q7CA 4AM7A 4GY2B 2D0OA 3L4IA 3I55N 4H5WA 4NB4A 2NRZA 2BTFA 4FPAA 3ZEUA 1W2BM 2GX9A 3CPEA 3UE5A 4FWOA 2KKZA 3M3ZA 3QFUA 5AQOA 5ADXH 4BY9C 1HKBA 4IZ9A 3U4LA 2P9PA 3HOSA 2QA4N 3E1YA 3TPQA 1BOTO 1U2VB 2HF3A 2V7YA 2ZGYA 4EIAA 3D6RA 4BC2A 2ASPA 3CCJN 3PIPL 3S41A 2QWNA 3MWPA 1NM1A 3RVCA 4WQ4A 3CI5A 4BQZA 2P9LB 3P38A 3IKMA 3OA9A 1XC3A 4PL7A 3VERA 5AFUA 4CZKA 3PLAA 3QFPA 2P9KB 3O5BA 3CIPA 4CZFA 3KVGA 5DM7L 1DEJA 5AZJB 4QS7A 4GV6A 1VQPN 5KPZA 3W0LA 1BUPA 3IMXA 3WXLA 3CQYA 4IJAA 1P90A 4H5RA 4Z94A 3C65A 1KAZA 3H46O 1EQYA 4IO9L 5HOOA 4GV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESV A;  4BRA A;  2VYP A;  2F9T A;  5AQV A;  5KPR A;  4JHD B;  2CH5 A;  4HTL A;  1SAZ A;  3D2F A;  3DXK B;  1MDU B;  2P9I B;  2IVP A;  2GUP A;  1MWK A;  2VCP A;  4K41 A;  1E4G T;  3LM9 A;  4FWP A;  1ATN A;  2GEM A;  3D2E B;  3A5M C;  1QQN A;  3MK6 A;  4K25 A;  5F2R A;  3WXI A;  1K8K B;  3FZL A;  5KPT A;  2A41 A;  2P9N B;  3QIC A;  1BA0 A;  3AY9 A;  5FPN A;  4C23 A;  3ZX0 A;  2ZGZ A;  3C7N A;  3MN9 A;  4H5T A;  5AQL A;  2DPN A;  2OAN A;  3R9P A;  3CJ1 A;  2QWQ A;  4XH5 A;  3UKR B;  1C0F A;  3O1W A;  3D7E O;  3JXU A;  2P9N A;  1NGB A;  5BRH A;  4EFH A;  4A2A A;  4I6M B;  2E2O A;  2V52 B;  4CZG A;  2GWK A;  3VGK A;  4FWM A;  1WUA A;  3D2E A;  1R59 O;  4RWT A;  5AQS A;  3A0I X;  1V4T A;  5AQR A;  3MN5 A;  2QWO A;  3VEY A;  5BRD A;  3FE1 A;  3M6G A;  3A5N C;  3FZM A;  3VEN A;  4FSV A;  5AFU H;  2FXU A;  2Q0R A;  1GLB G;  2D0P A;  2F9W A;  4B1U B;  3HZ6 A;  4DQ8 A;  3DWL A;  3DXM A;  2FSN A;  3OHR A;  2QWP A;  4L3Q A;  4B1Z A;  3ID8 A;  4NO7 A;  2E20 A;  4BRD A;  3VF2 A;  4DCH A;  3BP8 A;  2IVN A;  3VOV A;  2A42 A;  3EKS A;  1K8K A;  2QWL A;  1QQM A;  4BQL A;  3ATV A;  5AQI A;  4FOI A;  1MA9 B;  4JD2 A;  5AQW A;  2P9S A;  2P9L A;  1TUU A;  1KXP A;  4A62 A;  1ZXO A;  2PAV A;  4FPB A;  1T44 A;  3LDQ A;  5BN8 A;  4LC9 B;  2GTD A;  4BRP A;  3QBW A;  1U2V A;  3ENO A;  1G99 A;  2FF6 A;  3VEO A;  4GNI A;  3AAR A;  1JCG A;  4F9O A;  2QWR A;  5AZI A;  2H3G X;  1T6D A;  3W3D A;  4H5V A;  3ZEU B;  2E1Y A;  2ZF5 O;  1NGF A;  3VEW A;  3RSE A;  3O08 A;  2ZWH A;  4ISF A;  5KQ8 A;  1Q18 A;  1XQS C;  2I7P A;  3SMS A;  5F0X A;  2E8A A;  3WEE B;  3ZX2 A;  4WQ5 A;  2AA4 A;  4CBU A;  4J8F A;  3FFK B;  4K43 A;  5CE3 A;  1NGA A;  1V4S A;  2AP1 A;  3CET A;  3ENH A;  4QS9 A;  3GBT A;  5JMV A;  3ATU A;  3FZF A;  2YHX A;  4FWK A;  4BG9 A;  1IJJ A;  3EN9 A;  1HPM A;  2NRH A;  2UYT A;  3H45 C;  4H0Y B;  2PBD A;  5EY4 A;  4BR5 A;  2QXL A;  3A8Y A;  3EL2 A;  2P9P B;  4CZH A;  2IIR A;  4BGB A;  3SJH A;  4RTF D;  4YDU C;  1BU6 O;  5AZI B;  2A6A A;  4BC4 A;  4AM6 A;  1GLF O;  2W41 A;  1ZC6 A;  2W40 A;  3HTV A;  4BRL A;  3SK3 A;  3LDN A;  1RFQ A;  2E2Q A;  2Q2R A;  5LJW A;  4EAH D;  3O6W A;  4A61 A;  1NGH A;  1RDW X;  4H0O A;  4M7Y A;  5AQN A;  2P9S B;  5EOY A;  2ASO A;  1HKC A;  2J4R A;  1NBW A;  4CI6 A;  4BVO A;  3IDH A;  3AAP A;  1BDG A;  3HM8 A;  3WXJ A;  4CD1 A;  1ATR A;  4CD3 A;  3CHW A;  4BRH A;  4FWL A;  4B1X B;  5BPL A;  1DKG D;  5BN9 A;  3M1F A;  2FF3 B;  3UKU B;  2YJE A;  2FSK A;  4BRO A;  3DXM B;  3VGM A;  4H0V B;  2I7N A;  1E4F T;  1TUY A;  3CER A;  2E88 A;  3LL3 A;  3U8X A;  3U9Z A;  1GLA G;  3LM2 A;  4B1V A;  5BR9 A;  3CJ7 A;  5ELZ A;  4CZM A;  5AQF A;  1RGI A;  1NGE A;  5I9E B;  1GLJ O;  3HSC A;  4HWI A;  1TYQ A;  3VPZ A;  3EKU A;  1QHA A;  4WYB A;  2GEL A;  5JLH A;  4QS8 A;  5EX5 A;  1BG3 A;  3CJB A;  5KQD A;  3CJ9 A;  3A5O C;  3L6Q A;  4I6M A;  2BUP A;  1YVN A;  1P8Z A;  1BA1 A;  3QB0 A;  3SMP A;  3UKR A;  4CZL A;  2CGJ A;  3SLC A;  4CZJ A;  3UKU A;  4IO8 A;  1C0G A;  2V51 B;  1DGK N;  4H0P A;  3BUZ B;  2HF4 A;  2QW9 A;  4BRM A;  4YDU A;  1NGD A;  3ZET A;  4BRI A;  3H1Q A;  3LDP A;  1SZ2 A;  4IWV A;  5AQQ A;  3B8A X;  3JS6 A;  5B8H A;  4M7X A;  1NLV A;  1Z05 A;  1YXQ A;  2P9I A;  1S3X A;  3I8B A;  2HMP A;  1JCF A;  3D2F B;  3DXK A;  3BF3 A;  4FWS A;  4H0X B;  2FLO A;  5AQX A;  4JHD A;  1NGG A;  2EWS A;  3EZW A;  3DAW A;  2QWM A;  4MO5 A;  4BRG A;  3VGL A;  2Q31 A;  3I33 A;  4BRN A;  1HKG A;  1QQO A;  3G25 A;  1OKJ A;  4BR9 A;  5BPN A;  4ISE A;  3O8M A;  2P9U A;  4BG8 A;  1H1V A;  3CJC A;  4BRE A;  5E26 A;  2D1K A;  4DB3 A;  4BR2 A;  5AZJ A;  2WUS A;  1NGI A;  1HX1 A;  3VEV A;  3MDQ A;  1NGJ A;  5AQK A;  3L0Q A;  4B1Y B;  4H5N A;  4FO0 A;  2NZT A;  3MN6 A;  3O1B A;  3QBX A;  3MN7 A;  2V7Z A;  2GWJ A;  4WQ5 C;  1NGC A;  3HI0 A;  5FPM A;  1GLD G;  4A2B A;  2IVO A;  3FZH A;  3WEE A;  3HBT A;  4BR7 A;  1GLC G;  4BRK A;  2QM1 A;  3KHY A;  1MWM A;  5BRE A;  1BWF O;  3AAQ A;  4M63 C;  5LJV A;  4FL9 A;  3H6E A;  3WUH A;  1JCE A;  1BO5 O;  3F9M A;  4CBW A;  4BRC A;  3U9D A;  3QDK A;  3WQU A;  4BR4 A;  1J6Z A;  1IG8 A;  3GL1 A;  1ZBS A;  3GOI A;  1X3N A;  3ULE B;  1D4X A;  3FZK A;  2ITM A;  5BRF A;  3MCP A;  2Q97 A;  5JLF A;  4JD2 B;  4ISG A;  2Q0U A;  4EHT A;  5F1X A;  2Q1N A;  4BC5 A;  1ATS A;  1WOQ A;  2YHY A;  4BRF A;  3ZET B;  4JNE A;  5AQP A;  2D4W A;  1HUX A;  3WT0 A;  1X9J A;  4MLH A;  5E84 A;  3R6M A;  5TKY A;  2A3Z A;  2YHW A;  4H03 B;  2P9U B;  4Y0W A;  1X3M A;  4BVP A;  5JIC A;  4MO4 A;  2KHO A;  3VET A;  3A5L C;  2Q36 A;  4XEI A;  1HJO A;  3IFR A;  5EXW A;  3IUC A;  4CBX A;  3H1V X;  1YAG A;  3H3O B;  3LDL A;  1NWK A;  3J8A A;  1T6C A;  2CGK A;  4IJN A;  4EHU A;  4XH1 A;  3R8E A;  3KZB A;  3VEX A;  1Y64 A;  1U6Z A;  4IXC A;  1SQK A;  2FSJ A;  4JAX A;  1S22 A;  3O4W A;  2NLX A;  3DJC A;  5AQT A;  2VWB A;  5BPM A;  2A40 A;  4K42 A;  4PKH A;  4O8K A;  4FOE A;  2CH6 A;  5ADX A;  3CQX A;  3UB5 A;  3CJA A;  4MLE A;  4PKI A;  3GDQ A;  5FPE A;  2ASM A;  3H3N O;  5AQU A;  3C7N B;  4KBO A;  4FWR A;  5AQH A;  5AQG A;  3GG4 A;  1KAX A;  3P4I A;  1KAY A;  1GLL O;  5AQM A;  1YUW A;  1NMD A;  2E2N A;  4RCH A;  4BGA A;  5LY3 A;  1TYQ B;  1LOT B;  3WQT A;  3BF1 A;  3VEZ A;  4BR0 A;  4CJ7 A;  5AR0 A;  2E2P A;  5FPD A;  3WXK A;  1QZ5 A;  5AQY A;  3BEX A;  1LCU A;  4BC3 A;  4E1J A;  3LDO A;  2YJF A;  5AQJ A;  2YCH A;  4JN4 A;  1QZ6 A;  4FWQ A;  5AQZ A;  2HOE A;  2CGL A;  3GE1 A;  4DHY A;  1HLU A;  2A5X A;  3EO3 A;  3TU5 A;  4FWN A;  5EVZ A;  3C0B A;  4BRQ A;  1XUP O;  3FR0 A;  1CZA N;  4WQ4 C;  1Z6R A;  3FLC O;  4XH4 A;  2E1Z A;  3MMV A;  4PL8 A;  2YI1 A;  3VES A;  2P9K A;  3ZX3 A;  4H0T B;  3FGU A;  3O80 A;  3VF4 A;  4B1W B;  3ULE A;  4CZE A;  3QML A;  4PKG A;  1GLE G;  4B9Q A;  4O5F A;  4CZI A;  3VF6 A;  3RSE B;  4AM7 A;  4GY2 B;  2D0O A;  3L4I A;  4H5W A;  4NB4 A;  2BTF A;  4FPA A;  3ZEU A;  3UE5 A;  4FWO A;  3M3Z A;  3QFU A;  5AQO A;  5ADX H;  1HKB A;  4IZ9 A;  3U4L A;  2P9P A;  3TPQ A;  1BOT O;  1U2V B;  2HF3 A;  2V7Y A;  2ZGY A;  4EIA A;  4BC2 A;  2ASP A;  3S41 A;  2QWN A;  1NM1 A;  4WQ4 A;  3CI5 A;  4BQZ A;  2P9L B;  1XC3 A;  4PL7 A;  3VER A;  5AFU A;  4CZK A;  3QFP A;  2P9K B;  3O5B A;  3CIP A;  4CZF A;  3KVG A;  1DEJ A;  5AZJ B;  4QS7 A;  5KPZ A;  3W0L A;  1BUP A;  3IMX A;  3WXL A;  3CQY A;  4IJA A;  4H5R A;  4Z94 A;  1KAZ A;  3H46 O;  1EQY A; 
#chains in the Genus database with same CATH topology
 3AO2 A;  1XNQ K;  4JKB A;  2VYP A;  5AQV A;  4JHD B;  2P9I B;  2IVP A;  2VCP A;  1E4G T;  1ZBL A;  1YIJ N;  3ZT0 A;  3A5M C;  1S72 N;  4CF1 A;  4DFJ A;  3WXI A;  5KPT A;  2A41 A;  4DU1 A;  1BHL A;  3QIC A;  4ID5 A;  4GKK K;  3ZX0 A;  3C7N A;  3MN9 A;  3C94 A;  5AQL A;  3LAM A;  3CME N;  3LZI A;  1NOZ A;  1X9M A;  4OO1 J;  3QIP A;  1J5E K;  5BRH A;  3PX0 A;  2E6L A;  3CD6 N;  2V52 B;  1KQS M;  2GWK A;  1R59 O;  4RWT A;  4M3Y A;  5AQS A;  4NLB A;  3A0I X;  3J7Z O;  3MN5 A;  1N34 K;  5GIN A;  3QEW A;  3VEN A;  1NK6 A;  1VK0 A;  4FSV A;  1RDB A;  5AFU H;  1QVF M;  2D0P A;  2ZM6 K;  1BI4 B;  1VQ5 N;  3DWL A;  3OHR A;  4B1Z A;  3ID8 A;  4NO7 A;  2E20 A;  4ID1 A;  4DSJ A;  1DT9 A;  2G8U A;  3DLH A;  3OS1 A;  4DCH A;  3L3V A;  3HRG A;  3KK7 A;  2A42 A;  1SKS A;  5AQI A;  2X78 A;  1HYZ A;  1MA9 B;  4DR5 K;  1U48 A;  2IS3 A;  2P9L A;  1TUU A;  4A62 A;  4E19 A;  4DKW A;  4FPB A;  3LDQ A;  4BRP A;  1S6Q A;  3ENO A;  4CF9 A;  1G99 A;  3O9Q A;  1TL3 A;  1U04 A;  3AAR A;  3ZCM A;  5AZI A;  1T6D A;  4IG3 A;  4H5V A;  3R1X A;  4JKF A;  3VEW A;  4X62 K;  1QSY A;  3RSE A;  2HHV A;  4NYF A;  4C8O A;  2JWL A;  4ISF A;  5KQ8 A;  3SMS A;  1WSJ A;  3QIN A;  4FJM A;  2OTJ N;  1XI1 A;  3QEX A;  3RTV A;  4K43 A;  4QOZ B;  1V4S A;  3CET A;  1L3T A;  4QS9 A;  4B3S K;  3FZF A;  2YHX A;  4UQG A;  1KRP A;  1IJJ A;  4FLY A;  3T1H K;  4CEO A;  4H8K A;  4Z0U A;  3DMJ A;  1SL2 A;  3TAR A;  2P9P B;  1B92 A;  5CR4 A;  4C1N K;  1BIU A;  1VHX A;  5HBM A;  2QKB A;  2A6A A;  1EX4 A;  2YX6 A;  1GLF O;  5C2D A;  3E01 A;  2W40 A;  3KJV A;  3CG7 A;  4F3O A;  1VQM N;  4CF2 A;  2Q2R A;  2P5G A;  4A61 A;  4HVJ A;  2O4I A;  2OPR A;  3KIO A;  3OS2 A;  4CCH A;  1Q9Y A;  1E3M A;  1HKC A;  1OH7 A;  2HHQ A;  1RT1 A;  1T03 A;  1JLE A;  4CD1 A;  1ATR A;  2W42 A;  4GVM A;  2BDP A;  3O3H A;  3CHW A;  4BRH A;  1JLC A;  3HK2 A;  4CJ5 A;  1KVB A;  1NU0 A;  4KTW A;  2YHB A;  1DKG D;  5BN9 A;  4LF8 K;  4O44 A;  2OYQ A;  1TV6 A;  4AHT A;  3AA3 A;  4FJ7 A;  4H0V B;  4NCA A;  3CER A;  3AO5 A;  3P5J A;  2E88 A;  3OBY A;  3LL3 A;  4KB0 A;  2VWJ A;  1ITG A;  1FK9 A;  3CJ7 A;  1DLO A;  3BY5 A;  5DMR A;  3HSC A;  4J2D A;  3VPZ A;  1QHA A;  1LW0 A;  2GEL A;  3DLG A;  4QS8 A;  1HNZ K;  3CJB A;  4E1N A;  5KQD A;  3CJ9 A;  1VSD A;  3A5O C;  3CYM A;  4I6M A;  4B8C A;  3TSQ A;  3RR7 A;  4OPJ A;  2HMI A;  3BDP A;  1WNS A;  2KW4 A;  3QES A;  3SAH A;  3SLC A;  3KLH A;  4CZJ A;  2YNG A;  4CW7 B;  2V51 B;  5K14 A;  4B3T K;  1KFD A;  3L4Q A;  1HYS A;  4GVE A;  4CJL A;  5LL6 Z;  3ZET A;  3ZSZ A;  4DV2 K;  4CHQ A;  3THX B;  1SZ2 A;  3TAP A;  1Z05 A;  2KQ2 A;  4FZX C;  4DV5 K;  3NMU A;  5SZT A;  3WNH A;  1VSE A;  2HMP A;  3D2F B;  3DXK A;  1Q9X A;  4J2E A;  3OYB A;  2EWS A;  3EZW A;  3LP1 A;  2FBT A;  3I56 N;  3OVN A;  4BRG A;  4MO5 A;  4Q0B A;  4DS5 A;  3MAQ A;  2OPQ A;  2Q31 A;  3NF6 A;  1HKG A;  3G25 A;  3VQP A;  1T05 A;  4IOA L;  4ISE A;  3O8M A;  5MLC Q;  3SV4 A;  4B9U A;  1HX1 A;  3VEV A;  1NGJ A;  5AQK A;  4CF8 A;  1W0H A;  4FO0 A;  5HRR A;  2NZT A;  3MN6 A;  3O1B A;  1VQL N;  2VGN A;  2OZS A;  1Q81 O;  4DLE A;  4WQ5 C;  2HHS A;  4O0J A;  3T19 A;  4A2B A;  2IVO A;  4CHY A;  1LAW A;  1TAQ A;  4J2B A;  3TAF A;  1HPZ A;  5CZ1 A;  2QM1 A;  2P5O A;  1HNI A;  1BWF O;  4FL9 A;  1TGO A;  4KH6 A;  3AVF A;  3OYA A;  3SNN A;  1G15 A;  4MDB A;  3DLB A;  3BGR A;  3SUP A;  4JKG B;  3V1Q A;  1J6Z A;  1KCF A;  1IG8 A;  3GOI A;  3CF5 L;  1UA0 A;  3RWU A;  2O8E B;  2RHK A;  4AHU A;  1VQK N;  1ATS A;  3ZLJ A;  1W9H A;  3PX4 A;  4HUE A;  4JNE A;  5AQP A;  1W97 L;  2P51 A;  1RDC A;  3AVI A;  2FBV A;  4Y0W A;  1X3M A;  4BVP A;  4MO4 A;  1NK7 A;  4XEI A;  3AVJ A;  4CBX A;  1YAG A;  3H3O B;  3LDL A;  3L2Q A;  3Q7B A;  2UXB K;  2F8T A;  5J2N A;  4HUG A;  4B9M A;  4M41 A;  4WFB L;  3KZB A;  4BDP A;  1Y64 A;  1LAV A;  1U47 A;  1SQK A;  3OYC A;  4KPY A;  3WNE A;  3O4W A;  1C0U A;  3DJC A;  3CCS N;  4CEE A;  4FOE A;  5ADX A;  3TSU A;  3O9S A;  3M8R A;  1S1U A;  3OTO K;  1UAX A;  4CJP A;  2NRX A;  2XRI A;  3CJA A;  2W6L A;  3GDQ A;  2ASM A;  3H3N O;  3SAG A;  5T7B A;  5HL7 L;  3GG4 A;  3CQ8 A;  4JEP A;  1NJX A;  2G8F A;  4RG8 A;  4NYN A;  4LY7 A;  5JS1 A;  3VEZ A;  2QKK A;  4CJ7 A;  3WXM B;  2NRV A;  1VSF A;  3MX5 A;  2KLA A;  2QK9 A;  3BEX A;  4BC3 A;  3CXC M;  3AGR A;  2E4L A;  3VN5 A;  3LAL A;  4DWI A;  3OBW A;  3L2R A;  4IG0 A;  2CGL A;  3GE1 A;  5A2Q O;  1HLU A;  3EO3 A;  1ZBF A;  4CHZ A;  3QLH A;  5I42 A;  1L3U A;  3FR0 A;  3KKS A;  3PUF A;  4YOX A;  3AA4 A;  4KHU A;  1VRU A;  2P9K A;  4H0T B;  1KC8 O;  4A5A A;  4J2A A;  4E7J A;  4B1W B;  4CEB A;  3ULE A;  3L2V A;  4FCY A;  1GLE G;  3SV3 A;  3V9Z A;  4ILJ A;  4O5F A;  1HNW K;  3VF6 A;  1C0M A;  3NGZ A;  4GY2 B;  2IAJ A;  4H5W A;  1CLQ A;  4RW6 A;  2UUC K;  1T7P A;  2KKZ A;  3HPH A;  4Z4H A;  3QFU A;  3SQ4 A;  5FRM A;  3V4I A;  2P9P A;  4E3S A;  2IC3 A;  1U2V B;  2V7Y A;  2ZGY A;  4EIA A;  1HMV A;  2JGU A;  4DSI A;  1NM1 A;  3RVC A;  3SUO A;  3CI5 A;  3OA9 A;  3VER A;  3QFP A;  1WLJ A;  2P9K B;  3IG1 A;  4CJF A;  2X74 A;  4FYD A;  4FK0 A;  1YTA A;  1FJG K;  1SL0 A;  3KVG A;  5DM7 L;  1DEJ A;  1Y97 A;  4GV6 A;  5KPZ A;  5KGX A;  3W0L A;  4CGI A;  1HR0 K;  4Z94 A;  3C65 A;  4KB1 A;  1TKZ A;  3THW A;  1VSL A;  2HHH K;  4BRA A;  5KPR A;  2CH5 A;  4HTL A;  4BE1 A;  1MDU B;  3HYF A;  4KRE A;  4K41 A;  2YNF A;  3LM9 A;  3G71 N;  4Y1C A;  4EP4 A;  4ZTF A;  1QSS A;  4E7L A;  4KRF A;  1NK8 A;  1BQN A;  3MK6 A;  4K25 A;  3KKR A;  4CVN E;  4LF4 K;  1BA0 A;  5FPN A;  4C23 A;  4CGJ A;  2DPN A;  5GAH P;  4M45 A;  2UUA K;  3OS0 A;  1U45 A;  3E66 A;  4FLX A;  4O5B A;  3NVK A;  1C0F A;  4DTR A;  4DTN A;  2HBK A;  2DFH A;  4X65 K;  4A2A A;  3OYI A;  3VGK A;  4IFY A;  3D2E A;  1TKT A;  4U7B A;  3MX2 A;  3MCA B;  3I8D A;  1YJ9 N;  2XHB A;  2QWO A;  2JWK A;  3VEY A;  5BRD A;  3CC4 N;  4KHQ A;  1LWF A;  3A5N C;  3FZM A;  4OVL A;  3V9X A;  3MXI A;  4DLG A;  1M90 O;  1WBB A;  2E5L K;  3KK1 A;  3HZ6 A;  4DQR A;  3DXM A;  2VG6 A;  4OLA A;  4LFC K;  3NDK A;  3BP8 A;  5C15 A;  3S9H A;  3SQ0 A;  5I3U A;  3EKS A;  1ASW A;  3T7Z A;  4BQL A;  1CZ9 A;  3M8P A;  1QHT A;  1SS6 A;  3SYZ A;  4CJE A;  4CHP A;  2O8E A;  3LDS A;  2P9S A;  3CCU N;  2PAV A;  3J80 O;  1B9D A;  2WBN A;  3P31 A;  2VG7 A;  5M1N A;  2GTD A;  3QBW A;  3DM2 A;  5C24 A;  4DU3 A;  2FF6 A;  4LSN A;  2KFN A;  4AH9 A;  4FM2 A;  4GNI A;  1TK0 A;  1JCG A;  2QWR A;  1TKX A;  1WSF A;  3ZEU B;  1IKX A;  2ZF5 O;  3THY A;  1NGF A;  4YOW A;  4DR6 K;  1YIT N;  4FM0 A;  2E8A A;  4CK2 A;  3SBG A;  1WSI A;  3MED A;  4WCE L;  4DFM A;  1L3S A;  2AA4 A;  3ZT4 A;  2VQF K;  4DV4 K;  1NGA A;  2AP1 A;  3QO9 A;  2WOM A;  3ENH A;  3AVL A;  1EKE A;  5SWM A;  3ATU A;  5C10 A;  4CJS A;  3EN9 A;  3DLK A;  2UYT A;  3EL2 A;  5DM6 L;  2IIR A;  2YKN A;  5C12 A;  3R3L A;  2HVH A;  2OPP A;  4EZ9 A;  4KI4 A;  2GV9 A;  1S5J A;  1VSJ A;  2BGG A;  3QEV A;  4BC4 A;  1HQE A;  4DTO A;  2W41 A;  1ZC6 A;  1NJY A;  1HQU A;  3LDN A;  5M1F A;  1NK9 A;  4CK3 A;  4EAH D;  1LWE A;  3O6W A;  5AQN A;  2ASO A;  2J4R A;  2D5R A;  3TSP A;  3IDH A;  4FJ8 A;  1C0T A;  3HM8 A;  3WXJ A;  1BCO A;  4A57 A;  4FWL A;  2FF3 B;  4AHS A;  2YJE A;  1VSM A;  3VQ4 A;  3VA3 A;  4FZY A;  3ZSR A;  5E41 A;  3U8X A;  1RIL A;  1GLA G;  1T3V A;  5BR9 A;  2HNZ A;  4AQY K;  4JI6 K;  4XIU A;  4DV0 K;  1NGE A;  3SUN A;  5HLF A;  3CM6 A;  1IBL K;  1JLQ A;  1J53 A;  4LD0 A;  1TYQ A;  4WYB A;  5JLH A;  2HHX A;  1BG3 A;  2F7T A;  1NK4 A;  1DTQ A;  3L6Q A;  2XY8 A;  1Z26 A;  2BUP A;  4NCB A;  3QEI A;  1YVN A;  1VSK A;  1EXQ A;  4HHT A;  3UKR A;  4DSK A;  4CZL A;  1D9F A;  1SKW A;  3T1A A;  5C42 A;  3OYN A;  3CCV N;  4LH4 A;  4IO8 A;  3HVT A;  3MEC A;  2O4G A;  4JK8 A;  2QW9 A;  2G8W A;  4F2S A;  2YNI A;  3VQD A;  3LDP A;  4KTZ A;  5AQQ A;  2IDO A;  3B8A X;  4V19 S;  4Z4E A;  2LSN A;  4IFV A;  1NLV A;  1NG9 A;  1S3X A;  3BF3 A;  4FWS A;  3KLG A;  2FLO A;  3U6F A;  1F21 A;  3KWG A;  3TI0 A;  3KWI A;  1IBK K;  2A1R A;  3VGL A;  3I33 A;  4AF1 A;  1IKW A;  3UIQ A;  5BPN A;  4BG8 A;  1H1V A;  4BRE A;  4JYA K;  2D1K A;  1S1X A;  4BR2 A;  1HJR A;  2WUS A;  5CZ2 A;  3KK2 A;  4JI8 K;  2HHT A;  2Z1G A;  3CPW M;  3K59 A;  1NKB A;  1NNE A;  1XNR K;  1RTJ A;  3QBX A;  4CHN A;  4NXN K;  3L2U A;  3IS9 A;  2ZQB A;  2GWJ A;  3NF8 A;  1NGC A;  1RBS A;  5FPM A;  4I7F A;  5JVH L;  3J7Y P;  2ATQ A;  3KHY A;  1MWM A;  1A5X A;  1NJI O;  5LJV A;  3VTH A;  5HP1 A;  1JCE A;  3SI6 A;  3U9D A;  1OVQ A;  1JLF A;  4B9S A;  4JKC A;  4B3R K;  1X9S A;  5KGW A;  4YY3 K;  1XMO K;  2G8I A;  5FDL A;  4FLV A;  1TL1 A;  3AV9 A;  2B6A A;  4ELT A;  1S1V A;  2ITM A;  5BRF A;  4DUZ K;  4JRP A;  1Q86 O;  1IKY A;  1GOA A;  2Q97 A;  5TKW A;  1L3V A;  3VQ7 A;  1KSP A;  2Q0U A;  4IFE A;  4EHT A;  1VQ7 N;  3RRH A;  4BC5 A;  1WOQ A;  1C1B A;  1WBD A;  2FBY A;  4M3X A;  4CER A;  1JXB A;  1I39 A;  2D4W A;  3F9K A;  3WT0 A;  1X9J A;  4CEC A;  2Z1H A;  3VQ8 A;  5TKY A;  4O0I A;  2P9U B;  5JIC A;  1JJ2 M;  4IDH A;  2KHO A;  1ZBH A;  1FW6 A;  3U3G A;  2O8F A;  1RDA A;  3DRS A;  1T6C A;  4DR4 K;  4B3O A;  4EP5 A;  2UXD K;  4QAG A;  4JV5 K;  2RF2 A;  4I2P A;  1X1P A;  3R8E A;  3J81 O;  1XWL A;  1BCM A;  4BWM A;  3O9U A;  3OYF A;  2XO7 A;  2FSJ A;  2UU9 K;  4JAX A;  3N4Q A;  4PHT X;  5AQT A;  3NH1 A;  4K42 A;  4JI4 K;  3LWM A;  4O8K A;  1KD1 O;  5HRN A;  3OYG A;  1WSE A;  1OVY A;  5FPE A;  4YFU A;  3TAB A;  1YJN N;  4F3T A;  5KTQ A;  1WSG A;  3C7N B;  4M3U A;  4KBO A;  1BQM A;  3AVC A;  3ASM A;  1N36 K;  4EZ6 A;  2IOC A;  3P4I A;  3CC2 N;  3PIO L;  2QTD A;  1VQ6 N;  4DR1 K;  2EHG A;  5AQM A;  4RCH A;  4BGA A;  3WQT A;  3HXM A;  3J7A P;  4BR0 A;  3OY9 A;  1LWC A;  1JLA A;  4DMN A;  4KTQ A;  5JS2 A;  5AR0 A;  5KRT A;  5IT9 O;  4DR2 K;  4ICL A;  1J5O A;  5AQY A;  4X66 K;  2O8F B;  4JN4 A;  3VQC A;  3CCL N;  4KHW A;  2VG5 A;  4CF0 A;  4ZHR A;  1Q82 O;  3WNG A;  3K57 A;  4K8Z A;  1S6P A;  5LMU K;  2EX3 A;  4NCG A;  3C6H A;  4KH4 A;  3C0B A;  4BRQ A;  4WF9 L;  4FK4 A;  1XUP O;  4W5O A;  4PL8 A;  3VES A;  4LF9 K;  3ZX3 A;  4DSE A;  3KLE A;  4PKG A;  4FJK A;  3Q7C A;  2ITG A;  4AHV A;  1XHZ A;  3L4I A;  1LV5 A;  4M3Z A;  2NRZ A;  4KHN A;  3CPE A;  4CK1 A;  4FJJ A;  4FWO A;  3ZSY A;  1ASU A;  2YHA A;  5AQO A;  5ADX H;  3K5O A;  4PY5 A;  4I9Q A;  3HOS A;  2P1J A;  1BOT O;  4CHO A;  4LF6 K;  4WE1 A;  3KLF A;  3D6R A;  3G0Z A;  3S41 A;  3MEE A;  4M3W A;  4WQ4 A;  3HO1 A;  3F73 A;  4PL7 A;  4CZK A;  3PLA A;  3O5B A;  1EET A;  3LPT A;  3EZ5 A;  4QS7 A;  4Y1D A;  3RMC A;  2KTQ A;  1BUP A;  1U4B A;  1JLG A;  3CQY A;  1P90 A;  1KAZ A;  3H46 O;  2F9T A;  3AVN A;  5H1S Q;  1Z25 A;  1UWB A;  4W5R A;  5M1K A;  4CFB A;  4FWP A;  3HPG A;  1ATN A;  3MEG A;  2GEM A;  4AHC A;  5GAG P;  2KZZ A;  2O8D A;  2HVI A;  2O8C A;  3VQE A;  4KAZ A;  1XMQ K;  3CCM N;  1K8K B;  2HND A;  3SPZ A;  4N5S A;  2P9N B;  3K5L A;  3VMF B;  2Y1I A;  3AY9 A;  2Z1I A;  4ZTJ A;  3AO4 A;  2ZGZ A;  3N4P A;  4KV8 A;  4H5T A;  1RBT A;  2OAN A;  3CJ1 A;  1SL1 A;  2B4J A;  1BIZ A;  3UKR B;  4LF7 K;  3O1W A;  3D7E O;  2P9N A;  1CZB A;  4EFH A;  3NE6 A;  4N76 A;  4CZG A;  2O8C B;  3O4Q A;  2O8D B;  4FWM A;  2IGI A;  2HST A;  4C8M A;  4G9Z A;  5AQR A;  1Q8I A;  1S9G A;  1DTT A;  1TVR A;  2ZD1 A;  2PYJ A;  2FXU A;  2PFU A;  3HT3 A;  4N47 A;  3SUQ A;  1SV5 A;  2F9W A;  3BZK A;  4DQ8 A;  4C8L A;  2UXC K;  3HPO A;  1YI2 N;  1VQO N;  5CY4 A;  5C2F A;  4JI5 K;  4CJK A;  2GUI A;  5J2M A;  4BRD A;  3VF2 A;  4H4O A;  4FW1 A;  3OYJ A;  5DK5 A;  3P1G A;  3ALY A;  4JS5 A;  3VOV A;  4OX9 K;  4KH5 A;  4CFC A;  3HM9 A;  3ATV A;  4F4K A;  3QEP A;  4FOI A;  4YOU A;  4FLU A;  3K5M A;  4F2R A;  5GAD P;  2BE2 A;  3LZJ A;  1O1W A;  4R5P A;  1T44 A;  5BN8 A;  4LC9 B;  1N8R O;  3PX6 A;  3OYM A;  3V81 A;  3RR8 A;  3VEO A;  4Z4C A;  4F9O A;  3S3N A;  3W3D A;  2E1Y A;  3NGY A;  3EE8 A;  1UOC A;  4DTP A;  4FJ9 A;  1REV A;  4RW8 A;  3O08 A;  2ZWH A;  2OPS A;  5F0X A;  2I7P A;  3ZSV A;  4CJT A;  3WEE B;  3JAM O;  3CC7 N;  3VA0 A;  3FFK B;  2X6S A;  4DR7 K;  1HYV A;  5JMV A;  4BG9 A;  4JKE A;  1RBU A;  4YNQ A;  4FJL A;  1HPM A;  2NRH A;  5EY4 A;  1J9A A;  4ELU A;  4BR5 A;  2QXL A;  4BE0 A;  2FBX A;  2ETJ A;  4CZH A;  2NRR A;  3THY B;  4BGB A;  4M3R A;  2OCE A;  3M5R A;  1U49 A;  4AM6 A;  1IKV A;  3V9U A;  4H4M A;  5AJ3 K;  4BRL A;  3SK3 A;  4K0K K;  2E2Q A;  1N32 K;  1IO2 A;  1RDW X;  4M7Y A;  3PV8 A;  2P9S B;  5EOY A;  1NKE A;  2RN2 A;  1RTD A;  4ILH A;  4CI6 A;  4HUF A;  3SQ2 A;  3QER A;  3AAP A;  4JS4 A;  1BDG A;  3KLI A;  3O9T A;  5BPL A;  1CXU A;  1ZYQ A;  3KTQ A;  4OPH A;  3K9J A;  3UKU B;  4C1N I;  3T3F A;  5HRS A;  4JI2 K;  3DXM B;  1I94 K;  2I7N A;  1E4F T;  4W5N A;  1TUY A;  3VTI A;  4DUY K;  5LMN K;  1EO1 A;  1UA1 A;  5GIP A;  4OJR A;  3U9Z A;  3LM2 A;  4CZM A;  1RT3 A;  5AQF A;  1GLJ O;  5GIO A;  1YHQ N;  4CE9 A;  3H08 A;  4HWI A;  3PY8 A;  4DR3 K;  5EX5 A;  3SCX A;  1P8Z A;  1QE1 A;  1BA1 A;  3PSI A;  3SMP A;  1D9D A;  1J54 A;  4IDK A;  4LSL A;  2JLE A;  5CYQ A;  3TAE A;  3EEQ A;  3O9R A;  4H0P A;  3EE9 A;  4TSX A;  3BUZ B;  5CHI A;  4BRM A;  4BRI A;  3NH0 A;  4IWV A;  2RE2 A;  4DU4 A;  2O8B B;  3TWH A;  5KI6 A;  3JS6 A;  5B8H A;  4M7X A;  1YXQ A;  3QIO A;  3OW2 M;  1JL1 A;  5AQX A;  1JCF A;  4H0X B;  4DQP A;  1LW2 A;  4E0D A;  3CM5 A;  4CEA A;  1EWR A;  1NGG A;  4DV7 K;  3RMB A;  3I0S A;  2WTU A;  4E7K A;  1RT6 A;  3THW B;  4KI6 A;  1OKJ A;  4OLB A;  2G8H A;  3K9K A;  4DQS A;  4DTX A;  2NNW A;  5E26 A;  4DB3 A;  1RTI A;  3E9L A;  1NGI A;  3HOT A;  1K9M O;  3F5T A;  3TR8 A;  3VQ5 A;  4DFK A;  4B1Y B;  4PQU A;  3HST B;  2DFF A;  3MN7 A;  3DLR A;  2HBJ A;  3HI0 A;  1GLD G;  2DY4 A;  3IAY A;  3HBT A;  2X6N A;  4BR7 A;  4BRK A;  3AGK A;  5BRE A;  2E6M A;  1XHX A;  3AAQ A;  1YT3 A;  3H6E A;  5J2Q A;  3RMD A;  4LF5 K;  3L8B A;  3F9M A;  2Y1J A;  4FJH A;  4BRC A;  1WAF A;  4B9L A;  4BR4 A;  1M1K O;  4OKK A;  3NGI A;  1VQN N;  1ZBS A;  2AJQ A;  4IEE A;  4M3T A;  4ELV A;  4JRQ A;  3ULE B;  3FZK A;  3MCP A;  4KHP K;  4JK9 A;  4FLT A;  5JLF A;  4JD2 B;  3M8S A;  2Q1N A;  3QNN A;  4BRF A;  5M1P A;  1HUX A;  3SAF A;  4JI7 K;  1JL2 A;  1HNV A;  5E84 A;  1RDU A;  3D0P A;  3R6M A;  2A3Z A;  2YHW A;  4H03 B;  3KD1 E;  3KD5 E;  3P83 D;  3A5L C;  4JI0 K;  3IFR A;  3ZT3 A;  3IUC A;  3OJU A;  1VAZ A;  4DQI A;  3SBT A;  3J8A A;  2VWK A;  4LFB K;  1KLN A;  4PUO A;  3S3M A;  4EHU A;  4XH1 A;  4O8U A;  3VEX A;  1S9E A;  3G4S N;  2O8B A;  1U6Z A;  4DSL A;  4ILG B;  3HP9 A;  3D45 A;  3AVH A;  1GOB A;  4E89 A;  2NLX A;  5BPM A;  1L5U A;  3NBP A;  2G8K A;  2CH6 A;  2KZM A;  3O3F A;  3CQX A;  3UB5 A;  4MLE A;  3T69 A;  2Z1J A;  3AA2 A;  4QCL A;  4O4G A;  5AQU A;  3CCQ N;  4OKE A;  2PZS A;  4JI3 K;  4FWR A;  5AQG A;  4OPK A;  1KTQ A;  1FKP A;  1KAY A;  3LP2 A;  1YTU A;  4GMJ B;  4WFN L;  2E2N A;  1YVU A;  2D0A A;  4Z4G A;  1LOT B;  3BF1 A;  4HCB A;  2E2P A;  3NAE A;  4YOY A;  4B08 A;  5FPD A;  3WXK A;  5HRO A;  1QZ5 A;  4IOC L;  1CXQ A;  1LCU A;  4NXM K;  4E1J A;  2YJF A;  5AQJ A;  4KFB A;  5C25 A;  3AVB A;  4FWQ A;  5AQZ A;  2XY7 A;  2HOE A;  3NVM A;  4DHY A;  3ENB A;  4CED A;  1NMN A;  3OYL A;  2A5X A;  3TU5 A;  1ILY A;  4R79 A;  5EVZ A;  4CEF A;  1CZA N;  4I9L A;  1TK8 A;  1Z6R A;  3FLC O;  4CGH A;  2E1Z A;  3OJS A;  4G1Q A;  4DTS A;  3OYH A;  4GV3 A;  4CIF A;  3L3U A;  4E1M A;  3TTD A;  4NLC A;  5FRN A;  4RW4 A;  3P39 A;  3FGU A;  3O80 A;  3ZSW A;  4DV1 K;  4CZE A;  3QML A;  1K6Y A;  5FLX O;  1WAJ A;  4PWD A;  3AA5 X;  1QQC A;  4NB4 A;  3NFA A;  2BTF A;  4FPA A;  4BWJ A;  3ZEU A;  1NK0 A;  1WB9 A;  1EP4 A;  3UE5 A;  1N33 K;  1QSL A;  3LAN A;  1HKB A;  3E1Y A;  2HF3 A;  1I3A A;  4Z4F A;  4BDY A;  3K5N A;  4BC2 A;  2ASP A;  3CCJ N;  1NKC A;  2QWN A;  3MWP A;  4CIG A;  1C6V A;  1RCH A;  3P38 A;  4CIE A;  3IKM A;  4DTJ A;  5AFU A;  1NK5 A;  3THV A;  4CEQ A;  3CIP A;  4CZF A;  1QTM A;  4B8A B;  3TAN A;  4CGD A;  3HJF A;  4OGE A;  1KVA A;  3WXL A;  3LPU A;  4H5R A;  4IKF A;  3NF7 A;  5HOO A;  1VQ4 N;  4LH5 A;  1ESV A;  3K0S A;  1IBM K;  2HNY A;  1SAZ A;  3D2F A;  3DXK B;  1TK5 A;  3CMA N;  2GUP A;  1MWK A;  4BAC A;  4IOX A;  1ZBU A;  5J2P A;  2WFB A;  4C8K A;  4OPA A;  3D2E B;  1QQN A;  5F2R A;  4BDZ A;  3FZL A;  3V1O A;  3DLL L;  4JKD A;  1K73 O;  3IRX A;  3S3O A;  4DF8 A;  1YF5 L;  3DRP A;  4AHR A;  3KK3 A;  1BGX T;  4FJ5 A;  3R9P A;  1ASV A;  3PO5 A;  1NJW A;  4M42 A;  3DOK A;  2QWQ A;  4XH5 A;  2QI2 A;  3JXU A;  1NGB A;  5KRS A;  3MXM A;  4I6M B;  2E2O A;  1FXX A;  3FFI A;  2UUB K;  1WUA A;  4B9V A;  3CFO A;  1WN7 A;  4RW7 A;  3G6E N;  1JLB A;  1V4T A;  4YOR A;  4CJW A;  2D0B A;  1OH8 A;  1JXE A;  3FE1 A;  3M6G A;  2Q0R A;  4CES A;  1HNX K;  3DYA A;  3TAG A;  1GLB G;  4B1U B;  2R7Y A;  1N5Y A;  2FSN A;  4X64 K;  2QWP A;  4CFA A;  1VQ9 N;  4L3Q A;  3JYT A;  3VQQ A;  3L2W A;  5GAE P;  1SUQ A;  2HBM A;  5EU7 A;  1RT7 A;  4FVU A;  2IVN A;  3V6D A;  4IBN A;  1K8K A;  1D5A A;  2QWL A;  1QQM A;  5HRP A;  4KHS A;  4JD2 A;  1BIS A;  2HHU A;  5AQW A;  1VSH A;  1YJW N;  3AVK A;  1KXP A;  2BH1 A;  1ZXO A;  1RT5 A;  2VQE K;  3AO3 A;  3NF9 A;  1NOY A;  1WSH A;  3G10 A;  1U2V A;  3VQA A;  4FVM A;  4FLW A;  1T8E A;  2H3G X;  2NUB A;  4B9N A;  3WNF A;  1O13 A;  4I2Q A;  1Q18 A;  1XQS C;  3ISN C;  3ZX2 A;  1ZBI A;  4WQ5 A;  4CBU A;  4J8F A;  3ZSO A;  5CE3 A;  1RTH A;  3GBT A;  4CJQ A;  4DF4 A;  4FWK A;  1BL3 A;  1OH5 A;  3H45 C;  1A5V A;  4H0Y B;  2PBD A;  3RMA A;  3A8Y A;  1RBR A;  4K8X A;  2YKM A;  4CJ3 A;  3SJH A;  4RTF D;  3LP3 A;  4YDU C;  1BU6 O;  3CCR N;  5AZI B;  2ZJQ L;  4JLH A;  3V9W A;  3CCE N;  3HTV A;  5BR8 K;  1RFQ A;  2HW3 A;  4WFA L;  5LJW A;  1NGH A;  4H0O A;  4KKO A;  2WON A;  1NBW A;  4Z4I A;  4BVO A;  2QEX N;  4L8R B;  3B6O A;  4FXD A;  2XY5 A;  1KLM A;  4YOV A;  4CD3 A;  2YV0 X;  4B1X B;  2PYL A;  3M1F A;  3K58 A;  2HB5 A;  2FSK A;  4BRO A;  3VGM A;  4DS4 A;  4MDA A;  3AVM A;  4B1V A;  3O3G A;  5ELZ A;  5C0Y A;  1VSI A;  3VQ9 A;  2XY6 A;  4HCC A;  4JK7 A;  1RGI A;  4KO0 A;  5I9E B;  5M1O A;  2DTU A;  3OYD A;  3TTF A;  4W5T A;  3EKU A;  4U67 L;  3F2K A;  2GBZ A;  3DLE A;  1EWQ A;  3A2F A;  3QB0 A;  2DFE A;  1S1T A;  3TAM A;  3NHG A;  2CGJ A;  1X9W A;  3QET A;  3UKU A;  3JSM A;  3BZC A;  1C0G A;  1DGK N;  1RT4 A;  4CJU A;  1B9F A;  5M1Q A;  2HF4 A;  3M8Q A;  1R0A A;  4MQ3 A;  4E7H A;  4YDU A;  1NGD A;  2YNH A;  1C1C A;  3ZSX A;  2ZJP L;  3H1Q A;  3LAK A;  1RBV A;  3E9P A;  1S1W A;  1JKH A;  4F8R A;  3DI6 A;  1IH7 A;  1KFS A;  2P9I A;  4FK2 A;  3I8B A;  4JHD A;  4GKJ K;  3NCI A;  3O4N A;  1HRH A;  2KFZ A;  3DOL A;  4JKG A;  3DAW A;  2QWM A;  4B3M K;  3MXJ A;  4BRN A;  4DQQ A;  1QQO A;  4DG1 A;  4BR9 A;  4CJ4 A;  2P9U A;  3CJC A;  3C6A A;  1D8Y A;  4FJI A;  4CJV A;  5AZJ A;  4CEZ A;  3MDQ A;  2QXF A;  3PSF A;  3L0Q A;  5JVG L;  4H5N A;  2ZE2 A;  2V7Z A;  2D0C A;  2NRW A;  3VQB A;  5CYM A;  3FZH A;  3WEE A;  1Q7Y O;  1GLC G;  4FZZ A;  3EY1 A;  2RKI A;  4M63 C;  4DTM A;  3WUH A;  1BO5 O;  4JI1 K;  4CBW A;  3ID6 A;  3ZYY X;  3QDK A;  4FW2 A;  4B9T A;  3WQU A;  3ZT1 A;  3GL1 A;  3AO1 A;  2HHW A;  4DSF A;  1X3N A;  1D4X A;  4DV3 K;  3TTC A;  1C1A A;  4ISG A;  1GOC A;  3THX A;  5F1X A;  2F96 A;  2YHY A;  2I5J A;  1RDD A;  2NRT A;  3ZET B;  3HL8 A;  4OGC A;  3NH2 A;  2WC9 A;  4MLH A;  1VQ8 N;  4UY8 O;  4FM1 A;  4FLZ A;  3ITH A;  3VET A;  2Q36 A;  1HJO A;  4W5Q A;  5EXW A;  3OYK A;  2PY5 A;  3AVA A;  2F8S A;  3H1V X;  1A5W A;  3E9O A;  1NWK A;  1RT2 A;  4KHY A;  2CGK A;  1MU2 A;  4O55 A;  4IJN A;  4RW9 A;  1K8A O;  3C6U A;  4HTU A;  5FRO A;  4CGF A;  2W6K A;  4IXC A;  2RPI A;  1RNH A;  3ZSQ A;  3SZ2 A;  4JKA A;  1S22 A;  3CFP A;  3B6P A;  4FJX A;  2VWB A;  2A40 A;  4PKH A;  4A5B A;  4OKJ A;  3AVG A;  4PKI A;  2Q3S A;  3EYZ A;  5IWA K;  3MWT A;  4YOT A;  2G8V A;  5AQH A;  1FKO A;  1KAX A;  4FJN A;  3TAQ A;  5D3G A;  4CFD A;  1QS4 A;  3K2P A;  3SJJ A;  4FJG A;  1GLL O;  1SKR A;  1YUW A;  1NMD A;  4JKH A;  5LY3 A;  1TYQ B;  4PA1 A;  2OA8 A;  2BAN A;  3RRG A;  4BE2 A;  3LDO A;  2YCH A;  4AIL C;  1QZ6 A;  3QNO A;  4MFB A;  1IV0 A;  2VGM A;  3OYE A;  2FC0 A;  4N56 A;  2OTL N;  1QVG M;  3DRR A;  2ZJR L;  1W7A A;  4FWN A;  3PO4 A;  1OH6 A;  4DFP A;  4LFA K;  3ZT2 A;  4WQ4 C;  3LP0 A;  4XH4 A;  4N41 A;  3MMV A;  1IG9 A;  4IEI A;  2YI1 A;  2HBL A;  4A59 A;  3LWL A;  3SQ1 A;  3VF4 A;  4YHH K;  4E7I A;  2OZM A;  2F4V K;  4B9Q A;  4CZI A;  3CFR A;  3RSE B;  4DTU A;  4AM7 A;  1XC9 A;  2D0O A;  3V1R A;  3I55 N;  2B5J A;  4Q5V A;  1W2B M;  5J1E A;  2GX9 A;  1TAU A;  3I0R A;  3M3Z A;  3U3Y A;  4BY9 C;  4IZ9 A;  3U4L A;  2QA4 N;  1NJZ A;  3TPQ A;  2A1S A;  1N6Q A;  4CJR A;  3T1Y K;  3PIP L;  4CGG A;  4BQZ A;  2P9L B;  1TKD A;  1XC3 A;  3HP6 A;  3VQ6 A;  4DV6 K;  1KVC A;  3HVR A;  3V9S A;  5AZJ B;  4C8N A;  3C95 A;  1VQP N;  4GW6 A;  3ULD A;  3IMX A;  3C6T A;  4IJA A;  3SPY A;  1BI4 A;  1EQY A;  4IO9 L;  1VRT A;  4GV9 A; 
#chains in the Genus database with same CATH homology
 1VQ4 N;  1ESV A;  4BRA A;  4JKB A;  2VYP A;  2F9T A;  5AQV A;  5KPR A;  4JHD B;  2CH5 A;  5H1S Q;  4HTL A;  1SAZ A;  3D2F A;  3DXK B;  1MDU B;  2P9I B;  3CMA N;  2IVP A;  2GUP A;  1MWK A;  2VCP A;  4IOX A;  5M1K A;  4K41 A;  1E4G T;  3LM9 A;  4FWP A;  3G71 N;  2WFB A;  1YIJ N;  4OPA A;  1ATN A;  2GEM A;  3D2E B;  5GAG P;  3A5M C;  1QQN A;  1S72 N;  3MK6 A;  4K25 A;  5F2R A;  3WXI A;  3CCM N;  1K8K B;  3FZL A;  5KPT A;  2A41 A;  2P9N B;  3VMF B;  3QIC A;  3DLL L;  1BA0 A;  3AY9 A;  4JKD A;  1K73 O;  5FPN A;  4C23 A;  3ZX0 A;  2ZGZ A;  3N4P A;  3C7N A;  3MN9 A;  1YF5 L;  4H5T A;  5AQL A;  2DPN A;  2OAN A;  3R9P A;  3CME N;  5GAH P;  3CJ1 A;  4OO1 J;  3E66 A;  2QWQ A;  4XH5 A;  3NVK A;  3UKR B;  1C0F A;  3O1W A;  2QI2 A;  3D7E O;  2HBK A;  3JXU A;  2P9N A;  1NGB A;  5BRH A;  4EFH A;  4A2A A;  4I6M B;  2E2O A;  3CD6 N;  2V52 B;  4CZG A;  1KQS M;  2GWK A;  3VGK A;  4FWM A;  1WUA A;  3D2E A;  2HST A;  4U7B A;  1R59 O;  4RWT A;  3G6E N;  3MX2 A;  5AQS A;  4NLB A;  3MCA B;  4G9Z A;  3A0I X;  1V4T A;  4YOR A;  1YJ9 N;  5AQR A;  3J7Z O;  3MN5 A;  3CC4 N;  2QWO A;  2JWK A;  3VEY A;  5BRD A;  3FE1 A;  3M6G A;  5GIN A;  3A5N C;  3FZM A;  3VEN A;  4FSV A;  5AFU H;  2FXU A;  2PFU A;  2Q0R A;  1M90 O;  1QVF M;  1GLB G;  2D0P A;  2F9W A;  4B1U B;  3HZ6 A;  4DQ8 A;  1VQ5 N;  3DWL A;  3DXM A;  2FSN A;  3OHR A;  2QWP A;  1YI2 N;  1VQO N;  1VQ9 N;  4L3Q A;  4B1Z A;  3ID8 A;  5C2F A;  4NO7 A;  2E20 A;  1DT9 A;  4BRD A;  3VF2 A;  5GAE P;  2HBM A;  4DCH A;  3BP8 A;  5C15 A;  3HRG A;  4FVU A;  2IVN A;  3KK7 A;  3VOV A;  2A42 A;  3EKS A;  1K8K A;  2QWL A;  4KH5 A;  1QQM A;  3T7Z A;  4BQL A;  3ATV A;  5AQI A;  4FOI A;  4YOU A;  1SS6 A;  1MA9 B;  4JD2 A;  5AQW A;  3CCU N;  2P9S A;  2P9L A;  1YJW N;  1TUU A;  1KXP A;  2BH1 A;  4A62 A;  5GAD P;  1ZXO A;  2PAV A;  4DKW A;  4FPB A;  2WBN A;  3P31 A;  1T44 A;  3LDQ A;  5BN8 A;  4LC9 B;  5M1N A;  2GTD A;  1N8R O;  4BRP A;  3QBW A;  1U2V A;  3ENO A;  1G99 A;  2FF6 A;  3O9Q A;  3VEO A;  4GNI A;  3AAR A;  1JCG A;  4F9O A;  2QWR A;  5AZI A;  2H3G X;  1T6D A;  3W3D A;  4H5V A;  3ZEU B;  2E1Y A;  2ZF5 O;  1NGF A;  3EE8 A;  3R1X A;  4JKF A;  1O13 A;  3VEW A;  4YOW A;  3RSE A;  3O08 A;  2ZWH A;  2JWL A;  4ISF A;  5KQ8 A;  1Q18 A;  1XQS C;  2I7P A;  3SMS A;  5F0X A;  1YIT N;  2E8A A;  3WEE B;  3ZX2 A;  2OTJ N;  4WQ5 A;  3SBG A;  4WCE L;  3CC7 N;  2AA4 A;  4CBU A;  4J8F A;  3FFK B;  4K43 A;  5CE3 A;  1NGA A;  1V4S A;  2AP1 A;  3CET A;  3ENH A;  4QS9 A;  3GBT A;  5JMV A;  3ATU A;  5C10 A;  3FZF A;  2YHX A;  4FWK A;  4BG9 A;  1IJJ A;  4JKE A;  3EN9 A;  1HPM A;  2NRH A;  2UYT A;  3H45 C;  4H0Y B;  2PBD A;  5EY4 A;  4BR5 A;  2QXL A;  3A8Y A;  3EL2 A;  5DM6 L;  2P9P B;  4CZH A;  2IIR A;  2NRR A;  5CR4 A;  4BGB A;  3R3L A;  5C12 A;  3SJH A;  4C1N K;  3M5R A;  4RTF D;  4YDU C;  1BU6 O;  3CCR N;  5AZI B;  2A6A A;  2ZJQ L;  2YX6 A;  4BC4 A;  4AM6 A;  1GLF O;  2W41 A;  1ZC6 A;  5C2D A;  2W40 A;  3CCE N;  3HTV A;  4BRL A;  1VQM N;  3SK3 A;  3LDN A;  1RFQ A;  2E2Q A;  5M1F A;  2Q2R A;  4WFA L;  5LJW A;  4EAH D;  3O6W A;  4A61 A;  1NGH A;  1RDW X;  4H0O A;  4M7Y A;  5AQN A;  2P9S B;  5EOY A;  2ASO A;  1HKC A;  2J4R A;  3TSP A;  1NBW A;  4ILH A;  4CI6 A;  4BVO A;  3IDH A;  3AAP A;  2QEX N;  1BDG A;  3HM8 A;  3WXJ A;  4CD1 A;  1ATR A;  4YOV A;  4CD3 A;  3CHW A;  4BRH A;  4A57 A;  4FWL A;  4B1X B;  3O9T A;  5BPL A;  1DKG D;  5BN9 A;  3M1F A;  2FF3 B;  4OPH A;  3K9J A;  3UKU B;  4C1N I;  2YJE A;  2FSK A;  4BRO A;  3DXM B;  3VGM A;  4H0V B;  2I7N A;  1E4F T;  4MDA A;  1TUY A;  3CER A;  3VTI A;  2E88 A;  3OBY A;  1EO1 A;  5GIP A;  3LL3 A;  3U8X A;  3U9Z A;  1GLA G;  1T3V A;  3LM2 A;  4B1V A;  5BR9 A;  3CJ7 A;  5ELZ A;  4CZM A;  5C0Y A;  5AQF A;  4JK7 A;  1RGI A;  1NGE A;  5I9E B;  1GLJ O;  5GIO A;  1YHQ N;  5M1O A;  3HSC A;  3TTF A;  4HWI A;  1TYQ A;  3VPZ A;  3EKU A;  1QHA A;  4WYB A;  2GEL A;  5JLH A;  4QS8 A;  5EX5 A;  1BG3 A;  3CJB A;  2F7T A;  5KQD A;  3CJ9 A;  3A5O C;  3L6Q A;  4I6M A;  3F2K A;  2BUP A;  3TSQ A;  4U67 L;  1YVN A;  1P8Z A;  1BA1 A;  3QB0 A;  3SMP A;  3UKR A;  4CZL A;  2CGJ A;  3SAH A;  3SLC A;  4CZJ A;  3CCV N;  3UKU A;  4IO8 A;  1C0G A;  2V51 B;  1DGK N;  3O9R A;  4H0P A;  3EE9 A;  3L4Q A;  4JK8 A;  3BUZ B;  5M1Q A;  2HF4 A;  4GVE A;  5CHI A;  2QW9 A;  4BRM A;  4YDU A;  1NGD A;  3ZET A;  4BRI A;  2ZJP L;  3H1Q A;  3E9P A;  3LDP A;  1SZ2 A;  4IWV A;  2RE2 A;  5AQQ A;  3B8A X;  3JS6 A;  5B8H A;  4M7X A;  1NLV A;  1Z05 A;  1YXQ A;  3NMU A;  2P9I A;  1S3X A;  3OW2 M;  3I8B A;  2HMP A;  1JCF A;  3D2F B;  3DXK A;  3BF3 A;  4FWS A;  4H0X B;  2FLO A;  5AQX A;  4JHD A;  1NGG A;  2EWS A;  3EZW A;  3KWG A;  3KWI A;  3I56 N;  4JKG A;  3DAW A;  2QWM A;  4MO5 A;  4BRG A;  3VGL A;  2Q31 A;  3I33 A;  4BRN A;  1HKG A;  4AF1 A;  1QQO A;  3G25 A;  1OKJ A;  4BR9 A;  4IOA L;  5BPN A;  4ISE A;  3O8M A;  2P9U A;  3K9K A;  4BG8 A;  1H1V A;  3CJC A;  3C6A A;  4BRE A;  2NNW A;  2D1K A;  5E26 A;  4DB3 A;  5MLC Q;  4BR2 A;  5AZJ A;  2WUS A;  3E9L A;  1NGI A;  1HX1 A;  3HOT A;  3VEV A;  1K9M O;  3MDQ A;  1NGJ A;  3F5T A;  5AQK A;  3CPW M;  3L0Q A;  4B1Y B;  5JVG L;  4H5N A;  4FO0 A;  2NZT A;  3MN6 A;  3O1B A;  3QBX A;  1VQL N;  3MN7 A;  2VGN A;  2V7Z A;  1Q81 O;  2NRW A;  2GWJ A;  2HBJ A;  4WQ5 C;  1NGC A;  3HI0 A;  5FPM A;  1GLD G;  4A2B A;  2IVO A;  3FZH A;  3WEE A;  1Q7Y O;  5JVH L;  3HBT A;  4BR7 A;  1GLC G;  4BRK A;  2QM1 A;  3KHY A;  3AGK A;  1MWM A;  5BRE A;  1BWF O;  3AAQ A;  4M63 C;  3VTH A;  5LJV A;  1NJI O;  4FL9 A;  3H6E A;  4KH6 A;  1JCE A;  3WUH A;  1BO5 O;  3F9M A;  4CBW A;  4BRC A;  3U9D A;  4MDB A;  3ID6 A;  3ZYY X;  3QDK A;  4JKC A;  3WQU A;  4JKG B;  4BR4 A;  1J6Z A;  1M1K O;  1IG8 A;  3GL1 A;  1VQN N;  1ZBS A;  3GOI A;  3CF5 L;  4IEE A;  1X3N A;  3ULE B;  1D4X A;  3FZK A;  2ITM A;  5BRF A;  3MCP A;  1Q86 O;  3TTC A;  2Q97 A;  4JK9 A;  5TKW A;  5JLF A;  2RHK A;  4ISG A;  4JD2 B;  2Q0U A;  4IFE A;  4EHT A;  5F1X A;  2Q1N A;  1VQ7 N;  1VQK N;  4BC5 A;  1ATS A;  1WOQ A;  2YHY A;  4BRF A;  2NRT A;  3ZET B;  4JNE A;  5AQP A;  1W97 L;  2D4W A;  1HUX A;  5M1P A;  3SAF A;  3WT0 A;  1X9J A;  2WC9 A;  4MLH A;  5E84 A;  1VQ8 N;  1RDU A;  4UY8 O;  3R6M A;  5TKY A;  2A3Z A;  2YHW A;  4H03 B;  2P9U B;  4Y0W A;  1X3M A;  4BVP A;  5JIC A;  1JJ2 M;  4IDH A;  4MO4 A;  2KHO A;  3VET A;  3A5L C;  2Q36 A;  4XEI A;  1HJO A;  3IFR A;  5EXW A;  3IUC A;  1VAZ A;  4CBX A;  3H1V X;  1YAG A;  3E9O A;  3SBT A;  3H3O B;  3LDL A;  1NWK A;  3J8A A;  1T6C A;  2CGK A;  3Q7B A;  4IJN A;  4EHU A;  4XH1 A;  3R8E A;  1K8A O;  4O8U A;  4WFB L;  3KZB A;  3VEX A;  1Y64 A;  3G4S N;  1U6Z A;  4ILG B;  3O9U A;  4IXC A;  1SQK A;  2FSJ A;  4JKA A;  4JAX A;  1S22 A;  3N4Q A;  3O4W A;  4PHT X;  2NLX A;  3DJC A;  5AQT A;  2VWB A;  5BPM A;  2A40 A;  4K42 A;  4PKH A;  4A5B A;  3CCS N;  4O8K A;  4FOE A;  2CH6 A;  5ADX A;  3TSU A;  3O9S A;  1KD1 O;  3CQX A;  3UB5 A;  2NRX A;  3CJA A;  4MLE A;  4PKI A;  3T69 A;  1OVY A;  3GDQ A;  5FPE A;  1YJN N;  2ASM A;  3H3N O;  3MWT A;  5AQU A;  4YOT A;  3C7N B;  3CCQ N;  4KBO A;  3SAG A;  5HL7 L;  4FWR A;  5AQH A;  5AQG A;  3GG4 A;  1KAX A;  4JEP A;  3P4I A;  3CC2 N;  1KAY A;  3PIO L;  2QTD A;  1VQ6 N;  1GLL O;  5AQM A;  1YUW A;  1NMD A;  4WFN L;  4JKH A;  2E2N A;  4RCH A;  4BGA A;  5LY3 A;  1TYQ B;  1LOT B;  3WQT A;  3BF1 A;  3VEZ A;  4BR0 A;  4CJ7 A;  3WXM B;  2NRV A;  2E2P A;  5AR0 A;  4YOY A;  5FPD A;  3MX5 A;  3WXK A;  1QZ5 A;  2KLA A;  5AQY A;  4IOC L;  3BEX A;  1LCU A;  4BC3 A;  4E1J A;  3LDO A;  2YJF A;  3AGR A;  2YCH A;  4JN4 A;  5AQJ A;  3CXC M;  1QZ6 A;  3CCL N;  2VGM A;  4FWQ A;  5AQZ A;  1Q82 O;  3OBW A;  2HOE A;  2CGL A;  3GE1 A;  3NVM A;  4DHY A;  3ENB A;  1HLU A;  1QVG M;  2OTL N;  2A5X A;  3EO3 A;  3TU5 A;  2ZJR L;  1ILY A;  4R79 A;  4FWN A;  3C6H A;  4KH4 A;  5EVZ A;  3C0B A;  4BRQ A;  4WF9 L;  1XUP O;  3FR0 A;  1CZA N;  4WQ4 C;  1Z6R A;  3FLC O;  4XH4 A;  4YOX A;  2E1Z A;  3MMV A;  4PL8 A;  4IEI A;  2YI1 A;  3VES A;  2HBL A;  4GV3 A;  4A59 A;  2P9K A;  3ZX3 A;  3TTD A;  4NLC A;  4H0T B;  1KC8 O;  4A5A A;  3P39 A;  3FGU A;  3O80 A;  3VF4 A;  4B1W B;  3ULE A;  4CZE A;  3QML A;  4PKG A;  1GLE G;  4B9Q A;  4ILJ A;  4O5F A;  4CZI A;  3VF6 A;  3RSE B;  3Q7C A;  4AM7 A;  4GY2 B;  2D0O A;  3L4I A;  3I55 N;  4H5W A;  4NB4 A;  2NRZ A;  2BTF A;  4FPA A;  3ZEU A;  1W2B M;  2GX9 A;  3CPE A;  3UE5 A;  4FWO A;  2KKZ A;  3M3Z A;  3QFU A;  5AQO A;  5ADX H;  4BY9 C;  1HKB A;  4IZ9 A;  3U4L A;  2P9P A;  3HOS A;  2QA4 N;  3E1Y A;  3TPQ A;  1BOT O;  1U2V B;  2HF3 A;  2V7Y A;  2ZGY A;  4EIA A;  3D6R A;  4BC2 A;  2ASP A;  3CCJ N;  3PIP L;  3S41 A;  2QWN A;  3MWP A;  1NM1 A;  3RVC A;  4WQ4 A;  3CI5 A;  4BQZ A;  2P9L B;  3P38 A;  3IKM A;  3OA9 A;  1XC3 A;  4PL7 A;  3VER A;  5AFU A;  4CZK A;  3PLA A;  3QFP A;  2P9K B;  3O5B A;  3CIP A;  4CZF A;  3KVG A;  5DM7 L;  1DEJ A;  5AZJ B;  4QS7 A;  4GV6 A;  1VQP N;  5KPZ A;  3W0L A;  1BUP A;  3IMX A;  3WXL A;  3CQY A;  4IJA A;  1P90 A;  4H5R A;  4Z94 A;  3C65 A;  1KAZ A;  3H46 O;  1EQY A;  4IO9 L;  5HOO A;  4GV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...