3AAQA

Crystal structure of lp1ntpdase from legionella pneumophila in complex with the inhibitor arl 67156
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
353
structure length
349
Chain Sequence
b'KHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 106
structure length 349
sequence length 353
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aaqA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aaqA02
3SMPA 5EVZA 2H3GX 1DEJA 4PL8A 3EL2A 5AQRA 3DJCA 4C23A 3IDHA 4ISEA 4HTLA 5AZJB 3FLCO 3HM8A 5KPZA 3CJAA 3GBTA 1HKCA 4H0PA 4BC2A 4BROA 5FPEA 4XH4A 1YVNA 3EKSA 1SAZA 1U2VB 4B9QA 3ULEB 4H0OA 2D1KA 4H0TB 4CZJA 3SK3A 3LDPA 5BN9A 1C0FA 2IVOA 4JD2A 4BRMA 1NGIA 3A5OC 3H3NO 5FPMA 3H45C 3MN5A 4B1WB 3EZWA 3DXMB 4A2BA 3L6QA 3ID8A 4FWMA 1Y64A 1HPMA 4I6MA 5BN8A 4BRDA 3U8XA 2P9SB 3SJHA 3I8BA 2P9UA 3GOIA 1HLUA 3CQYA 5AQIA 1NWKA 1R59O 4BREA 1WOQA 4BRGA 3S41A 1G99A 1Q18A 1BDGA 5EXWA 1NGFA 4JAXA 3A0IX 4WQ5A 3UE5A 4FOEA 2GWKA 4EIAA 4H5TA 3UKRA 1JCEA 4EHUA 3BF3A 2EWSA 3EN9A 2PAVA 3VF4A 2BUPA 4BRCA 4PKGA 4BQZA 4AM7A 1JCFA 2E88A 3CETA 2PBDA 5AQNA 3QFUA 5AQZA 2Q0RA 3R9PA 1Z05A 2D0OA 3H46O 5ADXA 1NGAA 2IIRA 1V4TA 4FPAA 3BUZB 5AQTA 5JICA 5BPNA 2UYTA 4QS7A 4CBXA 1BWFO 4JNEA 5AQSA 4IZ9A 4Z94A 2A40A 2P9PB 3MCPA 4M7YA 2V52B 4YDUA 3VGKA 1ATNA 3D2EA 4H5RA 5EOYA 2P9IA 4BRKA 3CQXA 3H1QA 2P9UB 3WT0A 4GNIA 3H3OB 1EQYA 1NGDA 3VEXA 3FZHA 4JN4A 1NMDA 3UKUA 2J4RA 4ISFA 2NRHA 1P8ZA 4BR9A 4H5WA 3WXJA 2ITMA 3MDQA 2A41A 3ZX2A 4CD3A 4BVPA 5AQJA 3VF2A 1BA0A 3BF1A 2E2OA 4EFHA 5JLHA 3IFRA 3CJBA 3M6GA 5CE3A 3WUHA 2VYPA 1NGJA 1QQNA 3FGUA 1K8KB 4Y0WA 3A5LC 3C7NB 1TYQA 2NLXA 3LM2A 1T6DA 4JHDB 3FZMA 2ZGZA 4BRFA 4CZLA 1NLVA 3CHWA 1CZAN 2ASPA 2HF4A 2HOEA 1ATSA 2QWOA 1DGKN 4XEIA 4IJAA 1QZ5A 2A42A 3WXLA 3U4LA 3O6WA 2DPNA 2FXUA 1HUXA 2YI1A 1X3NA 4H0YB 3DAWA 4FPBA 3ZX3A 4LC9B 5AZIB 2D4WA 4B1UB 3GL1A 5JMVA 4FSVA 2P9IB 1T44A 5BPLA 2P9NA 5B8HA 2YHYA 3VETA 4CZIA 2QWRA 4O5FA 1NBWA 3ZEUB 4A2AA 4EHTA 1NGEA 2QWLA 1RGIA 3WXIA 3AARA 2Q31A 5AQFA 5KQDA 2YJEA 2FF3B 4PKIA 3GDQA 3L4IA 3IMXA 1XUPO 3HTVA 3RSEB 3QBWA 5LY3A 4CBUA 2FF6A 3O4WA 3LDOA 2AA4A 5AQQA 2BTFA 4XH5A 4BC4A 2KHOA 2CGKA 3KZBA 3VF6A 1GLFO 3FE1A 3WEEA 2HMPA 3VERA 4WQ4C 2A6AA 1SQKA 3SMSA 4L3QA 4BGBA 1S3XA 2GEMA 3QB0A 5AQOA 4A61A 1KAXA 2F9TA 3WQUA 4PL7A 2YHWA 3CI5A 3OHRA 4K41A 4FWRA 4BR7A 3DXKA 4CZFA 3M3ZA 5AQKA 4O8KA 2P9NB 2ASMA 3D2FA 5ELZA 1YXQA 3R6MA 4J8FA 1BG3A 3A5NC 4FWKA 4IXCA 2Q0UA 3FFKB 2ZWHA 2CGLA 4B1ZA 1LCUA 3O8MA 1ZBSA 3HZ6A 2ASOA 2Q2RA 4JD2B 4M63C 4KBOA 2D0PA 3D7EO 3QFPA 1YUWA 2E2NA 3CIPA 2P9KA 5FPDA 4K25A 1IG8A 2GWJA 5BRFA 2QWNA 3VEVA 1D4XA 1GLCG 1GLBG 4CD1A 4B1VA 4I6MB 4K43A 3VOVA 2E1YA 4H0XB 5E26A 3WEEB 4BRAA 1NGHA 5AFUH 4QS8A 1BA1A 4F9OA 3KHYA 4GY2B 1QQMA 3GG4A 4E1JA 3H1VX 3SLCA 1ATRA 4MO4A 4BR0A 3W3DA 3CJCA 1MA9B 3O1WA 1BO5O 5AQHA 5AZJA 3HBTA 2E20A 3DXKB 5JLFA 1C0GA 4AM6A 2HF3A 2IVPA 1HKBA 4BGAA 1KAYA 3LL3A 5TKYA 1QZ6A 3UKRB 2P9LA 2VCPA 1MWMA 1SZ2A 3VEZA 3VEYA 2F9WA 1BOTO 1U2VA 2I7NA 3ULEA 2Q1NA 3WQTA 2QXLA 1MWKA 3FZFA 3B8AX 3HSCA 1HJOA 4CZHA 2GTDA 2QM1A 3C0BA 5E84A 2V51B 1GLEG 1ZXOA 5AQWA 3O08A 4H5NA 4BG9A 2V7YA 1LOTB 2FSNA 3M1FA 1TUUA 3O1BA 5AQUA 5LJWA 4FWPA 5F1XA 3D2EB 1IJJA 2WUSA 1X9JA 2I7PA 2P9SA 1E4GT 1HKGA 3LDNA 1XC3A 3MN9A 3P4IA 1S22A 3UKUB 3H6EA 3A5MC 4RTFD 4FWOA 3CJ7A 1ZC6A 4EAHD 4FWSA 4BQLA 2V7ZA 4BRNA 5BPMA 2GUPA 4BR4A 3TU5A 3L0QA 4BR5A 4CJ7A 1V4SA 4FWNA 3JS6A 1J6ZA 3LM9A 5EX5A 3R8EA 2QW9A 2CH6A 2A3ZA 3ATVA 3AY9A 4B1YB 1X3MA 2P9LB 4IJNA 4FL9A 3ZX0A 3FR0A 4BRIA 2A5XA 1TYQB 1BUPA 5BRHA 4BG8A 3MMVA 5AQVA 3VEOA 3VPZA 3VENA 4WQ4A 1XQSC 4RWTA 4RCHA 3FZKA 4CBWA 3ENHA 3UB5A 1RFQA 2AP1A 4H03B 2YHXA 4BRPA 5AQPA 2VWBA 4ISGA 1QHAA 5BREA 2CGJA 3CJ9A 3EO3A 2E2PA 3GE1A 5KPTA 2YJFA 4NB4A 2P9PA 4QS9A 2ZGYA 3LDLA 3A8YA 3G25A 1TUYA 2W41A 1WUAA 5LJVA 2YCHA 4K42A 4HWIA 1NGCA 4BRQA 1T6CA 5BR9A 3QBXA 5FPNA 4DHYA 5AR0A 1JCGA 3BP8A 4BRHA 3KVGA 2E1ZA 3TPQA 5F0XA 1Z6RA 3ZETA 2QWQA 3WXKA 4BR2A 3VGMA 1NM1A 3F9MA 4WQ5C 4MLHA 1DKGD 5AQMA 4IWVA 5AQGA 3MN6A 3DWLA 3ATUA 1K8KA 4CZEA 1U6ZA 3JXUA 1KAZA 3C7NA 4H0VB 1E4FT 3LDQA 5AQYA 3U9ZA 1QQOA 4JHDA 1HX1A 1ESVA 2E8AA 4CZKA 1GLAG 2QWPA 5ADXH 4DB3A 4MO5A 2ZF5O 2GELA 4XH1A 5AFUA 3VGLA 2W40A 3I33A 4CZGA 2FSKA 3MK6A 4WYBA 5AQXA 2E2QA 4M7XA 3W0LA 4B1XB 4YDUC 3O80A 3CJ1A 5AZIA 1GLDG 2CH5A 3QDKA 4IO8A 1BU6O 1GLJO 3D2FB 1MDUB 3U9DA 5EY4A 3QMLA 3ZEUA 4H5VA 1KXPA 4FWQA 5I9EB 1OKJA 2OANA 2IVNA 2Q97A 4MLEA 3VEWA 1NGGA 4PKHA 3AAPA 3HI0A 3MN7A 2NZTA 3ZETB 4NO7A 4FO0A 2Q36A 1RDWX 3FZLA 5KPRA 4FOIA 2FLOA 4FWLA 3RSEA 2P9KB 2QWMA 3J8AA 4BC3A 5KQ8A 3BEXA 3EKUA 1H1VA 4DCHA 4CI6A 5BRDA 3AAQA 3DXMA 4BC5A 3QICA 5AQLA 1NGBA 4A62A 4CZMA 4DQ8A 1GLLO 1YAGA 4BVOA 3O5BA 4BRLA 3CERA 3VESA 2FSJA 3IUCA 3ENOA 5F2RA
chains in the Genus database with same CATH superfamily
1N6QA 5H1SQ 1DEJA 1SKWA 2YNFA 1WNSA 3V9ZA 1K73O 2HHSA 1JXBA 1RDAA 4HTLA 4OGEA 3NH1A 2D5RA 3IS9A 3BY5A 4JRPA 4KTWA 3CM5A 4H0PA 4FJNA 1YF5L 3O9TA 3AVNA 2OCEA 4CIEA 4EZ9A 2D1KA 1RBSA 4BWMA 1ZYQA 5BN9A 1C0FA 4JI4K 4FJXA 3THVA 3V6DA 3R1XA 3WNFA 2HNYA 1VQ5N 1KFSA 3DXMB 4Y1DA 3ALYA 3AVBA 3ID8A 4ILJA 4FWMA 1HPMA 4QOZB 5BN8A 2QK9A 4BRDA 2IDOA 2P9SB 4KHYA 3SJHA 4CGFA 3OYBA 3QEVA 1VSKA 1QSLA 4CFAA 3ZSOA 2QI2A 3ZT1A 4BREA 4KHSA 2O8FA 3OS2A 1SL0A 3LP1A 3KK1A 1HRHA 2XY6A 3A0IX 2D0CA 3UE5A 3SUPA 2HBJA 1JCEA 3L3UA 4GMJB 3HOSA 4FW2A 3EN9A 4GV9A 2QXFA 4DQRA 3VF4A 2KQ2A 4PKGA 2O8BA 5FRNA 2E88A 3EY1A 3CETA 4BE2A 3NCIA 4FJ7A 3C6TA 3QFUA 3AGKA 2YKMA 5C0YA 3J7AP 3BUZB 3CYMA 3P39A 5JICA 5BPNA 5KI6A 2KFNA 2DY4A 4Z94A 2A40A 2P9PB 4M7YA 4YDUA 4E7JA 1SS6A 4H5RA 1XC9A 5HRRA 4BRKA 3BZKA 4DV6K 1KTQA 1EQYA 3JYTA 4JN4A 3UKUA 3QNOA 4FLWA 1N8RO 2NRHA 1VSIA 1TV6A 2IAJA 1NKCA 4R5PA 2YNGA 4CD3A 4RG8A 3M8SA 5FLXO 2E2OA 1ZBFA 5HOOA 4J2EA 4L8RB 3T1YK 3WUHA 3HM9A 3FGUA 1S6QA 3C6AA 1WBDA 4KKOA 3O3HA 1TYQA 3KD1E 2P5OA 1T6DA 4CIGA 3TAEA 2HF4A 4CGHA 1ATSA 1DGKN 1VQPN 3I55N 1U48A 3PUFA 3ZT4A 3T3FA 3G10A 3LP0A 1VSHA 3KJVA 5JVHL 1EXQA 4E7KA 2IS3A 1CLQA 5CHIA 4LSNA 3U4LA 1RT4A 4EZ6A 2FXUA 3NGYA 5AZIB 3GL1A 4JK8A 2QWRA 1NBWA 4CK2A 3TTFA 1VQNN 1NGEA 1Q86O 1YITN 2QWLA 2HBLA 1TK5A 1U4BA 4I9QA 2ETJA 2QEXN 3RWUA 2VGMA 1HNIA 4GVEA 3DM2A 4O0JA 4CBUA 1C0UA 3E1YA 3CQ8A 4B08A 1VRUA 3CM6A 2CGKA 3KZBA 1SKRA 3DRRA 3FE1A 2QA4N 1S72N 1RT6A 1NJXA 4FW1A 1HPZA 4BGBA 1S3XA 2P51A 3BDPA 3I0RA 1L3SA 3QB0A 5AQOA 4A61A 1KAXA 3NVKA 4CCHA 1SV5A 4BY9C 4DSKA 3U3YA 1KSPA 4FWRA 1JLEA 4CZFA 3DLBA 1QSSA 3G6EN 3M3ZA 4DQIA 3I8DA 3D2FA 4NLCA 4J8FA 3ZSZA 3WXMB 4CJFA 2ZWHA 2XHBA 1NJYA 3J81O 3EE8A 4KREA 3T7ZA 1RDUA 5KRTA 2D0PA 3D7EO 3PIOL 4J2DA 1BCMA 1IKVA 5FPDA 4K25A 1UA1A 2GWJA 3M8PA 3HPOA 3K5NA 1RT7A 2KTQA 4KB0A 5HP1A 1J5EK 1KFDA 4JI7K 1UOCA 3Q7CA 4K43A 5DK5A 3VOVA 4HVJA 3S3MA 3WEEB 3CCLN 4B3TK 4JKDA 4NXMK 4DFMA 3SAFA 3KIOA 3ZSRA 3OYMA 3DRPA 5C15A 5C25A 3CXCM 1RILA 3GG4A 3C94A 4BDZA 1ATRA 4MO4A 3NVMA 4MQ3A 3CJCA 5D3GA 4PUOA 5AZJA 2E20A 5GAHP 1C0GA 4DTNA 1QE1A 4CEEA 5TKYA 2P9LA 1SZ2A 3SAHA 3VEZA 4JI2K 2F9WA 3QEXA 3ULEA 3ZLJA 2O8BB 4FLYA 2VG5A 2VQEK 4CFDA 3HSCA 4A5AA 2GTDA 2QM1A 1BI4B 3F73A 3O08A 4E7HA 4FZXC 2V7YA 3M1FA 4CEBA 4CF9A 1S5JA 4DU1A 3K9KA 1RTHA 4G1QA 1HKGA 1XC3A 3VQCA 2Z1IA 4DSIA 1YJNN 3UKUB 3H6EA 3A5MC 4FWOA 2V7ZA 3K0SA 1CZBA 3D6RA 4OPHA 3ZSWA 3NF6A 1J6ZA 3NH2A 5EX5A 3R8EA 1C0MA 4JKHA 3SUQA 3AY9A 1X3MA 3DRSA 1VQMN 4O0IA 3VQQA 2A5XA 3C6UA 3IKMA 1TYQB 1BUPA 4BACA 3AO5A 4BG8A 1N36K 2UUAK 3FZKA 4CBWA 5GIPA 1RDCA 2YHXA 1XHXA 1SL2A 1DT9A 4E1NA 3DYAA 4ICLA 3M5RA 3QO9A 1S9GA 3DLEA 5KPTA 2YJFA 3MEEA 4NB4A 3JSMA 3ZSYA 3SV3A 1C0TA 3I56N 3LDLA 4IFYA 3A8YA 4M3RA 4JS4A 2W41A 3U3GA 1NGCA 4BRQA 1T6CA 3HPHA 4OPKA 3OBWA 3QBXA 4JK7A 1BIUA 4KO0A 4DHYA 5I42A 1JCGA 3BP8A 5C10A 3VQ9A 2G8KA 2B4JA 1NG9A 1GOAA 3NHGA 1Z6RA 3H08A 3ZETA 2YHBA 3WXKA 1W7AA 4C8OA 3OVNA 4B9VA 3VGMA 1WLJA 4LFAK 4F4KA 3SZ2A 4OO1J 3G0ZA 2UU9K 1W2BM 1K8KA 1E4FT 3LDQA 3HOTA 1ZBLA 4B9TA 1B92A 4X62K 1ESVA 1HYZA 2QWPA 5ADXH 3N4PA 3O9RA 4YOXA 3J7ZO 4MO5A 1K6YA 4XH1A 1K9MO 2KZMA 3VGLA 2W40A 3L2RA 3OYHA 4WYBA 5AQXA 3DOLA 2E2QA 1EO1A 4CF8A 4B1XB 4TSXA 1HQEA 3CJ1A 1IG9A 4DV4K 3VQ5A 1GLJO 3D2FB 2DFFA 4RW7A 4RW8A 1XMQK 5DMRA 1KXPA 4KHPK 1OKJA 1KVCA 1C6VA 3AAPA 1RDDA 2GX9A 1B9FA 4B3SK 1RDWX 3HVTA 3RSEA 3J8AA 3AA4A 4DCHA 5J2QA 4M3ZA 3DXMA 3MXJA 1R0AA 4HUGA 3QICA 5CYMA 4DQ8A 3QIPA 1YAGA 4CEFA 4DFKA 1FXXA 3O5BA 4BRLA 4A5BA 2FSJA 5F2RA 4H4MA 2H3GX 4B9MA 2KFZA 3EL2A 3DJCA 3IDHA 2NNWA 4ID1A 5AZJB 2WBNA 4JKFA 1X1PA 5HBMA 3FLCO 4ELTA 3HM8A 3CJAA 4CHPA 3D45A 4BC2A 5FDLA 4NCGA 5FPEA 4XH4A 1YVNA 3EKSA 3TAFA 4JKBA 4KTZA 3ULEB 4DTJA 4Z4FA 2Y1IA 4CF1A 4AHCA 4OVLA 4V19S 2IVOA 4JD2A 2E5LK 1NGIA 3A5OC 3PX0A 1FKPA 4PA1A 3MECA 3MN5A 3EZWA 2VG7A 3SBGA 4WFNL 2RN2A 3K5LA 1FKOA 5LL6Z 1NK6A 3PSIA 2RF2A 3CQYA 3ZSVA 4CEQA 4CK1A 3F5TA 4ILGB 1KVAA 1KRPA 3CCRN 2XY5A 3LZIA 3O9SA 2E6LA 4O4GA 3Q7BA 1BDGA 1U04A 2HVHA 3DLLL 1NGFA 5KGWA 3K2PA 4ZHRA 1FW6A 4M42A 3BF3A 4W5QA 3L2QA 2PAVA 2ZM6K 4CK3A 4BRCA 2R7YA 5A2QO 2PBDA 1F21A 5AQZA 1Z05A 4FJ5A 4FPAA 1NK9A 5AQTA 2D0BA 2UYTA 4QS7A 4CBXA 2G8WA 2ZJPL 1BQNA 4MDAA 1L3VA 1IKWA 2VG6A 2B6AA 5EOYA 2YNHA 3CQXA 4OX9K 2P9UB 3HRGA 3OYFA 1W0HA 3WT0A 3H3OB 1N5YA 4DV1K 2X74A 4Z4HA 4B9UA 1DLOA 3WXJA 2ITMA 3MDQA 3TARA 1S1TA 4DTXA 4BVPA 1IKYA 3SQ0A 2W6KA 4CJPA 1RTJA 1YVUA 3VF2A 3BF1A 2P1JA 4FLTA 2HHXA 3IFRA 1YIJN 3LANA 3M6GA 4OKJA 5CE3A 2VYPA 4DQQA 1K8KB 1OH5A 3SQ1A 4CZLA 4CHYA 5IT9O 2ZGZA 4BRFA 5I3UA 4FJLA 4F2SA 2HOEA 3T1HK 4B3MK 3S3NA 1TL3A 1M90O 3G4SN 4DV5K 3O6WA 1IH7A 1HUXA 4DQPA 2XY8A 4H0YB 3ZX3A 1W97L 2A1RA 4LC9B 3ZYYX 5JMVA 2P9IB 1TAUA 2X78A 5M1OA 3VETA 3OW2M 1TKZA 4O5FA 4A2AA 3OYCA 3PO4A 1C1CA 4QCLA 1RGIA 3AARA 2Q31A 1OH8A 5C12A 2YJEA 3GDQA 3L4IA 1XUPO 1QVGM 4DF4A 4K0KK 4KI4A 3RSEB 3QBWA 4CEAA 2DFHA 4WFBL 1WBBA 2G8IA 5KRSA 5AQQA 2BTFA 4XH5A 4LFCK 3WNGA 2KHOA 1SKSA 3E9OA 3K5MA 3OYAA 5JS2A 3VF6A 5M1NA 3TSQA 3TABA 1Q8IA 3E66A 3WEEA 2WONA 4OPAA 4BE1A 1Q9XA 3SMSA 4CHZA 4L3QA 1VSDA 4CFBA 3RMAA 3WQUA 2F7TA 1TKTA 3CI5A 1TGOA 2WFBA 3OHRA 2FBVA 4K41A 1W9HA 4HUFA 1T7PA 4PWDA 3LPUA 2NRXA 4C8NA 5AQKA 4O8KA 2O8DB 1K8AO 4JI8K 2P9NB 4UY8O 2EHGA 3CCUN 1VQ9N 1BG3A 3A5NC 4IXCA 4E19A 1E3MA 2CGLA 1LCUA 3O8MA 1HQUA 2Q2RA 3HPGA 4JD2B 4FJMA 4KBOA 5BR8K 1YUWA 3CIPA 2P9KA 1BI4A 1NOYA 1EKEA 3K59A 3HK2A 5BRFA 3VEVA 1GLCG 3NFAA 3M8RA 2O4IA 4Z4GA 4BRAA 2OYQA 1BA1A 4F9OA 3CCMN 3KHYA 2FC0A 2UXDK 4M3WA 1BGXT 3VQ8A 2IOCA 4E1JA 3L3VA 4BWJA 3W3DA 1MA9B 4F3OA 4M3XA 4YOUA 3NDKA 4DV0K 3LP2A 5JLFA 1DTQA 4AM6A 2HF3A 1C1AA 1WSEA 3MX2A 4BGAA 3VQEA 1VK0A 2HNZA 5DM6L 4NYNA 3VEYA 3DI6A 5JVGL 1U2VA 2FBTA 3B8AX 4IG3A 1J9AA 4KV8A 1X9WA 1HJOA 3NF8A 5E84A 2V51B 1ZXOA 2FSNA 3AO4A 4CJQA 4EP5A 1LAWA 3O1BA 5C2FA 4FJIA 4IEEA 4CJWA 5F1XA 1S1VA 4C1NI 4CW7B 3TAQA 2BH1A 4B8AB 1HYSA 3LDNA 3VQPA 4OJRA 2WOMA 1ILYA 2G8UA 3PX6A 3J80O 3HT3A 3AA3A 5SZTA 4IO9L 4FWSA 4AILC 4E1MA 5BPMA 3AVIA 3TU5A 2Z1JA 1O1WA 3B6PA 1A5VA 3OYLA 3JS6A 1EETA 3LM9A 4DS4A 1TK8A 4CIFA 4B1YB 3SPYA 1ITGA 4IJNA 4LFBK 1NKEA 2GBZA 3V81A 3FR0A 1WB9A 4CVNE 3MMVA 4CF0A 5GINA 1XQSC 4E7LA 2BE2A 4FLVA 3ENHA 1RFQA 2AP1A 4BRPA 3DLHA 2NRZA 2VWBA 4OKKA 1QHAA 4FJHA 2OA8A 1JLAA 4IDHA 3RRHA 3QETA 3CMEN 5LJVA 1S1UA 4DWIA 3LAKA 2NUBA 3OYJA 1OVQA 2D0AA 3P5JA 3OJSA 1VSLA 3TPQA 5F0XA 4DFPA 2OPSA 4X66K 4YFUA 4HTUA 2QWQA 4F8RA 4BR2A 5J2MA 1B9DA 5GADP 4WQ5C 5AQMA 3B6OA 3E01A 3QIOA 4IWVA 3SI6A 3MN6A 4QAGA 1HNWK 3LWMA 3ATUA 5HLFA 3RR7A 1U6ZA 1J5OA 2OPQA 4JHDA 2EX3A 3TTDA 1RBVA 2ZF5O 3U6FA 3CCQN 4CZGA 1RDBA 3PV8A 4CJ5A 4M7XA 1RT5A 3W0LA 1YTAA 3VQ7A 3SUOA 5E41A 1GLDG 4HUEA 1RTDA 3ZT3A 1XMOK 1S9EA 4U67L 3AO3A 3SUNA 3QMLA 3C6HA 4H5VA 4KHWA 2I5JA 4MFBA 4FWQA 5I9EB 2OANA 3SNNA 2IVNA 3VEWA 1NGGA 4LSLA 3HJFA 3SAGA 2FLOA 4OGCA 4DR6K 2P9KB 2HBKA 5KQ8A 3KKRA 3BEXA 3TAPA 3EKUA 1H1VA 4CI6A 2OPPA 4BC5A 3LZJA 1ASVA 1GLLO 2QKKA 4E0DA 4JK9A 4DU3A 3SMPA 4NYFA 1YHQN 5AQRA 4C23A 4ISEA 4DSLA 1J53A 4CJLA 4KAZA 3AVKA 4JI5K 4ELUA 1LAVA 1HKCA 3ID6A 4JI3K 2HB5A 2NRVA 4CGDA 3TAGA 3CFOA 4XIUA 1U2VB 3T1AA 4B9QA 1LWCA 4H0OA 4W5RA 3LDPA 2OZMA 3K57A 4BRMA 1D9DA 2XO7A 4YORA 5FPMA 2KLAA 3I0SA 3E9LA 4LF5K 1IV0A 4B1WB 2GUIA 2HMIA 3L6QA 1KC8O 4DTPA 2O8EA 1Y64A 1U49A 3TI0A 2JLEA 3A2FA 4I6MA 4FK2A 4F2RA 1VSMA 4JLHA 3L8BA 2P9UA 3GOIA 2HHVA 1MU2A 1HLUA 3CPEA 1T03A 3CPWM 3KTQA 1R59O 3S41A 1G99A 1QVFM 4W5OA 3KLFA 4WE1A 4IFEA 1Q9YA 4LF6K 1ZBHA 4NXNK 1RNHA 3D0PA 3HL8A 4JAXA 4IG0A 4WQ5A 4FOEA 2GWKA 2VWKA 3UKRA 1IBMK 4EHUA 5FRMA 4DMNA 4GV6A 1JLFA 3V1QA 3ISNC 1JCFA 2VGNA 1RBTA 4KTQA 5AQNA 3JAMO 2Q0RA 4MDBA 1BISA 4KB1A 2D0OA 3LAMA 3H46O 5ADXA 2IIRA 1V4TA 4DTSA 4WCEL 4JNEA 4IZ9A 1WAJA 3TSPA 3MCPA 3O4NA 3VGKA 2B5JA 2UUBK 3D2EA 4CJVA 2P9IA 3H1QA 3O4QA 1NK7A 3VEXA 4CGGA 3FZHA 1NMDA 3T19A 1NK4A 1D8YA 4H5WA 3HO1A 5MLCQ 3K5OA 5J2PA 3V9XA 3KK7A 4EFHA 5JLHA 4KRFA 3QNNA 1LWEA 1KVBA 3KLHA 4Y0WA 3A5LC 4Z4IA 2NLXA 4JHDB 3FZMA 3HSTB 4K8XA 3CHWA 1CZAN 5M1KA 2QWOA 3EYZA 4XEIA 4DG1A 4LD0A 4CF2A 3LDSA 2A42A 2DTUA 1QTMA 4DV2K 2QTDA 3AVJA 3V1OA 4Z4EA 1NJZA 2YI1A 1X3NA 3AVGA 4FPBA 4N47A 3RVCA 2D4WA 3PLAA 4C8LA 2O8DA 1T44A 2P9NA 5B8HA 4J2BA 2YHYA 3AGRA 4EHTA 4HHTA 1JKHA 3WXIA 5AQFA 1RT2A 5CY4A 4DU4A 2FF3B 4M3TA 3IMXA 1KLMA 4CHNA 2UXBK 1VAZA 2FF6A 3PIPL 3O4WA 1LW0A 2AA4A 1SL1A 3NGZA 4BC4A 2Q3SA 2RPIA 1GLFO 3QINA 4H4OA 1NNEA 5IWAK 4WQ4C 2A6AA 4R79A 2HHWA 1QQCA 3AVCA 3O9UA 1NJIO 1XI1A 2F9TA 4PL7A 3PX4A 1S1WA 3SPZA 3ZSQA 3S9HA 3DLGA 1T05A 2YKNA 4Q5VA 3VQAA 1YXQA 3R6MA 2ZQBA 4ID5A 3FFKB 4JI0K 4B1ZA 3QEWA 4CFCA 4IDKA 1ZBIA 1ZBSA 1XHZA 4CERA 4M3YA 3AA2A 2VQFK 4FJ8A 2E2NA 3OYDA 4ELVA 4JKCA 1Q81O 4JI1K 1IG8A 5KTQA 2QWNA 1D4XA 5SWMA 1GLBG 2O8EB 4CD1A 4B1VA 4U7BA 3THYA 4I6MB 2E1YA 4H0XB 4AHRA 3CFRA 3CCEN 1T8EA 1RTIA 3P31A 4DSFA 4GW6A 5AFUH 4QS8A 4Z0UA 4DF8A 4JRQA 4KH4A 4N76A 1N33K 4FJJA 4BR0A 3AVFA 3TR8A 3O1WA 3OBYA 1UAXA 2ZE2A 1BO5O 1C1BA 3MCAB 3DXKB 3OY9A 3RMCA 4RW6A 4CGIA 1HNXK 1UA0A 3NMUA 1KAYA 3LL3A 4BDPA 3UIQA 1QZ6A 3HYFA 3E9PA 3UKRB 2VCPA 1MWMA 3AVHA 4DTRA 1Y97A 3PY8A 1DTTA 4CJ3A 1NOZA 4M45A 2KKZA 2QXLA 4FJ9A 4LH5A 3FZFA 4CZHA 4FZZA 5FROA 3C0BA 4ZTJA 5AQWA 1TK0A 4BG9A 1YJWN 5AQUA 5LJWA 2AJQA 3VTHA 4FM1A 3VA0A 5C24A 4FWPA 1ZBUA 1SUQA 1JL2A 3D2EB 2WUSA 1X9JA 2I7PA 3VQBA 2UXCK 1S22A 4RTFD 2HNDA 1WAFA 3CJ7A 4YOWA 4FM0A 1ZC6A 4EAHD 3V4IA 1TAQA 4DTUA 4BQLA 4JKGA 3ZSXA 4DR2K 4B3OA 2GUPA 3IRXA 4O8UA 3ENBA 3WNHA 4CJ7A 3V1RA 4RW4A 3OYIA 3KWIA 4JKAA 4PQUA 3SCXA 2CH6A 2A3ZA 4M3UA 1Q82O 4AQYK 3ZX0A 1VSFA 2HW3A 2XRIA 3L4QA 2ATQA 5AQVA 4H8KA 3VPZA 4GV3A 4WQ4A 1D9FA 1IKXA 3BGRA 4CGJA 3NAEA 4RWTA 4RCHA 3CD6N 3ZT0A 5AQPA 3HP9A 4ISGA 4IFVA 5JS1A 3CC4N 2CGJA 2YHAA 3CJ9A 1HNVA 3OA9A 4NCAA 2JWLA 4Z4CA 3SJJA 4PY5A 3G25A 3SV4A 1TUYA 1WUAA 5HL7L 1NK0A 2ZJQL 4LY7A 5FPNA 4LH4A 1ASUA 3P38A 5AR0A 5GAGP 1TL1A 3AVMA 2W42A 3F2KA 1HYVA 2XY7A 4A57A 4MLHA 1DKGD 1CXUA 5AQGA 2KW4A 3MX5A 4DR7K 1KAZA 3C7NA 4H0VB 5AQYA 3U9ZA 2Z1HA 4DV3K 3QEPA 4O44A 1VQLN 4CEOA 4GKKK 1HX1A 2RHKA 4CZKA 3MEGA 3LWLA 4DB3A 1VRTA 1RT3A 3LP3A 2HHUA 1ASWA 3OJUA 3TWHA 4B3RK 3DMJA 2FSKA 3MK6A 3QERA 2Z1GA 3TANA 4UQGA 2IC3A 2PZSA 3CCJN 5LMUK 4AH9A 3NH0A 2QKBA 3CFPA 2CH5A 4IO8A 1MDUB 3AV9A 3U9DA 3R3LA 3F9KA 3ZEUA 1VQ7N 2Q97A 4DFJA 2NZTA 2UUCK 3K9JA 4NO7A 4ILHA 1U47A 1I94K 1N34K 3K58A 3IAYA 4CJRA 5BRDA 4WF9L 3EEQA 4C8MA 3THYB 2Y1JA 5AQLA 1KQSM 4FK4A 1NGBA 4CZMA 1BHLA 3NE6A 3VESA 3IUCA 3ZT2A 3ENOA 4X64K 2YV0X 2G8FA 1XWLA 5EVZA 2HHHK 4YOTA 4FXDA 4PL8A 1A5WA 2G8HA 3LALA 4KHQA 3AO2A 1NK8A 1WSHA 5KPZA 3GBTA 4DKWA 4BROA 1N32K 1L5UA 3THWB 4IOXA 1SAZA 3C95A 4Y1CA 1QSYA 1YI2N 4H0TB 4CZJA 3SK3A 1CZ9A 4KI6A 3H3NO 4EP4A 4K8ZA 1KCFA 2A1SA 3H45C 4YNQA 4A2BA 3G71N 4FYDA 2F96A 1IBLK 4CHOA 2F8TA 3KK2A 1LW2A 1WSIA 3U8XA 2DFEA 1YT3A 3AA5X 3I8BA 3RMBA 3N4QA 4KPYA 1U45A 2YX6A 3P83D 5AQIA 1NMNA 3THXA 1VHXA 1NWKA 3VN5A 1P90A 4PHTX 4JKGB 1WOQA 4BRGA 3TSUA 1RT1A 4N5SA 1Q18A 2E6MA 3KLEA 3KK3A 3IG1A 5EXWA 2RE2A 3EE9A 4E7IA 3NF9A 4EIAA 4H5TA 2E4LA 5CYQA 2EWSA 3OYKA 4IBNA 2BUPA 4BQZA 4AM7A 3C65A 4FCYA 1HMVA 2OPRA 3R9PA 5M1QA 4W5NA 1NGAA 4CEZA 4X65K 2NRWA 3QESA 1WSGA 5LMNK 1NKBA 1LWFA 1BWFO 1L3TA 5AQSA 4IOCL 1VQ8N 2PFUA 2V52B 4LF8K 1ATNA 3RTVA 4IKFA 1UWBA 1TVRA 5C2DA 4GNIA 1NGDA 3KLGA 2J4RA 4ISFA 4FVMA 1P8ZA 4BR9A 4B9NA 5GAEP 4DUZK 4OLBA 2O8FB 2A41A 3ZX2A 5AQJA 1BA0A 3CJBA 5CZ1A 3CMAN 4AHSA 2X6SA 2LSNA 3VTIA 1NGJA 1QQNA 2HHTA 2JWKA 4AF1A 4JI6K 5HRNA 3C7NB 3LM2A 3CC7N 1NLVA 2ASPA 4CJKA 4HCCA 1RBUA 4N56A 5TKWA 5HRSA 1KLNA 1JLQA 2ZD1A 3T69A 4RW9A 4IJAA 4CHQA 4LF4K 1QZ5A 4B8CA 1L3UA 3WXLA 4CEDA 4YOVA 2DPNA 3DAWA 3AO1A 4OKEA 4YY3K 4B1UB 4FSVA 1FK9A 5BPLA 4DSJA 4N41A 2G8VA 5EU7A 4CZIA 3EZ5A 3ZEUB 2ZJRL 5T7BA 1QHTA 2OZSA 5KQDA 4DR1K 3SBTA 4PKIA 1JXEA 3MWPA 2BDPA 3HTVA 3OS1A 2W6LA 5LY3A 4GKJK 5CR4A 3LDOA 2FBXA 4FK0A 1BL3A 4OLAA 1S6PA 3VQ6A 5C42A 4B9SA 2HMPA 3VERA 1BQMA 1SQKA 4AHVA 2F8SA 1Z25A 3OS0A 1M1KO 1VQ6N 2GEMA 4G9ZA 5M1PA 3CC2N 1NJWA 1D5AA 4W5TA 2YHWA 2HBMA 2RKIA 4C8KA 1VQKN 4BR7A 3VQDA 3MXIA 3DXKA 5HROA 2WC9A 1Z26A 4DR4K 2ASMA 5ELZA 3ASMA 1JLBA 4FWKA 4JEPA 2P5GA 1O13A 2Q0UA 1J54A 4FLUA 3PO5A 1JL1A 4O55A 1TKXA 4NCBA 1VQ4N 1VQON 1X9MA 4IOAL 4NLBA 3HZ6A 4J2AA 1A5XA 2ASOA 3P1GA 4C1NK 4CJEA 4DR3K 1Q7YO 1HNZK 4M63C 2NRTA 4E3SA 3QFPA 1TKDA 3KLIA 4LF7K 1WSFA 2O8CA 4ZTFA 4Q0BA 4JYAK 5E26A 1VSEA 4KH6A 1NGHA 4FJKA 3HXMA 4DSEA 3THXB 3KD5E 2BANA 4FM2A 4GY2B 1QQMA 2VWJA 3H1VX 3SLCA 3CF5L 1FJGK 3OYEA 5GIOA 3O9QA 4FLZA 3OYNA 5AQHA 3ITHA 1RBRA 3HBTA 4DUYK 4HCBA 1X9SA 3HVRA 2WTUA 2IVPA 3WNEA 1HKBA 4I7FA 2PY5A 1JLCA 3QLHA 4FLXA 1OH7A 1YTUA 1GOBA 1BOTO 4AHUA 4CJUA 2I7NA 1I39A 3AVAA 2Q1NA 3WQTA 4O5BA 5KGXA 1EWRA 1MWKA 4KFBA 4FZYA 5M1FA 1LV5A 2OTLN 5J2NA 3MXMA 1T3VA 3NF7A 1XNQK 2FBYA 2GV9A 1GLEG 4H5NA 3RRGA 4JKEA 1S1XA 1GOCA 1LOTB 1TUUA 3M8QA 3DLKA 1IJJA 3TAMA 2P9SA 1E4GT 1OH6A 3NGIA 4A59A 3MN9A 3P4IA 2JGUA 3L2VA 5J1EA 3AVLA 4B9LA 4BRNA 2BGGA 3SYZA 2OTJN 4DLEA 4BR4A 3L0QA 2O4GA 4BR5A 4DR5K 1V4SA 4FVUA 1EX4A 4FWNA 2QW9A 3ATVA 1NU0A 3O3GA 2IGIA 2P9LB 3BZCA 4CECA 1HJRA 1BIZA 4FL9A 4BRIA 5HRPA 3O3FA 3PSFA 4OPJA 5BRHA 4DLGA 3VEOA 4CJTA 1YJ9N 3OTOK 3VENA 4YHHK 3CCSN 4KHUA 3UB5A 4H03B 3V9UA 2ITGA 5BREA 3EO3A 2E2PA 3GE1A 5DM7L 4YOYA 4KHNA 2P9PA 3MEDA 4QS9A 2ZGYA 3HP6A 3SQ4A 2PYLA 1KD1O 1VSJA 2YCHA 4K42A 4HWIA 3VQ4A 3J7YP 3L2UA 5BR9A 1EP4A 4DQSA 4BE0A 4DS5A 1JJ2M 4JV5K 4I2PA 4BRHA 4M41A 3KVGA 2E1ZA 4DTOA 3S3OA 4IEIA 4FJGA 2HVIA 4BDYA 3VMFB 2KZZA 4JS5A 3KKSA 1NM1A 3F9MA 3NBPA 3TTCA 3DWLA 3VA3A 4CZEA 3JXUA 2X6NA 3KWGA 1EWQA 4I9LA 1QQOA 1WSJA 4CE9A 3V9SA 2E8AA 3CG7A 1GLAG 5CZ2A 2F4VK 3RR8A 2HHQA 4CESA 4E89A 2GELA 1G15A 5AFUA 3I33A 3RMDA 5AJ3K 2HSTA 1XNRK 4YDUC 1OVYA 3CCVN 1IBKK 3O80A 1NK5A 5AZIA 2PYJA 3QDKA 1BU6O 1RCHA 4AHTA 1CXQA 3MAQA 3FFIA 1QS4A 5EY4A 3QEIA 3THWA 4DTMA 4WFAL 3V9WA 1REVA 4MLEA 4CJSA 3ULDA 1WN7A 4PKHA 3HI0A 3LPTA 3MN7A 4CJ4A 3ZETB 1HR0K 4FO0A 3OYGA 2Q36A 3FZLA 5KPRA 4FOIA 4FWLA 4LF9K 4BC3A 2QWMA 4F3TA 3L2WA 4DV7K 3ZCMA 2O8CB 1BCOA 3AAQA 1JLGA 4KH5A 3SQ2A 2YNIA 4GVMA 5K14A 3DLRA 3MWTA 4A62A 1IO2A 2NRRA 4BVOA 4I2QA 3DOKA 3CERA 1I3AA
chains in the Genus database with same CATH topology
3SMPA 5EVZA 2H3GX 5H1SQ 1DEJA 4YOTA 1YHQN 4PL8A 1K73O 3EL2A 5AQRA 3DJCA 4C23A 3IDHA 4ISEA 2NNWA 4HTLA 5AZJB 2WBNA 4JKFA 3FLCO 3HM8A 5KPZA 3CJAA 3GBTA 1HKCA 4H0PA 3ID6A 4DKWA 4BC2A 4BROA 5FPEA 4XH4A 1YVNA 2NRVA 3EKSA 1YF5L 4IOXA 1SAZA 3O9TA 1U2VB 4JKBA 4B9QA 3ULEB 4H0OA 1YI2N 2D1KA 4H0TB 4CZJA 3SK3A 3LDPA 5BN9A 1C0FA 2IVOA 4JD2A 4BRMA 4YORA 1NGIA 3A5OC 3H3NO 5FPMA 2KLAA 3E9LA 3H45C 3R1XA 3MN5A 4B1WB 3EZWA 3DXMB 4A2BA 3G71N 1VQ5N 3L6QA 3ID8A 1KC8O 4ILJA 4FWMA 1Y64A 1HPMA 4I6MA 3SBGA 5BN8A 4BRDA 3U8XA 2P9SB 4WFNL 3SJHA 3I8BA 2P9UA 3GOIA 3N4QA 1HLUA 3CQYA 3CPEA 2YX6A 3CPWM 5AQIA 3F5TA 2QI2A 1NWKA 4ILGB 1P90A 1R59O 4PHTX 4JKGB 4BREA 1WOQA 3CCRN 4BRGA 3S41A 1G99A 3TSUA 3O9SA 1QVFM 4IFEA 1Q18A 3Q7BA 1BDGA 3DLLL 5EXWA 2RE2A 1NGFA 4JAXA 3EE9A 3A0IX 4WQ5A 3UE5A 4FOEA 2GWKA 4EIAA 4H5TA 2HBJA 3UKRA 1JCEA 4EHUA 3BF3A 3HOSA 4GV9A 2EWSA 3EN9A 2PAVA 3VF4A 2BUPA 4GV6A 4BRCA 4PKGA 4BQZA 4AM7A 2VGNA 1JCFA 2E88A 3CETA 3C65A 2PBDA 5AQNA 3QFUA 5AQZA 3AGKA 2Q0RA 4MDBA 3R9PA 1Z05A 5M1QA 2D0OA 3H46O 5ADXA 1NGAA 2IIRA 1V4TA 4FPAA 5C0YA 3BUZB 2NRWA 5AQTA 3P39A 5JICA 5BPNA 2UYTA 4QS7A 4CBXA 1BWFO 4WCEL 4JNEA 5AQSA 2ZJPL 4IZ9A 3TSPA 2A40A 2P9PB 4Z94A 4IOCL 3MCPA 4MDAA 4M7YA 2PFUA 2V52B 4YDUA 1VQ8N 3VGKA 1ATNA 1SS6A 3D2EA 4H5RA 5EOYA 2P9IA 4BRKA 3CQXA 3H1QA 2P9UB 3HRGA 5C2DA 3WT0A 4GNIA 3H3OB 1EQYA 1NGDA 3VEXA 3FZHA 4JN4A 1NMDA 3UKUA 2J4RA 4ISFA 1N8RO 2NRHA 1P8ZA 4BR9A 4H5WA 5GAEP 3WXJA 2ITMA 3MDQA 2A41A 3ZX2A 5MLCQ 4CD3A 4BVPA 5AQJA 3VF2A 1BA0A 3BF1A 3KK7A 2E2OA 4EFHA 5JLHA 3IFRA 1YIJN 3CJBA 3M6GA 5HOOA 3CMAN 5CE3A 3WUHA 2VYPA 3VTIA 1NGJA 1QQNA 3FGUA 1K8KB 2JWKA 4AF1A 3C6AA 4Y0WA 3A5LC 3C7NB 1TYQA 2NLXA 3LM2A 1T6DA 4JHDB 3FZMA 2ZGZA 4BRFA 4CZLA 1NLVA 3CC7N 3CHWA 1CZAN 2ASPA 2HF4A 2HOEA 1ATSA 5M1KA 2QWOA 1DGKN 1VQPN 4XEIA 5TKWA 3I55N 1M90O 5JVHL 3T69A 4IJAA 1QZ5A 2A42A 5CHIA 3G4SN 3WXLA 3U4LA 4YOVA 3O6WA 2QTDA 2DPNA 2FXUA 1HUXA 2YI1A 1X3NA 4H0YB 3DAWA 4FPBA 3ZX3A 1W97L 4LC9B 3RVCA 5AZIB 2D4WA 3ZYYX 3GL1A 4B1UB 5JMVA 3PLAA 4FSVA 2P9IB 1T44A 5BPLA 2P9NA 5B8HA 5M1OA 2YHYA 3AGRA 3VETA 4JK8A 4CZIA 3OW2M 2QWRA 4O5FA 1NBWA 3ZEUB 4A2AA 4EHTA 2ZJRL 3TTFA 1VQNN 1NGEA 1Q86O 1YITN 2QWLA 1RGIA 3WXIA 3AARA 2HBLA 2Q31A 5AQFA 3SBTA 5KQDA 5C12A 2YJEA 2FF3B 4PKIA 3GDQA 2QEXN 3L4IA 2VGMA 3MWPA 3IMXA 1XUPO 1QVGM 3HTVA 4GVEA 3QBWA 3RSEB 4WFBL 1VAZA 4CBUA 5LY3A 2FF6A 5CR4A 3E1YA 3PIPL 3O4WA 3LDOA 2AA4A 5AQQA 2BTFA 4XH5A 4BC4A 2KHOA 2CGKA 3KZBA 3E9OA 3VF6A 1GLFO 3FE1A 3TSQA 5M1NA 3E66A 2HMPA 3WEEA 2QA4N 4OPAA 1S72N 3VERA 4WQ4C 2A6AA 1SQKA 4R79A 3SMSA 3O9UA 4L3QA 4BGBA 1NJIO 1S3XA 1M1KO 1VQ6N 2GEMA 4G9ZA 3NVKA 3QB0A 5AQOA 4A61A 1KAXA 2F9TA 5M1PA 3WQUA 3CC2N 4PL7A 2F7TA 2HBMA 2YHWA 4BY9C 1VQKN 3CI5A 2WFBA 3OHRA 4K41A 4FWRA 4BR7A 3DXKA 4CZFA 2WC9A 2NRXA 3G6EN 3M3ZA 5AQKA 4O8KA 1K8AO 2P9NB 2ASMA 3D2FA 4NLCA 1YXQA 3R6MA 4J8FA 5ELZA 3CCUN 4UY8O 1VQ9N 1BG3A 3A5NC 4FWKA 4JEPA 4IXCA 1O13A 2Q0UA 3WXMB 3FFKB 2ZWHA 2CGLA 4B1ZA 1LCUA 3EE8A 1VQ4N 3O8MA 1ZBSA 1VQON 4IOAL 4NLBA 3HZ6A 2ASOA 2Q2RA 3T7ZA 1RDUA 4JD2B 4C1NK 1Q7YO 4M63C 2NRTA 4KBOA 2D0PA 3D7EO 3QFPA 3PIOL 1YUWA 2E2NA 3CIPA 2P9KA 4JKCA 5FPDA 1Q81O 4K25A 1IG8A 2GWJA 5BRFA 2QWNA 3VEVA 1D4XA 1GLCG 1GLBG 4CD1A 4B1VA 4U7BA 4I6MB 3Q7CA 4K43A 3VOVA 2E1YA 4H0XB 5E26A 3WEEB 3CCEN 3CCLN 4BRAA 3P31A 1NGHA 4JKDA 4KH6A 5AFUH 4QS8A 1BA1A 4F9OA 4KH4A 3CCMN 3KHYA 3SAFA 5C15A 4GY2B 1QQMA 3CXCM 3GG4A 4E1JA 3H1VX 3SLCA 3CF5L 1ATRA 4MO4A 3NVMA 4BR0A 3W3DA 5GIOA 3O9QA 3CJCA 1MA9B 3O1WA 3OBYA 4YOUA 1BO5O 5AQHA 5AZJA 3MCAB 3HBTA 2E20A 3DXKB 5JLFA 5GAHP 1C0GA 4AM6A 2HF3A 2IVPA 1HKBA 3MX2A 4BGAA 3NMUA 1KAYA 3LL3A 5TKYA 1QZ6A 3E9PA 3UKRB 2P9LA 2VCPA 1MWMA 1SZ2A 3SAHA 5DM6L 3VEZA 3VEYA 2F9WA 1BOTO 5JVGL 1U2VA 2I7NA 3ULEA 2Q1NA 3WQTA 2KKZA 2QXLA 1MWKA 5M1FA 3FZFA 2OTLN 3B8AX 3HSCA 4A5AA 1HJOA 1T3VA 4CZHA 2GTDA 2QM1A 3C0BA 5E84A 2V51B 1GLEG 1ZXOA 5AQWA 3O08A 4H5NA 4BG9A 2V7YA 1LOTB 2FSNA 3M1FA 4JKEA 1YJWN 1TUUA 3O1BA 5AQUA 5C2FA 5LJWA 3VTHA 4IEEA 4FWPA 5F1XA 4C1NI 1IJJA 3D2EB 2WUSA 3K9KA 1X9JA 2I7PA 2P9SA 1E4GT 1HKGA 2BH1A 4A59A 3LDNA 1XC3A 3MN9A 3P4IA 1YJNN 1S22A 3UKUB 3H6EA 3A5MC 4RTFD 1ILYA 4FWOA 3CJ7A 4YOWA 4IO9L 1ZC6A 4EAHD 4FWSA 4BQLA 2V7ZA 4BRNA 4JKGA 2OTJN 5BPMA 2GUPA 4BR4A 4O8UA 3TU5A 3ENBA 3L0QA 3D6RA 4OPHA 4BR5A 4CJ7A 1V4SA 4FVUA 4FWNA 3JS6A 1J6ZA 3KWIA 4JKAA 3LM9A 5EX5A 3R8EA 2QW9A 2CH6A 4JKHA 2A3ZA 3ATVA 3AY9A 4B1YB 1Q82O 1X3MA 2P9LB 4IJNA 1VQMN 4FL9A 3ZX0A 3FR0A 4BRIA 2A5XA 3IKMA 1TYQB 1BUPA 3L4QA 5BRHA 4BG8A 3MMVA 5AQVA 3VEOA 3VPZA 5GINA 1YJ9N 4GV3A 3VENA 4WQ4A 3CCSN 1XQSC 4RWTA 4RCHA 3FZKA 4CBWA 3ENHA 5GIPA 3UB5A 1RFQA 2AP1A 4H03B 3CD6N 2YHXA 4BRPA 1DT9A 5AQPA 2NRZA 2VWBA 4ISGA 1QHAA 3M5RA 3CC4N 5BREA 2CGJA 3CJ9A 3EO3A 2E2PA 3GE1A 5KPTA 2YJFA 4NB4A 3OA9A 2P9PA 4QS9A 5DM7L 4YOYA 2JWLA 2ZGYA 4IDHA 3I56N 3LDLA 3A8YA 3G25A 1KD1O 1TUYA 2W41A 3CMEN 1WUAA 5LJVA 2YCHA 5HL7L 4K42A 4HWIA 1NGCA 2ZJQL 4BRQA 1T6CA 5BR9A 3OBWA 3QBXA 4JK7A 5FPNA 1JJ2M 3P38A 4DHYA 5AR0A 5GAGP 1JCGA 3BP8A 4BRHA 3KVGA 2E1ZA 5C10A 4IEIA 3TPQA 5F0XA 1Z6RA 3ZETA 3VMFB 2QWQA 3WXKA 3F2KA 4BR2A 3VGMA 5GADP 1NM1A 3F9MA 4WQ5C 4A57A 4MLHA 4OO1J 1DKGD 5AQMA 4IWVA 5AQGA 3MX5A 3MN6A 3TTCA 1W2BM 3DWLA 3ATUA 1K8KA 4CZEA 1U6ZA 3JXUA 3KWGA 1KAZA 3C7NA 4H0VB 1E4FT 3LDQA 5AQYA 3U9ZA 3HOTA 1VQLN 1QQOA 4JHDA 1HX1A 1ESVA 2E8AA 2RHKA 3TTDA 4CZKA 1GLAG 2QWPA 3N4PA 5ADXH 3O9RA 4DB3A 4YOXA 3J7ZO 4MO5A 2ZF5O 2GELA 4XH1A 1K9MO 5AFUA 3VGLA 2W40A 3CCQN 3I33A 4CZGA 2FSKA 3MK6A 4WYBA 5AQXA 2E2QA 4M7XA 2HSTA 1EO1A 3W0LA 4B1XB 4YDUC 1OVYA 3CCVN 3O80A 3CCJN 3CJ1A 5AZIA 1GLDG 2CH5A 3QDKA 4IO8A 1BU6O 1GLJO 3D2FB 1MDUB 3U9DA 3R3LA 4U67L 5EY4A 3QMLA 3ZEUA 1VQ7N 3C6HA 4H5VA 4WFAL 1KXPA 4FWQA 5I9EB 1OKJA 2OANA 2IVNA 2Q97A 4MLEA 3VEWA 1NGGA 4PKHA 3AAPA 2GX9A 3HI0A 3MN7A 2NZTA 3ZETB 3K9JA 4NO7A 4FO0A 2Q36A 1RDWX 3FZLA 4ILHA 5KPRA 3SAGA 4FOIA 2FLOA 4FWLA 3RSEA 2P9KB 2HBKA 2QWMA 3J8AA 4BC3A 5KQ8A 3BEXA 3EKUA 1H1VA 4DCHA 4CI6A 5BRDA 3AAQA 4WF9L 3DXMA 4KH5A 4BC5A 3QICA 5AQLA 1KQSM 3MWTA 1NGBA 4A62A 4CZMA 4DQ8A 1GLLO 1YAGA 2NRRA 3O5BA 4BVOA 4BRLA 3CERA 4A5BA 3VESA 2FSJA 4JK9A 3IUCA 3ENOA 5F2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SMP A;  5EVZ A;  2H3G X;  1DEJ A;  4PL8 A;  3EL2 A;  5AQR A;  3DJC A;  4C23 A;  3IDH A;  4ISE A;  4HTL A;  5AZJ B;  3FLC O;  3HM8 A;  5KPZ A;  3CJA A;  3GBT A;  1HKC A;  4H0P A;  4BC2 A;  4BRO A;  5FPE A;  4XH4 A;  1YVN A;  3EKS A;  1SAZ A;  1U2V B;  4B9Q A;  3ULE B;  4H0O A;  2D1K A;  4H0T B;  4CZJ A;  3SK3 A;  3LDP A;  5BN9 A;  1C0F A;  2IVO A;  4JD2 A;  4BRM A;  1NGI A;  3A5O C;  3H3N O;  5FPM A;  3H45 C;  3MN5 A;  4B1W B;  3EZW A;  3DXM B;  4A2B A;  3L6Q A;  3ID8 A;  4FWM A;  1Y64 A;  1HPM A;  4I6M A;  5BN8 A;  4BRD A;  3U8X A;  2P9S B;  3SJH A;  3I8B A;  2P9U A;  3GOI A;  1HLU A;  3CQY A;  5AQI A;  1NWK A;  1R59 O;  4BRE A;  1WOQ A;  4BRG A;  3S41 A;  1G99 A;  1Q18 A;  1BDG A;  5EXW A;  1NGF A;  4JAX A;  3A0I X;  4WQ5 A;  3UE5 A;  4FOE A;  2GWK A;  4EIA A;  4H5T A;  3UKR A;  1JCE A;  4EHU A;  3BF3 A;  2EWS A;  3EN9 A;  2PAV A;  3VF4 A;  2BUP A;  4BRC A;  4PKG A;  4BQZ A;  4AM7 A;  1JCF A;  2E88 A;  3CET A;  2PBD A;  5AQN A;  3QFU A;  5AQZ A;  2Q0R A;  3R9P A;  1Z05 A;  2D0O A;  3H46 O;  5ADX A;  1NGA A;  2IIR A;  1V4T A;  4FPA A;  3BUZ B;  5AQT A;  5JIC A;  5BPN A;  2UYT A;  4QS7 A;  4CBX A;  1BWF O;  4JNE A;  5AQS A;  4IZ9 A;  4Z94 A;  2A40 A;  2P9P B;  3MCP A;  4M7Y A;  2V52 B;  4YDU A;  3VGK A;  1ATN A;  3D2E A;  4H5R A;  5EOY A;  2P9I A;  4BRK A;  3CQX A;  3H1Q A;  2P9U B;  3WT0 A;  4GNI A;  3H3O B;  1EQY A;  1NGD A;  3VEX A;  3FZH A;  4JN4 A;  1NMD A;  3UKU A;  2J4R A;  4ISF A;  2NRH A;  1P8Z A;  4BR9 A;  4H5W A;  3WXJ A;  2ITM A;  3MDQ A;  2A41 A;  3ZX2 A;  4CD3 A;  4BVP A;  5AQJ A;  3VF2 A;  1BA0 A;  3BF1 A;  2E2O A;  4EFH A;  5JLH A;  3IFR A;  3CJB A;  3M6G A;  5CE3 A;  3WUH A;  2VYP A;  1NGJ A;  1QQN A;  3FGU A;  1K8K B;  4Y0W A;  3A5L C;  3C7N B;  1TYQ A;  2NLX A;  3LM2 A;  1T6D A;  4JHD B;  3FZM A;  2ZGZ A;  4BRF A;  4CZL A;  1NLV A;  3CHW A;  1CZA N;  2ASP A;  2HF4 A;  2HOE A;  1ATS A;  2QWO A;  1DGK N;  4XEI A;  4IJA A;  1QZ5 A;  2A42 A;  3WXL A;  3U4L A;  3O6W A;  2DPN A;  2FXU A;  1HUX A;  2YI1 A;  1X3N A;  4H0Y B;  3DAW A;  4FPB A;  3ZX3 A;  4LC9 B;  5AZI B;  2D4W A;  4B1U B;  3GL1 A;  5JMV A;  4FSV A;  2P9I B;  1T44 A;  5BPL A;  2P9N A;  5B8H A;  2YHY A;  3VET A;  4CZI A;  2QWR A;  4O5F A;  1NBW A;  3ZEU B;  4A2A A;  4EHT A;  1NGE A;  2QWL A;  1RGI A;  3WXI A;  3AAR A;  2Q31 A;  5AQF A;  5KQD A;  2YJE A;  2FF3 B;  4PKI A;  3GDQ A;  3L4I A;  3IMX A;  1XUP O;  3HTV A;  3RSE B;  3QBW A;  5LY3 A;  4CBU A;  2FF6 A;  3O4W A;  3LDO A;  2AA4 A;  5AQQ A;  2BTF A;  4XH5 A;  4BC4 A;  2KHO A;  2CGK A;  3KZB A;  3VF6 A;  1GLF O;  3FE1 A;  3WEE A;  2HMP A;  3VER A;  4WQ4 C;  2A6A A;  1SQK A;  3SMS A;  4L3Q A;  4BGB A;  1S3X A;  2GEM A;  3QB0 A;  5AQO A;  4A61 A;  1KAX A;  2F9T A;  3WQU A;  4PL7 A;  2YHW A;  3CI5 A;  3OHR A;  4K41 A;  4FWR A;  4BR7 A;  3DXK A;  4CZF A;  3M3Z A;  5AQK A;  4O8K A;  2P9N B;  2ASM A;  3D2F A;  5ELZ A;  1YXQ A;  3R6M A;  4J8F A;  1BG3 A;  3A5N C;  4FWK A;  4IXC A;  2Q0U A;  3FFK B;  2ZWH A;  2CGL A;  4B1Z A;  1LCU A;  3O8M A;  1ZBS A;  3HZ6 A;  2ASO A;  2Q2R A;  4JD2 B;  4M63 C;  4KBO A;  2D0P A;  3D7E O;  3QFP A;  1YUW A;  2E2N A;  3CIP A;  2P9K A;  5FPD A;  4K25 A;  1IG8 A;  2GWJ A;  5BRF A;  2QWN A;  3VEV A;  1D4X A;  1GLC G;  1GLB G;  4CD1 A;  4B1V A;  4I6M B;  4K43 A;  3VOV A;  2E1Y A;  4H0X B;  5E26 A;  3WEE B;  4BRA A;  1NGH A;  5AFU H;  4QS8 A;  1BA1 A;  4F9O A;  3KHY A;  4GY2 B;  1QQM A;  3GG4 A;  4E1J A;  3H1V X;  3SLC A;  1ATR A;  4MO4 A;  4BR0 A;  3W3D A;  3CJC A;  1MA9 B;  3O1W A;  1BO5 O;  5AQH A;  5AZJ A;  3HBT A;  2E20 A;  3DXK B;  5JLF A;  1C0G A;  4AM6 A;  2HF3 A;  2IVP A;  1HKB A;  4BGA A;  1KAY A;  3LL3 A;  5TKY A;  1QZ6 A;  3UKR B;  2P9L A;  2VCP A;  1MWM A;  1SZ2 A;  3VEZ A;  3VEY A;  2F9W A;  1BOT O;  1U2V A;  2I7N A;  3ULE A;  2Q1N A;  3WQT A;  2QXL A;  1MWK A;  3FZF A;  3B8A X;  3HSC A;  1HJO A;  4CZH A;  2GTD A;  2QM1 A;  3C0B A;  5E84 A;  2V51 B;  1GLE G;  1ZXO A;  5AQW A;  3O08 A;  4H5N A;  4BG9 A;  2V7Y A;  1LOT B;  2FSN A;  3M1F A;  1TUU A;  3O1B A;  5AQU A;  5LJW A;  4FWP A;  5F1X A;  3D2E B;  1IJJ A;  2WUS A;  1X9J A;  2I7P A;  2P9S A;  1E4G T;  1HKG A;  3LDN A;  1XC3 A;  3MN9 A;  3P4I A;  1S22 A;  3UKU B;  3H6E A;  3A5M C;  4RTF D;  4FWO A;  3CJ7 A;  1ZC6 A;  4EAH D;  4FWS A;  4BQL A;  2V7Z A;  4BRN A;  5BPM A;  2GUP A;  4BR4 A;  3TU5 A;  3L0Q A;  4BR5 A;  4CJ7 A;  1V4S A;  4FWN A;  3JS6 A;  1J6Z A;  3LM9 A;  5EX5 A;  3R8E A;  2QW9 A;  2CH6 A;  2A3Z A;  3ATV A;  3AY9 A;  4B1Y B;  1X3M A;  2P9L B;  4IJN A;  4FL9 A;  3ZX0 A;  3FR0 A;  4BRI A;  2A5X A;  1TYQ B;  1BUP A;  5BRH A;  4BG8 A;  3MMV A;  5AQV A;  3VEO A;  3VPZ A;  3VEN A;  4WQ4 A;  1XQS C;  4RWT A;  4RCH A;  3FZK A;  4CBW A;  3ENH A;  3UB5 A;  1RFQ A;  2AP1 A;  4H03 B;  2YHX A;  4BRP A;  5AQP A;  2VWB A;  4ISG A;  1QHA A;  5BRE A;  2CGJ A;  3CJ9 A;  3EO3 A;  2E2P A;  3GE1 A;  5KPT A;  2YJF A;  4NB4 A;  2P9P A;  4QS9 A;  2ZGY A;  3LDL A;  3A8Y A;  3G25 A;  1TUY A;  2W41 A;  1WUA A;  5LJV A;  2YCH A;  4K42 A;  4HWI A;  1NGC A;  4BRQ A;  1T6C A;  5BR9 A;  3QBX A;  5FPN A;  4DHY A;  5AR0 A;  1JCG A;  3BP8 A;  4BRH A;  3KVG A;  2E1Z A;  3TPQ A;  5F0X A;  1Z6R A;  3ZET A;  2QWQ A;  3WXK A;  4BR2 A;  3VGM A;  1NM1 A;  3F9M A;  4WQ5 C;  4MLH A;  1DKG D;  5AQM A;  4IWV A;  5AQG A;  3MN6 A;  3DWL A;  3ATU A;  1K8K A;  4CZE A;  1U6Z A;  3JXU A;  1KAZ A;  3C7N A;  4H0V B;  1E4F T;  3LDQ A;  5AQY A;  3U9Z A;  1QQO A;  4JHD A;  1HX1 A;  1ESV A;  2E8A A;  4CZK A;  1GLA G;  2QWP A;  5ADX H;  4DB3 A;  4MO5 A;  2ZF5 O;  2GEL A;  4XH1 A;  5AFU A;  3VGL A;  2W40 A;  3I33 A;  4CZG A;  2FSK A;  3MK6 A;  4WYB A;  5AQX A;  2E2Q A;  4M7X A;  3W0L A;  4B1X B;  4YDU C;  3O80 A;  3CJ1 A;  5AZI A;  1GLD G;  2CH5 A;  3QDK A;  4IO8 A;  1BU6 O;  1GLJ O;  3D2F B;  1MDU B;  3U9D A;  5EY4 A;  3QML A;  3ZEU A;  4H5V A;  1KXP A;  4FWQ A;  5I9E B;  1OKJ A;  2OAN A;  2IVN A;  2Q97 A;  4MLE A;  3VEW A;  1NGG A;  4PKH A;  3AAP A;  3HI0 A;  3MN7 A;  2NZT A;  3ZET B;  4NO7 A;  4FO0 A;  2Q36 A;  1RDW X;  3FZL A;  5KPR A;  4FOI A;  2FLO A;  4FWL A;  3RSE A;  2P9K B;  2QWM A;  3J8A A;  4BC3 A;  5KQ8 A;  3BEX A;  3EKU A;  1H1V A;  4DCH A;  4CI6 A;  5BRD A;  3AAQ A;  3DXM A;  4BC5 A;  3QIC A;  5AQL A;  1NGB A;  4A62 A;  4CZM A;  4DQ8 A;  1GLL O;  1YAG A;  4BVO A;  3O5B A;  4BRL A;  3CER A;  3VES A;  2FSJ A;  3IUC A;  3ENO A;  5F2R A; 
#chains in the Genus database with same CATH topology
 1N6Q A;  5H1S Q;  1DEJ A;  1SKW A;  2YNF A;  1WNS A;  3V9Z A;  1K73 O;  2HHS A;  1JXB A;  1RDA A;  4HTL A;  4OGE A;  3NH1 A;  2D5R A;  3IS9 A;  3BY5 A;  4JRP A;  4KTW A;  3CM5 A;  4H0P A;  4FJN A;  1YF5 L;  3O9T A;  3AVN A;  2OCE A;  4CIE A;  4EZ9 A;  2D1K A;  1RBS A;  4BWM A;  1ZYQ A;  5BN9 A;  1C0F A;  4JI4 K;  4FJX A;  3THV A;  3V6D A;  3R1X A;  3WNF A;  2HNY A;  1VQ5 N;  1KFS A;  3DXM B;  4Y1D A;  3ALY A;  3AVB A;  3ID8 A;  4ILJ A;  4FWM A;  1HPM A;  4QOZ B;  5BN8 A;  2QK9 A;  4BRD A;  2IDO A;  2P9S B;  4KHY A;  3SJH A;  4CGF A;  3OYB A;  3QEV A;  1VSK A;  1QSL A;  4CFA A;  3ZSO A;  2QI2 A;  3ZT1 A;  4BRE A;  4KHS A;  2O8F A;  3OS2 A;  1SL0 A;  3LP1 A;  3KK1 A;  1HRH A;  2XY6 A;  3A0I X;  2D0C A;  3UE5 A;  3SUP A;  2HBJ A;  1JCE A;  3L3U A;  4GMJ B;  3HOS A;  4FW2 A;  3EN9 A;  4GV9 A;  2QXF A;  4DQR A;  3VF4 A;  2KQ2 A;  4PKG A;  2O8B A;  5FRN A;  2E88 A;  3EY1 A;  3CET A;  4BE2 A;  3NCI A;  4FJ7 A;  3C6T A;  3QFU A;  3AGK A;  2YKM A;  5C0Y A;  3J7A P;  3BUZ B;  3CYM A;  3P39 A;  5JIC A;  5BPN A;  5KI6 A;  2KFN A;  2DY4 A;  4Z94 A;  2A40 A;  2P9P B;  4M7Y A;  4YDU A;  4E7J A;  1SS6 A;  4H5R A;  1XC9 A;  5HRR A;  4BRK A;  3BZK A;  4DV6 K;  1KTQ A;  1EQY A;  3JYT A;  4JN4 A;  3UKU A;  3QNO A;  4FLW A;  1N8R O;  2NRH A;  1VSI A;  1TV6 A;  2IAJ A;  1NKC A;  4R5P A;  2YNG A;  4CD3 A;  4RG8 A;  3M8S A;  5FLX O;  2E2O A;  1ZBF A;  5HOO A;  4J2E A;  4L8R B;  3T1Y K;  3WUH A;  3HM9 A;  3FGU A;  1S6Q A;  3C6A A;  1WBD A;  4KKO A;  3O3H A;  1TYQ A;  3KD1 E;  2P5O A;  1T6D A;  4CIG A;  3TAE A;  2HF4 A;  4CGH A;  1ATS A;  1DGK N;  1VQP N;  3I55 N;  1U48 A;  3PUF A;  3ZT4 A;  3T3F A;  3G10 A;  3LP0 A;  1VSH A;  3KJV A;  5JVH L;  1EXQ A;  4E7K A;  2IS3 A;  1CLQ A;  5CHI A;  4LSN A;  3U4L A;  1RT4 A;  4EZ6 A;  2FXU A;  3NGY A;  5AZI B;  3GL1 A;  4JK8 A;  2QWR A;  1NBW A;  4CK2 A;  3TTF A;  1VQN N;  1NGE A;  1Q86 O;  1YIT N;  2QWL A;  2HBL A;  1TK5 A;  1U4B A;  4I9Q A;  2ETJ A;  2QEX N;  3RWU A;  2VGM A;  1HNI A;  4GVE A;  3DM2 A;  4O0J A;  4CBU A;  1C0U A;  3E1Y A;  3CQ8 A;  4B08 A;  1VRU A;  3CM6 A;  2CGK A;  3KZB A;  1SKR A;  3DRR A;  3FE1 A;  2QA4 N;  1S72 N;  1RT6 A;  1NJX A;  4FW1 A;  1HPZ A;  4BGB A;  1S3X A;  2P51 A;  3BDP A;  3I0R A;  1L3S A;  3QB0 A;  5AQO A;  4A61 A;  1KAX A;  3NVK A;  4CCH A;  1SV5 A;  4BY9 C;  4DSK A;  3U3Y A;  1KSP A;  4FWR A;  1JLE A;  4CZF A;  3DLB A;  1QSS A;  3G6E N;  3M3Z A;  4DQI A;  3I8D A;  3D2F A;  4NLC A;  4J8F A;  3ZSZ A;  3WXM B;  4CJF A;  2ZWH A;  2XHB A;  1NJY A;  3J81 O;  3EE8 A;  4KRE A;  3T7Z A;  1RDU A;  5KRT A;  2D0P A;  3D7E O;  3PIO L;  4J2D A;  1BCM A;  1IKV A;  5FPD A;  4K25 A;  1UA1 A;  2GWJ A;  3M8P A;  3HPO A;  3K5N A;  1RT7 A;  2KTQ A;  4KB0 A;  5HP1 A;  1J5E K;  1KFD A;  4JI7 K;  1UOC A;  3Q7C A;  4K43 A;  5DK5 A;  3VOV A;  4HVJ A;  3S3M A;  3WEE B;  3CCL N;  4B3T K;  4JKD A;  4NXM K;  4DFM A;  3SAF A;  3KIO A;  3ZSR A;  3OYM A;  3DRP A;  5C15 A;  5C25 A;  3CXC M;  1RIL A;  3GG4 A;  3C94 A;  4BDZ A;  1ATR A;  4MO4 A;  3NVM A;  4MQ3 A;  3CJC A;  5D3G A;  4PUO A;  5AZJ A;  2E20 A;  5GAH P;  1C0G A;  4DTN A;  1QE1 A;  4CEE A;  5TKY A;  2P9L A;  1SZ2 A;  3SAH A;  3VEZ A;  4JI2 K;  2F9W A;  3QEX A;  3ULE A;  3ZLJ A;  2O8B B;  4FLY A;  2VG5 A;  2VQE K;  4CFD A;  3HSC A;  4A5A A;  2GTD A;  2QM1 A;  1BI4 B;  3F73 A;  3O08 A;  4E7H A;  4FZX C;  2V7Y A;  3M1F A;  4CEB A;  4CF9 A;  1S5J A;  4DU1 A;  3K9K A;  1RTH A;  4G1Q A;  1HKG A;  1XC3 A;  3VQC A;  2Z1I A;  4DSI A;  1YJN N;  3UKU B;  3H6E A;  3A5M C;  4FWO A;  2V7Z A;  3K0S A;  1CZB A;  3D6R A;  4OPH A;  3ZSW A;  3NF6 A;  1J6Z A;  3NH2 A;  5EX5 A;  3R8E A;  1C0M A;  4JKH A;  3SUQ A;  3AY9 A;  1X3M A;  3DRS A;  1VQM N;  4O0I A;  3VQQ A;  2A5X A;  3C6U A;  3IKM A;  1TYQ B;  1BUP A;  4BAC A;  3AO5 A;  4BG8 A;  1N36 K;  2UUA K;  3FZK A;  4CBW A;  5GIP A;  1RDC A;  2YHX A;  1XHX A;  1SL2 A;  1DT9 A;  4E1N A;  3DYA A;  4ICL A;  3M5R A;  3QO9 A;  1S9G A;  3DLE A;  5KPT A;  2YJF A;  3MEE A;  4NB4 A;  3JSM A;  3ZSY A;  3SV3 A;  1C0T A;  3I56 N;  3LDL A;  4IFY A;  3A8Y A;  4M3R A;  4JS4 A;  2W41 A;  3U3G A;  1NGC A;  4BRQ A;  1T6C A;  3HPH A;  4OPK A;  3OBW A;  3QBX A;  4JK7 A;  1BIU A;  4KO0 A;  4DHY A;  5I42 A;  1JCG A;  3BP8 A;  5C10 A;  3VQ9 A;  2G8K A;  2B4J A;  1NG9 A;  1GOA A;  3NHG A;  1Z6R A;  3H08 A;  3ZET A;  2YHB A;  3WXK A;  1W7A A;  4C8O A;  3OVN A;  4B9V A;  3VGM A;  1WLJ A;  4LFA K;  4F4K A;  3SZ2 A;  4OO1 J;  3G0Z A;  2UU9 K;  1W2B M;  1K8K A;  1E4F T;  3LDQ A;  3HOT A;  1ZBL A;  4B9T A;  1B92 A;  4X62 K;  1ESV A;  1HYZ A;  2QWP A;  5ADX H;  3N4P A;  3O9R A;  4YOX A;  3J7Z O;  4MO5 A;  1K6Y A;  4XH1 A;  1K9M O;  2KZM A;  3VGL A;  2W40 A;  3L2R A;  3OYH A;  4WYB A;  5AQX A;  3DOL A;  2E2Q A;  1EO1 A;  4CF8 A;  4B1X B;  4TSX A;  1HQE A;  3CJ1 A;  1IG9 A;  4DV4 K;  3VQ5 A;  1GLJ O;  3D2F B;  2DFF A;  4RW7 A;  4RW8 A;  1XMQ K;  5DMR A;  1KXP A;  4KHP K;  1OKJ A;  1KVC A;  1C6V A;  3AAP A;  1RDD A;  2GX9 A;  1B9F A;  4B3S K;  1RDW X;  3HVT A;  3RSE A;  3J8A A;  3AA4 A;  4DCH A;  5J2Q A;  4M3Z A;  3DXM A;  3MXJ A;  1R0A A;  4HUG A;  3QIC A;  5CYM A;  4DQ8 A;  3QIP A;  1YAG A;  4CEF A;  4DFK A;  1FXX A;  3O5B A;  4BRL A;  4A5B A;  2FSJ A;  5F2R A;  4H4M A;  2H3G X;  4B9M A;  2KFZ A;  3EL2 A;  3DJC A;  3IDH A;  2NNW A;  4ID1 A;  5AZJ B;  2WBN A;  4JKF A;  1X1P A;  5HBM A;  3FLC O;  4ELT A;  3HM8 A;  3CJA A;  4CHP A;  3D45 A;  4BC2 A;  5FDL A;  4NCG A;  5FPE A;  4XH4 A;  1YVN A;  3EKS A;  3TAF A;  4JKB A;  4KTZ A;  3ULE B;  4DTJ A;  4Z4F A;  2Y1I A;  4CF1 A;  4AHC A;  4OVL A;  4V19 S;  2IVO A;  4JD2 A;  2E5L K;  1NGI A;  3A5O C;  3PX0 A;  1FKP A;  4PA1 A;  3MEC A;  3MN5 A;  3EZW A;  2VG7 A;  3SBG A;  4WFN L;  2RN2 A;  3K5L A;  1FKO A;  5LL6 Z;  1NK6 A;  3PSI A;  2RF2 A;  3CQY A;  3ZSV A;  4CEQ A;  4CK1 A;  3F5T A;  4ILG B;  1KVA A;  1KRP A;  3CCR N;  2XY5 A;  3LZI A;  3O9S A;  2E6L A;  4O4G A;  3Q7B A;  1BDG A;  1U04 A;  2HVH A;  3DLL L;  1NGF A;  5KGW A;  3K2P A;  4ZHR A;  1FW6 A;  4M42 A;  3BF3 A;  4W5Q A;  3L2Q A;  2PAV A;  2ZM6 K;  4CK3 A;  4BRC A;  2R7Y A;  5A2Q O;  2PBD A;  1F21 A;  5AQZ A;  1Z05 A;  4FJ5 A;  4FPA A;  1NK9 A;  5AQT A;  2D0B A;  2UYT A;  4QS7 A;  4CBX A;  2G8W A;  2ZJP L;  1BQN A;  4MDA A;  1L3V A;  1IKW A;  2VG6 A;  2B6A A;  5EOY A;  2YNH A;  3CQX A;  4OX9 K;  2P9U B;  3HRG A;  3OYF A;  1W0H A;  3WT0 A;  3H3O B;  1N5Y A;  4DV1 K;  2X74 A;  4Z4H A;  4B9U A;  1DLO A;  3WXJ A;  2ITM A;  3MDQ A;  3TAR A;  1S1T A;  4DTX A;  4BVP A;  1IKY A;  3SQ0 A;  2W6K A;  4CJP A;  1RTJ A;  1YVU A;  3VF2 A;  3BF1 A;  2P1J A;  4FLT A;  2HHX A;  3IFR A;  1YIJ N;  3LAN A;  3M6G A;  4OKJ A;  5CE3 A;  2VYP A;  4DQQ A;  1K8K B;  1OH5 A;  3SQ1 A;  4CZL A;  4CHY A;  5IT9 O;  2ZGZ A;  4BRF A;  5I3U A;  4FJL A;  4F2S A;  2HOE A;  3T1H K;  4B3M K;  3S3N A;  1TL3 A;  1M90 O;  3G4S N;  4DV5 K;  3O6W A;  1IH7 A;  1HUX A;  4DQP A;  2XY8 A;  4H0Y B;  3ZX3 A;  1W97 L;  2A1R A;  4LC9 B;  3ZYY X;  5JMV A;  2P9I B;  1TAU A;  2X78 A;  5M1O A;  3VET A;  3OW2 M;  1TKZ A;  4O5F A;  4A2A A;  3OYC A;  3PO4 A;  1C1C A;  4QCL A;  1RGI A;  3AAR A;  2Q31 A;  1OH8 A;  5C12 A;  2YJE A;  3GDQ A;  3L4I A;  1XUP O;  1QVG M;  4DF4 A;  4K0K K;  4KI4 A;  3RSE B;  3QBW A;  4CEA A;  2DFH A;  4WFB L;  1WBB A;  2G8I A;  5KRS A;  5AQQ A;  2BTF A;  4XH5 A;  4LFC K;  3WNG A;  2KHO A;  1SKS A;  3E9O A;  3K5M A;  3OYA A;  5JS2 A;  3VF6 A;  5M1N A;  3TSQ A;  3TAB A;  1Q8I A;  3E66 A;  3WEE A;  2WON A;  4OPA A;  4BE1 A;  1Q9X A;  3SMS A;  4CHZ A;  4L3Q A;  1VSD A;  4CFB A;  3RMA A;  3WQU A;  2F7T A;  1TKT A;  3CI5 A;  1TGO A;  2WFB A;  3OHR A;  2FBV A;  4K41 A;  1W9H A;  4HUF A;  1T7P A;  4PWD A;  3LPU A;  2NRX A;  4C8N A;  5AQK A;  4O8K A;  2O8D B;  1K8A O;  4JI8 K;  2P9N B;  4UY8 O;  2EHG A;  3CCU N;  1VQ9 N;  1BG3 A;  3A5N C;  4IXC A;  4E19 A;  1E3M A;  2CGL A;  1LCU A;  3O8M A;  1HQU A;  2Q2R A;  3HPG A;  4JD2 B;  4FJM A;  4KBO A;  5BR8 K;  1YUW A;  3CIP A;  2P9K A;  1BI4 A;  1NOY A;  1EKE A;  3K59 A;  3HK2 A;  5BRF A;  3VEV A;  1GLC G;  3NFA A;  3M8R A;  2O4I A;  4Z4G A;  4BRA A;  2OYQ A;  1BA1 A;  4F9O A;  3CCM N;  3KHY A;  2FC0 A;  2UXD K;  4M3W A;  1BGX T;  3VQ8 A;  2IOC A;  4E1J A;  3L3V A;  4BWJ A;  3W3D A;  1MA9 B;  4F3O A;  4M3X A;  4YOU A;  3NDK A;  4DV0 K;  3LP2 A;  5JLF A;  1DTQ A;  4AM6 A;  2HF3 A;  1C1A A;  1WSE A;  3MX2 A;  4BGA A;  3VQE A;  1VK0 A;  2HNZ A;  5DM6 L;  4NYN A;  3VEY A;  3DI6 A;  5JVG L;  1U2V A;  2FBT A;  3B8A X;  4IG3 A;  1J9A A;  4KV8 A;  1X9W A;  1HJO A;  3NF8 A;  5E84 A;  2V51 B;  1ZXO A;  2FSN A;  3AO4 A;  4CJQ A;  4EP5 A;  1LAW A;  3O1B A;  5C2F A;  4FJI A;  4IEE A;  4CJW A;  5F1X A;  1S1V A;  4C1N I;  4CW7 B;  3TAQ A;  2BH1 A;  4B8A B;  1HYS A;  3LDN A;  3VQP A;  4OJR A;  2WOM A;  1ILY A;  2G8U A;  3PX6 A;  3J80 O;  3HT3 A;  3AA3 A;  5SZT A;  4IO9 L;  4FWS A;  4AIL C;  4E1M A;  5BPM A;  3AVI A;  3TU5 A;  2Z1J A;  1O1W A;  3B6P A;  1A5V A;  3OYL A;  3JS6 A;  1EET A;  3LM9 A;  4DS4 A;  1TK8 A;  4CIF A;  4B1Y B;  3SPY A;  1ITG A;  4IJN A;  4LFB K;  1NKE A;  2GBZ A;  3V81 A;  3FR0 A;  1WB9 A;  4CVN E;  3MMV A;  4CF0 A;  5GIN A;  1XQS C;  4E7L A;  2BE2 A;  4FLV A;  3ENH A;  1RFQ A;  2AP1 A;  4BRP A;  3DLH A;  2NRZ A;  2VWB A;  4OKK A;  1QHA A;  4FJH A;  2OA8 A;  1JLA A;  4IDH A;  3RRH A;  3QET A;  3CME N;  5LJV A;  1S1U A;  4DWI A;  3LAK A;  2NUB A;  3OYJ A;  1OVQ A;  2D0A A;  3P5J A;  3OJS A;  1VSL A;  3TPQ A;  5F0X A;  4DFP A;  2OPS A;  4X66 K;  4YFU A;  4HTU A;  2QWQ A;  4F8R A;  4BR2 A;  5J2M A;  1B9D A;  5GAD P;  4WQ5 C;  5AQM A;  3B6O A;  3E01 A;  3QIO A;  4IWV A;  3SI6 A;  3MN6 A;  4QAG A;  1HNW K;  3LWM A;  3ATU A;  5HLF A;  3RR7 A;  1U6Z A;  1J5O A;  2OPQ A;  4JHD A;  2EX3 A;  3TTD A;  1RBV A;  2ZF5 O;  3U6F A;  3CCQ N;  4CZG A;  1RDB A;  3PV8 A;  4CJ5 A;  4M7X A;  1RT5 A;  3W0L A;  1YTA A;  3VQ7 A;  3SUO A;  5E41 A;  1GLD G;  4HUE A;  1RTD A;  3ZT3 A;  1XMO K;  1S9E A;  4U67 L;  3AO3 A;  3SUN A;  3QML A;  3C6H A;  4H5V A;  4KHW A;  2I5J A;  4MFB A;  4FWQ A;  5I9E B;  2OAN A;  3SNN A;  2IVN A;  3VEW A;  1NGG A;  4LSL A;  3HJF A;  3SAG A;  2FLO A;  4OGC A;  4DR6 K;  2P9K B;  2HBK A;  5KQ8 A;  3KKR A;  3BEX A;  3TAP A;  3EKU A;  1H1V A;  4CI6 A;  2OPP A;  4BC5 A;  3LZJ A;  1ASV A;  1GLL O;  2QKK A;  4E0D A;  4JK9 A;  4DU3 A;  3SMP A;  4NYF A;  1YHQ N;  5AQR A;  4C23 A;  4ISE A;  4DSL A;  1J53 A;  4CJL A;  4KAZ A;  3AVK A;  4JI5 K;  4ELU A;  1LAV A;  1HKC A;  3ID6 A;  4JI3 K;  2HB5 A;  2NRV A;  4CGD A;  3TAG A;  3CFO A;  4XIU A;  1U2V B;  3T1A A;  4B9Q A;  1LWC A;  4H0O A;  4W5R A;  3LDP A;  2OZM A;  3K57 A;  4BRM A;  1D9D A;  2XO7 A;  4YOR A;  5FPM A;  2KLA A;  3I0S A;  3E9L A;  4LF5 K;  1IV0 A;  4B1W B;  2GUI A;  2HMI A;  3L6Q A;  1KC8 O;  4DTP A;  2O8E A;  1Y64 A;  1U49 A;  3TI0 A;  2JLE A;  3A2F A;  4I6M A;  4FK2 A;  4F2R A;  1VSM A;  4JLH A;  3L8B A;  2P9U A;  3GOI A;  2HHV A;  1MU2 A;  1HLU A;  3CPE A;  1T03 A;  3CPW M;  3KTQ A;  1R59 O;  3S41 A;  1G99 A;  1QVF M;  4W5O A;  3KLF A;  4WE1 A;  4IFE A;  1Q9Y A;  4LF6 K;  1ZBH A;  4NXN K;  1RNH A;  3D0P A;  3HL8 A;  4JAX A;  4IG0 A;  4WQ5 A;  4FOE A;  2GWK A;  2VWK A;  3UKR A;  1IBM K;  4EHU A;  5FRM A;  4DMN A;  4GV6 A;  1JLF A;  3V1Q A;  3ISN C;  1JCF A;  2VGN A;  1RBT A;  4KTQ A;  5AQN A;  3JAM O;  2Q0R A;  4MDB A;  1BIS A;  4KB1 A;  2D0O A;  3LAM A;  3H46 O;  5ADX A;  2IIR A;  1V4T A;  4DTS A;  4WCE L;  4JNE A;  4IZ9 A;  1WAJ A;  3TSP A;  3MCP A;  3O4N A;  3VGK A;  2B5J A;  2UUB K;  3D2E A;  4CJV A;  2P9I A;  3H1Q A;  3O4Q A;  1NK7 A;  3VEX A;  4CGG A;  3FZH A;  1NMD A;  3T19 A;  1NK4 A;  1D8Y A;  4H5W A;  3HO1 A;  5MLC Q;  3K5O A;  5J2P A;  3V9X A;  3KK7 A;  4EFH A;  5JLH A;  4KRF A;  3QNN A;  1LWE A;  1KVB A;  3KLH A;  4Y0W A;  3A5L C;  4Z4I A;  2NLX A;  4JHD B;  3FZM A;  3HST B;  4K8X A;  3CHW A;  1CZA N;  5M1K A;  2QWO A;  3EYZ A;  4XEI A;  4DG1 A;  4LD0 A;  4CF2 A;  3LDS A;  2A42 A;  2DTU A;  1QTM A;  4DV2 K;  2QTD A;  3AVJ A;  3V1O A;  4Z4E A;  1NJZ A;  2YI1 A;  1X3N A;  3AVG A;  4FPB A;  4N47 A;  3RVC A;  2D4W A;  3PLA A;  4C8L A;  2O8D A;  1T44 A;  2P9N A;  5B8H A;  4J2B A;  2YHY A;  3AGR A;  4EHT A;  4HHT A;  1JKH A;  3WXI A;  5AQF A;  1RT2 A;  5CY4 A;  4DU4 A;  2FF3 B;  4M3T A;  3IMX A;  1KLM A;  4CHN A;  2UXB K;  1VAZ A;  2FF6 A;  3PIP L;  3O4W A;  1LW0 A;  2AA4 A;  1SL1 A;  3NGZ A;  4BC4 A;  2Q3S A;  2RPI A;  1GLF O;  3QIN A;  4H4O A;  1NNE A;  5IWA K;  4WQ4 C;  2A6A A;  4R79 A;  2HHW A;  1QQC A;  3AVC A;  3O9U A;  1NJI O;  1XI1 A;  2F9T A;  4PL7 A;  3PX4 A;  1S1W A;  3SPZ A;  3ZSQ A;  3S9H A;  3DLG A;  1T05 A;  2YKN A;  4Q5V A;  3VQA A;  1YXQ A;  3R6M A;  2ZQB A;  4ID5 A;  3FFK B;  4JI0 K;  4B1Z A;  3QEW A;  4CFC A;  4IDK A;  1ZBI A;  1ZBS A;  1XHZ A;  4CER A;  4M3Y A;  3AA2 A;  2VQF K;  4FJ8 A;  2E2N A;  3OYD A;  4ELV A;  4JKC A;  1Q81 O;  4JI1 K;  1IG8 A;  5KTQ A;  2QWN A;  1D4X A;  5SWM A;  1GLB G;  2O8E B;  4CD1 A;  4B1V A;  4U7B A;  3THY A;  4I6M B;  2E1Y A;  4H0X B;  4AHR A;  3CFR A;  3CCE N;  1T8E A;  1RTI A;  3P31 A;  4DSF A;  4GW6 A;  5AFU H;  4QS8 A;  4Z0U A;  4DF8 A;  4JRQ A;  4KH4 A;  4N76 A;  1N33 K;  4FJJ A;  4BR0 A;  3AVF A;  3TR8 A;  3O1W A;  3OBY A;  1UAX A;  2ZE2 A;  1BO5 O;  1C1B A;  3MCA B;  3DXK B;  3OY9 A;  3RMC A;  4RW6 A;  4CGI A;  1HNX K;  1UA0 A;  3NMU A;  1KAY A;  3LL3 A;  4BDP A;  3UIQ A;  1QZ6 A;  3HYF A;  3E9P A;  3UKR B;  2VCP A;  1MWM A;  3AVH A;  4DTR A;  1Y97 A;  3PY8 A;  1DTT A;  4CJ3 A;  1NOZ A;  4M45 A;  2KKZ A;  2QXL A;  4FJ9 A;  4LH5 A;  3FZF A;  4CZH A;  4FZZ A;  5FRO A;  3C0B A;  4ZTJ A;  5AQW A;  1TK0 A;  4BG9 A;  1YJW N;  5AQU A;  5LJW A;  2AJQ A;  3VTH A;  4FM1 A;  3VA0 A;  5C24 A;  4FWP A;  1ZBU A;  1SUQ A;  1JL2 A;  3D2E B;  2WUS A;  1X9J A;  2I7P A;  3VQB A;  2UXC K;  1S22 A;  4RTF D;  2HND A;  1WAF A;  3CJ7 A;  4YOW A;  4FM0 A;  1ZC6 A;  4EAH D;  3V4I A;  1TAQ A;  4DTU A;  4BQL A;  4JKG A;  3ZSX A;  4DR2 K;  4B3O A;  2GUP A;  3IRX A;  4O8U A;  3ENB A;  3WNH A;  4CJ7 A;  3V1R A;  4RW4 A;  3OYI A;  3KWI A;  4JKA A;  4PQU A;  3SCX A;  2CH6 A;  2A3Z A;  4M3U A;  1Q82 O;  4AQY K;  3ZX0 A;  1VSF A;  2HW3 A;  2XRI A;  3L4Q A;  2ATQ A;  5AQV A;  4H8K A;  3VPZ A;  4GV3 A;  4WQ4 A;  1D9F A;  1IKX A;  3BGR A;  4CGJ A;  3NAE A;  4RWT A;  4RCH A;  3CD6 N;  3ZT0 A;  5AQP A;  3HP9 A;  4ISG A;  4IFV A;  5JS1 A;  3CC4 N;  2CGJ A;  2YHA A;  3CJ9 A;  1HNV A;  3OA9 A;  4NCA A;  2JWL A;  4Z4C A;  3SJJ A;  4PY5 A;  3G25 A;  3SV4 A;  1TUY A;  1WUA A;  5HL7 L;  1NK0 A;  2ZJQ L;  4LY7 A;  5FPN A;  4LH4 A;  1ASU A;  3P38 A;  5AR0 A;  5GAG P;  1TL1 A;  3AVM A;  2W42 A;  3F2K A;  1HYV A;  2XY7 A;  4A57 A;  4MLH A;  1DKG D;  1CXU A;  5AQG A;  2KW4 A;  3MX5 A;  4DR7 K;  1KAZ A;  3C7N A;  4H0V B;  5AQY A;  3U9Z A;  2Z1H A;  4DV3 K;  3QEP A;  4O44 A;  1VQL N;  4CEO A;  4GKK K;  1HX1 A;  2RHK A;  4CZK A;  3MEG A;  3LWL A;  4DB3 A;  1VRT A;  1RT3 A;  3LP3 A;  2HHU A;  1ASW A;  3OJU A;  3TWH A;  4B3R K;  3DMJ A;  2FSK A;  3MK6 A;  3QER A;  2Z1G A;  3TAN A;  4UQG A;  2IC3 A;  2PZS A;  3CCJ N;  5LMU K;  4AH9 A;  3NH0 A;  2QKB A;  3CFP A;  2CH5 A;  4IO8 A;  1MDU B;  3AV9 A;  3U9D A;  3R3L A;  3F9K A;  3ZEU A;  1VQ7 N;  2Q97 A;  4DFJ A;  2NZT A;  2UUC K;  3K9J A;  4NO7 A;  4ILH A;  1U47 A;  1I94 K;  1N34 K;  3K58 A;  3IAY A;  4CJR A;  5BRD A;  4WF9 L;  3EEQ A;  4C8M A;  3THY B;  2Y1J A;  5AQL A;  1KQS M;  4FK4 A;  1NGB A;  4CZM A;  1BHL A;  3NE6 A;  3VES A;  3IUC A;  3ZT2 A;  3ENO A;  4X64 K;  2YV0 X;  2G8F A;  1XWL A;  5EVZ A;  2HHH K;  4YOT A;  4FXD A;  4PL8 A;  1A5W A;  2G8H A;  3LAL A;  4KHQ A;  3AO2 A;  1NK8 A;  1WSH A;  5KPZ A;  3GBT A;  4DKW A;  4BRO A;  1N32 K;  1L5U A;  3THW B;  4IOX A;  1SAZ A;  3C95 A;  4Y1C A;  1QSY A;  1YI2 N;  4H0T B;  4CZJ A;  3SK3 A;  1CZ9 A;  4KI6 A;  3H3N O;  4EP4 A;  4K8Z A;  1KCF A;  2A1S A;  3H45 C;  4YNQ A;  4A2B A;  3G71 N;  4FYD A;  2F96 A;  1IBL K;  4CHO A;  2F8T A;  3KK2 A;  1LW2 A;  1WSI A;  3U8X A;  2DFE A;  1YT3 A;  3AA5 X;  3I8B A;  3RMB A;  3N4Q A;  4KPY A;  1U45 A;  2YX6 A;  3P83 D;  5AQI A;  1NMN A;  3THX A;  1VHX A;  1NWK A;  3VN5 A;  1P90 A;  4PHT X;  4JKG B;  1WOQ A;  4BRG A;  3TSU A;  1RT1 A;  4N5S A;  1Q18 A;  2E6M A;  3KLE A;  3KK3 A;  3IG1 A;  5EXW A;  2RE2 A;  3EE9 A;  4E7I A;  3NF9 A;  4EIA A;  4H5T A;  2E4L A;  5CYQ A;  2EWS A;  3OYK A;  4IBN A;  2BUP A;  4BQZ A;  4AM7 A;  3C65 A;  4FCY A;  1HMV A;  2OPR A;  3R9P A;  5M1Q A;  4W5N A;  1NGA A;  4CEZ A;  4X65 K;  2NRW A;  3QES A;  1WSG A;  5LMN K;  1NKB A;  1LWF A;  1BWF O;  1L3T A;  5AQS A;  4IOC L;  1VQ8 N;  2PFU A;  2V52 B;  4LF8 K;  1ATN A;  3RTV A;  4IKF A;  1UWB A;  1TVR A;  5C2D A;  4GNI A;  1NGD A;  3KLG A;  2J4R A;  4ISF A;  4FVM A;  1P8Z A;  4BR9 A;  4B9N A;  5GAE P;  4DUZ K;  4OLB A;  2O8F B;  2A41 A;  3ZX2 A;  5AQJ A;  1BA0 A;  3CJB A;  5CZ1 A;  3CMA N;  4AHS A;  2X6S A;  2LSN A;  3VTI A;  1NGJ A;  1QQN A;  2HHT A;  2JWK A;  4AF1 A;  4JI6 K;  5HRN A;  3C7N B;  3LM2 A;  3CC7 N;  1NLV A;  2ASP A;  4CJK A;  4HCC A;  1RBU A;  4N56 A;  5TKW A;  5HRS A;  1KLN A;  1JLQ A;  2ZD1 A;  3T69 A;  4RW9 A;  4IJA A;  4CHQ A;  4LF4 K;  1QZ5 A;  4B8C A;  1L3U A;  3WXL A;  4CED A;  4YOV A;  2DPN A;  3DAW A;  3AO1 A;  4OKE A;  4YY3 K;  4B1U B;  4FSV A;  1FK9 A;  5BPL A;  4DSJ A;  4N41 A;  2G8V A;  5EU7 A;  4CZI A;  3EZ5 A;  3ZEU B;  2ZJR L;  5T7B A;  1QHT A;  2OZS A;  5KQD A;  4DR1 K;  3SBT A;  4PKI A;  1JXE A;  3MWP A;  2BDP A;  3HTV A;  3OS1 A;  2W6L A;  5LY3 A;  4GKJ K;  5CR4 A;  3LDO A;  2FBX A;  4FK0 A;  1BL3 A;  4OLA A;  1S6P A;  3VQ6 A;  5C42 A;  4B9S A;  2HMP A;  3VER A;  1BQM A;  1SQK A;  4AHV A;  2F8S A;  1Z25 A;  3OS0 A;  1M1K O;  1VQ6 N;  2GEM A;  4G9Z A;  5M1P A;  3CC2 N;  1NJW A;  1D5A A;  4W5T A;  2YHW A;  2HBM A;  2RKI A;  4C8K A;  1VQK N;  4BR7 A;  3VQD A;  3MXI A;  3DXK A;  5HRO A;  2WC9 A;  1Z26 A;  4DR4 K;  2ASM A;  5ELZ A;  3ASM A;  1JLB A;  4FWK A;  4JEP A;  2P5G A;  1O13 A;  2Q0U A;  1J54 A;  4FLU A;  3PO5 A;  1JL1 A;  4O55 A;  1TKX A;  4NCB A;  1VQ4 N;  1VQO N;  1X9M A;  4IOA L;  4NLB A;  3HZ6 A;  4J2A A;  1A5X A;  2ASO A;  3P1G A;  4C1N K;  4CJE A;  4DR3 K;  1Q7Y O;  1HNZ K;  4M63 C;  2NRT A;  4E3S A;  3QFP A;  1TKD A;  3KLI A;  4LF7 K;  1WSF A;  2O8C A;  4ZTF A;  4Q0B A;  4JYA K;  5E26 A;  1VSE A;  4KH6 A;  1NGH A;  4FJK A;  3HXM A;  4DSE A;  3THX B;  3KD5 E;  2BAN A;  4FM2 A;  4GY2 B;  1QQM A;  2VWJ A;  3H1V X;  3SLC A;  3CF5 L;  1FJG K;  3OYE A;  5GIO A;  3O9Q A;  4FLZ A;  3OYN A;  5AQH A;  3ITH A;  1RBR A;  3HBT A;  4DUY K;  4HCB A;  1X9S A;  3HVR A;  2WTU A;  2IVP A;  3WNE A;  1HKB A;  4I7F A;  2PY5 A;  1JLC A;  3QLH A;  4FLX A;  1OH7 A;  1YTU A;  1GOB A;  1BOT O;  4AHU A;  4CJU A;  2I7N A;  1I39 A;  3AVA A;  2Q1N A;  3WQT A;  4O5B A;  5KGX A;  1EWR A;  1MWK A;  4KFB A;  4FZY A;  5M1F A;  1LV5 A;  2OTL N;  5J2N A;  3MXM A;  1T3V A;  3NF7 A;  1XNQ K;  2FBY A;  2GV9 A;  1GLE G;  4H5N A;  3RRG A;  4JKE A;  1S1X A;  1GOC A;  1LOT B;  1TUU A;  3M8Q A;  3DLK A;  1IJJ A;  3TAM A;  2P9S A;  1E4G T;  1OH6 A;  3NGI A;  4A59 A;  3MN9 A;  3P4I A;  2JGU A;  3L2V A;  5J1E A;  3AVL A;  4B9L A;  4BRN A;  2BGG A;  3SYZ A;  2OTJ N;  4DLE A;  4BR4 A;  3L0Q A;  2O4G A;  4BR5 A;  4DR5 K;  1V4S A;  4FVU A;  1EX4 A;  4FWN A;  2QW9 A;  3ATV A;  1NU0 A;  3O3G A;  2IGI A;  2P9L B;  3BZC A;  4CEC A;  1HJR A;  1BIZ A;  4FL9 A;  4BRI A;  5HRP A;  3O3F A;  3PSF A;  4OPJ A;  5BRH A;  4DLG A;  3VEO A;  4CJT A;  1YJ9 N;  3OTO K;  3VEN A;  4YHH K;  3CCS N;  4KHU A;  3UB5 A;  4H03 B;  3V9U A;  2ITG A;  5BRE A;  3EO3 A;  2E2P A;  3GE1 A;  5DM7 L;  4YOY A;  4KHN A;  2P9P A;  3MED A;  4QS9 A;  2ZGY A;  3HP6 A;  3SQ4 A;  2PYL A;  1KD1 O;  1VSJ A;  2YCH A;  4K42 A;  4HWI A;  3VQ4 A;  3J7Y P;  3L2U A;  5BR9 A;  1EP4 A;  4DQS A;  4BE0 A;  4DS5 A;  1JJ2 M;  4JV5 K;  4I2P A;  4BRH A;  4M41 A;  3KVG A;  2E1Z A;  4DTO A;  3S3O A;  4IEI A;  4FJG A;  2HVI A;  4BDY A;  3VMF B;  2KZZ A;  4JS5 A;  3KKS A;  1NM1 A;  3F9M A;  3NBP A;  3TTC A;  3DWL A;  3VA3 A;  4CZE A;  3JXU A;  2X6N A;  3KWG A;  1EWQ A;  4I9L A;  1QQO A;  1WSJ A;  4CE9 A;  3V9S A;  2E8A A;  3CG7 A;  1GLA G;  5CZ2 A;  2F4V K;  3RR8 A;  2HHQ A;  4CES A;  4E89 A;  2GEL A;  1G15 A;  5AFU A;  3I33 A;  3RMD A;  5AJ3 K;  2HST A;  1XNR K;  4YDU C;  1OVY A;  3CCV N;  1IBK K;  3O80 A;  1NK5 A;  5AZI A;  2PYJ A;  3QDK A;  1BU6 O;  1RCH A;  4AHT A;  1CXQ A;  3MAQ A;  3FFI A;  1QS4 A;  5EY4 A;  3QEI A;  3THW A;  4DTM A;  4WFA L;  3V9W A;  1REV A;  4MLE A;  4CJS A;  3ULD A;  1WN7 A;  4PKH A;  3HI0 A;  3LPT A;  3MN7 A;  4CJ4 A;  3ZET B;  1HR0 K;  4FO0 A;  3OYG A;  2Q36 A;  3FZL A;  5KPR A;  4FOI A;  4FWL A;  4LF9 K;  4BC3 A;  2QWM A;  4F3T A;  3L2W A;  4DV7 K;  3ZCM A;  2O8C B;  1BCO A;  3AAQ A;  1JLG A;  4KH5 A;  3SQ2 A;  2YNI A;  4GVM A;  5K14 A;  3DLR A;  3MWT A;  4A62 A;  1IO2 A;  2NRR A;  4BVO A;  4I2Q A;  3DOK A;  3CER A;  1I3A A; 
#chains in the Genus database with same CATH homology
 3SMP A;  5EVZ A;  2H3G X;  5H1S Q;  1DEJ A;  4YOT A;  1YHQ N;  4PL8 A;  1K73 O;  3EL2 A;  5AQR A;  3DJC A;  4C23 A;  3IDH A;  4ISE A;  2NNW A;  4HTL A;  5AZJ B;  2WBN A;  4JKF A;  3FLC O;  3HM8 A;  5KPZ A;  3CJA A;  3GBT A;  1HKC A;  4H0P A;  3ID6 A;  4DKW A;  4BC2 A;  4BRO A;  5FPE A;  4XH4 A;  1YVN A;  2NRV A;  3EKS A;  1YF5 L;  4IOX A;  1SAZ A;  3O9T A;  1U2V B;  4JKB A;  4B9Q A;  3ULE B;  4H0O A;  1YI2 N;  2D1K A;  4H0T B;  4CZJ A;  3SK3 A;  3LDP A;  5BN9 A;  1C0F A;  2IVO A;  4JD2 A;  4BRM A;  4YOR A;  1NGI A;  3A5O C;  3H3N O;  5FPM A;  2KLA A;  3E9L A;  3H45 C;  3R1X A;  3MN5 A;  4B1W B;  3EZW A;  3DXM B;  4A2B A;  3G71 N;  1VQ5 N;  3L6Q A;  3ID8 A;  1KC8 O;  4ILJ A;  4FWM A;  1Y64 A;  1HPM A;  4I6M A;  3SBG A;  5BN8 A;  4BRD A;  3U8X A;  2P9S B;  4WFN L;  3SJH A;  3I8B A;  2P9U A;  3GOI A;  3N4Q A;  1HLU A;  3CQY A;  3CPE A;  2YX6 A;  3CPW M;  5AQI A;  3F5T A;  2QI2 A;  1NWK A;  4ILG B;  1P90 A;  1R59 O;  4PHT X;  4JKG B;  4BRE A;  1WOQ A;  3CCR N;  4BRG A;  3S41 A;  1G99 A;  3TSU A;  3O9S A;  1QVF M;  4IFE A;  1Q18 A;  3Q7B A;  1BDG A;  3DLL L;  5EXW A;  2RE2 A;  1NGF A;  4JAX A;  3EE9 A;  3A0I X;  4WQ5 A;  3UE5 A;  4FOE A;  2GWK A;  4EIA A;  4H5T A;  2HBJ A;  3UKR A;  1JCE A;  4EHU A;  3BF3 A;  3HOS A;  4GV9 A;  2EWS A;  3EN9 A;  2PAV A;  3VF4 A;  2BUP A;  4GV6 A;  4BRC A;  4PKG A;  4BQZ A;  4AM7 A;  2VGN A;  1JCF A;  2E88 A;  3CET A;  3C65 A;  2PBD A;  5AQN A;  3QFU A;  5AQZ A;  3AGK A;  2Q0R A;  4MDB A;  3R9P A;  1Z05 A;  5M1Q A;  2D0O A;  3H46 O;  5ADX A;  1NGA A;  2IIR A;  1V4T A;  4FPA A;  5C0Y A;  3BUZ B;  2NRW A;  5AQT A;  3P39 A;  5JIC A;  5BPN A;  2UYT A;  4QS7 A;  4CBX A;  1BWF O;  4WCE L;  4JNE A;  5AQS A;  2ZJP L;  4IZ9 A;  3TSP A;  2A40 A;  2P9P B;  4Z94 A;  4IOC L;  3MCP A;  4MDA A;  4M7Y A;  2PFU A;  2V52 B;  4YDU A;  1VQ8 N;  3VGK A;  1ATN A;  1SS6 A;  3D2E A;  4H5R A;  5EOY A;  2P9I A;  4BRK A;  3CQX A;  3H1Q A;  2P9U B;  3HRG A;  5C2D A;  3WT0 A;  4GNI A;  3H3O B;  1EQY A;  1NGD A;  3VEX A;  3FZH A;  4JN4 A;  1NMD A;  3UKU A;  2J4R A;  4ISF A;  1N8R O;  2NRH A;  1P8Z A;  4BR9 A;  4H5W A;  5GAE P;  3WXJ A;  2ITM A;  3MDQ A;  2A41 A;  3ZX2 A;  5MLC Q;  4CD3 A;  4BVP A;  5AQJ A;  3VF2 A;  1BA0 A;  3BF1 A;  3KK7 A;  2E2O A;  4EFH A;  5JLH A;  3IFR A;  1YIJ N;  3CJB A;  3M6G A;  5HOO A;  3CMA N;  5CE3 A;  3WUH A;  2VYP A;  3VTI A;  1NGJ A;  1QQN A;  3FGU A;  1K8K B;  2JWK A;  4AF1 A;  3C6A A;  4Y0W A;  3A5L C;  3C7N B;  1TYQ A;  2NLX A;  3LM2 A;  1T6D A;  4JHD B;  3FZM A;  2ZGZ A;  4BRF A;  4CZL A;  1NLV A;  3CC7 N;  3CHW A;  1CZA N;  2ASP A;  2HF4 A;  2HOE A;  1ATS A;  5M1K A;  2QWO A;  1DGK N;  1VQP N;  4XEI A;  5TKW A;  3I55 N;  1M90 O;  5JVH L;  3T69 A;  4IJA A;  1QZ5 A;  2A42 A;  5CHI A;  3G4S N;  3WXL A;  3U4L A;  4YOV A;  3O6W A;  2QTD A;  2DPN A;  2FXU A;  1HUX A;  2YI1 A;  1X3N A;  4H0Y B;  3DAW A;  4FPB A;  3ZX3 A;  1W97 L;  4LC9 B;  3RVC A;  5AZI B;  2D4W A;  3ZYY X;  3GL1 A;  4B1U B;  5JMV A;  3PLA A;  4FSV A;  2P9I B;  1T44 A;  5BPL A;  2P9N A;  5B8H A;  5M1O A;  2YHY A;  3AGR A;  3VET A;  4JK8 A;  4CZI A;  3OW2 M;  2QWR A;  4O5F A;  1NBW A;  3ZEU B;  4A2A A;  4EHT A;  2ZJR L;  3TTF A;  1VQN N;  1NGE A;  1Q86 O;  1YIT N;  2QWL A;  1RGI A;  3WXI A;  3AAR A;  2HBL A;  2Q31 A;  5AQF A;  3SBT A;  5KQD A;  5C12 A;  2YJE A;  2FF3 B;  4PKI A;  3GDQ A;  2QEX N;  3L4I A;  2VGM A;  3MWP A;  3IMX A;  1XUP O;  1QVG M;  3HTV A;  4GVE A;  3QBW A;  3RSE B;  4WFB L;  1VAZ A;  4CBU A;  5LY3 A;  2FF6 A;  5CR4 A;  3E1Y A;  3PIP L;  3O4W A;  3LDO A;  2AA4 A;  5AQQ A;  2BTF A;  4XH5 A;  4BC4 A;  2KHO A;  2CGK A;  3KZB A;  3E9O A;  3VF6 A;  1GLF O;  3FE1 A;  3TSQ A;  5M1N A;  3E66 A;  2HMP A;  3WEE A;  2QA4 N;  4OPA A;  1S72 N;  3VER A;  4WQ4 C;  2A6A A;  1SQK A;  4R79 A;  3SMS A;  3O9U A;  4L3Q A;  4BGB A;  1NJI O;  1S3X A;  1M1K O;  1VQ6 N;  2GEM A;  4G9Z A;  3NVK A;  3QB0 A;  5AQO A;  4A61 A;  1KAX A;  2F9T A;  5M1P A;  3WQU A;  3CC2 N;  4PL7 A;  2F7T A;  2HBM A;  2YHW A;  4BY9 C;  1VQK N;  3CI5 A;  2WFB A;  3OHR A;  4K41 A;  4FWR A;  4BR7 A;  3DXK A;  4CZF A;  2WC9 A;  2NRX A;  3G6E N;  3M3Z A;  5AQK A;  4O8K A;  1K8A O;  2P9N B;  2ASM A;  3D2F A;  4NLC A;  1YXQ A;  3R6M A;  4J8F A;  5ELZ A;  3CCU N;  4UY8 O;  1VQ9 N;  1BG3 A;  3A5N C;  4FWK A;  4JEP A;  4IXC A;  1O13 A;  2Q0U A;  3WXM B;  3FFK B;  2ZWH A;  2CGL A;  4B1Z A;  1LCU A;  3EE8 A;  1VQ4 N;  3O8M A;  1ZBS A;  1VQO N;  4IOA L;  4NLB A;  3HZ6 A;  2ASO A;  2Q2R A;  3T7Z A;  1RDU A;  4JD2 B;  4C1N K;  1Q7Y O;  4M63 C;  2NRT A;  4KBO A;  2D0P A;  3D7E O;  3QFP A;  3PIO L;  1YUW A;  2E2N A;  3CIP A;  2P9K A;  4JKC A;  5FPD A;  1Q81 O;  4K25 A;  1IG8 A;  2GWJ A;  5BRF A;  2QWN A;  3VEV A;  1D4X A;  1GLC G;  1GLB G;  4CD1 A;  4B1V A;  4U7B A;  4I6M B;  3Q7C A;  4K43 A;  3VOV A;  2E1Y A;  4H0X B;  5E26 A;  3WEE B;  3CCE N;  3CCL N;  4BRA A;  3P31 A;  1NGH A;  4JKD A;  4KH6 A;  5AFU H;  4QS8 A;  1BA1 A;  4F9O A;  4KH4 A;  3CCM N;  3KHY A;  3SAF A;  5C15 A;  4GY2 B;  1QQM A;  3CXC M;  3GG4 A;  4E1J A;  3H1V X;  3SLC A;  3CF5 L;  1ATR A;  4MO4 A;  3NVM A;  4BR0 A;  3W3D A;  5GIO A;  3O9Q A;  3CJC A;  1MA9 B;  3O1W A;  3OBY A;  4YOU A;  1BO5 O;  5AQH A;  5AZJ A;  3MCA B;  3HBT A;  2E20 A;  3DXK B;  5JLF A;  5GAH P;  1C0G A;  4AM6 A;  2HF3 A;  2IVP A;  1HKB A;  3MX2 A;  4BGA A;  3NMU A;  1KAY A;  3LL3 A;  5TKY A;  1QZ6 A;  3E9P A;  3UKR B;  2P9L A;  2VCP A;  1MWM A;  1SZ2 A;  3SAH A;  5DM6 L;  3VEZ A;  3VEY A;  2F9W A;  1BOT O;  5JVG L;  1U2V A;  2I7N A;  3ULE A;  2Q1N A;  3WQT A;  2KKZ A;  2QXL A;  1MWK A;  5M1F A;  3FZF A;  2OTL N;  3B8A X;  3HSC A;  4A5A A;  1HJO A;  1T3V A;  4CZH A;  2GTD A;  2QM1 A;  3C0B A;  5E84 A;  2V51 B;  1GLE G;  1ZXO A;  5AQW A;  3O08 A;  4H5N A;  4BG9 A;  2V7Y A;  1LOT B;  2FSN A;  3M1F A;  4JKE A;  1YJW N;  1TUU A;  3O1B A;  5AQU A;  5C2F A;  5LJW A;  3VTH A;  4IEE A;  4FWP A;  5F1X A;  4C1N I;  1IJJ A;  3D2E B;  2WUS A;  3K9K A;  1X9J A;  2I7P A;  2P9S A;  1E4G T;  1HKG A;  2BH1 A;  4A59 A;  3LDN A;  1XC3 A;  3MN9 A;  3P4I A;  1YJN N;  1S22 A;  3UKU B;  3H6E A;  3A5M C;  4RTF D;  1ILY A;  4FWO A;  3CJ7 A;  4YOW A;  4IO9 L;  1ZC6 A;  4EAH D;  4FWS A;  4BQL A;  2V7Z A;  4BRN A;  4JKG A;  2OTJ N;  5BPM A;  2GUP A;  4BR4 A;  4O8U A;  3TU5 A;  3ENB A;  3L0Q A;  3D6R A;  4OPH A;  4BR5 A;  4CJ7 A;  1V4S A;  4FVU A;  4FWN A;  3JS6 A;  1J6Z A;  3KWI A;  4JKA A;  3LM9 A;  5EX5 A;  3R8E A;  2QW9 A;  2CH6 A;  4JKH A;  2A3Z A;  3ATV A;  3AY9 A;  4B1Y B;  1Q82 O;  1X3M A;  2P9L B;  4IJN A;  1VQM N;  4FL9 A;  3ZX0 A;  3FR0 A;  4BRI A;  2A5X A;  3IKM A;  1TYQ B;  1BUP A;  3L4Q A;  5BRH A;  4BG8 A;  3MMV A;  5AQV A;  3VEO A;  3VPZ A;  5GIN A;  1YJ9 N;  4GV3 A;  3VEN A;  4WQ4 A;  3CCS N;  1XQS C;  4RWT A;  4RCH A;  3FZK A;  4CBW A;  3ENH A;  5GIP A;  3UB5 A;  1RFQ A;  2AP1 A;  4H03 B;  3CD6 N;  2YHX A;  4BRP A;  1DT9 A;  5AQP A;  2NRZ A;  2VWB A;  4ISG A;  1QHA A;  3M5R A;  3CC4 N;  5BRE A;  2CGJ A;  3CJ9 A;  3EO3 A;  2E2P A;  3GE1 A;  5KPT A;  2YJF A;  4NB4 A;  3OA9 A;  2P9P A;  4QS9 A;  5DM7 L;  4YOY A;  2JWL A;  2ZGY A;  4IDH A;  3I56 N;  3LDL A;  3A8Y A;  3G25 A;  1KD1 O;  1TUY A;  2W41 A;  3CME N;  1WUA A;  5LJV A;  2YCH A;  5HL7 L;  4K42 A;  4HWI A;  1NGC A;  2ZJQ L;  4BRQ A;  1T6C A;  5BR9 A;  3OBW A;  3QBX A;  4JK7 A;  5FPN A;  1JJ2 M;  3P38 A;  4DHY A;  5AR0 A;  5GAG P;  1JCG A;  3BP8 A;  4BRH A;  3KVG A;  2E1Z A;  5C10 A;  4IEI A;  3TPQ A;  5F0X A;  1Z6R A;  3ZET A;  3VMF B;  2QWQ A;  3WXK A;  3F2K A;  4BR2 A;  3VGM A;  5GAD P;  1NM1 A;  3F9M A;  4WQ5 C;  4A57 A;  4MLH A;  4OO1 J;  1DKG D;  5AQM A;  4IWV A;  5AQG A;  3MX5 A;  3MN6 A;  3TTC A;  1W2B M;  3DWL A;  3ATU A;  1K8K A;  4CZE A;  1U6Z A;  3JXU A;  3KWG A;  1KAZ A;  3C7N A;  4H0V B;  1E4F T;  3LDQ A;  5AQY A;  3U9Z A;  3HOT A;  1VQL N;  1QQO A;  4JHD A;  1HX1 A;  1ESV A;  2E8A A;  2RHK A;  3TTD A;  4CZK A;  1GLA G;  2QWP A;  3N4P A;  5ADX H;  3O9R A;  4DB3 A;  4YOX A;  3J7Z O;  4MO5 A;  2ZF5 O;  2GEL A;  4XH1 A;  1K9M O;  5AFU A;  3VGL A;  2W40 A;  3CCQ N;  3I33 A;  4CZG A;  2FSK A;  3MK6 A;  4WYB A;  5AQX A;  2E2Q A;  4M7X A;  2HST A;  1EO1 A;  3W0L A;  4B1X B;  4YDU C;  1OVY A;  3CCV N;  3O80 A;  3CCJ N;  3CJ1 A;  5AZI A;  1GLD G;  2CH5 A;  3QDK A;  4IO8 A;  1BU6 O;  1GLJ O;  3D2F B;  1MDU B;  3U9D A;  3R3L A;  4U67 L;  5EY4 A;  3QML A;  3ZEU A;  1VQ7 N;  3C6H A;  4H5V A;  4WFA L;  1KXP A;  4FWQ A;  5I9E B;  1OKJ A;  2OAN A;  2IVN A;  2Q97 A;  4MLE A;  3VEW A;  1NGG A;  4PKH A;  3AAP A;  2GX9 A;  3HI0 A;  3MN7 A;  2NZT A;  3ZET B;  3K9J A;  4NO7 A;  4FO0 A;  2Q36 A;  1RDW X;  3FZL A;  4ILH A;  5KPR A;  3SAG A;  4FOI A;  2FLO A;  4FWL A;  3RSE A;  2P9K B;  2HBK A;  2QWM A;  3J8A A;  4BC3 A;  5KQ8 A;  3BEX A;  3EKU A;  1H1V A;  4DCH A;  4CI6 A;  5BRD A;  3AAQ A;  4WF9 L;  3DXM A;  4KH5 A;  4BC5 A;  3QIC A;  5AQL A;  1KQS M;  3MWT A;  1NGB A;  4A62 A;  4CZM A;  4DQ8 A;  1GLL O;  1YAG A;  2NRR A;  3O5B A;  4BVO A;  4BRL A;  3CER A;  4A5B A;  3VES A;  2FSJ A;  4JK9 A;  3IUC A;  3ENO A;  5F2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...