3AATA

Activity and structure of the active-site mutants r386y and r386f of escherichia coli aspartate aminotransferase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGFVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Activity and structure of the active-site mutants R386Y and R386F of Escherichia coli aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 116
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1990-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3aatA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3aatA01
5K8BA 1AMRA 3F9TA 1GEWA 1UU0A 3BCBA 4EB5A 3KE3A 2VMVA 3BS8A 4A6TA 1EQBA 1N31A 1WYUB 2W8UA 3FD0A 3GZDA 1UKJA 2W7KA 2D61A 1G4XA 3AEOA 2AY5A 4RKCA 3AATA 1AHXA 1M32A 3OP7A 4M2MA 1I29A 1CQ7A 2DR1A 4IY7A 1AY4A 2CH2A 3FTBA 2EO5A 3DYDA 1M7YA 1MLZA 1BS0A 3JW9A 2QMAA 5D5SA 4W5KA 1JF9A 2W7LA 1B4XA 2E7IA 3CQ5A 2ZC0A 2BI1A 1WYTA 2CJDA 2VMOA 4JEZA 4ADEA 1AICA 2BIEA 1AX4A 2O7CA 1FG3A 4XJLA 1MAQA 1W7LA 2VLFA 4WYAA 4AO4A 3WCOA 3VK3A 4MSOA 2D5YA 2ORDA 3IHJA 4IXOA 2VGVA 2XBNA 2FYFA 3DODA 4PFNA 4RM1A 2E54A 4ITXA 4ATQA 2X5DA 4EU1A 1ARHA 2X8UA 2D66A 3P6KA 1OATA 4JEWA 2W8WA 3UWCA 3A9YA 3NUBA 5TF5A 1BJWA 1GC4A 2AY1A 4A00A 1YOOA 3E2YA 4LC3A 4AO9A 1W3UA 2X5FA 3PGYA 5EAAA 1ZOBA 3HT4A 2YCTA 2BHXA 4A0HA 1WYTB 3JWAA 3HMUA 3PJ0A 4R5FA 2VLHA 4MKKA 2YCPA 2JJGA 2HP2A 3B1EA 2VMTA 3NTJA 2FM1A 5EQCA 1O4SA 4RJ0A 5DB5A 4OT8A 3FKDA 5E3KA 4A0RA 2OATA 1D7UA 1IAXA 1D7VA 1C7GA 2VMZA 3PAAA 4K2IA 3K28A 4EB7A 4KAMA 1JS3A 1M0PA 3DU4A 5D95A 3AV7A 2BIGA 5IWQA 2VMNA 1LKCA 2VGZA 2V0YA 4P7YA 2QB2A 1EJIA 2FNIA 3MC6A 3NYUA 4WB0A 3WLXA 4ATPA 4ZM4A 1IAYA 1AKAA 1P3WA 2BI3A 2CJHA 1GBNA 4UQVA 3DR7A 3LVLB 1IX7A 4K2MA 2QBTA 3NU8A 2BYLA 3GZCA 3EIAA 1IX6A 1OHWA 3GZDC 3ASBA 4XAUA 4XQ2A 4B9BA 1ASLA 3DXVA 4ZASA 2YKUA 2AY6A 2TPLA 1AMQA 4PFFA 1SZUA 1SFFA 1BJOA 3JU7A 1CZCA 1AMSA 4Q75A 2CJGA 4U2HA 2BKWA 3QN6A 1SPAA 3ISLA 4R8DA 3H7FA 1ARIA 2VGTA 2VIBA 1CJ0A 1GC0A 1Z3ZA 2D7YA 4WB0B 4WYCA 4RIZA 2GQNA 1TOJA 3NX3A 5DJ9A 2YOBA 2BYJA 1LS3A 4GE7A 3F0HA 2OGEA 5G4IA 4HVKA 1FC4A 1ASDA 3PDBB 2O1BA 4W1XA 3LG0A 4ZWMA 3MAFA 1J04A 4J8LA 2XH1A 1TOKA 3QGUA 2CANA 2CB1A 1KMJA 1W23A 4RAEA 3ZRQA 1BJOB 1I43A 1IJIA 2WK9A 4OC9A 2C0RA 5AX8A 4BQ0A 4E1OA 1TARA 2R5CA 3FCRA 4IXZA 3MKJA 2W7MA 3AEJA 4ZDLA 5JAYA 2AY7A 2C81A 1N8PA 3ASAA 2GSAA 2VMYA 4OCAA 1B9IA 1G7WA 3FQ7A 2E7JA 3NUIA 3NRAA 3BC8A 1PFFA 2EZ2A 2DOUA 4LNLA 2W7HA 4DQ6A 4BA5A 3MAFB 1DFOA 4IXSA 2JGTA 1RVYA 2YKYA 4AOAA 1YJSA 5E4ZA 3WKRA 4ZLVA 3FQ8A 1ARSA 1UU2A 5HHYA 3R4TA 3TQXA 1GC2A 1B5OA 1YIZA 4OTLA 1EG5A 4JE5A 3I16A 2FQ6A 4U1TA 5G2PA 4MQQA 3TFTA 2R5CB 4W1WA 4JF0A 1X2AA 4ZWVA 1AHGA 1KL2A 2F8JA 1C0NA 4JEYA 4WBTA 1AAWA 1YJZA 4HF8A 3ZRRA 5M4DA 4ITGA 3FZ7A 3MC6C 1X28A 5LH9A 1TOGA 2EPJA 3CQ4A 3KKIA 3MEBA 3NDNA 2ZY4A 1JS6A 1Y4IA 2BI2A 2OGAA 2CY8A 1YIYA 2EGYA 4WP0A 2AY2A 2JJFA 3E77A 2VMXA 1MAPA 3L44A 3RI6A 4RITA 2YKVA 4PVFA 3VOMA 2ZY2A 4CVQA 1C7OA 2HZPA 3CBFA 1DJ9A 1QZ9A 4BMKA 3FSLA 2VMWA 4L0OA 4IYOA 2HOZA 1AIAA 1DJEA 2Z67A 3HQTA 4GSAA 2OQXA 3R9AA 3FFHA 1OHYA 3K40A 2CINA 1N2TA 4OYTA 1FG7A 1M0NA 4E77A 1ELQA 1LC5A 1KKPA 1DGEA 2BWPA 3NYSA 2YRIA 1IBJA 1VP4A 1S09A 3BN1A 3BV0A 2VMQA 2X3LA 4F5MA 4F5JA 5EIGA 3W1HA 5M46A 1I48A 4OBUA 3N5MA 1T3IA 3LVKA 1ZODA 2VI8A 1G4VA 3JWBA 2WKAA 2O0RA 2R2NA 5FT5A 4J5UA 5G09A 4ZAHA 3HLMA 1LK9A 1BKGA 3QPGA 3AEJC 2VIAA 4MY5A 5HDMA 5EFSA 4F5IA 2V1PA 1V2EA 4WYEA 4E3RA 4ZM3A 1CZEA 3RCHA 3WY7A 4F4EA 2PB2A 4H51A 1VJOA 3W1JA 3EI9A 4BHDA 2VGWA 3EUCA 2DGMA 3AENA 1CQ8A 2YRRA 3GETA 3M5UA 4XK1A 2ZSLA 3PIUA 2VYCA 1ASAA 2VGUA 1XI9A 1H1CA 3DRDA 3ELPA 4MQRA 3BB8A 3QHXA 1JG8A 2JISA 3P1TA 4MGRA 5G2QA 3ZZJA 1I41A 3AEMA 2ZSMA 1AKCA 3ECDA 3LV2A 4E3QA 4F5GA 4FL0A 1C7NA 2HUFA 1RV3A 3VP6A 4GE4A 3PD6A 3RCHB 5DJ1A 4UHOA 4B98A 5EAVA 3T32A 1TOIA 4WYFA 1OXPA 2BI5A 5DX5A 3HL2A 3AENB 1MDZA 1MDXA 2DKBA 4IW7A 3ZRPA 3B8XA 3A2BA 4ADCA 8AATA 1IUGA 4XJPA 1GDEA 3HDOA 2GMUA 3A8UX 3GJUA 2FNUA 1AHFA 2AY8A 3HVYA 2VMSA 4M2JA 4O6ZA 4F5FA 1G7XA 2CFBA 2QA3A 2JJEA 3LVJA 4I8AA 4IX8A 2D65A 3E2ZA 1AMAA 4LNJA 2W7IA 4QGRA 3VK2A 3MAUA 1ZC9A 2PB0A 3ELEA 2HOXA 4CXRA 1CS1A 1AKBA 1X29A 2W8TA 4GEBA 2Z9WA 1YAAA 1O69A 4JF1A 4A0GA 1TATA 3IF2A 3GWPA 4NOGA 4ZSWA 2R5EA 1WYVA 3DXWA 3JZLA 4A0FA 4K2BA 2NMPA 4ZSYA 4UOYA 3JTXA 3ATHA 3RBFA 2D63A 1GCKA 1AY5A 5FT8A 2QLRA 4LNMA 2E7UA 1ASFA 1SF2A 1WKGA 3FFRA 4R5ZA 1S06A 2AY4A 2GMSA 1AY8A 1QJ5A 1S07A 4WLHA 4A6UA 2W7JA 1QITA 3E2ZB 5FT4A 1MGVA 7AATA 3FVSA 3G0TA 1W7NA 4Y0HA 2JG2A 3CAIA 2CSTA 3AEPA 4JEXA 3NNKA 1OXOA 3USFA 4GRXA 1WYVB 2W7EA 1WYUA 5HXXA 1QGNA 4JEVA 1ASGA 3VK4A 5F9SA 1DJUA 1KL1A 2DGKA 1X0MA 4MKJA 1ASEA 1GD9A 5EUEA 2HUIA 4F5KA 3E6GA 3AEMC 3G7QA 1GC3A 1RVUA 3EI6A 4XJMA 4W1VA 3H14A 3BWNA 5C6UA 5J8QA 2VI9A 1AIBA 1QJ3A 5I92A 4ISYA 2G6WA 4OBVA 3VAXA 3GSBA 3FDBA 1M0OA 3WGBA 2BWOA 3PA9A 2CTZA 4EMYA 4W8IA 2YCNA 2Z1YA 3CQ6A 4WXBA 3ACZA 3Q8NA 3MBBA 1D7SA 1IVRA 3EZSA 1VEFA 2ZUKA 5EUNA 3FVUA 1LC8A 1YNUA 2Z9XA 4KYOA 2HOYA 4MQPA 1GEYA 3A9ZA 5E5IA 1ASBA 2HP1A 9AATA 4N0BA 1PG8A 2EZ1A 3LWSA 1AJRA 2FN6A 4WXFA 1B8GA 2YHKA 3AELA 5M49A 1SVVA 3FQAA 3N75A 2HUUA 3G8MA 2W7DA 1ARGA 4GDYA 1BJNA 4BA4A 1QISA 4LW2A 5F8VA 3COGA 2W8VA 2CH1A 3N0LA 1O61A 4F5LA 4A72A 1J32A 1TOEA 1U08A 4IYOB 2VGSA 4ADBA 4R2NA 1TASA 3BCXA 2PO3A 3MADA 2W8JA 1DKAA 2WK7A 4Q31A 4WLJA 4AH3A 1ASNA 1SZKA 4F5HA 2OKJA 1AHYA 1KKJA 2JJHA 2Z1ZA 1BJ4A 3KGXA 1ASMA 1DGDA 1V2DA 2R0TA 2BI9A 2HORA 3EI5A 3EI7A 3FRKA 4WD2A 5EIGB 1S08A 3D6KA 3HBXA 3OKSA 3I5TA 2AY3A 4WYGA 3RUYA 4RLGA 1C9CA 4GE9A 3WX9A 2AEVA 3NU7A 2C7TA 2OKKA 3DC1A 1ELUA 1LC7A 2BWNA 5EUDA 3E9KA 4ADDA 1UU1A 1SZSA 2VMUA 3F6TA 4N0WA 4DBCA 5BJ4A 2ZJGA 3WCNA 1S0AA 1AJSA 3B1CA 3B1DA 4WXGA 3W1IA 5M4BA 3KGWA 3FDDA 2D7ZA 3UAKA 3WKSA 3LY1A 1B9HA 3K7YA 3QBOA 1B5PA 3UE8A 2W7GA 4XJOA 3TFUA 3I4JA 1ARTA 3QI6A 3RQ1A 3AOVA 4UHNA 2RFVA 3E2FA 4EFFA 2Z61A 2Q7WA 3EIBA 3TCMA 3BWNC 4OMAA 1H0CA 1TPLA 1E5FA 1CL2A 1AAMA 3FZ8A 4Q76A 5BJ3A 1IX8A 1V72A 3PDBA 1AJSB 4TV7A 2W7FA 5LHAA 1OHVA 2YKXA 4KXKA 4AZKA 4WYDA 3ZZKA 4FFCA 4Y0IA 1QIRA 1E5EA 3L8AA 4RKDA 3LVMA 3PD6B 1LW5A 3DR4A 2DGLA 4CBSA 2VMRA 1RV4A 2D64A 1AHEA 2WK8A 2AATA 4ZDPA 4P3MA 1WSTA 4Q6RA 3A9XA 1ORDA 4W91A 4Y0DA 4UHMA 1BQDA 1CQ6A 1D7RA 3DZZA 1M4NA 3FZ6A 3EI8A 3FVXA 3GR9A 5G0AA 1ASCA 3WGCA 3PDXA 2GB3A 2ZY5A 2ZY3A 1KMKA 3BWOA 1GEXA 2C44A 3NYTA 3TATA 4CBRA 4DGTA 5FT6A 1PMMA 4ZDOA 1PMOA 3II0A 2VMPA 1D2FA 4AZJA 4M2KA 1M6SA 1Z7DA 3PPLA 2EH6A 2ZYJA 4LW4A 2ZP7A 1ECXA 1W7MA 4JE5D 4A6RA 2Z20A 2AEUA 2Z9VA 1V2FA 1M0QA 5G4JA 1BQAA 1DTYA 2QB3A 3RBLA 2AY9A 3BCAA 2Z9UA 3GBXA 4TMRA 1BT4A 4CXQA 4PIWA 2BIAA 1O62A 4XEWA 3B46A 3EZ1A 4TN4A 3AOWA 3WZFA 3QM2A 2DKJA 1MLYA 1C4KA 1WKHA 1YJYA 1CL1A 1XEYA 1MDOA 1BW0A 4RJYA 1LW4A
chains in the Genus database with same CATH superfamily
5K8BA 1AMRA 3F9TA 1GEWA 1UU0A 3BCBA 4EB5A 3KE3A 2VMVA 3BS8A 4A6TA 1EQBA 1N31A 1WYUB 2W8UA 3FD0A 3GZDA 1UKJA 2W7KA 2D61A 1G4XA 3AEOA 2AY5A 4RKCA 3AATA 1AHXA 1M32A 3OP7A 4M2MA 1I29A 1CQ7A 2DR1A 4IY7A 1AY4A 2CH2A 3FTBA 2EO5A 3DYDA 1M7YA 1MLZA 1BS0A 3JW9A 2QMAA 5D5SA 4W5KA 1JF9A 2W7LA 5KTBA 1B4XA 2E7IA 3CQ5A 2ZC0A 2KFPA 2BI1A 1WYTA 2CJDA 2VMOA 4JEZA 4ADEA 1AICA 2BIEA 1AX4A 2O7CA 1FG3A 4XJLA 3N4XA 1MAQA 1W7LA 2VLFA 4WYAA 4AO4A 3WCOA 3VK3A 4MSOA 2D5YA 2ORDA 3IHJA 4IXOA 2VGVA 2XBNA 2FYFA 3DODA 4PFNA 4RM1A 2E54A 4ITXA 4ATQA 2X5DA 4EU1A 1ARHA 2X8UA 2D66A 3P6KA 1OATA 4JEWA 2W8WA 3UWCA 3A9YA 3NUBA 5TF5A 1BJWA 1GC4A 2AY1A 4A00A 1YOOA 3E2YA 4LC3A 4AO9A 1W3UA 2X5FA 3PGYA 5EAAA 1ZOBA 3HT4A 2YCTA 2BHXA 4A0HA 1WYTB 3JWAA 3HMUA 3PJ0A 4R5FA 2VLHA 4MKKA 2YCPA 2JJGA 2HP2A 3B1EA 2VMTA 3NTJA 2FM1A 5EQCA 1O4SA 4RJ0A 5DB5A 4OT8A 3FKDA 5E3KA 4A0RA 2OATA 1D7UA 1IAXA 1D7VA 1C7GA 2VMZA 3PAAA 4K2IA 2G7JA 3K28A 2WB6A 4EB7A 4KAMA 1JS3A 1M0PA 3DU4A 5D95A 3AV7A 2BIGA 5IWQA 2VMNA 1LKCA 2VGZA 2V0YA 4K05A 4P7YA 2QB2A 1EJIA 2FNIA 3MC6A 3NYUA 4WB0A 3WLXA 4ATPA 4ZM4A 4H63Q 1IAYA 1AKAA 1P3WA 2BI3A 2CJHA 1GBNA 4UQVA 3DR7A 3LVLB 1IX7A 4K2MA 2QBTA 3NU8A 2BYLA 3GZCA 3EIAA 1IX6A 1OHWA 3GZDC 3ASBA 4XAUA 4XQ2A 4B9BA 1ASLA 3DXVA 4ZASA 2YKUA 2AY6A 2TPLA 1AMQA 4PFFA 1SZUA 1SFFA 1BJOA 3JU7A 1CZCA 1AMSA 4Q75A 2CJGA 3N7NA 4U2HA 2BKWA 3QN6A 1SPAA 3ISLA 4R8DA 3H7FA 1ARIA 2VGTA 2VIBA 1CJ0A 1GC0A 1Z3ZA 2D7YA 4WB0B 4WYCA 4RIZA 2GQNA 1TOJA 3NX3A 5DJ9A 2YOBA 2BYJA 1LS3A 4GE7A 3F0HA 2OGEA 5G4IA 4HVKA 1FC4A 1ASDA 3PDBB 2O1BA 4W1XA 3LG0A 4ZWMA 3MAFA 1J04A 4J8LA 2XH1A 1TOKA 3QGUA 2CANA 2CB1A 1KMJA 1W23A 4RAEA 3ZRQA 1BJOB 1I43A 1IJIA 2WK9A 4OC9A 2C0RA 5AX8A 4BQ0A 4E1OA 1TARA 2R5CA 3FCRA 4IXZA 3MKJA 2W7MA 3AEJA 4ZDLA 5JAYA 2AY7A 2C81A 1N8PA 3ASAA 2GSAA 2VMYA 4OCAA 1B9IA 1G7WA 3FQ7A 2E7JA 3NUIA 3NRAA 3BC8A 1PFFA 2EZ2A 2DOUA 4LNLA 2W7HA 4DQ6A 4BA5A 3MAFB 1DFOA 4IXSA 2JGTA 1RVYA 2YKYA 4AOAA 1YJSA 5E4ZA 3WKRA 4ZLVA 3FQ8A 1ARSA 1UU2A 5HHYA 3R4TA 3TQXA 3N4RA 1GC2A 1B5OA 1YIZA 4OTLA 1EG5A 4JE5A 3I16A 2FQ6A 4U1TA 5G2PA 4MQQA 3TFTA 2R5CB 4W1WA 4JF0A 1X2AA 4ZWVA 1AHGA 1KL2A 2F8JA 1C0NA 4JEYA 4WBTA 1AAWA 1YJZA 4HF8A 3ZRRA 5M4DA 4ITGA 3FZ7A 3MC6C 1X28A 5LH9A 1TOGA 2EPJA 3CQ4A 3KKIA 3MEBA 3NDNA 2ZY4A 1JS6A 1Y4IA 2BI2A 2OGAA 2CY8A 1YIYA 2EGYA 4WP0A 2AY2A 2JJFA 3E77A 2VMXA 1MAPA 3L44A 3RI6A 4RITA 2YKVA 4PVFA 3VOMA 2ZY2A 4CVQA 1C7OA 2HZPA 3CBFA 1DJ9A 1QZ9A 4BMKA 3FSLA 2VMWA 4L0OA 4IYOA 2HOZA 1AIAA 1DJEA 2Z67A 3HQTA 4GSAA 2OQXA 3R9AA 3FFHA 1OHYA 3K40A 2CINA 1N2TA 4OYTA 1FG7A 1M0NA 4E77A 1ELQA 1LC5A 1KKPA 1DGEA 2BWPA 3NYSA 2YRIA 1IBJA 1VP4A 1S09A 3BN1A 3BV0A 2VMQA 2X3LA 4F5MA 4F5JA 5EIGA 3W1HA 5M46A 1I48A 4OBUA 3N5MA 1T3IA 3LVKA 1ZODA 2VI8A 1G4VA 3JWBA 2WKAA 2O0RA 2R2NA 5FT5A 4J5UA 5G09A 4ZAHA 3HLMA 1LK9A 1BKGA 3QPGA 3AEJC 2VIAA 4MY5A 2A1VA 5HDMA 5EFSA 4F5IA 2V1PA 1V2EA 4WYEA 4E3RA 4ZM3A 1CZEA 3RCHA 3WY7A 4F4EA 2PB2A 4H51A 1VJOA 3W1JA 3EI9A 4BHDA 2VGWA 3EUCA 2DGMA 3AENA 1CQ8A 2YRRA 3GETA 3M5UA 4XK1A 2ZSLA 3PIUA 2VYCA 1ASAA 2VGUA 1XI9A 1H1CA 3DRDA 3ELPA 4MQRA 3BB8A 3QHXA 1JG8A 2JISA 3P1TA 4MGRA 5G2QA 3ZZJA 1I41A 3AEMA 2ZSMA 1AKCA 2FKIA 3ECDA 3LV2A 4E3QA 4F5GA 4FL0A 1C7NA 2HUFA 1RV3A 3VP6A 4GE4A 3PD6A 3RCHB 5DJ1A 4UHOA 4B98A 5EAVA 3H9XA 3T32A 1TOIA 4WYFA 1OXPA 2BI5A 5DX5A 3HL2A 3AENB 1MDZA 1MDXA 2DKBA 4IW7A 3ZRPA 2EYQA 3B8XA 3A2BA 4ADCA 8AATA 1IUGA 4XJPA 1GDEA 3HDOA 2GMUA 3A8UX 3GJUA 2FNUA 1AHFA 2AY8A 3HVYA 2VMSA 4M2JA 4O6ZA 4F5FA 1G7XA 2CFBA 2QA3A 2JJEA 3LVJA 4I8AA 4IX8A 2D65A 3E2ZA 1AMAA 4LNJA 2W7IA 4QGRA 3VK2A 3MAUA 1ZC9A 2PB0A 3ELEA 2HOXA 4CXRA 1CS1A 1AKBA 1X29A 2W8TA 4GEBA 2Z9WA 1YAAA 1O69A 4JF1A 4A0GA 1TATA 3IF2A 3GWPA 4NOGA 4ZSWA 2R5EA 1WYVA 3DXWA 3N4SA 3JZLA 4A0FA 4K2BA 2NMPA 4ZSYA 4UOYA 3JTXA 3ATHA 3RBFA 2D63A 1GCKA 1AY5A 5FT8A 2QLRA 4LNMA 2E7UA 1ASFA 1SF2A 1WKGA 3FFRA 4R5ZA 1S06A 2AY4A 2GMSA 1AY8A 1QJ5A 1S07A 4WLHA 4A6UA 2W7JA 1QITA 3E2ZB 5FT4A 1MGVA 7AATA 3FVSA 3G0TA 1W7NA 4Y0HA 2JG2A 3CAIA 2CSTA 3AEPA 4JEXA 3NNKA 1OXOA 3USFA 4GRXA 1WYVB 2W7EA 1WYUA 5HXXA 1QGNA 4JEVA 1ASGA 3VK4A 5F9SA 1DJUA 1KL1A 2DGKA 1X0MA 4MKJA 1ASEA 1GD9A 5EUEA 2HUIA 4F5KA 3E6GA 3AEMC 3G7QA 1GC3A 1RVUA 3EI6A 4XJMA 4W1VA 3H14A 3BWNA 5C6UA 5J8QA 2VI9A 1AIBA 1QJ3A 5I92A 4ISYA 2G6WA 4OBVA 3VAXA 3GSBA 3FDBA 1M0OA 3WGBA 2BWOA 3PA9A 2CTZA 4EMYA 4W8IA 2YCNA 2Z1YA 3CQ6A 4WXBA 3ACZA 3Q8NA 3MBBA 1D7SA 1IVRA 3EZSA 1VEFA 2ZUKA 5EUNA 3FVUA 1LC8A 1YNUA 2Z9XA 4KYOA 2HOYA 4MQPA 1GEYA 3A9ZA 5E5IA 1ASBA 2HP1A 9AATA 4N0BA 1PG8A 2EZ1A 3LWSA 1AJRA 2FN6A 4WXFA 1B8GA 2YHKA 3AELA 5M49A 1KAFA 1SVVA 3FQAA 3N75A 2HUUA 3G8MA 2W7DA 1ARGA 4GDYA 1BJNA 4BA4A 1QISA 4LW2A 5F8VA 3COGA 2W8VA 2CH1A 3N0LA 1O61A 4F5LA 4A72A 1J32A 1TOEA 1U08A 4IYOB 2VGSA 4ADBA 4R2NA 1TASA 3BCXA 2PO3A 3MADA 2W8JA 1DKAA 2WK7A 4Q31A 4WLJA 4AH3A 1ASNA 1SZKA 4F5HA 2OKJA 1AHYA 1KKJA 2JJHA 2Z1ZA 1BJ4A 3KGXA 1ASMA 1DGDA 1V2DA 2R0TA 2BI9A 2HORA 3EI5A 3EI7A 3FRKA 4WD2A 5EIGB 1S08A 3D6KA 3HBXA 3OKSA 3I5TA 2AY3A 4WYGA 3RUYA 4RLGA 1C9CA 4GE9A 3WX9A 2AEVA 3NU7A 2C7TA 2OKKA 3DC1A 1ELUA 1LC7A 2BWNA 5EUDA 3E9KA 4ADDA 1UU1A 1SZSA 2VMUA 3F6TA 4N0WA 4DBCA 5BJ4A 2ZJGA 3WCNA 1S0AA 1AJSA 3B1CA 3B1DA 4WXGA 3W1IA 5M4BA 3KGWA 3FDDA 2D7ZA 3UAKA 3WKSA 3LY1A 1B9HA 3K7YA 3QBOA 1B5PA 3UE8A 2W7GA 4XJOA 3TFUA 3I4JA 1ARTA 3QI6A 3RQ1A 3AOVA 4UHNA 2RFVA 3E2FA 4EFFA 2Z61A 2Q7WA 3EIBA 3TCMA 3BWNC 4OMAA 1H0CA 1TPLA 1E5FA 1CL2A 1AAMA 3FZ8A 4Q76A 5BJ3A 1IX8A 1V72A 3PDBA 1AJSB 4TV7A 2W7FA 5LHAA 1OHVA 2YKXA 4KXKA 4AZKA 4WYDA 3ZZKA 4FFCA 4Y0IA 1QIRA 1E5EA 3L8AA 4RKDA 3LVMA 3PD6B 1LW5A 3DR4A 2DGLA 4CBSA 2VMRA 1RV4A 2D64A 1AHEA 2WK8A 2AATA 4ZDPA 4P3MA 1WSTA 4Q6RA 3A9XA 1ORDA 4W91A 4Y0DA 4UHMA 1BQDA 1CQ6A 1D7RA 3DZZA 1M4NA 3FZ6A 3EI8A 3FVXA 3GR9A 5G0AA 1ASCA 3WGCA 3PDXA 2GB3A 2ZY5A 2ZY3A 1KMKA 3BWOA 1GEXA 2C44A 3NYTA 3TATA 4CBRA 4DGTA 5FT6A 2QSRA 1PMMA 4ZDOA 1PMOA 3II0A 2VMPA 1D2FA 4AZJA 4M2KA 1M6SA 1Z7DA 3PPLA 2EH6A 2ZYJA 4LW4A 2ZP7A 1ECXA 1W7MA 4JE5D 4A6RA 2Z20A 2AEUA 2Z9VA 1V2FA 1M0QA 5G4JA 1BQAA 1DTYA 2QB3A 3RBLA 2AY9A 3BCAA 2Z9UA 3GBXA 4TMRA 1BT4A 4CXQA 4PIWA 2BIAA 1O62A 4XEWA 3B46A 3EZ1A 4TN4A 3AOWA 3WZFA 3QM2A 2DKJA 1MLYA 1C4KA 1WKHA 1YJYA 1CL1A 1XEYA 1MDOA 1BW0A 4RJYA 1LW4A
chains in the Genus database with same CATH topology
5K8BA 1AMRA 3F9TA 1GEWA 1UU0A 3BCBA 4EB5A 3KE3A 2VMVA 3BS8A 4A6TA 1EQBA 1N31A 1WYUB 2W8UA 3FD0A 3GZDA 1UKJA 2W7KA 2D61A 1G4XA 3AEOA 2AY5A 4RKCA 3AATA 1AHXA 1M32A 3OP7A 4M2MA 1I29A 1CQ7A 2DR1A 4IY7A 1AY4A 2CH2A 3FTBA 2EO5A 3DYDA 1M7YA 1MLZA 1BS0A 3JW9A 2QMAA 5D5SA 4W5KA 1JF9A 2W7LA 5KTBA 1B4XA 2E7IA 3CQ5A 2ZC0A 2KFPA 2BI1A 1WYTA 2CJDA 2VMOA 4JEZA 4ADEA 1AICA 2BIEA 1AX4A 2O7CA 1FG3A 4XJLA 3N4XA 1MAQA 1W7LA 2VLFA 4WYAA 4AO4A 3WCOA 3VK3A 4MSOA 2D5YA 2ORDA 3IHJA 4IXOA 2VGVA 2XBNA 2FYFA 3DODA 4PFNA 4RM1A 2E54A 4ITXA 4ATQA 2X5DA 4EU1A 1ARHA 2X8UA 2D66A 3P6KA 1OATA 4JEWA 2W8WA 3UWCA 3A9YA 3NUBA 5TF5A 1BJWA 1GC4A 2AY1A 4A00A 1YOOA 3E2YA 4LC3A 4AO9A 1W3UA 2X5FA 3PGYA 5EAAA 1ZOBA 3HT4A 2YCTA 2BHXA 4A0HA 1WYTB 3JWAA 3HMUA 3PJ0A 4R5FA 2VLHA 4MKKA 2YCPA 2JJGA 2HP2A 3B1EA 2VMTA 3NTJA 2FM1A 5EQCA 1O4SA 4RJ0A 5DB5A 4OT8A 3FKDA 5E3KA 4A0RA 2OATA 1D7UA 1IAXA 1D7VA 1C7GA 2VMZA 3PAAA 4K2IA 2G7JA 3K28A 2WB6A 4EB7A 4KAMA 1JS3A 1M0PA 3DU4A 5D95A 3AV7A 2BIGA 5IWQA 2VMNA 1LKCA 2VGZA 2V0YA 4K05A 4P7YA 2QB2A 1EJIA 2FNIA 3MC6A 3NYUA 4WB0A 3WLXA 4ATPA 4ZM4A 4H63Q 1IAYA 1AKAA 1P3WA 2BI3A 2CJHA 1GBNA 4UQVA 3DR7A 3LVLB 1IX7A 4K2MA 2QBTA 3NU8A 2BYLA 3GZCA 3EIAA 1IX6A 1OHWA 3GZDC 3ASBA 4XAUA 4XQ2A 4B9BA 1ASLA 3DXVA 4ZASA 2YKUA 2AY6A 2TPLA 1AMQA 4PFFA 1SZUA 1SFFA 1BJOA 3JU7A 1CZCA 1AMSA 4Q75A 2CJGA 3N7NA 4U2HA 2BKWA 3QN6A 1SPAA 3ISLA 4R8DA 3H7FA 1ARIA 2VGTA 2VIBA 1CJ0A 1GC0A 1Z3ZA 2D7YA 4WB0B 4WYCA 4RIZA 2GQNA 1TOJA 3NX3A 5DJ9A 2YOBA 2BYJA 1LS3A 4GE7A 3F0HA 2OGEA 5G4IA 4HVKA 1FC4A 1ASDA 3PDBB 2O1BA 4W1XA 3LG0A 4ZWMA 3MAFA 1J04A 4J8LA 2XH1A 1TOKA 3QGUA 2CANA 2CB1A 1KMJA 1W23A 4RAEA 3ZRQA 1BJOB 1I43A 1IJIA 2WK9A 4OC9A 2C0RA 5AX8A 4BQ0A 4E1OA 1TARA 2R5CA 3FCRA 4IXZA 3MKJA 2W7MA 3AEJA 4ZDLA 5JAYA 2AY7A 2C81A 1N8PA 3ASAA 2GSAA 2VMYA 4OCAA 1B9IA 1G7WA 3FQ7A 2E7JA 3NUIA 3NRAA 3BC8A 1PFFA 2EZ2A 2DOUA 4LNLA 2W7HA 4DQ6A 4BA5A 3MAFB 1DFOA 4IXSA 2JGTA 1RVYA 2YKYA 4AOAA 1YJSA 5E4ZA 3WKRA 4ZLVA 3FQ8A 1ARSA 1UU2A 5HHYA 3R4TA 3TQXA 3N4RA 1GC2A 1B5OA 1YIZA 4OTLA 1EG5A 4JE5A 3I16A 2FQ6A 4U1TA 5G2PA 4MQQA 3TFTA 2R5CB 4W1WA 4JF0A 1X2AA 4ZWVA 1AHGA 1KL2A 2F8JA 1C0NA 4JEYA 4WBTA 1AAWA 1YJZA 4HF8A 3ZRRA 5M4DA 4ITGA 3FZ7A 3MC6C 1X28A 5LH9A 1TOGA 2EPJA 3CQ4A 3KKIA 3MEBA 3NDNA 2ZY4A 1JS6A 1Y4IA 2BI2A 2OGAA 2CY8A 1YIYA 2EGYA 4WP0A 2AY2A 2JJFA 3E77A 2VMXA 1MAPA 3L44A 3RI6A 4RITA 2YKVA 4PVFA 3VOMA 2ZY2A 4CVQA 1C7OA 2HZPA 3CBFA 1DJ9A 1QZ9A 4BMKA 3FSLA 2VMWA 4L0OA 4IYOA 2HOZA 1AIAA 1DJEA 2Z67A 3HQTA 4GSAA 2OQXA 3R9AA 3FFHA 1OHYA 3K40A 2CINA 1N2TA 4OYTA 1FG7A 1M0NA 4E77A 1ELQA 1LC5A 1KKPA 1DGEA 2BWPA 3NYSA 2YRIA 1IBJA 1VP4A 1S09A 3BN1A 3BV0A 2VMQA 2X3LA 4F5MA 4F5JA 5EIGA 3W1HA 5M46A 1I48A 4OBUA 3N5MA 1T3IA 3LVKA 1ZODA 2VI8A 1G4VA 3JWBA 2WKAA 2O0RA 2R2NA 5FT5A 4J5UA 5G09A 4ZAHA 3HLMA 1LK9A 1BKGA 3QPGA 3AEJC 2VIAA 4MY5A 2A1VA 5HDMA 5EFSA 4F5IA 2V1PA 1V2EA 4WYEA 4E3RA 4ZM3A 1CZEA 3RCHA 3WY7A 4F4EA 2PB2A 4H51A 1VJOA 3W1JA 3EI9A 4BHDA 2VGWA 3EUCA 2DGMA 3AENA 1CQ8A 2YRRA 3GETA 3M5UA 4XK1A 2ZSLA 3PIUA 2VYCA 1ASAA 2VGUA 1XI9A 1H1CA 3DRDA 3ELPA 4MQRA 3BB8A 3QHXA 1JG8A 2JISA 3P1TA 4MGRA 5G2QA 3ZZJA 1I41A 3AEMA 2ZSMA 1AKCA 2FKIA 3ECDA 3LV2A 4E3QA 4F5GA 4FL0A 1C7NA 2HUFA 1RV3A 3VP6A 4GE4A 3PD6A 3RCHB 5DJ1A 4UHOA 4B98A 5EAVA 3H9XA 3T32A 1TOIA 4WYFA 1OXPA 2BI5A 5DX5A 3HL2A 3AENB 1MDZA 1MDXA 2DKBA 4IW7A 3ZRPA 2EYQA 3B8XA 3A2BA 4ADCA 8AATA 1IUGA 4XJPA 1GDEA 3HDOA 2GMUA 3A8UX 3GJUA 2FNUA 1AHFA 2AY8A 3HVYA 2VMSA 4M2JA 4O6ZA 4F5FA 1G7XA 2CFBA 2QA3A 2JJEA 3LVJA 4I8AA 4IX8A 2D65A 3E2ZA 1AMAA 4LNJA 2W7IA 4QGRA 3VK2A 3MAUA 1ZC9A 2PB0A 3ELEA 2HOXA 4CXRA 1CS1A 1AKBA 1X29A 2W8TA 4GEBA 2Z9WA 1YAAA 1O69A 4JF1A 4A0GA 1TATA 3IF2A 3GWPA 4NOGA 4ZSWA 2R5EA 1WYVA 3DXWA 3N4SA 3JZLA 4A0FA 4K2BA 2NMPA 4ZSYA 4UOYA 3JTXA 3ATHA 3RBFA 2D63A 1GCKA 1AY5A 5FT8A 2QLRA 4LNMA 2E7UA 1ASFA 1SF2A 1WKGA 3FFRA 4R5ZA 1S06A 2AY4A 2GMSA 1AY8A 1QJ5A 1S07A 4WLHA 4A6UA 2W7JA 1QITA 3E2ZB 5FT4A 1MGVA 7AATA 3FVSA 3G0TA 1W7NA 4Y0HA 2JG2A 3CAIA 2CSTA 3AEPA 4JEXA 3NNKA 1OXOA 3USFA 4GRXA 1WYVB 2W7EA 1WYUA 5HXXA 1QGNA 4JEVA 1ASGA 3VK4A 5F9SA 1DJUA 1KL1A 2DGKA 1X0MA 4MKJA 1ASEA 1GD9A 5EUEA 2HUIA 4F5KA 3E6GA 3AEMC 3G7QA 1GC3A 1RVUA 3EI6A 4XJMA 4W1VA 3H14A 3BWNA 5C6UA 5J8QA 2VI9A 1AIBA 1QJ3A 5I92A 4ISYA 2G6WA 4OBVA 3VAXA 3GSBA 3FDBA 1M0OA 3WGBA 2BWOA 3PA9A 2CTZA 4EMYA 4W8IA 2YCNA 2Z1YA 3CQ6A 4WXBA 3ACZA 3Q8NA 3MBBA 1D7SA 1IVRA 3EZSA 1VEFA 2ZUKA 5EUNA 3FVUA 1LC8A 1YNUA 2Z9XA 4KYOA 2HOYA 4MQPA 1GEYA 3A9ZA 5E5IA 1ASBA 2HP1A 9AATA 4N0BA 1PG8A 2EZ1A 3LWSA 1AJRA 2FN6A 4WXFA 1B8GA 2YHKA 3AELA 5M49A 1SVVA 3FQAA 3N75A 2HUUA 3G8MA 2W7DA 1ARGA 4GDYA 1BJNA 4BA4A 1QISA 4LW2A 5F8VA 3COGA 2W8VA 2CH1A 3N0LA 1O61A 4F5LA 4A72A 1J32A 1TOEA 1U08A 4IYOB 2VGSA 4ADBA 4R2NA 1TASA 3BCXA 2PO3A 3MADA 2W8JA 1DKAA 2WK7A 4Q31A 4WLJA 4AH3A 1ASNA 1SZKA 4F5HA 2OKJA 1AHYA 1KKJA 2JJHA 2Z1ZA 1BJ4A 3KGXA 1ASMA 1DGDA 1V2DA 2R0TA 2BI9A 2HORA 3EI5A 3EI7A 3FRKA 4WD2A 5EIGB 1S08A 3D6KA 3HBXA 3OKSA 3I5TA 2AY3A 4WYGA 3RUYA 4RLGA 1C9CA 4GE9A 3WX9A 2AEVA 3NU7A 2C7TA 2OKKA 3DC1A 1ELUA 1LC7A 2BWNA 5EUDA 3E9KA 4ADDA 1UU1A 1SZSA 2VMUA 3F6TA 4N0WA 4DBCA 5BJ4A 2ZJGA 3WCNA 1S0AA 1AJSA 3B1CA 3B1DA 4WXGA 3W1IA 5M4BA 3KGWA 3FDDA 2D7ZA 3UAKA 3WKSA 3LY1A 1B9HA 3K7YA 3QBOA 1B5PA 3UE8A 2W7GA 4XJOA 3TFUA 3I4JA 1ARTA 3QI6A 3RQ1A 3AOVA 4UHNA 2RFVA 3E2FA 4EFFA 2Z61A 2Q7WA 3EIBA 3TCMA 3BWNC 4OMAA 1H0CA 1TPLA 1E5FA 1CL2A 1AAMA 3FZ8A 4Q76A 5BJ3A 1IX8A 1V72A 3PDBA 1AJSB 4TV7A 2W7FA 5LHAA 1OHVA 2YKXA 4KXKA 4AZKA 4WYDA 3ZZKA 4FFCA 4Y0IA 1QIRA 1E5EA 3L8AA 4RKDA 3LVMA 3PD6B 1LW5A 3DR4A 2DGLA 4CBSA 2VMRA 1RV4A 2D64A 1AHEA 2WK8A 2AATA 4ZDPA 4P3MA 1WSTA 4Q6RA 3A9XA 1ORDA 4W91A 4Y0DA 4UHMA 1BQDA 1CQ6A 1D7RA 3DZZA 1M4NA 3FZ6A 3EI8A 3FVXA 3GR9A 5G0AA 1ASCA 3WGCA 3PDXA 2GB3A 2ZY5A 2ZY3A 1KMKA 3BWOA 1GEXA 2C44A 3NYTA 3TATA 4CBRA 4DGTA 5FT6A 2QSRA 1PMMA 4ZDOA 1PMOA 3II0A 2VMPA 1D2FA 4AZJA 4M2KA 1M6SA 1Z7DA 3PPLA 2EH6A 2ZYJA 4LW4A 2ZP7A 1ECXA 1W7MA 4JE5D 4A6RA 2Z20A 2AEUA 2Z9VA 1V2FA 1M0QA 5G4JA 1BQAA 1DTYA 2QB3A 3RBLA 2AY9A 3BCAA 2Z9UA 3GBXA 4TMRA 1BT4A 4CXQA 4PIWA 2BIAA 1O62A 4XEWA 3B46A 3EZ1A 4TN4A 3AOWA 3WZFA 3QM2A 2DKJA 1MLYA 1C4KA 1WKHA 1YJYA 1CL1A 1XEYA 1MDOA 1BW0A 4RJYA 1LW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K8B A;  1AMR A;  3F9T A;  1GEW A;  1UU0 A;  3BCB A;  4EB5 A;  3KE3 A;  2VMV A;  3BS8 A;  4A6T A;  1EQB A;  1N31 A;  1WYU B;  2W8U A;  3FD0 A;  3GZD A;  1UKJ A;  2W7K A;  2D61 A;  1G4X A;  3AEO A;  2AY5 A;  4RKC A;  3AAT A;  1AHX A;  1M32 A;  3OP7 A;  4M2M A;  1I29 A;  1CQ7 A;  2DR1 A;  4IY7 A;  1AY4 A;  2CH2 A;  3FTB A;  2EO5 A;  3DYD A;  1M7Y A;  1MLZ A;  1BS0 A;  3JW9 A;  2QMA A;  5D5S A;  4W5K A;  1JF9 A;  2W7L A;  1B4X A;  2E7I A;  3CQ5 A;  2ZC0 A;  2BI1 A;  1WYT A;  2CJD A;  2VMO A;  4JEZ A;  4ADE A;  1AIC A;  2BIE A;  1AX4 A;  2O7C A;  1FG3 A;  4XJL A;  1MAQ A;  1W7L A;  2VLF A;  4WYA A;  4AO4 A;  3WCO A;  3VK3 A;  4MSO A;  2D5Y A;  2ORD A;  3IHJ A;  4IXO A;  2VGV A;  2XBN A;  2FYF A;  3DOD A;  4PFN A;  4RM1 A;  2E54 A;  4ITX A;  4ATQ A;  2X5D A;  4EU1 A;  1ARH A;  2X8U A;  2D66 A;  3P6K A;  1OAT A;  4JEW A;  2W8W A;  3UWC A;  3A9Y A;  3NUB A;  5TF5 A;  1BJW A;  1GC4 A;  2AY1 A;  4A00 A;  1YOO A;  3E2Y A;  4LC3 A;  4AO9 A;  1W3U A;  2X5F A;  3PGY A;  5EAA A;  1ZOB A;  3HT4 A;  2YCT A;  2BHX A;  4A0H A;  1WYT B;  3JWA A;  3HMU A;  3PJ0 A;  4R5F A;  2VLH A;  4MKK A;  2YCP A;  2JJG A;  2HP2 A;  3B1E A;  2VMT A;  3NTJ A;  2FM1 A;  5EQC A;  1O4S A;  4RJ0 A;  5DB5 A;  4OT8 A;  3FKD A;  5E3K A;  4A0R A;  2OAT A;  1D7U A;  1IAX A;  1D7V A;  1C7G A;  2VMZ A;  3PAA A;  4K2I A;  3K28 A;  4EB7 A;  4KAM A;  1JS3 A;  1M0P A;  3DU4 A;  5D95 A;  3AV7 A;  2BIG A;  5IWQ A;  2VMN A;  1LKC A;  2VGZ A;  2V0Y A;  4P7Y A;  2QB2 A;  1EJI A;  2FNI A;  3MC6 A;  3NYU A;  4WB0 A;  3WLX A;  4ATP A;  4ZM4 A;  1IAY A;  1AKA A;  1P3W A;  2BI3 A;  2CJH A;  1GBN A;  4UQV A;  3DR7 A;  3LVL B;  1IX7 A;  4K2M A;  2QBT A;  3NU8 A;  2BYL A;  3GZC A;  3EIA A;  1IX6 A;  1OHW A;  3GZD C;  3ASB A;  4XAU A;  4XQ2 A;  4B9B A;  1ASL A;  3DXV A;  4ZAS A;  2YKU A;  2AY6 A;  2TPL A;  1AMQ A;  4PFF A;  1SZU A;  1SFF A;  1BJO A;  3JU7 A;  1CZC A;  1AMS A;  4Q75 A;  2CJG A;  4U2H A;  2BKW A;  3QN6 A;  1SPA A;  3ISL A;  4R8D A;  3H7F A;  1ARI A;  2VGT A;  2VIB A;  1CJ0 A;  1GC0 A;  1Z3Z A;  2D7Y A;  4WB0 B;  4WYC A;  4RIZ A;  2GQN A;  1TOJ A;  3NX3 A;  5DJ9 A;  2YOB A;  2BYJ A;  1LS3 A;  4GE7 A;  3F0H A;  2OGE A;  5G4I A;  4HVK A;  1FC4 A;  1ASD A;  3PDB B;  2O1B A;  4W1X A;  3LG0 A;  4ZWM A;  3MAF A;  1J04 A;  4J8L A;  2XH1 A;  1TOK A;  3QGU A;  2CAN A;  2CB1 A;  1KMJ A;  1W23 A;  4RAE A;  3ZRQ A;  1BJO B;  1I43 A;  1IJI A;  2WK9 A;  4OC9 A;  2C0R A;  5AX8 A;  4BQ0 A;  4E1O A;  1TAR A;  2R5C A;  3FCR A;  4IXZ A;  3MKJ A;  2W7M A;  3AEJ A;  4ZDL A;  5JAY A;  2AY7 A;  2C81 A;  1N8P A;  3ASA A;  2GSA A;  2VMY A;  4OCA A;  1B9I A;  1G7W A;  3FQ7 A;  2E7J A;  3NUI A;  3NRA A;  3BC8 A;  1PFF A;  2EZ2 A;  2DOU A;  4LNL A;  2W7H A;  4DQ6 A;  4BA5 A;  3MAF B;  1DFO A;  4IXS A;  2JGT A;  1RVY A;  2YKY A;  4AOA A;  1YJS A;  5E4Z A;  3WKR A;  4ZLV A;  3FQ8 A;  1ARS A;  1UU2 A;  5HHY A;  3R4T A;  3TQX A;  1GC2 A;  1B5O A;  1YIZ A;  4OTL A;  1EG5 A;  4JE5 A;  3I16 A;  2FQ6 A;  4U1T A;  5G2P A;  4MQQ A;  3TFT A;  2R5C B;  4W1W A;  4JF0 A;  1X2A A;  4ZWV A;  1AHG A;  1KL2 A;  2F8J A;  1C0N A;  4JEY A;  4WBT A;  1AAW A;  1YJZ A;  4HF8 A;  3ZRR A;  5M4D A;  4ITG A;  3FZ7 A;  3MC6 C;  1X28 A;  5LH9 A;  1TOG A;  2EPJ A;  3CQ4 A;  3KKI A;  3MEB A;  3NDN A;  2ZY4 A;  1JS6 A;  1Y4I A;  2BI2 A;  2OGA A;  2CY8 A;  1YIY A;  2EGY A;  4WP0 A;  2AY2 A;  2JJF A;  3E77 A;  2VMX A;  1MAP A;  3L44 A;  3RI6 A;  4RIT A;  2YKV A;  4PVF A;  3VOM A;  2ZY2 A;  4CVQ A;  1C7O A;  2HZP A;  3CBF A;  1DJ9 A;  1QZ9 A;  4BMK A;  3FSL A;  2VMW A;  4L0O A;  4IYO A;  2HOZ A;  1AIA A;  1DJE A;  2Z67 A;  3HQT A;  4GSA A;  2OQX A;  3R9A A;  3FFH A;  1OHY A;  3K40 A;  2CIN A;  1N2T A;  4OYT A;  1FG7 A;  1M0N A;  4E77 A;  1ELQ A;  1LC5 A;  1KKP A;  1DGE A;  2BWP A;  3NYS A;  2YRI A;  1IBJ A;  1VP4 A;  1S09 A;  3BN1 A;  3BV0 A;  2VMQ A;  2X3L A;  4F5M A;  4F5J A;  5EIG A;  3W1H A;  5M46 A;  1I48 A;  4OBU A;  3N5M A;  1T3I A;  3LVK A;  1ZOD A;  2VI8 A;  1G4V A;  3JWB A;  2WKA A;  2O0R A;  2R2N A;  5FT5 A;  4J5U A;  5G09 A;  4ZAH A;  3HLM A;  1LK9 A;  1BKG A;  3QPG A;  3AEJ C;  2VIA A;  4MY5 A;  5HDM A;  5EFS A;  4F5I A;  2V1P A;  1V2E A;  4WYE A;  4E3R A;  4ZM3 A;  1CZE A;  3RCH A;  3WY7 A;  4F4E A;  2PB2 A;  4H51 A;  1VJO A;  3W1J A;  3EI9 A;  4BHD A;  2VGW A;  3EUC A;  2DGM A;  3AEN A;  1CQ8 A;  2YRR A;  3GET A;  3M5U A;  4XK1 A;  2ZSL A;  3PIU A;  2VYC A;  1ASA A;  2VGU A;  1XI9 A;  1H1C A;  3DRD A;  3ELP A;  4MQR A;  3BB8 A;  3QHX A;  1JG8 A;  2JIS A;  3P1T A;  4MGR A;  5G2Q A;  3ZZJ A;  1I41 A;  3AEM A;  2ZSM A;  1AKC A;  3ECD A;  3LV2 A;  4E3Q A;  4F5G A;  4FL0 A;  1C7N A;  2HUF A;  1RV3 A;  3VP6 A;  4GE4 A;  3PD6 A;  3RCH B;  5DJ1 A;  4UHO A;  4B98 A;  5EAV A;  3T32 A;  1TOI A;  4WYF A;  1OXP A;  2BI5 A;  5DX5 A;  3HL2 A;  3AEN B;  1MDZ A;  1MDX A;  2DKB A;  4IW7 A;  3ZRP A;  3B8X A;  3A2B A;  4ADC A;  8AAT A;  1IUG A;  4XJP A;  1GDE A;  3HDO A;  2GMU A;  3A8U X;  3GJU A;  2FNU A;  1AHF A;  2AY8 A;  3HVY A;  2VMS A;  4M2J A;  4O6Z A;  4F5F A;  1G7X A;  2CFB A;  2QA3 A;  2JJE A;  3LVJ A;  4I8A A;  4IX8 A;  2D65 A;  3E2Z A;  1AMA A;  4LNJ A;  2W7I A;  4QGR A;  3VK2 A;  3MAU A;  1ZC9 A;  2PB0 A;  3ELE A;  2HOX A;  4CXR A;  1CS1 A;  1AKB A;  1X29 A;  2W8T A;  4GEB A;  2Z9W A;  1YAA A;  1O69 A;  4JF1 A;  4A0G A;  1TAT A;  3IF2 A;  3GWP A;  4NOG A;  4ZSW A;  2R5E A;  1WYV A;  3DXW A;  3JZL A;  4A0F A;  4K2B A;  2NMP A;  4ZSY A;  4UOY A;  3JTX A;  3ATH A;  3RBF A;  2D63 A;  1GCK A;  1AY5 A;  5FT8 A;  2QLR A;  4LNM A;  2E7U A;  1ASF A;  1SF2 A;  1WKG A;  3FFR A;  4R5Z A;  1S06 A;  2AY4 A;  2GMS A;  1AY8 A;  1QJ5 A;  1S07 A;  4WLH A;  4A6U A;  2W7J A;  1QIT A;  3E2Z B;  5FT4 A;  1MGV A;  7AAT A;  3FVS A;  3G0T A;  1W7N A;  4Y0H A;  2JG2 A;  3CAI A;  2CST A;  3AEP A;  4JEX A;  3NNK A;  1OXO A;  3USF A;  4GRX A;  1WYV B;  2W7E A;  1WYU A;  5HXX A;  1QGN A;  4JEV A;  1ASG A;  3VK4 A;  5F9S A;  1DJU A;  1KL1 A;  2DGK A;  1X0M A;  4MKJ A;  1ASE A;  1GD9 A;  5EUE A;  2HUI A;  4F5K A;  3E6G A;  3AEM C;  3G7Q A;  1GC3 A;  1RVU A;  3EI6 A;  4XJM A;  4W1V A;  3H14 A;  3BWN A;  5C6U A;  5J8Q A;  2VI9 A;  1AIB A;  1QJ3 A;  5I92 A;  4ISY A;  2G6W A;  4OBV A;  3VAX A;  3GSB A;  3FDB A;  1M0O A;  3WGB A;  2BWO A;  3PA9 A;  2CTZ A;  4EMY A;  4W8I A;  2YCN A;  2Z1Y A;  3CQ6 A;  4WXB A;  3ACZ A;  3Q8N A;  3MBB A;  1D7S A;  1IVR A;  3EZS A;  1VEF A;  2ZUK A;  5EUN A;  3FVU A;  1LC8 A;  1YNU A;  2Z9X A;  4KYO A;  2HOY A;  4MQP A;  1GEY A;  3A9Z A;  5E5I A;  1ASB A;  2HP1 A;  9AAT A;  4N0B A;  1PG8 A;  2EZ1 A;  3LWS A;  1AJR A;  2FN6 A;  4WXF A;  1B8G A;  2YHK A;  3AEL A;  5M49 A;  1SVV A;  3FQA A;  3N75 A;  2HUU A;  3G8M A;  2W7D A;  1ARG A;  4GDY A;  1BJN A;  4BA4 A;  1QIS A;  4LW2 A;  5F8V A;  3COG A;  2W8V A;  2CH1 A;  3N0L A;  1O61 A;  4F5L A;  4A72 A;  1J32 A;  1TOE A;  1U08 A;  4IYO B;  2VGS A;  4ADB A;  4R2N A;  1TAS A;  3BCX A;  2PO3 A;  3MAD A;  2W8J A;  1DKA A;  2WK7 A;  4Q31 A;  4WLJ A;  4AH3 A;  1ASN A;  1SZK A;  4F5H A;  2OKJ A;  1AHY A;  1KKJ A;  2JJH A;  2Z1Z A;  1BJ4 A;  3KGX A;  1ASM A;  1DGD A;  1V2D A;  2R0T A;  2BI9 A;  2HOR A;  3EI5 A;  3EI7 A;  3FRK A;  4WD2 A;  5EIG B;  1S08 A;  3D6K A;  3HBX A;  3OKS A;  3I5T A;  2AY3 A;  4WYG A;  3RUY A;  4RLG A;  1C9C A;  4GE9 A;  3WX9 A;  2AEV A;  3NU7 A;  2C7T A;  2OKK A;  3DC1 A;  1ELU A;  1LC7 A;  2BWN A;  5EUD A;  3E9K A;  4ADD A;  1UU1 A;  1SZS A;  2VMU A;  3F6T A;  4N0W A;  4DBC A;  5BJ4 A;  2ZJG A;  3WCN A;  1S0A A;  1AJS A;  3B1C A;  3B1D A;  4WXG A;  3W1I A;  5M4B A;  3KGW A;  3FDD A;  2D7Z A;  3UAK A;  3WKS A;  3LY1 A;  1B9H A;  3K7Y A;  3QBO A;  1B5P A;  3UE8 A;  2W7G A;  4XJO A;  3TFU A;  3I4J A;  1ART A;  3QI6 A;  3RQ1 A;  3AOV A;  4UHN A;  2RFV A;  3E2F A;  4EFF A;  2Z61 A;  2Q7W A;  3EIB A;  3TCM A;  3BWN C;  4OMA A;  1H0C A;  1TPL A;  1E5F A;  1CL2 A;  1AAM A;  3FZ8 A;  4Q76 A;  5BJ3 A;  1IX8 A;  1V72 A;  3PDB A;  1AJS B;  4TV7 A;  2W7F A;  5LHA A;  1OHV A;  2YKX A;  4KXK A;  4AZK A;  4WYD A;  3ZZK A;  4FFC A;  4Y0I A;  1QIR A;  1E5E A;  3L8A A;  4RKD A;  3LVM A;  3PD6 B;  1LW5 A;  3DR4 A;  2DGL A;  4CBS A;  2VMR A;  1RV4 A;  2D64 A;  1AHE A;  2WK8 A;  2AAT A;  4ZDP A;  4P3M A;  1WST A;  4Q6R A;  3A9X A;  1ORD A;  4W91 A;  4Y0D A;  4UHM A;  1BQD A;  1CQ6 A;  1D7R A;  3DZZ A;  1M4N A;  3FZ6 A;  3EI8 A;  3FVX A;  3GR9 A;  5G0A A;  1ASC A;  3WGC A;  3PDX A;  2GB3 A;  2ZY5 A;  2ZY3 A;  1KMK A;  3BWO A;  1GEX A;  2C44 A;  3NYT A;  3TAT A;  4CBR A;  4DGT A;  5FT6 A;  1PMM A;  4ZDO A;  1PMO A;  3II0 A;  2VMP A;  1D2F A;  4AZJ A;  4M2K A;  1M6S A;  1Z7D A;  3PPL A;  2EH6 A;  2ZYJ A;  4LW4 A;  2ZP7 A;  1ECX A;  1W7M A;  4JE5 D;  4A6R A;  2Z20 A;  2AEU A;  2Z9V A;  1V2F A;  1M0Q A;  5G4J A;  1BQA A;  1DTY A;  2QB3 A;  3RBL A;  2AY9 A;  3BCA A;  2Z9U A;  3GBX A;  4TMR A;  1BT4 A;  4CXQ A;  4PIW A;  2BIA A;  1O62 A;  4XEW A;  3B46 A;  3EZ1 A;  4TN4 A;  3AOW A;  3WZF A;  3QM2 A;  2DKJ A;  1MLY A;  1C4K A;  1WKH A;  1YJY A;  1CL1 A;  1XEY A;  1MDO A;  1BW0 A;  4RJY A;  1LW4 A; 
#chains in the Genus database with same CATH topology
 5K8B A;  1AMR A;  3F9T A;  1GEW A;  1UU0 A;  3BCB A;  4EB5 A;  3KE3 A;  2VMV A;  3BS8 A;  4A6T A;  1EQB A;  1N31 A;  1WYU B;  2W8U A;  3FD0 A;  3GZD A;  1UKJ A;  2W7K A;  2D61 A;  1G4X A;  3AEO A;  2AY5 A;  4RKC A;  3AAT A;  1AHX A;  1M32 A;  3OP7 A;  4M2M A;  1I29 A;  1CQ7 A;  2DR1 A;  4IY7 A;  1AY4 A;  2CH2 A;  3FTB A;  2EO5 A;  3DYD A;  1M7Y A;  1MLZ A;  1BS0 A;  3JW9 A;  2QMA A;  5D5S A;  4W5K A;  1JF9 A;  2W7L A;  5KTB A;  1B4X A;  2E7I A;  3CQ5 A;  2ZC0 A;  2KFP A;  2BI1 A;  1WYT A;  2CJD A;  2VMO A;  4JEZ A;  4ADE A;  1AIC A;  2BIE A;  1AX4 A;  2O7C A;  1FG3 A;  4XJL A;  3N4X A;  1MAQ A;  1W7L A;  2VLF A;  4WYA A;  4AO4 A;  3WCO A;  3VK3 A;  4MSO A;  2D5Y A;  2ORD A;  3IHJ A;  4IXO A;  2VGV A;  2XBN A;  2FYF A;  3DOD A;  4PFN A;  4RM1 A;  2E54 A;  4ITX A;  4ATQ A;  2X5D A;  4EU1 A;  1ARH A;  2X8U A;  2D66 A;  3P6K A;  1OAT A;  4JEW A;  2W8W A;  3UWC A;  3A9Y A;  3NUB A;  5TF5 A;  1BJW A;  1GC4 A;  2AY1 A;  4A00 A;  1YOO A;  3E2Y A;  4LC3 A;  4AO9 A;  1W3U A;  2X5F A;  3PGY A;  5EAA A;  1ZOB A;  3HT4 A;  2YCT A;  2BHX A;  4A0H A;  1WYT B;  3JWA A;  3HMU A;  3PJ0 A;  4R5F A;  2VLH A;  4MKK A;  2YCP A;  2JJG A;  2HP2 A;  3B1E A;  2VMT A;  3NTJ A;  2FM1 A;  5EQC A;  1O4S A;  4RJ0 A;  5DB5 A;  4OT8 A;  3FKD A;  5E3K A;  4A0R A;  2OAT A;  1D7U A;  1IAX A;  1D7V A;  1C7G A;  2VMZ A;  3PAA A;  4K2I A;  2G7J A;  3K28 A;  2WB6 A;  4EB7 A;  4KAM A;  1JS3 A;  1M0P A;  3DU4 A;  5D95 A;  3AV7 A;  2BIG A;  5IWQ A;  2VMN A;  1LKC A;  2VGZ A;  2V0Y A;  4K05 A;  4P7Y A;  2QB2 A;  1EJI A;  2FNI A;  3MC6 A;  3NYU A;  4WB0 A;  3WLX A;  4ATP A;  4ZM4 A;  4H63 Q;  1IAY A;  1AKA A;  1P3W A;  2BI3 A;  2CJH A;  1GBN A;  4UQV A;  3DR7 A;  3LVL B;  1IX7 A;  4K2M A;  2QBT A;  3NU8 A;  2BYL A;  3GZC A;  3EIA A;  1IX6 A;  1OHW A;  3GZD C;  3ASB A;  4XAU A;  4XQ2 A;  4B9B A;  1ASL A;  3DXV A;  4ZAS A;  2YKU A;  2AY6 A;  2TPL A;  1AMQ A;  4PFF A;  1SZU A;  1SFF A;  1BJO A;  3JU7 A;  1CZC A;  1AMS A;  4Q75 A;  2CJG A;  3N7N A;  4U2H A;  2BKW A;  3QN6 A;  1SPA A;  3ISL A;  4R8D A;  3H7F A;  1ARI A;  2VGT A;  2VIB A;  1CJ0 A;  1GC0 A;  1Z3Z A;  2D7Y A;  4WB0 B;  4WYC A;  4RIZ A;  2GQN A;  1TOJ A;  3NX3 A;  5DJ9 A;  2YOB A;  2BYJ A;  1LS3 A;  4GE7 A;  3F0H A;  2OGE A;  5G4I A;  4HVK A;  1FC4 A;  1ASD A;  3PDB B;  2O1B A;  4W1X A;  3LG0 A;  4ZWM A;  3MAF A;  1J04 A;  4J8L A;  2XH1 A;  1TOK A;  3QGU A;  2CAN A;  2CB1 A;  1KMJ A;  1W23 A;  4RAE A;  3ZRQ A;  1BJO B;  1I43 A;  1IJI A;  2WK9 A;  4OC9 A;  2C0R A;  5AX8 A;  4BQ0 A;  4E1O A;  1TAR A;  2R5C A;  3FCR A;  4IXZ A;  3MKJ A;  2W7M A;  3AEJ A;  4ZDL A;  5JAY A;  2AY7 A;  2C81 A;  1N8P A;  3ASA A;  2GSA A;  2VMY A;  4OCA A;  1B9I A;  1G7W A;  3FQ7 A;  2E7J A;  3NUI A;  3NRA A;  3BC8 A;  1PFF A;  2EZ2 A;  2DOU A;  4LNL A;  2W7H A;  4DQ6 A;  4BA5 A;  3MAF B;  1DFO A;  4IXS A;  2JGT A;  1RVY A;  2YKY A;  4AOA A;  1YJS A;  5E4Z A;  3WKR A;  4ZLV A;  3FQ8 A;  1ARS A;  1UU2 A;  5HHY A;  3R4T A;  3TQX A;  3N4R A;  1GC2 A;  1B5O A;  1YIZ A;  4OTL A;  1EG5 A;  4JE5 A;  3I16 A;  2FQ6 A;  4U1T A;  5G2P A;  4MQQ A;  3TFT A;  2R5C B;  4W1W A;  4JF0 A;  1X2A A;  4ZWV A;  1AHG A;  1KL2 A;  2F8J A;  1C0N A;  4JEY A;  4WBT A;  1AAW A;  1YJZ A;  4HF8 A;  3ZRR A;  5M4D A;  4ITG A;  3FZ7 A;  3MC6 C;  1X28 A;  5LH9 A;  1TOG A;  2EPJ A;  3CQ4 A;  3KKI A;  3MEB A;  3NDN A;  2ZY4 A;  1JS6 A;  1Y4I A;  2BI2 A;  2OGA A;  2CY8 A;  1YIY A;  2EGY A;  4WP0 A;  2AY2 A;  2JJF A;  3E77 A;  2VMX A;  1MAP A;  3L44 A;  3RI6 A;  4RIT A;  2YKV A;  4PVF A;  3VOM A;  2ZY2 A;  4CVQ A;  1C7O A;  2HZP A;  3CBF A;  1DJ9 A;  1QZ9 A;  4BMK A;  3FSL A;  2VMW A;  4L0O A;  4IYO A;  2HOZ A;  1AIA A;  1DJE A;  2Z67 A;  3HQT A;  4GSA A;  2OQX A;  3R9A A;  3FFH A;  1OHY A;  3K40 A;  2CIN A;  1N2T A;  4OYT A;  1FG7 A;  1M0N A;  4E77 A;  1ELQ A;  1LC5 A;  1KKP A;  1DGE A;  2BWP A;  3NYS A;  2YRI A;  1IBJ A;  1VP4 A;  1S09 A;  3BN1 A;  3BV0 A;  2VMQ A;  2X3L A;  4F5M A;  4F5J A;  5EIG A;  3W1H A;  5M46 A;  1I48 A;  4OBU A;  3N5M A;  1T3I A;  3LVK A;  1ZOD A;  2VI8 A;  1G4V A;  3JWB A;  2WKA A;  2O0R A;  2R2N A;  5FT5 A;  4J5U A;  5G09 A;  4ZAH A;  3HLM A;  1LK9 A;  1BKG A;  3QPG A;  3AEJ C;  2VIA A;  4MY5 A;  2A1V A;  5HDM A;  5EFS A;  4F5I A;  2V1P A;  1V2E A;  4WYE A;  4E3R A;  4ZM3 A;  1CZE A;  3RCH A;  3WY7 A;  4F4E A;  2PB2 A;  4H51 A;  1VJO A;  3W1J A;  3EI9 A;  4BHD A;  2VGW A;  3EUC A;  2DGM A;  3AEN A;  1CQ8 A;  2YRR A;  3GET A;  3M5U A;  4XK1 A;  2ZSL A;  3PIU A;  2VYC A;  1ASA A;  2VGU A;  1XI9 A;  1H1C A;  3DRD A;  3ELP A;  4MQR A;  3BB8 A;  3QHX A;  1JG8 A;  2JIS A;  3P1T A;  4MGR A;  5G2Q A;  3ZZJ A;  1I41 A;  3AEM A;  2ZSM A;  1AKC A;  2FKI A;  3ECD A;  3LV2 A;  4E3Q A;  4F5G A;  4FL0 A;  1C7N A;  2HUF A;  1RV3 A;  3VP6 A;  4GE4 A;  3PD6 A;  3RCH B;  5DJ1 A;  4UHO A;  4B98 A;  5EAV A;  3H9X A;  3T32 A;  1TOI A;  4WYF A;  1OXP A;  2BI5 A;  5DX5 A;  3HL2 A;  3AEN B;  1MDZ A;  1MDX A;  2DKB A;  4IW7 A;  3ZRP A;  2EYQ A;  3B8X A;  3A2B A;  4ADC A;  8AAT A;  1IUG A;  4XJP A;  1GDE A;  3HDO A;  2GMU A;  3A8U X;  3GJU A;  2FNU A;  1AHF A;  2AY8 A;  3HVY A;  2VMS A;  4M2J A;  4O6Z A;  4F5F A;  1G7X A;  2CFB A;  2QA3 A;  2JJE A;  3LVJ A;  4I8A A;  4IX8 A;  2D65 A;  3E2Z A;  1AMA A;  4LNJ A;  2W7I A;  4QGR A;  3VK2 A;  3MAU A;  1ZC9 A;  2PB0 A;  3ELE A;  2HOX A;  4CXR A;  1CS1 A;  1AKB A;  1X29 A;  2W8T A;  4GEB A;  2Z9W A;  1YAA A;  1O69 A;  4JF1 A;  4A0G A;  1TAT A;  3IF2 A;  3GWP A;  4NOG A;  4ZSW A;  2R5E A;  1WYV A;  3DXW A;  3N4S A;  3JZL A;  4A0F A;  4K2B A;  2NMP A;  4ZSY A;  4UOY A;  3JTX A;  3ATH A;  3RBF A;  2D63 A;  1GCK A;  1AY5 A;  5FT8 A;  2QLR A;  4LNM A;  2E7U A;  1ASF A;  1SF2 A;  1WKG A;  3FFR A;  4R5Z A;  1S06 A;  2AY4 A;  2GMS A;  1AY8 A;  1QJ5 A;  1S07 A;  4WLH A;  4A6U A;  2W7J A;  1QIT A;  3E2Z B;  5FT4 A;  1MGV A;  7AAT A;  3FVS A;  3G0T A;  1W7N A;  4Y0H A;  2JG2 A;  3CAI A;  2CST A;  3AEP A;  4JEX A;  3NNK A;  1OXO A;  3USF A;  4GRX A;  1WYV B;  2W7E A;  1WYU A;  5HXX A;  1QGN A;  4JEV A;  1ASG A;  3VK4 A;  5F9S A;  1DJU A;  1KL1 A;  2DGK A;  1X0M A;  4MKJ A;  1ASE A;  1GD9 A;  5EUE A;  2HUI A;  4F5K A;  3E6G A;  3AEM C;  3G7Q A;  1GC3 A;  1RVU A;  3EI6 A;  4XJM A;  4W1V A;  3H14 A;  3BWN A;  5C6U A;  5J8Q A;  2VI9 A;  1AIB A;  1QJ3 A;  5I92 A;  4ISY A;  2G6W A;  4OBV A;  3VAX A;  3GSB A;  3FDB A;  1M0O A;  3WGB A;  2BWO A;  3PA9 A;  2CTZ A;  4EMY A;  4W8I A;  2YCN A;  2Z1Y A;  3CQ6 A;  4WXB A;  3ACZ A;  3Q8N A;  3MBB A;  1D7S A;  1IVR A;  3EZS A;  1VEF A;  2ZUK A;  5EUN A;  3FVU A;  1LC8 A;  1YNU A;  2Z9X A;  4KYO A;  2HOY A;  4MQP A;  1GEY A;  3A9Z A;  5E5I A;  1ASB A;  2HP1 A;  9AAT A;  4N0B A;  1PG8 A;  2EZ1 A;  3LWS A;  1AJR A;  2FN6 A;  4WXF A;  1B8G A;  2YHK A;  3AEL A;  5M49 A;  1KAF A;  1SVV A;  3FQA A;  3N75 A;  2HUU A;  3G8M A;  2W7D A;  1ARG A;  4GDY A;  1BJN A;  4BA4 A;  1QIS A;  4LW2 A;  5F8V A;  3COG A;  2W8V A;  2CH1 A;  3N0L A;  1O61 A;  4F5L A;  4A72 A;  1J32 A;  1TOE A;  1U08 A;  4IYO B;  2VGS A;  4ADB A;  4R2N A;  1TAS A;  3BCX A;  2PO3 A;  3MAD A;  2W8J A;  1DKA A;  2WK7 A;  4Q31 A;  4WLJ A;  4AH3 A;  1ASN A;  1SZK A;  4F5H A;  2OKJ A;  1AHY A;  1KKJ A;  2JJH A;  2Z1Z A;  1BJ4 A;  3KGX A;  1ASM A;  1DGD A;  1V2D A;  2R0T A;  2BI9 A;  2HOR A;  3EI5 A;  3EI7 A;  3FRK A;  4WD2 A;  5EIG B;  1S08 A;  3D6K A;  3HBX A;  3OKS A;  3I5T A;  2AY3 A;  4WYG A;  3RUY A;  4RLG A;  1C9C A;  4GE9 A;  3WX9 A;  2AEV A;  3NU7 A;  2C7T A;  2OKK A;  3DC1 A;  1ELU A;  1LC7 A;  2BWN A;  5EUD A;  3E9K A;  4ADD A;  1UU1 A;  1SZS A;  2VMU A;  3F6T A;  4N0W A;  4DBC A;  5BJ4 A;  2ZJG A;  3WCN A;  1S0A A;  1AJS A;  3B1C A;  3B1D A;  4WXG A;  3W1I A;  5M4B A;  3KGW A;  3FDD A;  2D7Z A;  3UAK A;  3WKS A;  3LY1 A;  1B9H A;  3K7Y A;  3QBO A;  1B5P A;  3UE8 A;  2W7G A;  4XJO A;  3TFU A;  3I4J A;  1ART A;  3QI6 A;  3RQ1 A;  3AOV A;  4UHN A;  2RFV A;  3E2F A;  4EFF A;  2Z61 A;  2Q7W A;  3EIB A;  3TCM A;  3BWN C;  4OMA A;  1H0C A;  1TPL A;  1E5F A;  1CL2 A;  1AAM A;  3FZ8 A;  4Q76 A;  5BJ3 A;  1IX8 A;  1V72 A;  3PDB A;  1AJS B;  4TV7 A;  2W7F A;  5LHA A;  1OHV A;  2YKX A;  4KXK A;  4AZK A;  4WYD A;  3ZZK A;  4FFC A;  4Y0I A;  1QIR A;  1E5E A;  3L8A A;  4RKD A;  3LVM A;  3PD6 B;  1LW5 A;  3DR4 A;  2DGL A;  4CBS A;  2VMR A;  1RV4 A;  2D64 A;  1AHE A;  2WK8 A;  2AAT A;  4ZDP A;  4P3M A;  1WST A;  4Q6R A;  3A9X A;  1ORD A;  4W91 A;  4Y0D A;  4UHM A;  1BQD A;  1CQ6 A;  1D7R A;  3DZZ A;  1M4N A;  3FZ6 A;  3EI8 A;  3FVX A;  3GR9 A;  5G0A A;  1ASC A;  3WGC A;  3PDX A;  2GB3 A;  2ZY5 A;  2ZY3 A;  1KMK A;  3BWO A;  1GEX A;  2C44 A;  3NYT A;  3TAT A;  4CBR A;  4DGT A;  5FT6 A;  2QSR A;  1PMM A;  4ZDO A;  1PMO A;  3II0 A;  2VMP A;  1D2F A;  4AZJ A;  4M2K A;  1M6S A;  1Z7D A;  3PPL A;  2EH6 A;  2ZYJ A;  4LW4 A;  2ZP7 A;  1ECX A;  1W7M A;  4JE5 D;  4A6R A;  2Z20 A;  2AEU A;  2Z9V A;  1V2F A;  1M0Q A;  5G4J A;  1BQA A;  1DTY A;  2QB3 A;  3RBL A;  2AY9 A;  3BCA A;  2Z9U A;  3GBX A;  4TMR A;  1BT4 A;  4CXQ A;  4PIW A;  2BIA A;  1O62 A;  4XEW A;  3B46 A;  3EZ1 A;  4TN4 A;  3AOW A;  3WZF A;  3QM2 A;  2DKJ A;  1MLY A;  1C4K A;  1WKH A;  1YJY A;  1CL1 A;  1XEY A;  1MDO A;  1BW0 A;  4RJY A;  1LW4 A; 
#chains in the Genus database with same CATH homology
 5K8B A;  1AMR A;  3F9T A;  1GEW A;  1UU0 A;  3BCB A;  4EB5 A;  3KE3 A;  2VMV A;  3BS8 A;  4A6T A;  1EQB A;  1N31 A;  1WYU B;  2W8U A;  3FD0 A;  3GZD A;  1UKJ A;  2W7K A;  2D61 A;  1G4X A;  3AEO A;  2AY5 A;  4RKC A;  3AAT A;  1AHX A;  1M32 A;  3OP7 A;  4M2M A;  1I29 A;  1CQ7 A;  2DR1 A;  4IY7 A;  1AY4 A;  2CH2 A;  3FTB A;  2EO5 A;  3DYD A;  1M7Y A;  1MLZ A;  1BS0 A;  3JW9 A;  2QMA A;  5D5S A;  4W5K A;  1JF9 A;  2W7L A;  5KTB A;  1B4X A;  2E7I A;  3CQ5 A;  2ZC0 A;  2KFP A;  2BI1 A;  1WYT A;  2CJD A;  2VMO A;  4JEZ A;  4ADE A;  1AIC A;  2BIE A;  1AX4 A;  2O7C A;  1FG3 A;  4XJL A;  3N4X A;  1MAQ A;  1W7L A;  2VLF A;  4WYA A;  4AO4 A;  3WCO A;  3VK3 A;  4MSO A;  2D5Y A;  2ORD A;  3IHJ A;  4IXO A;  2VGV A;  2XBN A;  2FYF A;  3DOD A;  4PFN A;  4RM1 A;  2E54 A;  4ITX A;  4ATQ A;  2X5D A;  4EU1 A;  1ARH A;  2X8U A;  2D66 A;  3P6K A;  1OAT A;  4JEW A;  2W8W A;  3UWC A;  3A9Y A;  3NUB A;  5TF5 A;  1BJW A;  1GC4 A;  2AY1 A;  4A00 A;  1YOO A;  3E2Y A;  4LC3 A;  4AO9 A;  1W3U A;  2X5F A;  3PGY A;  5EAA A;  1ZOB A;  3HT4 A;  2YCT A;  2BHX A;  4A0H A;  1WYT B;  3JWA A;  3HMU A;  3PJ0 A;  4R5F A;  2VLH A;  4MKK A;  2YCP A;  2JJG A;  2HP2 A;  3B1E A;  2VMT A;  3NTJ A;  2FM1 A;  5EQC A;  1O4S A;  4RJ0 A;  5DB5 A;  4OT8 A;  3FKD A;  5E3K A;  4A0R A;  2OAT A;  1D7U A;  1IAX A;  1D7V A;  1C7G A;  2VMZ A;  3PAA A;  4K2I A;  2G7J A;  3K28 A;  2WB6 A;  4EB7 A;  4KAM A;  1JS3 A;  1M0P A;  3DU4 A;  5D95 A;  3AV7 A;  2BIG A;  5IWQ A;  2VMN A;  1LKC A;  2VGZ A;  2V0Y A;  4K05 A;  4P7Y A;  2QB2 A;  1EJI A;  2FNI A;  3MC6 A;  3NYU A;  4WB0 A;  3WLX A;  4ATP A;  4ZM4 A;  4H63 Q;  1IAY A;  1AKA A;  1P3W A;  2BI3 A;  2CJH A;  1GBN A;  4UQV A;  3DR7 A;  3LVL B;  1IX7 A;  4K2M A;  2QBT A;  3NU8 A;  2BYL A;  3GZC A;  3EIA A;  1IX6 A;  1OHW A;  3GZD C;  3ASB A;  4XAU A;  4XQ2 A;  4B9B A;  1ASL A;  3DXV A;  4ZAS A;  2YKU A;  2AY6 A;  2TPL A;  1AMQ A;  4PFF A;  1SZU A;  1SFF A;  1BJO A;  3JU7 A;  1CZC A;  1AMS A;  4Q75 A;  2CJG A;  3N7N A;  4U2H A;  2BKW A;  3QN6 A;  1SPA A;  3ISL A;  4R8D A;  3H7F A;  1ARI A;  2VGT A;  2VIB A;  1CJ0 A;  1GC0 A;  1Z3Z A;  2D7Y A;  4WB0 B;  4WYC A;  4RIZ A;  2GQN A;  1TOJ A;  3NX3 A;  5DJ9 A;  2YOB A;  2BYJ A;  1LS3 A;  4GE7 A;  3F0H A;  2OGE A;  5G4I A;  4HVK A;  1FC4 A;  1ASD A;  3PDB B;  2O1B A;  4W1X A;  3LG0 A;  4ZWM A;  3MAF A;  1J04 A;  4J8L A;  2XH1 A;  1TOK A;  3QGU A;  2CAN A;  2CB1 A;  1KMJ A;  1W23 A;  4RAE A;  3ZRQ A;  1BJO B;  1I43 A;  1IJI A;  2WK9 A;  4OC9 A;  2C0R A;  5AX8 A;  4BQ0 A;  4E1O A;  1TAR A;  2R5C A;  3FCR A;  4IXZ A;  3MKJ A;  2W7M A;  3AEJ A;  4ZDL A;  5JAY A;  2AY7 A;  2C81 A;  1N8P A;  3ASA A;  2GSA A;  2VMY A;  4OCA A;  1B9I A;  1G7W A;  3FQ7 A;  2E7J A;  3NUI A;  3NRA A;  3BC8 A;  1PFF A;  2EZ2 A;  2DOU A;  4LNL A;  2W7H A;  4DQ6 A;  4BA5 A;  3MAF B;  1DFO A;  4IXS A;  2JGT A;  1RVY A;  2YKY A;  4AOA A;  1YJS A;  5E4Z A;  3WKR A;  4ZLV A;  3FQ8 A;  1ARS A;  1UU2 A;  5HHY A;  3R4T A;  3TQX A;  3N4R A;  1GC2 A;  1B5O A;  1YIZ A;  4OTL A;  1EG5 A;  4JE5 A;  3I16 A;  2FQ6 A;  4U1T A;  5G2P A;  4MQQ A;  3TFT A;  2R5C B;  4W1W A;  4JF0 A;  1X2A A;  4ZWV A;  1AHG A;  1KL2 A;  2F8J A;  1C0N A;  4JEY A;  4WBT A;  1AAW A;  1YJZ A;  4HF8 A;  3ZRR A;  5M4D A;  4ITG A;  3FZ7 A;  3MC6 C;  1X28 A;  5LH9 A;  1TOG A;  2EPJ A;  3CQ4 A;  3KKI A;  3MEB A;  3NDN A;  2ZY4 A;  1JS6 A;  1Y4I A;  2BI2 A;  2OGA A;  2CY8 A;  1YIY A;  2EGY A;  4WP0 A;  2AY2 A;  2JJF A;  3E77 A;  2VMX A;  1MAP A;  3L44 A;  3RI6 A;  4RIT A;  2YKV A;  4PVF A;  3VOM A;  2ZY2 A;  4CVQ A;  1C7O A;  2HZP A;  3CBF A;  1DJ9 A;  1QZ9 A;  4BMK A;  3FSL A;  2VMW A;  4L0O A;  4IYO A;  2HOZ A;  1AIA A;  1DJE A;  2Z67 A;  3HQT A;  4GSA A;  2OQX A;  3R9A A;  3FFH A;  1OHY A;  3K40 A;  2CIN A;  1N2T A;  4OYT A;  1FG7 A;  1M0N A;  4E77 A;  1ELQ A;  1LC5 A;  1KKP A;  1DGE A;  2BWP A;  3NYS A;  2YRI A;  1IBJ A;  1VP4 A;  1S09 A;  3BN1 A;  3BV0 A;  2VMQ A;  2X3L A;  4F5M A;  4F5J A;  5EIG A;  3W1H A;  5M46 A;  1I48 A;  4OBU A;  3N5M A;  1T3I A;  3LVK A;  1ZOD A;  2VI8 A;  1G4V A;  3JWB A;  2WKA A;  2O0R A;  2R2N A;  5FT5 A;  4J5U A;  5G09 A;  4ZAH A;  3HLM A;  1LK9 A;  1BKG A;  3QPG A;  3AEJ C;  2VIA A;  4MY5 A;  2A1V A;  5HDM A;  5EFS A;  4F5I A;  2V1P A;  1V2E A;  4WYE A;  4E3R A;  4ZM3 A;  1CZE A;  3RCH A;  3WY7 A;  4F4E A;  2PB2 A;  4H51 A;  1VJO A;  3W1J A;  3EI9 A;  4BHD A;  2VGW A;  3EUC A;  2DGM A;  3AEN A;  1CQ8 A;  2YRR A;  3GET A;  3M5U A;  4XK1 A;  2ZSL A;  3PIU A;  2VYC A;  1ASA A;  2VGU A;  1XI9 A;  1H1C A;  3DRD A;  3ELP A;  4MQR A;  3BB8 A;  3QHX A;  1JG8 A;  2JIS A;  3P1T A;  4MGR A;  5G2Q A;  3ZZJ A;  1I41 A;  3AEM A;  2ZSM A;  1AKC A;  2FKI A;  3ECD A;  3LV2 A;  4E3Q A;  4F5G A;  4FL0 A;  1C7N A;  2HUF A;  1RV3 A;  3VP6 A;  4GE4 A;  3PD6 A;  3RCH B;  5DJ1 A;  4UHO A;  4B98 A;  5EAV A;  3H9X A;  3T32 A;  1TOI A;  4WYF A;  1OXP A;  2BI5 A;  5DX5 A;  3HL2 A;  3AEN B;  1MDZ A;  1MDX A;  2DKB A;  4IW7 A;  3ZRP A;  2EYQ A;  3B8X A;  3A2B A;  4ADC A;  8AAT A;  1IUG A;  4XJP A;  1GDE A;  3HDO A;  2GMU A;  3A8U X;  3GJU A;  2FNU A;  1AHF A;  2AY8 A;  3HVY A;  2VMS A;  4M2J A;  4O6Z A;  4F5F A;  1G7X A;  2CFB A;  2QA3 A;  2JJE A;  3LVJ A;  4I8A A;  4IX8 A;  2D65 A;  3E2Z A;  1AMA A;  4LNJ A;  2W7I A;  4QGR A;  3VK2 A;  3MAU A;  1ZC9 A;  2PB0 A;  3ELE A;  2HOX A;  4CXR A;  1CS1 A;  1AKB A;  1X29 A;  2W8T A;  4GEB A;  2Z9W A;  1YAA A;  1O69 A;  4JF1 A;  4A0G A;  1TAT A;  3IF2 A;  3GWP A;  4NOG A;  4ZSW A;  2R5E A;  1WYV A;  3DXW A;  3N4S A;  3JZL A;  4A0F A;  4K2B A;  2NMP A;  4ZSY A;  4UOY A;  3JTX A;  3ATH A;  3RBF A;  2D63 A;  1GCK A;  1AY5 A;  5FT8 A;  2QLR A;  4LNM A;  2E7U A;  1ASF A;  1SF2 A;  1WKG A;  3FFR A;  4R5Z A;  1S06 A;  2AY4 A;  2GMS A;  1AY8 A;  1QJ5 A;  1S07 A;  4WLH A;  4A6U A;  2W7J A;  1QIT A;  3E2Z B;  5FT4 A;  1MGV A;  7AAT A;  3FVS A;  3G0T A;  1W7N A;  4Y0H A;  2JG2 A;  3CAI A;  2CST A;  3AEP A;  4JEX A;  3NNK A;  1OXO A;  3USF A;  4GRX A;  1WYV B;  2W7E A;  1WYU A;  5HXX A;  1QGN A;  4JEV A;  1ASG A;  3VK4 A;  5F9S A;  1DJU A;  1KL1 A;  2DGK A;  1X0M A;  4MKJ A;  1ASE A;  1GD9 A;  5EUE A;  2HUI A;  4F5K A;  3E6G A;  3AEM C;  3G7Q A;  1GC3 A;  1RVU A;  3EI6 A;  4XJM A;  4W1V A;  3H14 A;  3BWN A;  5C6U A;  5J8Q A;  2VI9 A;  1AIB A;  1QJ3 A;  5I92 A;  4ISY A;  2G6W A;  4OBV A;  3VAX A;  3GSB A;  3FDB A;  1M0O A;  3WGB A;  2BWO A;  3PA9 A;  2CTZ A;  4EMY A;  4W8I A;  2YCN A;  2Z1Y A;  3CQ6 A;  4WXB A;  3ACZ A;  3Q8N A;  3MBB A;  1D7S A;  1IVR A;  3EZS A;  1VEF A;  2ZUK A;  5EUN A;  3FVU A;  1LC8 A;  1YNU A;  2Z9X A;  4KYO A;  2HOY A;  4MQP A;  1GEY A;  3A9Z A;  5E5I A;  1ASB A;  2HP1 A;  9AAT A;  4N0B A;  1PG8 A;  2EZ1 A;  3LWS A;  1AJR A;  2FN6 A;  4WXF A;  1B8G A;  2YHK A;  3AEL A;  5M49 A;  1SVV A;  3FQA A;  3N75 A;  2HUU A;  3G8M A;  2W7D A;  1ARG A;  4GDY A;  1BJN A;  4BA4 A;  1QIS A;  4LW2 A;  5F8V A;  3COG A;  2W8V A;  2CH1 A;  3N0L A;  1O61 A;  4F5L A;  4A72 A;  1J32 A;  1TOE A;  1U08 A;  4IYO B;  2VGS A;  4ADB A;  4R2N A;  1TAS A;  3BCX A;  2PO3 A;  3MAD A;  2W8J A;  1DKA A;  2WK7 A;  4Q31 A;  4WLJ A;  4AH3 A;  1ASN A;  1SZK A;  4F5H A;  2OKJ A;  1AHY A;  1KKJ A;  2JJH A;  2Z1Z A;  1BJ4 A;  3KGX A;  1ASM A;  1DGD A;  1V2D A;  2R0T A;  2BI9 A;  2HOR A;  3EI5 A;  3EI7 A;  3FRK A;  4WD2 A;  5EIG B;  1S08 A;  3D6K A;  3HBX A;  3OKS A;  3I5T A;  2AY3 A;  4WYG A;  3RUY A;  4RLG A;  1C9C A;  4GE9 A;  3WX9 A;  2AEV A;  3NU7 A;  2C7T A;  2OKK A;  3DC1 A;  1ELU A;  1LC7 A;  2BWN A;  5EUD A;  3E9K A;  4ADD A;  1UU1 A;  1SZS A;  2VMU A;  3F6T A;  4N0W A;  4DBC A;  5BJ4 A;  2ZJG A;  3WCN A;  1S0A A;  1AJS A;  3B1C A;  3B1D A;  4WXG A;  3W1I A;  5M4B A;  3KGW A;  3FDD A;  2D7Z A;  3UAK A;  3WKS A;  3LY1 A;  1B9H A;  3K7Y A;  3QBO A;  1B5P A;  3UE8 A;  2W7G A;  4XJO A;  3TFU A;  3I4J A;  1ART A;  3QI6 A;  3RQ1 A;  3AOV A;  4UHN A;  2RFV A;  3E2F A;  4EFF A;  2Z61 A;  2Q7W A;  3EIB A;  3TCM A;  3BWN C;  4OMA A;  1H0C A;  1TPL A;  1E5F A;  1CL2 A;  1AAM A;  3FZ8 A;  4Q76 A;  5BJ3 A;  1IX8 A;  1V72 A;  3PDB A;  1AJS B;  4TV7 A;  2W7F A;  5LHA A;  1OHV A;  2YKX A;  4KXK A;  4AZK A;  4WYD A;  3ZZK A;  4FFC A;  4Y0I A;  1QIR A;  1E5E A;  3L8A A;  4RKD A;  3LVM A;  3PD6 B;  1LW5 A;  3DR4 A;  2DGL A;  4CBS A;  2VMR A;  1RV4 A;  2D64 A;  1AHE A;  2WK8 A;  2AAT A;  4ZDP A;  4P3M A;  1WST A;  4Q6R A;  3A9X A;  1ORD A;  4W91 A;  4Y0D A;  4UHM A;  1BQD A;  1CQ6 A;  1D7R A;  3DZZ A;  1M4N A;  3FZ6 A;  3EI8 A;  3FVX A;  3GR9 A;  5G0A A;  1ASC A;  3WGC A;  3PDX A;  2GB3 A;  2ZY5 A;  2ZY3 A;  1KMK A;  3BWO A;  1GEX A;  2C44 A;  3NYT A;  3TAT A;  4CBR A;  4DGT A;  5FT6 A;  2QSR A;  1PMM A;  4ZDO A;  1PMO A;  3II0 A;  2VMP A;  1D2F A;  4AZJ A;  4M2K A;  1M6S A;  1Z7D A;  3PPL A;  2EH6 A;  2ZYJ A;  4LW4 A;  2ZP7 A;  1ECX A;  1W7M A;  4JE5 D;  4A6R A;  2Z20 A;  2AEU A;  2Z9V A;  1V2F A;  1M0Q A;  5G4J A;  1BQA A;  1DTY A;  2QB3 A;  3RBL A;  2AY9 A;  3BCA A;  2Z9U A;  3GBX A;  4TMR A;  1BT4 A;  4CXQ A;  4PIW A;  2BIA A;  1O62 A;  4XEW A;  3B46 A;  3EZ1 A;  4TN4 A;  3AOW A;  3WZF A;  3QM2 A;  2DKJ A;  1MLY A;  1C4K A;  1WKH A;  1YJY A;  1CL1 A;  1XEY A;  1MDO A;  1BW0 A;  4RJY A;  1LW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...