3AAUA

Bovine beta-trypsin bound to meta-diguanidino schiff base copper (ii) chelate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the design of novel Schiff base metal chelate inhibitors of trypsin
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aauA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aauA02
1LO6A 4TPIZ 1LKBA 2BLVA 4WMEA 4ABIA 1VCPA 2ZPSA 1EXFA 1SG8B 1SGIB 1K9OE 1OYQA 4BTTB 2A2QH 4K8YA 1Q2WA 1HB0B 2SGEE 2TGPZ 3B9FH 1YLDA 1HDTH 3MH4A 3WY8A 1GI3A 1DLEA 1TE0A 1Y3UA 1SFQB 1ZGIA 1YKTA 3FVFB 4DW2U 3D65E 2I6SA 3T29A 4DG4A 5A8YA 3V0XA 4CRFA 3RXOA 1DVAH 1PPHE 2PKSC 1AUTC 2G00A 4INLA 1C5MD 3W95A 1C5VA 1W14U 4LZ4B 1Z1IA 1P10A 4KELA 4NSVA 1MAXA 2PTCE 1W0ZU 2ZEBA 3VXEH 3SNEA 2Q6DA 2OUAA 5SGAE 1HAHH 1HJAB 3KL6A 1W10U 5FX6A 1ZJKA 2G5NA 3QGJA 3P8OA 1EZXC 4OS7A 1W7XH 1LDTT 3MO3A 5JBTA 4FUJA 3OU0A 2A4RA 1O32A 1CO7E 3D23A 2P94A 1F7ZA 4UDWH 4AGJA 4HTCH 3RLWH 1FMGA 4IW4E 1C1UH 1UTKA 1AVGH 1H8DH 2CHAB 3U8RH 1RRKA 3E91A 1CQQA 4ABDA 3CP7A 4E06H 1V2TT 1UCYE 1SGPE 1TABE 3L3TA 1SHYA 1G3CA 2P3FH 2WUBA 3KQDA 3TK6A 1V2JT 2DE8A 3MNBA 1K1JA 1MMJN 1P03A 1BJUA 1TLDA 2BDGA 3VB6A 1A5GH 2F9BH 2ZG0H 1C2HA 4ABEA 2P59A 1EAXA 2STBE 3RC5A 4TWWA 4YT6H 1ZTKA 3GOVB 4I8HA 3ZZ5A 1RFNA 4H42U 2FDAA 2SGPE 2FOGA 1C2LA 1Z6JH 3PLPA 3MU5A 3KEEA 3LJJA 2TPIZ 1WTGH 2ZCKP 2B7DH 3LGIA 4YOIA 2PR3A 1SGCA 2ZGHA 1TQ7B 5GWZA 2FI3E 5EQSA 1GBKA 1KLJH 1MAYA 1OYTH 2ZHQH 4XFQA 3TPIZ 3TNTA 3V13A 2GD4B 2ODPA 4O03A 5L2ZH 1GI2A 1JRSA 2ZA5A 1TYNA 2QA9E 4DCDA 1BITA 4A1TA 1QJ6B 1GBHA 1TBRH 4U01A 1C5WB 1H9HE 1RJXB 1J14A 1ELEE 1O3GA 1UK3A 2G81E 1Z7KA 1PYTD 4NZQA 3RXRA 2XWBI 3B8JA 4FUDA 1V2UT 1KXEA 2ZDMA 1GPZA 2NU2E 1SLUB 1SQTA 1O3LA 1OP0A 1MCTA 2A31A 2ZF0H 1BHXB 3T25A 2ZDNA 3RP2A 3ZZ3A 2A2XH 1J17T 2GVFA 3SUDA 8GCHG 3SUEA 2BD2A 4WMFA 3MFJA 1BTPA 3BTEE 4NG9H 2HPPH 2GCTB 2LNCA 4U32A 4IN2A 1O2JA 4ABGA 4AFUA 1BTYA 2R3UA 1C2IA 3GY7A 1G37A 1C5ZB 3DHKH 1O33A 2NU4E 3RXJA 5E8EH 2G8TA 3D62A 2JETB 1O5FH 1IQKA 1EAWA 2HPQH 2SGFE 3HGNA 1P04A 3GY5A 4INKA 2TGDA 1V2RT 4RKJB 3UTUH 1P2JA 1TA6A 2ZGCA 1O2PA 3QLPH 4VGCC 1TOCB 1J15A 4I7YH 2D1JA 1C2MA 4MQAA 3VEQB 2AFQB 2F9NA 1HAPH 2HALA 1BTXA 4JZFH 1O3DA 1P3CA 1O2TA 1AY6H 4Y10E 4K1EA 2QIQA 3O8CA 1Z71A 1C2FA 2BZ6H 3LPRA 5T3HA 2GTBA 2HRVA 1OP2A 2A32A 1KDQB 1F0UA 5C1XA 4MNWA 2AEIH 2GGVB 2QV1A 5HMAA 3RM2H 2CGAA 2ZWLH 4HGCA 1DS2E 3RXBA 3MMGA 1FAXA 1BB0B 1AMHA 2FXRA 3RC4A 1TAWA 2OP9A 1NRPH 3E0PB 2J95A 1KSNA 1PPZA 3CS7A 1EZQA 3TLOA 1UTOA 1YC0A 2FMJA 3ZYDA 3STJA 1ZRBA 1DXWA 3PO1B 4K5ZA 1L1NA 2FLRH 1W7GH 1P9UA 3MNXA 4JMYA 1GHZA 3L33A 5JPMH 1BMLA 2DUCA 3ZVCA 1CT4E 3SUFA 3VGCB 2OQUA 2H2ZA 3P6ZB 4GHQA 3UNSA 2AGIX 2BY7X 1Z8RA 3SOSA 4X2XA 1GG6C 1UK4A 1ZSJA 1ZTLA 2ZQ1A 2ZHEH 2ANKH 4WVPE 4D7FA 1HAGE 2Q6FA 4GCHF 1YPGH 4M7GA 1C2KA 2VU8E 1YPJH 3UOPA 1T32A 3EGKH 1S0QA 4A92A 3SV6A 1C5SA 1EZSC 1Y8TA 3RXKA 3ZZCA 2NWNA 1E0FD 3UWIA 2FOAA 1V2OT 3RXCA 2QCYA 3GCHC 2ZGBH 4KKDA 2QC2A 4JZIA 1D3QB 1Z6EA 3S69A 1LHFH 4GHTA 1AE5A 9LPRA 2V6NA 1GBCA 3SV9A 1FY8E 3P8GA 1YPHC 2GMTC 3K6YA 3SGBE 3DUXH 2NU3E 3A80A 3RMOH 1PPCE 3ZV8A 3D49H 2YOLA 3BN9A 1GMHG 1QRZA 1KTTB 5LGOA 1O2ZA 5DP8A 2J34A 2KAIA 1ANEA 4CBOA 1SL3A 1G3BA 1PQ7A 1NESE 3T2NA 4CBNA 3M35A 2FI5E 3S0NA 4Q7ZA 3O8RA 2ILNA 1AFQB 1EP6A 4MPXA 2ZU4A 3RXGA 3BTQE 3VXFH 1BRCE 1FZZA 1GI9B 4I31A 4UONA 4Q2KA 3FP8E 3RXDA 2OC0A 3A84A 2SNWA 1KXBA 4I8KA 1SGFA 1BHXF 4IGDA 3BTGE 5F8ZA 2ZC9H 3F9EA 1C4Y2 1C5OH 2H9TH 1V2LT 1O34A 5G4BA 1NS3A 3M37A 5FBIA 2W7SA 2PUQH 1HAXB 3DA9B 4F49A 2R3YA 1F5LA 3P70B 1F0SA 4Y0ZE 1QRXA 5LPEA 2RCEA 3RXEA 4K3JA 1CA8B 4UFFH 1IOEA 1QFKH 1C5RA 1NT1A 5TJXA 1GI1A 2QN5T 3OY5U 4PROA 1H1BA 1NY22 3OX7U 1GDUA 2F3CE 3IWMA 1JBUH 3SHCH 4CRAA 1GI6A 2HGTH 4BANB 1FUJA 1SGQE 1O2GH 2C8ZB 1ELVA 1O2LA 5EXMA 2P3TB 2GZ7A 1YF4A 1H9LB 3VB3A 1FJSA 2BD3A 5C2ZA 2ODYB 1H4WA 4ZROA 4NSYA 1NRRH 1CHOG 1C5XB 3BTHE 1LHEH 2AIQA 1ZZZA 4UFGH 1TIOA 3DFJA 2XYAA 4O3UA 1VJAU 2HLCA 1P3EA 1GHAG 2XRCA 2AGGX 1BMNH 3BEFB 5GIBA 2FS9A 1QQ4A 3ZVFA 1XUKA 1XXFA 1QB6A 1OSSA 1SGNE 4Y79A 3HK6B 3M61U 4ZH8A 4AB8A 1TGTA 2Z6BD 3HKJB 3W94A 1JOUB 3MOCA 1LKAA 5C5NA 1GGDB 4ESTE 1SGRE 2FYQA 1ACBE 4NA8A 1BT7A 1P2NA 2QXGA 1OS8A 4NCYA 2ASUB 2FOEA 4MPWA 1KDQA 1O39A 4ZXXH 1MKWK 1KXCA 1MH0A 4HZHA 4WXIA 1HBTH 3UQVA 2XXLA 3QWCH 1K1MA 2XBXA 2FOMB 1GVZA 1UCYH 3JZ1B 1HAVB 1HJ8A 3NPSA 1C2EA 2PV9B 4OS1A 1DICA 1C2JA 4X1PU 4ZKOU 1TNIA 4A1XA 5J4QA 1SHHB 1ANCA 1WBGB 1C1NA 2G4UA 4KTSA 2AS9A 2A5KA 2NU1E 3F9GA 4D9RA 2OQ5A 4B73A 2H5CA 2C4FH 2F9PA 2EI8A 2VVCA 1FAKH 4K1TA 1O3OA 4FU7A 3A7ZA 2A7HA 1GHBG 3GICB 2YNAA 1GHBF 2P3UB 2XBVA 4FUHA 2BMGB 4FU8A 5B6OA 3MI4A 3SNCA 2UWOA 2IOTA 2ZFFH 3SJOA 3UREA 2QXIA 2OD3B 5ETXA 2STAE 1V2WT 5T6FA 3BF6H 3F68H 2FTLE 3Q00A 2ZFSA 1NFYA 1AKSB 3SU3A 1BZXE 3KGPA 1HAYB 3MTYA 3HATH 1KLTA 1UCYK 4TWYA 5GXPA 2A5AA 1EAUA 2XC4A 2ZDAH 4INHA 2GX4A 1S6HA 4YZUA 2R0KA 5AVDA 4WXVA 1DLKB 4JK6A 3GDUA 8LPRA 3ZZAA 3KNXA 1EUFA 4UFEH 3T26A 2XBWA 1TGSZ 2PGBB 1CT2E 1BOQA 3SQHE 2AYWA 2AMPA 4CRDA 1SGYE 2SGQE 1L2EA 2A7JA 1QQUA 3MO6A 2JH6D 3GISB 1DSTA 1ELDE 2B8OH 3QX5H 1O5DH 4XBDA 3SNDA 2OBOA 2TBSA 2G4TA 3GCOA 1XUGA 2VIQA 2ZTXA 4LOYH 4BAHB 4ABJA 2TGAA 2BVXH 1NFWA 3GYMA 1UTJA 1ZMLA 5FCKA 1C1OA 1ESTA 5DP7A 2W7UA 3RMNH 3SO3A 3RXLA 2VVVA 1BTZA 1LCYA 1BRUP 1B0EA 2BY8X 2QXJA 2V35A 2WV5A 2ZO3H 3SN8A 3UPEA 1GHXH 2R2WU 1MBMA 1TFXA 2PW8H 5EOKA 4OGXA 5AF9H 1LVMA 3SBKA 1KLIH 2VIOA 2F9VA 2EI7A 3ODFA 1GJCB 1ZSKA 1RIWB 1Y3YA 5IDKA 1GBFA 1HJAC 1YPKH 4B2AA 1S81A 1EB1H 2PWXA 1DWCH 4UEHH 2RA0A 1P0SH 3ZVEA 3ATLA 1UVUH 1YCPK 2FWWA 2ALPA 1A0LA 2UWLA 3RUOA 2VWMA 3A8DA 5FCRA 1KXDA 3MH7A 1FY3A 1W11U 1EPTC 3KQBA 4U30A 1ZMNA 2P8OC 1LPGB 3ZZDA 1TMTH 3H7OA 3TVJB 3PB1E 2BLQA 1DWBH 3P8FA 2FODA 4UFDH 3PMBB 2EEKA 1IQHA 1GI7B 4ISOA 1C1SA 4JK5A 4B75A 5DG6A 3ELAH 2HNTE 1C9TA 2ZQ2A 3RXIA 3ZVBA 1GBEA 1Y5UT 2ZP0H 1ELFA 2ZPRA 1YPEH 1AD8H 3SU1A 2PKAA 1EATA 3TK5A 1EX3A 1GMDF 1ESBA 1EB2A 7GCHG 1G2LA 5FX5A 1O3KA 2Z3CA 3K9XB 2J4IA 1K22H 5AHGH 3SUGA 1IQIA 3GY8A 3QK1A 3BTTE 3E3TA 1V2NT 4OS2A 1FY1A 1TOMH 4TY7A 2ZHDA 2FS8A 1RGQA 1TRYA 1WYKA 4ISLA 3TITA 3NCLA 1NFXA 3PMHB 1C5TA 4ASHA 4O97A 4AG2A 1DXPA 1MBQA 3GCTG 2ZPQA 1QL8A 1CHGA 2F83A 2Q1JA 1K21H 4ZUHA 3OYPA 1ZPZA 1HLTH 1TX6A 5DO4H 4NA7A 2BVSH 1C5NH 1NTPA 2H1UA 3V3MA 3PWBA 1AIXH 1EZUC 1G3EA 1QRWA 5C5OA 1O3BA 1GI5A 2BX4A 3QDZB 2FYRA 1AUJA 1HJ9A 2OC7A 1AZ8A 1B5GH 5EW1H 3MYWA 1MU6B 3RXVA 3MO9A 1QTFA 2GT8A 2Y7ZA 2FX4A 1SGFG 1UHBB 1O3JA 1VITG 3VGCC 1YCPM 5E0JA 1O36A 1Q3XA 1JRTA 4ZKRU 3SU0A 1TPPA 1JWTA 1ZSLA 2XC0A 3LGWA 1P2IA 1ZPBA 4GVUA 2TIOA 2A7CA 1W13U 2GCHG 1OXGA 1A3BH 2BDAA 1O0DH 1TNGA 1XX9A 1GJ5H 2ZU3A 1SPJA 3A85A 1T4UH 3SU4A 2G51A 3PMAB 1FQ3A 1GDQA 5A8ZA 5AFZH 1IQGA 2ZU1A 1T8NA 2PFEA 3ATKA 2WPMS 4X2YA 2BDHA 2FTMA 1TBZH 1GJ8B 4WH6A 1LTOA 1G2MA 2VWOA 3BTME 1GCDA 1TRMA 1ZHPA 1Z8GA 3TNSA 1SGEE 1LHDH 1W0YH 3SV8A 2ZHWH 1RIWC 3FP6E 2WPLS 4YOGA 3SI3H 2CMYA 3ITIA 2BLWA 5DK1A 5C20A 5CE1A 1NC6A 2O8UA 1GJ9B 3JZ2B 2IN2A 1MQ5A 1ZPCA 2ULLA 4NIVA 3SGQE 2VH6A 4NFFA 1OX1A 3URCA 4CREA 1IQLA 1ELAA 1VITH 5EQQA 2Z3EA 1TONA 1A46H 3LONA 4Y76A 1CE5A 1T7CA 5EU8A 2FO9A 4NWKA 1EJMA 1M9UA 2GDEH 2PSXA 1YYY1 3QZQA 3V12A 2FP7B 1TQ0B 1V2ST 3MWIU 4CHAC 1O2UA 3A83A 2B5TB 3TJNA 2PKSB 3MHWU 1TGBA 3GCHB 3RXAA 1EAIA 4XBCA 1ETRH 3QN7A 3DT0H 4X1NU 2BY6X 2RDLA 2FX6A 1A1RA 4MTBA 2FESH 3A7YA 1RTLA 2Y5GA 3TIUA 4JZDH 4ZXYH 1O5AB 8KME2 1GBIA 2UUFB 4DIHH 3RXPA 4FVBA 4H6SB 2A1DB 1QA7A 1T8MA 3A7TA 5C3NA 4X6NA 1L0ZA 1O3NA 2BD8A 2I6QA 5IYTA 1BMMH 1E34B 1TNLA 4F4OC 2IJOB 1DX5M 4WY3A 1MUEB 3RU4D 5ESTE 3ESTA 4HFPB 4FUEA 2FOHA 2GCHF 3R0FA 3ZVGA 2P8OB 2DE9A 4XSKU 3RM0H 1AB9B 4BXWA 1BTUA 1NU7B 4I8JA 1XUFA 1D3TB 5FAHA 4AYVB 4D9QA 2A4GA 2VWLA 4WH8A 3M3SA 4CHAB 2Z9IA 1GJBB 5FPTA 3PTNA 3GDSA 1ANBA 3A87A 1TPAE 5LH8A 2BY9X 5AFYH 4DGJA 3S9BA 2BB4A 4FUGA 1LHCH 1UJ1A 1K28D 3EAJA 3VB5A 2XBYA 1O2XA 2TRMA 3UFAA 4DIIH 1Y3XA 3A86A 2VGCB 1N8OC 3BIUH 3EE0B 1DUEA 1FIZA 1GMCF 3LGYA 1VITF 1CGIE 3TH3H 5DGJA 4CR5A 5E0HA 3HK3B 7ESTE 1BTHH 1N1LA 1T8LA 1TNHA 2ZU5A 1S85A 2V3OH 2UUJB 1D9IA 2BQ7B 2P95A 1GCTB 1P2MA 2C93B 1TPSA 5EODA 1XUHA 1KTSB 2HVXA 2C3SA 5DP9A 4AN7A 1DY9A 3FZZA 4LXBH 2D8WA 3E16B 2ZFRH 4Y0YE 4Z0KA 1A5IA 3NZIA 2XNIA 1EOLA 4MNXA 2BVRH 1GCTC 1OP8A 2ZGJA 2CHAC 1L1GA 1GJ7B 4ABFA 1O5EH 1SI5H 3Q3XA 1HFDA 5DP5A 3ZZ4A 4R0IA 3ATMA 3S7KB 4XE4A 1TNKA 1QBOA 1GBDA 1P8VC 1PPGE 1QIXB 4YTAA 1DOJA 4HI3A 1FV9A 1G3DA 4ISNA 2VGCC 1C1WH 4GCHG 1SC8U 2JKHA 1TALA 1O3IA 3M5OA 3VFEA 2Z7FE 4J2YB 5C67A 2XTTB 4CRGA 1TPOA 4D8NA 2O8TA 2A5IA 1ORFA 1P9SA 1OKXA 3RXMA 1QL7A 1GJ4H 1AU8A 3SU2A 4IC6A 1O3PB 1G32B 5LPFA 2FOCA 1FXYA 3SZNA 1RTFB 3MNCA 5FBEA 1F5RA 1GJAB 3SNBA 1Z8IB 2O8MA 1VCQA 4Q7YA 4O9VA 3DFLA 3NK8A 4XBBA 2V3HH 3BV9B 4X1RU 3AVZA 1ZGVA 1BA8B 2VVUA 3KQCA 1AO5A 3CENA 4YM9A 1Y5AT 2OTVA 5E2OA 4Y8XA 1OPHB 4BAOB 1SSXA 3URDA 1L4DA 4B71A 4IMZA 3PM3A 3IITA 1FIWA 2Q6GA 4BTIB 1KY9A 1WSSH 4DT7B 4Y7BA 4TYDA 2J9NA 1EPTA 2H6MA 3LH3A 1PPEE 2EC9H 3RXUA 5JYIA 5A0BA 1TX8A 1JXPA 5K7RA 1GGDC 2PUXB 2ZHFH 4IN1A 2P16A 1HXFH 1XVOA 1J8AA 2R2MB 3TH2H 4WWYA 1C5QA 1MU8B 1AQ7A 1IHTH 2CN0H 1BIOA 4B1TA 7GCHF 2GZ8A 4B2BA 1TBQH 4YLQH 1GL1A 4UE7H 3A81A 3SQEE 3TGJE 1BQYA 2ODQA 4AFZA 3HKIB 3RXHA 1IQJA 2OCVB 1ZJDA 2VIVA 3ZZ7A 1GBTA 1WUNH 3EA7A 1IAUA 2O8LA 5DP3A 3ZV9A 1L4ZA 4YOJA 2HOBA 1DANH 1A0HB 2ZI2H 5F03A 2J94A 1EQ9A 5DKMA 3RU4T 1O30A 1ANDA 3TK9A 2WUCA 2D2DA 1CSOE 1ETSH 3RMMH 3M7TA 3TJUA 3P92A 1KIGH 1MD8A 3FAOA 5HXFA 1AFEH 3ZYEA 1DWDH 1T31A 1XVMA 3LC3A 2H5DA 4ZMAH 1FY4A 4X8TH 2BLOA 1GWAA 1LHGH 2VH0A 3FZDA 4ISIH 4JYTA 1GG6B 4IBLH 4A5TS 2RA3A 5C1UA 4RSPA 2XC5A 1FNIA 3A88A 1P05A 1H9IE 1PQ5A 2ZKSA 2BY5X 3A8CA 2QGRA 5JBAS 1O3MA 1GI4A 1XUJA 1K1PA 1QR3E 3CS0A 3FP7E 3GYLB 1IQNA 1UTNA 4K69A 4YESB 1A0JA 1LVBA 1NRQH 2ZCLP 1O3HA 1O35A 1EASA 1AWFH 2KAIB 1YPLH 1SLVB 1THRH 4AZ2B 2BZAA 3TGKE 5EQRA 5BRRE 3LKWA 1GBMA 1P01A 2FM2A 2Y7XA 5BPEA 1HRTH 1YPMH 1SGTA 2XW9A 3TU7H 3SU6A 1VJ9U 1QNJA 1WU1A 7KMEH 2A0QB 3UR6A 6ESTA 4FXGH 4X2VA 1VGCC 3KHVA 3S9CA 1OWKA 1JIMA 3S7HB 2ZTZA 1K1IA 3KQEA 1X7AC 2BDYA 2VJ1A 1O3AA 1Z8JB 3U98H 2FI4E 1FI8A 5JDUB 1D4PB 2WYJA 2O8WA 1Q31A 2ZFTA 2ZGXH 1P57B 3PLBA 4AGKA 1TNJA 4DOQA 1ZR0A 4QT8C 3T28A 3O8BA 2A4QA 2XCFA 2PTNA 1HAOH 4A1VA 1NROH 4Y8ZA 1OOKB 1ZTJA 2G52A 3U8TH 2AH4X 1MTWA 4ABBA 2VIDA 1VZQH 3PTBA 3QTOH 2ZCHP 1C2DA 1Y3WA 3ENSB 1XM1A 2VB0A 1ZOMA 2Z3DA 4LZ1H 2BOHB 5E2PA 1C4U2 1DPOA 1NO9H 4MDSA 5DPAA 4XOJA 2W3IA 3Q3YA 8GCHF 1J9CH 3P17H 3U8OH 1G9IE 1HXEH 1TA2A 4X1SU 3RXSA 3ZZ9A 4CR9A 4KTUA 3ZVAA 1O3EA 1S6FA 1UMAH 2FZZA 3C1KA 1EPTB 1F0TA 4ZKNU 2GT7A 2Y82A 3MNSA 3N7OA 3SU5A 1TGCA 3H5CB 1W3CA 1MZAA 1E38B 3F9FA 5CMXH 1GBAA 2PHBA 1BCUH 2A4OA 3SJ8A 4MVNA 1AZZA 1GHWH 3TJOA 2C90B 3T5FH 2TGTA 1TMBH 5HYOA 3QZRA 1PQ8A 4ZAEA 2OC1A 3UY9A 3GY6A 1AN1E 1BRAA 1FDPA 5FHTA 1FPCH 4GLYA 1OWIA 4Y11E 2B9LA 3EDXB 3SV7A 5EXNA 2BX3A 1OWJA 4Y71A 1GI0A 1UO6A 4MLFB 2CF9H 2ZZUH 4BOHA 4MG3A 2EI6A 4IMQA 4NIXA 4OS5A 2SFAA 1CVWH 5L6NH 3DD2H 3M5MA 3K65B 4K1SA 1WTHD 2Z9LA 5A0CA 3LU9B 3KF2A 1CT0E 1NZQH 1YP9A 5L2YH 1AGJA 5DJ7A 3U9AH 1K2I1 2BHGA 2IPHA 3F6UH 5TCAA 1TMUH 1O2NA 3GCNA 2BYAX 5F8XA 2W5EA 1BBRK 1AI8H 1ELBA 4AOQA 3AW0A 1MKWH 3HPTB 3BEIB 3BIVH 1YCPH 2JETC 2GCTC 1O37A 3LGVA 4OS4A 1IQMA 1TB6H 5T6DA 2H9HA 2VIPA 3A82A 1W2KH 3A7VA 5I46H 3UOUA 3P8NA 3U1IB 1FLEE 1SLXB 1C2GA 1SLWB 3RU4E 1OWDA 3UWJH 3VPKA 4D76A 5GPIB 1BUIA 3ZZ8A 2B0FA 2R9PA 1C1MA 3PLKA 3VB7A 2QYIA 1XMNB 3ZVDA 4ZHAA 2QXHA 2FPZA 1PFXC 3EA8A 2ZDKA 2SNVA 2FOBA 2GMTB 2PLXA 4K8BA 4JYVH 1HYLA 2K1QA 2BD7A 3LDXH 1F2SE 1H8IH 1Y3VA 1BDAA 1LMWB 1DSUA 1MTNC 2WPIS 3AASA 3Q77A 1AE8H 1YGCH 2QY0B 1F5KU 1O2WA 4BAQB 1CA0C 4DY7B 5JB8S 1DFPA 4XDEA 1G36A 5EPYA 4ISHH 1O2VA 1RS0A 3M36A 3LGTA 1IHSH 3U1JB 3MH6A 2BDBA 1V2VT 1C1VH 1HUTH 5A09A 2QAAA 2QF0A 1UTMA 3L6PA 1BBRH 4FU9A 4D7GA 1GL0E 4AFSA 5GCHF 4B76A 1RTKA 1PQAA 3M5LA 2C8XB 1GMHF 1TRNA 4WMDA 4JYUH 2ANMH 2VWNA 4X8VH 1ABJH 4KTCA 2FOFA 3E90B 3E6PH 1GBBA 1WQSA 4X8UH 1MCVA 2BTCE 2GDDA 3BTWE 5PTPA 1SQAA 1XXDA 3MU4A 4BTUB 3V7TA 1S0RA 2A45B 1YLCA 1ZRKA 1NRSH 2WINI 2Z9KA 4X2WA 1Y59T 1GHAF 4Q80A 3BG8A 4E05H 1W12U 1MTUA 2VINA 1JMOH 1W8BH 1ZHRA 1C1QA 2J92A 1LVYA 1MD7A 2D26C 2VIWA 1UTQA 1NU9A 3BEUA 1D3DB 1T4VH 2O9QA 1O3CA 2UUYA 1LQDB 3I77A 5JB9S 1QURH 1WOFA 2H9EH 3B23B 3ZZ6A 1DM4B 1NPMA 1BMAA 1ZLRA 2M5TA 1GHVH 1GJDB 5DP4A 1C5YB 1AVWA 3BG4B 1O2RA 4THNH 3BG4C 4SGBE 3T27A 2HWLB 3NWUA 1C1TA 3KN2A 3I78A 1VCWA 5CHAC 1FN6A 5A8XA 4AORA 3RXQA 1Z1JA 4SGAE 2BD9A 4RN6A 2FLBH 4YO9A 1C5UA 2J2UA 1D6RA 1FN8A 3UIRA 1THSH 2PKAB 1GBJA 1HAIH 4GSOA 1O2MA 2JH5D 1QJ1B 3MU1A 3M7QA 4A6LA 1O2HA 3BSQA 1SOZA 3M3TA 4NFEA 5E0GA 1SFIA 3ATIA 3E1XB 3I29A 4ABAA 1MTNB 1P06A 2BDCA 1AWHB 3H7TA 3QO6A 5DP6A 1UVSH 1AFQC 2WYGA 1C1PA 2UWPA 3PV4A 5GJ4B 4YLUA 1SBWA 2OBQA 1P2KA 4FVDA 1QB1A 1V2PT 1YBWA 1F92A 1QY6A 1S83A 9ESTA 4DJZB 5JBCS 1ZHMA 3PWCA 2WPKS 1B7XB 2ZIQH 5GDSH 1AB9C 3A7WA 2P93A 2BQWB 2BDIA 1ESAA 5FPSA 4ZHLU 1C1RA 2RG3A 1D6WA 4GAWA 3RXFA 2ZFPH 3SJ9A 3SORA 4A7IB 4WJG2 1V2MT 1XKAC 5HGGA 1MKXK 1V6DA 1GBLA 3A89A 2BM2A 4NGAH 3T62A 3TH4H 1CHOF 2Y5HA 4FUBA 5GCHG 6LPRA 1S5SA 5EGMA 2Y81A 1HIAB 1TWXB 1NM6A 1IQFA 3O8DA 5T6GA 3KIDU 1BRBE 1UHBA 4UD9H 1HV7A 1GDNA 1PJPA 1VR1H 1UTPA 4O3TA 4Y8YA 1GVKB 1SVPA 4E7RG 1BBRE 2ZFQH 1K1LA 4Q7XA 1XUIA 1N6XA 3F9HA 1AVXA 3LT3A 2F9OA 1ELCA 1DT2A 3UR9A 2ALVA 3AAUA 3OTJE 4DURA 2Z9GA 5L30H 2PSYA 1WQVH 3A8BA 4CRBA 1B0FA 1HNEE 5EG4A 3K2UA 3GY3A 5TCCA 4K60A 5EW2H 3S9AA 1SGDE 4ZKSU 1F0RA 3PMJA 2FIRH 1RD3B 4ZHMU 1RXPA 1VGCB 1C5PA 5H4IB 1A7SA 3Q3KA 3HGPA 1ARCA 5ESBA 4X0WU 1O5CB 2GV7A 2XWAA 1PPBH 1U6QA 4LK4A 2V0BA 1HPGA 2G55A 3FANA 5F6MA 1O2OA 1O31A 1GI8B 1HAVA 1QBVH 1QJ7B 3FFGA 3TGIE 1DDJA 5HM2A 3P95A 1EOJA 3M7UA 3GCTF 1V3XA 3VB4A 1A5HA 1FPHH 1WV7H 1SR5C 2QF3A 1P2QA 4IC5A 1O3FA 1ETTH 4Z6AH 2R0LA 1D3PB 4CH2B 1INCA 2GP9B 1UVOA 1XKBC 2CV3A 2Y5FA 1ZMJA 1THPB 3SW2B 1E36B 5J4SA 3UNQA 1V2KT 3U69H 3NKKA 6GCHF 4NZLA 4BNRA 4MPUA 2ZTYA 1GHYH 2AGEX 1UVTH 1C9PA 3BTDE 1P09A 4NIYA 4BXSA 2F91A 1QGFA 4ABHA 1AKSA 1LPKB 2WPJS 5A0AE 2CF8H 2XCNA 4CRCA 3R3GB 5FXLA 3AAVA 2AERH 3EYDA 2YNBA 3MH5A 3IG6B 4B74A 5HM9A 1T8OA 2OXSA 1CA0B 3PROA 1DITH 1O2KA 1NRNH 1CGJE 3OY6U 4I33A 3LJOA 2HNTF 1HGTH 2C8WB 5C1YA 3SNAA 3E0NB 2THFB 4AYYB 1ELTA 1O2SA 1O2IA 4GUXA 1FY5A 2ZECA 1V2QT 3LIWA 1L1JA 1QB9A 1GVLA 3EQ0H 1QHRB 4JCNA 2CJIA 4JZEH 4KGAA 1ELGA 3GY4A 3LC5A 2G5VA 3NXPA 4K2YA 4J1YA 1S82A 4H4FA 5EPNA 3LOXA 3G01A 1EJAA 4TY6A 2BD5A 4AG1A 6CHAC 1IQEA 3F1SB 4MPVA 8ESTE 2W26A 3QUMP 1UTLM 3SI4H 1SOTA 1MQ6A 1K1NA 2ANYA 4TPYA 3QGNB 5LPRA 3RXTA 1G30B 4MNYA 4MNVA 2Z9JA 3K6ZA 4AB9A 1QCPA 2NU0E 4I8GA 3SJKA 1O2YA 2JH0D 1CGHA 4FUCA 5CHAB 1KXFA 4AFQA 1ZYOA 1MTSA 1DWEH 1P02A 5K0HA 2OINA 4NIWA 1NN6A 1DY8A 4B2CA 3GDVA 4FUIA 3SHAH 1P2OA 3PO1C 3GY2A 1GMDG 2EA3A 4BAMB 3OSYA 1GMCG 2LPRA 3ZZBA 1SQOA 3KCGH 3RC6A 1SB1H 3NUMA 1MZDA 1ABIH 1A2CH 1UK2A 1WCZA 3SV2H 1AHTH 3A7XA 6GCHG 1A61H 1TX7A 3A8AA 4CH8B 4NWLA 5EXLA 2ANWA 1S84A 5ABWA 2VNTA 1CBWB 2AIPA 3ODDA 3AW1A 1KXAA 1EJNA 4R8TB 2WV4A 1NFUA 2ZDLA 4AX9H 2GKVE 1E35B 2WPHS 1DUAA 2HNTC 1YM0A 1CBWC 3EA9A 4RKOB 4DVAU 2OLGA 1QL9A 2BXTH 2BD4A 3M5NA 1K1OA 4FUFA 4IS5A 4I32A 1J16A 1KYNA 4OS6A 2GZ9A 1OWHA 4GPGA 2SGDE 3MU8A 2AMDA 1LQEA 1FONA 3Q76A 5JBBS 1QBNA 2BQ6B 1YPHE 1N6YA 1ID5H 1A3EH 3MU0A 4VGCB 3LH1A 1EP5A 7LPRA 4X6MA 4NA9H 4I8LA 5F8TA 3SGAE 3C27B 5I25A 1Y5BT 2ZNKH 1C4V2 4JZ1A 1E37B 2SGAA 3QTVH 1DE7H 2PGQB 4E7NA 2BOKA 1O2QA 1BTWA 1WAYB 3E8LA 1BJVA 1PPFE 1LVOA 1PYTC 4X1QU 3LGUA 1UVPA 4Y6DA 1N8OB 4OGYA 3STIA 3ATWA 1P11E 3UQOA 1MKXH 1HAZB 2Y80A 2F9UA 1JIRA 1CU1A 4KP0A 4X6PA 5FPYA 5A2MH 3BTFE 1QA0A 1LPZB 1P12E 2GV6A 4X6OA 1C5LH 3UUZA 1O38A 2ESTE 2OC8A 2UUKB 2ZU2A 2Y6TA 2W3KA 6CHAB 2FEQH 3TJVA 2AMQA 1ARBA 4X8SH 3RLYH 1SMFE 2ZDVH 4YT7H 4WF8A 1MTVA 2C8YB 1GJ6A 4U2WA 3RMLH 1O5GH 1TGNA 2CXVA 1A4WH 1HCGA 3PYHA 3RDZA 3SJIA 3M3VA 4Y7AA 3UNRA 2J38A 1HIAA 2BXUH 4H6TA 4BAKB 2Z94A 1EKBB 3BTKE 1O5BB 1OWEA
chains in the Genus database with same CATH superfamily
1LO6A 4TPIZ 1LKBA 2BLVA 5KGOA 4WMEA 4ABIA 1VCPA 2ZPSA 1EXFA 1SG8B 1SGIB 1K9OE 1OYQA 4BTTB 2A2QH 4K8YA 1Q2WA 1HB0B 2SGEE 2TGPZ 3B9FH 1YLDA 1HDTH 3MH4A 3WY8A 1GI3A 1DLEA 1TE0A 1Y3UA 1SFQB 1ZGIA 1YKTA 3FVFB 4DW2U 3D65E 2I6SA 3T29A 4DG4A 5A8YA 3V0XA 4CRFA 3RXOA 1DVAH 1PPHE 2PKSC 1AUTC 2G00A 4INLA 1C5MD 3OE7D 3W95A 2LP6A 1C5VA 1W14U 4LZ4B 1Z1IA 1P10A 4KELA 5HIZA 4NSVA 1MAXA 4B6FA 5CDFE 2PTCE 1W0ZU 2ZEBA 3VXEH 3SNEA 2Q6DA 2OUAA 5SGAE 1HAHH 1HJAB 3KL6A 1W10U 5FX6A 1ZJKA 2G5NA 3QGJA 3P8OA 1EZXC 5KECA 4OS7A 1W7XH 1LDTT 3MO3A 5JBTA 4FUJA 3OU0A 2A4RA 1O32A 1CO7E 3D23A 2P94A 1F7ZA 4UDWH 4AGJA 4HTCH 3RLWH 2KFWA 1FMGA 4IW4E 1C1UH 1UTKA 1AVGH 1H8DH 2CHAB 3U8RH 1RRKA 3E91A 1CQQA 4ABDA 4Q63A 3CP7A 4E06H 1V2TT 1UCYE 1SGPE 1TABE 3L3TA 1SHYA 1G3CA 2P3FH 2WUBA 3KQDA 3TK6A 1V2JT 2DE8A 3MNBA 1K1JA 1MMJN 1P03A 1BJUA 1TLDA 2BDGA 3VB6A 1A5GH 2F9BH 2KCPA 2ZG0H 1C2HA 4ABEA 2P59A 1EAXA 2STBE 3RC5A 4TWWA 4YT6H 1ZTKA 3GOVB 4I8HA 3ZZ5A 1RFNA 4H42U 2FDAA 2SGPE 2FOGA 1C2LA 1Z6JH 3PLPA 3MU5A 3KEEA 3LJJA 2TPIZ 1WTGH 2ZCKP 2B7DH 3LGIA 4YOIA 2PR3A 2QF5A 4TT3D 1SGCA 2ZGHA 1TQ7B 5GWZA 2FI3E 5EQSA 1GBKA 1KLJH 1MAYA 1OYTH 2ZHQH 4XFQA 3TPIZ 3TNTA 3V13A 2GD4B 2ODPA 2WSSD 2XOKD 4O03A 5L2ZH 4M9FA 1GI2A 1JRSA 2ZA5A 1TYNA 2QA9E 4DCDA 1BITA 4A1TA 1QJ6B 1GBHA 1TBRH 4U01A 1C5WB 1E1RD 1H9HE 1RJXB 1J14A 1ELEE 1O3GA 1UK3A 2G81E 1Z7KA 1PYTD 4NZQA 3RXRA 2XWBI 3B8JA 4FUDA 1V2UT 1KXEA 4P00A 2ZDMA 1GPZA 2NU2E 1SLUB 1SQTA 1O3LA 1OP0A 1MCTA 2A31A 2ZF0H 1BHXB 3T25A 2ZDNA 3RP2A 3ZZ3A 2A2XH 1J17T 2GVFA 3SUDA 8GCHG 3SUEA 2BD2A 4WMFA 3MFJA 1BTPA 3BTEE 2KR7A 4NG9H 2HPPH 2GCTB 2LNCA 4U32A 4IN2A 1O2JA 4ABGA 4AFUA 1BTYA 2R3UA 1C2IA 3GY7A 1G37A 1C5ZB 3N7EA 3DHKH 1O33A 2NU4E 3RXJA 5E8EH 2G8TA 3D62A 2JETB 1O5FH 1IQKA 1EAWA 2HPQH 2SGFE 3HGNA 1P04A 2RDEA 3GY5A 4INKA 2TGDA 1V2RT 4RKJB 3UTUH 1P2JA 1TA6A 2ZGCA 1O2PA 3QLPH 1W0JD 4VGCC 1TOCB 2QF4A 1J15A 4I7YH 2D1JA 1C2MA 4MQAA 3VEQB 2AFQB 2F9NA 1HAPH 2HALA 1BTXA 4JZFH 1O3DA 1P3CA 1O2TA 1AY6H 4Y10E 4K1EA 2QIQA 3O8CA 1Z71A 3FKSD 2WHXA 1C2FA 2BZ6H 3LPRA 5T3HA 2GTBA 2HRVA 1OP2A 2A32A 1KDQB 1F0UA 5C1XA 4MNWA 2AEIH 2GGVB 2QV1A 5HMAA 3RM2H 2CGAA 2ZWLH 4HGCA 1DS2E 3RXBA 3MMGA 1FAXA 1BB0B 1AMHA 2FXRA 3RC4A 1TAWA 1BMFD 2OP9A 1NRPH 3E0PB 2J95A 1KSNA 1PPZA 3CS7A 1EZQA 3TLOA 1UTOA 1YC0A 2FMJA 5DN6D 3ZYDA 2KCAA 3STJA 1ZRBA 1DXWA 3PO1B 4K5ZA 1L1NA 2FLRH 1W7GH 1P9UA 3MNXA 4JMYA 1GHZA 3L33A 5JPMH 1BMLA 2DUCA 3ZVCA 1CT4E 3SUFA 3VGCB 2OQUA 1YWUA 2H2ZA 3P6ZB 4GHQA 3UNSA 2AGIX 2BY7X 1Z8RA 3SOSA 4X2XA 1GG6C 1UK4A 1ZSJA 1ZTLA 2ZQ1A 2ZHEH 2ANKH 4WVPE 4D7FA 1HAGE 2Q6FA 4GCHF 1YPGH 4M7GA 1C2KA 2VU8E 1YPJH 3UOPA 1T32A 5EJ1A 3EGKH 1S0QA 4A92A 3SV6A 1C5SA 1EZSC 1Y8TA 3RXKA 3ZZCA 2NWNA 1E0FD 3UWIA 2FOAA 1V2OT 3RXCA 2QCYA 3GCHC 2ZGBH 4KKDA 2QC2A 4JZIA 1D3QB 1Z6EA 4ZCNA 3S69A 1LHFH 4GHTA 1AE5A 9LPRA 2V6NA 1GBCA 3SV9A 1FY8E 3P8GA 1YPHC 2GMTC 3K6YA 3SGBE 3DUXH 2NU3E 3A80A 3RMOH 1PPCE 3ZV8A 3D49H 2YOLA 3BN9A 1GMHG 1QRZA 1KTTB 5LGOA 1O2ZA 5DP8A 2J34A 2KAIA 1ANEA 4CBOA 1SL3A 1G3BA 2AHME 1PQ7A 1NESE 3T2NA 4CBNA 3M35A 2FI5E 3S0NA 4Q7ZA 2V3MA 1NBMD 3O8RA 2ILNA 1AFQB 1EP6A 1KMHB 4MPXA 2ZU4A 3RXGA 3BTQE 3VXFH 1BRCE 1FZZA 1GI9B 4I31A 4UONA 4Q2KA 3FP8E 3RXDA 2OC0A 3A84A 2SNWA 1KXBA 4I8KA 1SGFA 1BHXF 4IGDA 3BTGE 5F8ZA 2ZC9H 3F9EA 1C4Y2 1C5OH 2H9TH 1V2LT 1O34A 5G4BA 1NS3A 3M37A 5FBIA 2W7SA 2PUQH 1HAXB 3DA9B 4F49A 2R3YA 1F5LA 3P70B 1F0SA 4Y0ZE 1QRXA 5LPEA 2RCEA 3RXEA 4K3JA 1CA8B 4UFFH 1FX0B 1IOEA 1QFKH 1C5RA 1NT1A 5TJXA 1GI1A 2QN5T 3OY5U 4PROA 1H1BA 1NY22 3OX7U 1GDUA 3DSPA 2F3CE 4ACAA 3IWMA 1JBUH 3SHCH 4CRAA 1GI6A 2HGTH 3OEHD 4BANB 1FUJA 1SGQE 1O2GH 2C8ZB 1ELVA 1O2LA 5EXMA 2P3TB 2GZ7A 1YF4A 4Q4LA 1H9LB 3VB3A 1FJSA 2BD3A 5C2ZA 2ODYB 1H4WA 4ZROA 4NSYA 1NRRH 1CHOG 1C5XB 5B6LA 3BTHE 1LHEH 2AIQA 2KM0A 1ZZZA 4UFGH 1TIOA 3DFJA 2XYAA 4O3UA 1VJAU 3PV2A 2HLCA 1P3EA 1GHAG 2XRCA 2AGGX 1BMNH 3BEFB 5GIBA 2FS9A 1QQ4A 3ZVFA 1XUKA 1XXFA 2GJGA 1QB6A 1OSSA 1SGNE 1NBME 4Y79A 3HK6B 1SQRA 3M61U 4ZH8A 4AB8A 3FO8D 1TGTA 2Z6BD 3HKJB 3W94A 1JOUB 3MOCA 1LKAA 5C5NA 1GGDB 1EFRD 4ESTE 1SGRE 3UAIC 2FYQA 1ACBE 4NA8A 1BT7A 1P2NA 2QXGA 1OS8A 4NCYA 2ASUB 2FOEA 4MPWA 1KDQA 1O39A 4ZXXH 1MKWK 1KXCA 1MH0A 4HZHA 4WXIA 1HBTH 3UQVA 2XXLA 3QWCH 1K1MA 2XBXA 2FOMB 1GVZA 1UCYH 3JZ1B 1HAVB 1HJ8A 3NPSA 1C2EA 2PV9B 4OS1A 1DICA 1C2JA 4X1PU 4ZKOU 1TNIA 4A1XA 5J4QA 1SHHB 1ANCA 1WBGB 1C1NA 2G4UA 4KTSA 2AS9A 2A5KA 2NU1E 3F9GA 5FL7D 4D9RA 2OQ5A 4B73A 2H5CA 2C4FH 2F9PA 2EI8A 2VVCA 1FAKH 4K1TA 1O3OA 4FU7A 3A7ZA 2A7HA 1GHBG 3GICB 2YNAA 1GHBF 2P3UB 2XBVA 4FUHA 2BMGB 4FU8A 5B6OA 3MI4A 3SNCA 2UWOA 2PP6A 2IOTA 2ZFFH 3SJOA 3UREA 2J97A 2QXIA 2OD3B 5ETXA 2STAE 1V2WT 5T6FA 3BF6H 3F68H 4FOUC 2FTLE 3Q00A 2ZFSA 1NFYA 1AKSB 3SU3A 1BZXE 3KGPA 1HAYB 3MTYA 3HATH 1KLTA 1UCYK 4TWYA 3DSGA 5GXPA 2F4LA 5F53A 2A5AA 1EAUA 2XC4A 2ZDAH 2HLDD 4INHA 2GX4A 1S6HA 4YZUA 3U28C 2R0KA 5AVDA 4WXVA 1DLKB 4JK6A 3GDUA 8LPRA 3ZZAA 3KNXA 1EUFA 4UFEH 3T26A 2XBWA 1TGSZ 5F6MA 5KEDA 2PGBB 1CT2E 1BOQA 3SQHE 2AYWA 2AMPA 2EY4C 4CRDA 1SGYE 2SGQE 1L2EA 2A7JA 1QQUA 3MO6A 2JH6D 3GISB 1DSTA 1ELDE 2B8OH 3QX5H 1O5DH 4XBDA 3SNDA 2OBOA 2TBSA 2G4TA 3GCOA 1XUGA 2VIQA 5CHBA 2ZTXA 4LOYH 4BAHB 4ABJA 2TGAA 2BVXH 1NFWA 3GYMA 1UTJA 1ZMLA 5FCKA 1C1OA 1ESTA 5DP7A 2W7UA 3RMNH 3SO3A 3RXLA 2VVVA 4ACBA 3MQKC 1BTZA 1LCYA 1BRUP 1B0EA 2BY8X 2QXJA 2V35A 2WV5A 2ZO3H 3SN8A 3UPEA 1GHXH 2R2WU 1MBMA 1TFXA 2PW8H 5EOKA 4OGXA 5AF9H 1LVMA 3SBKA 1KLIH 2VIOA 2F9VA 2EI7A 2W6JD 3ODFA 1GJCB 1ZSKA 1RIWB 1Y3YA 5IDKA 1GBFA 1HJAC 1YPKH 2F43B 4B2AA 1S81A 1EB1H 2PWXA 1DWCH 4UEHH 2RA0A 1P0SH 3ZVEA 3ATLA 1UVUH 1YCPK 2FWWA 2ALPA 1A0LA 2UWLA 3RUOA 2VWMA 3A8DA 5FCRA 1KXDA 3MH7A 1FY3A 1W11U 1EPTC 3KQBA 4U30A 1ZMNA 2P8OC 1LPGB 3ZZDA 1TMTH 3H7OA 3TVJB 3OEED 3PB1E 2BLQA 1DWBH 3P8FA 2FODA 4UFDH 3PMBB 2EEKA 1IQHA 1GI7B 4ISOA 1C1SA 4JK5A 4B75A 5DG6A 3ELAH 2HNTE 1C9TA 2ZQ2A 3RXIA 3ZVBA 1GBEA 1Y5UT 2ZP0H 1ELFA 2ZPRA 1YPEH 1AD8H 3SU1A 2PKAA 1EATA 3TK5A 1EX3A 1GMDF 1ESBA 1EB2A 7GCHG 1G2LA 5FX5A 1O3KA 2Z3CA 3K9XB 2J4IA 1K22H 5AHGH 3SUGA 1IQIA 3GY8A 3QK1A 3BTTE 3E3TA 5C0UA 1V2NT 4OS2A 3FOAA 1FY1A 1TOMH 4TY7A 2ZHDA 2RFKC 3WW7A 2FS8A 1RGQA 2YMSC 1TRYA 1WYKA 4ISLA 3TITA 3NCLA 1NFXA 3PMHB 1C5TA 4ASHA 4O97A 4AG2A 1DXPA 1MBQA 3GCTG 4DT4A 2ZPQA 1QL8A 1CHGA 3VG8A 2F83A 2Q1JA 1K21H 4ZUHA 3OYPA 1ZPZA 1HLTH 1TX6A 5DO4H 4NA7A 2BVSH 1C5NH 1NTPA 2H1UA 3V3MA 3PWBA 1AIXH 1EZUC 3NRLA 1G3EA 1QRWA 5C5OA 1O3BA 1GI5A 2BX4A 3QDZB 2FYRA 1AUJA 1HJ9A 2OC7A 1AZ8A 1B5GH 5EW1H 3MYWA 1MU6B 3RXVA 3MO9A 1QTFA 2GT8A 2Y7ZA 2FX4A 1SGFG 1UHBB 1O3JA 1VITG 3VGCC 1YCPM 5E0JA 1O36A 1Q3XA 1JRTA 4ZKRU 3SU0A 1TPPA 1JWTA 1ZSLA 2XC0A 3LGWA 1P2IA 1ZPBA 4GVUA 2TIOA 2A7CA 1W13U 2GCHG 1OXGA 1A3BH 2BDAA 1O0DH 1TNGA 1XX9A 1GJ5H 2ZU3A 1SPJA 3A85A 1T4UH 3SU4A 2G51A 3PMAB 1FQ3A 1GDQA 5A8ZA 5AFZH 1IQGA 2ZU1A 1T8NA 2PFEA 3ATKA 2WPMS 4X2YA 2BDHA 2FTMA 1TBZH 1GJ8B 4WH6A 1LTOA 1G2MA 2VWOA 3BTME 1GCDA 1TRMA 1ZHPA 1Z8GA 3TNSA 1SGEE 1LHDH 1W0YH 3SV8A 2ZHWH 1RIWC 3FP6E 2WPLS 4YOGA 3SI3H 2CMYA 3ITIA 2BLWA 5DK1A 5C20A 5CE1A 1NC6A 2O8UA 1GJ9B 3JZ2B 2IN2A 1MQ5A 1ZPCA 2ULLA 4NIVA 3SGQE 2VH6A 4NFFA 1OX1A 3URCA 2JIZD 4CREA 1IQLA 1ELAA 1VITH 2J5UA 2Z3EA 5EQQA 1TONA 1A46H 3LONA 4Y76A 1CE5A 1T7CA 5EU8A 2FO9A 4NWKA 1EJMA 1M9UA 2GDEH 2PSXA 1YYY1 3QZQA 3V12A 2FP7B 1TQ0B 1V2ST 3MWIU 4CHAC 1O2UA 3A83A 2B5TB 3TJNA 2PKSB 3MHWU 1TGBA 3GCHB 3RXAA 4XRNA 1EAIA 4XBCA 1ETRH 3QN7A 3DT0H 4X1NU 2BY6X 2RDLA 2FX6A 1A1RA 4MTBA 2FESH 3A7YA 1RTLA 2Y5GA 3TIUA 4JZDH 4ZXYH 1O5AB 8KME2 1GBIA 2UUFB 4DIHH 3RXPA 4FVBA 4H6SB 2A1DB 1QA7A 1T8MA 3A7TA 5C3NA 4X6NA 1L0ZA 1O3NA 2BD8A 2I6QA 5IYTA 4ASUD 1BMMH 1E34B 1TNLA 4F4OC 2IJOB 2V7QD 1DX5M 4WY3A 1MUEB 3RU4D 5ESTE 3ESTA 4HFPB 1E79D 4FUEA 2FOHA 3H09A 2GCHF 3R0FA 3ZVGA 2P8OB 2DE9A 4XSKU 3RM0H 1AB9B 4BXWA 1BTUA 1NU7B 4I8JA 1XUFA 1D3TB 5FAHA 4AYVB 4D9QA 2A4GA 2VWLA 4AC9A 4WH8A 3M3SA 4CHAB 2Z9IA 1GJBB 5FPTA 3PTNA 3GDSA 1ANBA 3A87A 1TPAE 5LH8A 2BY9X 5AFYH 4DGJA 3S9BA 2BB4A 4FUGA 1LHCH 1UJ1A 1K28D 3EAJA 3VB5A 2XBYA 1O2XA 2TRMA 3UFAA 4DIIH 1Y3XA 3A86A 2VGCB 1N8OC 3BIUH 3EE0B 1DUEA 1FIZA 2M2AA 1GMCF 3LGYA 1VITF 1CGIE 3TH3H 5DGJA 3WWFA 4CR5A 5E0HA 3HK3B 7ESTE 5GNDA 2IPQX 1BTHH 1N1LA 1T8LA 1TNHA 2ZU5A 1S85A 1WDIA 2V3OH 2UUJB 1D9IA 2BQ7B 2P95A 3SZEA 1GCTB 4HG6A 1P2MA 2C93B 1TPSA 5EODA 1XUHA 1KTSB 2HVXA 2C3SA 4RI0A 3ZIAD 4AN7A 1DY9A 5DP9A 3FZZA 4LXBH 2D8WA 3E16B 2ZFRH 4Y0YE 4Z0KA 1A5IA 3NZIA 2XNIA 1EOLA 4MNXA 2BVRH 1GCTC 1OP8A 2ZGJA 2CHAC 1L1GA 1GJ7B 4ABFA 1O5EH 1SI5H 3Q3XA 1HFDA 4XD7D 5DP5A 3ZZ4A 4R0IA 3ATMA 3S7KB 4XE4A 1TNKA 1QBOA 1GBDA 1P8VC 1PPGE 1QIXB 4YTAA 1DOJA 4HI3A 1YY3A 1FV9A 1G3DA 4ISNA 2VGCC 1C1WH 4GCHG 1SC8U 2JKHA 1TALA 1O3IA 3M5OA 3VFEA 2Z7FE 4J2YB 5C67A 2XTTB 4CRGA 1TPOA 4D8NA 2O8TA 2A5IA 2YMSD 1ORFA 1P9SA 1OKXA 3RXMA 1QL7A 1GJ4H 1AU8A 3SU2A 4IC6A 1O3PB 5C0TA 1G32B 5LPFA 2FOCA 1FXYA 3SZNA 1RTFB 3MNCA 5FBEA 1F5RA 1GJAB 3SNBA 1Z8IB 5EIYA 2O8MA 1VCQA 2L6OA 4Q7YA 4O9VA 2YMSB 3DFLA 3NK8A 4XBBA 2V3HH 3BV9B 4X1RU 3AVZA 1ZGVA 1BA8B 2VVUA 3KQCA 1AO5A 3CENA 4YM9A 1Y5AT 2OTVA 3PRDA 5E2OA 4Y8XA 1OPHB 4BAOB 1SSXA 3URDA 1L4DA 2QE7D 4B71A 4IMZA 3PM3A 3IITA 1FIWA 2Q6GA 4BTIB 1KY9A 1WSSH 4DT7B 2IJD1 4Y7BA 4TYDA 2J9NA 1EPTA 2H6MA 3LH3A 1PPEE 2EC9H 3RXUA 5JYIA 5A0BA 1TX8A 1JXPA 5K7RA 1GGDC 2PUXB 2ZHFH 4IN1A 2P16A 1HXFH 1XVOA 1COWD 1J8AA 2R2MB 3TH2H 4WWYA 1C5QA 1MU8B 1AQ7A 1IHTH 2CN0H 1BIOA 4B1TA 7GCHF 2GZ8A 4B2BA 1TBQH 4YLQH 2WZQA 1GL1A 4UE7H 3A81A 3SQEE 3TGJE 1BQYA 2ODQA 4AFZA 3HKIB 3RXHA 1IQJA 2OCVB 1ZJDA 2VIVA 3ZZ7A 1GBTA 2JJ1D 1WUNH 3EA7A 1IAUA 2O8LA 5DP3A 3ZV9A 1L4ZA 4YOJA 2HOBA 1DANH 1A0HB 2ZI2H 5F03A 2J94A 1EQ9A 5DKMA 3RU4T 1O30A 1ANDA 3TK9A 2WUCA 2D2DA 3N7DA 1CSOE 1ETSH 3RMMH 3M7TA 3TJUA 3P92A 1KIGH 1MD8A 3FAOA 5HXFA 1AFEH 3ZYEA 1DWDH 1T31A 1XVMA 3LC3A 2H5DA 4ZMAH 1FY4A 4X8TH 2BLOA 1GWAA 1LHGH 2VH0A 3FZDA 4ISIH 4JYTA 1GG6B 4IBLH 4A5TS 2RA3A 5C1UA 4RSPA 2XC5A 1FNIA 3A88A 1P05A 1H9IE 1PQ5A 3EE7A 1H8ED 2ZKSA 2BY5X 3A8CA 2QGRA 5JBAS 1O3MA 1GI4A 1XUJA 1K1PA 1QR3E 3CS0A 3FP7E 3GYLB 1IQNA 4F48B 1UTNA 4B6EA 4K69A 4YESB 1A0JA 1LVBA 1SKYE 1NRQH 2ZCLP 1O3HA 1O35A 1EASA 1AWFH 2KAIB 3OFND 1YPLH 1SLVB 1THRH 4RT0A 4AZ2B 2BZAA 3TGKE 5EQRA 5BRRE 3LKWA 1GBMA 1P01A 2FM2A 2Y7XA 5BPEA 1HRTH 2JDID 2WPDD 1YPMH 1SGTA 2XW9A 3TU7H 3SU6A 1VJ9U 1QNJA 1WU1A 7KMEH 2A0QB 3UR6A 6ESTA 4FXGH 4X2VA 1VGCC 3KHVA 3S9CA 1OWKA 1JIMA 3S7HB 3KYFA 2ZTZA 1K1IA 3KQEA 1X7AC 2BDYA 2VJ1A 1O3AA 1Z8JB 3U98H 2FI4E 1FI8A 5JDUB 1D4PB 2WYJA 2O8WA 1Q31A 4P02A 2ZFTA 1UW7A 2ZGXH 2J98A 1P57B 3PLBA 4AGKA 1TNJA 4DOQA 3DSOA 1ZR0A 4QT8C 3T28A 3O8BA 2A4QA 2XCFA 2PTNA 1QZ8A 1HAOH 4A1VA 1NROH 4Y8ZA 1OOKB 5DSFA 1ZTJA 2G52A 3U8TH 2AH4X 1MTWA 4ABBA 2VIDA 1VZQH 3PTBA 3QTOH 2ZCHP 1C2DA 1Y3WA 4I86A 3ENSB 1XM1A 2VB0A 1ZOMA 4Z1MD 2Z3DA 4LZ1H 2BOHB 5E2PA 1C4U2 1DPOA 1NO9H 2KX4A 4MDSA 5DPAA 4XOJA 2W3IA 3Q3YA 8GCHF 2W6ID 1J9CH 3P17H 3U8OH 1G9IE 1HXEH 1TA2A 4X1SU 3RXSA 3ZZ9A 4CR9A 4KTUA 3ZVAA 1O3EA 1S6FA 1UMAH 2FZZA 3C1KA 1EPTB 1F0TA 4ZKNU 2GT7A 2Y82A 3MNSA 3N7OA 3SU5A 1TGCA 3H5CB 5HKKD 1W3CA 1MZAA 1E38B 3F9FA 5CMXH 1GBAA 2PHBA 1BCUH 2A4OA 2K0QA 3SJ8A 4MVNA 1AZZA 1GHWH 3TJOA 2C90B 3T5FH 2TGTA 1TMBH 5HYOA 3QZRA 1PQ8A 4ZAEA 2OC1A 3UY9A 3GY6A 1AN1E 1BRAA 1FDPA 5FHTA 1FPCH 4GLYA 1OWIA 4Y11E 2B9LA 3EDXB 3SV7A 5EXNA 2BX3A 1OWJA 4Y71A 1GI0A 1UO6A 2KCYA 4MLFB 3SYJA 2CF9H 2ZZUH 4BOHA 4MG3A 2EI6A 4IMQA 4NIXA 4OS5A 2SFAA 1CVWH 5L6NH 3DD2H 3M5MA 3K65B 4K1SA 1WTHD 2Z9LA 5A0CA 3LU9B 3KF2A 1CT0E 1NZQH 1YP9A 3UB0A 5L2YH 1AGJA 5DJ7A 3U9AH 1K2I1 2BHGA 2IPHA 3F6UH 5TCAA 1TMUH 1O2NA 3GCNA 2BYAX 5F8XA 2W5EA 1BBRK 1AI8H 1ELBA 4AOQA 3AW0A 1MKWH 3HPTB 3BEIB 3BIVH 1YCPH 2JETC 2GCTC 1O37A 3LGVA 4OS4A 1IQMA 1TB6H 5T6DA 2H9HA 2VIPA 3A82A 1W2KH 3A7VA 5I46H 3UOUA 3P8NA 3U1IB 1FLEE 1SLXB 1C2GA 1SLWB 3RU4E 1OWDA 3UWJH 3VPKA 4D76A 5GPIB 1BUIA 3ZZ8A 2B0FA 2R9PA 1C1MA 3PLKA 3VB7A 2QYIA 1XMNB 3ZVDA 4ZHAA 2QXHA 2FPZA 1PFXC 3EA8A 2ZDKA 2SNVA 2FOBA 2GMTB 2PLXA 4K8BA 4OM9A 4JYVH 1HYLA 2K1QA 2BD7A 3LDXH 1F2SE 1H8IH 1Y3VA 1BDAA 1LMWB 1DSUA 1MTNC 2WPIS 3AASA 3Q77A 1AE8H 1YGCH 2QY0B 1F5KU 1O2WA 4BAQB 1CA0C 4DY7B 5JB8S 1DFPA 4XDEA 1G36A 2J98B 5EPYA 3F0PA 4ISHH 1O2VA 1RS0A 3M36A 3LGTA 1IHSH 3U1JB 3MH6A 2BDBA 1V2VT 1C1VH 1HUTH 5A09A 2QAAA 2QF0A 1UTMA 3L6PA 1BBRH 4FU9A 1VKYA 4D7GA 1GL0E 4AFSA 5GCHF 4B76A 1RTKA 1PQAA 3M5LA 2C8XB 1GMHF 1TRNA 4WMDA 4JYUH 2ANMH 2VWNA 4X8VH 1ABJH 4KTCA 2FOFA 3E90B 3E6PH 1GBBA 1WQSA 4X8UH 1MCVA 2BTCE 2GDDA 3BTWE 2OK5A 5PTPA 1SQAA 1XXDA 3MU4A 4BTUB 3F2HA 3V7TA 1S0RA 2A45B 1YLCA 1ZRKA 1NRSH 2WINI 2Z9KA 4X2WA 2HVYB 1Y59T 1GHAF 4Q80A 3BG8A 4E05H 1W12U 1MTUA 2VINA 1JMOH 1W8BH 1ZHRA 1C1QA 2J92A 1LVYA 1MD7A 2D26C 2VIWA 1UTQA 1NU9A 3BEUA 1D3DB 1T4VH 2O9QA 1O3CA 2UUYA 1LQDB 3I77A 5JB9S 1QURH 1WOFA 2H9EH 1K0HA 3B23B 3ZZ6A 1DM4B 1NPMA 2JJ2D 1BMAA 2KCOA 1ZLRA 2M5TA 1GHVH 1GJDB 5DP4A 1C5YB 1AVWA 3BG4B 1O2RA 4THNH 3BG4C 4SGBE 3T27A 2HWLB 3NWUA 1C1TA 3KN2A 3I78A 1VCWA 5CHAC 1FN6A 5A8XA 4AORA 3RXQA 1Z1JA 4SGAE 2BD9A 4RN6A 2FLBH 4YO9A 1C5UA 2J2UA 3W1EA 5C17A 1D6RA 1FN8A 3UIRA 1THSH 2PKAB 1GBJA 1HAIH 4GSOA 1O2MA 2JH5D 1QJ1B 3MU1A 3M7QA 4A6LA 1O2HA 3BSQA 1SOZA 3M3TA 4NFEA 5E0GA 1SFIA 3ATIA 3E1XB 3I29A 3CNRA 4ABAA 1MTNB 1P06A 2BDCA 1AWHB 3H7TA 3QO6A 5DP6A 1UVSH 1AFQC 2WYGA 1C1PA 2UWPA 3PV4A 5GJ4B 4YLUA 1SBWA 2OBQA 1P2KA 3F2FA 4FVDA 1QB1A 1V2PT 1YBWA 1F92A 1QY6A 1S83A 9ESTA 3FN8A 4DJZB 5JBCS 1ZHMA 2XNDD 3PWCA 2WPKS 1B7XB 2ZIQH 5GDSH 1AB9C 3A7WA 2P93A 1S6LA 2BQWB 2BDIA 1ESAA 5FPSA 4ZHLU 1C1RA 2RG3A 1D6WA 4GAWA 3RXFA 2ZFPH 3SJ9A 3SORA 4A7IB 4WJG2 1V2MT 1XKAC 5HGGA 1MKXK 1V6DA 1GBLA 3A89A 2BM2A 4NGAH 3T62A 3TH4H 1CHOF 2Y5HA 4FUBA 5GCHG 6LPRA 1S5SA 5EGMA 2Y81A 1HIAB 1TWXB 1NM6A 1IQFA 3O8DA 5T6GA 3KIDU 1BRBE 1UHBA 4UD9H 1HV7A 1GDNA 1PJPA 1VR1H 1UTPA 4O3TA 4Y8YA 1GVKB 1SVPA 4E7RG 1BBRE 4YXWD 2ZFQH 5EJLA 1K1LA 4Q7XA 5IK2D 1XUIA 1N6XA 3F9HA 1AVXA 3LT3A 2F9OA 1ELCA 1DT2A 3UR9A 2ALVA 3AAUA 3OTJE 4DURA 2Z9GA 5L30H 2PSYA 1WQVH 3A8BA 4CRBA 1B0FA 1HNEE 5EG4A 3K2UA 3GY3A 2L74A 5TCCA 4K60A 5EW2H 3S9AA 1SGDE 4ZKSU 1F0RA 3PMJA 2FIRH 1RD3B 4ZHMU 1RXPA 1VGCB 1C5PA 5H4IB 1YLNA 1A7SA 3Q3KA 3HGPA 1ARCA 5ESBA 4X0WU 1O5CB 2GV7A 2XWAA 1PPBH 4F55A 1MABB 1U6QA 4LK4A 2V0BA 1HPGA 2G55A 3FANA 2KZ4A 1O2OA 1O31A 1GI8B 1HAVA 1QBVH 1QJ7B 3FFGA 3TGIE 1DDJA 5HM2A 3P95A 1EOJA 3M7UA 3GCTF 1V3XA 3VB4A 2K8IA 1A5HA 1FPHH 1WV7H 1SR5C 2QF3A 1P2QA 4IC5A 1O3FA 1ETTH 4Z6AH 2R0LA 1D3PB 4CH2B 1INCA 2GP9B 1UVOA 1XKBC 2CV3A 2Y5FA 1ZMJA 1THPB 3SW2B 1E36B 5J4SA 1E1QD 1V2KT 4FETA 3UNQA 3U69H 3NKKA 6GCHF 4NZLA 4BNRA 5EJZA 4MPUA 2ZTYA 1GHYH 2AGEX 1UVTH 1C9PA 3BTDE 1P09A 4NIYA 4BXSA 2F91A 1QGFA 4ABHA 1AKSA 1LPKB 2WPJS 5A0AE 2CF8H 2XCNA 4CRCA 3R3GB 3PV5A 5FXLA 3AAVA 2AERH 3EYDA 2YNBA 3MH5A 3IG6B 4B74A 5HM9A 1T8OA 2OXSA 1CA0B 3PROA 1DITH 1O2KA 1NRNH 1CGJE 3OY6U 4I33A 1H8HD 3OTPA 3LJOA 2HNTF 1HGTH 2C8WB 5C1YA 5T1VA 3E0NB 2THFB 3SNAA 4AYYB 1ELTA 3N99A 1O2SA 1O2IA 4GUXA 1FY5A 2ZECA 1V2QT 3LIWA 1L1JA 1QB9A 1GVLA 3EQ0H 1QHRB 4JCNA 2CJIA 4JZEH 4KGAA 1ELGA 3GY4A 3LC5A 2G5VA 3NXPA 4K2YA 4J1YA 1S82A 4H4FA 5EPNA 3LOXA 3G01A 1EJAA 4TY6A 2BD5A 4AG1A 6CHAC 1IQEA 3F1SB 4MPVA 8ESTE 1W0KD 2W26A 3DCLA 3QUMP 1UTLM 3SI4H 1SOTA 1WXRA 1MQ6A 1K1NA 3PRBA 2ANYA 4TPYA 3WWBA 3QGNB 5LPRA 3RXTA 1G30B 4MNYA 4MNVA 2Z9JA 3K6ZA 4AB9A 1QCPA 2NU0E 4I8GA 3SJKA 1O2YA 2VBCA 2JH0D 1CGHA 4FUCA 3OAAD 1KXFA 5CHAB 4AFQA 1ZYOA 1MTSA 1DWEH 1P02A 5K0HA 2OINA 4NIWA 1NN6A 1DY8A 3KYGA 4B2CA 3GDVA 4FUIA 3SHAH 1P2OA 3PO1C 3GY2A 1GMDG 2EA3A 4BAMB 3OSYA 1GMCG 2LPRA 3ZZBA 1SQOA 3KCGH 3RC6A 1SB1H 3NUMA 1MZDA 1ABIH 1A2CH 1UK2A 1WCZA 3SV2H 1AHTH 3A7XA 6GCHG 1A61H 1TX7A 3A8AA 4CH8B 3GS9A 4NWLA 5EXLA 2ANWA 1S84A 5ABWA 2VNTA 1CBWB 2AIPA 3ODDA 3AW1A 1KXAA 1EJNA 4R8TB 2WV4A 1NFUA 2ZDLA 5HIYA 4AX9H 2GKVE 1E35B 2WPHS 1DUAA 2HNTC 1YM0A 1CBWC 3EA9A 4RKOB 4DVAU 2OLGA 1QL9A 2BXTH 2EQNA 2BD4A 3M5NA 1K1OA 4FUFA 4IS5A 4I32A 1J16A 1KYNA 4OS6A 2GZ9A 1OWHA 4GPGA 2SGDE 3MU8A 2AMDA 4TSFD 3F3BA 1LQEA 1FONA 2CK3D 3Q76A 5JBBS 3AK5A 1QBNA 2BQ6B 1YPHE 1N6YA 1ID5H 1A3EH 3MU0A 4VGCB 3LH1A 1EP5A 7LPRA 4X6MA 4NA9H 4I8LA 5F8TA 3SGAE 3C27B 5I25A 1Y5BT 2ZNKH 1C4V2 4JZ1A 1E37B 2SGAA 3QTVH 1DE7H 2PGQB 4E7NA 2BOKA 1O2QA 1BTWA 1WAYB 3E8LA 3KQ5A 1BJVA 1PPFE 1LVOA 1PYTC 4X1QU 3LGUA 1UVPA 4Y6DA 1N8OB 4OGYA 3STIA 3ATWA 1P11E 3UQOA 1MKXH 1HAZB 2Y80A 2F9UA 1JIRA 1CU1A 4KP0A 3F0OA 4X6PA 5FPYA 5A2MH 3BTFE 1QA0A 1LPZB 1P12E 2GV6A 4X6OA 1C5LH 3UUZA 1O38A 2ESTE 2OC8A 2UUKB 2ZU2A 2Y6TA 2W3KA 6CHAB 2LELA 2FEQH 3TJVA 2AMQA 1ARBA 4X8SH 3RLYH 1SMFE 2ZDVH 4YT7H 4WF8A 1MTVA 1OHHD 2C8YB 1GJ6A 3F2GA 4U2WA 4RT1A 3RMLH 2WV9A 1O5GH 1TGNA 2CXVA 1A4WH 1HCGA 3PYHA 3RDZA 3SJIA 3M3VA 4Y7AA 3UNRA 2J38A 1HIAA 2BXUH 4H6TA 4BAKB 2Z94A 1EKBB 3BTKE 1O5BB 1OWEA 5C94A
chains in the Genus database with same CATH topology
1LO6A 4TPIZ 1LKBA 2BLVA 4WMEA 4ABIA 1VCPA 2ZPSA 1EXFA 1SG8B 1SGIB 1K9OE 1OYQA 4BTTB 2A2QH 4K8YA 1Q2WA 1HB0B 2SGEE 2TGPZ 3B9FH 1YLDA 1HDTH 3MH4A 3WY8A 1GI3A 1DLEA 1TE0A 1Y3UA 1SFQB 1ZGIA 1YKTA 3FVFB 4DW2U 3D65E 2I6SA 3T29A 4DG4A 5A8YA 3V0XA 4CRFA 3RXOA 1DVAH 1PPHE 2PKSC 1AUTC 2G00A 4INLA 1C5MD 3W95A 1C5VA 1W14U 4LZ4B 1Z1IA 1P10A 4KELA 4NSVA 1MAXA 2PTCE 1W0ZU 2ZEBA 3VXEH 3SNEA 2Q6DA 2OUAA 5SGAE 1HAHH 1HJAB 3KL6A 1W10U 5FX6A 1ZJKA 2G5NA 3QGJA 3P8OA 1EZXC 4OS7A 1W7XH 1LDTT 3MO3A 5JBTA 4FUJA 3OU0A 2A4RA 1O32A 1CO7E 3D23A 2P94A 1F7ZA 4UDWH 4AGJA 4HTCH 3RLWH 1FMGA 4IW4E 1C1UH 1UTKA 1AVGH 1H8DH 2CHAB 3U8RH 1RRKA 3E91A 1CQQA 4ABDA 3CP7A 4E06H 1V2TT 1UCYE 1SGPE 1TABE 3L3TA 1SHYA 1G3CA 2P3FH 2WUBA 3KQDA 3TK6A 1V2JT 2DE8A 3MNBA 1K1JA 1MMJN 1P03A 1BJUA 1TLDA 2BDGA 3VB6A 1A5GH 2F9BH 2ZG0H 1C2HA 4ABEA 2P59A 1EAXA 2STBE 3RC5A 4TWWA 4YT6H 1ZTKA 3GOVB 4I8HA 3ZZ5A 1RFNA 4H42U 2FDAA 2SGPE 2FOGA 1C2LA 1Z6JH 3PLPA 3MU5A 3KEEA 3LJJA 2TPIZ 1WTGH 2ZCKP 2B7DH 3LGIA 4YOIA 2PR3A 1SGCA 2ZGHA 1TQ7B 5GWZA 2FI3E 5EQSA 1GBKA 1KLJH 1MAYA 1OYTH 2ZHQH 4XFQA 3TPIZ 3TNTA 3V13A 2GD4B 2ODPA 4O03A 5L2ZH 1GI2A 1JRSA 2ZA5A 1TYNA 2QA9E 4DCDA 1BITA 4A1TA 1QJ6B 1GBHA 1TBRH 4U01A 1C5WB 1H9HE 1RJXB 1J14A 1ELEE 1O3GA 1UK3A 2G81E 1Z7KA 1PYTD 4NZQA 3RXRA 2XWBI 3B8JA 4FUDA 1V2UT 1KXEA 2ZDMA 1GPZA 2NU2E 1SLUB 1SQTA 1O3LA 1OP0A 1MCTA 2A31A 2ZF0H 1BHXB 3T25A 2ZDNA 3RP2A 3ZZ3A 2A2XH 1J17T 2GVFA 3SUDA 8GCHG 3SUEA 2BD2A 4WMFA 3MFJA 1BTPA 3BTEE 4NG9H 2HPPH 2GCTB 2LNCA 4U32A 4IN2A 1O2JA 4ABGA 4AFUA 1BTYA 2R3UA 1C2IA 3GY7A 1G37A 1C5ZB 3DHKH 1O33A 2NU4E 3RXJA 5E8EH 2G8TA 3D62A 2JETB 1O5FH 1IQKA 1EAWA 2HPQH 2SGFE 3HGNA 1P04A 3GY5A 4INKA 2TGDA 1V2RT 4RKJB 3UTUH 1P2JA 1TA6A 2ZGCA 1O2PA 3QLPH 4VGCC 1TOCB 1J15A 4I7YH 2D1JA 1C2MA 4MQAA 3VEQB 2AFQB 2F9NA 1HAPH 2HALA 1BTXA 4JZFH 1O3DA 1P3CA 1O2TA 1AY6H 4Y10E 4K1EA 2QIQA 3O8CA 1Z71A 1C2FA 2BZ6H 3LPRA 5T3HA 2GTBA 2HRVA 1OP2A 2A32A 1KDQB 1F0UA 5C1XA 4MNWA 2AEIH 2GGVB 2QV1A 5HMAA 3RM2H 2CGAA 2ZWLH 4HGCA 1DS2E 3RXBA 3MMGA 1FAXA 1BB0B 1AMHA 2FXRA 3RC4A 1TAWA 2OP9A 1NRPH 3E0PB 2J95A 1KSNA 1PPZA 3CS7A 1EZQA 3TLOA 1UTOA 1YC0A 2FMJA 3ZYDA 3STJA 1ZRBA 1DXWA 3PO1B 4K5ZA 1L1NA 2FLRH 1W7GH 1P9UA 3MNXA 4JMYA 1GHZA 3L33A 5JPMH 1BMLA 2DUCA 3ZVCA 1CT4E 3SUFA 3VGCB 2OQUA 2H2ZA 3P6ZB 4GHQA 3UNSA 2AGIX 2BY7X 1Z8RA 3SOSA 4X2XA 1GG6C 1UK4A 1ZSJA 1ZTLA 2ZQ1A 2ZHEH 2ANKH 4WVPE 4D7FA 1HAGE 2Q6FA 4GCHF 1YPGH 4M7GA 1C2KA 2VU8E 1YPJH 3UOPA 1T32A 3EGKH 1S0QA 4A92A 3SV6A 1C5SA 1EZSC 1Y8TA 3RXKA 3ZZCA 2NWNA 1E0FD 3UWIA 2FOAA 1V2OT 3RXCA 2QCYA 3GCHC 2ZGBH 4KKDA 2QC2A 4JZIA 1D3QB 1Z6EA 3S69A 1LHFH 4GHTA 1AE5A 9LPRA 2V6NA 1GBCA 3SV9A 1FY8E 3P8GA 1YPHC 2GMTC 3K6YA 3SGBE 3DUXH 2NU3E 3A80A 3RMOH 1PPCE 3ZV8A 3D49H 2YOLA 3BN9A 1GMHG 1QRZA 1KTTB 5LGOA 1O2ZA 5DP8A 2J34A 2KAIA 1ANEA 4CBOA 1SL3A 1G3BA 1PQ7A 1NESE 3T2NA 4CBNA 3M35A 2FI5E 3S0NA 4Q7ZA 3O8RA 2ILNA 1AFQB 1EP6A 4MPXA 2ZU4A 3RXGA 3BTQE 3VXFH 1BRCE 1FZZA 1GI9B 4I31A 4UONA 4Q2KA 3FP8E 3RXDA 2OC0A 3A84A 2SNWA 1KXBA 4I8KA 1SGFA 1BHXF 4IGDA 3BTGE 5F8ZA 2ZC9H 3F9EA 1C4Y2 1C5OH 2H9TH 1V2LT 1O34A 5G4BA 1NS3A 3M37A 5FBIA 2W7SA 2PUQH 1HAXB 3DA9B 4F49A 2R3YA 1F5LA 3P70B 1F0SA 4Y0ZE 1QRXA 5LPEA 2RCEA 3RXEA 4K3JA 1CA8B 4UFFH 1IOEA 1QFKH 1C5RA 1NT1A 5TJXA 1GI1A 2QN5T 3OY5U 4PROA 1H1BA 1NY22 3OX7U 1GDUA 2F3CE 3IWMA 1JBUH 3SHCH 4CRAA 1GI6A 2HGTH 4BANB 1FUJA 1SGQE 1O2GH 2C8ZB 1ELVA 1O2LA 5EXMA 2P3TB 2GZ7A 1YF4A 1H9LB 3VB3A 1FJSA 2BD3A 5C2ZA 2ODYB 1H4WA 4ZROA 4NSYA 1NRRH 1CHOG 1C5XB 3BTHE 1LHEH 2AIQA 1ZZZA 4UFGH 1TIOA 3DFJA 2XYAA 4O3UA 1VJAU 2HLCA 1P3EA 1GHAG 2XRCA 2AGGX 1BMNH 3BEFB 5GIBA 2FS9A 1QQ4A 3ZVFA 1XUKA 1XXFA 1QB6A 1OSSA 1SGNE 4Y79A 3HK6B 3M61U 4ZH8A 4AB8A 1TGTA 2Z6BD 3HKJB 3W94A 1JOUB 3MOCA 1LKAA 5C5NA 1GGDB 4ESTE 1SGRE 2FYQA 1ACBE 4NA8A 1BT7A 1P2NA 2QXGA 1OS8A 4NCYA 2ASUB 2FOEA 4MPWA 1KDQA 1O39A 4ZXXH 1MKWK 1KXCA 1MH0A 4HZHA 4WXIA 1HBTH 3UQVA 2XXLA 3QWCH 1K1MA 2XBXA 2FOMB 1GVZA 1UCYH 3JZ1B 1HAVB 1HJ8A 3NPSA 1C2EA 2PV9B 4OS1A 1DICA 1C2JA 4X1PU 4ZKOU 1TNIA 4A1XA 5J4QA 1SHHB 1ANCA 1WBGB 1C1NA 2G4UA 4KTSA 2AS9A 2A5KA 2NU1E 3F9GA 4D9RA 2OQ5A 4B73A 2H5CA 2C4FH 2F9PA 2EI8A 2VVCA 1FAKH 4K1TA 1O3OA 4FU7A 3A7ZA 2A7HA 1GHBG 3GICB 2YNAA 1GHBF 2P3UB 2XBVA 4FUHA 2BMGB 4FU8A 5B6OA 3MI4A 3SNCA 2UWOA 2IOTA 2ZFFH 3SJOA 3UREA 2QXIA 2OD3B 5ETXA 2STAE 1V2WT 5T6FA 3BF6H 3F68H 2FTLE 3Q00A 2ZFSA 1NFYA 1AKSB 3SU3A 1BZXE 3KGPA 1HAYB 3MTYA 3HATH 1KLTA 1UCYK 4TWYA 5GXPA 2A5AA 1EAUA 2XC4A 2ZDAH 4INHA 2GX4A 1S6HA 4YZUA 2R0KA 5AVDA 4WXVA 1DLKB 4JK6A 3GDUA 8LPRA 3ZZAA 3KNXA 1EUFA 4UFEH 3T26A 2XBWA 1TGSZ 2PGBB 1CT2E 1BOQA 3SQHE 2AYWA 2AMPA 4CRDA 1SGYE 2SGQE 1L2EA 2A7JA 1QQUA 3MO6A 2JH6D 3GISB 1DSTA 1ELDE 2B8OH 3QX5H 1O5DH 4XBDA 3SNDA 2OBOA 2TBSA 2G4TA 3GCOA 1XUGA 2VIQA 2ZTXA 4LOYH 4BAHB 4ABJA 2TGAA 2BVXH 1NFWA 3GYMA 1UTJA 1ZMLA 5FCKA 1C1OA 1ESTA 5DP7A 2W7UA 3RMNH 3SO3A 3RXLA 2VVVA 1BTZA 1LCYA 1BRUP 1B0EA 2BY8X 2QXJA 2V35A 2WV5A 2ZO3H 3SN8A 3UPEA 1GHXH 2R2WU 1MBMA 1TFXA 2PW8H 5EOKA 4OGXA 5AF9H 1LVMA 3SBKA 1KLIH 2VIOA 2F9VA 2EI7A 3ODFA 1GJCB 1ZSKA 1RIWB 1Y3YA 5IDKA 1GBFA 1HJAC 1YPKH 4B2AA 1S81A 1EB1H 2PWXA 1DWCH 4UEHH 2RA0A 1P0SH 3ZVEA 3ATLA 1UVUH 1YCPK 2FWWA 2ALPA 1A0LA 2UWLA 3RUOA 2VWMA 3A8DA 5FCRA 1KXDA 3MH7A 1FY3A 1W11U 1EPTC 3KQBA 4U30A 1ZMNA 2P8OC 1LPGB 3ZZDA 1TMTH 3H7OA 3TVJB 3PB1E 2BLQA 1DWBH 3P8FA 2FODA 4UFDH 3PMBB 2EEKA 1IQHA 1GI7B 4ISOA 1C1SA 4JK5A 4B75A 5DG6A 3ELAH 2HNTE 1C9TA 2ZQ2A 3RXIA 3ZVBA 1GBEA 1Y5UT 2ZP0H 1ELFA 2ZPRA 1YPEH 1AD8H 3SU1A 2PKAA 1EATA 3TK5A 1EX3A 1GMDF 1ESBA 1EB2A 7GCHG 1G2LA 5FX5A 1O3KA 2Z3CA 3K9XB 2J4IA 1K22H 5AHGH 3SUGA 1IQIA 3GY8A 3QK1A 3BTTE 3E3TA 1V2NT 4OS2A 1FY1A 1TOMH 4TY7A 2ZHDA 2FS8A 1RGQA 1TRYA 1WYKA 4ISLA 3TITA 3NCLA 1NFXA 3PMHB 1C5TA 4ASHA 4O97A 4AG2A 1DXPA 1MBQA 3GCTG 2ZPQA 1QL8A 1CHGA 2F83A 2Q1JA 1K21H 4ZUHA 3OYPA 1ZPZA 1HLTH 1TX6A 5DO4H 4NA7A 2BVSH 1C5NH 1NTPA 2H1UA 3V3MA 3PWBA 1AIXH 1EZUC 1G3EA 1QRWA 5C5OA 1O3BA 1GI5A 2BX4A 3QDZB 2FYRA 1AUJA 1HJ9A 2OC7A 1AZ8A 1B5GH 5EW1H 3MYWA 1MU6B 3RXVA 3MO9A 1QTFA 2GT8A 2Y7ZA 2FX4A 1SGFG 1UHBB 1O3JA 1VITG 3VGCC 1YCPM 5E0JA 1O36A 1Q3XA 1JRTA 4ZKRU 3SU0A 1TPPA 1JWTA 1ZSLA 2XC0A 3LGWA 1P2IA 1ZPBA 4GVUA 2TIOA 2A7CA 1W13U 2GCHG 1OXGA 1A3BH 2BDAA 1O0DH 1TNGA 1XX9A 1GJ5H 2ZU3A 1SPJA 3A85A 1T4UH 3SU4A 2G51A 3PMAB 1FQ3A 1GDQA 5A8ZA 5AFZH 1IQGA 2ZU1A 1T8NA 2PFEA 3ATKA 2WPMS 4X2YA 2BDHA 2FTMA 1TBZH 1GJ8B 4WH6A 1LTOA 1G2MA 2VWOA 3BTME 1GCDA 1TRMA 1ZHPA 1Z8GA 3TNSA 1SGEE 1LHDH 1W0YH 3SV8A 2ZHWH 1RIWC 3FP6E 2WPLS 4YOGA 3SI3H 2CMYA 3ITIA 2BLWA 5DK1A 5C20A 5CE1A 1NC6A 2O8UA 1GJ9B 3JZ2B 2IN2A 1MQ5A 1ZPCA 2ULLA 4NIVA 3SGQE 2VH6A 4NFFA 1OX1A 3URCA 4CREA 1IQLA 1ELAA 1VITH 5EQQA 2Z3EA 1TONA 1A46H 3LONA 4Y76A 1CE5A 1T7CA 5EU8A 2FO9A 4NWKA 1EJMA 1M9UA 2GDEH 2PSXA 1YYY1 3QZQA 3V12A 2FP7B 1TQ0B 1V2ST 3MWIU 4CHAC 1O2UA 3A83A 2B5TB 3TJNA 2PKSB 3MHWU 1TGBA 3GCHB 3RXAA 1EAIA 4XBCA 1ETRH 3QN7A 3DT0H 4X1NU 2BY6X 2RDLA 2FX6A 1A1RA 4MTBA 2FESH 3A7YA 1RTLA 2Y5GA 3TIUA 4JZDH 4ZXYH 1O5AB 8KME2 1GBIA 2UUFB 4DIHH 3RXPA 4FVBA 4H6SB 2A1DB 1QA7A 1T8MA 3A7TA 5C3NA 4X6NA 1L0ZA 1O3NA 2BD8A 2I6QA 5IYTA 1BMMH 1E34B 1TNLA 4F4OC 2IJOB 1DX5M 4WY3A 1MUEB 3RU4D 5ESTE 3ESTA 4HFPB 4FUEA 2FOHA 2GCHF 3R0FA 3ZVGA 2P8OB 2DE9A 4XSKU 3RM0H 1AB9B 4BXWA 1BTUA 1NU7B 4I8JA 1XUFA 1D3TB 5FAHA 4AYVB 4D9QA 2A4GA 2VWLA 4WH8A 3M3SA 4CHAB 2Z9IA 1GJBB 5FPTA 3PTNA 3GDSA 1ANBA 3A87A 1TPAE 5LH8A 2BY9X 5AFYH 4DGJA 3S9BA 2BB4A 4FUGA 1LHCH 1UJ1A 1K28D 3EAJA 3VB5A 2XBYA 1O2XA 2TRMA 3UFAA 4DIIH 1Y3XA 3A86A 2VGCB 1N8OC 3BIUH 3EE0B 1DUEA 1FIZA 1GMCF 3LGYA 1VITF 1CGIE 3TH3H 5DGJA 4CR5A 5E0HA 3HK3B 7ESTE 1BTHH 1N1LA 1T8LA 1TNHA 2ZU5A 1S85A 2V3OH 2UUJB 1D9IA 2BQ7B 2P95A 1GCTB 1P2MA 2C93B 1TPSA 5EODA 1XUHA 1KTSB 2HVXA 2C3SA 5DP9A 4AN7A 1DY9A 3FZZA 4LXBH 2D8WA 3E16B 2ZFRH 4Y0YE 4Z0KA 1A5IA 3NZIA 2XNIA 1EOLA 4MNXA 2BVRH 1GCTC 1OP8A 2ZGJA 2CHAC 1L1GA 1GJ7B 4ABFA 1O5EH 1SI5H 3Q3XA 1HFDA 5DP5A 3ZZ4A 4R0IA 3ATMA