3AAUA

Bovine beta-trypsin bound to meta-diguanidino schiff base copper (ii) chelate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the design of novel Schiff base metal chelate inhibitors of trypsin
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aauA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aauA02
1MKXH 3KGPA 2Z3DA 1F5KU 4ZMAH 3SNAA 1TALA 4RSPA 1AHTH 1TPAE 2G4TA 1NC6A 1PFXC 2PKSB 2ZCHP 3CENA 1CA8B 5C67A 1C2JA 1EXFA 1ZRKA 3GCTF 1O35A 1ZPZA 2ALPA 5EXMA 3WY8A 2DE9A 1MD8A 1SGFA 1QR3E 1TGBA 1SB1H 4K60A 2VVCA 5FPYA 4I31A 2SGDE 2ZTYA 4XSKU 2F9VA 1AO5A 2FTLE 2XWAA 3PV4A 1YPKH 1TOCB 3GCNA 2Y82A 5T6DA 4B75A 4ZHAA 1EOLA 3MHWU 1HAXB 2A1DB 3SJIA 3MU4A 2VIDA 4UE7H 1EQ9A 7GCHG 3SI3H 3D23A 1O33A 4NCYA 5GJ4B 2ZFPH 4A1XA 2ZPQA 3PB1E 4UFEH 1SVPA 1UMAH 3SV9A 1BA8B 4NIWA 2CHAC 3SGQE 3R0FA 2BD5A 1QFKH 2QF3A 1G3BA 3VPKA 1J17T 2QXJA 2K1QA 2VIVA 1BTWA 1ZYOA 1IQFA 1O5FH 1UTJA 1BMNH 5A8ZA 3GY8A 1NRNH 2F9NA 2H2ZA 4I7YH 1MQ6A 2ODQA 1GG6B 1GHVH 4H6TA 1ELVA 4J2YB 3W95A 3A85A 2BTCE 2ZGJA 3R3GB 5FBIA 5DP4A 3RMOH 3ZV8A 2GGVB 3STJA 1XXFA 1BRAA 5E0JA 5EW2H 1JRSA 4FUEA 4OS1A 3V7TA 1BB0B 4K5ZA 2C8ZB 2XBYA 3SOSA 6GCHF 1ZSKA 1FI8A 2P8OB 1V2JT 1YPHC 1Y5BT 1GMHF 1RRKA 3FP8E 1LKAA 1A3EH 1IQKA 2UWLA 2ZHWH 1DITH 4KTCA 5HXFA 4AFZA 3NZIA 2HNTF 3M3SA 2HVXA 1GMCG 2HALA 4Z0KA 3L33A 1O3BA 3KEEA 1DM4B 1VGCB 1ZRBA 2G51A 2ODPA 4WMEA 2WPJS 4E06H 4IN1A 5DP9A 4BANB 1NU9A 3RMNH 3F1SB 1QGFA 3MH5A 1TGTA 1V2PT 3UY9A 1H4WA 1AVGH 4DIIH 1GBCA 4YT6H 5FPTA 3QLPH 4FUBA 3A8DA 3UFAA 4GCHF 1SGYE 2P59A 4UFDH 4YTAA 1MTNC 2C8YB 4X8SH 1C2DA 2BY8X 1TLDA 1AN1E 3P92A 2ZZUH 6ESTA 1ZR0A 5DG6A 1CO7E 1WV7H 1ZLRA 2QCYA 1EZQA 3EQ0H 2F91A 3MWIU 3BV9B 3GYMA 1BDAA 1Y59T 4DCDA 1HUTH 1F7ZA 1V2QT 1RXPA 2GT7A 3RXHA 1LMWB 3H5CB 1LVMA 5EOKA 4ISHH 1GCTB 4OGXA 1KDQB 1NY22 1OPHB 2NU2E 1O31A 1UVPA 2FEQH 3LGIA 3U8OH 3UNSA 1NRQH 2GZ8A 3SU0A 4X8UH 3LH1A 4ZKRU 4CH2B 3OYPA 4X1QU 1WTGH 3P8GA 3I77A 2BD2A 2F9UA 2FO9A 1UVUH 3RXDA 1P2QA 1S85A 3SUGA 1QQUA 3UR6A 2ZKSA 4YOJA 1NESE 1FIWA 2RDLA 5EQQA 2TGPZ 1O3PB 3GOVB 4FVBA 1N6XA 2YOLA 1MMJN 3AAUA 1SQOA 1QB1A 2J9NA 4ZXYH 1QHRB 1ZTLA 1O2MA 3ELAH 1HB0B 5TCAA 3RU4D 1GI7B 4THNH 2BD7A 3P6ZB 3BTDE 3CP7A 3OY6U 3GY2A 1E34B 1GJ9B 4KELA 1KY9A 1BJVA 1HPGA 1GJAB 2VIPA 4F49A 1HJ9A 4Y8XA 4IC6A 1JWTA 4X6PA 4MPWA 4GHQA 5ESTE 3P8OA 4Q7YA 1HAPH 3K6ZA 1DWDH 1C2FA 2STAE 4DJZB 1GI0A 4I8LA 2ZGBH 1HAHH 1NN6A 1W2KH 1O3AA 1F0RA 4ZHLU 2Q6DA 3MU5A 1SFIA 1KXFA 4TWWA 1A2CH 4H42U 1AB9B 1QY6A 2VH6A 2BHGA 1V2KT 2ZCKP 1CGJE 2Z3EA 1ANEA 5L30H 1CT4E 4K2YA 1KDQA 4CR5A 2P93A 1XM1A 2ANYA 2FOMB 5F03A 2H9HA 3P17H 1TGNA 1SGPE 1AD8H 1SPJA 2R0LA 5GIBA 1C9TA 1ELCA 1Z1JA 3PYHA 1UCYE 3PLKA 3RXSA 1PYTC 1ANDA 1F5RA 2SFAA 3VB4A 1GVLA 3M61U 2PUQH 1EAXA 1ACBE 1V2LT 1JXPA 2P3UB 2DE8A 1T32A 3LC5A 2BY9X 1PPCE 1NPMA 1GBIA 1VITH 3FFGA 2G52A 5HM9A 2TPIZ 1BMAA 1L4ZA 4WWYA 1O5BB 2NU0E 3M37A 2XXLA 5A0BA 4NFFA 1BBRH 1BUIA 1YGCH 1F0SA 4AYVB 1BTHH 4WH8A 2WPHS 3EGKH 1U6QA 3SV8A 3UNQA 1MUEB 2Y7ZA 3OU0A 4B1TA 1LQDB 2UWOA 1ZOMA 2BD9A 1RTFB 1W8BH 2F9PA 2Q6FA 1GBFA 1Z1IA 2VVUA 4K8YA 1ELEE 2AMQA 1O3KA 1AUTC 3BN9A 4Q7XA 4JMYA 1O5GH 2VWOA 3T27A 4Q7ZA 2CF9H 1C2KA 5LGOA 1GI1A 1QIXB 1YLCA 2IPHA 2FI5E 4BOHA 1HXEH 3TJVA 1FPHH 1KYNA 1FY5A 1T8LA 4B76A 3IITA 1SG8B 2C3SA 4QT8C 3LGVA 4GVUA 3TGKE 5EGMA 3GCOA 2XCFA 4Y6DA 4HZHA 6GCHG 1HIAB 4WMFA 1RJXB 1AFQB 2ZO3H 4ABDA 1C1TA 4NG9H 4U01A 2QA9E 1O2LA 3NUMA 1O2SA 1GHAF 3T5FH 2Y6TA 1X7AC 4NIXA 1YBWA 1MBQA 1WQSA 1CQQA 1GDQA 1OWEA 1AFEH 2GCTC 5PTPA 3TK5A 2A7HA 1V2MT 1ZSJA 2GZ9A 1ETRH 4INKA 2OXSA 1FV9A 1IHTH 5ETXA 5EQSA 2YNAA 2SGAA 2FZZA 2ZGHA 2THFB 3PO1B 4X2YA 1MTWA 2A45B 2H6MA 4X2VA 4I8JA 4R8TB 3ATMA 1SLUB 2XC0A 3RXCA 1KTTB 2BOKA 3ATIA 4B2BA 1MCVA 1OXGA 1O5DH 4Y11E 4ZKOU 2BLQA 1K1OA 1K2I1 2ASUB 1KLJH 1IQHA 1GJCB 1MKWK 2WUBA 2JKHA 3P70B 1O2IA 2G5VA 1AWHB 2FOEA 1ELTA 4K1SA 4PROA 2VH0A 3BTGE 4WF8A 4AFQA 1J9CH 4Q2KA 1BOQA 3A82A 1ARCA 3KF2A 4K69A 2ODYB 4LZ1H 1DWBH 5C5OA 2BYAX 4XDEA 3RC4A 2QGRA 1PPGE 2ZFFH 1T8NA 3TGJE 2BDYA 1THPB 4FUHA 3ZVBA 1EJAA 1MZDA 4D7GA 4J1YA 1O2RA 1C5LH 4BAMB 2BD8A 1K22H 2FTMA 4D9QA 2XC4A 1DANH 3MI4A 5G4BA 3QZQA 1HAGE 3GDSA 5LH8A 1GI9B 2RCEA 4UD9H 1A1RA 2J38A 2FOHA 2JETC 2SGPE 3TGIE 2HPPH 4YLUA 1Q2WA 3PLPA 4LZ4B 3E0PB 4I8GA 3PTBA 5A8XA 1LDTT 2BM2A 3NPSA 1PQ8A 3ZZ9A 2O8WA 1C5XB 2ZDVH 1BRCE 2QIQA 4OGYA 1A0HB 1XUJA 3RC6A 1NM6A 1DSUA 1T4UH 1C4Y2 3LPRA 1G30B 2BLOA 1OP2A 3GY4A 2GCHG 4RKOB 1O3HA 1LPGB 2BY7X 1Y8TA 2CN0H 1ANCA 3HKIB 4FU9A 1BRBE 3RM0H 4ISLA 3UWIA 5DP5A 1PPFE 3T25A 3MH6A 3QGNB 5JPMH 2BDHA 2HOBA 3A80A 4B74A 3MNCA 1MH0A 1ZMLA 2A5AA 1EPTB 3HK3B 2XCNA 1BT7A 2CV3A 3SORA 1DOJA 2ZHFH 3K6YA 3RLWH 1O37A 3SUDA 4JK5A 4CRFA 1D3TB 1YYY1 1GBLA 1QA0A 3PMBB 4YT7H 4LXBH 5A0AE 5F8TA 1XUFA 2I6QA 1UTMA 1KLTA 1RIWB 1P2NA 3U8TH 3AASA 4MNVA 1ELFA 4I8KA 1RIWC 5E0HA 3P8NA 1J15A 3T28A 1P03A 4WMDA 3KQBA 2FOBA 3RMMH 4UFGH 3JZ2B 1GJ4H 2H5DA 1ELGA 1Y3YA 1TFXA 2ZHQH 3ZZ8A 1AFQC 1A7SA 5B6OA 1HJAB 1TB6H 1BTYA 2A5IA 3EA8A 1HAYB 5L6NH 1ZHRA 4BAHB 1ETTH 2VGCC 5DGJA 4TYDA 9LPRA 2QXHA 1ZJDA 1LCYA 3Q76A 1AIXH 1VJAU 1Y3XA 1SFQB 2AMDA 1P2MA 2ZIQH 3SU6A 1MKXK 2NU3E 1UVTH 1P11E 4IW4E 1Z6EA 5F8ZA 1IAUA 1LHFH 1LPKB 1KXBA 1NTPA 1TBZH 3KCGH 5BRRE 4XOJA 2QAAA 2PHBA 3IWMA 1FN6A 2BVXH 3TIUA 1HDTH 4B73A 3E90B 1TBQH 1AGJA 1F5LA 1FY8E 1Z8IB 2A2XH 3A83A 3KN2A 3HGPA 4XBCA 1IOEA 2OQUA 1Y5UT 1PQ7A 1AZ8A 3S9AA 2HRVA 4HTCH 1HAIH 1OSSA 2PTNA 4FUCA 3ZZBA 1L0ZA 1OKXA 2TGTA 4ABJA 4A5TS 3S0NA 4BTUB 3BTKE 1O32A 1K1PA 1CT2E 1QJ7B 3E91A 3SJOA 3ZZ3A 5JYIA 5GCHF 1QB6A 2O8TA 3V0XA 1A46H 4IGDA 1K1JA 2FOGA 1FY3A 2ZFRH 3U1IB 1YCPK 1P01A 1YLDA 2Y5HA 1DLEA 2AERH 4YM9A 2EI7A 1AVWA 2SGQE 3BG4B 5L2YH 1EJNA 3GY6A 3Q77A 1C4V2 1WBGB 3RXOA 1GBBA 2BOHB 3UIRA 4NSVA 2AGIX 1FLEE 3LGTA 2AYWA 3TU7H 2JH5D 2H5CA 1XKAC 1P2KA 2PKAB 3KQCA 4AB9A 1H9LB 4JK6A 3SU4A 1EX3A 1V2OT 2R3UA 1GI4A 3MNBA 3SU1A 2Z6BD 3LJOA 2OTVA 4XBBA 4CREA 1BRUP 2XC5A 1GHAG 2AH4X 1FMGA 1G9IE 4MNWA 3EYDA 2GT8A 1O3NA 3G01A 2W7UA 1LVBA 3SHAH 2WV4A 2VVVA 1J16A 4ISOA 1WTHD 1QBOA 1S6HA 5BPEA 2SNVA 1GHWH 1UCYK 2Z7FE 4CBNA 2VWLA 3UQOA 8LPRA 5A2MH 4NA7A 4X8TH 3K9XB 2WV5A 1B0EA 3T62A 3DUXH 1C2GA 1C1PA 3NKKA 1YKTA 4JZDH 1O3LA 2GZ7A 1S82A 1C2HA 1GGDC 2ZDAH 1YPHE 1HV7A 2WPLS 1SHHB 1LTOA 1UK3A 4SGAE 3Q3YA 4CBOA 1XX9A 1DY8A 4AYYB 2R0KA 2W5EA 2BQ6B 4DURA 1LKBA 1TA6A 1QTFA 1ZMNA 2QV1A 3LIWA 1INCA 3IG6B 3QDZB 3PMHB 3RXJA 3TH2H 1XXDA 2C93B 1NS3A 2V35A 2ALVA 2PGQB 2Q1JA 1IQJA 3A8CA 4ABEA 2D26C 2XYAA 1V2UT 4FVDA 1DFPA 1P2OA 2BB4A 1EZUC 1EP5A 4D7FA 1C5RA 4INHA 4JCNA 4BXSA 3PO1C 1HLTH 2YNBA 4JZIA 2ZTXA 3M7QA 3BTHE 5DO4H 2ZFQH 4ISNA 1H1BA 1BBRE 2Y5FA 2F9BH 1C5UA 3S9BA 3ZZ4A 1C9PA 2W7SA 2Z94A 3F9FA 1GHYH 1C4U2 3P8FA 2XTTB 2Y7XA 3EDXB 2B0FA 2ZA5A 3BTEE 4DW2U 3M5OA 1RD3B 1J14A 2R3YA 1OX1A 2QN5T 4OS5A 1V2NT 1GMHG 4A6LA 3HATH 1BTXA 3U8RH 5DP7A 3M5NA 4NZLA 3TK6A 3LKWA 4R0IA 4B2CA 3BF6H 1DVAH 2GTBA 2VB0A 4WXIA 1SGRE 2FESH 2ILNA 4XE4A 3A81A 3L3TA 1FUJA 2J34A 2A0QB 1D6RA 3ZZ5A 4M7GA 2HLCA 3SV6A 1S81A 1TPPA 1C5WB 3BTTE 4H4FA 2GDDA 1OS8A 1W7GH 3MTYA 4ZAEA 2P94A 3TNTA 2P16A 1FN8A 2QXGA 1GI8B 5HYOA 1Y3UA 2PWXA 4UDWH 3B23B 1AI8H 3RXLA 2FYQA 1E36B 3ESTA 2ZHEH 1QURH 1SLXB 1TABE 1GJBB 5EPYA 1C5SA 1C2MA 1EJMA 1TPSA 3LGYA 5AF9H 2O8UA 4IS5A 1FPCH 1XUHA 2A7CA 2OP9A 2FMJA 1S83A 3TITA 4UONA 4WJG2 1N8OC 2VIQA 2ZCLP 4X8VH 1BTZA 1DICA 1SLVB 3ZZ7A 1IQNA 4A1VA 4H6SB 3U1JB 3GYLB 3ZVCA 1ZSLA 1O3MA 2PSXA 3E1XB 6LPRA 2O9QA 1YC0A 3ZZCA 3L6PA 1GMDF 5H4IB 2BDIA 3QTOH 2R2MB 2BVSH 1A3BH 3M7UA 3E16B 1UVSH 2G00A 7KMEH 4CRAA 2G8TA 1A4WH 3FANA 1L2EA 1CT0E 2SGEE 3QWCH 1LO6A 1MQ5A 2HNTE 2UUKB 3SHCH 4NFEA 2LNCA 1SLWB 1FAKH 3RXEA 1AKSB 4X1NU 4FU7A 9ESTA 3T2NA 1K1NA 1TGSZ 1W0ZU 3ENSB 4INLA 4WVPE 2ZF0H 4UFFH 5J4SA 4OS6A 1NO9H 2PTCE 1MD7A 1O3IA 1XMNB 2O8LA 3ZYEA 1EAUA 2P95A 2H9TH 1CA0C 1RGQA 1YPGH 3FZDA 4MPXA 1HAVB 4NIVA 1WSSH 1BBRK 3A7XA 1GVKB 1TBRH 3A86A 5FHTA 1PQ5A 1OYTH 1G3CA 4HI3A 5T6GA 2VGCB 3KQDA 3OSYA 3Q00A 5CMXH 2FP7B 2ESTE 3URDA 3BIUH 2ZEBA 3QGJA 4KKDA 5HGGA 1ELDE 2VU8E 2SGFE 4GCHG 3SU5A 5SGAE 4BNRA 1DWCH 3SW2B 1IQIA 1ANBA 3B8JA 4BTTB 4ZROA 4ABBA 1CBWB 3RXTA 1FDPA 3E3TA 4UEHH 4A7IB 2ZFTA 2FXRA 1J8AA 5C3NA 3TJUA 1GBAA 1UK2A 3HGNA 4I33A 1IHSH 2FWWA 2B7DH 2Q6GA 1GMCF 1KLIH 1O2UA 4XFQA 1Y5AT 3VEQB 2F83A 3GCHB 1KXCA 5ESBA 4FXGH 3Q3KA 5C1XA 1UJ1A 1G2LA 1NRRH 4JYVH 1O2ZA 1C5ZB 2GD4B 3RXBA 1A0LA 5DP6A 2BVRH 4E7NA 2VWNA 1L1NA 2PFEA 4NA8A 1OWKA 2ZQ1A 3TPIZ 2A4RA 1WCZA 2V3OH 1FJSA 1M9UA 1H8IH 3TNSA 2V3HH 1O30A 4ZKNU 3C1KA 5FAHA 1Z8GA 2ZU2A 4ISIH 1YCPM 5EU8A 3C27B 1EZXC 3UREA 3ATKA 1TMBH 2CGAA 4Y8YA 1K1MA 2QF0A 5AFZH 1CE5A 2A4GA 1V6DA 2Z9IA 2AEIH 5EXNA 1NFWA 2PKAA 1S0QA 1YM0A 2PSYA 3H7OA 1Q31A 1Z71A 3A7VA 1EOJA 1QB9A 3ZVAA 1V2ST 1BHXB 4VGCB 2CMYA 1GI3A 2BY5X 3HKJB 1GI6A 2BDBA 3RU4E 3UQVA 1ZPCA 1TX7A 1C5NH 2ZPSA 1BCUH 3LJJA 4DVAU 1PPBH 4MQAA 5DP8A 2GKVE 1D9IA 3PROA 4Y10E 3ITIA 1UHBB 4ASHA 1QBVH 1T31A 1O2QA 5C5NA 1S5SA 5CHAC 5E8EH 3SU2A 1V2WT 4KGAA 3UNRA 2GX4A 4Z6AH 1O2JA 3E8LA 4ZHMU 2V0BA 3UPEA 1P04A 1KXDA 2Z9JA 5C20A 1BTUA 3ATWA 1IQMA 1A5HA 1HNEE 1VCQA 1QCPA 3UUZA 3F9HA 2O8MA 2C90B 1GGDB 3STIA 5I46H 5AVDA 2IJOB 1HBTH 1D6WA 2A32A 1TNKA 1TRYA 6CHAC 3VXEH 5LPFA 3RXFA 3SV7A 2UWPA 1XUKA 5K7RA 1TNIA 1GMDG 2ZGCA 3QUMP 1ZJKA 3AW0A 1O0DH 3EAJA 2TIOA 4IMQA 3TLOA 5GDSH 1C5VA 2BLWA 4WH6A 2OC7A 1MU6B 1UTPA 1YPLH 3LOXA 4NWLA 1O2OA 2J92A 1D3DB 1NRSH 1GL1A 3T26A 1BHXF 1S84A 3SBKA 3MNSA 1TE0A 4DIHH 1VCWA 3GDUA 3E6PH 1XKBC 1DE7H 5JBBS 1UHBA 3PLBA 4E7RG 3BEUA 4WY3A 1V2VT 4KTSA 3RMLH 5I25A 1ESBA 1N1LA 2BQWB 1P0SH 3SGAE 1SR5C 1WU1A 1DY9A 1DUEA 1FZZA 2CF8H 2EI8A 4O3UA 1ABIH 1MTVA 3VB7A 1C2IA 3DFJA 3AAVA 2GMTB 1C5YB 5IYTA 1TIOA 1TOMH 4CHAC 2FIRH 3RDZA 3DFLA 1C2EA 2GDEH 5J4QA 2GVFA 3MYWA 3HK6B 2FODA 1DX5M 3MOCA 4NGAH 1MBMA 3SNEA 3FVFB 1MAYA 1GHZA 5GXPA 3AVZA 1SGDE 1TNJA 3F9GA 2NWNA 5FCKA 1VCPA 5FX5A 1V2TT 4CH8B 1PPZA 3BEIB 4CRCA 4NWKA 2WYJA 1GWAA 2OC1A 3QTVH 5L2ZH 1JRTA 3BSQA 1UTNA 1PJPA 1Z7KA 1F0UA 3V12A 1C1WH 1C1VH 2A4OA 2OINA 3GISB 1UVOA 2C8XB 4CRBA 1C1NA 5C1YA 1P05A 1SBWA 1SGNE 3M35A 1HAOH 1O2GH 1W10U 4KP0A 1O36A 5GCHG 1SGEE 3VB3A 3BEFB 1BQYA 2WINI 1O2YA 1OWHA 3Q3XA 2FS8A 2G4UA 5EW1H 3BG8A 3RXRA 2AIPA 1ZTKA 1OWJA 3RM2H 1O3JA 2LPRA 1G36A 1HFDA 1O3OA 4K8BA 1N8OB 2VWMA 3SJ8A 1TWXB 1G3DA 2XBXA 1C1SA 2PV9B 1O2VA 1TYNA 2AFQB 1SC8U 1TRNA 2BMGB 2W3IA 1EPTC 4AN7A 3A8AA 1XUIA 3KNXA 3BTFE 2BQ7B 4FUGA 1D3QB 1OP8A 1RFNA 4TY7A 1RTKA 4CR9A 3M5MA 1EPTA 3ZZDA 3UWJH 1LHDH 1QL7A 1SGFG 2JETB 1W13U 1PPHE 2OLGA 4B71A 1LVOA 3EA9A 4LK4A 2RA3A 2WPMS 2ZDKA 3LT3A 3KQEA 2WUCA 1DT2A 2C8WB 2P3TB 2ZDNA 1BIOA 2FLRH 4DGJA 3PMJA 2GCHF 1C2LA 2BZAA 2PLXA 3MNXA 2G55A 1TQ0B 4MDSA 3M3VA 1SQTA 1UTQA 1EB1H 2P3FH 3SV2H 4BTIB 4X1RU 2ZWLH 4DG4A 3RXKA 1NU7B 2PW8H 2VNTA 2Y80A 1O5AB 1TNHA 1O3FA 5AHGH 2FYRA 3BTWE 2GV6A 2ZG0H 1XUGA 1O3DA 5GWZA 1W7XH 2Z9LA 5JBCS 3ZVGA 2H9EH 1ABJH 1MU8B 1CHOG 5ABWA 1A5GH 2HPQH 3LGWA 2ZU5A 1QQ4A 1GJ6A 1TONA 1K1LA 1P9UA 1LQEA 3PM3A 1O2HA 1CHGA 2GMTC 2QYIA 1SI5H 3M5LA 4BAQB 3LH3A 1SHYA 2Z9KA 2A7JA 3QX5H 5K0HA 5TCCA 2FOCA 4GHTA 1DWEH 1UK4A 4NSYA 4FUFA 2Y81A 1DSTA 1V3XA 3FP6E 1TX6A 1F0TA 4I8HA 3M36A 5DP3A 1HJ8A 1V2RT 2VINA 2BXTH 4JZEH 3SI4H 4BXWA 2BD3A 1TAWA 5HMAA 3ODFA 3TH3H 4DY7B 4IC5A 1HGTH 1BZXE 1BTPA 1C1RA 1ARBA 2BY6X 3B9FH 3BTME 4Y79A 3ZVFA 3NCLA 5C2ZA 3O8DA 1WAYB 3MO6A 1EZSC 4Y7BA 4E05H 2ZC9H 1O2XA 4MNXA 2OBQA 2G5NA 5TJXA 1XVMA 1QRWA 1SGQE 1CSOE 1TNLA 1GPZA 4X2WA 1C1OA 5EQRA 2PGBB 1O39A 3KIDU 2B9LA 1VR1H 1W0YH 2A2QH 4VGCC 4D76A 2XWBI 4IMZA 1OYQA 3LGUA 2EC9H 2ZU1A 3RC5A 1IQEA 1AZZA 3ZYDA 1BMMH 3F6UH 3MH7A 4KTUA 1HAVA 1O38A 2VJ1A 3EE0B 4GPGA 5CHAB 3SU3A 1O34A 5F8XA 1H8DH 3S7KB 3RP2A 3ATLA 1YCPH 1UTOA 1Z8RA 3RU4T 1FY1A 1TMTH 1ID5H 4K3JA 5EPNA 3MU1A 3NXPA 3UTUH 1P57B 4MVNA 2ZTZA 3SNCA 1Z8JB 3VGCC 4WXVA 1XVOA 1GBEA 3OX7U 2FX6A 1DUAA 3TK9A 5LPRA 1JIMA 1N6YA 2ZNKH 2BXUH 2ANMH 2FPZA 4ESTE 1C5OH 2NU1E 2ANWA 3SNBA 1SMFE 1FY4A 1O2TA 5EG4A 1NFXA 1DDJA 1PQAA 1ELBA 3NK8A 1HRTH 2OQ5A 2G81E 1A5IA 3U69H 3A7YA 1T8MA 1O3EA 1HJAC 3LDXH 1QNJA 1YPMH 2FX4A 1FIZA 5FCRA 3S69A 2P8OC 4JYUH 1CA0B 4ZUHA 1GL0E 3ZVDA 1EP6A 1SGIB 1SL3A 3LU9B 2FOFA 1GBJA 1SGTA 3QN7A 1O3CA 4ZH8A 1LHGH 3F9EA 2HGTH 1S0RA 3RLYH 1O2NA 3RXGA 2TRMA 2Z9GA 3UOUA 1E0FD 5C1UA 1ZGIA 4NIYA 1QJ6B 5JB9S 1T8OA 1GJDB 3CS7A 1EASA 4B2AA 1C5MD 3K65B 3A7WA 1TQ7B 1HIAA 1EKBB 1MAXA 4YOIA 4ABAA 3I29A 2ZDMA 1EUFA 4X6OA 1QL9A 2GP9B 2C4FH 4IBLH 1AMHA 1P12E 3S7HB 3QK1A 1OOKB 4Y76A 1YP9A 4AB8A 1O5EH 1BMLA 1DXWA 3URCA 1DS2E 2TGAA 1LHCH 4AGKA 5A0CA 1GHBG 4OS4A 1DLKB 1ZTJA 3FP7E 1TX8A 4RN6A 4CHAB 3RXMA 5T6FA 2EA3A 1G37A 1NROH 4AORA 3SO3A 4YESB 2PUXB 1Z6JH 2FM2A 2TBSA 3DA9B 4OS7A 1BJUA 2AGEX 1ESAA 1AKSA 4MPVA 1B0FA 3H7TA 4D8NA 2WYGA 5E2OA 3RXPA 5HM2A 3VB6A 1GG6C 1C1QA 2VIWA 1LVYA 2RA0A 1G2MA 2KAIB 2QY0B 2DUCA 4AGJA 3A88A 1G32B 1NZQH 3TH4H 2FI4E 1D4PB 1GBKA 3V13A 3BG4C 1O2PA 1LPZB 4OS2A 2PKSC 3QO6A 3U9AH 4AOQA 4ABHA 1AE8H 1ETSH 3RUOA 2AGGX 5DJ7A 4GLYA 3S9CA 1SGCA 5A8YA 4AFSA 5A09A 2FDAA 4TPIZ 2CJIA 3GY3A 1TPOA 2GV7A 5AFYH 1PYTD 1KXAA 2FS9A 1MCTA 2BX4A 2KAIA 1THSH 1CGIE 2ANKH 1TNGA 1GI5A 1GJ8B 1GBDA 3EA7A 4U32A 4GSOA 1LHEH 3A8BA 2FI3E 5CE1A 2ZQ2A 1K1IA 2ZGXH 4O3TA 1JBUH 1GCDA 2ZPRA 4O97A 3TJNA 1MKWH 4X1PU 2QXIA 3BIVH 2J2UA 3M7TA 1L1JA 1QBNA 1WYKA 1NFUA 2UUFB 4Y0ZE 4AG1A 5E2PA 5FBEA 1F2SE 3GDVA 4YOGA 2ULLA 1CHOF 5IDKA 1F92A 3LONA 4AFUA 2J94A 2ZU3A 5GPIB 1P06A 1BITA 4X0WU 1OP0A 3I78A 2Z3CA 3VXFH 1ESTA 1MTNB 4AG2A 3VGCB 1NRPH 3RXAA 3UR9A 2A31A 3FZZA 1H9HE 1FAXA 4X2XA 1RTLA 2A5KA 5EODA 1AVXA 1HAZB 4JZ1A 3ZV9A 6CHAB 7ESTE 1JOUB 3F68H 3SJKA 5JDUB 3O8BA 1GBMA 1ZZZA 3PTNA 4FUIA 2RG3A 3DD2H 1MTUA 3GCTG 1ELAA 3KL6A 4YO9A 4MLFB 2AS9A 1DXPA 1GDUA 1K28D 1ZPBA 2AIQA 2EI6A 2HWLB 3SNDA 3MH4A 1K9OE 2AMPA 2ZU4A 2ZI2H 1O2KA 1THRH 1WQVH 3A7TA 4AX9H 1AE5A 2XBVA 1SQAA 4DT7B 1VGCC 1Q3XA 2EEKA 3M3TA 4ZKSU 1AU8A 4O9VA 3GICB 4HGCA 1QRZA 1MZAA 1KTSB 7LPRA 3SUFA 2TGDA 4XBDA 4X6NA 3DT0H 3TJOA 3V3MA 1QJ1B 2M5TA 2J4IA 4A1TA 3GCHC 1ZHPA 1P3EA 3ZZAA 1WUNH 1OWDA 1JMOH 1QL8A 2W26A 3DHKH 1HYLA 2B5TB 3A84A 7GCHF 1NFYA 3SQHE 3K2UA 5FPSA 1B5GH 3N7OA 1FONA 1W3CA 1EATA 2D1JA 2BDCA 3OY5U 4K1EA 2STBE 2ZFSA 4D9RA 1P2IA 3O8CA 2XW9A 1D3PB 1UCYH 2GCTB 2ZHDA 2QC2A 8ESTE 1GCTC 2OCVB 1CU1A 3RXQA 3MU0A 2XBWA 1SOTA 3SJ9A 1P10A 4K1TA 3HPTB 4X1SU 1CVWH 4BAKB 1P3CA 2IOTA 4A92A 4Q80A 1SSXA 2V6NA 1YPEH 1P2JA 4FUDA 1P02A 3MFJA 3PMAB 3RXVA 3PWCA 1A0JA 2Y5GA 3FAOA 2J95A 4GUXA 4YLQH 1T7CA 3RXIA 3GY7A 1WOFA 3AW1A 1GBHA 4ABGA 4SGBE 1VZQH 4Y0YE 1UO6A 3LC3A 4Y71A 5LPEA 2R2WU 2WPIS 3P95A 1L4DA 4CRDA 3VFEA 2CXVA 2FOAA 1AWFH 1DPOA 1GBTA 3D65E 4CRGA 1P9SA 4MNYA 2D8WA 2FLBH 3VB5A 2A4QA 1TMUH 1E37B 2XRCA 5FX6A 1IQLA 2SNWA 1S6FA 2BDAA 5DKMA 2JH0D 1TGCA 1VITF 1ZHMA 4MG3A 1GDNA 1GI2A 4LOYH 3PWBA 1AB9C 2H1UA 2OC0A 2BX3A 1GJ7B 1HXFH 3SN8A 1W12U 1QA7A 2CHAB 1OWIA 5E0GA 1C5PA 1EAWA 1NT1A 2F3CE 1B7XB 1T4VH 4GAWA 4U2WA 2BD4A 1O5CB 3MO3A 1AUJA 3A87A 2OBOA 1O2WA 5T3HA 1VJ9U 3NWUA 2UUJB 4DOQA 5FXLA 4MTBA 1HCGA 1YF4A 1GVZA 3T29A 2BDGA 1Y3VA 2ZP0H 1UTKA 2W3KA 3A89A 2NU4E 3ODDA 4U30A 2WPKS 3OTJE 1C1MA 1EB2A 4HFPB 4JZFH 2UUYA 1QRXA 3MMGA 2F9OA 3E0NB 4MPUA 4BAOB 3ZVEA 2OD3B 3ZZ6A 1ORFA 3D49H 1MTSA 1Y3WA 1C5TA 1KXEA 2HNTC 1FXYA 4ABIA 4I32A 3D62A 1H9IE 1P09A 1KIGH 4FUJA 3O8RA 4JYTA 1KSNA 1ZMJA 3SGBE 3SUEA 4AZ2B 1C1UH 3KHVA 5F6MA 1E35B 3W94A 1O3GA 1UTLM 1ZGVA 4NA9H 3MO9A 4TY6A 4TWYA 3CS0A 5DK1A 2JH6D 1TA2A 1EAIA 5EXLA 1RS0A 5JB8S 3BTQE 4RKJB 3TVJB 2BLVA 1FNIA 1CBWC 3SQEE 8GCHG 4Y8ZA 2BZ6H 4FU8A 2VIOA 1K21H 3QZRA 1P8VC 2ZDLA 3SZNA 2I6SA 1W14U 4NZQA 1GHBF 4X6MA 8GCHF 3GY5A 3A7ZA 3UOPA 4ZXXH 1C5QA 1FQ3A 5JBTA 1SOZA 8KME2 1TRMA 4IN2A 2D2DA 4O03A 5DPAA 2B8OH 1VITG 4F4OC 1GJ5H 1E38B 1AY6H 3U98H 5JBAS 4ABFA 1PPEE 2OC8A 2PR3A 1AQ7A 1A61H 1G3EA 4TPYA 2ZECA 3JZ1B 3MU8A 1L1GA 1YPJH 4Y7AA 1GHXH 2OUAA 4YZUA 1CGHA 2IN2A 1JIRA 3RXUA 1W11U 1IQGA 2R9PA 2XNIA
chains in the Genus database with same CATH superfamily
1MKXH 3KGPA 2Z3DA 1F5KU 4ZMAH 3SNAA 1TALA 4RSPA 1AHTH 1TPAE 2G4TA 1NC6A 1PFXC 2PKSB 2ZCHP 3CENA 1CA8B 5C67A 1C2JA 4ACBA 1EXFA 1ZRKA 3GCTF 1O35A 1ZPZA 2ALPA 5EXMA 3WY8A 2DE9A 1MD8A 1SGFA 1QR3E 1WXRA 1TGBA 1SB1H 2IPQX 4K60A 2VVCA 5FPYA 4I31A 2SGDE 2ZTYA 4XSKU 2F9VA 1AO5A 2FTLE 4TSFD 2XWAA 3PV4A 1YPKH 1TOCB 3GCNA 3F2FA 2Y82A 5T6DA 4B75A 4ZHAA 1EOLA 3MHWU 1HAXB 2A1DB 2JIZD 3SJIA 3MU4A 2VIDA 4UE7H 1EQ9A 7GCHG 3SI3H 3D23A 1O33A 4NCYA 2JJ2D 2ZFPH 5GJ4B 2ZPQA 4A1XA 3PB1E 4UFEH 1SVPA 1UMAH 3SV9A 1BA8B 4NIWA 2CHAC 3SGQE 3R0FA 2BD5A 1QFKH 2QF3A 1G3BA 3VPKA 1J17T 2QXJA 2K1QA 2VIVA 1BTWA 1ZYOA 1IQFA 1O5FH 1UTJA 1BMNH 5A8ZA 3GY8A 1NRNH 2F9NA 2H2ZA 4I7YH 1MQ6A 2J5UA 2ODQA 1GG6B 1GHVH 4H6TA 1ELVA 4J2YB 3W95A 3A85A 2BTCE 2ZGJA 3R3GB 5FBIA 5DP4A 3RMOH 3ZV8A 2GGVB 3STJA 5KEDA 1XXFA 1BRAA 5E0JA 5EW2H 1JRSA 4FUEA 4OS1A 3V7TA 1BB0B 4K5ZA 2C8ZB 2XBYA 3SOSA 6GCHF 1ZSKA 1FI8A 2P8OB 1V2JT 1YPHC 2WSSD 1Y5BT 1GMHF 1RRKA 3FP8E 1LKAA 2W6JD 1A3EH 1IQKA 2KCOA 2UWLA 2ZHWH 1DITH 4KTCA 5HXFA 4AFZA 3NZIA 2HNTF 3M3SA 2HVXA 1GMCG 2HALA 4Z0KA 1W0JD 3L33A 1O3BA 3KEEA 1DM4B 1VGCB 1ZRBA 2G51A 2ODPA 4WMEA 2WPJS 4E06H 4IN1A 5DP9A 4BANB 1NU9A 3RMNH 3F1SB 1QGFA 3MH5A 1TGTA 1V2PT 3UY9A 1H4WA 1AVGH 4DIIH 1GBCA 4YT6H 5FPTA 3QLPH 4FUBA 3A8DA 3UFAA 4GCHF 1SGYE 2P59A 4UFDH 4YTAA 1MTNC 2C8YB 4X8SH 1C2DA 2BY8X 1TLDA 1AN1E 3P92A 2ZZUH 4Q4LA 6ESTA 1ZR0A 5DG6A 1CO7E 1WV7H 1ZLRA 2QCYA 1EZQA 3EQ0H 2F91A 3MWIU 3BV9B 3GYMA 1BDAA 1Y59T 4DCDA 1HUTH 1F7ZA 1V2QT 1RXPA 2GT7A 3RXHA 1LMWB 3H5CB 1LVMA 5EOKA 4ISHH 1GCTB 4OGXA 1KDQB 1NY22 1OPHB 2NU2E 1O31A 1UVPA 2FEQH 5HKKD 3LGIA 3U8OH 3UNSA 1NRQH 2GZ8A 3SU0A 4X8UH 3LH1A 4ZKRU 4CH2B 3OYPA 4X1QU 1WTGH 3P8GA 3I77A 2BD2A 2F9UA 2FO9A 1UVUH 3RXDA 1P2QA 1S85A 3SUGA 1QQUA 3UR6A 2ZKSA 4YOJA 1NESE 1FIWA 2RDLA 5EQQA 4I86A 2TGPZ 1O3PB 3GOVB 2QF5A 4FVBA 1N6XA 2YOLA 1MMJN 3AAUA 1SQOA 2LP6A 1QB1A 2J9NA 4ZXYH 1QHRB 1ZTLA 1O2MA 3ELAH 1HB0B 5TCAA 3RU4D 1GI7B 4THNH 2BD7A 3P6ZB 1NBME 3BTDE 3CP7A 3OY6U 3GY2A 1E34B 1GJ9B 4KELA 1KY9A 1BJVA 1HPGA 1GJAB 2VIPA 4F49A 1HJ9A 4Y8XA 4IC6A 1JWTA 4X6PA 4MPWA 4GHQA 5ESTE 3P8OA 4Q7YA 1HAPH 3K6ZA 1DWDH 2J98A 1C2FA 2STAE 4DJZB 1GI0A 4I8LA 2ZGBH 1HAHH 1NN6A 1W2KH 1O3AA 1F0RA 4ZHLU 2Q6DA 3MU5A 1SFIA 1KXFA 4TWWA 1A2CH 4H42U 1AB9B 1QY6A 2VH6A 2BHGA 1V2KT 2ZCKP 1CGJE 2Z3EA 1ANEA 5L30H 1CT4E 4K2YA 1KDQA 3VG8A 4CR5A 2P93A 1XM1A 2ANYA 2FOMB 5F03A 2H9HA 3P17H 2J98B 1TGNA 1SGPE 1AD8H 1SPJA 2R0LA 5GIBA 1C9TA 1ELCA 1Z1JA 3PYHA 1UCYE 3PLKA 3RXSA 1PYTC 1ANDA 1F5RA 2SFAA 3VB4A 1GVLA 3M61U 2PUQH 1EAXA 1ACBE 1V2LT 1JXPA 2P3UB 2DE8A 1T32A 3LC5A 2BY9X 1PPCE 1NPMA 1GBIA 1VITH 3FFGA 2G52A 5EJLA 5HM9A 2TPIZ 1BMAA 1L4ZA 4WWYA 1O5BB 2NU0E 2WHXA 3M37A 2XXLA 5A0BA 4NFFA 5F53A 1BBRH 1BUIA 1YGCH 1F0SA 4AYVB 1BTHH 4WH8A 2WPHS 3EGKH 1U6QA 3SV8A 3UNQA 1MUEB 2CK3D 2Y7ZA 2HLDD 3OU0A 4B1TA 1LQDB 2Q6FA 2UWOA 1ZOMA 1RTFB 1W8BH 2BD9A 2F9PA 1GBFA 1Z1IA 2VVUA 4K8YA 2RDEA 1ELEE 2AMQA 1O3KA 1AUTC 3BN9A 4Q7XA 4JMYA 1O5GH 2VWOA 3T27A 4Q7ZA 2CF9H 1C2KA 5LGOA 1GI1A 1QIXB 1YLCA 3FOAA 2IPHA 2FI5E 4BOHA 1HXEH 3TJVA 1FPHH 1KYNA 1FY5A 1T8LA 4B76A 3IITA 1SG8B 2C3SA 4QT8C 3LGVA 4GVUA 3TGKE 5EGMA 3GCOA 2XCFA 4Y6DA 4HZHA 6GCHG 1HIAB 3DSPA 4WMFA 1YY3A 1RJXB 1AFQB 3OEED 2ZO3H 5C94A 4ABDA 1C1TA 4NG9H 4U01A 2QA9E 1O2LA 3NUMA 1O2SA 1GHAF 3T5FH 2Y6TA 1X7AC 4NIXA 1YBWA 1MBQA 1WQSA 1CQQA 1GDQA 1OWEA 1AFEH 2GCTC 5B6LA 5PTPA 3TK5A 2A7HA 1V2MT 1ZSJA 2GZ9A 1ETRH 4INKA 2JJ1D 2OXSA 1FV9A 1IHTH 5ETXA 5EQSA 2YNAA 2SGAA 2FZZA 2ZGHA 4M9FA 2THFB 3PO1B 4X2YA 1MTWA 2A45B 2H6MA 4X2VA 4I8JA 4R8TB 3ATMA 1SLUB 2XC0A 3RXCA 1KTTB 2BOKA 3ATIA 4B2BA 1MCVA 1OXGA 1O5DH 4Y11E 4ZKOU 2BLQA 1K1OA 1K2I1 2ASUB 1KLJH 1IQHA 1GJCB 1MKWK 2WUBA 2JKHA 3P70B 1O2IA 2G5VA 1AWHB 2FOEA 1ELTA 4K1SA 4PROA 2VH0A 3BTGE 4WF8A 4AFQA 1J9CH 4Q2KA 1BOQA 3A82A 1ARCA 3KF2A 4K69A 2ODYB 4LZ1H 1DWBH 5C5OA 2BYAX 4XDEA 3RC4A 2QGRA 1PPGE 2ZFFH 1T8NA 5DSFA 3TGJE 2BDYA 1THPB 4FUHA 3ZVBA 1EJAA 1MZDA 4D7GA 5HIZA 4J1YA 1O2RA 1C5LH 4BAMB 2BD8A 1K22H 2FTMA 4D9QA 2XC4A 1DANH 3MI4A 5G4BA 3QZQA 1HAGE 2YMSC 3GDSA 5LH8A 1GI9B 2RCEA 4UD9H 1A1RA 2J38A 2SGPE 2FOHA 2JETC 3TGIE 2HPPH 4YLUA 1Q2WA 3PLPA 4LZ4B 3E0PB 4I8GA 2QE7D 3PTBA 5A8XA 1LDTT 2BM2A 3NPSA 1PQ8A 3ZZ9A 2O8WA 1C5XB 2ZDVH 1BRCE 2QIQA 4OGYA 1A0HB 1XUJA 3RC6A 1NM6A 1DSUA 1T4UH 1C4Y2 3LPRA 1G30B 4HG6A 2BLOA 1OP2A 3N7DA 3GY4A 2GCHG 4RKOB 1O3HA 1LPGB 2BY7X 1Y8TA 2CN0H 1ANCA 3HKIB 3WWBA 4FU9A 1BRBE 3RM0H 4ISLA 3UWIA 5DP5A 1PPFE 3T25A 3MH6A 3QGNB 2QF4A 5JPMH 2BDHA 3F0PA 2HOBA 3A80A 4B74A 3MNCA 1MH0A 1ZMLA 2A5AA 4YXWD 1EPTB 2VBCA 3HK3B 2XCNA 1BT7A 2CV3A 3SORA 1DOJA 2ZHFH 3K6YA 3RLWH 1O37A 3SUDA 4JK5A 4CRFA 1D3TB 1YYY1 1GBLA 1QA0A 3PMBB 4YT7H 4LXBH 5A0AE 5F8TA 1XUFA 2I6QA 1UTMA 1KLTA 1RIWB 1P2NA 4DT4A 3U8TH 3AASA 4MNVA 1OHHD 1ELFA 4I8KA 1RIWC 5E0HA 3P8NA 1J15A 3T28A 3AK5A 1P03A 4WMDA 3EE7A 3KQBA 2FOBA 3RMMH 4UFGH 3JZ2B 1GJ4H 2H5DA 1ELGA 1Y3YA 1TFXA 2ZHQH 3ZZ8A 1AFQC 1A7SA 5B6OA 1HJAB 1TB6H 1BTYA 2A5IA 3EA8A 1HAYB 5L6NH 1ZHRA 4BAHB 1ETTH 2VGCC 5DGJA 4TYDA 9LPRA 2QXHA 1ZJDA 1LCYA 3Q76A 1AIXH 1VJAU 1Y3XA 1SFQB 2AMDA 1P2MA 2ZIQH 1NBMD 3SU6A 1MKXK 2IJD1 2NU3E 1UVTH 1P11E 3WW7A 5IK2D 4IW4E 1Z6EA 5F8ZA 1IAUA 1E1QD 1LHFH 1LPKB 1KXBA 1NTPA 1TBZH 3KCGH 5BRRE 4XOJA 2QAAA 2PHBA 3IWMA 1FN6A 2BVXH 3TIUA 1HDTH 4B73A 3E90B 1TBQH 1AGJA 1F5LA 1Z8IB 1FY8E 2A2XH 3A83A 3KN2A 3HGPA 3PV2A 4XBCA 1IOEA 2OQUA 1Y5UT 1PQ7A 1AZ8A 3S9AA 2HRVA 4HTCH 1HAIH 1OSSA 2PTNA 4FUCA 3ZZBA 1L0ZA 2V3MA 1OKXA 2TGTA 4ABJA 4A5TS 3S0NA 4BTUB 3BTKE 1VKYA 1O32A 1K1PA 1CT2E 1QJ7B 3E91A 3SJOA 3ZZ3A 5JYIA 5GCHF 1QB6A 2O8TA 3V0XA 1A46H 4IGDA 1K1JA 2FOGA 1FY3A 3WWFA 2ZFRH 3U1IB 1YCPK 1P01A 1YLDA 2Y5HA 1DLEA 2AERH 4YM9A 2EI7A 1AVWA 2AHME 2SGQE 3BG4B 5L2YH 1EJNA 3GY6A 3Q77A 1C4V2 1WBGB 1YWUA 3RXOA 1GBBA 2BOHB 3UIRA 4NSVA 2AGIX 1FLEE 3LGTA 2AYWA 3TU7H 2JH5D 2H5CA 1XKAC 1P2KA 2PKAB 3KQCA 4AB9A 4Z1MD 1H9LB 4JK6A 3SU4A 1EX3A 1V2OT 2R3UA 1GI4A 3MNBA 3SU1A 2Z6BD 3LJOA 2OTVA 4XBBA 4CREA 1BRUP 2AH4X 1GHAG 2XC5A 4P02A 1FMGA 1G9IE 4MNWA 3EYDA 3ZIAD 2GT8A 4Q63A 1O3NA 3G01A 2W7UA 1LVBA 3SHAH 2WV4A 2VVVA 1J16A 4ISOA 1WTHD 1QBOA 1FX0B 1S6HA 5BPEA 2SNVA 1H8ED 1GHWH 1UCYK 2Z7FE 4CBNA 2VWLA 3DCLA 3UQOA 8LPRA 5A2MH 4NA7A 4X8TH 3K9XB 2WV5A 1B0EA 3T62A 3DUXH 1C2GA 1C1PA 3NKKA 1YKTA 4JZDH 1O3LA 2GZ7A 1S82A 1C2HA 1GGDC 2ZDAH 1YPHE 1HV7A 2WPLS 1SHHB 1LTOA 1UK3A 4SGAE 2V7QD 3Q3YA 4CBOA 1XX9A 1DY8A 4AYYB 2R0KA 2W5EA 2BQ6B 5FL7D 4DURA 1LKBA 1TA6A 1QTFA 1ZMNA 2KM0A 2QV1A 3SYJA 3LIWA 3KYFA 1INCA 3IG6B 3QDZB 3PMHB 3RXJA 3TH2H 1XXDA 4F48B 4F55A 2C93B 1NS3A 2V35A 2ALVA 2PGQB 2Q1JA 1IQJA 3A8CA 4ABEA 2K8IA 2D26C 1V2UT 2XYAA 4FVDA 1DFPA 1P2OA 2BB4A 1EZUC 1EP5A 4D7FA 1C5RA 3CNRA 4INHA 4JCNA 4BXSA 3PO1C 1HLTH 2YNBA 4JZIA 2ZTXA 3M7QA 3BTHE 5DO4H 2ZFQH 4ISNA 1H1BA 1BBRE 2Y5FA 2F9BH 4RT1A 1C5UA 3S9BA 2F43B 3ZZ4A 1C9PA 2W7SA 2Z94A 3F9FA 1GHYH 1C4U2 2L74A 3P8FA 2XTTB 2Y7XA 3EDXB 2B0FA 2ZA5A 3BTEE 4DW2U 3M5OA 2R3YA 1RD3B 1J14A 1OX1A 2QN5T 4OS5A 1V2NT 1GMHG 4A6LA 3HATH 1BTXA 3U8RH 5DP7A 3M5NA 4NZLA 3TK6A 5C0UA 3LKWA 4R0IA 4B2CA 3BF6H 1DVAH 2GTBA 2VB0A 3F0OA 4WXIA 1SGRE 2FESH 2ILNA 4XE4A 3A81A 3L3TA 1FUJA 2J34A 2A0QB 1D6RA 3ZZ5A 4M7GA 2HLCA 3SV6A 2XOKD 1S81A 1TPPA 1C5WB 2YMSB 3BTTE 4H4FA 2GDDA 1OS8A 1W7GH 3MTYA 4ZAEA 2P94A 3TNTA 2P16A 1FN8A 2QXGA 1GI8B 5HYOA 1Y3UA 2PWXA 4UDWH 3B23B 1AI8H 3RXLA 2FYQA 1E36B 3ESTA 2ZHEH 1QURH 1SLXB 2EY4C 1TABE 1GJBB 5EPYA 1C5SA 1C2MA 1EJMA 1TPSA 3H09A 3LGYA 5AF9H 2O8UA 4IS5A 1FPCH 1XUHA 2A7CA 2OP9A 2FMJA 1S83A 3TITA 4UONA 4WJG2 1N8OC 2VIQA 2ZCLP 4X8VH 1BTZA 1DICA 1SLVB 3ZZ7A 1IQNA 4A1VA 4H6SB 3U1JB 3GYLB 3ZVCA 1ZSLA 1O3MA 2PSXA 3E1XB 6LPRA 1E79D 2WV9A 2O9QA 1EFRD 1YC0A 3ZZCA 3L6PA 1GMDF 5H4IB 2BDIA 3QTOH 2R2MB 2BVSH 1A3BH 3M7UA 3E16B 1UVSH 2HVYB 2G00A 3MQKC 7KMEH 4CRAA 2G8TA 1A4WH 3FANA 1L2EA 1CT0E 2SGEE 3QWCH 1LO6A 1MQ5A 2UUKB 2HNTE 3SHCH 4NFEA 2LNCA 1SLWB 1FAKH 3RXEA 1AKSB 2XNIA 3F2GA 2PP6A 4X1NU 4FU7A 9ESTA 3T2NA 1K1NA 1TGSZ 1W0ZU 3ENSB 4INLA 4WVPE 2ZF0H 4UFFH 5J4SA 4OS6A 1NO9H 2PTCE 1MD7A 1O3IA 1XMNB 2O8LA 3ZYEA 1EAUA 2P95A 2H9TH 1CA0C 1RGQA 1YPGH 3FZDA 4MPXA 1HAVB 4NIVA 1WSSH 1BBRK 3A7XA 1GVKB 1TBRH 3A86A 5FHTA 1PQ5A 1OYTH 1G3CA 4HI3A 5T6GA 2VGCB 3KQDA 3OSYA 3Q00A 5CMXH 2FP7B 2ESTE 3OAAD 3URDA 3BIUH 2ZEBA 3QGJA 4KKDA 5HGGA 1ELDE 2VU8E 2SGFE 4ACAA 4GCHG 3SU5A 5SGAE 4FOUC 4BNRA 1DWCH 3SW2B 1IQIA 1ANBA 3B8JA 4BTTB 4ZROA 4ABBA 1CBWB 4ASUD 3RXTA 1FDPA 3E3TA 4UEHH 4A7IB 2ZFTA 2FXRA 1J8AA 5C3NA 3TJUA 1GBAA 1UK2A 3HGNA 4I33A 1IHSH 2FWWA 2B7DH 2Q6GA 1GMCF 1KLIH 1O2UA 4XFQA 1Y5AT 3VEQB 2F83A 3GCHB 1KXCA 5ESBA 4FXGH 3Q3KA 5C1XA 1UJ1A 4AC9A 1G2LA 1NRRH 4JYVH 1O2ZA 1C5ZB 2GD4B 3RXBA 1A0LA 5DP6A 2BVRH 4E7NA 2VWNA 1L1NA 2PFEA 4NA8A 1OWKA 2ZQ1A 3TPIZ 2A4RA 1WCZA 2V3OH 1FJSA 1M9UA 1H8IH 3TNSA 2V3HH 1O30A 4ZKNU 3C1KA 5FAHA 1Z8GA 2ZU2A 4ISIH 1YCPM 5EU8A 3C27B 1EZXC 3UREA 3ATKA 1TMBH 2CGAA 2LELA 4Y8YA 2QF0A 5AFZH 3UB0A 1CE5A 2A4GA 1MABB 1V6DA 2Z9IA 2AEIH 5EXNA 1NFWA 2PKAA 1S0QA 1YM0A 2PSYA 3H7OA 1Q31A 1Z71A 3A7VA 1EOJA 1QB9A 5CDFE 3ZVAA 1V2ST 1BHXB 4VGCB 2CMYA 1GI3A 2BY5X 3HKJB 1GI6A 2BDBA 3RU4E 3UQVA 1ZPCA 1TX7A 1C5NH 2ZPSA 1BCUH 3LJJA 4DVAU 1PPBH 4MQAA 5DP8A 2GKVE 1D9IA 4XRNA 3PROA 4Y10E 3ITIA 1UHBB 4ASHA 1QBVH 1T31A 1O2QA 5C5NA 1S5SA 5CHAC 4RI0A 5E8EH 3SU2A 1V2WT 4KGAA 3UNRA 2GX4A 4Z6AH 1O2JA 3E8LA 4ZHMU 2V0BA 3UPEA 1P04A 1KXDA 2Z9JA 5C20A 1BTUA 3ATWA 1IQMA 1A5HA 1HNEE 1VCQA 1QCPA 3UUZA 3F9HA 5KECA 2O8MA 2C90B 1GGDB 3STIA 5I46H 5AVDA 2IJOB 1HBTH 1D6WA 2A32A 1TNKA 1TRYA 6CHAC 3VXEH 5CHBA 5LPFA 4OM9A 3RXFA 3SV7A 2UWPA 1XUKA 5K7RA 1TNIA 1GMDG 2ZGCA 3QUMP 2K0QA 1ZJKA 3AW0A 1O0DH 3EAJA 2TIOA 4IMQA 3TLOA 5GDSH 1C5VA 2BLWA 4WH6A 2OC7A 1MU6B 1UTPA 1E1RD 1YPLH 3LOXA 4NWLA 1O2OA 2J92A 1D3DB 1NRSH 1GL1A 3SZEA 3T26A 3F2HA 1BHXF 1S84A 3SBKA 3MNSA 1TE0A 4DIHH 1VCWA 3GDUA 3E6PH 1XKBC 1DE7H 2KCPA 5JBBS 1UHBA 3PLBA 4E7RG 3BEUA 4WY3A 1V2VT 4KTSA 3RMLH 5I25A 1ESBA 1UW7A 1N1LA 2BQWB 1P0SH 3SGAE 1SR5C 1WU1A 1DY9A 1DUEA 1FZZA 2CF8H 2EI8A 4O3UA 1ABIH 2KX4A 1MTVA 3VB7A 1C2IA 3DFJA 3AAVA 2GMTB 1C5YB 5IYTA 1TIOA 1TOMH 4CHAC 2FIRH 3RDZA 3DFLA 1C2EA 2GDEH 5J4QA 2GVFA 3MYWA 3HK6B 2FODA 1DX5M 3MOCA 4NGAH 1MBMA 3SNEA 3FVFB 1S6LA 1MAYA 1GHZA 5GXPA 3AVZA 1SGDE 1TNJA 3F9GA 2NWNA 5FCKA 1VCPA 5FX5A 1V2TT 4CH8B 1PPZA 3BEIB 4CRCA 4NWKA 2WYJA 1GWAA 2OC1A 3QTVH 5L2ZH 1JRTA 1W0KD 3BSQA 1UTNA 3OFND 1PJPA 1Z7KA 1F0UA 3V12A 1C1WH 1C1VH 2A4OA 2OINA 3GISB 1UVOA 2C8XB 4CRBA 1C1NA 5C1YA 2KCAA 1P05A 1SBWA 1SGNE 3M35A 1HAOH 1O2GH 1W10U 4KP0A 1O36A 5GCHG 3DSGA 5EIYA 1SGEE 3VB3A 3BEFB 1BQYA 2WINI 1O2YA 1OWHA 3Q3XA 2FS8A 2G4UA 5EW1H 3BG8A 3RXRA 2AIPA 1ZTKA 3OE7D 1OWJA 3RM2H 1O3JA 2LPRA 1G36A 1HFDA 1O3OA 4K8BA 5C17A 1N8OB 2VWMA 3FKSD 3SJ8A 1TWXB 2GJGA 1G3DA 3PRDA 1C1SA 2XBXA 2PV9B 1O2VA 1TYNA 2AFQB 1SC8U 1TRNA 2BMGB 2W3IA 1EPTC 4AN7A 2M2AA 3A8AA 1XUIA 3KNXA 3BTFE 2BQ7B 4FUGA 1D3QB 1OP8A 1RFNA 4TY7A 1RTKA 4CR9A 3M5MA 1EPTA 3ZZDA 3UWJH 1LHDH 1QL7A 1SGFG 2JETB 1W13U 1PPHE 2OLGA 5GNDA 4B71A 1LVOA 3EA9A 4LK4A 2RA3A 2WPMS 2ZDKA 3LT3A 3KQEA 1DT2A 2WUCA 2C8WB 2P3TB 2ZDNA 1BIOA 2FLRH 4DGJA 3PMJA 2GCHF 1C2LA 2BZAA 2PLXA 3MNXA 2G55A 1TQ0B 2JDID 4MDSA 3M3VA 1SQTA 1UTQA 1EB1H 2P3FH 3SV2H 4BTIB 4X1RU 2ZWLH 4ZCNA 4DG4A 3RXKA 1NU7B 2PW8H 3PRBA 2VNTA 2Y80A 2EQNA 1O5AB 1TNHA 1O3FA 5AHGH 2FYRA 3BTWE 2GV6A 2ZG0H 1XUGA 1O3DA 5GWZA 5DN6D 1W7XH 3DSOA 2Z9LA 5JBCS 3ZVGA 2H9EH 1ABJH 1MU8B 1CHOG 5ABWA 1A5GH 2HPQH 3LGWA 2ZU5A 1QQ4A 4XD7D 1GJ6A 1TONA 1SQRA 1K1LA 1P9UA 1LQEA 3PM3A 1O2HA 1CHGA 2GMTC 2QYIA 1SI5H 3M5LA 4BAQB 3LH3A 1SHYA 2Z9KA 2A7JA 3QX5H 5K0HA 5TCCA 2FOCA 4GHTA 1DWEH 1UK4A 4NSYA 4FUFA 2Y81A 1DSTA 1V3XA 3FP6E 1TX6A 1F0TA 4I8HA 3M36A 5DP3A 1HJ8A 1V2RT 2VINA 2BXTH 3OTPA 4JZEH 3SI4H 2BD3A 4BXWA 1TAWA 5HMAA 3ODFA 3TH3H 3OEHD 4DY7B 4IC5A 1HGTH 1BZXE 1BTPA 1C1RA 1ARBA 2BY6X 3B9FH 3BTME 4Y79A 3ZVFA 3UAIC 3NCLA 5C2ZA 3O8DA 1WAYB 3MO6A 3NRLA 1EZSC 4Y7BA 4E05H 2ZC9H 1O2XA 4MNXA 2OBQA 2G5NA 5TJXA 1XVMA 1QRWA 1SGQE 1CSOE 1TNLA 1GPZA 4X2WA 1C1OA 5EQRA 2PGBB 1O39A 3KIDU 2B9LA 1VR1H 1COWD 1W0YH 2A2QH 4VGCC 4D76A 2XWBI 4IMZA 1OYQA 3LGUA 2EC9H 2ZU1A 3RC5A 1IQEA 1AZZA 3ZYDA 1BMMH 3F6UH 3MH7A 4KTUA 1HAVA 1O38A 2VJ1A 3EE0B 4GPGA 5CHAB 3SU3A 1O34A 5F8XA 1H8DH 3S7KB 2L6OA 3RP2A 3ATLA 1YCPH 3KQ5A 1UTOA 1Z8RA 3RU4T 1FY1A 1TMTH 1ID5H 4K3JA 5EPNA 3MU1A 3NXPA 3UTUH 1P57B 4MVNA 2ZTZA 3SNCA 1Z8JB 3VGCC 4WXVA 1XVOA 1GBEA 3OX7U 2FX6A 1DUAA 3TK9A 5LPRA 1JIMA 1N6YA 2ZNKH 2BXUH 2ANMH 2FPZA 4ESTE 1C5OH 2NU1E 2ANWA 3SNBA 1SMFE 1FY4A 4B6EA 1O2TA 5EG4A 1NFXA 1DDJA 1PQAA 1ELBA 3NK8A 1HRTH 2OQ5A 2G81E 5T1VA 1A5IA 3GS9A 3U69H 3A7YA 1T8MA 1O3EA 1HJAC 3LDXH 1QNJA 1YPMH 2FX4A 1FIZA 5FCRA 3S69A 2P8OC 2F4LA 4JYUH 1CA0B 4ZUHA 1GL0E 3ZVDA 1EP6A 1SGIB 1SL3A 3LU9B 2FOFA 1GBJA 1SGTA 3QN7A 1O3CA 4ZH8A 1LHGH 3F9EA 2WPDD 2HGTH 1S0RA 3RLYH 1O2NA 3RXGA 2TRMA 2Z9GA 2KCYA 1E0FD 3UOUA 5C1UA 1ZGIA 4TT3D 4NIYA 1QJ6B 5JB9S 1T8OA 1GJDB 3CS7A 1EASA 4B2AA 1C5MD 3K65B 3A7WA 1TQ7B 1HIAA 1EKBB 1MAXA 4YOIA 4ABAA 3I29A 2ZDMA 1EUFA 4X6OA 1QL9A 2GP9B 2C4FH 1SKYE 4IBLH 1AMHA 1P12E 3S7HB 3QK1A 1OOKB 4Y76A 1YP9A 4AB8A 2W6ID 1O5EH 1BMLA 1DXWA 3URCA 1DS2E 2TGAA 1LHCH 4AGKA 5A0CA 1GHBG 4OS4A 1DLKB 1ZTJA 3FP7E 1TX8A 4RN6A 4CHAB 3RXMA 5T6FA 2EA3A 1G37A 1NROH 4AORA 3SO3A 4YESB 2PUXB 1Z6JH 2FM2A 2TBSA 3DA9B 4OS7A 1BJUA 2AGEX 1ESAA 3N7EA 1AKSA 4MPVA 5KGOA 1B0FA 3H7TA 4D8NA 2WYGA 5E2OA 3RXPA 5HM2A 3VB6A 1GG6C 1C1QA 1QZ8A 2VIWA 1LVYA 2RA0A 1G2MA 2KAIB 2QY0B 2DUCA 4AGJA 3A88A 1G32B 1NZQH 3TH4H 2FI4E 1D4PB 1GBKA 3V13A 1H8HD 3BG4C 1O2PA 1LPZB 4OS2A 2PKSC 3QO6A 1YLNA 3U9AH 4AOQA 4ABHA 1AE8H 1ETSH 3RUOA 2AGGX 5DJ7A 4GLYA 3S9CA 1SGCA 4B6FA 4AFSA 5A8YA 5A09A 2FDAA 4TPIZ 1K0HA 2CJIA 3GY3A 1TPOA 2GV7A 5AFYH 1PYTD 1KXAA 2FS9A 1MCTA 2BX4A 2KAIA 1THSH 1CGIE 2ANKH 1TNGA 1GI5A 1GJ8B 1GBDA 3EA7A 4U32A 4GSOA 1LHEH 3A8BA 2FI3E 5CE1A 2ZQ2A 1K1IA 2ZGXH 4O3TA 1JBUH 1GCDA 2ZPRA 4O97A 3TJNA 1MKWH 4X1PU 2QXIA 3BIVH 2J2UA 3M7TA 1L1JA 1QBNA 4FETA 1WYKA 1NFUA 2UUFB 4Y0ZE 4AG1A 5E2PA 5FBEA 1F2SE 3GDVA 4YOGA 2ULLA 1CHOF 5IDKA 1F92A 3LONA 4AFUA 2J94A 2ZU3A 3PV5A 1P06A 1BITA 5GPIB 5HIYA 3KYGA 4X0WU 1OP0A 2YMSD 3I78A 2Z3CA 3VXFH 1ESTA 1MTNB 4AG2A 1WDIA 3VGCB 1NRPH 3RXAA 3UR9A 2A31A 3FZZA 1H9HE 1FAXA 4X2XA 2RFKC 1RTLA 2A5KA 5EODA 1AVXA 1HAZB 4JZ1A 3ZV9A 6CHAB 7ESTE 1JOUB 3F68H 3SJKA 5JDUB 4P00A 3O8BA 1GBMA 1ZZZA 3PTNA 4FUIA 2RG3A 3DD2H 1MTUA 3GCTG 1ELAA 3KL6A 4YO9A 4MLFB 2AS9A 1DXPA 1GDUA 1K28D 1ZPBA 2AIQA 2EI6A 2HWLB 3SNDA 3MH4A 1K9OE 2J97A 2AMPA 2ZU4A 2ZI2H 1O2KA 1THRH 1WQVH 3A7TA 4AX9H 4RT0A 1AE5A 2XBVA 1SQAA 4DT7B 1VGCC 1Q3XA 2EEKA 3M3TA 4ZKSU 1AU8A 4O9VA 3GICB 4HGCA 1QRZA 1MZAA 1KTSB 7LPRA 3SUFA 2TGDA 4XBDA 4X6NA 3DT0H 3TJOA 3V3MA 1QJ1B 2M5TA 2J4IA 4A1TA 3GCHC 1ZHPA 1P3EA 3ZZAA 1WUNH 1OWDA 2WZQA 1JMOH 1QL8A 2W26A 3DHKH 1HYLA 2B5TB 3A84A 7GCHF 1NFYA 3SQHE 3K2UA 5FPSA 1B5GH 3N7OA 1FONA 1W3CA 1EATA 2D1JA 2BDCA 3OY5U 4K1EA 2STBE 2ZFSA 4D9RA 1P2IA 3N99A 3O8CA 2XW9A 1D3PB 1UCYH 5EJZA 2GCTB 2ZHDA 2QC2A 8ESTE 1GCTC 2OCVB 5C0TA 1CU1A 3RXQA 3MU0A 2XBWA 1SOTA 3SJ9A 1P10A 4K1TA 3HPTB 4X1SU 1CVWH 4BAKB 1P3CA 2IOTA 4A92A 4Q80A 1SSXA 2V6NA 1YPEH 1P2JA 4FUDA 1P02A 3MFJA 3PMAB 3RXVA 3PWCA 1A0JA 2Y5GA 3FAOA 2J95A 4GUXA 4YLQH 1T7CA 3RXIA 3GY7A 2XNDD 1WOFA 3AW1A 1GBHA 4ABGA 4SGBE 1VZQH 4Y0YE 1UO6A 3LC3A 4Y71A 5LPEA 2R2WU 2WPIS 3P95A 1L4DA 4CRDA 3VFEA 2CXVA 5EJ1A 2FOAA 1AWFH 1DPOA 1GBTA 3D65E 4CRGA 1P9SA 4MNYA 2D8WA 2FLBH 3VB5A 2A4QA 1TMUH 1E37B 2XRCA 5FX6A 1IQLA 2SNWA 1S6FA 2BDAA 5DKMA 2JH0D 1TGCA 1VITF 1ZHMA 1KMHB 4MG3A 1GDNA 1GI2A 4LOYH 3PWBA 1AB9C 2H1UA 2OC0A 2BX3A 1GJ7B 1HXFH 3SN8A 1W12U 1QA7A 2CHAB 1OWIA 5E0GA 1C5PA 1EAWA 1NT1A 2F3CE 1B7XB 1T4VH 4GAWA 4U2WA 2BD4A 1O5CB 3MO3A 1AUJA 3A87A 2OBOA 3U28C 1O2WA 5T3HA 1VJ9U 3NWUA 2UUJB 4DOQA 5FXLA 4MTBA 1HCGA 1YF4A 1GVZA 3T29A 2BDGA 1Y3VA 2ZP0H 1UTKA 2W3KA 3A89A 2NU4E 3ODDA 4U30A 2WPKS 3OTJE 1C1MA 1EB2A 4HFPB 4JZFH 2UUYA 1QRXA 3MMGA 2F9OA 3E0NB 4MPUA 4BAOB 3ZVEA 2OD3B 3ZZ6A 1ORFA 3D49H 1MTSA 1Y3WA 1C5TA 1KXEA 2HNTC 1FXYA 4ABIA 4I32A 3D62A 1H9IE 1P09A 1KIGH 4FUJA 3O8RA 4JYTA 2OK5A 1KSNA 1ZMJA 3SGBE 3SUEA 4AZ2B 1C1UH 3KHVA 1BMFD 5F6MA 1E35B 2KR7A 3W94A 1O3GA 1UTLM 1ZGVA 4NA9H 3MO9A 4TY6A 4TWYA 3CS0A 5DK1A 2JH6D 1TA2A 1EAIA 5EXLA 1RS0A 5JB8S 3BTQE 4RKJB 3TVJB 2BLVA 1FNIA 1CBWC 3SQEE 8GCHG 4Y8ZA 2BZ6H 4FU8A 2VIOA 1K21H 3QZRA 1P8VC 2ZDLA 3F3BA 3SZNA 2I6SA 3FO8D 1W14U 4NZQA 1GHBF 4X6MA 2KFWA 3W1EA 8GCHF 3GY5A 3A7ZA 3UOPA 4ZXXH 1C5QA 1FQ3A 5JBTA 1SOZA 8KME2 1TRMA 4IN2A 2D2DA 4O03A 5DPAA 2B8OH 1VITG 4F4OC 1GJ5H 1E38B 1AY6H 3U98H 5JBAS 4ABFA 1PPEE 2OC8A 2PR3A 1AQ7A 1A61H 1G3EA 4TPYA 2ZECA 3JZ1B 3MU8A 2KZ4A 1L1GA 1YPJH 4Y7AA 1GHXH 2OUAA 4YZUA 1CGHA 2IN2A 1JIRA 3RXUA 1W11U 3FN8A 1IQGA 2R9PA 1K1MA
chains in the Genus database with same CATH topology
1MKXH 3KGPA 2Z3DA 1F5KU 4ZMAH 3SNAA 1TALA 4RSPA 1AHTH 1TPAE 2G4TA 1NC6A 1PFXC 2PKSB 2ZCHP 3CENA 1CA8B 5C67A 1C2JA 1EXFA 1ZRKA 3GCTF 1O35A 1ZPZA 2ALPA 5EXMA 3WY8A 2DE9A 1MD8A 1SGFA 1QR3E 1TGBA 1SB1H 4K60A 2VVCA 5FPYA 4I31A 2SGDE 2ZTYA 4XSKU 2F9VA 1AO5A 2FTLE 2XWAA 3PV4A 1YPKH 1TOCB 3GCNA 2Y82A 5T6DA 4B75A 4ZHAA 1EOLA 3MHWU 1HAXB 2A1DB 3SJIA 3MU4A 2VIDA 4UE7H 1EQ9A 7GCHG 3SI3H 3D23A 1O33A 4NCYA 5GJ4B 2ZFPH 4A1XA 2ZPQA 3PB1E 4UFEH 1SVPA 1UMAH 3SV9A 1BA8B 4NIWA 2CHAC 3SGQE 3R0FA 2BD5A 1QFKH 2QF3A 1G3BA 3VPKA 1J17T 2QXJA 2K1QA 2VIVA 1BTWA 1ZYOA 1IQFA 1O5FH 1UTJA 1BMNH 5A8ZA 3GY8A 1NRNH 2F9NA 2H2ZA 4I7YH 1MQ6A 2ODQA 1GG6B 1GHVH 4H6TA 1ELVA 4J2YB 3W95A 3A85A 2BTCE 2ZGJA 3R3GB 5FBIA 5DP4A 3RMOH 3ZV8A 2GGVB 3STJA 1XXFA 1BRAA 5E0JA 5EW2H 1JRSA 4FUEA 4OS1A 3V7TA 1BB0B 4K5ZA 2C8ZB 2XBYA 3SOSA 6GCHF 1ZSKA 1FI8A 2P8OB 1V2JT 1YPHC 1Y5BT 1GMHF 1RRKA 3FP8E 1LKAA 1A3EH 1IQKA 2UWLA 2ZHWH 1DITH 4KTCA 5HXFA 4AFZA 3NZIA 2HNTF 3M3SA 2HVXA 1GMCG 2HALA 4Z0KA 3L33A 1O3BA 3KEEA 1DM4B 1VGCB 1ZRBA 2G51A 2ODPA 4WMEA 2WPJS 4E06H 4IN1A 5DP9A 4BANB 1NU9A 3RMNH 3F1SB 1QGFA 3MH5A 1TGTA 1V2PT 3UY9A 1H4WA 1AVGH 4DIIH 1GBCA 4YT6H 5FPTA 3QLPH 4FUBA 3A8DA 3UFAA 4GCHF 1SGYE 2P59A 4UFDH 4YTAA 1MTNC 2C8YB 4X8SH 1C2DA 2BY8X 1TLDA 1AN1E 3P92A 2ZZUH 6ESTA 1ZR0A 5DG6A 1CO7E 1WV7H 1ZLRA 2QCYA 1EZQA 3EQ0H 2F91A 3MWIU 3BV9B 3GYMA 1BDAA 1Y59T 4DCDA 1HUTH 1F7ZA 1V2QT 1RXPA 2GT7A 3RXHA 1LMWB 3H5CB 1LVMA 5EOKA 4ISHH 1GCTB 4OGXA 1KDQB 1NY22 1OPHB 2NU2E 1O31A 1UVPA 2FEQH 3LGIA 3U8OH 3UNSA 1NRQH 2GZ8A 3SU0A 4X8UH 3LH1A 4ZKRU 4CH2B 3OYPA 4X1QU 1WTGH 3P8GA 3I77A 2BD2A 2F9UA 2FO9A 1UVUH 3RXDA 1P2QA 1S85A 3SUGA 1QQUA 3UR6A 2ZKSA 4YOJA 1NESE 1FIWA 2RDLA 5EQQA 2TGPZ 1O3PB 3GOVB 4FVBA 1N6XA 2YOLA 1MMJN 3AAUA 1SQOA 1QB1A 2J9NA 4ZXYH 1QHRB 1ZTLA 1O2MA 3ELAH 1HB0B 5TCAA 3RU4D 1GI7B 4THNH 2BD7A 3P6ZB 3BTDE 3CP7A 3OY6U 3GY2A 1E34B 1GJ9B 4KELA 1KY9A 1BJVA 1HPGA 1GJAB 2VIPA 4F49A 1HJ9A 4Y8XA 4IC6A 1JWTA 4X6PA 4MPWA 4GHQA 5ESTE 3P8OA 4Q7YA 1HAPH 3K6ZA 1DWDH 1C2FA 2STAE 4DJZB 1GI0A 4I8LA 2ZGBH 1HAHH 1NN6A 1W2KH 1O3AA 1F0RA 4ZHLU 2Q6DA 3MU5A 1SFIA 1KXFA 4TWWA 1A2CH 4H42U 1AB9B 1QY6A 2VH6A 2BHGA 1V2KT 2ZCKP 1CGJE 2Z3EA 1ANEA 5L30H 1CT4E 4K2YA 1KDQA 4CR5A 2P93A 1XM1A 2ANYA 2FOMB 5F03A 2H9HA 3P17H 1TGNA 1SGPE 1AD8H 1SPJA 2R0LA 5GIBA 1C9TA 1ELCA 1Z1JA 3PYHA 1UCYE 3PLKA 3RXSA 1PYTC 1ANDA 1F5RA 2SFAA 3VB4A 1GVLA 3M61U 2PUQH 1EAXA 1ACBE 1V2LT 1JXPA 2P3UB 2DE8A 1T32A 3LC5A 2BY9X 1PPCE 1NPMA 1GBIA 1VITH 3FFGA 2G52A 5HM9A 2TPIZ 1BMAA 1L4ZA 4WWYA 1O5BB 2NU0E 3M37A 2XXLA 5A0BA 4NFFA 1BBRH 1BUIA 1YGCH 1F0SA 4AYVB 1BTHH 4WH8A 2WPHS 3EGKH 1U6QA 3SV8A 3UNQA 1MUEB 2Y7ZA 3OU0A 4B1TA 1LQDB 2UWOA 1ZOMA 2BD9A 1RTFB 1W8BH 2F9PA 2Q6FA 1GBFA 1Z1IA 2VVUA 4K8YA 1ELEE 2AMQA 1O3KA 1AUTC 3BN9A 4Q7XA 4JMYA 1O5GH 2VWOA 3T27A 4Q7ZA 2CF9H 1C2KA 5LGOA 1GI1A 1QIXB 1YLCA 2IPHA 2FI5E 4BOHA 1HXEH 3TJVA 1FPHH 1KYNA 1FY5A 1T8LA 4B76A 3IITA 1SG8B 2C3SA 4QT8C 3LGVA 4GVUA 3TGKE 5EGMA 3GCOA 2XCFA 4Y6DA 4HZHA 6GCHG 1HIAB 4WMFA 1RJXB 1AFQB 2ZO3H 4ABDA 1C1TA 4NG9H 4U01A 2QA9E 1O2LA 3NUMA 1O2SA 1GHAF 3T5FH 2Y6TA 1X7AC 4NIXA 1YBWA 1MBQA 1WQSA 1CQQA 1GDQA 1OWEA 1AFEH 2GCTC 5PTPA 3TK5A 2A7HA 1V2MT 1ZSJA 2GZ9A 1ETRH 4INKA 2OXSA 1FV9A 1IHTH 5ETXA 5EQSA 2YNAA 2SGAA 2FZZA 2ZGHA 2THFB 3PO1B 4X2YA 1MTWA 2A45B 2H6MA 4X2VA 4I8JA 4R8TB 3ATMA 1SLUB 2XC0A 3RXCA 1KTTB 2BOKA 3ATIA 4B2BA 1MCVA 1OXGA 1O5DH 4Y11E 4ZKOU 2BLQA 1K1OA 1K2I1 2ASUB 1KLJH 1IQHA 1GJCB 1MKWK 2WUBA 2JKHA 3P70B 1O2IA 2G5VA 1AWHB 2FOEA 1ELTA 4K1SA 4PROA 2VH0A 3BTGE 4WF8A 4AFQA 1J9CH 4Q2KA 1BOQA 3A82A 1ARCA 3KF2A 4K69A 2ODYB 4LZ1H 1DWBH 5C5OA 2BYAX 4XDEA 3RC4A 2QGRA 1PPGE 2ZFFH 1T8NA 3TGJE 2BDYA 1THPB 4FUHA 3ZVBA 1EJAA 1MZDA 4D7GA 4J1YA 1O2RA 1C5LH 4BAMB 2BD8A 1K22H 2FTMA 4D9QA 2XC4A 1DANH 3MI4A 5G4BA 3QZQA 1HAGE 3GDSA 5LH8A 1GI9B 2RCEA 4UD9H 1A1RA 2J38A 2FOHA 2JETC 2SGPE 3TGIE 2HPPH 4YLUA 1Q2WA 3PLPA 4LZ4B 3E0PB 4I8GA 3PTBA 5A8XA 1LDTT 2BM2A 3NPSA 1PQ8A 3ZZ9A 2O8WA 1C5XB 2ZDVH 1BRCE 2QIQA 4OGYA 1A0HB 1XUJA 3RC6A 1NM6A 1DSUA 1T4UH 1C4Y2 3LPRA 1G30B 2BLOA 1OP2A 3GY4A 2GCHG 4RKOB 1O3HA 1LPGB 2BY7X 1Y8TA 2CN0H 1ANCA 3HKIB 4FU9A 1BRBE 3RM0H 4ISLA 3UWIA 5DP5A 1PPFE 3T25A 3MH6A 3QGNB 5JPMH 2BDHA 2HOBA 3A80A 4B74A 3MNCA 1MH0A 1ZMLA 2A5AA 1EPTB 3HK3B 2XCNA 1BT7A 2CV3A 3SORA 1DOJA 2ZHFH 3K6YA 3RLWH 1O37A 3SUDA 4JK5A 4CRFA 1D3TB 1YYY1 1GBLA 1QA0A 3PMBB 4YT7H 4LXBH 5A0AE 5F8TA 1XUFA 2I6QA 1UTMA 1KLTA 1RIWB 1P2NA 3U8TH 3AASA 4MNVA 1ELFA 4I8KA 1RIWC 5E0HA 3P8NA 1J15A 3T28A 1P03A 4WMDA 3KQBA 2FOBA 3RMMH 4UFGH 3JZ2B 1GJ4H 2H5DA 1ELGA 1Y3YA 1TFXA 2ZHQH 3ZZ8A 1AFQC 1A7SA 5B6OA 1HJAB 1TB6H 1BTYA 2A5IA 3EA8A 1HAYB 5L6NH 1ZHRA 4BAHB 1ETTH 2VGCC 5DGJA 4TYDA 9LPRA 2QXHA 1ZJDA 1LCYA 3Q76A 1AIXH 1VJAU 1Y3XA 1SFQB 2AMDA 1P2MA 2ZIQH 3SU6A 1MKXK 2NU3E 1UVTH 1P11E 4IW4E 1Z6EA 5F8ZA 1IAUA 1LHFH 1LPKB 1KXBA 1NTPA 1TBZH 3KCGH 5BRRE 4XOJA 2QAAA 2PHBA 3IWMA 1FN6A 2BVXH 3TIUA 1HDTH 4B73A 3E90B 1TBQH 1AGJA 1F5LA 1FY8E 1Z8IB 2A2XH 3A83A 3KN2A 3HGPA 4XBCA 1IOEA 2OQUA 1Y5UT 1PQ7A 1AZ8A 3S9AA 2HRVA 4HTCH 1HAIH 1OSSA 2PTNA 4FUCA 3ZZBA 1L0ZA 1OKXA 2TGTA 4ABJA 4A5TS 3S0NA 4BTUB 3BTKE 1O32A 1K1PA 1CT2E 1QJ7B 3E91A 3SJOA 3ZZ3A 5JYIA 5GCHF 1QB6A 2O8TA 3V0XA 1A46H 4IGDA 1K1JA 2FOGA 1FY3A 2ZFRH 3U1IB 1YCPK 1P01A 1YLDA 2Y5HA 1DLEA 2AERH 4YM9A 2EI7A 1AVWA 2SGQE 3BG4B 5L2YH 1EJNA 3GY6A 3Q77A 1C4V2 1WBGB 3RXOA 1GBBA 2BOHB 3UIRA 4NSVA 2AGIX 1FLEE 3LGTA 2AYWA 3TU7H 2JH5D 2H5CA 1XKAC 1P2KA 2PKAB 3KQCA 4AB9A 1H9LB 4JK6A 3SU4A 1EX3A 1V2OT 2R3UA 1GI4A 3MNBA 3SU1A 2Z6BD 3LJOA 2OTVA 4XBBA 4CREA 1BRUP 2XC5A 1GHAG 2AH4X 1FMGA 1G9IE 4MNWA 3EYDA 2GT8A 1O3NA 3G01A 2W7UA 1LVBA 3SHAH 2WV4A 2VVVA 1J16A 4ISOA 1WTHD 1QBOA 1S6HA 5BPEA 2SNVA 1GHWH 1UCYK 2Z7FE 4CBNA 2VWLA 3UQOA 8LPRA 5A2MH 4NA7A 4X8TH 3K9XB 2WV5A 1B0EA 3T62A 3DUXH 1C2GA 1C1PA 3NKKA 1YKTA 4JZDH 1O3LA 2GZ7A 1S82A 1C2HA 1GGDC 2ZDAH 1YPHE 1HV7A 2WPLS 1SHHB 1LTOA 1UK3A 4SGAE 3Q3YA 4CBOA 1XX9A 1DY8A 4AYYB 2R0KA 2W5EA 2BQ6B 4DURA 1LKBA 1TA6A 1QTFA 1ZMNA 2QV1A 3LIWA 1INCA 3IG6B 3QDZB 3PMHB 3RXJA 3TH2H 1XXDA 2C93B 1NS3A 2V35A 2ALVA 2PGQB 2Q1JA 1IQJA 3A8CA 4ABEA 2D26C 2XYAA 1V2UT 4FVDA 1DFPA 1P2OA 2BB4A 1EZUC 1EP5A 4D7FA 1C5RA 4INHA 4JCNA 4BXSA 3PO1C 1HLTH 2YNBA 4JZIA 2ZTXA 3M7QA 3BTHE 5DO4H 2ZFQH 4ISNA 1H1BA 1BBRE 2Y5FA 2F9BH 1C5UA 3S9BA 3ZZ4A 1C9PA 2W7SA 2Z94A 3F9FA 1GHYH 1C4U2 3P8FA 2XTTB 2Y7XA 3EDXB 2B0FA 2ZA5A 3BTEE 4DW2U 3M5OA 1RD3B 1J14A 2R3YA 1OX1A 2QN5T 4OS5A 1V2NT 1GMHG 4A6LA 3HATH 1BTXA 3U8RH 5DP7A 3M5NA 4NZLA 3TK6A 3LKWA 4R0IA 4B2CA 3BF6H 1DVAH 2GTBA 2VB0A 4WXIA 1SGRE 2FESH 2ILNA 4XE4A 3A81A 3L3TA 1FUJA 2J34A 2A0QB 1D6RA 3ZZ5A 4M7GA 2HLCA 3SV6A 1S81A 1TPPA 1C5WB 3BTTE 4H4FA 2GDDA 1OS8A 1W7GH 3MTYA 4ZAEA 2P94A 3TNTA 2P16A 1FN8A 2QXGA 1GI8B 5HYOA 1Y3UA 2PWXA 4UDWH 3B23B 1AI8H 3RXLA 2FYQA 1E36B 3ESTA 2ZHEH 1QURH 1SLXB 1TABE 1GJBB 5EPYA 1C5SA 1C2MA 1EJMA 1TPSA 3LGYA 5AF9H 2O8UA 4IS5A 1FPCH 1XUHA 2A7CA 2OP9A 2FMJA 1S83A 3TITA 4UONA 4WJG2 1N8OC 2VIQA 2ZCLP 4X8VH 1BTZA 1DICA 1SLVB 3ZZ7A 1IQNA 4A1VA 4H6SB 3U1JB 3GYLB 3ZVCA 1ZSLA 1O3MA 2PSXA 3E1XB 6LPRA 2O9QA 1YC0A 3ZZCA 3L6PA 1GMDF 5H4IB 2BDIA 3QTOH 2R2MB 2BVSH 1A3BH 3M7UA 3E16B 1UVSH 2G00A 7KMEH 4CRAA 2G8TA 1A4WH 3FANA 1L2EA 1CT0E 2SGEE 3QWCH 1LO6A 1MQ5A 2HNTE 2UUKB 3SHCH 4NFEA 2LNCA 1SLWB 1FAKH 3RXEA 1AKSB 4X1NU 4FU7A 9ESTA 3T2NA 1K1NA 1TGSZ 1W0ZU 3ENSB 4INLA 4WVPE 2ZF0H 4UFFH 5J4SA 4OS6A 1NO9H 2PTCE 1MD7A 1O3IA 1XMNB 2O8LA 3ZYEA 1EAUA 2P95A 2H9TH 1CA0C 1RGQA 1YPGH 3FZDA 4MPXA 1HAVB 4NIVA 1WSSH 1BBRK 3A7XA 1GVKB 1TBRH 3A86A 5FHTA 1PQ5A 1OYTH 1G3CA 4HI3A 5T6GA 2VGCB 3KQDA 3OSYA 3Q00A 5CMXH 2FP7B 2ESTE 3URDA 3BIUH 2ZEBA 3QGJA 4KKDA 5HGGA 1ELDE 2VU8E 2SGFE 4GCHG 3SU5A 5SGAE 4BNRA 1DWCH 3SW2B 1IQIA 1ANBA 3B8JA 4BTTB 4ZROA 4ABBA 1CBWB 3RXTA 1FDPA 3E3TA 4UEHH 4A7IB 2ZFTA 2FXRA 1J8AA 5C3NA 3TJUA 1GBAA 1UK2A 3HGNA 4I33A 1IHSH 2FWWA 2B7DH 2Q6GA 1GMCF 1KLIH 1O2UA 4XFQA 1Y5AT 3VEQB 2F83A 3GCHB 1KXCA