3AAUA

Bovine beta-trypsin bound to meta-diguanidino schiff base copper (ii) chelate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structural basis for the design of novel Schiff base metal chelate inhibitors of trypsin
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aauA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aauA02
3UWJH 3ZZ4A 1W11U 3TH2H 1FN8A 5EU8A 1HFDA 3PTBA 2TGTA 1Z8RA 1GJ7B 1QQ4A 1NU9A 3SUDA 4UFEH 3K9XB 2RCEA 2H2ZA 3ZV9A 1OWDA 1UTNA 3M7UA 1GGDC 3SNBA 3SNAA 1YYY1 1MTVA 4JYUH 4FU8A 5EQQA 8GCHF 3MO3A 1ELBA 1UK2A 2OC8A 3BTTE 1J9CH 1IQKA 4IW4E 1CU1A 1C5UA 2AGIX 4F49A 1TMTH 1S0QA 3SQHE 1SG8B 6GCHG 1AFQC 1HRTH 4X2VA 3OX7U 3CENA 4E7NA 6ESTA 1ANDA 1O2PA 3STJA 1O5DH 3O8RA 4X6PA 4FUEA 1K1NA 5ESBA 3R3GB 3F9GA 1SSXA 4D7GA 2CJIA 3SU4A 1SQTA 6LPRA 2SGEE 1DY9A 4ABBA 3Q00A 5FAHA 1GHBF 1WQVH 1DANH 2JH0D 3MU1A 3SHCH 3DD2H 3LIWA 1ELDE 1WU1A 3BTQE 1ZRKA 1L4ZA 1OWJA 1TQ7B 1FNIA 2FEQH 3MYWA 3RXJA 1ZJKA 1CQQA 3GCOA 2C8ZB 3UIRA 4H6TA 1XKAC 4I8KA 1LHGH 3FANA 4NFFA 3VGCC 2J34A 1SGTA 2OC0A 1LHDH 1NFXA 3GDVA 2EC9H 2FX6A 2VIQA 2W3IA 2R9PA 4OS7A 3AW1A 1Z1JA 1QJ7B 3GY4A 1CA8B 1OWEA 4MVNA 3RXSA 3LOXA 2BLWA 5L2ZH 1CHOG 1C1TA 1JRSA 1PQ5A 4O97A 2GKVE 2PKAB 5EG4A 3T29A 1WTGH 1XVMA 2XWAA 2Z9GA 3I29A 1GG6B 4ABFA 1O2ZA 3RXMA 2ZGJA 2ZFSA 3D23A 4ZROA 1GBFA 1BIOA 1MTWA 3T27A 4WF8A 1GJDB 2ZF0H 1D3DB 3TVJB 3UFAA 1IHTH 3RXIA 2AERH 4X8SH 1C5MD 3T2NA 2QC2A 4FUFA 4R0IA 3ZZ5A 5E2PA 3A87A 1UTMA 2VVCA 3Q3KA 2OBQA 2ZTXA 2AFQB 4D9RA 1J8AA 2P3TB 4NZQA 3M3SA 1YPGH 4AORA 2FXRA 1HIAB 1P9SA 1SGDE 1P01A 3HKIB 1KLJH 2GVFA 1GBBA 4YTAA 1HGTH 2A2XH 3SV8A 2VWNA 2QY0B 4RKOB 4ISNA 1H4WA 2BOHB 2PSXA 4X1SU 1THRH 1BMLA 1C2KA 1BDAA 1F0TA 5A09A 1O5AB 3UNRA 3HPTB 3UNSA 5JBAS 2W7SA 4ZAEA 5JB8S 2VVUA 2ILNA 3TNTA 1NRSH 1TMUH 2AIQA 2VGCB 2B7DH 1S84A 3RXRA 3ZYEA 4ZHMU 2KAIB 4D76A 3H7TA 1W13U 4X1NU 3VXFH 3EA9A 3KQDA 5EXMA 1MTNB 4D7FA 1OP2A 1UMAH 5CMXH 3BTEE 2SNVA 3LU9B 3TJVA 1ARBA 2TGPZ 4GHQA 3D49H 1SR5C 4JZDH 1MAYA 1CA0B 5HM9A 3CS7A 2ZDMA 1PYTC 3RDZA 4TYDA 1OWKA 4AFUA 1JWTA 2CF9H 1TRYA 2EI7A 2WYJA 1ZTJA 3SNDA 1P2QA 3KIDU 2ODYB 3LJJA 4GPGA 1TBRH 1AWHB 1DUEA 4AGJA 5A8YA 1KXBA 2VIOA 1BRAA 3BTME 3KQEA 3ZZ3A 1IQGA 3W95A 1GVZA 5L2YH 2AIPA 5DO4H 2UUKB 1XUIA 1KIGH 2WUBA 1AMHA 1HJ8A 4Y71A 2ZP0H 5GDSH 3SGBE 2J4IA 1QNJA 1O2QA 1KDQA 1XMNB 4NIVA 2P93A 5EODA 3D62A 1GG6C 1C5YB 4BTTB 3V0XA 1GHYH 1C1NA 1GI0A 2GDDA 1O38A 1GMCG 1MUEB 1PPGE 4Y8XA 1O3FA 5JBTA 1CE5A 1XUFA 2ZTZA 1TNLA 1AN1E 3M5MA 1T8OA 2ANKH 1LHEH 4Z0KA 1JXPA 2FI5E 3PWCA 1P02A 1C5PA 3URCA 1TNIA 4U2WA 5LGOA 1K1LA 3DA9B 4BAOB 1BOQA 1YPHC 2BD4A 4I33A 4MG3A 1AE8H 1AWFH 1TNGA 2ESTE 4CRBA 1UK4A 4AG2A 8GCHG 1YPHE 3SGQE 3UOPA 2K1QA 4ZHLU 4FXGH 1SFIA 1W3CA 4JZ1A 3TK5A 1FIZA 5DP3A 2Y81A 1C2IA 2Q6DA 3BTKE 1GBAA 4JZEH 1N6YA 2TIOA 4XOJA 1BQYA 2AYWA 4TWWA 3ZVAA 4ABDA 1AKSB 2CGAA 3E16B 4BXWA 2WPIS 1E34B 1W7XH 3SNCA 4I8HA 3ZV8A 4XDEA 1LTOA 5B6OA 4UE7H 1KYNA 2VGCC 1WAYB 1GL0E 3ZZ6A 1V2RT 2BXUH 5C2ZA 2QCYA 1QCPA 1KY9A 2FMJA 4LZ4B 1GHXH 1UK3A 4DIHH 3DHKH 1BMNH 4JK6A 3SORA 2BD5A 1WOFA 5FPSA 3FZDA 2V6NA 4MLFB 4ZKNU 1VJAU 1TPOA 2GX4A 3M61U 4KP0A 3SV6A 2FESH 2A4GA 4WJG2 3P95A 2ULLA 1ZJDA 1A5GH 1TRNA 1BZXE 2FOHA 1N1LA 1CA0C 2VH6A 1O3AA 4K8YA 8ESTE 1WUNH 2F9VA 3VB3A 1G9IE 3RXAA 3M37A 2ZZUH 3PWBA 4YT7H 5F8TA 5EXLA 5AHGH 1O2WA 1YPLH 3QTVH 1JRTA 2B5TB 2PR3A 1GBMA 3UR9A 3UY9A 1O2MA 1PJPA 1BA8B 4OGXA 1C2LA 1KXAA 1LPKB 1TPPA 1EKBB 3BG8A 1EZUC 2XBYA 4X0WU 2P3UB 1O2KA 2PW8H 2ZHFH 1XM1A 1S85A 2G51A 4IBLH 4XFQA 1PPFE 1EUFA 3ZVFA 1O3JA 2YNAA 2SNWA 4J1YA 2HPQH 2WPKS 2FLRH 4IS5A 1ZLRA 1GJCB 2FOBA 1QL9A 1D6WA 4KTCA 1TIOA 4AYYB 4FUCA 1IQFA 3NKKA 1XUHA 3DFJA 4E06H 1TLDA 3BEUA 4B2CA 1T8LA 4B1TA 1C2EA 3EA8A 1O2OA 1AQ7A 3U1IB 2VJ1A 3OY6U 4CRGA 1KTSB 1Z8GA 3CS0A 4HTCH 3S69A 3SJKA 4JYTA 1TGNA 4A5TS 1Y3YA 2XBXA 1HV7A 1AE5A 1F2SE 2TBSA 1HXFH 3RUOA 2Z94A 3KN2A 1SC8U 3TK6A 3P70B 1NT1A 4ABHA 2H5DA 4MNXA 1LO6A 1V2TT 1E38B 5JB9S 2XBWA 2ZDVH 1A7SA 1GBLA 3P92A 1J17T 1SFQB 1O5FH 3E6PH 2ZFFH 2Y5HA 2PTCE 1ELVA 3K6ZA 1D9IA 1C2HA 2R3YA 1C5QA 4WMEA 5EW2H 3NWUA 3ITIA 1C5RA 1T31A 2AGEX 1OP8A 3FVFB 1HJ9A 5DGJA 2VIDA 1GWAA 5DJ7A 2BOKA 4X1PU 3UREA 3KL6A 2ZG0H 3NCLA 1FQ3A 2ZA5A 8KME2 4YM9A 1O2NA 2C90B 1FPCH 4UD9H 2STAE 4E05H 1DDJA 1K2I1 1A1RA 1DSUA 1BTWA 1VJ9U 2GGVB 3EQ0H 1ELEE 2BLQA 5TCCA 3A88A 1ESTA 1C9PA 1GDNA 2VWLA 2BDAA 1F5LA 2B9LA 4WVPE 3SU5A 3O8CA 5AVDA 3V7TA 3LJOA 1V2VT 1P2JA 1SGYE 2W5EA 1X7AC 2FI3E 1EOJA 1O2HA 3AVZA 1PPCE 4ISIH 2QXHA 1BTZA 3BTGE 3BG4B 2Y80A 2ZEBA 4FU9A 5E2OA 2SGDE 4WY3A 4RN6A 2IPHA 3RM0H 5T6GA 3RXGA 1P04A 3A8DA 4Q7XA 1TA2A 5FBIA 3VB4A 3IITA 4BAKB 1XX9A 4H6SB 5JBBS 3QO6A 1HAGE 2YOLA 1TRMA 3A80A 1L0ZA 4IMQA 9LPRA 3P8NA 4ZH8A 4BNRA 1W2KH 4DVAU 4QT8C 1YPJH 3V12A 3PV4A 2NU1E 2J94A 3A89A 1IQEA 3UOUA 3SJOA 5A8XA 1TX7A 5TCAA 1BBRE 3EA7A 3TITA 1HJAB 1TPAE 2BY6X 3B8JA 1BBRH 1IOEA 3A7ZA 1P0SH 2PV9B 2QF3A 2PSYA 4Q7ZA 2PLXA 5FBEA 1NROH 4LZ1H 4MPXA 3L33A 3GISB 2C3SA 4UFFH 1S0RA 1B7XB 3SBKA 4AN7A 2VIPA 1W0ZU 3RMMH 4UEHH 1GBKA 2A4RA 2Z6BD 2OD3B 2DE8A 3JZ2B 5JYIA 2FZZA 5AFYH 3A84A 3QK1A 4A92A 5K0HA 2NWNA 3UQOA 1NRNH 3UWIA 2AMQA 2Y82A 3SV9A 1F0SA 1O34A 1G3CA 2ZTYA 2O8WA 2VU8E 3A7XA 4RSPA 2UUFB 1CT0E 2STBE 4CREA 2BQWB 1SQAA 1SGIB 3RU4E 3GCTF 4RKJB 2ZDKA 1O2YA 2QXGA 3MHWU 2A31A 5C1XA 2GTBA 4ZMAH 4Y6DA 1TA6A 1AVWA 1BRUP 1PQAA 1G36A 2G5VA 2WINI 3U1JB 2ZI2H 4DT7B 1YBWA 3FFGA 4NCYA 1DX5M 1FY5A 1ZMJA 1IAUA 4YO9A 3ATWA 4UFDH 2P3FH 3RXUA 3MO9A 2ZDNA 1MKWK 1EAIA 3BTHE 1QL8A 3MU5A 1G32B 2FDAA 1DITH 1E35B 1H9LB 3MH7A 5T6FA 4A1VA 1P3EA 2ZHDA 3HKJB 1TGSZ 2PTNA 5DP5A 2I6QA 2VH0A 1C2GA 1GMHF 1RIWB 3MH4A 4LK4A 3KCGH 1M9UA 4I8LA 1IQIA 2CV3A 2QYIA 4WH6A 1GVKB 1MCTA 1GJ5H 1GHZA 2AMPA 2VWOA 1GJ8B 1UHBA 3BG4C 3ZVGA 2AS9A 1O2RA 1GI9B 3H5CB 4NIWA 4AYVB 3RXEA 1GJ9B 3QUMP 1V2ST 4MTBA 3VB7A 4TPYA 1H1BA 7ESTE 2THFB 4JK5A 1HUTH 2XCFA 3BSQA 3GCHB 2ZKSA 3K65B 2AH4X 2ZU5A 1ZHRA 3EYDA 1NFYA 3ODFA 2ZPRA 2GMTC 1AO5A 1LQEA 1HLTH 1EZXC 1MTUA 1A61H 1V2JT 1ZPZA 2BDHA 3W94A 3JZ1B 3MMGA 3SV7A 3SUFA 1MKWH 5BPEA 4Z6AH 2FOFA 2H5CA 4TPIZ 2PFEA 3LGUA 1LHFH 4WXVA 1D4PB 3LC3A 1SLXB 1HJAC 2ODPA 2QF0A 2GD4B 5J4SA 1O39A 1SLUB 5GCHF 2WPHS 5DP7A 4X2XA 3IWMA 1O3NA 1H8DH 1G3EA 1HAVB 2VVVA 1QURH 4OS5A 2ZHQH 3TH3H 1IQNA 3TGJE 4AOQA 3AAVA 2G8TA 1H9HE 1O5EH 2G4UA 3LH3A 1O37A 2W26A 5EPYA 1O3PB 1YCPM 1E36B 1ELAA 2YNBA 2HALA 1BTPA 2GT7A 3QZQA 1LVYA 4A6LA 2BQ7B 4KGAA 3SI3H 2RDLA 3I78A 1FAXA 1A2CH 2BXTH 2Y7ZA 2VINA 3SI4H 5EXNA 3U8RH 2A5AA 1CGIE 5FX6A 1BB0B 1K1PA 1B0EA 1HBTH 2OC1A 3F68H 1DWCH 3S9AA 3FZZA 3F6UH 4UFGH 3P17H 3LKWA 1C2FA 4E7RG 1QY6A 1NZQH 4B74A 3GDSA 1QRXA 2OUAA 3PMHB 4IGDA 1SLWB 4CRCA 1GI3A 2Q6GA 2ALVA 1GI2A 2B8OH 3SJIA 1ZYOA 1QR3E 3E8LA 5F03A 1OSSA 1DOJA 3VFEA 2BLVA 1O5BB 1RTLA 3TU7H 4FU7A 2ANWA 1DLKB 4BOHA 2QN5T 1BTHH 3F9HA 3SJ8A 1UCYK 4Q7YA 2NU4E 1AU8A 1HAHH 1U6QA 1XUKA 3VXEH 3TPIZ 1QL7A 1RIWC 3KNXA 3MNXA 4GUXA 2OQ5A 3TK9A 1THSH 2NU0E 1A4WH 3KGPA 4X8VH 4YT6H 1O2IA 1Y3XA 1ZGIA 1V2KT 1GPZA 2TGAA 3U98H 1SLVB 4ISHH 2JKHA 1O2TA 1WYKA 4CH8B 1CT2E 3ZZ7A 5DP4A 2UWPA 1WQSA 1O2GH 2F9UA 1IQMA 1SGFA 1OS8A 2BDGA 5L6NH 4FUBA 4DCDA 4SGAE 4CRFA 3EAJA 2WV5A 3GCHC 1EJMA 1UTQA 3MU0A 3A83A 1ORFA 4HFPB 1HDTH 3I77A 4Y8YA 1ELTA 4HI3A 3F9FA 3ZVCA 5BRRE 3PMBB 1VITF 1ZMLA 4CHAB 4IC6A 3MNBA 2FPZA 2ZHWH 2F91A 1EAWA 1KLTA 1MQ5A 1L1JA 4GHTA 3LH1A 1C9TA 1UTLM 1WBGB 1KXDA 1LVMA 2BM2A 3ATKA 4YOJA 1WCZA 3ZVDA 1SHYA 4DJZB 4MPVA 5DKMA 1C4Y2 1TQ0B 5HMAA 4ZHAA 1HAZB 1Y5AT 1FIWA 1NM6A 1RJXB 1UJ1A 3O8BA 1AVGH 4Y8ZA 4AZ2B 1N8OB 3V13A 3KEEA 4NIXA 1TBZH 3E3TA 2Q1JA 1C1UH 1VCWA 1MBMA 2ODQA 3GCTG 2FM2A 2VIVA 3HK6B 1BTUA 2BD9A 5DPAA 4KELA 1BUIA 2AMDA 2FYQA 1O35A 2G00A 1SGQE 2R0LA 1SMFE 3DT0H 5L30H 1ZHMA 4K1EA 1RTKA 2OP9A 2ZDLA 1F5KU 2F9BH 1MZDA 2A7JA 4Q2KA 5K7RA 1A0JA 2ZFPH 1VITH 1QB6A 1FDPA 3BF6H 1MTSA 1SVPA 1C5NH 2OQUA 1IHSH 2FIRH 1V3XA 1JOUB 1ETTH 2UUYA 1GHAF 2BVRH 2RG3A 1UVUH 1TOMH 2BDYA 4JMYA 1W12U 2SFAA 1ELCA 1LPGB 3GY8A 3M5OA 4JYVH 2DUCA 5CE1A 4YESB 3RC4A 3RP2A 1TNJA 1ZPBA 2F83A 5E0HA 4CRDA 1KDQB 2QAAA 3ZZCA 3SHAH 1O0DH 1ZSKA 3ODDA 3TLOA 1ESBA 1O5CB 1O3GA 1QIXB 5F8XA 1GHBG 3A86A 3PMAB 1FONA 1W10U 4NG9H 4NZLA 3SOSA 1OX1A 1QRWA 4GVUA 3OSYA 1C5WB 1XVOA 1P8VC 1E37B 1EJNA 1K1JA 3A8CA 2P8OB 1O2UA 1ZZZA 3S9CA 1Z7KA 1AZ8A 2H9EH 4WXIA 3QGJA 4DW2U 4XBBA 2BY9X 4JCNA 1C5VA 2BY5X 1EAUA 2R2WU 1OWIA 4YLQH 4U30A 1TNHA 1YPKH 1THPB 4DGJA 2FYRA 5A0BA 1OWHA 1DPOA 2A7HA 3A8AA 2ZPSA 1CHGA 1G37A 5GPIB 2CMYA 4CHAC 2HVXA 3E91A 4X2WA 1H9IE 4X8UH 1EXFA 3UQVA 2FOGA 3G01A 1BTXA 3NK8A 3BEIB 4Y10E 2ZU1A 1C2JA 1W8BH 4O9VA 1QJ6B 2D2DA 3ZVEA 3SU0A 1Y8TA 2J9NA 2VWMA 3K6YA 3RC6A 1VGCB 3SU2A 1FV9A 1ACBE 1RTFB 4ZKRU 2SGFE 4FUIA 4OGYA 2CN0H 3RXVA 1EAXA 3AASA 1GI4A 2WPJS 1FN6A 2ZECA 5GJ4B 1D3QB 3U69H 5A8ZA 1V2LT 3U9AH 1TX6A 1C5OH 1N8OC 1ZSJA 3M5LA 1A3EH 2FOCA 3C27B 3QDZB 4O03A 3RXKA 5C5NA 4A7IB 1QJ1B 3QWCH 3PROA 4B75A 3MNCA 6GCHF 1NC6A 4I8GA 4I7YH 1ELFA 3LPRA 1NESE 1AGJA 1XUGA 3PYHA 3NZIA 1C1SA 3SNEA 1NRPH 3RXTA 1MAXA 1T8NA 1P2MA 2H9TH 4X1QU 2BYAX 2FS8A 4FUHA 1O3CA 4UONA 1DS2E 2G55A 2G5NA 2C93B 3KQCA 2BD3A 1VCQA 1O3BA 3QX5H 1ZMNA 7KMEH 2GV7A 1WV7H 3S9BA 1K1MA 2GV6A 4DIIH 1BMMH 1C1QA 5GXPA 3IG6B 4B76A 5DK1A 3GY6A 3LC5A 1E0FD 2JH5D 1FLEE 2WYGA 1PPEE 4O3UA 3RMOH 1C4V2 1SI5H 3TJUA 1YCPK 2ZCHP 3VB5A 1NRQH 1L4DA 1GBCA 3MOCA 1O3KA 1K1IA 3RXQA 1O3IA 4X6OA 2FP7B 2HNTF 5C67A 1YP9A 2HPPH 1FJSA 1O33A 2B0FA 3P8FA 1IQHA 3MH6A 4ISOA 1TAWA 4NSVA 1HAYB 4OS2A 4Y79A 1LVBA 3GY7A 2P8OC 4IN1A 1BRCE 4NSYA 2H9HA 2SGPE 1UTKA 5A0AE 3GCNA 2P59A 1AZZA 2I6SA 1AIXH 1VITG 2XCNA 3UPEA 4KTUA 5JDUB 1YGCH 1GBDA 3T62A 1UVTH 1TALA 4INKA 2J2UA 1KXFA 1O32A 3E90B 5FX5A 2XXLA 1GI7B 3RU4T 2GCHF 1IQJA 1FZZA 1SOZA 2CHAB 3PLBA 4K8BA 3A7WA 3RXBA 1YCPH 1OOKB 1PQ7A 1TMBH 3HGPA 4Y7BA 5AF9H 1GBTA 1C2DA 1GBIA 2FTMA 4INHA 3H7OA 4YZUA 8LPRA 3P8GA 2O8UA 1P2IA 1SPJA 5JBCS 3B23B 3SV2H 1VGCC 1T4UH 1BHXF 4AFZA 2GDEH 3GYMA 1GJ4H 2BB4A 2BY7X 4B2BA 4YLUA 4AFQA 3ESTA 1FAKH 2GZ9A 4ESTE 4Y0YE 2Y5GA 2GMTB 1BCUH 1TB6H 1QTFA 4X2YA 5TJXA 9ESTA 1C1MA 1HNEE 1GDQA 1ZTKA 5LPRA 3RXFA 1G2MA 5HGGA 1V2NT 2QXJA 2V3OH 1C5LH 3A82A 4Y76A 5DP6A 1DICA 1P03A 1W7GH 3S7KB 2RA3A 1KXEA 4X8TH 5I46H 1AVXA 2R0KA 2BD7A 3NPSA 1NPMA 1YM0A 2V35A 1HAIH 5GWZA 4XBCA 1GHAG 4IN2A 1IQLA 5CHAB 1NO9H 1A5HA 1Q3XA 1ZR0A 1C5XB 1DWEH 1DWBH 2BD2A 2PUQH 5LPFA 1TGCA 5DG6A 1BMAA 1ID5H 3GOVB 3LGIA 2FTLE 2IN2A 1GCDA 1Z6EA 3MTYA 4U01A 1EPTB 2CXVA 1O2JA 2C8XB 1P05A 4PROA 5LH8A 4NGAH 3BN9A 2GCTB 1BJUA 3A8BA 2XTTB 1SBWA 1PPZA 1DWDH 4X6NA 3TJNA 4DY7B 1MH0A 1T7CA 1UVOA 1LCYA 4CH2B 2BQ6B 4AB9A 3RLYH 2GT8A 5E0JA 1EP5A 1EX3A 4AX9H 3PTNA 2F9OA 1VCPA 1A0LA 4BTIB 3M36A 1SB1H 1OKXA 1UVPA 2BY8X 1GBJA 1DSTA 1HPGA 2WPMS 4LOYH 4X6MA 3M3VA 3RU4D 2Y5FA 1O30A 1PPBH 4R8TB 1TGTA 1TBQH 1AUTC 1GJBB 5J4QA 2C8WB 2Z3CA 1CGHA 1TABE 1L1GA 2EI8A 2PHBA 2Q6FA 1QBVH 1RD3B 2Z9KA 3P8OA 4GSOA 5A2MH 1RGQA 1OXGA 1ZRBA 2XC5A 2OXSA 2V3HH 1C1VH 1T32A 3RC5A 2CHAC 5EOKA 1NFUA 3A7VA 2LNCA 2LPRA 3ELAH 2R3UA 6CHAB 3A81A 1O3DA 1CSOE 2PUXB 2GZ8A 1QQUA 1XXDA 5HYOA 3U8OH 2XWBI 1GJAB 4B71A 3OYPA 3S0NA 7GCHF 1HAVA 1V2MT 2BDBA 4Y7AA 2PKAA 1Z1IA 4K69A 3M35A 3M7QA 3MFJA 1G3DA 4CBNA 3SJ9A 2Z9IA 3E0PB 1LKAA 1ZGVA 4XSKU 3URDA 1YPMH 1GVLA 2F9NA 1ANEA 1FY4A 1J14A 1Z71A 3M3TA 2P95A 2JH6D 5T3HA 3AAUA 2G4TA 4SGBE 1V2WT 5G4BA 4J2YB 4VGCB 1AI8H 2A0QB 1NS3A 2OLGA 2J92A 4BTUB 1CT4E 1YPEH 1C5TA 3RXLA 1HXEH 3GICB 5DP9A 4MNYA 1HAPH 1FI8A 3SW2B 1UVSH 2G81E 1HIAA 4DOQA 3UTUH 2V0BA 5CHAC 1SHHB 1GHVH 1HYLA 1DT2A 1F92A 1GL1A 2A2QH 3WY8A 1A46H 2ASUB 4GCHF 4ISLA 4TY7A 4CR5A 1Y3UA 1UHBB 2ANYA 1EPTC 1JMOH 2VB0A 4NA7A 1C4U2 2A32A 1F0RA 3FP6E 1ZPCA 2A1DB 3O8DA 2GCTC 3RXPA 1EZQA 2Z3DA 5C5OA 4K1SA 1JBUH 2P94A 1SGRE 1XKBC 1B0FA 3RXOA 1CBWB 2TRMA 2EA3A 5EGMA 1ABJH 1K1OA 2P16A 1VZQH 1VR1H 1LHCH 2PKSB 5EW1H 2XC4A 3GY3A 4DG4A 1O2SA 2F9PA 2KAIA 5EQSA 5SGAE 5DP8A 3AW0A 5C1YA 3SUGA 3SUEA 4OS4A 2WV4A 1ANCA 2ZC9H 4IMZA 3R0FA 4LXBH 2XC0A 3RMNH 1Y5UT 3S7HB 1MZAA 1ZOMA 2ZFRH 1TYNA 2GCHG 1FPHH 1WSSH 1YLDA 1SOTA 1ESAA 1LMWB 4WH8A 1TWXB 3L6PA 3LT3A 1NRRH 2BHGA 4NA9H 2AGGX 2RA0A 1EZSC 4MDSA 1TX8A 2FOAA 4ABGA 2ZWLH 4KTSA 1MCVA 1MBQA 2BZAA 4I8JA 1W0YH 1HB0B 1XXFA 1QB9A 4MPUA 4A1TA 4O3TA 1S82A 4K3JA 3A7YA 3UR6A 4WMDA 6CHAC 1F0UA 4FUGA 4NA8A 1TFXA 5F8ZA 1SGEE 3GDUA 3P6ZB 4GAWA 3ATIA 4FVDA 2D8WA 1HAXB 1O3OA 2ZGBH 5JPMH 4NIYA 1F5RA 1YLCA 3BV9B 2O8LA 3RXCA 2BLOA 3VEQB 3SZNA 1Z8JB 3L3TA 1HAOH 4YOGA 2BVXH 2XW9A 2ZU3A 4ZKOU 4UDWH 1C2MA 4K2YA 1QA7A 4ZXYH 2A45B 1O2XA 1SGPE 2WUCA 1AY6H 2ZGXH 1H8IH 1MU6B 1OP0A 1UCYE 4VGCC 1KTTB 5FPYA 3GY5A 1UCYH 1PYTD 5A0CA 1BJVA 3GY2A 4TY6A 4ABAA 2H6MA 4ZKSU 2FWWA 1DY8A 1FY1A 1P06A 1DM4B 1P2NA 3DUXH 4Q80A 1P2KA 1C5SA 5F6MA 3PLKA 1Y5BT 2ZCKP 3UNQA 5HXFA 3Q3YA 5FCRA 3EDXB 1V2OT 2IOTA 3F9EA 1GMDF 2VNTA 1P9UA 2ZPQA 1UO6A 4I32A 3TGIE 1P3CA 1AKSA 2Z7FE 2ZU2A 3LDXH 2ZCLP 1CBWC 2QV1A 2HWLB 1GJ6A 2TGDA 3VB6A 1EJAA 2PKSC 1KLIH 1LDTT 3T28A 2CF8H 2FX4A 1N6XA 3KQBA 1P10A 3BEFB 1ARCA 1NFWA 2ZDAH 3PO1B 1C1OA 2Y7XA 3ATMA 1O3EA 3HK3B 1GHWH 1TONA 4BANB 3V3MA 3MU8A 2ZIQH 3C1KA 1QB1A 1GMHG 4CRAA 1GCTB 4THNH 2PGQB 4F4OC 2J95A 2ZGHA 5FXLA 1LPZB 1J15A 2JETB 1C1RA 1RXPA 3UUZA 3E1XB 1G3BA 1L2EA 1D3TB 2FOEA 3QN7A 4MNWA 7GCHG 1Y59T 5FCKA 1SL3A 2NU2E 5EPNA 4ABJA 1NTPA 1MD8A 4FUJA 1EP6A 1LVOA 1YC0A 3FP8E 2BMGB 4OS1A 3T26A 1XUJA 3BIVH 1Y3WA 1B5GH 2ZHEH 1LQDB 1P11E 1HCGA 2QXIA 3LGVA 3VPKA 1MU8B 4DURA 1K22H 4CBOA 1INCA 1TNKA 1EB2A 2PGBB 1GBHA 5E0GA 1A0HB 5E8EH 1DVAH 3BTDE 1RS0A 2BX4A 4Y11E 3STIA 3RM2H 2EEKA 3PB1E 3SU1A 1K9OE 4FUDA 4NWKA 5IYTA 1KSNA 3QZRA 3ZYDA 1MTNC 5GCHG 1O36A 1UTPA 1AHTH 1MKXK 4XE4A 2W3KA 1WTHD 3RXHA 1T4VH 1O3MA 3OY5U 1AUJA 3KHVA 1AB9B 4KKDA 1D6RA 1GBEA 1Y3VA 4AGKA 5T6DA 1GDUA 5IDKA 1D3PB 2ZFQH 1BTYA 4GCHG 2A7CA 1CO7E 3RXDA 3EGKH 3NUMA 2ZNKH 4ABIA 1RFNA 1YF4A 2XBVA 3KF2A 3U8TH 2D1JA 3TJOA 1PQ8A 1QBOA 2UWLA 4ASHA 4NWLA 3N7OA 1DXWA 1O3LA 1TE0A 1W14U 1TPSA 3LGWA 1KXCA 4D9QA 1Z8IB 4BAHB 4CR9A 3TNSA 1EASA 2FI4E 3BIUH 3A85A 4ZUHA 2HGTH 1ETRH 4X1RU 1QHRB 1V6DA 3T25A 3OTJE 4MPWA 2ALPA 2XYAA 4GLYA 2QIQA 4K60A 5H4IB 3ZZ8A 5FHTA 1OYQA 2XRCA 5GIBA 5PTPA 1MKXH 1MQ6A 3M5NA 7LPRA 4Y0ZE 2ZQ2A 2FS9A 1S81A 3EE0B 2FO9A 1S6HA 3CP7A 3PO1C 1FY3A 2ZFTA 3MNSA 3MWIU 1QRZA 3ENSB 2BDIA 2M5TA 1A5IA 1BHXB 2O8MA 2C8YB 1ZTLA 3LONA 2PWXA 1FXYA 1GCTC 1S5SA 4AG1A 1K21H 2XNIA 3MH5A 3NXPA 4BXSA 2JETC 3LGYA 1NY22 2ZU4A 2AEIH 1RRKA 5C1UA 4TWYA 2Y6TA 1OYTH 1C1WH 2A5IA 1DLEA 1CHOF 3ZZBA 5LPEA 1O31A 3PMJA 2WPLS 3Q77A 2QA9E 3LGTA 4ABEA 1P09A 1V2PT 1TGBA 1S6FA 2H1UA 2G52A 1TOCB 4WMFA 1QBNA 1J16A 3PLPA 3HGNA 3ATLA 4K1TA 5ABWA 3TH4H 3QGNB 4ZXXH 4AB8A 2UWOA 5FPTA 4MQAA 2UUJB 3RMLH 1A3BH 3TIUA 2QGRA 3ZZ9A 4YOIA 1V2UT 1FMGA 2EI6A 1OPHB 1K28D 3FP7E 1GGDB 1GI5A 1V2QT 2HOBA 3PM3A 3DFLA 3MO6A 4I31A 4D8NA 2A4OA 2F3CE 5ETXA 1Z6JH 4JZIA 1AB9C 1C1PA 1S83A 1YKTA 2O8TA 2HRVA 4BAQB 2OINA 1C5ZB 2HNTC 3SN8A 1BITA 1ZHPA 4MNVA 1FY8E 1NU7B 1T8MA 1ETSH 3FAOA 1GMDG 1BBRK 1CVWH 2HNTE 1O2VA 2ZQ1A 4WWYA 3D65E 1AFQB 4M7GA 2Z9LA 2Z9JA 5I25A 1EPTA 3MI4A 1ZSLA 3GYLB 1DXPA 1MMJN 4AFSA 3BTFE 1SGCA 1Q31A 3Q3XA 1FUJA 1JIRA 1NN6A 1EATA 2O9QA 2BZ6H 4JZFH 2BD8A 3M7TA 4HGCA 4OS6A 2J38A 2OC7A 3QLPH 1G30B 3HATH 1ANBA 1L1NA 2BVSH 3T5FH 2BTCE 1CGJE 1F7ZA 2NU3E 1BT7A 4H4FA 2R2MB 3ZZAA 4INLA 2HLCA 1UTJA 3K2UA 3RLWH 3VGCB 1UTOA 1EB1H 1O5GH 1P57B 3Q76A 3F1SB 2IJOB 3SO3A 1BRBE 2A4QA 1G2LA 2FODA 2A5KA 2ZGCA 4H42U 3SGAE 2OCVB 4NFEA 3SQEE 2VIWA 1AFEH 2W7UA 2SGQE 1QFKH 2C4FH 3A7TA 1DUAA 5ESTE 5C20A 5C3NA 2ANMH 2FOMB 2TPIZ 3SU3A 4FVBA 1DFPA 1PPHE 4B2AA 2SGAA 3OU0A 2OBOA 3QTOH 1EOLA 1GI6A 4HZHA 3TGKE 1AD8H 1O3HA 2D26C 1QGFA 1GI8B 2BDCA 1ABIH 2BX3A 4XBDA 1MD7A 1QA0A 1GI1A 3BTWE 3ZZDA 2GZ7A 1LKBA 3E0NB 1PFXC 4U32A 5AFZH 3B9FH 1O2LA 5HM2A 2DE9A 4K5ZA 2FLBH 1P12E 2ZO3H 3SU6A 1Q2WA 1SGNE 1SGFG 2GP9B 1JIMA 4BAMB 4IC5A 2OTVA 4A1XA 1SQOA 3MU4A 1EQ9A 3ZVBA 1DE7H 1GMCF 1P2OA 4B73A 5EQRA 1ELGA 2Z3EA
chains in the Genus database with same CATH superfamily
3UWJH 3ZZ4A 1W11U 3TH2H 1FN8A 5EU8A 1HFDA 3PTBA 2TGTA 1Z8RA 1GJ7B 1QQ4A 1NU9A 2K0QA 3SUDA 4UFEH 3K9XB 2RCEA 2H2ZA 3ZV9A 1OWDA 1UTNA 3M7UA 1GGDC 3SNBA 3WWBA 3SNAA 1YYY1 1MTVA 4JYUH 4FU8A 5EQQA 8GCHF 3MO3A 1ELBA 1UK2A 2OC8A 5CDFE 3BTTE 1J9CH 1IQKA 4IW4E 1CU1A 1C5UA 2EY4C 2AGIX 4F49A 1TMTH 1S0QA 3SQHE 1SG8B 6GCHG 1AFQC 1HRTH 4X2VA 3OX7U 3CENA 4E7NA 6ESTA 1ANDA 1O2PA 3STJA 1O5DH 3O8RA 4X6PA 4FUEA 1K1NA 5ESBA 3R3GB 3F9GA 1SSXA 4D7GA 2CJIA 3SU4A 1SQTA 6LPRA 2SGEE 1DY9A 4ABBA 3Q00A 5FAHA 1GHBF 1WQVH 1DANH 2JH0D 3MU1A 3SHCH 3DD2H 3LIWA 1ELDE 1WU1A 3BTQE 1ZRKA 1L4ZA 1OWJA 1TQ7B 1FNIA 5KEDA 2FEQH 3MYWA 3RXJA 1ZJKA 1CQQA 3GCOA 2C8ZB 3UIRA 4H6TA 1S6LA 1XKAC 4I8KA 1LHGH 3FANA 5HIYA 4NFFA 3VGCC 2J34A 1SGTA 2OC0A 1LHDH 1NFXA 2QF5A 3GDVA 2EC9H 2FX6A 2VIQA 2W3IA 2R9PA 4OS7A 3AW1A 1Z1JA 1QJ7B 3GY4A 1CA8B 1OWEA 4MVNA 3RXSA 3LOXA 2BLWA 5L2ZH 1CHOG 1C1TA 1JRSA 1PQ5A 4O97A 2GKVE 2PKAB 5EG4A 3T29A 1WTGH 1XVMA 2XWAA 2Z9GA 3I29A 1GG6B 4ABFA 5CHBA 1O2ZA 3RXMA 2ZGJA 3F2FA 2ZFSA 3D23A 4ZROA 1BMFD 1GBFA 1BIOA 1MTWA 3T27A 4WF8A 1GJDB 2ZF0H 1D3DB 3TVJB 3UFAA 1IHTH 5B6LA 3RXIA 2AERH 4X8SH 1C5MD 3T2NA 2QC2A 4FUFA 4R0IA 3ZZ5A 5E2PA 3A87A 1UTMA 2VVCA 3Q3KA 2OBQA 2ZTXA 2AFQB 3KQ5A 4D9RA 1J8AA 2P3TB 4NZQA 3M3SA 2WZQA 1YPGH 4AORA 2FXRA 1HIAB 1P9SA 1SGDE 1P01A 3HKIB 1KLJH 2GVFA 1GBBA 3GS9A 4YTAA 1HGTH 4P02A 2A2XH 3SV8A 2VWNA 2QY0B 2AHME 4RKOB 5GNDA 4ISNA 1H4WA 2BOHB 2PSXA 4X1SU 1THRH 1BMLA 1C2KA 1BDAA 1F0TA 5A09A 1O5AB 3UNRA 3HPTB 3UNSA 5JBAS 2W6JD 2W7SA 4ZAEA 5JB8S 2VVUA 2ILNA 3TNTA 1NRSH 1TMUH 2AIQA 2VGCB 2B7DH 1S84A 3RXRA 3ZYEA 3NRLA 4ZHMU 2KAIB 2RFKC 2HVYB 4D76A 3H7TA 1W13U 4X1NU 3VXFH 3EA9A 3KQDA 5EXMA 1MTNB 4D7FA 1OP2A 1UMAH 5CMXH 3BTEE 2SNVA 3LU9B 3TJVA 1ARBA 2TGPZ 4GHQA 3D49H 2KCOA 1SR5C 4JZDH 1MAYA 1CA0B 5HM9A 3CS7A 2ZDMA 1PYTC 3RDZA 4TYDA 1OWKA 2F43B 4AFUA 1JWTA 2CF9H 1TRYA 2EI7A 3FN8A 2WYJA 1ZTJA 4AC9A 3SNDA 1P2QA 3KIDU 2ODYB 3LJJA 4GPGA 1TBRH 1AWHB 1DUEA 4AGJA 5A8YA 1KXBA 2VIOA 1BRAA 3BTME 3KQEA 3ZZ3A 1IQGA 3W95A 1GVZA 5L2YH 2AIPA 5DO4H 2UUKB 1XUIA 1KIGH 2WUBA 1AMHA 1HJ8A 4Y71A 2ZP0H 5GDSH 3F2GA 3SGBE 2J4IA 1QNJA 1O2QA 1KDQA 1XMNB 4NIVA 2P93A 5EODA 3D62A 1GG6C 1C5YB 4BTTB 3V0XA 1GHYH 1C1NA 3OEHD 1GI0A 2GDDA 1O38A 5F53A 1GMCG 1MUEB 1PPGE 4Y8XA 1O3FA 5JBTA 1CE5A 1XUFA 2ZTZA 1TNLA 1AN1E 3M5MA 1T8OA 2ANKH 1LHEH 4Z0KA 1JXPA 2FI5E 3PWCA 1P02A 1C5PA 3URCA 1TNIA 4U2WA 5LGOA 1K1LA 4F48B 3DA9B 4BAOB 1BOQA 1YPHC 2BD4A 4I33A 4MG3A 1AE8H 1AWFH 1TNGA 2ESTE 2OK5A 4CRBA 1UK4A 4AG2A 8GCHG 1YPHE 3SGQE 3UOPA 2K1QA 4ZHLU 4FXGH 1SFIA 1W3CA 4JZ1A 3TK5A 5C17A 1FIZA 5DP3A 2Y81A 1C2IA 2Q6DA 3BTKE 1GBAA 4JZEH 1N6YA 2TIOA 4XOJA 1BQYA 2AYWA 4TWWA 3ZVAA 4ABDA 1AKSB 2CGAA 3E16B 4BXWA 2WPIS 3PRBA 1E34B 1W7XH 3SNCA 4I8HA 3ZV8A 4XDEA 1LTOA 5B6OA 4UE7H 1KYNA 2VGCC 1WAYB 3OE7D 1GL0E 3ZZ6A 1V2RT 2BXUH 5C2ZA 1E1QD 2QCYA 1QCPA 1KY9A 2FMJA 4LZ4B 1GHXH 1UK3A 4DIHH 3DHKH 1BMNH 4JK6A 3SORA 2BD5A 1WOFA 5FPSA 3FZDA 2V6NA 4MLFB 4ZKNU 1VJAU 1TPOA 2GX4A 3M61U 4KP0A 3SV6A 2FESH 2A4GA 4WJG2 2KCAA 3P95A 2ULLA 4HG6A 1ZJDA 1A5GH 1TRNA 1BZXE 2FOHA 1N1LA 1CA0C 2VH6A 1KMHB 1O3AA 4K8YA 8ESTE 4YXWD 1WUNH 2F9VA 3VB3A 1G9IE 3RXAA 3M37A 2ZZUH 3PWBA 2KFWA 4YT7H 5F8TA 5EXLA 5AHGH 1O2WA 1YPLH 3QTVH 1JRTA 2B5TB 2PR3A 1GBMA 4TT3D 3UR9A 3UY9A 1O2MA 3DSOA 1PJPA 1BA8B 4OGXA 1C2LA 1KXAA 1LPKB 1TPPA 3SZEA 1EKBB 3BG8A 1EZUC 2XBYA 4X0WU 2P3UB 1O2KA 2PW8H 2ZHFH 1XM1A 1S85A 2G51A 4IBLH 4XFQA 1PPFE 1EUFA 3ZVFA 1O3JA 2YNAA 2SNWA 4J1YA 2HPQH 2WPKS 2FLRH 4IS5A 1ZLRA 1GJCB 2FOBA 1QL9A 1D6WA 4KTCA 1TIOA 4AYYB 4FUCA 1IQFA 3NKKA 1XUHA 3DFJA 4E06H 1TLDA 3BEUA 4B2CA 1T8LA 4B1TA 1C2EA 3EA8A 1O2OA 1AQ7A 3U1IB 2VJ1A 3OY6U 4CRGA 1KTSB 1Z8GA 3CS0A 4HTCH 3S69A 3SJKA 4JYTA 1TGNA 4A5TS 1Y3YA 2XBXA 1HV7A 1AE5A 1F2SE 2TBSA 1HXFH 3RUOA 2Z94A 3KN2A 1SC8U 3TK6A 3P70B 1NT1A 4ABHA 2H5DA 4MNXA 1LO6A 1V2TT 1E38B 5JB9S 2XBWA 2ZDVH 1A7SA 1GBLA 3P92A 1J17T 3OEED 1SFQB 1O5FH 3E6PH 2ZFFH 2Y5HA 2PTCE 1ELVA 3K6ZA 1D9IA 1C2HA 2R3YA 1C5QA 4WMEA 5EW2H 3NWUA 3ITIA 1C5RA 1T31A 2AGEX 1OP8A 3FVFB 1HJ9A 5DGJA 2VIDA 1GWAA 5DJ7A 3OTPA 2BOKA 4X1PU 3UREA 3KL6A 2ZG0H 3NCLA 1FQ3A 2ZA5A 8KME2 4YM9A 1O2NA 2C90B 1FPCH 4UD9H 2STAE 4E05H 1DDJA 1K2I1 1A1RA 1DSUA 1BTWA 1VJ9U 2GGVB 3EQ0H 1ELEE 4ACAA 2BLQA 5TCCA 3A88A 1ESTA 1C9PA 1GDNA 2VWLA 2BDAA 1F5LA 2B9LA 4WVPE 3SU5A 3O8CA 5AVDA 2M2AA 3V7TA 3LJOA 1V2VT 1P2JA 1SGYE 2W5EA 1X7AC 2FI3E 1EOJA 1O2HA 3AVZA 1PPCE 4ISIH 2QXHA 1BTZA 5HKKD 3BTGE 3BG4B 2Y80A 2ZEBA 4FU9A 5E2OA 2SGDE 4WY3A 1E1RD 4RN6A 2IPHA 3RM0H 5T6GA 3RXGA 1P04A 3A8DA 4Q7XA 1TA2A 5FBIA 3VB4A 3IITA 4BAKB 1XX9A 4H6SB 5JBBS 3QO6A 1HAGE 2YOLA 1TRMA 3A80A 1L0ZA 4IMQA 2QE7D 9LPRA 3P8NA 4ZH8A 4BNRA 1W2KH 4DVAU 4QT8C 1YPJH 3V12A 3PV4A 2NU1E 2J94A 2JJ2D 3A89A 1IQEA 3UOUA 3SJOA 5A8XA 1TX7A 5TCAA 1BBRE 3EA7A 3TITA 1HJAB 1TPAE 2BY6X 3B8JA 1BBRH 1IOEA 3A7ZA 1P0SH 2PV9B 2QF3A 2PSYA 4Q7ZA 2PLXA 5FBEA 1NROH 4LZ1H 2JIZD 4MPXA 3L33A 3GISB 2C3SA 4UFFH 1S0RA 1B7XB 3SBKA 4AN7A 2VIPA 1W0ZU 3RMMH 4UEHH 4RT0A 1GBKA 2A4RA 2Z6BD 2OD3B 2DE8A 3JZ2B 5JYIA 2FZZA 5AFYH 1YLNA 2GJGA 3A84A 3QK1A 4A92A 5K0HA 2NWNA 3UQOA 1NRNH 3UWIA 2AMQA 2Y82A 3SV9A 1F0SA 1O34A 1G3CA 2ZTYA 2O8WA 2VU8E 3A7XA 4RSPA 2UUFB 1CT0E 2STBE 4CREA 2BQWB 1SQAA 1NBMD 1SGIB 3RU4E 3GCTF 4RKJB 2ZDKA 2L6OA 1O2YA 2QXGA 3MHWU 2A31A 5C1XA 2GTBA 4ZMAH 4Y6DA 1TA6A 1AVWA 1BRUP 1PQAA 1G36A 2G5VA 2J98B 2WINI 3U1JB 2ZI2H 4DT7B 1YBWA 3FFGA 4NCYA 1DX5M 1FY5A 1ZMJA 1IAUA 3EE7A 4YO9A 3ATWA 4UFDH 2P3FH 3RXUA 3MO9A 2ZDNA 1MKWK 1EAIA 3BTHE 1QL8A 3MU5A 1G32B 2FDAA 1DITH 1E35B 1H9LB 3MH7A 5T6FA 4A1VA 1P3EA 2ZHDA 3HKJB 1TGSZ 2PTNA 5DP5A 2I6QA 2VH0A 1C2GA 1GMHF 1RIWB 3MH4A 4LK4A 3KCGH 1M9UA 4I8LA 1IQIA 2CV3A 2QYIA 4WH6A 1GVKB 1MCTA 1GJ5H 1GHZA 2AMPA 2VWOA 1GJ8B 1UHBA 3BG4C 3ZVGA 2AS9A 1O2RA 1GI9B 3H5CB 4NIWA 4AYVB 3RXEA 1GJ9B 3QUMP 3N99A 3CNRA 1V2ST 4MTBA 3VB7A 4TPYA 1H1BA 7ESTE 2THFB 1W0JD 4JK5A 1HUTH 2XCFA 3BSQA 3GCHB 2ZKSA 3K65B 2AH4X 2ZU5A 1ZHRA 3EYDA 1NFYA 4I86A 3ODFA 2ZPRA 2GMTC 1AO5A 1LQEA 1HLTH 1EZXC 1MTUA 1A61H 1V2JT 1ZPZA 2BDHA 3W94A 3JZ1B 3MMGA 3SV7A 3SUFA 1COWD 3F0PA 1MKWH 5BPEA 4Z6AH 2FOFA 2H5CA 4TPIZ 2PFEA 3LGUA 1LHFH 4WXVA 1D4PB 3LC3A 1SLXB 1HJAC 2ODPA 2QF0A 2GD4B 5J4SA 1O39A 1SLUB 5GCHF 2WPHS 5DP7A 4X2XA 3IWMA 1O3NA 1H8DH 1G3EA 1HAVB 2VVVA 1QURH 4OS5A 2ZHQH 3TH3H 1IQNA 3TGJE 2WHXA 1H8ED 4AOQA 3AAVA 2G8TA 1H9HE 1O5EH 2G4UA 3LH3A 1O37A 2W26A 5EPYA 1O3PB 1YCPM 1E36B 1ELAA 2YNBA 2HALA 1BTPA 2GT7A 3QZQA 1LVYA 4A6LA 2BQ7B 4KGAA 3SI3H 2RDLA 3SYJA 3I78A 1FAXA 1A2CH 1SQRA 2BXTH 2Y7ZA 2VINA 3SI4H 5EXNA 3U8RH 2A5AA 1CGIE 5FX6A 2KM0A 1BB0B 1K1PA 4RT1A 1B0EA 1HBTH 1VKYA 2OC1A 3F68H 1DWCH 3S9AA 3FZZA 3F6UH 4UFGH 3P17H 3LKWA 1C2FA 4E7RG 1QY6A 1NZQH 4B74A 3GDSA 1QRXA 2KX4A 2OUAA 3PMHB 4IGDA 1SLWB 4CRCA 1GI3A 2Q6GA 2ALVA 1GI2A 2B8OH 3SJIA 1ZYOA 1QR3E 3E8LA 5F03A 1OSSA 1DOJA 4Z1MD 3VFEA 2BLVA 1O5BB 1RTLA 3TU7H 4FU7A 2ANWA 1DLKB 4BOHA 2QN5T 1BTHH 3F9HA 3SJ8A 1UCYK 4Q7YA 2NU4E 1AU8A 1HAHH 1U6QA 1XUKA 3VXEH 3TPIZ 1QL7A 2JDID 1RIWC 3KNXA 3MNXA 4GUXA 5HIZA 2OQ5A 3TK9A 1THSH 2NU0E 1A4WH 2VBCA 3KGPA 4X8VH 4YT6H 1O2IA 1Y3XA 1ZGIA 1V2KT 1GPZA 2TGAA 3UB0A 3U98H 1SLVB 4ISHH 2JKHA 1O2TA 1WYKA 4CH8B 1CT2E 3ZZ7A 5DP4A 2UWPA 1WQSA 1O2GH 2F9UA 1IQMA 1SGFA 1OS8A 2BDGA 5L6NH 4FUBA 4DCDA 4SGAE 4CRFA 3EAJA 2WV5A 3GCHC 1EJMA 1UTQA 4ASUD 3MU0A 3A83A 1ORFA 4HFPB 5FL7D 1HDTH 3I77A 4Y8YA 1ELTA 4HI3A 3F9FA 3ZVCA 5BRRE 3PMBB 1VITF 1ZMLA 4CHAB 4IC6A 3MNBA 2FPZA 2ZHWH 2F91A 1EAWA 1KLTA 1MQ5A 1L1JA 3PV2A 4GHTA 3LH1A 1C9TA 4P00A 1UTLM 1WBGB 1KXDA 1LVMA 2BM2A 3ATKA 4YOJA 1WCZA 3ZVDA 1SHYA 4DJZB 4MPVA 5DKMA 1C4Y2 1TQ0B 5HMAA 4ZHAA 1HAZB 1Y5AT 1FIWA 1NM6A 1RJXB 3F3BA 1W0KD 1UJ1A 3O8BA 1AVGH 4Y8ZA 4AZ2B 1N8OB 3V13A 2HLDD 3KEEA 4NIXA 1TBZH 3E3TA 3N7EA 2Q1JA 1C1UH 1VCWA 1MBMA 2ODQA 3GCTG 2FM2A 2VIVA 3HK6B 1BTUA 2BD9A 5DPAA 4KELA 1BUIA 2AMDA 2FYQA 1O35A 2G00A 1E79D 3KYFA 1SGQE 2R0LA 1SMFE 3DT0H 5L30H 1ZHMA 4K1EA 1RTKA 2OP9A 2ZDLA 1F5KU 2F9BH 1MZDA 2A7JA 4Q2KA 5K7RA 1A0JA 2ZFPH 4XD7D 1VITH 1QB6A 1FDPA 3BF6H 3DSPA 4ACBA 1MTSA 1SVPA 1C5NH 2OQUA 1IHSH 2FIRH 1V3XA 1JOUB 1ETTH 2UUYA 1GHAF 2BVRH 2RG3A 2RDEA 1UVUH 1TOMH 2BDYA 4JMYA 1W12U 2SFAA 1ELCA 1LPGB 2WV9A 3GY8A 3M5OA 4JYVH 2DUCA 5CE1A 4YESB 3RC4A 3RP2A 1TNJA 1ZPBA 2F83A 5E0HA 5KGOA 1KDQB 4CRDA 2QAAA 3ZZCA 3SHAH 1O0DH 1ZSKA 3ODDA 3TLOA 1ESBA 1O5CB 1O3GA 1QIXB 5F8XA 1GHBG 3A86A 5EJLA 3PMAB 1FONA 1W10U 4NG9H 4NZLA 3SOSA 1OX1A 1QRWA 4GVUA 2JJ1D 1C5WB 3OSYA 1XVOA 1P8VC 1E37B 1EJNA 1K1JA 3A8CA 2P8OB 1O2UA 1ZZZA 3S9CA 1Z7KA 1AZ8A 2H9EH 4WXIA 3QGJA 4DW2U 4XBBA 2BY9X 4JCNA 1C5VA 2BY5X 1EAUA 2R2WU 1OWIA 4YLQH 4U30A 1TNHA 1YPKH 1THPB 4DGJA 5EIYA 2FYRA 5A0BA 1OWHA 1DPOA 2A7HA 3A8AA 2ZPSA 1CHGA 1G37A 5GPIB 2CMYA 4CHAC 2HVXA 3E91A 4X2WA 1H9IE 4X8UH 1EXFA 3UQVA 2FOGA 3G01A 5C0UA 1BTXA 3NK8A 2KR7A 3BEIB 4Y10E 2ZU1A 1C2JA 1W8BH 4O9VA 1QJ6B 2D2DA 3ZVEA 2QF4A 3SU0A 1Y8TA 2J9NA 2VWMA 3K6YA 3RC6A 1VGCB 3SU2A 1FV9A 1ACBE 1RTFB 1SKYE 4ZKRU 2SGFE 4FUIA 4OGYA 3OFND 2CN0H 3RXVA 2F4LA 1EAXA 3AASA 1GI4A 2WPJS 1FN6A 2ZECA 5GJ4B 1D3QB 2EQNA 3U69H 1V2LT 3WWFA 5A8ZA 3U9AH 1TX6A 1C5OH 1N8OC 1ZSJA 3M5LA 1A3EH 2FOCA 3C27B 3QDZB 4O03A 3RXKA 5C5NA 4A7IB 1QJ1B 3QWCH 3PROA 4B75A 1EFRD 2LP6A 3MNCA 6GCHF 1NC6A 3PRDA 4I8GA 4I7YH 1ELFA 3LPRA 1NESE 1AGJA 1XUGA 3PYHA 3NZIA 1C1SA 3SNEA 1NRPH 3RXTA 1MAXA 1T8NA 1P2MA 2H9TH 4X1QU 2BYAX 2FS8A 4FUHA 1O3CA 4UONA 1DS2E 2G55A 2G5NA 2C93B 3KQCA 2BD3A 1VCQA 1O3BA 3QX5H 1ZMNA 7KMEH 2GV7A 1WV7H 3S9BA 1K1MA 2GV6A 4DIIH 4FOUC 1BMMH 1C1QA 5GXPA 3IG6B 4B76A 5DK1A 3GY6A 3LC5A 1E0FD 2JH5D 1FLEE 2WYGA 1PPEE 4O3UA 3RMOH 1C4V2 1SI5H 3TJUA 1YCPK 2ZCHP 3VB5A 1NRQH 1L4DA 1GBCA 3MOCA 1O3KA 1K1IA 3RXQA 1O3IA 4X6OA 2FP7B 2HNTF 5C67A 1YP9A 2HPPH 1FJSA 1O33A 2B0FA 3P8FA 1IQHA 2WPDD 3MH6A 4ISOA 4B6FA 1TAWA 4NSVA 1HAYB 4OS2A 4Y79A 1LVBA 3FOAA 3GY7A 2P8OC 4IN1A 1BRCE 4NSYA 2H9HA 2SGPE 1UTKA 5A0AE 3GCNA 2P59A 1AZZA 2I6SA 3AK5A 1AIXH 1VITG 2XCNA 3UPEA 4KTUA 5JDUB 1YGCH 1GBDA 3T62A 1UVTH 1TALA 4INKA 2J2UA 1KXFA 1O32A 3E90B 5FX5A 2XXLA 1GI7B 3RU4T 2GCHF 1IQJA 1FZZA 1SOZA 2CHAB 3PLBA 4K8BA 3A7WA 3FO8D 3RXBA 1YCPH 1OOKB 1PQ7A 1TMBH 3HGPA 4Y7BA 5AF9H 1GBTA 1C2DA 1GBIA 2FTMA 4INHA 3H7OA 4YZUA 8LPRA 3P8GA 3DSGA 2O8UA 1P2IA 1SPJA 5JBCS 3B23B 3SV2H 1VGCC 1T4UH 2PP6A 1BHXF 4AFZA 2GDEH 3GYMA 1GJ4H 2BB4A 2BY7X 4B2BA 4YLUA 4AFQA 3ESTA 1FAKH 2GZ9A 4ESTE 4Y0YE 2Y5GA 2GMTB 1BCUH 1TB6H 1QTFA 4X2YA 5TJXA 9ESTA 1C1MA 1HNEE 1GDQA 1ZTKA 5LPRA 3RXFA 1G2MA 2KCPA 5HGGA 1V2NT 2QXJA 2V3OH 1C5LH 3A82A 4Y76A 5DP6A 1DICA 1P03A 1W7GH 3S7KB 2RA3A 1KXEA 4X8TH 5I46H 1AVXA 2R0KA 2BD7A 3NPSA 1NPMA 1YM0A 2V35A 1HAIH 5GWZA 4XBCA 1GHAG 3W1EA 4IN2A 1IQLA 5CHAB 2J98A 1A5HA 1NO9H 1Q3XA 1ZR0A 1C5XB 1DWEH 1DWBH 2BD2A 2PUQH 5LPFA 1TGCA 5DG6A 1BMAA 1ID5H 3GOVB 3LGIA 3UAIC 2FTLE 2IN2A 1GCDA 1Z6EA 3MTYA 4U01A 1EPTB 2CXVA 1O2JA 5EJ1A 2C8XB 2YMSD 1P05A 4PROA 5LH8A 4NGAH 3BN9A 2GCTB 1BJUA 3A8BA 2XTTB 1SBWA 1PPZA 1DWDH 4X6NA 3TJNA 4DY7B 1MH0A 1T7CA 1UVOA 1LCYA 4CH2B 2BQ6B 4AB9A 3RLYH 2GT8A 5E0JA 1EP5A 1EX3A 4AX9H 3PTNA 2F9OA 1VCPA 4OM9A 1A0LA 4BTIB 3M36A 1SB1H 1OKXA 1UVPA 2BY8X 1GBJA 2IJD1 1DSTA 1HPGA 2WPMS 3F0OA 4LOYH 3M3VA 4X6MA 2Y5FA 3RU4D 1O30A 1PPBH 4R8TB 1TGTA 1TBQH 1AUTC 1GJBB 5J4QA 2C8WB 2Z3CA 1CGHA 2V3MA 1TABE 1L1GA 2EI8A 3N7DA 2XOKD 2PHBA 2Q6FA 1QBVH 1RD3B 2Z9KA 2KCYA 3P8OA 4GSOA 5A2MH 1RGQA 1OXGA 1ZRBA 2XC5A 2OXSA 2V3HH 1C1VH 1T32A 3RC5A 2CHAC 2IPQX 3ZIAD 1FX0B 5EOKA 1NFUA 3A7VA 2LNCA 2LPRA 3ELAH 2R3UA 6CHAB 3A81A 1O3DA 1CSOE 2PUXB 2GZ8A 1QQUA 1XXDA 5HYOA 3U8OH 2XWBI 1GJAB 4B71A 3OYPA 3S0NA 7GCHF 1HAVA 1V2MT 2BDBA 4Y7AA 2WSSD 2PKAA 1Z1IA 4K69A 3M35A 3M7QA 3MFJA 1G3DA 4CBNA 3SJ9A 2Z9IA 3E0PB 1LKAA 1ZGVA 3H09A 4XSKU 3URDA 1YPMH 1GVLA 2F9NA 1ANEA 1FY4A 1J14A 1Z71A 3M3TA 2P95A 2JH6D 5T3HA 3AAUA 2G4TA 4SGBE 1V2WT 5G4BA 4J2YB 4VGCB 1AI8H 5EJZA 2A0QB 1NS3A 2OLGA 2J92A 4BTUB 1CT4E 1YPEH 1C5TA 3RXLA 1HXEH 4Q4LA 3GICB 5DP9A 4MNYA 1HAPH 1FI8A 3SW2B 1UVSH 2G81E 1HIAA 4DOQA 3UTUH 2V0BA 5CHAC 1SHHB 1GHVH 1HYLA 1DT2A 1F92A 1GL1A 2A2QH 3WY8A 1WDIA 1A46H 5IK2D 2ASUB 4GCHF 4ISLA 4TY7A 4CR5A 1Y3UA 1UHBB 2ANYA 1EPTC 1JMOH 2VB0A 4NA7A 1C4U2 2A32A 1F0RA 3FP6E 1ZPCA 2A1DB 3O8DA 2GCTC 3RXPA 1EZQA 2Z3DA 5C5OA 4K1SA 1JBUH 2P94A 1SGRE 1XKBC 1B0FA 3RXOA 1CBWB 2TRMA 2EA3A 5EGMA 1ABJH 1K1OA 2P16A 1VZQH 1VR1H 1LHCH 2PKSB 5EW1H 2XC4A 3GY3A 4DG4A 1O2SA 2F9PA 2KAIA 5EQSA 5SGAE 5DP8A 3AW0A 5C1YA 3SUGA 3SUEA 4OS4A 2WV4A 1ANCA 2ZC9H 4IMZA 3R0FA 4LXBH 2XC0A 3RMNH 1Y5UT 3S7HB 1MZAA 1ZOMA 2ZFRH 1TYNA 2GCHG 1FPHH 1WSSH 1YLDA 1SOTA 1ESAA 1LMWB 3PV5A 4WH8A 2KZ4A 1TWXB 3L6PA 3LT3A 1NRRH 2BHGA 4NA9H 2AGGX 2RA0A 1EZSC 4MDSA 1TX8A 2FOAA 4ABGA 2ZWLH 4KTSA 1MCVA 1MBQA 2BZAA 4I8JA 1W0YH 1HB0B 1XXFA 1QB9A 4MPUA 1H8HD 4A1TA 4O3TA 1S82A 4K3JA 4DT4A 3A7YA 3UR6A 4WMDA 6CHAC 1K0HA 1F0UA 4FUGA 4NA8A 1TFXA 5F8ZA 1SGEE 3GDUA 3P6ZB 4GAWA 3ATIA 4FVDA 2D8WA 1HAXB 1O3OA 5KECA 2ZGBH 5JPMH 4NIYA 1F5RA 1MABB 1YLCA 3BV9B 2O8LA 3RXCA 2BLOA 3VEQB 3SZNA 1Z8JB 3L3TA 1HAOH 4YOGA 2BVXH 2XW9A 2ZU3A 1YY3A 4ZKOU 4UDWH 1C2MA 4K2YA 1QA7A 4ZXYH 2A45B 1O2XA 1SGPE 2WUCA 1AY6H 2ZGXH 1H8IH 1MU6B 1OP0A 1UCYE 4VGCC 1KTTB 5FPYA 3GY5A 1UCYH 1PYTD 5A0CA 1BJVA 3GY2A 4TY6A 4ABAA 2H6MA 4ZKSU 2FWWA 1DY8A 1FY1A 1P06A 1DM4B 1P2NA 3DUXH 4Q80A 1P2KA 1C5SA 5F6MA 3PLKA 1Y5BT 2ZCKP 3UNQA 5HXFA 2LELA 3Q3YA 5FCRA 3EDXB 1V2OT 2IOTA 3F9EA 2V7QD 1GMDF 2VNTA 1P9UA 2ZPQA 1UO6A 4I32A 3TGIE 3MQKC 1P3CA 1AKSA 2Z7FE 2ZU2A 3LDXH 2ZCLP 1CBWC 2QV1A 2HWLB 1GJ6A 4F55A 4RI0A 2L74A 2TGDA 3VB6A 1EJAA 2PKSC 1KLIH 1LDTT 3T28A 2CF8H 2FX4A 1N6XA 3KQBA 1P10A 3BEFB 1ARCA 1NFWA 2ZDAH 3PO1B 1C1OA 2Y7XA 3ATMA 3U28C 1O3EA 3HK3B 1GHWH 1TONA 4BANB 3V3MA 3MU8A 2ZIQH 3C1KA 1QB1A 1GMHG 4CRAA 1GCTB 4THNH 2PGQB 4F4OC 2J95A 2ZGHA 5FXLA 1LPZB 1J15A 2JETB 1C1RA 1RXPA 3UUZA 3E1XB 1G3BA 1L2EA 1D3TB 2FOEA 3QN7A 4MNWA 7GCHG 1Y59T 5FCKA 1SL3A 2NU2E 5EPNA 4ABJA 1NTPA 1MD8A 4FUJA 1EP6A 1LVOA 1YC0A 3FP8E 2BMGB 4OS1A 3T26A 1XUJA 3BIVH 1Y3WA 1B5GH 2ZHEH 1LQDB 1P11E 1HCGA 2QXIA 3LGVA 3VPKA 1MU8B 4DURA 1K22H 4CBOA 1INCA 1TNKA 1EB2A 2PGBB 1GBHA 2J97A 5E0GA 1UW7A 1A0HB 3OAAD 5E8EH 1DVAH 3BTDE 1RS0A 2BX4A 4Y11E 3STIA 3RM2H 1WXRA 2EEKA 3PB1E 3SU1A 1K9OE 4FUDA 4NWKA 5IYTA 1KSNA 1YWUA 3QZRA 3ZYDA 1MTNC 5GCHG 1O36A 1UTPA 1AHTH 1MKXK 4XE4A 2W3KA 1WTHD 3F2HA 3RXHA 1T4VH 1O3MA 3OY5U 1AUJA 3KHVA 1AB9B 4KKDA 1D6RA 1GBEA 1Y3VA 4AGKA 5T6DA 1GDUA 4FETA 5IDKA 3VG8A 1D3PB 2ZFQH 1BTYA 4GCHG 2A7CA 1CO7E 3FKSD 3RXDA 3EGKH 3NUMA 4B6EA 2ZNKH 4ABIA 1RFNA 1YF4A 2XBVA 3KF2A 3U8TH 2D1JA 3TJOA 1PQ8A 1QBOA 2UWLA 2J5UA 4ASHA 4NWLA 3N7OA 1DXWA 1O3LA 1TE0A 1W14U 1TPSA 3LGWA 1KXCA 4D9QA 1Z8IB 4BAHB 4CR9A 3TNSA 5C94A 1EASA 2FI4E 3BIUH 3A85A 4ZUHA 1QZ8A 2HGTH 1ETRH 4X1RU 1QHRB 1V6DA 3T25A 3OTJE 4MPWA 2ALPA 2XYAA 4GLYA 2QIQA 4K60A 5H4IB 3ZZ8A 5FHTA 1OYQA 2XRCA 5GIBA 5PTPA 1MKXH 1MQ6A 3M5NA 7LPRA 4Y0ZE 2ZQ2A 2FS9A 1S81A 3EE0B 2FO9A 1S6HA 3CP7A 3PO1C 1FY3A 2ZFTA 3MNSA 3MWIU 1QRZA 3ENSB 5T1VA 2BDIA 2M5TA 1A5IA 1BHXB 2O8MA 2C8YB 1ZTLA 3LONA 2PWXA 1FXYA 1GCTC 1S5SA 4AG1A 1K21H 2XNIA 3MH5A 5C0TA 3NXPA 4BXSA 2JETC 2YMSB 3LGYA 1NY22 2ZU4A 2AEIH 1RRKA 5C1UA 4TWYA 2Y6TA 1OYTH 1C1WH 2A5IA 1DLEA 1CHOF 3ZZBA 5LPEA 1O31A 3PMJA 2WPLS 3Q77A 2QA9E 3LGTA 4ABEA 1P09A 1V2PT 1TGBA 4ZCNA 1S6FA 2H1UA 2G52A 1TOCB 4WMFA 1QBNA 1J16A 3PLPA 3HGNA 5DSFA 4M9FA 3ATLA 4K1TA 5ABWA 3TH4H 3QGNB 4ZXXH 4AB8A 2UWOA 5FPTA 4MQAA 4TSFD 2UUJB 3RMLH 1A3BH 3TIUA 2QGRA 3ZZ9A 4YOIA 1V2UT 1FMGA 2EI6A 1OPHB 1K28D 3FP7E 1GGDB 1GI5A 1V2QT 2HOBA 3PM3A 3DFLA 3MO6A 4I31A 4D8NA 2A4OA 2F3CE 5ETXA 1Z6JH 4JZIA 1AB9C 1C1PA 1S83A 1YKTA 2O8TA 3DCLA 2HRVA 4BAQB 2OINA 1C5ZB 2HNTC 3SN8A 1BITA 1ZHPA 2XNDD 4MNVA 1FY8E 1NU7B 1T8MA 1ETSH 3FAOA 1GMDG 1BBRK 1CVWH 2HNTE 1O2VA 2ZQ1A 4WWYA 2CK3D 3D65E 1AFQB 4M7GA 2Z9LA 2Z9JA 5I25A 1EPTA 3MI4A 1ZSLA 3GYLB 1DXPA 1MMJN 4AFSA 3BTFE 1SGCA 1Q31A 3Q3XA 1FUJA 1JIRA 1NN6A 1EATA 2O9QA 2BZ6H 4JZFH 2BD8A 3M7TA 4HGCA 4OS6A 2J38A 2OC7A 3QLPH 1G30B 3HATH 1ANBA 1L1NA 2BVSH 3T5FH 2BTCE 1CGJE 1F7ZA 2NU3E 1BT7A 4H4FA 2R2MB 3ZZAA 4INLA 2HLCA 1UTJA 3K2UA 3RLWH 3VGCB 1UTOA 1EB1H 1O5GH 1P57B 2W6ID 3Q76A 3F1SB 2IJOB 3SO3A 1BRBE 2A4QA 1G2LA 3WW7A 2FODA 2A5KA 2ZGCA 1OHHD 4H42U 3SGAE 2OCVB 4NFEA 3SQEE 2VIWA 1AFEH 2W7UA 2SGQE 5DN6D 1QFKH 2C4FH 3A7TA 1DUAA 5ESTE 2YMSC 2K8IA 5C20A 5C3NA 2ANMH 2FOMB 2TPIZ 3SU3A 4FVBA 1DFPA 1PPHE 4B2AA 2SGAA 3OU0A 2OBOA 3QTOH 1EOLA 1GI6A 4HZHA 3TGKE 1AD8H 1O3HA 2D26C 1QGFA 1GI8B 2BDCA 1ABIH 2BX3A 4XBDA 1MD7A 1QA0A 1GI1A 3BTWE 3ZZDA 2GZ7A 4XRNA 1LKBA 4Q63A 3E0NB 1PFXC 4U32A 5AFZH 3B9FH 1O2LA 5HM2A 2DE9A 4K5ZA 2FLBH 1P12E 2ZO3H 3SU6A 1NBME 1Q2WA 1SGNE 1SGFG 2GP9B 1JIMA 4BAMB 4IC5A 2OTVA 4A1XA 1SQOA 3MU4A 1EQ9A 3ZVBA 1DE7H 1GMCF 1P2OA 3KYGA 5EQRA 4B73A 1ELGA 2Z3EA
chains in the Genus database with same CATH topology
3UWJH 3ZZ4A 1W11U 3TH2H 1FN8A 5EU8A 1HFDA 3PTBA 2TGTA 1Z8RA 1GJ7B 1QQ4A 1NU9A 3SUDA 4UFEH 3K9XB 2RCEA 2H2ZA 3ZV9A 1OWDA 1UTNA 3M7UA 1GGDC 3SNBA 3SNAA 1YYY1 1MTVA 4JYUH 4FU8A 5EQQA 8GCHF 3MO3A 1ELBA 1UK2A 2OC8A 3BTTE 1J9CH 1IQKA 4IW4E 1CU1A 1C5UA 2AGIX 4F49A 1TMTH 1S0QA 3SQHE 1SG8B 6GCHG 1AFQC 1HRTH 4X2VA 3OX7U 3CENA 4E7NA 6ESTA 1ANDA 1O2PA 3STJA 1O5DH 3O8RA 4X6PA 4FUEA 1K1NA 5ESBA 3R3GB 3F9GA 1SSXA 4D7GA 2CJIA 3SU4A 1SQTA 6LPRA 2SGEE 1DY9A 4ABBA 3Q00A 5FAHA 1GHBF 1WQVH 1DANH 2JH0D 3MU1A 3SHCH 3DD2H 3LIWA 1ELDE 1WU1A 3BTQE 1ZRKA 1L4ZA 1OWJA 1TQ7B 1FNIA 2FEQH 3MYWA 3RXJA 1ZJKA 1CQQA 3GCOA 2C8ZB 3UIRA 4H6TA 1XKAC 4I8KA 1LHGH 3FANA 4NFFA 3VGCC 2J34A 1SGTA 2OC0A 1LHDH 1NFXA 3GDVA 2EC9H 2FX6A 2VIQA 2W3IA 2R9PA 4OS7A 3AW1A 1Z1JA 1QJ7B 3GY4A 1CA8B 1OWEA 4MVNA 3RXSA 3LOXA 2BLWA 5L2ZH 1CHOG 1C1TA 1JRSA 1PQ5A 4O97A 2GKVE 2PKAB 5EG4A 3T29A 1WTGH 1XVMA 2XWAA 2Z9GA 3I29A 1GG6B 4ABFA 1O2ZA 3RXMA 2ZGJA 2ZFSA 3D23A 4ZROA 1GBFA 1BIOA 1MTWA 3T27A 4WF8A 1GJDB 2ZF0H 1D3DB 3TVJB 3UFAA 1IHTH 3RXIA 2AERH 4X8SH 1C5MD 3T2NA 2QC2A 4FUFA 4R0IA 3ZZ5A 5E2PA 3A87A 1UTMA 2VVCA 3Q3KA 2OBQA 2ZTXA 2AFQB 4D9RA 1J8AA 2P3TB 4NZQA 3M3SA 1YPGH 4AORA 2FXRA 1HIAB 1P9SA 1SGDE 1P01A 3HKIB 1KLJH 2GVFA 1GBBA 4YTAA 1HGTH 2A2XH 3SV8A 2VWNA 2QY0B 4RKOB 4ISNA 1H4WA 2BOHB 2PSXA 4X1SU 1THRH 1BMLA 1C2KA 1BDAA 1F0TA 5A09A 1O5AB 3UNRA 3HPTB 3UNSA 5JBAS 2W7SA 4ZAEA 5JB8S 2VVUA 2ILNA 3TNTA 1NRSH 1TMUH 2AIQA 2VGCB 2B7DH 1S84A 3RXRA 3ZYEA 4ZHMU 2KAIB 4D76A 3H7TA 1W13U 4X1NU 3VXFH 3EA9A 3KQDA 5EXMA 1MTNB 4D7FA 1OP2A 1UMAH 5CMXH 3BTEE 2SNVA 3LU9B 3TJVA 1ARBA 2TGPZ 4GHQA 3D49H 1SR5C 4JZDH 1MAYA 1CA0B 5HM9A 3CS7A 2ZDMA 1PYTC 3RDZA 4TYDA 1OWKA 4AFUA 1JWTA 2CF9H 1TRYA 2EI7A 2WYJA 1ZTJA 3SNDA 1P2QA 3KIDU 2ODYB 3LJJA 4GPGA 1TBRH 1AWHB 1DUEA 4AGJA 5A8YA 1KXBA 2VIOA 1BRAA 3BTME 3KQEA 3ZZ3A 1IQGA 3W95A 1GVZA 5L2YH 2AIPA 5DO4H 2UUKB 1XUIA 1KIGH 2WUBA 1AMHA 1HJ8A 4Y71A 2ZP0H 5GDSH 3SGBE 2J4IA 1QNJA 1O2QA 1KDQA 1XMNB 4NIVA 2P93A 5EODA 3D62A 1GG6C 1C5YB 4BTTB 3V0XA 1GHYH 1C1NA 1GI0A 2GDDA 1O38A 1GMCG 1MUEB 1PPGE 4Y8XA 1O3FA 5JBTA 1CE5A 1XUFA 2ZTZA 1TNLA 1AN1E 3M5MA 1T8OA 2ANKH 1LHEH 4Z0KA 1JXPA 2FI5E 3PWCA 1P02A 1C5PA 3URCA 1TNIA 4U2WA 5LGOA 1K1LA 3DA9B 4BAOB 1BOQA 1YPHC 2BD4A 4I33A 4MG3A 1AE8H 1AWFH 1TNGA 2ESTE 4CRBA 1UK4A 4AG2A 8GCHG 1YPHE 3SGQE 3UOPA 2K1QA 4ZHLU 4FXGH 1SFIA 1W3CA 4JZ1A 3TK5A 1FIZA 5DP3A 2Y81A 1C2IA 2Q6DA 3BTKE 1GBAA 4JZEH 1N6YA 2TIOA 4XOJA 1BQYA 2AYWA 4TWWA 3ZVAA 4ABDA 1AKSB 2CGAA 3E16B 4BXWA 2WPIS 1E34B 1W7XH 3SNCA 4I8HA 3ZV8A 4XDEA 1LTOA 5B6OA 4UE7H 1KYNA 2VGCC 1WAYB 1GL0E 3ZZ6A 1V2RT 2BXUH 5C2ZA 2QCYA 1QCPA 1KY9A 2FMJA 4LZ4B 1GHXH 1UK3A 4DIHH 3DHKH 1BMNH 4JK6A 3SORA 2BD5A 1WOFA 5FPSA 3FZDA 2V6NA 4MLFB 4ZKNU 1VJAU 1TPOA 2GX4A 3M61U 4KP0A 3SV6A 2FESH 2A4GA 4WJG2 3P95A 2ULLA 1ZJDA 1A5GH 1TRNA 1BZXE 2FOHA 1N1LA 1CA0C 2VH6A 1O3AA 4K8YA 8ESTE 1WUNH 2F9VA 3VB3A 1G9IE 3RXAA 3M37A 2ZZUH 3PWBA 4YT7H 5F8TA 5EXLA 5AHGH 1O2WA 1YPLH 3QTVH 1JRTA 2B5TB 2PR3A 1GBMA 3UR9A 3UY9A 1O2MA 1PJPA 1BA8B 4OGXA 1C2LA 1KXAA 1LPKB 1TPPA 1EKBB 3BG8A 1EZUC 2XBYA 4X0WU 2P3UB 1O2KA 2PW8H 2ZHFH 1XM1A 1S85A 2G51A 4IBLH 4XFQA 1PPFE 1EUFA 3ZVFA 1O3JA 2YNAA 2SNWA 4J1YA 2HPQH 2WPKS 2FLRH 4IS5A 1ZLRA 1GJCB 2FOBA 1QL9A 1D6WA 4KTCA 1TIOA 4AYYB 4FUCA 1IQFA 3NKKA 1XUHA 3DFJA 4E06H 1TLDA 3BEUA 4B2CA 1T8LA 4B1TA 1C2EA 3EA8A 1O2OA 1AQ7A 3U1IB 2VJ1A 3OY6U 4CRGA 1KTSB 1Z8GA 3CS0A 4HTCH 3S69A 3SJKA 4JYTA 1TGNA 4A5TS 1Y3YA 2XBXA 1HV7A 1AE5A 1F2SE 2TBSA 1HXFH 3RUOA 2Z94A 3KN2A 1SC8U 3TK6A 3P70B 1NT1A 4ABHA 2H5DA 4MNXA 1LO6A 1V2TT 1E38B 5JB9S 2XBWA 2ZDVH 1A7SA 1GBLA 3P92A 1J17T 1SFQB 1O5FH 3E6PH 2ZFFH 2Y5HA 2PTCE 1ELVA 3K6ZA 1D9IA 1C2HA 2R3YA 1C5QA 4WMEA 5EW2H 3NWUA 3ITIA 1C5RA 1T31A 2AGEX 1OP8A 3FVFB 1HJ9A 5DGJA 2VIDA 1GWAA 5DJ7A 2BOKA 4X1PU 3UREA 3KL6A 2ZG0H 3NCLA 1FQ3A 2ZA5A 8KME2 4YM9A 1O2NA 2C90B 1FPCH 4UD9H 2STAE 4E05H 1DDJA 1K2I1 1A1RA 1DSUA 1BTWA 1VJ9U 2GGVB 3EQ0H 1ELEE 2BLQA 5TCCA 3A88A 1ESTA 1C9PA 1GDNA 2VWLA 2BDAA 1F5LA 2B9LA 4WVPE 3SU5A 3O8CA 5AVDA 3V7TA 3LJOA 1V2VT 1P2JA 1SGYE 2W5EA 1X7AC 2FI3E 1EOJA 1O2HA 3AVZA 1PPCE 4ISIH 2QXHA 1BTZA 3BTGE 3BG4B 2Y80A 2ZEBA 4FU9A 5E2OA 2SGDE 4WY3A 4RN6A 2IPHA 3RM0H 5T6GA 3RXGA 1P04A 3A8DA 4Q7XA 1TA2A 5FBIA 3VB4A 3IITA 4BAKB 1XX9A 4H6SB 5JBBS 3QO6A 1HAGE 2YOLA 1TRMA 3A80A 1L0ZA 4IMQA 9LPRA 3P8NA 4ZH8A 4BNRA 1W2KH 4DVAU 4QT8C 1YPJH 3V12A 3PV4A 2NU1E 2J94A 3A89A 1IQEA 3UOUA 3SJOA 5A8XA 1TX7A 5TCAA 1BBRE 3EA7A 3TITA 1HJAB 1TPAE 2BY6X 3B8JA 1BBRH 1IOEA 3A7ZA 1P0SH 2PV9B 2QF3A 2PSYA 4Q7ZA 2PLXA 5FBEA 1NROH 4LZ1H 4MPXA 3L33A 3GISB 2C3SA 4UFFH 1S0RA 1B7XB 3SBKA 4AN7A 2VIPA 1W0ZU 3RMMH 4UEHH 1GBKA 2A4RA 2Z6BD 2OD3B 2DE8A 3JZ2B 5JYIA 2FZZA 5AFYH 3A84A 3QK1A 4A92A 5K0HA 2NWNA 3UQOA 1NRNH 3UWIA 2AMQA 2Y82A 3SV9A 1F0SA 1O34A 1G3CA 2ZTYA 2O8WA 2VU8E 3A7XA 4RSPA 2UUFB 1CT0E 2STBE 4CREA 2BQWB 1SQAA 1SGIB 3RU4E 3GCTF 4RKJB 2ZDKA 1O2YA 2QXGA 3MHWU 2A31A 5C1XA 2GTBA 4ZMAH 4Y6DA 1TA6A 1AVWA 1BRUP 1PQAA 1G36A 2G5VA 2WINI 3U1JB 2ZI2H 4DT7B 1YBWA 3FFGA 4NCYA 1DX5M 1FY5A 1ZMJA 1IAUA 4YO9A 3ATWA 4UFDH 2P3FH 3RXUA 3MO9A 2ZDNA 1MKWK 1EAIA 3BTHE 1QL8A 3MU5A 1G32B 2FDAA 1DITH 1E35B 1H9LB 3MH7A 5T6FA 4A1VA 1P3EA 2ZHDA 3HKJB 1TGSZ 2PTNA 5DP5A 2I6QA 2VH0A 1C2GA 1GMHF 1RIWB 3MH4A 4LK4A 3KCGH 1M9UA 4I8LA 1IQIA 2CV3A 2QYIA 4WH6A 1GVKB 1MCTA 1GJ5H 1GHZA 2AMPA 2VWOA 1GJ8B 1UHBA 3BG4C 3ZVGA 2AS9A 1O2RA 1GI9B 3H5CB 4NIWA 4AYVB 3RXEA 1GJ9B 3QUMP 1V2ST 4MTBA 3VB7A 4TPYA 1H1BA 7ESTE 2THFB 4JK5A 1HUTH 2XCFA 3BSQA 3GCHB 2ZKSA 3K65B 2AH4X 2ZU5A 1ZHRA 3EYDA 1NFYA 3ODFA 2ZPRA 2GMTC 1AO5A 1LQEA 1HLTH 1EZXC 1MTUA 1A61H 1V2JT 1ZPZA 2BDHA 3W94A 3JZ1B 3MMGA 3SV7A 3SUFA 1MKWH 5BPEA 4Z6AH 2FOFA 2H5CA 4TPIZ 2PFEA 3LGUA 1LHFH 4WXVA 1D4PB 3LC3A 1SLXB 1HJAC 2ODPA 2QF0A 2GD4B 5J4SA 1O39A 1SLUB 5GCHF 2WPHS 5DP7A 4X2XA 3IWMA 1O3NA 1H8DH 1G3EA 1HAVB 2VVVA 1QURH 4OS5A 2ZHQH 3TH3H 1IQNA 3TGJE 4AOQA 3AAVA 2G8TA 1H9HE 1O5EH 2G4UA 3LH3A 1O37A 2W26A 5EPYA 1O3PB 1YCPM 1E36B 1ELAA 2YNBA 2HALA 1BTPA 2GT7A 3QZQA 1LVYA 4A6LA 2BQ7B 4KGAA 3SI3H 2RDLA 3I78A 1FAXA 1A2CH 2BXTH 2Y7ZA 2VINA 3SI4H 5EXNA 3U8RH 2A5AA 1CGIE 5FX6A 1BB0B 1K1PA 1B0EA 1HBTH 2OC1A 3F68H 1DWCH 3S9AA 3FZZA 3F6UH 4UFGH 3P17H 3LKWA 1C2FA 4E7RG 1QY6A 1NZQH 4B74A 3GDSA 1QRXA 2OUAA 3PMHB 4IGDA 1SLWB 4CRCA 1GI3A 2Q6GA 2ALVA 1GI2A 2B8OH 3SJIA 1ZYOA 1QR3E 3E8LA 5F03A 1OSSA 1DOJA 3VFEA 2BLVA 1O5BB 1RTLA 3TU7H 4FU7A 2ANWA 1DLKB 4BOHA 2QN5T 1BTHH 3F9HA 3SJ8A 1UCYK 4Q7YA 2NU4E 1AU8A 1HAHH 1U6QA 1XUKA 3VXEH 3TPIZ 1QL7A 1RIWC 3KNXA 3MNXA 4GUXA 2OQ5A 3TK9A 1THSH 2NU0E 1A4WH 3KGPA 4X8VH 4YT6H 1O2IA 1Y3XA 1ZGIA 1V2KT 1GPZA 2TGAA 3U98H 1SLVB 4ISHH 2JKHA 1O2TA 1WYKA 4CH8B 1CT2E 3ZZ7A 5DP4A 2UWPA 1WQSA 1O2GH 2F9UA 1IQMA 1SGFA 1OS8A 2BDGA 5L6NH 4FUBA 4DCDA 4SGAE 4CRFA 3EAJA 2WV5A 3GCHC 1EJMA 1UTQA 3MU0A 3A83A 1ORFA 4HFPB 1HDTH 3I77A 4Y8YA 1ELTA 4HI3A 3F9FA 3ZVCA 5BRRE 3PMBB 1VITF 1ZMLA 4CHAB 4IC6A 3MNBA 2FPZA 2ZHWH 2F91A 1EAWA 1KLTA 1MQ5A 1L1JA 4GHTA 3LH1A 1C9TA 1UTLM 1WBGB 1KXDA 1LVMA 2BM2A 3ATKA 4YOJA 1WCZA 3ZVDA 1SHYA 4DJZB 4MPVA 5DKMA 1C4Y2 1TQ0B 5HMAA 4ZHAA 1HAZB 1Y5AT 1FIWA 1NM6A 1RJXB 1UJ1A 3O8BA 1AVGH 4Y8ZA 4AZ2B 1N8OB 3V13A 3KEEA 4NIXA 1TBZH 3E3TA 2Q1JA 1C1UH 1VCWA 1MBMA 2ODQA 3GCTG 2FM2A 2VIVA 3HK6B 1BTUA 2BD9A 5DPAA 4KELA 1BUIA 2AMDA 2FYQA 1O35A 2G00A 1SGQE 2R0LA 1SMFE 3DT0H 5L30H 1ZHMA 4K1EA 1RTKA 2OP9A 2ZDLA 1F5KU 2F9BH 1MZDA 2A7JA 4Q2KA 5K7RA 1A0JA 2ZFPH 1VITH 1QB6A 1FDPA 3BF6H 1MTSA 1SVPA 1C5NH 2OQUA 1IHSH 2FIRH 1V3XA 1JOUB 1ETTH 2UUYA 1GHAF 2BVRH 2RG3A 1UVUH 1TOMH 2BDYA 4JMYA 1W12U 2SFAA 1ELCA 1LPGB 3GY8A 3M5OA 4JYVH 2DUCA 5CE1A 4YESB 3RC4A 3RP2A 1TNJA 1ZPBA 2F83A 5E0HA 4CRDA 1KDQB 2QAAA 3ZZCA 3SHAH 1O0DH 1ZSKA 3ODDA 3TLOA 1ESBA 1O5CB 1O3GA 1QIXB 5F8XA 1GHBG 3A86A 3PMAB 1FONA 1W10U 4NG9H 4NZLA 3SOSA 1OX1A 1QRWA 4GVUA 3OSYA 1C5WB 1XVOA 1P8VC 1E37B 1EJNA 1K1JA 3A8CA 2P8OB 1O2UA 1ZZZA 3S9CA 1Z7KA 1AZ8A 2H9EH 4WXIA 3QGJA 4DW2U 4XBBA