3AB0A

Crystal structure of complex of the bacillus anthracis major spore surface protein bcla with scfv antibody fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
136
structure length
136
Chain Sequence
GLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSKFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isolation, kinetic analysis, and structural characterization of an antibody targeting the Bacillus anthracis major spore surface protein BclA.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Immune system
molecule keywords BclA protein
total genus 22
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18573 BclA_C BclA C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ab0A00
2QDNA 1PK6B 2QE3A 4QQ2A 4RSUA 5KWRA 2WNUA 4F3JA 5CIRA 1JH5A 1D2QA 1U5XA 4TSVA 4KG8A 2HEVF 4OUSA 1D4VB 2WNVB 4QQPA 2R6QA 3L9JT 4KGGA 4D7YA 4HT1T 2JG9C 2WNVC 2KA3A 3URFA 1C28A 4NN0A 2WNVA 2JG8B 3V56A 2RJKA 1S55A 4DB5A 2JG9A 3QBQA 2Z5WA 1XU2A 4N90A 2Q8OA 2TNFA 1XU1A 4OULA 2WNUC 2JG9B 1KD7A 3K51A 4GIQA 3K48A 1PK6A 3B93A 1GR3A 4MXWA 2WNUB 2JG8C 2R30A 1RJ7A 2OIIA 1U5YA 2O0OA 4DOUA 1TNFA 3MI8A 4QQLA 1O91A 5HBAA 2HEYF 3QD6A 2JG8A 1DU3D 3ME2A 4MXWB 5KC6A 4E4DX 5L19A 1A8MA 1D0GA 1OSGA 4QPYA 1IQAA 4E4SA 3FC0A 2X29A 3B94A 2R32A 1PK6C 1JTZX 2RJLA 1DG6A 4MXVA 1I9RA 4OUMA 2ZJCA 2TUNA 2RE9A 1RJ8A 3IT8A 1C3HA 4QQHA 5L36A 3TYJA 5BNQA 2E7AA 1U5ZA 1OQDA 4MSVA 5TSWA 2Q1MA 3TWIA 1KXGA 3ALQA 1TNRA 1OQEA 3WD5A 3LKJA 4J6GA 4G4FA 2ZPXA 2HEWF 3AB0A 4EN0A 4KGQA 2AZ5A 1ALYA 4TWTA 1WCKA 3B9IA 4QQOA 5KC5A 4G3YC
chains in the Genus database with same CATH superfamily
4TLFA 4D7TA 1A8DA 5H9RA 3BU7A 2P34A 1MZ6A 3WOGA 1XSQA 3USSA 1EPZA 4NRPA 4I0BA 3UGHA 4CDUA 3VZMA 3UETA 3KVAA 1UXZA 3PUIA 3AL5A 3KSCA 1QNWA 1XPWA 1JHJA 2VOXA 5LK5A 5SV8A 2ADEA 4LTAA 2NZ9A 2VMGA 5A32A 2PHLA 5FO7B 5A3UA 4XMAA 1BMV1 2MEV2 2ADDA 4UF0A 3WT3A 2W39A 3TBDA 5G04L 2EXHA 3WDWA 1YJKA 2BYVE 2VMFA 1MZ5A 5CEHA 2WC2A 1W6OA 4LUKA 4GMP3 1B35B 1MS0A 2BNOA 2WAOA 3ES4A 1RHI1 3FFZA 3KGLA 5T5PA 2RJKA 3RJ2X 5T52A 3U1XA 2VY0A 1VBD2 5EHDA 5FOBB 1HLCA 4B4QA 5E16A 4Y24A 2VTXJ 4Q27A 1CAXB 4JDNA 2HBUA 2Y6GA 3VKLA 5I0RA 1UY3A 1AYM1 3AKTA 3LDKA 2YBSA 3FBYA 4OHVA 4QX2A 1F2NA 5T5JA 3SC7X 4URAA 3S5AA 4M4RA 3MF9A 1LOBA 4LE4A 3LF7A 3PIGA 1UYZA 5JXJA 3RI8A 2WYFA 5IATA 3H7JA 2QZ2A 3ON7A 3R05A 5HV0A 3RZLA 3HPNA 2JDYA 2HEYF 3MPPG 3QD6A 4HKOA 4XAAA 2WFF1 3RJRA 2R49A 4K6BA 5AFEA 1S2EA 3I2HA 4LQRA 1NZIA 5L9BA 3VD9A 3OY8B 4PIZA 1IHMA 1H4HA 4DUVA 2D40A 2XLGA 1VMJA 5DUUA 2VZUA 1DZTA 3ENRA 2JKBA 2RMU3 3ZFEB 1AXZA 3C7GA 4CP9B 5DXDA 4DZGA 4P5HA 1GZWA 1RHI3 4AI9A 3LQCA 3WR0A 1H9WA 4A2UA 4Q4V1 4C90A 5JMOA 3AP5A 1AL0G 4IV1A 2VXRA 2CU5A 4IETA 2DTYA 2YBKA 1J83A 2EXKA 1DCSA 1D0HA 3VHPA 3VZLA 4I3GA 3THPA 1G8WA 3ZSLA 1C3HA 3KHBA 2ZACA 4YZ3A 2ZGLA 5J48A 1CPNA 4D8MA 1JZ2A 1HB1A 2E7AA 2WWJA 4HANA 3VGIA 2OVUA 3GHNA 2WFF3 3IDEA 4ZU4A 4BA6A 3VBUC 4CP1A 3I97A 2Z42A 5C5TA 1MEC3 1C4RA 1D4M3 1VRH1 1PGW2 1SQ4A 3AZWA 5DG2A 4Q0QA 5DG1A 2ILMA 4MYEA 1XNBA 1HXS2 1TNRA 5FRAA 2HWE1 1SBEA 3KF5A 4XUTA 1UY2A 3VBFC 5FMOS 4AL9A 1BEV3 3VDDB 3N9OA 4P9LA 3O1OA 2ZHMA 5L7OB 3ZOIA 4S2FA 2EXJA 1NYWA 3J8F3 1GNHA 5FQ0B 1JYXA 4MGIE 2YC0A 3GALA 4JV4A 4LLOA 5EZWA 2VUDA 4O9GA 3T1MA 4XFHA 4ZPIA 4YPJA 3EO6A 3U4XA 2QJVA 4JVAA 1NZCA 2XQXA 2YYOA 1SLIA 4IEWA 1ZX5A 4QDSA 2D3PA 3GGLA 4IQPA 2ZBJA 2VQTA 2P17A 2RM21 2XJTA 3D8CA 5T50A 3SHRA 4QAWA 2PYTA 1VBA1 1VBB1 1WGPA 4ZS3A 1J1LA 3ZFFB 3AP9A 2BVBA 1ZZCA 1ZBE1 3PVOA 1JODA 5LK7B 4PF1A 2VBPA 3DKWA 4CSWA 5FZGA 3DF0A 2DCTA 1W6OB 2BFUS 2GH8A 3RFRA 4XAEA 1COV2 4ITCA 4OLLA 4CDWB 2Q0AA 1AR62 1BEV2 1HRI3 4LT5A 1N47A 3O1RA 3VBFB 5FZ4A 4Y1ZA 4Y4RA 2WO7A 4HFSA 4BLIA 1CIYA 1UZWA 2A1XA 5F5AA 4PF5A 1BKZA 2BERA 5CB7A 4A44A 3OD4A 5K0UB 1PGSA 4LBOA 2XJSA 2WQ4A 3GXUA 4XCAA 1XBFA 2ZKNA 5FZ1A 3RVHA 4GIQA 1UKGA 4LHKA 1REDA 1ZZ6A 3TOJA 1H30A 4CUCA 2GNMA 2BNMA 3MHZA 5J98B 2UU8A 5DAVA 2YV8A 4OI2A 4Y1YA 5JPMB 3O5SA 1KRIA 4PDWA 3BTYA 1HDKA 1MZFA 4XXAA 1WLTA 1IG0A 4PBOA 1AJKA 1D4M2 2C9AA 4PDWC 2PA7A 4XF0A 5CFCB 3E1F1 4QQLA 4H3WA 1UZ0A 1ULOA 2A6WA 3B7MA 3BTXA 1IS3A 1JZ4A 2JKXA 5L19A 1JW6A 2CDOA 3NSTA 5JXIA 2ES3A 3E5QA 5APAA 5IVVA 1WD3A 4CEYB 5C8WA 4YARA 4Q1PA 2R0HA 1WCUA 4OI1A 2G4IA 5FWEA 5FPAA 4IV1B 3B9CA 1W06A 1W0PA 2PHUA 5FY1A 1R093 1PIV3 2RS52 3GDBA 1K5MB 2VJXA 5I0SA 3U07A 2WS91 3TN92 1ZRDA 1XYOA 3RGBA 5C4WB 2WIIB 3I2DA 1V6JA 1XNKA 2A7AA 4O65A 2ZAAA 1BK0A 5DPNA 5LA0A 2UWCA 4AWDA 2GALA 5JUVA 2F17A 1VLNA 1DYPA 4HOOA 5H9SA 4XIOA 3ZO0B 2VNRA 3ZYBA 1FPN3 1ZZ8A 2RR11 4E4HA 4YM2A 2Q1FA 3BN6A 4M01A 4IERA 1AVBA 3S7IA 4XABA 1LOEA 1PVC1 1DQ1A 3OUIA 5F5QA 3USUB 4AEDB 4Q4V3 1CAVA 3WDYA 4LK7A 1R083 3FLPA 5FYMA 4RFT0 1NLQA 3OGRA 1UY0A 1FOD2 1NY72 3SITA 4LOTA 1UYYA 2OXBA 2VUAA 3B5LB 1YCIA 5IHRA 1VAMA 3NAPA 4EN9B 1VP6A 1YXWA 4NIAA 2GNTA 2PQQA 4YFWA 5LBCA 1POQA 2ARBA 1W04A 5F8PA 4XXPA 2O8OA 2VZRA 3DGTA 1ND3B 5FCCA 1MACA 2JIGA 4AFDA 4RS5C 1OFSA 4UOJA 2ZA9A 1PK6B 4IDZA 4PLOA 4FXKB 3CQOA 3H8XA 3MIFA 1VBC2 1RUD3 4ISQA 5FYZA 4IEOA 3O1UA 4TSVA 4YG0A 2LW8A 1HV1A 3PU3A 4QQPA 1CR7A 2ARCA 5BY5A 3WDUA 3WP3A 1GUIA 3SH4A 5JAXA 1APNA 1JYIA 1H4GA 3MLLA 4QPIA 5C9AA 2QNKA 4B1MA 1RUI1 1RUF2 5IK5A 1ZYBA 4UAPA 3ACLA 5C9AC 3N9QA 2C0ZA 5IVJA 4QKNA 4P9GA 2YY1A 3OTFA 4E2QA 3WQ1A 2D44A 1W39A 3MV01 3TEXA 4OCTA 2W1WA 5D8AA 1SLCA 2IZWA 5FYVA 5JI7A 3VZNA 1XU1A 2BBVA 1POV1 4AE2A 1KD7A 4B1LA 3OUJA 3WDTA 3EJKA 1QOSA 2P5BA 4RS5A 5KHGA 4QXHA 3M3OA 2DCZA 4BXSV 4N53B 2FZ1A 1UW8A 2W52A 1YC61 1NX9A 2A6ZA 4LKDA 1C8M2 1CVNA 5BV6A 1SBDA 2KR2A 3ZR6A 4GH4C 1H1MA 4DOUA 3WDXA 3HNBM 1JXNA 5DUXA 3HNYM 1K5JA 3TNPB 3WG2A 1LHVA 4CDQC 4XILA 2WZR2 2VG9A 5C7GA 1Q8VA 4XHXA 4M0HA 4OHYA 2R071 3NMBA 2HWD1 2VW2A 4LA3A 1YLLA 3UNPA 5FPVA 3DUIA 5JSOA 4YZ2A 3IDCB 4CEYA 4GQ7A 2W08A 3UGGA 3NV2A 2JXAA 3GJAA 5BYNA 4GMP0 1G6NA 3F2ZA 4BQ4A 3S57A 3VDBA 3B94A 3MFCA 2YC2A 1UZYA 1YQCA 1PNFA 4IEPA 5L73A 4CUBA 4YVSB 2DV9A 1PMIA 1U12A 3MO4A 1DG6A 5FYYA 1JYTA 2HYXA 4MXVA 4YW1A 4ZU5A 2ZJCA 4S2GA 4GALA 3S7EA 2DUQA 1ND2C 1Y43B 2C1FA 1V6KA 4COVA 3TEWA 3RZGA 1NXMA 4BIOA 5FY5A 4MGTA 3GBFA 2Q1ZB 2Y8KA 3PJYA 4K1YA 5JR7B 4IEUA 5L9RA 5ABJB 4CXWA 3TNQA 1UO9A 1IPJA 2K46A 1K45A 4MGYE 2BGCA 1B35C 3ZDSA 3UKNA 1VBE3 3N9NA 3O0WA 4CCLA 4OYUA 2J1RA 2JDZA 4NIHA 1EV12 1GQPA 5BNOA 1NA1C 2GP5A 1W28A 4UF0B 3USUA 5IVFA 5M0TA 5T55A 3BCWA 2VR4A 3AP7A 2PXJA 4Q0UA 1RUJ2 4NAMA 1LNSA 1FNZA 1S2BA 1GZWB 3CBNA 3H1WA 3I59B 4P9WA 4Y20A 2VW0A 3H0OA 1W8OA 3FWEA 4JZRA 4OHZA 3VD5A 5JZGA 1Z7S3 4E8CA 1H8TA 3E5XA 4YVSA 2D97A 4MH0E 5FPZA 4LPLA 5DAXA 2XPJA 3MPBA 3SCGA 3HAGA 2NN8A 2W9XA 2YBPA 4JX0A 4CPBA 1ZRFA 3EHKA 4JKKA 4RHV1 4O61A 5A33A 1GNZA 5KC5A 4COUA 4TTGA 1MQTA 1J59A 5C4WC 2XKPA 4PBPA 5KXEA 4OZOA 4DFSA 1CWPA 2ORZA 3LFMA 3ELNA 3POSA 3TB0A 2WNUA 1WW6A 3RS6A 1BVVA 1QXPA 5F2WA 3U0ZA 1OUXA 1HJFA 5LBFA 3UK9A 4B3NA 1WCDJ 5DDJ3 2WRAA 3RZZA 3E5UA 3BU0A 2TEPA 3AJYA 2YMZA 1W2TA 2R6QA 2VZSA 5HXMA 1XJAA 4MHRA 5FLJA 3CU7A 5FZLA 4B4RA 3WNMA 1X36A 1BMV2 4RFRB 3GJBA 2DURA 2PN5A 4E2GA 1QJU3 4XVHA 2GN3A 4OMCA 3URFA 5FZEA 4N7IA 2PHFA 2VZTA 5C3PA 4FPLA 3LCPA 4LLFA 2WNVA 2WT2A 3GM8A 3I3DA 5FZFA 2UWBA 4R9AA 1G9BA 5KHIA 1GP4A 1DQ4A 3PVEA 4DPNA 5CFDB 5FYUA 1LCLA 1IPKA 1ODNA 3VHRA 2CL2A 3K48A 4LMFA 1ULDA 2WZ8A 4H7LA 3WNNA 4CU6A 1COV3 5E8AA 4B4PA 3H8RA 5AC93 2GMEA 1ZBA3 2DFBA 3DPRC 3WG3A 5JXGA 3AYAA 3KQRA 3RDIA 1IOAA 1EV13 3MI8A 5C5UA 1NA1A 4I0AA 2XGXA 4V1PA 2ZS6B 1AUYA 1ZZBA 3A7QA 3ME2A 1AR63 1IPSA 1UD1A 2XJRA 3Q9OA 2JD9A 4HSLA 5HXVA 3VBFA 1SG3A 3KQ4B 2ZHKA 1QMJA 1XNAA 2VOWA 3RYPA 4W65A 2JDUA 2OW4A 2VMEA 4GJYA 5ACA2 5JDBA 4AAXA 3N35A 5J36A 5J96B 3P3PA 2LS6A 5FZAA 3IAQA 2FCUA 5CA6A 1ACCA 4CCMA 5IYYA 5JR2A 4CCDA 1LOFC 1IZ3A 4JGYB 3EMRA 3GZEA 5CFCC 5GZDA 1ULGA 3BVCA 5E6HA 2Q4SA 4AFBA 2Y38A 2RS31 1GP5A 3POJA 1H1IA 1T6BX 2RDSA 4QPGC 2GC1A 3WQBA 3CZJA 1W9YA 1OFNA 5DDJ1 3GZTB 1BCXA 2XHKA 2Z69A 4GWNA 2VZPA 2VQUA 5F9TA 1LOAA 3ZN4A 3LA7A 1DQ6A 4NIDA 2ZX3A 1O6UA 2J1AA 2JWPA 2Z79A 4NE9A 1RUE2 3PMEA 5BNPA 2D3SA 3EQEA 3DYMA 1W9SA 1RUC1 3KF3A 2LROA 2P4EA 2BFUL 2K2SA 3U4SA 2I74A 4V2WA 2YROA 5IJRA 1K42A 4ONUA 4EN0A 3N3HA 3MIEA 5CISA 4NJ4A 5T54A 3G7DA 4XJZA 1VBE2 1DZRA 3H8OA 1O3TA 1AR81 1TE1B 1O4YA 1KFUL 5DAQA 2Y60A 4BYYA 1SPPB 2ZX0A 4A7KA 2RS33 5JSRA 1PNGA 5FREA 4RQPC 1QY4A 5FYIA 4LBQB 1S0EA 3DYOA 4Q29A 2AEYA 3MLKA 4RSUA 4AI8A 4CP0A 1G9AA 4YZ4A 2BDRA 1UMHA 1IQDC 3D4KA 4HPKA 4F3JA 2C24A 2VD7A 3UYJA 2QQPA 5G05L 1AR93 5KXCA 3MDPA 1KS5A 4R52A 2JX9A 1CAVB 2GC2A 4ZY9A 4DINB 4ISRA 5FY4A 4FAGA 1ENRA 4ASKA 1W6NA 3NNGA 3GCWA 2JG9C 1J3RA 5LB6A 5FIXA 1VBC3 4KU7A 5GLTA 5GZCA 3ZXEA 1HX6A 5H9PA 3OBAA 3ZXAC 1S0GA 1YEWA 2PAKA 2R043 1FYUA 3O12A 4W6WA 1NCQA 4CEWB 1CX1A 3B69A 4CCCA 2ZEYA 5FQ0A 4LUMA 5K9YA 5EV7A 1DQ5A 3A23A 1MZEA 1TME2 3H1YA 2XWJB 4PLMA 4Y26A 3B3QE 3BB6A 2JE8A 4J1WA 4CDUC 5HCAA 5F5CA 3W5MA 1PGL1 1FOD3 4FOWA 4BQWA 1H9PA 1RIRA 4AR2A 5F3CA 2VO5A 3MYXA 3WP4A 2ZX4A 3PIJA 4QGMA 4F7ZA 2R061 1NE6A 5B2GB 3K3NA 1OOPA 2OIIA 5F37A 2DU1A 4FTSA 5GLVA 1V6OA 3I4IA 5GLZA 1SCSA 1J1TA 2YZ4A 3IBMA 4MADA 3VKFC 1QH6A 2W5FA 5DZGA 5LWBA 3LAGA 5FYHA 5A6XA 1YFUA 5FTTC 3FJSA 4D3WA 2HWC2 1GMMA 1YI9A 2F4LA 4KWJA 1WLWA 1DLCA 1TQ5A 4MZUA 1DFQA 2P37A 1QJX3 1AR83 3CL1A 3K3OA 3WCSA 4YZ5A 2DUPA 4BHPA 1V70A 3ZM8A 3ZVXA 1GNYA 3FC0A 2EALA 2VOTA 3WUDA 1E5HA 3UJQA 1PO23 2GZWA 2VMIA 3JD73 2QFEA 1HV0A 4BQ5A 4FCAA 1JTZX 4LR4A 2J1EA 2X8KA 3KWVA 4Q5OA 3AKPA 4JGYC 2HKXA 3N7MA 2MEV1 2RS51 4FTEA 3VBHC 1V6IA 1OUSA 3X29B 3ZDVA 4CP9A 1QQP2 4FFHA 5FK8A 5FY7A 1HN0A 3KZ4C 2YC4A 4PDWB 2NMNA 4XTMA 3VN4A 3THTA 2XL9A 4R4ZA 1RHI2 4GXLA 5LATA 1OMIA 1AX1A 2X5IC 1WKYA 3GZAA 3I7DA 3ECQA 2XJPA 3A22A 3HIFA 3TWIA 4KNCA 1H2KA 1QJZA 2AREA 4JGZA 1C8NA 4KBZA 4XZUG 1Q8PA 4NRQA 3ZSJA 4B29A 4QB2A 3NV3A 4GJZA 4Y33A 4ZONA 4F8AA 1RUNA 2BWAA 4YVWB 4IGPA 4FPFA 4QMAA 4YW2A 3B9IA 2C5DA 4E8DA 1K5MC 4Q4W1 4XEZA 5ABJA 2BGOA 1HRI2 2A73B 4D6QA 1BBT1 3CIHA 2WFF2 3IPVA 4NHKA 1POV0 4KWUA 2WZR3 1UX7A 3FN9A 1JH5A 2VCCA 2BW8A 4AI2A 1JZ7A 3ROUA 2D5FA 4XBLA 2HLEA 4XJWA 1W8FA 4RN5A 3MICA 1DGLA 3VHOA 1IS4A 1DGRA 1XSRA 4MHUA 5C70A 1N1SA 1MS4A 1DHKB 1JU4A 1O8PA 4LKFA 1URXA 4WM8A 3GF6A 1A3KA 1YQ2A 3FZ3A 3ZPOA 1X9TA 1O5LA 3OG2A 5DN2A 4GKYA 5CFDC 4Q4Y2 5A70A 4A6SA 1MS1A 1S2KA 4FPHA 3VB9A 4AVAA 1QHDA 4BMBA 4JKMA 1JYVA 5IFPA 3BTZA 2AEZA 2V73A 3DN7A 4YZ1A 2BVVA 2ZMKA 4L0PA 1KS4A 3WNPA 1OLMA 1SFPA 1XE7A 1ONAA 4NRMA 1W6QB 2FDKA 1ULPA 4ES9A 3OBZA 1V9U3 5FYCA 4AFMA 2DVGA 2VVFA 2Z2SB 5FXWA 1PK6A 3TEYA 2PHDA 3V0BA 3EB7A 2HWE2 4LO7A 2XJVA 3ATGA 1C57A 4C91A 1EP0A 1QDCA 1V00A 2JDKA 1QU0A 3I2KA 3Q8CA 3I2GA 4R4XA 3T0AA 3RMYA 4ASLA 2WLQA 3POFA 1Q56A 5HBAA 1W2OA 3BOPA 1CAUA 2ZGMA 5CZKA 1ASJ2 3MV11 3VBUA 1N1YA 4MXWB 2DUOA 2GMMA 2ZGPA 1OT5A 3MIBA 4ZU7A 1HQLA 3HJRA 4P02B 4EZHA 2XBO3 2ZKLA 1VAVA 1UZZA 2L9LA 2XG3A 3VBSA 1QEXA 1Z78A 3RPQA 5CFCA 4QGLA 1I1EA 1N3QA 1TMF2 4L99A 1LULA 1US3A 3M4FA 4TN7A 4CDWC 3KLSA 1GWMA 4PI2A 3WVJA 4AG4A 3BTAA 2YG0A 5A33B 2E32A 2GP3A 3IM0A 3AP6A 3VUOA 1ZBE2 2BTVC 4CDXB 5SV5A 1F4AA 1MEC1 4BM8A 2G9ZA 2RS11 2ZGSA 1QWRA 1MVQA 1JOBA 5L36A 5A3TA 2VPVA 4UW4A 3T2TA 1REFA 1RUC3 2ZEWA 1HW5A 3W21A 4RGAA 4UYBA 1H8VA 1VBD1 3WP6A 3D0SA 2BEOA 2IVIB 1RUH1 1D7PM 3O1VA 4OHWA 2GC3A 2VTXA 4NWWA 3ILRA 3OYWB 1QF3A 5FLIA 5IVEA 4NR1A 3BUCA 4HN1A 4KL1A 3O1TA 1X7NA 2ZX2A 5ANNA 4DS0A 3K4AA 1U0AA 4JC1A 5LW9A 4ZS2A 5F2SA 1KQRA 5LZ6A 4IE7A 1PM4A 2ATFA 3A4UA 3NV1A 4RR3C 3WD5A 2E9QA 4A45A 5BNNC 1UNBA 4GH4B 4KG0A 5A80A 4G4FA 3RMXA 4IGQA 4NAOA 3PTRB 4JGYA 2W1SA 3M1HA 3NNMA 1VAKA 1NLRA 3OCPA 5F6KA 4FFGA 4AEDA 1MS9A 2E31A 4QQOA 3WX5A 2W91A 4YW7A 5FPLA 4XTPA 4QM9A 1WBFA 4RHV2 3K2OA 4R9DA 1H0BA 3U14A 5HPOA 1RMU1 1RITA 4KWLA 4NMIA 5LRSA 5BPXA 5E88A 2KM2A 4NHMA 3DKQA 4NIIA 1XB9A 2P3IA 3T1LA 3C3VA 4LA2A 3AZZA 4AEKA 3J7MA 1PX4A 5BNPB 4CA9A 1RUE3 1B35A 3PUAA 4KGGA 1Y7BA 3RG0A 1B09A 2UY9A 3U75A 3JCIA 5CVRA 3W20A 2WLPA 1WMXA 5I93A 2CHHA 5FZIA 5FZ9A 3WNKA 3VBOB 4CDQA 2WS92 2XDVA 4YNIA 4N43B 3R0RA 2AACA 5ACA3 3ASIA 3AMNA 3V56A 1AX2A 1DGWA 3KCXA 1CZTA 3W5NA 1S55A 4JTNA 2PMWB 4QM8A 4ARYA 1YQ8A 4TZDA 2ZHNA 3CLPA 1NAEA 4N90A 4FP3A 4XBQA 5FZOB 1HB2A 4Z2AA 3RZHA 3OF1A 3WDVA 3K51A 4A7ZA 3RRDA 3C2UA 1VMFA 3OUHA 1PVC2 2IXCA 3IN9A 4DEVA 2DBIA 1GWLA 2WNUB 2J1TA 2V5YA 4HL0A 4QKDA 5JOZA 2QCSB 3M3CA 1SHWB 3LA3A 4BCUA 5FY9A 1Y9MA 5HI0A 2IWGB 2VECA 2H6BA 4UFHA 3KT7A 4FSJA 1JZ8A 5CAZA 3JBG1 4XOGA 3SCFA 2R063 2YFUA 2D43A 4B7EA 3LSDA 1GZ9A 2UYAA 1YFWA 2JG8A 2XUEA 4O7XA 4WM7B 1V9U2 2ZZJA 4BIFA 3LE0A 5FBZA 4EN8B 1Y9QA 3KD4A 2EF6A 1UN1A 3WSOA 3SCHA 3POGA 4CPBD 5J37A 2YXSA 1UKRA 2ZGUA 3L2YA 2ZX1A 3FFQA 1ND2A 2AC1A 5A3OA 3VBRC 2WA3A 4BQ2A 4TLGA 4AAPA 1OVPA 3LEMA 3NKTA 4N43C 5ACA1 4FI9A 3H9AA 1QOTA 2A6YA 1RUOA 2IUWA 4K8FA 3JU9A 1KGYA 4HZFA 4E2SA 3P1IA 3QLQA 4XUPA 4UBHA 3N9MA 4QKFA 1IG3A 1WWYA 2D7FA 3HD8B 2NP0A 3IT8A 2EIGA 5ISLA 1BEV1 5BNQA 1U5ZA 1W99A 1OOPC 2E7TA 1RINA 2VQ0A 3PNAA 4N9HA 3CJIB 2IXKA 3J4UH 3A21A 2FBEA 2Q1MA 3IMNA 4YLZA 4Z82A 2E51A 4E9KA 1XNCA 4YM0A 4R9CA 2VH9A 3VLBB 3WZ1A 4BU2A 3ALQA 3CHXA 4EN6B 1HB4A 1ZM1A 1GOHA 1PIV1 2J22A 4P9XA 4QPGA 2FMDA 3I54A 1OQEA 4FFIA 4C0HA 3JD72 4FPEA 1JU3A 4QKBA 3QH7A 4J6GA 4UFLA 4BH9A 3AVRA 1RUC2 3N7JA 1NCQB 4QXBA 4CEWA 1D4M1 1BLZA 1VRH3 3BODA 2CY6A 4NWVA 4Z92B 4C1XA 1C8M1 2VCMA 2UURA 1LEMA 3Q8BA 4TWTA 1WCKA 4IV3B 4BDVB 3WF0A 1W8NA 1AR82 2A75A 2PLV3 3AMHA 2W47A 3M70A 4WVMA 1LB2A 4QQ2A 4AGVA 4Z8BA 2ENRA 3Q8AA 1TME3 4ZKTB 1YFXA 3WNLA 5JIUA 1ULCA 4AI0A 3JB8A 4KMQA 5ABJC 1UOJA 5A32B 4XQDA 1GANA 4WBBA 1MQTB 2O14A 2B42B 4UFKA 3SMHA 5CG8A 5EJZB 1VALA 1FX5A 2WFPA 2Y64A 4QT6A 5DQ0A 4UW5A 2VVDA 1QJEA 1XC6A 3P3NA 3SXWA 5K7PA 5A7QA 4HK8A 4YVWC 4YGEA 3D6EA 4C1WA 2IC1A 2VZ1A 1I6XA 3ZN5A 2GDFA 2ZABA 5FKBA 2VOVA 5K8SA 4CEWC 1R1A3 3NKGA 4NHXA 2XVGA 3FX3A 2WSUA 1L3JA 4QWNA 2TNFA 3F95A 2YFZA 3RSJA 3BOWA 2JG9B 1RUD2 2DTWA 3RQ0A 3TN93 3LZZA 4D6SA 2E33A 1EPWA 1O8SA 2Y34A 3AZXA 1Q8QA 2E7QA 1FOD1 2BP6A 4AFAA 4QHZA 3T4VA 2Y26A 4P9JA 3VBHA 4HPKB 4BK4A 4Z07A 4IEXA 4WM8B 1GKBA 2XLAA 3NVCA 1JS9A 1GOGA 2H6CA 3WXPA 3E6CC 1O91A 4HVQA 2BZDA 1QGLA 2WUHA 5FYBA 2FDGA 1W9TA 3J7LA 1DU3D 1DGRN 2CSGA 1UXXX 4H14A 2CTVA 2NYYA 1R082 4LJHA 5FO9B 1NUKA 4I0WB 5T3NA 2WT1A 1SFYA 3ZFEA 2VQAA 2OZJA 3VHNA 2WKKA 3HVDA 2RS13 3D3AA 1IQAA 4YW5A 2WSVA 4E4SA 4LXLA 3T0DA 2DWRA 1ZRIA 2X29A 3MFAA 1NLSA 3RYRA 2WA4A 1RL3A 3WF4A 2IVJA 1KDMA 2PLV2 4FPKA 2HWE3 4YM3A 4DXTA 4L11A 2I07B 5A6ZA 1I9RA 3HEIA 3IPVB 1SACA 1RXGA 1ENSA 3KB5A 1RUF1 2F4PA 3A0NA 2VOKA 3CMGA 2Q5TA 1FV2A 2D6MA 2AH2A 5FZ8A 2XHNA 4FOQA 4CE8A 1DQ2A 1JHNA 1K3IA 4LKSA 1OQDA 5CU1A 4CXYA 4AF9A 1OOPB 1VJ2A 4LHLA 1LOGA 1OD3A 3J8F2 5A7PA 2EIEA 5A7NA 3SLIA 4ZZ5A 4DXZA 1PGW1 2R7EB 1UPSA 3VBSB 1EAH1 3KCCA 4QX8A 2GH2A 5A1AA 1PMHX 1RUH3 1S0DA 1OA3A 2OQ7A 2WN3A 4GMP1 4UW6A 3DCQA 3ZYPA 3SEPA 1RUG2 2ID4A 2W2IA 3O14A 4RD7A 2ETEA 3OPTA 4KGQA 4QXKA 2JB8A 2BPA2 5IUQA 3OGJA 5A3MA 3PU8A 4LBKA 3POIA 1AXYA 4XPVA 4WVMB 2A3XA 1AL21 2ZMLA 5FP9A 4CZSA 5IK4A 2X09A 3KT1A 3I3MA 4Q4W2 3LFIA 2B8MA 3I2OA 1OXCA 1QJY1 4BQ3A 4LBLA 4CU9A 5LEKA 1REEA 1ZREA 3CZUA 1PO22 4K3UA 4MV2A 1WUVA 3HBKA 4P9IA 4RL7A 3RYKA 1ZRCA 4HSJA 4YYOA 5CIRA 1XNDA 3BYWA 3FHQA 1GQGA 4N9IA 2CWSA 1OPMA 2VCBA 3WQ0A 2FD8A 1F5FA 2XH6A 3POEA 4MGSA 1W03A 3GZUC 1RVF2 3L9JT 2WINB 4CTEA 2W92A 5JSPA 4HK9A 3D5OA 2JIJA 1Y3TA 4YWAA 4L92A 4QDRA 3ZPYA 4EWDA 4QHOA 2D6KA 2MHFA 2OA2A 4MVTA 4N7UA 3WNOA 4XCBA 1XQNA 5LBBA 1WMFA 2R16A 2LM3A 3AKRA 3OY8A 2JDNA 1UMIA 1W6NB 1CIWA 5K0UA 1XU2A 5FFOC 3BKZA 4CDXA 4PIYA 4X6QB 4XF3A 2IXJA 2HWD3 4W50A 5FZ6A 3EBRA 2QUOA 3R4UA 4XW3A 2C4XA 1XNTA 4S2DA 1E5RA 3G6JB 3KCYA 2YDEA 4FPOB 2XLFA 3V64A 1A34A 1PM7A 3OYWA 1GZTA 3TAYA 1Z7S2 4QX3A 3I2JA 1R64A 1XYNA 2HWF3 3T2PA 2DCYA 4JDOA 2MPFA 5AVPA 3AFGA 2JDHA 1LRHA 1J3PA 1NCRC 1MVEA 1RB8G 1CESA 5LY1A 4WZFA 3DV8A 3FLTA 4Y5SA 4LHSA 1NE4A 4NHLA 2BQPA 3H7YA 4FTBA 2OT7A 1PO12 2WZPP 2E53A 1PVC3 2YU1A 3ILNA 3NJYA 4CCKA 1S0CA 3NAPC 1SLBA 1C1LA 4RQPA 2WQZC 2ARXA 2V5DA 4NUBA 1F35A 1RUI3 1VPHA 1RJ8A 1JUIA 2QQJA 3H50A 1Q8OA 2WO1A 5C3RA 1OVSA 2JD4A 2NQYA 1SDDB 4YGDA 4DQAA 4NHYA 1ZVFA 2YPDA 1R1ZA 2CNAA 3DPRB 2WBKA 4MOAA 2B9VA 4JGZC 1RUG3 1J3QA 4Q4W3 3H3ZA 4WM7A 1CAWA 4MSVA 1GICA 1CONA 3LEIA 2WT0A 4LO6B 1W8ZA 4PLNA 4GB31 5L9VA 3HBZA 3M3EA 1BZWA 1I5PA 5F3EA 4XZPA 1KFXL 2VCAA 3FLRA 2TBVA 2DVDA 2YB7A 3OBTA 3VBOA 3WHTA 4CDQB 1YYNA 5F32A 1X9PA 3PUSA 4KH9A 4X6RB 2ZPXA 3J7HA 2G9FA 3SKVA 3T30A 2FDHA 2OYZA 1GSLA 1Y9GA 2RMU2 1LGNA 3UL2A 4KBBA 1O59A 3IMMA 2YGLA 1PHMA 3SH3A 1TEIA 2JE7A 3ACGA 5FXZA 4IW3A 2EAKA 4QB6A 5F3GA 2B45X 5FJKA 5CNAA 3PVNA 3H3LA 4P08A 3DXUA 1RXFA 3FHAA 3FHIB 3MZHA 1M4WA 4YGCA 1HQNA 3CKHA 2VW1A 2Q8DA 1RMU2 5C8CA 4DUXA 3GHMA 4M3CA 1HRV1 2DCKA 1U5XA 1W9WA 3JQXA 3NQHA 1EYBA 4YG6A 3ZSKA 4XETA 1XRUA 1I3HA 3MIHA 3PHMA 5IFTA 4LOSA 1YQ6A 4FPGA 4Q4X1 4BZ4A 5BUVA 3C7EA 4DXRA 5JZGC 2A3YA 4JQRA 4BJ0A 1LTEA 3O1MA 2PAEA 2DBNA 5A3NA 2WNVC 2XWBB 3JQWA 4CUGA 4GKXA 1QJY3 2PFWA 3KV5A 2ORXA 1CX4A 3D82A 3LIGA 4NPLA 4AI3A 3ZR5A 1PVXA 3JXSA 1ENQA 4UXAA 3UV9A 5BNOC 4FPYA 3N7KA 3ZKUA 2VL4A 5DZFA 1ZZ9A 3WEZA 1UU4A 3IKWA 2MNGA 4RS5B 1NA1B 2B39A 3H42B 3O1SA 3IZOA 1O4TA 1UMZA 5D21A 2LTNA 3B93A 1AYM2 1BVP1 3IDAA 4OQ9A 3ZFFA 2HWB3 2ERFA 4X8NA 4CCJA 3ZFGB 2QDRA 2R30A 4IESA 1L7RA 2D6PA 5B4NA 3OBRA 1CZSA 3V0AA 3MIDA 4HLTA 2WWUA 3ZFEC 5CG9A 2RR13 5FXXA 5LRRA 2DVBA 1NQDA 2LUWA 2VUJA 2J7MA 2ZGOA 2R072 4AEDC 4COZA 1LGCA 4CDWA 2SBAA 3H1MA 4QDQA 4LK6A 5LCWL 4XUOA 1W90A 3PL0A 3POBA 5A7WA 4Y5Z0 3NV4A 4BB3A 1N3PA 3S5QA 5FZBA 2FDJA 3M8LA 3OGVA 5ANQA 4WVZA 2W95A 5LA1A 3ES1A 1HB3A 1OH4A 4RQPB 4A7YA 4WVVA 2DDUA 4BOWA 4IEZA 3ZIXA 5FPXA 1GBGA 4XDQA 1JOPA 2TUNA 3AK0A 4IV3C 4AVSA 3LEKA 1OURA 2DU0A 5FR3A 4N8MA 3AYDA 4P9YA 5GJ6A 3UGFA 4BLJA 5J7MA 3TYJA 4AEJA 4MLOA 3R6SA 4OZXA 1YI7A 2WO3A 5FYSA 4AGGA 1X8MA 4FP2A 1AZDA 5GM0A 3JZVA 2OKXA 4AHYA 1V6MA 2NLRA 4L2NA 5CBLA 5FZ0A 5A3WA 1TME1 4F83A 2O8QA 3BI3A 2C9KA 4COWA 5C3SA 4LIVA 2HWB2 3UKVA 1UQXA 1OC1A 4A41A 4U2AA 2N7GA 4XURA 3T2QA 3W59A 1SPPA 1S1AA 3APBA 5FMCA 3RZMA 4OVEA 3JD71 3LKJA 2R042 1WA4A 3VBSC 4BXFA 4IE5A 3AB0A 2QQMA 3LGRA 1JYCA 1IKQA 3IWZA 2Q8EA 5L7OA 4Q8KA 3HT2A 4XE9A 2ZGQA 1LU2A 1ALYA 4OMDA 4Y22A 3ZYJB 5J3UA 4Q0PA 1R1A1 4AFCA 5IVCA 1AR91 3OSDA 5FZMA 1OLRA 2VZOA 4XQ4A 5FZCA 1S0JA 3NW4A 4QD2A 1OPOA 1DZQA 1WBLA 1PZ8A 1FMD1 1WW5A 3IAPA 3ZXLA 4W6XA 3LPFA 1VB2A 1S4CA 1QJX2 2JECA 3KGZA 4SBVA 3KV4A 1H1AA 3ZMNA 1TMF1 1IGOA 5FP3A 4Y3OA 3BIWE 1O5UA 3I2IA 2VXJA 3E6DA 5FUNA 3M3IA 2GMPA 4FO9A 4JCKA 4ET7A 1YHFA 2BUKA 3WLUA 1US2A 5K0UC 4Z2WA 4XFGA 3WV6A 1QQP1 2RS12 2KA3A 5FV3A 2IFRA 5A7SA 2C26A 4QGNA 1COV1 2YGMA 3CO2A 2IFWA 4LE3A 4EV0A 4HXCA 4DMIA 2FDIA 2P3JA 1TZOA 3ACHA 4WM8C 4XUQA 1ZZ7A 4BK5A 3I2FA 5GLWA 1NCRA 1NT0A 1RUH2 3MGUA 4Y1VA 3MW2A 3WINE 1O3RA 4GWIA 4IV3A 2UWAA 5FLHA 1SCRA 2QQOA 4JHTA 1QOOA 2WABA 3AVSA 4N43A 3AMMA 2WL1A 4J1XA 2D5HA 1FT9A 2CDPA 2HWF1 3VD7A 3NNJA 3DECA 3GCXA 3R4SA 4FT8A 5KBFA 4XF1A 5FPUA 5DMYA 3K4DA 1RJ7A 1WLDA 1L7QA 4XF4A 1FMD3 1OLQA 2AENA 3HWJA 1TNFA 3BPSA 5FP7A 2ZGKA 1HRI1 3ZXDA 1SFNA 4XIKA 3B01A 3POYA 5KC6A 4P5YA 4E4DX 2E6VA 1OBNA 1PZ7A 1AYM3 1FPN2 1LEDA 2IXHA 4DRVA 4CU7A 3ZYGA 5FDBA 4RA0A 2JICA 2WO2A 1WD4A 2O1QA 3EXUA 5AC92 4FQZA 2V72A 1RVF3 1NXD1 1G86A 4COYA 3Q8EA 5EXOA 5K4LA 1JZ5A 3LOBA 4BQYA 2OUJA 4YFZA 2ZCWA 2G1MA 1VBB3 5DABA 1OQ1A 5A3LA 4FOVA 2RJLA 1GWKA 2CYFA 2W1QA 3KS7A 5JZGB 1G9DA 2RE9A 1W2AX 1UAIA 2VGDA 4ZZ8A 2W87A 2Q30A 4ATFA 2AGSA 3JUUA 4QQHA 4A3ZA 1VBD3 3ETPA 1NOVA 4BISA 5C6CA 1SZBA 5DDJ2 3S30A 2D6OX 3LEGA 4R9BA 4K8RB 1DP0A 1W8HA 4LITA 1E5SA 2PAMA 3J8F1 3JBG3 4LIUA 3RI9A 2V4VA 3OEBA 2R1DA 3ETQA 3T3YA 1F31A 4GZ9A 3M2MA 1EAH2 4EQVA 3GNEA 4CXXA 3D0JA 2HYKA 3KVBA 5FP8A 3U78A 1MS3A 2YU2A 4URTA 1MPXA 4X8PA 1ODMA 1UY1A 3AKSA 3VZJA 3CJIA 4FQ4A 2PELA 1QJU1 4AVBA 2FCVA 4UWDA 1NY71 5FWJA 2DVFA 4HMZA 1DLLA 1GFF2 2QQKA 2YPJA 4M3CF 4XFIA 2A3WA 1ASJ1 5FZHA 2J1VA 3LIHA 2Y6JA 2SLIA 5FMOL 3ABZA 1QNYA 3BALA 4D0QA 3N7LA 3ZSMA 4A42A 3NNFA 4CU8A 2VNOA 2QE3A 3VDDA 1I5ZA 3ZFFC 4DNYA 3AXEA 4K20A 3MF6A 4GD4A 1QDOA 3J9SA 3PTYA 4Y1XA 1SEFA 2XBO2 3OGGA 1N1TA 2BJSA 2ZXQA 2ZEZA 4JDMA 1BK1A 1HXS3 1OA2A 4WZCA 2X10A 1UYPA 2RHPA 1D4VB 4JQTA 4O9EA 5JCTA 1AX0A 3EYPA 1GOFA 1MEC2 1JI6A 4AQSA 1DBNA 4FFFA 2VBDA 2VC9A 3IIIA 4HT1T 1H8TB 1F5JA 2VMHA 4LORA 5IT6A 4RGKA 3CDZB 3Q8FA 2ZTNA 3I3BA 1RUI2 2GN7A 1PZ9A 1ST8A 4OI4A 3HN1A 3MLJA 3V0BB 2B46X 4BPZA 2WR9A 1NCRB 5CADA 3WQ7A 2ZAHA 5DZEA 1RUJ3 3WP5A 2KD7A 2VNGA 3ZFGC 5BXXA 1KJRA 4OULA 2WDBA 1BXHA 4LEJA 4Q4X3 4PCRA 1W2NA 1UWWA 4D6RA 2J1UA 1HXS1 1W6MA 4MXWA 4XFAA 4HG6B 4Q0VA 3HNMA 1OKQA 5FY8A 4CYDA 5EIYB 3N36A 3MW3A 3MW4A 1IKPA 3PVBB 1FXZA 1WMDA 2OS2A 5EWSA 1WCSA 1IS5A 5FZ3A 3WCRA 2I2SA 5LBEA 5FUPA 4NVPA 1H6XA 3VZOA 2HWC1 1U5IA 1QH7A 2P1BA 3VBOC 5FJHA 5FYTA 4XDPA 3AJZA 3VBHB 1AYN2 2AR6A 4LBMA 3VBRB 2WS93 3OPWA 1KEXA 2ET7A 1CQ9A 3FE5A 4A4AA 5BNPC 2OUHA 3RWNA 2R32A 1BYHA 4PIXA 1PK6C 2VUCA 3FMGA 2A71A 1WW7A 2PQSA 2RVAA 4WM7C 2CGNA 5D8AC 1N1VA 3B02A 1C1FA 1ENXA 4M4PA 1E5IA 1SLTA 2D98A 3FBMA 4AHXA 1VMHA 2FDFA 1AR73 4IL7A 4YW6A 3PUHA 1UX6A 3R4DB 3ZYRA 3O0XA 3K4ZA 5C3OA 2E63A 4PQQA 4I30A 1XXNA 1H2MA 1ULEA 5TSWA 4LBQA 1LHNA 1UPIA 2RM23 5A7WB 2V09A 5JMCA 2KXLA 4Q0SA 5IAVA 1S0IA 1LGBA 1ZRRA 4GB32 4L9BA 4ZXEA 1F4HA 4TXWA 5CKNA 2PHXA 4M0NA 4AQTA 2GNBA 5EQUA 3U11A 4MGQA 2GNDA 4OFGA 3ZXFA 2XUMA 1RTVA 4NROA 1DQ0A 2QQIA 3GBGA 2CAVA 5LA2A 3SNMA 2FHRA 1CPMA 3T09A 3WY6A 5IW0A 3K46A 4Q2FA 4OQ8A 2WYSA 5L7OC 1UU5A 2WZEA 1H6YA 4AQ6A 4WVWA 4GA9A 5LA9A 5A6QA 2P3YA 3N4MA 3BIEA 2RG4A 5JOYA 5DUVA 3AYEA 1FNYA 1QKQA 3I3EA 1F15A 4XF9A 5IVBA 4IV1C 1AXKA 3LDBA 3WG1A 3C7FA 2D3RA 2VZQA 2ZGRA 4XMIA 5AFBA 4AQ2A 4CDXC 1ZBA2 3DPRA 1KJLA 1WLCA 2NPIA 2XR4A 4IEVA 4JTOA 1MQTC 4QHBA 3ZMOA 2YHJA 4DEQA 1TVGA 1WCQA 1SDWA 2VTFA 4Q4V2 4AVCA 2D6LX 2HWC3 1AR72 1X8EA 4W4ZA 1YRZA 4Q8LA 3K77A 3PJQA 3I3QA 2Y6LA 1O4ZA 1POV3 4P14A 3LB9A 3ZIWA 2OPWA 5EJ1B 1MS5A 3ST7A 4Y22B 3T4HB 4XUNA 3VDAA 4UW3A 4NN0A 4ARXA 4DIQA 4LBQD 1MR5A 1Q3EA 1UZVA 2VULA 1VRBA 3IIAA 5FKCA 1VRH2 3J7NA 4LBJA 1W6QA 1BQPA 5C9AB 2HJIA 2QQNA 4BE3A 5I91A 4I02A 2QQVA 4AOCA 2EIBA 3UKTA 2WQ8A 1W6MB 2RDRA 4YW3A 4U36A 4NIGA 2CV6A 3AZVA 5E89A 4PT6A 3AP4A 3VL9A 4CRQA 1F8VA 3VD3A 2QBXA 2F6BA 4XACA 5E1RA 2ZEXA 5LASA 2QZ3A 3SH5A 4OUEA 2BBAA 1CN1A 1UIKA 5I0TA 4AVTA 1CAUB 1R091 1ND2B 1H2LA 3PDQA 4K1ZA 2D93A 4YRDA 3AM2A 5HCHA 4L8QA 1W0OA 3PURA 1ZBE3 5C71A 1M06G 2P6CA 1AL23 1D0GA 2I45A 2OQ6A 3BGAA 3HQRA 2QVSB 1GYKA 3AYCA 1W8TA 4LO5B 1IS6A 2PHRA 1W05A 1OD5A 3AZYA 4PJYA 2V4AA 1VIWB 2VMCA 5CKMA 1WZXA 4Z1VA 1W0NA 2QQLA 2X53S 2Y6HA 4MG2A 1RVF1 3LPGA 2PHWA 5FZKA 4KQ7A 1LENA 1AYN3 2PHTA 1V6NA 4L97A 2WNEA 4QX1A 1FI2A 3NRUA 2X5IB 2ET1A 1SMVA 1D2SA 5IAXA 2RS32 3MIGA 1DF0A 4C8DA 5JIAA 1PO13 2C6SA 5FOJB 4ORFA 4RYDA 3ZX7A 1OF3A 1JOJA 3ZXGA 1RUD1 1RMU3 3KHCA 1RYYA 2EVXA 2RDNA 1O3SA 4EYUA 2CGPA 2JB4A 3J26N 3CJIC 1CAWB 3VDCA 1VE0A 1YWKA 1Q8SA 4QPIC 1LOCA 5BNOB 3ZYIB 3KMHA 4HN0A 3SQOA 1NQJA 3WF3A 2UYBA 3WUCA 2WAAA 2VZVA 3QCWA 4I2OA 1X33A 3HQXA 3MUY1 4Y20B 3RNSA 4G3YC 3WHUA 1R081 3NNLA 1R1A2 1H2NA 2HBTA 4HETA 5KWRA 3CNAA 4QXCA 1P8JA 1EUUA 3IB3A 5GLUA 5IWFA 2Y33A 4JRLA 1AHSA 1SLLA 1FMD2 3T0BA 3ILFA 4KG8A 5F6LB 2HEVF 1YQ5A 5J09A 4EWAA 1KITA 2PLV1 3VKOA 5HCBA 4NPRA 1DGWX 5F3IA 1ASJ3 1TMF3 1O3QA 3WW2A 4H2AA 1C8M3 2D6NA 4V2VA 3TN91 2P6HA 1W3XA 1ZA7A 3V65A 1DIWA 1VB4A 3AKQA 4IEQA 4BWOA 4FAHA 1ULFA 5C8CB 4R8HA 3SEEA 4CUAA 5FBJA 2EAAA 4DY5A 4AHZA 5JI9A 4EN7B 3FL7A 4G9SB 5FMBA 4H55A 4NPMA 4K9SA 1OA4A 4LBNA 5EJ3A 2XJUA 2RR12 4DB5A 5AVAA 5FP4A 4J25A 3QBQA 2Z5WA 5KHKA 5DAWA 4B8EA 4YSFA 5KXDA 4OI0A 3P6BA 2ZZQA 4RR3B 5BNNB 1UU6A 2GU9A 3M3QA 4XYXA 3ZYFA 4Q1RA 1PGL2 1XOYA 3NWKA 4E4ZA 1HRV3 5GKAC 1VBA3 4EJRA 1HJGA 2O0OA 5FY0A 2WJSA 2G9GA 2IXLA 3JBG2 2A6VA 2BRTA 3FUOA 2FQPA 1EY2A 2LRPA 1LECA 1LKNA 4A3XA 3L2HA 4GAZA 1QJY2 1PX3A 2CAUA 1HQWA 4UI9L 4AGRA 3AMQA 1VBC1 2VAUA 1LHUA 5A3PA 2AUYA 3K75B 4HKLA 1KDKA 1OSGA 4CCEA 4QPYA 3IDBB 4Y5TA 5CYYA 1UCXA 3UT0A 3OD0A 2JDMA 2ZOEB 4OHXA 3E97A 2VU9A 4FPCA 2WN2A 1UY4A 5A7OA 3ORJA 2B5HA 2RV9A 3QOPA 1DYKA 3KV9A 2VNVA 4K40A 2EICA 1Z0HA 5JLVA 1T6GC 4OUMA 5FXVA 5DUWA 1CJDA 1W3VA 4Q4X2 1GP6A 2B7YA 2XXZA 1A6CA 2X5IA 4D69A 4DY3A 2JE9A 4JAAA 3BPZA 4XFCA 2JENA 3VBUB 2W1UA 1JZ6A 2Y6FA 5GZGA 1V0AA 1L7LA 4XFFA 4DXSA 2B9UA 4XC9A 4D7SA 4CDUB 5KHJA 1MS8A 1PIV2 2RS53 2BNNA 4M00A 4QB1A 1KXGA 2XONA 3ITQA 5C3QA 2JJ6A 3AC0A 3OGSA 5IVYA 1JYNA 4MGZE 1YJLA 4CCNA 1DDLA 1ND3A 1E57A 3C8XA 2AYHA 5FZDA 1QQP3 5FO8B 5CKQA 2A5ZA 5BNNA 1TG7A 1QJU2 3INAA 4XJAA 1Z7S1 2P2KA 1RGSA 3HT1A 2BV4A 2XL7A 2A6XA 3KT4A 4XDOA 4EE2A 1T2XA 2HWD2 5IK8A 5JOXA 2QDNA 3DL3A 4UFIA 3AXDA 1H8TC 1LESA 3O1PA 1QIQA 2CWMA 2RM22 2HH9A 4HVRA 1CAXA 4QX0A 5JWPA 1VBA2 3AMPA 4GB33 4XFBA 1VBB2 1D2QA 2A70A 1PO11 3LOIA 4E27A 2XBO1 3HR9A 3S6PA 5A1FA 2Y6KA 1LJ7A 1LHWA 1X50A 2DFCA 3NJZA 3OEAA 5HCFA 4FVVA 3ZYHA 3LD8A 3W9AA 3VL8A 1SBFA 4HBNA 4LULA 5D8AB 1J84A 1N3OA 3HOBA 4W8JA 5EFUA 2ZGTA 4KWKA 4S2HA 3VV1A 2X05A 3WF2A 2BOIA 4PHZA 1ND3C 1AR61 2R0FA 1C28A 5GZEA 1NCQC 2GC0A 4Y4YA 4FBFA 2JG8B 4N53A 4Q4Y1 1V6LA 1GLHA 4JKLA 3N9PA 4Y1UA 1EV11 1J58A 3O7OA 2JG9A 5B4XA 2Q8OA 5JPNB 2WNUC 5GALA 1RUJ1 3JB4C 1OF4A 3T2OA 4P00B 3WW1A 5C8CC 4ES8A 5F7UA 2HWB1 4GWJA 5I8TA 3S0MA 1NG0A 5C4WA 5EP9A 1GR3A 1RUE1 5KXBA 4AZZA 3KM5A 3DEMA 1QJFA 3CJXA 2VM9A 1YO8A 4IUGA 2XB6C 1U5YA 3OPZA 3T08A 1JBCA 1PMJX 1W9FA 4EZ4A 2GSYA 1K12A 4CEYC 3I8TA 3PMSA 4UFJA 1VBE1 3ZXKA 4MX3A 1G9CA 4I3PA 4XQWA 1WMEA 1C5IA 3HQUA 3NJVA 5EYXA 2XJQA 2QQWA 4M3CE 3UJOA 1YIFA 1FV3A 2XVLA 3ACFA 3VKMA 1AR92 1JMUB 5LEJA 3SKJE 1OHFA 2QQUA 1G9FA 1AYN1 3MUZ1 1HRV2 1JN2P 3ZLIA 4RGGA 3VKNA 3H8UA 5HV4A 4QPGB 5JOWA 1JUHA 4K21A 4XJ8A 5FK7A 4BQ1A 4SLIA 1GU3A 4KI5M 3THDA 1S0FA 2XKOA 4JHZA 3AX4A 4HKWA 1EAH3 1OH3A 2BGPA 5GZFA 1C5HA 2XVKA 2XOMA 3NL1A 4DRRA 5KHHA 4BMEA 3M7AA 4I09A 4FXGB 1W6PB 1UOGA 1EUTA 4EROA 1ZA4A 2P3KA 1LODA 3ZN6A 5FUIA 3RZKA 1XE0A 4LO4B 3FUQA 3ZKYA 2R073 1Y4WA 4RHV3 2DVAA 3CEWA 3HN3A 5I8YA 4AHWA 5KR7A 2Z4FA 4AYUA 1JYWA 1UOFA 2JDAA 4AEMA 4B7KA 5C33A 1HIXA 1S0BA 1YNAA 5EYYA 1GQHA 3WW3A 3AFKA 4IXLA 4LKEA 3ACIA 1HKDA 2BOJA 1CGPA 2ZGNA 5FPBA 3SISA 1JZ3A 4XJUA 1RUG1 1SLAA 2RDQA 4LO8A 4EWEA 2Q8CA 3LWCA 2YUEA 4IE6A 4PI0A 4GH4A 2R062 5I0DA 2K0GA 1AF9A 1O7FA 3DXTA 3B00A 2NM1A 2AZ5A 3WW4A 1XYPA 1AJOA 1FATA 4M3CB 1AL22 5LY2A 4JGZB 3A0KA 5H9QA 5T5OA 4ZXKA 4CCOA 2RJ2A 1FAYA 1K5MA 4YG3A 3THCA 2EXIA 4LNVA 1PO21 2W68A 4ASMB 1UOBA 5ERLA 1XE8A 4HONA 1YFYA 4INDA 3UESA 4I01A 3ZXJA 1FPN1 4YW4A 2VBBA 1OI6A 4YVWA 4IE4A 1GZCA 1ZBA1 1BBT3 3NO8A 3U37A 5AC91 5JXHA 1A78A 2DF7A 1CD3G 4OUSA 4UFMA 3ZSEA 4ATEA 5A1LA 2WNVB 3AL6A 1GV9A 3LDRA 4KU8A 1LAJA 2ZMNA 1Q43A 3KV6A 4NOTA 4QX5A 2G19A 2EIDA 1OKOA 3CF6E 4NO4A 3O0VA 3LA2A 1AR71 4D7YA 2QTWB 5CFDA 1LOFA 2VVEA 1LU1A 2FMYA 3MBWA 2GAUA 4QX7A 2Y0OA 3GBWA 3OOXA 3VZKA 3MEPA 3VD4A 2J42A 4Q26A 3DYPA 4ZHNA 2NMOA 4BQXA 1W2UA 2VMDA 4TYSA 5T5LA 4LHNA 5A6YA 3ZFGA 4IEYA 4QU2A 5FMDA 4YGBA 3WNXA 4UT5A 2J1SA 2FCTA 3V0AB 2W3JA 3E6BA 4MGKE 5FZOA 3GYDA 4DO0A 4N53C 3QH6A 2VZ3A 3TRSB 1OLME 2BU9A 2R041 4JRAA 2JG8C 5IK7A 2DYCA 4PQ9A 5I0UA 4IE0A 4HVOA 2H0BA 3H3UA 3POWA 1YIPA 2XMLA 3W58A 3RZJA 2IXIA 2WZR1 3C7OA 1WW4A 1R092 1F9KA 2CGOA 2OZ6A 1STMA 4Q4Y3 1X82A 2W0XA 4XHBA 4YM1A 5FAXA 2E26A 4YVSC 3I59A 1UYXA 2H0VA 1A8MA 4GWMA 1V9U1 4WV8A 1BBT2 5F39A 5FZ7A 3RWKX 4CVUA 1QJX1 4QU1A 1NKGA 3WF1A 3PUQA 1LHOA 3P5BA 3U10A 3HMYA 1QXRA 4AK3A 2W46A 1RC6A 1UL9A 1BHGA 4W6YA 4XJ9A 3TEZA 1HN1A 4AW7A 1UF2C 2Y0IA 3C7HA 4A6OA 1G7YA 2JDPA 3QACA 4FOYA 1W6PA 2PTMA 3NAPB 2B4KA 3PLQA 3VBRA 3N9LA 3OJBA 3ZN6B 3I49A 1UIJA 5F5IA 2VE1A 2BWCA 4XBNA 1QXJA 5JVVA 5D1IA 5DAPA 2ZHLA 3VDDC 4CP2A 2ARAA 4IGOA 4H7MA 2XQRA 4MO3M 4AXOA 3LSEA 2LALA 2QKDA 2OX0A 4FPJA 1W8UA 4AI1A 2MEV3 3NJXA 1ZNPA 2W94A 1LR5A 2EA7A 2HWF2 2WNOA 4C0BA 4K7JA 5EPAA 4MUVA 5F1RA 2FZ2A 5D2AA 4UBGA 1BJQA 2DCJA 2JEMA 4GULA 4META 2RMU1 1W8WA 2HEWF 2WWSA 2OPKA 1Q5OA 2K9ZA 3OB8A 4QPIB 4D94A 4DUWA 4AVVA 1CZVA 1RUF3 1DYOA 1YUDA 4QPWA 5J1XA 1VR3A 2R1BA 4RR3A 3WG4A 2UY8A 1CJPA 1WA6X 5I8SA
chains in the Genus database with same CATH topology
4TLFA 4D7TA 1A8DA 5H9RA 3BU7A 2P34A 1MZ6A 3WOGA 3USSA 1EPZA 4I0BA 4CDUA 3VZMA 3KSCA 1QNWA 2VOXA 5LK5A 5SV8A 4LTAA 2NZ9A 2VMGA 5A32A 2PHLA 5FO7B 1BMV1 4XMAA 2MEV2 3WT3A 2W39A 3TBDA 2EXHA 3WDWA 1YJKA 2BYVE 1MZ5A 2WC2A 1W6OA 4LUKA 4GMP3 1B35B 1MS0A 2BNOA 3KGLA 3ES4A 1RHI1 3FFZA 5T5PA 2RJKA 3RJ2X 5T52A 5FOBB 2VY0A 1VBD2 1HLCA 4B4QA 5E16A 4Y24A 4Q27A 1CAXB 4JDNA 3VKLA 5I0RA 3AKTA 1AYM1 4OHVA 5T5JA 3FBYA 1F2NA 3MF9A 1LOBA 4LE4A 3RI8A 3H7JA 2QZ2A 3R05A 2HEYF 3MPPG 3QD6A 4HKOA 3RJRA 2WFF1 5AFEA 2R49A 4K6BA 3OY8B 4PIZA 1IHMA 1H4HA 2D40A 2XLGA 5DUUA 3ENRA 1DZTA 2JKBA 2RMU3 3ZFEB 1AXZA 5DXDA 4DZGA 4P5HA 1GZWA 1RHI3 3WR0A 1H9WA 4A2UA 4Q4V1 4C90A 3AP5A 1AL0G 4IV1A 2VXRA 4IETA 2DTYA 2EXKA 3VZLA 1D0HA 4I3GA 3THPA 1G8WA 3ZSLA 1C3HA 2ZACA 4YZ3A 2ZGLA 5J48A 1CPNA 2E7AA 4HANA 3VGIA 2OVUA 3GHNA 2WFF3 3IDEA 4ZU4A 4BA6A 3VBUC 4CP1A 2Z42A 1MEC3 1C4RA 1D4M3 1VRH1 1PGW2 1SQ4A 3AZWA 5DG2A 4Q0QA 5DG1A 2ILMA 4MYEA 1XNBA 1HXS2 1TNRA 5FRAA 2HWE1 1SBEA 3VBFC 5FMOS 1BEV3 3VDDB 4P9LA 2ZHMA 5L7OB 4S2FA 2EXJA 1NYWA 3J8F3 1GNHA 5FQ0B 4MGIE 2YC0A 3GALA 4JV4A 4LLOA 5EZWA 4O9GA 3T1MA 4XFHA 3EO6A 3U4XA 2QJVA 4JVAA 1NZCA 2YYOA 1SLIA 4IEWA 1ZX5A 2D3PA 4IQPA 3SHRA 2ZBJA 4BE3A 2P17A 2RM21 2XJTA 3D8CA 5T50A 2PYTA 1VBA1 1VBB1 1WGPA 1J1LA 3ZFFB 3AP9A 2BVBA 1ZZCA 1ZBE1 3PVOA 5LK7B 3DKWA 3DF0A 2DCTA 1W6OB 2BFUS 2GH8A 1COV2 4ITCA 4OLLA 4CDWB 2Q0AA 1AR62 1BEV2 1HRI3 4LT5A 1N47A 3VBFB 4Y1ZA 4BLIA 4HFSA 4PF5A 1BKZA 5CB7A 3OD4A 5K0UB 1PGSA 4LBOA 2XJSA 2WQ4A 2ZKNA 4GIQA 1UKGA 4LHKA 1REDA 1ZZ6A 3TOJA 1H30A 2GNMA 2BNMA 5J98B 2UU8A 2YV8A 4OI2A 4Y1YA 5JPMB 3O5SA 1KRIA 4PDWA 1HDKA 1MZFA 4XXAA 1WLTA 4PBOA 4PDWC 1AJKA 1D4M2 2C9AA 4XF0A 2PA7A 5CFCB 4QQLA 4H3WA 2A6WA 3B7MA 1IS3A 5L19A 1JW6A 3NSTA 2ES3A 3E5QA 1WD3A 4CEYB 5C8WA 4YARA 4Q1PA 2R0HA 4OI1A 2G4IA 4IV1B 3B9CA 1W0PA 2PHUA 1R093 1PIV3 2RS52 1K5MB 5I0SA 3U07A 2WS91 3TN92 1ZRDA 1XYOA 5C4WB 2WIIB 3I2DA 1V6JA 1XNKA 2A7AA 2ZAAA 2UWCA 4AWDA 2GALA 1VLNA 1DYPA 5H9SA 4XIOA 3ZO0B 2VNRA 1FPN3 1ZZ8A 2RR11 4YM2A 4M01A 4IERA 1AVBA 3S7IA 1LOEA 1PVC1 1DQ1A 5F5QA 3USUB 4AEDB 4Q4V3 1CAVA 3WDYA 1R083 3FLPA 4RFT0 3SITA 1FOD2 1NY72 2VUAA 3B5LB 1YCIA 1VAMA 3NAPA 4EN9B 1VP6A 1YXWA 2GNTA 2PQQA 4YFWA 2ARBA 4XXPA 2O8OA 3DGTA 1ND3B 5FCCA 1MACA 4AFDA 4RS5C 1OFSA 2ZA9A 1PK6B 4PLOA 4FXKB 3MIFA 1VBC2 1RUD3 4ISQA 4IEOA 4TSVA 4YG0A 1HV1A 4QQPA 1CR7A 5BY5A 3WDUA 3WP3A 3SH4A 5JAXA 1APNA 1JYIA 1H4GA 3MLLA 4QPIA 5C9AA 2QNKA 1RUI1 1RUF2 5IK5A 1ZYBA 5C9AC 3ACLA 2C0ZA 4P9GA 2YY1A 3OTFA 4E2QA 3WQ1A 2D44A 1W39A 5D8AA 1SLCA 2IZWA 5JI7A 3VZNA 2BBVA 1XU1A 1POV1 4AE2A 1KD7A 3WDTA 3EJKA 1QOSA 4RS5A 5KHGA 3M3OA 2DCZA 4N53B 2FZ1A 1UW8A 2W52A 2A6ZA 1C8M2 1CVNA 5BV6A 1SBDA 4DOUA 4GH4C 1H1MA 3WDXA 1JXNA 5DUXA 3TNPB 3WG2A 1LHVA 4CDQC 4XILA 2WZR2 2VG9A 1Q8VA 4XHXA 4M0HA 4OHYA 2R071 4LA3A 2HWD1 2VW2A 1YLLA 5JSOA 3DUIA 4YZ2A 3IDCB 4CEYA 4GQ7A 2W08A 3NV2A 2JXAA 5BYNA 4GMP0 1G6NA 3B94A 3MFCA 1UZYA 4IEPA 1PNFA 5L73A 4YVSB 2DV9A 1PMIA 1U12A 1DG6A 4MXVA 4YW1A 4ZU5A 2ZJCA 4S2GA 4GALA 3S7EA 2DUQA 1ND2C 1Y43B 2C1FA 1V6KA 4COVA 1NXMA 4BIOA 3GBFA 2Q1ZB 3PJYA 4K1YA 5JR7B 4IEUA 5ABJB 3TNQA 1IPJA 4MGYE 2BGCA 1B35C 3ZDSA 3UKNA 1VBE3 3O0WA 2JDZA 1EV12 5BNOA 1NA1C 3USUA 5T55A 3BCWA 4Q0UA 3AP7A 1RUJ2 1FNZA 1S2BA 1GZWB 3H1WA 3I59B 4P9WA 4Y20A 2VW0A 3H0OA 3FWEA 4OHZA 5JZGA 1Z7S3 1H8TA 3E5XA 4YVSA 2D97A 4MH0E 5FPZA 2XPJA 3MPBA 3SCGA 3HAGA 2NN8A 1ZRFA 3EHKA 5A33A 4RHV1 1J59A 5KC5A 1GNZA 4COUA 1MQTA 5C4WC 2XKPA 4PBPA 5KXEA 4DFSA 3ELNA 3POSA 3TB0A 2WNUA 1WW6A 3RS6A 1BVVA 1QXPA 3U0ZA 3UK9A 4B3NA 1WCDJ 5DDJ3 3RZZA 3E5UA 2TEPA 3AJYA 2YMZA 2R6QA 5FLJA 3CU7A 4B4RA 1X36A 1BMV2 2DURA 2PN5A 4E2GA 1QJU3 2GN3A 3URFA 4N7IA 2PHFA 4FPLA 3LCPA 4LLFA 2WNVA 2WT2A 2UWBA 4R9AA 1G9BA 5KHIA 1DQ4A 3PVEA 4DPNA 5CFDB 1LCLA 1IPKA 3VHRA 2CL2A 3K48A 1ULDA 4H7LA 1COV3 5E8AA 4B4PA 5AC93 2GMEA 1ZBA3 2DFBA 3DPRC 3WG3A 3AYAA 3KQRA 3RDIA 1IOAA 1EV13 3MI8A 1NA1A 4I0AA 2XGXA 4V1PA 2ZS6B 1AUYA 1ZZBA 3ME2A 1AR63 1UD1A 2XJRA 3Q9OA 5HXVA 4HSLA 3VBFA 2ZHKA 1QMJA 2VOWA 3RYPA 4W65A 2OW4A 5ACA2 5JDBA 3N35A 5J36A 5J96B 3P3PA 5CA6A 1LOFC 1IZ3A 4JGYB 5CFCC 5GZDA 1ULGA 4AFBA 2Q4SA 2Y38A 2RS31 1H1IA 4QPGC 2GC1A 5DDJ1 1OFNA 3GZTB 1BCXA 2XHKA 2Z69A 4GWNA 5F9TA 1LOAA 3ZN4A 3LA7A 1DQ6A 2ZX3A 2Z79A 1RUE2 3PMEA 5BNPA 2D3SA 3EQEA 1RUC1 2BFUL 2K2SA 2I74A 2YROA 4ONUA 4EN0A 3N3HA 3MIEA 5T54A 3G7DA 4XJZA 1VBE2 1DZRA 1O3TA 1AR81 1TE1B 1O4YA 1KFUL 4BYYA 2ZX0A 4A7KA 2RS33 5JSRA 1PNGA 5FREA 4RQPC 1QY4A 3VHPA 4LBQB 1S0EA 4Q29A 4RSUA 1G9AA 3MLKA 4CP0A 4AI8A 4YZ4A 3D4KA 4HPKA 4F3JA 2QQPA 1AR93 5KXCA 3MDPA 1KS5A 4R52A 2JX9A 1CAVB 2GC2A 4DINB 4ISRA 4FAGA 1ENRA 1W6NA 2JG9C 1J3RA 1VBC3 4KU7A 5GLTA 5GZCA 3ZXEA 1HX6A 5H9PA 3ZXAC 1S0GA 4W6WA 2PAKA 2R043 1FYUA 3O12A 1NCQA 4CEWB 3B69A 5FQ0A 4LUMA 5K9YA 5EV7A 1DQ5A 4YGDA 1MZEA 1TME2 3H1YA 2XWJB 4PLMA 4Y26A 3B3QE 3BB6A 4J1WA 4CDUC 5HCAA 1PGL1 1FOD3 4FOWA 1H9PA 1RIRA 3MYXA 3WP4A 2ZX4A 4QGMA 4F7ZA 2R061 1NE6A 5B2GB 1OOPA 2OIIA 2DU1A 4FTSA 5GLVA 1V6OA 3I4IA 5GLZA 1SCSA 1J1TA 2YZ4A 3IBMA 3VKFC 1QH6A 5DZGA 3LAGA 1YFUA 5FTTC 3FJSA 4D3WA 2HWC2 1YI9A 4KWJA 1WLWA 4N9HA 1TQ5A 4MZUA 1DFQA 2P37A 1QJX3 1AR83 3CL1A 3WCSA 4YZ5A 2DUPA 4BHPA 1V70A 3ZVXA 3FC0A 2EALA 3WUDA 3UJQA 1PO23 2GZWA 2VMIA 3JD73 2QFEA 1HV0A 4FCAA 1JTZX 4LR4A 2X8KA 3AKPA 4JGYC 2HKXA 3N7MA 2MEV1 2RS51 3VBHC 1V6IA 3X29B 1QQP2 3KZ4C 4PDWB 2NMNA 4XTMA 3VN4A 3THTA 2XL9A 4R4ZA 1RHI2 4GXLA 1OMIA 1AX1A 2X5IC 3ECQA 3GZAA 3I7DA 2XJPA 3HIFA 3TWIA 4KNCA 1H2KA 1QJZA 2AREA 4JGZA 1C8NA 1Q8PA 3ZSJA 4B29A 3NV3A 4F8AA 1RUNA 2BWAA 4YVWB 4FPFA 4QMAA 4YW2A 3B9IA 2C5DA 1K5MC 4Q4W1 4XEZA 5ABJA 1HRI2 2A73B 1BBT1 3IPVA 2WFF2 4NHKA 1POV0 2WZR3 1JH5A 4AI2A 2BW8A 3ROUA 2D5FA 4XBLA 4XJWA 3MICA 1DGLA 3VHOA 1IS4A 1DGRA 1N1SA 1MS4A 1DHKB 1URXA 4WM8A 3GF6A 1A3KA 3FZ3A 1O5LA 4GKYA 5CFDC 4Q4Y2 1MS1A 1S2KA 4FPHA 4BMBA 4AVAA 1QHDA 2V73A 3DN7A 4YZ1A 2BVVA 2ZMKA 1KS4A 1XE7A 1ONAA 1W6QB 4ES9A 1V9U3 4AFMA 2DVGA 2VVFA 2Z2SB 1PK6A 2PHDA 3V0BA 2HWE2 4LO7A 2XJVA 3ATGA 1C57A 1EP0A 1QDCA 1V00A 4R4XA 1QU0A 4ASLA 3RMYA 2WLQA 1Q56A 5HBAA 3BOPA 1CAUA 2ZGMA 1ASJ2 3VBUA 1N1YA 4MXWB 2DUOA 2GMMA 2ZGPA 3MIBA 4ZU7A 1HQLA 2XBO3 2ZKLA 1VAVA 1UZZA 2XG3A 3VBSA 3RPQA 1Z78A 5CFCA 4QGLA 1I1EA 1N3QA 1TMF2 4L99A 1LULA 3M4FA 4CDWC 3KLSA 3WVJA 4AG4A 3BTAA 5A33B 3IM0A 3AP6A 3VUOA 1ZBE2 2BTVC 4CDXB 5SV5A 1MEC1 4BM8A 2ZGSA 2RS11 1QWRA 1MVQA 5L36A 2VPVA 4UW4A 3T2TA 1REFA 1RUC3 1HW5A 4RGAA 1H8VA 1VBD1 3WP6A 3D0SA 2BEOA 1RUH1 4OHWA 2GC3A 4NWWA 3ILRA 3OYWB 1QF3A 5FLIA 4NR1A 4HN1A 4KL1A 1X7NA 2ZX2A 4DS0A 1U0AA 4JC1A 1KQRA 2ATFA 3A4UA 4RR3C 3NV1A 3WD5A 5BNNC 2E9QA 4GH4B 4KG0A 4G4FA 3RMXA 4JGYA 3M1HA 3OCPA 5F6KA 1VAKA 1NLRA 4AEDA 1MS9A 4QQOA 3WX5A 4XTPA 4QM9A 1WBFA 4RHV2 4R9DA 1H0BA 1RMU1 1RITA 4KWLA 5LRSA 5BPXA 5E88A 2KM2A 4NHMA 3T1LA 2P3IA 3C3VA 4LA2A 3AZZA 4AEKA 5BNPB 1RUE3 1B35A 4KGGA 1Y7BA 3RG0A 1B09A 2UY9A 3JCIA 5CVRA 2WLPA 5I93A 3VBOB 4CDQA 2WS92 4YNIA 4N43B 3R0RA 5ACA3 3ASIA 3AMNA 3V56A 1AX2A 1DGWA 3KCXA 1S55A 4JTNA 4QM8A 4TZDA 2ZHNA 3CLPA 4N90A 4FP3A 4XBQA 3OF1A 3WDVA 3K51A 4A7ZA 3RRDA 3C2UA 1PVC2 2IXCA 3IN9A 2WNUB 4HL0A 5JOZA 2V5YA 2QCSB 3M3CA 3LA3A 4BCUA 5HI0A 2IWGB 2VECA 2H6BA 4FSJA 3KT7A 5CAZA 3JBG1 4XOGA 3SCFA 2R063 2D43A 4B7EA 3LSDA 1GZ9A 2UYAA 1YFWA 2JG8A 4WM7B 1V9U2 2ZZJA 4BIFA 4EN8B 5FBZA 1Y9QA 3KD4A 2EF6A 1UN1A 3SCHA 5J37A 2YXSA 1UKRA 2ZGUA 3L2YA 2ZX1A 3FFQA 1ND2A 3VBRC 2WA3A 3NKTA 1RUOA 4N43C 5ACA1 3H9AA 1QOTA 2A6YA 4K8FA 3JU9A 4HZFA 4E2SA 3QLQA 4UBHA 3HD8B 2NP0A 2D7FA 3IT8A 2EIGA 1BEV1 5BNQA 1U5ZA 1OOPC 2E7TA 1RINA 2VQ0A 3PNAA 3CJIB 2IXKA 3J4UH 2FBEA 2Q1MA 3IMNA 4YLZA 4Z82A 2E51A 4E9KA 1XNCA 4YM0A 4R9CA 2VH9A 3VLBB 3WZ1A 4EN6B 3ALQA 1ZM1A 4QPGA 1PIV1 4P9XA 2FMDA 3I54A 1OQEA 4C0HA 3JD72 4FPEA 3QH7A 4J6GA 4BH9A 3N7JA 1RUC2 1NCQB 4CEWA 1D4M1 1VRH3 3BODA 4NWVA 2CY6A 4Z92B 4C1XA 1C8M1 2UURA 1LEMA 4TWTA 1WCKA 4IV3B 1AR82 2A75A 2PLV3 3AMHA 3M70A 4WVMA 1LB2A 4QQ2A 4AGVA 4Z8BA 2ENRA 1TME3 4ZKTB 1YFXA 5JIUA 1ULCA 4AI0A 3JB8A 5ABJC 5A32B 4XQDA 1GANA 4WBBA 1MQTB 2B42B 3SMHA 5CG8A 1VALA 1FX5A 2WFPA 4QT6A 4UW5A 2VVDA 3SXWA 3P3NA 5K7PA 4HK8A 4YVWC 4YGEA 3D6EA 4C1WA 2IC1A 1I6XA 3ZN5A 2GDFA 2ZABA 2VOVA 5K8SA 4CEWC 1R1A3 3NKGA 2XVGA 3FX3A 2WSUA 1L3JA 2TNFA 3RSJA 3BOWA 2JG9B 1RUD2 2DTWA 3RQ0A 3TN93 3LZZA 1EPWA 3AZXA 1Q8QA 2E7QA 1FOD1 4AFAA 2Y26A 4P9JA 3VBHA 4HPKB 4Z07A 4IEXA 4WM8B 1GKBA 2XLAA 3NVCA 2H6CA 3WXPA 3E6CC 1O91A 4HVQA 1QGLA 1DU3D 1DGRN 4H14A 2CTVA 2NYYA 1R082 5FO9B 4I0WB 5T3NA 2WT1A 1SFYA 3ZFEA 2VQAA 2OZJA 3VHNA 2WKKA 2RS13 1IQAA 4YW5A 2WSVA 4E4SA 2DWRA 3MFAA 2X29A 1NLSA 3RYRA 2WA4A 1RL3A 1KDMA 2PLV2 4FPKA 2HWE3 4YM3A 4L11A 2I07B 1I9RA 3IPVB 1SACA 3KB5A 1ENSA 1RUF1 2F4PA 3A0NA 2VOKA 2Q5TA 1FV2A 2D6MA 2AH2A 4FOQA 1DQ2A 1JHNA 5CU1A 1OQDA 4AF9A 1OOPB 1VJ2A 4LHLA 1LOGA 3J8F2 3SLIA 4DXZA 1PGW1 1UPSA 3VBSB 1EAH1 3KCCA 2GH2A 1RUH3 1S0DA 1OA3A 4GMP1 4UW6A 3ZYPA 1RUG2 3O14A 4RD7A 2ETEA 4KGQA 4QXKA 2BPA2 5IUQA 3OGJA 5A3MA 4LBKA 1AXYA 4XPVA 4WVMB 2A3XA 2ZMLA 1AL21 4CZSA 5IK4A 3KT1A 4Q4W2 2B8MA 1QJY1 4LBLA 5LEKA 1REEA 1ZREA 1PO22 4K3UA 4MV2A 1WUVA 4P9IA 4RL7A 3RYKA 1ZRCA 4HSJA 4YYOA 5CIRA 1XNDA 1GQGA 4N9IA 2CWSA 1OPMA 3WQ0A 1F5FA 2XH6A 3GZUC 1RVF2 3L9JT 2WINB 4CTEA 5JSPA 4HK9A 3D5OA 1Y3TA 4L92A 3ZPYA 4EWDA 2D6KA 2MHFA 2OA2A 4MVTA 4N7UA 1XQNA 1WMFA 2R16A 2LM3A 3AKRA 3OY8A 1W6NB 5K0UA 1CIWA 1XU2A 5FFOC 4CDXA 4PIYA 4X6QB 4XF3A 2IXJA 2HWD3 3EBRA 2QUOA 3R4UA 4XW3A 4S2DA 3G6JB 3KCYA 2YDEA 4FPOB 2XLFA 3V64A 1PM7A 3OYWA 3TAYA 1Z7S2 1XYNA 2HWF3 2DCYA 4JDOA 2MPFA 5AVPA 3AFGA 1LRHA 1J3PA 1NCRC 1MVEA 1RB8G 1CESA 4WZFA 3DV8A 3FLTA 4NHLA 1NE4A 2BQPA 3H7YA 4FTBA 1PO12 2WZPP 2E53A 1PVC3 3ILNA 1S0CA 3NAPC 1SLBA 1C1LA 4RQPA 2WQZC 2ARXA 1RUI3 3H50A 1RJ8A 1JUIA 4FTEA 1Q8OA 2JD4A 2NQYA 4DQAA 1ZVFA 3DPRB 1R1ZA 2CNAA 4JGZC 1RUG3 1J3QA 4Q4W3 3H3ZA 4WM7A 1CAWA 4MSVA 1GICA 1CONA 4LO6B 2WT0A 4PLNA 4GB31 3HBZA 3M3EA 1BZWA 4XZPA 1KFXL 3FLRA 2TBVA 2DVDA 3WHTA 3OBTA 3VBOA 4CDQB 1YYNA 4KH9A 4X6RB 2ZPXA 2G9FA 2OYZA 1GSLA 2RMU2 1LGNA 3UL2A 4KBBA 2YGLA 1PHMA 3SH3A 1TEIA 2JE7A 2EAKA 2B45X 5CNAA 3PVNA 3MZHA 3FHIB 1M4WA 4YGCA 1HQNA 5C8CA 2VW1A 1RMU2 3GHMA 4M3CA 1HRV1 2DCKA 1U5XA 3JQXA 4YG6A 3ZSKA 1EYBA 4XETA 1XRUA 1I3HA 3MIHA 3PHMA 4FPGA 4Q4X1 4BZ4A 5BUVA 5JZGC 2A3YA 4JQRA 1LTEA 2PAEA 2WNVC 2XWBB 3JQWA 4GKXA 1QJY3 2PFWA 1CX4A 3D82A 4AI3A 1PVXA 4UXAA 1ENQA 3UV9A 5BNOC 4FPYA 3N7KA 5DZFA 1ZZ9A 1UU4A 3IKWA 2MNGA 4RS5B 1NA1B 2B39A 1O4TA 1UMZA 2LTNA 3B93A 1AYM2 1BVP1 3ZFFA 2HWB3 2ERFA 4X8NA 3ZFGB 2QDRA 2R30A 4IESA 2D6PA 3OBRA 3V0AA 3MIDA 4HLTA 3ZFEC 5CG9A 2RR13 5LRRA 2DVBA 1NQDA 2LUWA 2VUJA 2ZGOA 2R072 4AEDC 4COZA 1LGCA 4CDWA 2SBAA 3H1MA 4Y5Z0 3NV4A 1N3PA 3M8LA 4WVZA 3ES1A 4RQPB 4A7YA 4WVVA 4BOWA 4IEZA 3ZIXA 5FPXA 1GBGA 4XDQA 2TUNA 3AK0A 4IV3C 4AVSA 2DU0A 3AYDA 4P9YA 5GJ6A 4BLJA 5J7MA 3TYJA 4AEJA 4MLOA 3R6SA 4OZXA 1YI7A 4AGGA 1X8MA 4FP2A 1AZDA 5GM0A 3JZVA 4AHYA 1V6MA 2NLRA 4L2NA 5CBLA 1TME1 4F83A 2O8QA 4COWA 2HWB2 3UKVA 4U2AA 2N7GA 3W59A 1S1AA 3APBA 4OVEA 3JD71 3LKJA 2R042 1WA4A 3VBSC 3AB0A 3LGRA 1JYCA 1IKQA 3IWZA 5L7OA 4Q8KA 3HT2A 4XE9A 2ZGQA 1LU2A 1ALYA 4Y22A 3ZYJB 5J3UA 4Q0PA 1R1A1 4AFCA 1AR91 1OLRA 4XQ4A 1S0JA 3NW4A 4QD2A 1OPOA 1DZQA 1WBLA 1PZ8A 1FMD1 1WW5A 3ZXLA 4W6XA 1VB2A 1QJX2 2JECA 3KGZA 4SBVA 3ZMNA 1H1AA 1TMF1 1IGOA 3BIWE 1O5UA 3E6DA 3M3IA 2GMPA 4FO9A 4JCKA 1YHFA 2BUKA 3WLUA 5K0UC 4Z2WA 4XFGA 3WV6A 1QQP1 2RS12 2KA3A 2IFRA 4QGNA 1COV1 2YGMA 3CO2A 2IFWA 4LE3A 4EV0A 4DMIA 2P3JA 4WM8C 1ZZ7A 5GLWA 1NCRA 1RUH2 3MGUA 4Y1VA 3WINE 3MW2A 1O3RA 4IV3A 2UWAA 5FLHA 1SCRA 1QOOA 4N43A 3AMMA 2WL1A 4J1XA 2D5HA 1FT9A 2HWF1 3R4SA 4FT8A 5KBFA 4XF1A 1RJ7A 1WLDA 4XF4A 1FMD3 1OLQA 2AENA 3HWJA 1TNFA 2ZGKA 1HRI1 3ZXDA 1SFNA 4XIKA 3B01A 3POYA 5KC6A 4E4DX 2E6VA 1PZ7A 1AYM3 1FPN2 1LEDA 2IXHA 4DRVA 3ZYGA 5FDBA 4RA0A 2JICA 1WD4A 2O1QA 3EXUA 5AC92 4FQZA 1RVF3 1NXD1 1G86A 4COYA 5EXOA 3LOBA 2OUJA 4YFZA 2ZCWA 1VBB3 1OQ1A 5A3LA 4FOVA 2RJLA 2CYFA 3KS7A 5JZGB 1G9DA 2RE9A 2VGDA 1UAIA 2Q30A 4ATFA 2AGSA 3JUUA 4QQHA 1VBD3 1NOVA 5C6CA 5DDJ2 3S30A 2D6OX 4R9BA 2PAMA 3J8F1 3JBG3 3RI9A 2R1DA 3ETQA 1F31A 3M2MA 1EAH2 3GNEA 3D0JA 2HYKA 1MS3A 4URTA 4X8PA 3VZJA 3AKSA 3CJIA 4FQ4A 2PELA 1QJU1 4AVBA 1NY71 2DVFA 4HMZA 1DLLA 2YPJA 1GFF2 4M3CF 4XFIA 2A3WA 1ASJ1 2SLIA 5FMOL 1QNYA 3BALA 3N7LA 3ZSMA 2VNOA 2QE3A 3VDDA 1I5ZA 3ZFFC 4DNYA 3AXEA 4K20A 3MF6A 1QDOA 3J9SA 3PTYA 4Y1XA 1SEFA 2XBO2 3OGGA 1N1TA 4JDMA 1BK1A 1HXS3 1OA2A 4WZCA 2RHPA 1D4VB 4O9EA 5JCTA 1AX0A 1MEC2 4AQSA 1DBNA 4HT1T 1H8TB 1F5JA 2VMHA 5IT6A 2ZTNA 1RUI2 2GN7A 1PZ9A 4OI4A 3HN1A 3MLJA 3V0BB 2B46X 4BPZA 1NCRB 5CADA 3WQ7A 2ZAHA 5DZEA 1RUJ3 3WP5A 2VNGA 3ZFGC 5BXXA 1KJRA 4OULA 1BXHA 4LEJA 4Q4X3 4PCRA 1HXS1 1W6MA 4MXWA 4XFAA 4Q0VA 4CYDA 1OKQA 3N36A 3MW3A 3MW4A 1IKPA 3PVBB 1FXZA 1WMDA 5EWSA 1WCSA 1IS5A 3WCRA 2I2SA 4NVPA 3VZOA 2HWC1 1U5IA 1QH7A 3VBOC 3AJZA 3VBHB 1AYN2 2AR6A 4LBMA 3VBRB 2WS93 2ET7A 1CQ9A 3FE5A 5BNPC 2OUHA 3RWNA 2R32A 1BYHA 4PIXA 1PK6C 3FMGA 2A71A 1WW7A 4WM7C 2CGNA 5D8AC 1N1VA 3B02A 1C1FA 1ENXA 2D98A 1SLTA 3FBMA 4AHXA 1AR73 4IL7A 1UX6A 3R4DB 3ZYRA 3O0XA