3AB2B

Crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
160
structure length
160
Chain Sequence
MEEAVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of concerted inhibition of {alpha}2{beta}2-type heterooligomeric aspartate kinase from Corynebacterium glutamicum
pubmed doi rcsb
molecule keywords Aspartokinase
molecule tags Transferase
source organism Corynebacterium glutamicum
total genus 38
structure length 160
sequence length 160
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01842 ACT ACT domain
B PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab2B02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab2B01
4X84A 2LVWA 5JJBA 3MTJA 2F1FA 3P96A 3ENWA 2RQMA 3K5PA 5IS2A 2F8MA 2P9CA 3OBIA 1U8SA 1UJ5A 3TUIC 4LUBA 2RE1A 3ENVA 1ZPVA 4IO1A 5FIIA 1KS2A 2RQKA 2ZHOA 2QRRA 1XTZA 1O8BA 2P9GA 3NRBA 3S1TA 1YBAA 3LUYA 3U7JA 3AB2B 1M0SA 2P9EA 3DDNA 3CEDA 3LOUA 2MDAA 2NYIA 3HHEA 3IBWA 3UW1A 2H9ZA 3OFEA 3MWBA 1LK7A 1PSDA 2FGCA 3AB4B 5IT4A 2CDQA 1UJ4A 3IXQA 2DTJA 1LKZA 1Y7PA 3MAHA 1UJ6A 2J0WA 3L7OA 4GO5X 1LK5A 5IT0A 2PA3A 1YGYA 2PC6A 3AAWB 4M8LA 4NMLA 4PWUA 4GO7X 2KO1A 3DHWC 3OFFA 2J0XA 3TUJC 3OFGA 3W7BA 2DT9A 3DC2A 2QMWA 2JOQA 3OFHA 3ENQA 3DHXA 2LQJA 1SC6A 5T41A 3N0VA 1RWUA 3O1LA 2QSWA 2QMXA 3TUZC 3KWMA 2I9SA 2JHEA 4GMKA
chains in the Genus database with same CATH superfamily
4BDPA 2E1AA 1HNIB 1RTHA 2JL9A 4RW8B 3GR0A 1T95A 2EK6A 1NPKA 2OMOA 3SI8A 4NLWA 4RNMA 2AJFE 1N4LA 3DLGB 4HHUA 4YR0A 3AB2B 4OX7A 2FJWA 2QA1A 1KVIA 4IRKA 4YOEA 2PFFB 2KYZA 4EMDA 5C24A 2FGCA 4DX6A 3UQSA 1PIEA 1LQ9A 1F60B 4C97A 1BY9A 1MW7A 3HHDA 5HMWA 1WNEA 1SJQA 2CRLA 4P7TA 2B8PA 2B56A 2VC0A 4OYOA 1XMOJ 4GO7X 1L3UA 2U1AA 4KE5A 1LFWA 3CXCR 3H90A 5HSPA 1X60A 1S7IA 3R3TA 3K8WA 3DLJA 1HA1A 2RKIA 2LYVA 1QSLA 4CLFA 4NLUA 2IC3B 1RKJA 3NGSA 5IFMA 4BLGA 3MM6A 2CQPA 1SV5B 2E29A 3ET6B 2V8DA 1EHWA 2P9CA 4PQAA 4JUZA 3DRSA 2VA3A 1HNVA 3EICA 3GMGA 2KXFA 3DLHA 5DQGA 2JEFA 2P9GA 4CRJA 5D0EA 5EWEA 1NH7A 2FVRA 2QX0A 2C22A 1Q0NA 4PKDB 4NLXA 4WP3A 3DYAA 4PABA 3NMAA 1B7FA 3MMAB 1CJTA 3R1HA 2CQ3A 2I2YA 2HHQA 2AYGA 2VH7A 3PZPA 3QIPB 1YJRA 1RP5A 3V4IA 1S12A 3DI6B 1CJKA 5IV3A 4HEA9 2EVZA 4IOCQ 1TL1A 3Q83A 3R7BB 4C8ZA 3PKYA 4HR2A 1TUVA 3LTOA 1Z1ZA 2KVQE 3RRHA 5BYQA 4TQSA 1MWZA 3BGFA 1SJFA 1T9UA 2Y9HA 3ZZOA 3I4HX 4KGKA 5LXYA 2WSEC 3PYEA 1RT2A 2KHDA 3CJKA 3BO4A 5IT9Y 4ZVEA 3PR4A 1NJXA 1FDDA 1YDLA 2ZUGA 3P5BP 1M5KC 2QSFA 2R2UA 4D3GA 4LF8J 3OR1A 1LFPA 2YWHA 4NZ6A 1S4EA 2NPFA 2DD8S 2E9ZA 3PKMA 3GQCA 1YWXA 2XO6A 3V6JA 1Y7PA 2C2NA 2IM0A 5EUHA 1VDHA 3GIJA 4DV5J 4B02A 5D3GA 4NLOA 4KO0B 2KB2A 1G4CA 3W2VA 3UDLA 5K8OA 4L3KA 1VQPS 3B8HA 1REVA 2DT9A 5K8MA 4AYBD 2HQDA 3T9NA 1MN9A 3GFXA 1WUUA 4DF8A 4NA3A 4BHQA 2XMKA 2PDAA 2I9SA 1BQMB 5B0CA 3R6LB 1FD2A 2QLXA 3GSIA 1NK4A 4RNHA 2RE1A 5J1EA 2AT1B 3H42A 2XLJA 2PEHA 1I94J 2H48B 4J9UE 3BM7A 5A8RA 4ZOSA 2IRYA 4ZJLA 3W60A 3RB0A 5KOWA 1TV6B 2R8IA 3MMCB 1P9QC 1FKAF 1DQ9A 4OV1A 2E1PA 4DZDA 1CS4A 4QBUA 3R8YA 3F41A 3POTA 2CQIA 2XB2D 2R7VA 1RADB 3PHEA 4RW9B 1NHUA 2EBEA 2MQ8A 4DV4J 5KT3A 1MROA 2VG7B 4A8YA 4WTOB 2NREA 2RRNA 2PO4A 2WSFC 2DVIA 5LM7E 2J7UA 3M1VA 2DH8A 3NLCA 2RMLA 2VBZA 1RTHB 4YB6A 2W2OP 1ZAWA 3PRVA 2OEMA 2M0GB 1SJRA 1RWMB 2HNZA 3TZZA 2H5EA 1H7WA 4TU8A 2XULA 1OQ6A 2CNKB 2YNFA 2RT3A 2MQQA 1RAOA 2P5VA 3QAEA 2VFUA 4FYDA 1CVJA 2DO4A 4KGZB 3JXOA 4C7QA 4OYZA 1UP1A 2VA2A 3PJXA 1VIOA 5BYRA 4LRFA 4LRAA 5C24B 1NJZA 4LF6J 2N82B 1HQEA 3LPEA 3MPWA 3A3NB 4Y6IA 3SV4A 1URNA 3PV8A 1PJ5A 3KJNB 1RK8A 2QLJB 3UN5A 1N5YA 3DFEA 1R43A 2E1RA 2NLWA 4JV2A 1S1XB 1XN9A 4AXIA 2CPZA 3OJSA 1F9HA 4K4TA 5H9FJ 4G3IA 4X2BA 3L4BC 1RWXB 1KTVA 2ZHAA 4AL7A 2VBXA 3M7VA 3KJFB 2IM3A 4ZLJA 3EUNA 1W26A 2RKIB 5A6PA 3AHPA 3BQ1A 3NNCA 2V9KA 4OLOA 1U0SA 4CM0A 3MM6B 3NKYA 3D1HA 3LWLA 1NSPA 4NEZA 2HHWA 5GMKa 3DRSB 4H4KA 3LPYA 1HNVB 3SQOP 4MKAA 3PDNA 1EKSA 2ASDA 1AXQA 4PG8A 4C8OA 2JVRA 5ETPA 2AGQA 3UCUP 3M6UA 2X51A 2CQ4A 5C2GA 3DYAB 1RCOB 3QO9A 2BKNA 4FVMA 4DV1F 1CJTB 3N79A 3PYDA 4A8KA 4Y3CA 4ZVQB 2X1GA 4AL6A 1HD0A 1Q8IA 1OPIA 4ZPVR 3JB9k 4ZIVA 4DZ6A 1CJUA 1TL1B 2WVCA 3PM9A 5IT0A 3VTIA 1XR7A 4MKBA 4F02A 3LP1B 3IG1A 1K73T 3B4DA 3MR2A 2ZOMA 2YY3A 2BE2A 3UD5A 3ITHA 1VHFA 1RT2B 2UUAJ 3IR6B 1OPZA 3CJKB 1S97A 2W9BA 3TW0A 2DGUA 4Y0FA 1GX5A 1IJFB 1XMQF 2ERRA 3ZTOA 3OR1B 4K59A 1KTQA 3WC0A 1HI0P 1R27B 3HVRA 1FE0A 2AYEA 4I6WA 5I42A 1RB0A 1DTQA 2CZ4A 2E1CA 4U96A 4RR5A 2MZQA 1U2RA 4DR4F 4O3OA 4EYHB 4YR3A 3QWPA 1VR6A 3QNWB 2XCPA 1NDLA 4WU2A 5D3GB 1NAQA 3I9ZA 4EI2A 3W2WA 2NYHA 3I0SA 2HWTA 1ZYQA 3W2VB 4FYWB 4DSLA 5LJ3Y 2KJWA 4U95A 3BYPA 4OHYA 1NSKL 1REVB 4J9LA 3MPYA 1OIAA 1JXLA 4O3NA 1GK8A 2N4CA 1UWBB 3FK4A 4FPRA 2J0XA 4DV6F 1U6ZA 2LQ5A 8RUCA 3N9UC 3FMWA 1SJ3P 1RTJA 3D3BJ 3ZZTA 1F2GA 3VAFA 2YWKA 5J1EB 4IFYA 1LW2A 1ICEB 4F4XA 1IWAA 4H4KC 1Y3KA 4OI4A 2JX2A 5A8RB 2IPOB 4WIIA 2CJ9A 4J9KA 3QGPA 4ZK7M 5DDQC 1CS4B 1EETA 9ATCB 3POTB 2R8JA 4DR2F 3LWMA 5B0AA 2RUGA 4YY3F 2O3DA 4P2MA 1X4HA 1VIXA 1VQSA 1MROB 2HBRB 1WF2A 2LEPA 1D9DA 2R4FA 2YPYA 1FKOA 2IVFB 4B9TA 1LEOA 5EWFA 3MPVA 3IM8A 2KYXA 3M1VB 4N8NA 5A8WA 1C0TA 2DNLA 2XQCA 3FEYB 2ROEA 4DR7J 2OFGX 2YX1A 8AT1B 1P1TA 3OFFA 2QV6A 1U48A 2HBYB 4O3SA 2PGCA 4FBTA 2HNZB 1BQNA 4X64F 4USKA 2OTLS 1KR4A 4RO0A 2YNFB 4ED2A 4IUFA 3K0JA 4KHPF 4DHVA 2M7SA 2BV3A 5D4NA 2DPJA 2ZC3A 4CLTA 1HQEB 2CPDA 4RU9A 4IFVA 4JI2J 2ZEJA 2DHAA 1SH3A 4KBIA 4LF9F 1FTCA 1N5YB 1WJ9A 1U02A 3B78A 3QJJA 2FVQA 1S57A 2BVZA 1WC0A 4DQQA 1D1UA 3EXYA 3U27A 3OW2R 4H4OA 2IJFA 2NYIA 2RU9A 4PXDA 1SQGA 4QW9A 1UVNA 4AQYF 3MHYA 3PX0A 1J2VA 1CLFA 4J91A 1HBMA 3JTOA 4R25A 2BJ3A 2Y0SD 3R5CA 4X4TA 4UQGA 4WZMA 4DR6F 4I2PA 1S0NA 2V2ZA 4N77A 4DUYJ 4JBCA 2V8VA 4N41A 3BR8A 4HHHA 4CT9A 2UU9F 4C98A 1DARA 3W64A 1UZDA 2QSWA 5F8NA 4CLUA 1EB0A 2FB0A 5KFZA 1GFWB 3BBCA 2ZFHA 3ENWA 2RQMA 4XDDA 1FT8A 3VCDA 3KK3A 3M6XA 2ZBRA 1FWPA 2C2OB 3DU6A 3D1QA 1OS5A 4QU7A 2WOMA 2MHNA 2UUBJ 2G0CA 2NCKL 2CVIA 4FP9A 2FJAB 1AA1B 3W66A 1CJUB 4M5GA 2K2PA 3PXGa 3IG1B 4FPIA 1N34F 3QWUA 2FC9A 4UZCA 3OT9A 2AYBA 3IXQA 2WTFA 3IRXA 2JZ5A 2PN6A 3FZ2A 1T9XA 3J7YU 4ELUA 2BE2B 3ITHB 5EX0A 2NXJA 4HT7A 2E66A 4FF3A 1U47A 3CIZA 3EGNA 4R0JA 3HJFA 3HJVA 3BR9A 3D54A 3G82A 3DLLQ 2NQPA 4C8MA 2W9BB 5E3PA 1MLAA 3GP9A 1EQMA 3KWMA 2X1BA 2ZBPA 1X7VA 4N76A 1F9FA 2R8GA 5L1KA 1BD6A 3NBPA 5HROA 2FQQB 1DTQB 2GMJA 1RT6A 4ILRA 1V9OA 4TY9A 5JXSA 1XMOF 4FF4A 2J9EA 5A76A 5DETA 1OY8A 3M8ZA 2HVHA 3W2WB 4B17A 3I0SB 2DIUA 2E7VA 1JNRB 5G4DA 2PFDA 2XBPA 1VBZA 2X7IA 1V5VA 4UOCA 1S1UA 2C3MA 2OEKA 2B0GA 2NXUA 3EDRB 1UJ4A 2NR0A 4B3TF 3KHLA 3H20A 2ZNZA 2LXFA 1H73A 3OTCA 2W7AA 1YSJA 1RTJB 2F65A 1SB6A 1TP7A 2WVEA 5HQ8A 1RAGB 2A1BA 3THPA 3WQPA 2W7PA 4PG7A 2BOAA 1VK3A 2EI5A 3K5NA 4IFYB 2PMZD 1LW2B 1EJ7L 4DF4A 4DL2A 3FSXA 4ED6A 2RQCA 1RYSA 2FLOA 2IRXA 2MZSA 2CPXA 2R3VA 2Q6BA 3BN7A 1GMWD 1KHWA 4JP8A 2JHEA 3F73A 5KFXA 2VBWA 2IMOA 3Q2SC 3BO2A 2GV1A 3TR5A 2ACMA 2HG4A 2M70A 4NASA 2ZC4A 1T9WA 4FKXA 4DQPA 4UZBA 2AEFA 2NXEA 2F4VF 3TP2A 4Q44A 3EPGA 2Q3PA 3WX8A 1UL3A 1FKOB 3MCNA 2ZKUA 5L9XA 1S1TA 5A8WB 1C0TB 3PY8A 2UP1A 1YJWS 4OZ1A 2ZH2A 1LK7A 2EBGA 1V3RA 2R2TA 4NXMJ 3DLEA 1BQNB 4U7UK 2VPZB 2HQFA 4M94A 4LF8F 3HHKA 2EFNA 2ZJPQ 4K4XA 3Q23A 4DUTA 4RBTA 4K7QA 2V2KA 4EO8A 2ASYA 4IR9A 2HRTA 4QWBA 1VOMA 4I67A 2EFGA 3MMBA 4IFVB 2F40A 2MLYA 4M5IA 4DSJA 2HSEB 1IR0A 1T02A 3DGVA 2F8MA 2CAJA 2HZAA 4ZN1A 4DV5F 4TYAA 3OR2A 3CWJA 4JI8J 4WTYA 4YP3A 4H4OB 4KTQA 2Y1JA 4HLBA 2XTJP 1O5JA 3AT1B 1RAIB 5D15A 4P72A 3GILA 2D3O1 1HBMB 1AROP 1SH0A 2DY1A 2HZCA 1BE4A 2HRYA 1IBLF 4I2PB 5F8MA 1A9NB 2DPIA 1FRXA 1XIQA 2LXUA 1SKWA 2DTJA 4O44A 3M30A 2KZZA 4ATNA 1TL7A 4HVZA 2W1BA 5KG3A 1I94F 4NLPA 4NLGA 1VQ5S 1FWKA 4QQBA 4QIGA 2OO4A 4G65A 5B7WA 4ZDNA 4X66J 1QDUB 1SC6A 3A8EA 1CEZA 3KK3B 3AJ1A 2JVOA 2EPIA 1R89A 2RNEA 4ZVHA 1RACB 4TLQA 5DG8A 1SBRA 2XO7A 4HL9A 1SL1A 2WOMB 4DFMA 4DV4F 4J9RA 1FTRA 3MD1A 1R0AA 1IM6A 2ILZA 3DU5A 3AJ2A 3VF0B 2NUHA 4J9OA 4Y2AA 1WC5A 3PX6A 2W8LA 2I0XA 1KDNA 2AW0A 1KEKA 1NO8A 4DJBA 3Q86A 4V19J 2W25A 1H74A 3HD1A 3IRXB 5KFEA 1SKRA 1Q53A 2CJKA 4E8UA 1D3WA 3GG0A 2YXLA 3V5RA 3K17A 4S0MA 1TUWA 1RZMA 3QZ7A 5DM7Q 4W98A 5C25A 3G82B 2OHDA 1I5OB 3M8QA 3GV8B 3FMBA 2ZH9A 2J0SD 2FJXA 4LF6F 1JLCA 5HI7A 2XYGB 3NCPA 3HVAA 4CO1A 2OIHA 5K8NA 3NBPB 5HROB 2A2CA 2KVIA 4I64A 1RT6B 2DNQA 1HI8A 4K4UA 4PQUB 5E2QA 3TZYA 2Z56B 3NGRA 4B9LA 2APOA 1N33J 2GZOA 4I6AA 4RNFA 3CNQP 3FUYA 4XAKA 3CC7S 1WF0A 3S8SA 4D3HA 2CJBA 5DDRC 3UO0A 3MEKA 1VQMS 3DGPA 2VASA 1K1QA 1S1UB 1U1KA 4ILLA 2ZNYA 2BJEA 4DPXA 2RD5C 1HFEL 5FLXY 2XS5A 2H9ZA 5DZ7A 4CLLA 5F41A 2FLLA 3GCWP 4KC5A 1R31A 1G2EA 5LJ5Y 1WKLA 1H2VZ 4DR3J 4MAKA 5KFDA 2HFNA 4PCQA 2DKOB 3LANA 2R7RA 5CZVA 2XY5A 2M52A 5GMEA 4CLZA 1U6BA 3VGSA 5HMYA 5B0FA 2WSCC 1LW0A 2YWGA 2F3JA 4WFNQ 2OEJA 3V81A 4DFPA 1NU4A 1GMVA 2IJRA 1WACA 1RLDA 1ELOA 4JI3F 4CLPA 4MIBA 4C3LA 2DR9A 3BSAA 1SQFA 3OBIA 3IMQJ 1JJHA 4DV0J 4O3PA 1GQEA 4ECSA 4DV3J 2H1YA 2JRSA 1Y10A 1S1TB 3QMQA 3BSCA 4Q2MA 3MEEA 3MF5A 3AOCA 1OQ3A 4LFAJ 3THVA 1KLMA 3GR1A 3PIPQ 3UCZP 1X5OA 2C42A 2UUAF 4P74A 2JEGA 5KFVA 3CCRS 4LBPA 3DLEB 4NXNJ 3H25A 1Q8KA 2ALYB 4OZ5A 1Z4UA 1IKVA 2FTRA 4B3OA 2BM1A 1WC6A 1MMDA 3TAQA 3G6XA 3MOZA 2KDOA 2CUYA 4PPZA 2XWXA 5AE2A 4G1PA 2C28A 2IIHA 4QZVB 4B9VA 2MXYA 4OJ1A 2PIIA 3AD7C 4GKKJ 2GA7A 5I3UA 3D0GE 3HM9A 3IC1A 1PG5B 3MMBB 2HIQA 3K5OA 3PW4A 3I31A 3M6WA 4PXBA 1RTDA 3QBCA 3OR2B 3OL9A 3R6GB 2RU3A 3MM8A 3M9OB 4OYXA 1H38A 1GX6A 2HS3A 2QFIA 4CH1A 2NXCA 3BDPA 2MZ1A 2ASJA 3SSSA 2JJ4D 5CAAA 1IBKJ 3D5MA 3G8QA 3ZTQA 2WW8A 1RWOB 2GS8A 1BWEA 4P6QA 3MD3A 1U1NA 1B0PA 3LOUA 4DXLA 2H5IB 3SYZA 2QL7B 4O44B 4WU3A 2MZRA 3M30B 2PE8A 4OZ0A 4DFJA 1R3NA 3KG4A 1TL7B 2W24A 4QCLA 3W8GA 2XI2A 3MAHA 4EYIB 5E5NA 4M5JA 2DCLA 3GCXP 3O8WA 1HHSA 5HO4A 4O4RA 1F2HA 2MKKA 3ZFVA 1PO6A 2HFOA 1WC3A 3J81Y 2BE9B 2DGXA 4CT8A 1T8EA 2M9KA 2BJ9A 1VJQA 1WHYA 1L5UA 4IYQA 2XLIA 5BYSA 3J80Y 1XNRF 4ZVPB 7FD1A 3SSQA 1HKAA 1R0AB 3WC2A 2V2VA 2EG2A 3KLHA 5DM6Q 4CYUB 1ZTWA 1XEZA 4K8RA 3C6UB 2BZ2A 4DR7F 1KS2A 2NZ4A 3VAIA 1F1BB 4DU7A 3RAXA 3MM9A 1S99A 5E3CA 1YLXA 5C25B 2KJVA 4P2FA 3HKZD 5B08A 3BBFA 2AEJA 3I82A 2XS7A 2QJ3A 3M8QB 3EX7B 3O3LA 4DL3A 4DU8A 3Q89A 1U1OA 2CDRB 3LQVA 4KKOA 1JLCB 2HFUA 4ZCIA 4ECTA 1Y3JA 4KSEB 4EO6A 2E9TA 1KQFB 4JI2F 1KVJA 2BOPA 3M8PA 2BQUA 3QT8A 2D3OR 4TNOA 1FNOA 3T6BA 2R7SA 5AE3A 3VZIA 3RBEA 1YRUA 1SJ4P 4R0EA 1S6UA 1NNDA 4WE1A 4DL5A 1U25A 2E9RX 1KKHA 2BR0A 3G6YA 5KFBA 1RLCL 2BJ7A 3DGPB 5AXNA 4ZS6A 1MMNA 4DUYF 4J9QA 4KGXB 2C2ZB 4YUDA 3OD2A 3OTEA 3K8VA 3KHRA 4HACA 2DHHA 2Q79A 4DL6A 1S0OA 5KT6A 3CEDA 3D68A 3CCMS 1AZSA 2DNOA 3SCJE 2R2SA 3KNAA 4DL4A 4LSNA 4C4WA 4F04B 2A18A 4DDFA 3NMRA 5AXMA 1CJVA 3NWRA 1JLGA 3NOCA 1N32F 4MYUA 2VHGA 1LW0B 4LR9A 2JC1A 1AB8A 4URQU 4NA2A 3V81B 1Q86T 2UUBF 2FY8A 2WHOA 1FJEB 3DOLA 5KG4A 3I5CA 2EFVA 4N7TA 3N6NA 2P8IA 5AJ3F 1KOOA 4LIWA 2BEFA 2B7CB 1ZM4A 3H4DA 3WIVA 4N5SA 2W4PA 1M5VC 2OPSB 2UUCF 2VQFJ 4RUCA 3UNGC 4A8OA 3FRYA 3MEEB 1KLMB 3T3FA 5B0GA 3S1TA 4DX5A 3MAAA 3CUNA 1QY7A 4LBHA 4ZPDA 1HR0J 1IKVB 2AQ4A 4B3OB 4DPOA 1Q8BA 4TY8A 5L1IA 4X4QA 4CP5A 4ZN3A 4ECWA 3VWSA 4YB1P 1ROFA 4UY85 2KZMA 1PBUA 2H65B 1TL3A 1C2PA 1UJ6A 1BXNA 3MR5A 5ETMA 3NXZA 2Y8YA 2ROPA 2HVDA 1U6FA 4C11A 5I3UB 4LF5J 4M8LA 2HAIA 1RJJA 3BH6B 3DMJA 2J76E 2R2RA 1L3TA 1WC4A 2OFHX 2M8HA 2AV5A 2PMWA 1RTDB 2KRRA 5F0UA 5F3TA 3MM8B 2HK2A 2IDEA 3W3SA 1OJ4A 2ABYA 3RGIA 1HIYA 2UVRA 2DH7A 1WSVA 4EGLA 1NK0A 2BACA 2J6SA 4FS1A 1RA6A 1CQNA 2AKWB 1Q7LB 2WBRA 5T14A 4CZCA 8ATCB 2IA6A 3S6EA 1PGZA 2CYYA 1IJEB 1N5TA 3LP0A 1NDPA 1JWWA 2OLWA 3VAJA 4XK8C 1XC9A 1SQEA 1IKYB 1DHMA 1H7XA 2W2NP 1NK5A 3S7RA 2XMAA 1U2CA 3DM2A 4KGVB 4P9SA 2CQHA 4ZMMA 3LAKA 1RSCA 1D9FA 1XWLA 1FERA 2Q1LA 1AFJA 2GVZA 3SEOA 3UN2A 3HO1A 2VDIA 2F5GA 3DHWC 4NYPA 2GHWA 3MPDA 2VPXB 3HVTA 1X0PA 5HAOA 4CDIA 1VC6A 3DHXA 2WB1D 1Z2LA 3KLHB 3D4JA 1HPZA 1S59A 3KLIB 2XZTB 5IQQA 4UOFA 3FQKA 1Q81T 2ZKTA 3MTKA 3M32A 4ZP7A 3H2UB 4NXMF 4W90B 5GAEI 2GJIA 3MM9B 3VAGA 5CH7B 2A6OA 3D2WA 4R5PA 3VVTA 4OI0A 4WPAA 1GXLA 2LA6A 1NBEB 2P9EA 1LWCA 1RDRA 1RABB 1ZOTA 4KKOB 1NSAA 1W2BR 4QYZK 3D6TB 5IT4A 4GVLA 4OI2A 5HJYA 3M8PB 3Q8UA 4JI8F 3FBFA 1YTYA 4RUAA 3T1HJ 4OZNA 1X9MA 1JK9B 3QT5A 3DOMA 4OV6A 9RUBA 3P3DA 1H2TZ 3DC2A 2WK4A 1B0VA 2VJUA 3WBZA 3TOQA 4WE1B 3LGHA 3L7UA 3JAMU 2V0NA 3C2PA 2QEXS 3ISND 3GIMA 1HBNA 3TUZC 2QN6B 2W4CA 3IR5B 3PRDA 2Y3YA 3FGVA 3QT7A 2HFSA 3P96A 3CIMA 3ZZUA 4RW4A 4HACB 1FESA 3C19A 2HGMA 1N8RT 3VV2B 4CM2A 4IRDA 1AZSB 1BLUA 4LSNB 1Y4ZB 1Q82T 3DKDA 4LR7A 2VKRA 2AX0A 3LA0A 1CJVB 3QGGA 1JLGB 1TKXA 3QRPA 2HGNA 3SZ2A 1UKUA 2DNMA 3J80U 1IR2A 4OMFG 3C15A 1X4GA 2J6TA 2C3PA 2CNLB 5KG6A 2B4OA 4B08A 1UPPA 2GO9A 4A48A 1EQ0A 3U1NA 3DOLB 4Q8FA 3SQGA 2QGFB 5MAOA 2JDJA 4IR1A 1Y9OA 3BF4A 3TZXA 2VJVA 2BJ1A 1Q4RA 3ENQA 2MY8A 1T05A 1S4FA 1IR1A 5DGBA 3P6YC 3A1YG 3R5AA 4Y2KA 2MLXA 3HSGA 4DV7F 3HULA 2L9DA 4YDXA 4LFBF 2RF2A 4YDDB 2D3ZA 2ZE2A 2HVZA 2O66A 3K5LA 3MAAB 2BE7D 3QGHA 1CULA 2DO0A 1K47A 3HX9A 4RW6A 5L9NA 1YZ6A 4PEOA 4TY8B 4O3RA 1NPPA 1LNQA 5D0RA 5CHCB 1SIZA 3CCJS 1TL3B 2G0IA 3UDEA 2IAJA 3PEHA 1YRXA 1H2UX 2E7XA 3L95X 3M6VA 4C11B 1NLKL 4NE9C 3NY0A 2DNZA 1FX2A 3DMJB 3G8TA 1FXRA 3T6JA 1JJ2R 3JSBA 2VPYB 2P2CB 4ZIWA 2Y1LB 5DLGA 1UVKA 4EBEA 4PG4A 1AT1B 2I8EA 3DNCA 1P8GA 3GJQB 2CJXB 3IA0A 2HVEA 2R42A 3BV8A 5ETVA 1YJTA 5LSRA 4L72B 4GMKA 4QYZJ 4HKQA 4KQZA 2KHCA 2AP6A 3AXKA 3TX8A 4K4YA 1NPRA 1N56A 1Q7YT 4DWIA 3PIOQ 5ETNA 3LP0B 4DR3F 1A0OB 2Q43A 4CO3A 4DPWA 3OHBA 1F3FA 1HWUA 4O0NA 3G87A 2ATLA 2HS0A 6AT1B 3H8YA 2M3DA 3CJTA 4ZPAA 3DM2B 1U49A 3HFKA 3CD0A 5F8GA 2LQBA 5CABA 2JLFA 3RRGA 3CJ4A 4WWSA 2GVZB 2HLUA 3WHIA 4KFBA 1RU1A 1KSPA 2XHWA 1T0TV 2GX8A 4DV0F 3RW7A 1YGYA 2G0JA 3QSIA 1O6XA 1RT5A 2KT3A 4DV3F 4GRSA 3A3OB 2I5JA 1R8PA 1HPZB 3W7BA 4F8RA 4LFAF 2CPIA 3MMJA 4MK8A 3L09A 1NM2A 4J9MA 4I7FA 1NXIA 4EZ6A 3M32B 5IQ6A 4NXNF 4KYZA 3EM1A 4M5LA 5ETRA 4C8KA 3CCLS 1KFSA 1FRMA 2R7WA 3GJSB 4ID8A 4R5PB 1YRTA 4ELTA 3Q8PB 3CGIA 2HQGA 4DLEA 1LWCB 4C2MA 4QPTA 2KG0A 1KN6A 4CI0B 4GKKF 5GAHI 3OXFA 1S5ZA 3BGOP 1NDCA 1IBCB 2CIMA 3MI7X 4W92B 2E7WA 3F44A 3RBZA 1B70B 2HHXA 4PWDA 2FYXA 1RXOB 5LMNF 2GIRA 4L6V3 4RU2A 3ZTRA 2E5JA 4DCOB 1FVQA 2LP4A 3DOMB 4V19X 4FNIA 3ZXWA 1RWNB 1HWKA 1TU0B 2DNGA 3GIIA 3FDSA 3HXMA 2N4DA 2EC0A 4DSFA 3O5TB 3NCRA 2ZZNA 5M2RA 3CDAA 4ETXA 2NSCA 3E01A 4X4NA 3SDEA 3FEZA 2AJQA 3VZHA 4DR6J 2XLKA 4USUA 4U6PA 4RW4B 3ISZA 2NSBA 4IH6A 2G4BA 4DEZA 2LEBA 3OLBA 2DNNA 4ZCLA 1X0FA 2HURA 3CJSA 3RB3A 3GFHA 4ED1A 1U8SA 2HVIA 2ZBIA 4DV2J 1SC1B 4WP9A 4G1QA 4MKYA 1VLYA 3IWXA 1WTFA 2MJNA 3MMCA 2KT5A 1TKXB 3JSMB 1IM4A 2RAQA 1C1BA 3C15B 1DY3A 4USJC 2RUSA 5HP1A 2CPYA 2CXEA 4RX6A 1YKWA 2AIRB 3SQGB 3W8PA 5L1LA 1RAAB 4WFBQ 1T05B 1PBAA 3HKWA 3OTDA 1N34J 1FRIA 1JLFA 2JSXA 1FEEA 2VONA 1XMBA 2R7TA 3DN9A 1LXJA 4FXVA 2YX4A 5GADI 2RF2B 5B0BA 2MGZA 4FXWA 2ZE2B 4FF1A 5EHHA 3LAMA 2W9AA 2VOPA 1JQGA 3HP6A 2ZH5A 3KYLA 5F0WA 1URRA 2ZM6J 1U8WA 1CULB 4RW6B 4K2JA 4G1IA 4EBCA 3E2EA 4DR5J 1N54B 3PEJA 5AXLA 3RB6A 2ZHOA 2DRAA 2IAJB 1FRLA 5M2PA 2IYGA 2MKHA 2C2RA 3R27A 4ECYA 1S1XA 3Q8RB 3SV3A 3NOGA 3AH6A 1UETA 1PYOB 4TVAB 2IM1A 5D78A 4DX7A 4ZVUB 1L3KA 1QSYA 1IQZA 1Q5VA 4AXJA 2G2ZA 4RJVA 2D9OA 2E5LJ 3THTA 4OHXA 1HD1A 2OTJS 2YH0A 3OTOJ 4B3TJ 2D1CA 4KHRA 1NRKA 3HSZA 6FDRA 5KFNA 1ZAVA 3PFEA 2YKQA 2XG8A 4J37A 3ETOA 2R8KA 5HMZA 5J2MA 1YIJS 4Y28C 1G7CB 3B6BA 3H5UA 2CFXA 4ZLNA 3HHLD 2Z8QA 2Y8WA 2Y1RI 5J1PA 4I2QA 1VQ9S 4OJGA 4I56A 4ILMA 2UXCF 3KJQB 3H2LA 2VUGA 3BQ2A 4KFBB 3R9LA 3TRGA 4B9NA 2XSJA 1OSCA 1D9AA 2F4VJ 3LW5C 2UXDF 1RT5B 3BREA 3LP1A 4AFFA 2I5JB 4H4MA 3GV7B 4B9SA 1SIWB 2VQFF 3IGVA 3UNYA 1JXVA 1UW4A 2VFVA 4LF2A 5HVHA 2OKQA 2HS4A 4LMZA 1TR0A 4I7FB 1SKUB 2J9CA 3EMTA 5H9FK 1XNQF 1ZPWX 1E6VA 1QAYA 2A2DA 1HR0F 4U8VA 4AL5A 3R5JB 3CDUA 1GAOA 1YJ7A 3EVOA 3FKBA 2ZH4A 5F8LA 3M8WA 2Z4PA 3K7RA 2GIFA 4U67Q 1S10A 1BGXT 4DUZJ 2GQCA 3UR0A 2QL5B 3VVUA 1YI2S 2ZH8A 2CKWA 4LF5F 1SC4B 2B43A 2HQIA 1VMBA 1UW9A 5C5JA 3NRBA 4B3SJ 3KKFA 4L74A 4PWDB 4I1TA 3I4PA 2K7KA 4L76A 5K9FA 4FYYB 5LMUF 2FLNA 3C66A 2XYPB 3SBMA 2DNHA 1FFWB 1UWBA 3G96A 3E01B 3SDEB 4C8YA 2L08A 1IBLJ 2AX1A 1TUGB 4CO4A 4KPYA 3MCMA 1TAUA 4QPXA 5CYMA 4ZHRA 1JJCB 4URGA 2AMCB 3TX0A 5DRKA 3CD5A 4OLPA 1X4FA 4WJBA 5H1SV 5HLFA 4RBUA 4BC9A 3NS5A 4WKYA 4QIWD 3V2UC 4DQSA 1N6QA 1HYSA 4G1QB 5I3PA 2MTLA 3EDQB 2L9NA 3KG0A 3DRPA 4L73A 5KTQA 1S1VA 3TVYA 4MFBA 4KR0B 1C1BB 2V67A 2J6UA 4HDGA 3PG9A 5IZHA 1Q95G 2VZ9A 1ITPA 1UCNA 3R5GA 5HP1B 2YQ3A 1NHKL 1OMSA 2F7VA 3OHAA 3ZNUA 3PYFA 3DCAA 4DSEA 2N3OA 3ONQA 2G13A 2LLZA 2AU0A 2UV8A 1X5PA 1HLWA 4QWCA 1JLFB 1FFGB 3TANA 2OELA 3VGTA 5A2QU 5DG7A 5LOQA 5KT7A 2MGZB 3CD7A 3TNVA 1ZA1B 2LDIA 1WG1A 3OUYA 3TVKA 4IH7A 2X1AA 3D28A 2AJ0A 4DSKA 2HRUA 3OVSA 4B3RJ 1GXUA 4C6AA 3K2YA 4N8OA 2BXJA 1APSA 2LVWA 4F2RA 2YNGA 3UCGA 3NL0A 3U1MA 2GC8A 3C6TA 1Q8LA 2XMMA 4X65J 1X8DA 4OZ3A 3PO5A 4YHHF 3ENVA 3KLGA 2M5YA 4BC7A 3N4WA 3GFZA 3T1HF 3CDWA 2W4DA 4M5NA 1AYEA 2SXLA 1M5PC 3JQJA 1YJ9S 3QRRA 5KOXA 3CE8A 2BKOA 5HJXA 4QU6A 2ZBQA 2DJWA 3FRZA 4FZVA 4YN3B 1DZ5A 2VG5B 2J7KA 4QIEA 1Y00A 4RW7A 3I96A 2VPWB 3EPIA 2DXDA 1U0HA 3W1YC 1NK8A 4FNHA 5J2MB 1DLOA 1T9VA 3QYYA 3NS6A 2JLEA 4ES2A 2HHSA 3GU0A 1VRQC 1D09B 4I2QB 4K5RA 5FDLA 4DN9A 2QZ8A 2OSQA 2DYAA 3P8BB 4OYBA 4JI3J 2CPEA 2AGPA 2XSJB 2R7OA 3AODA 3SCKE 2CJYB 3GWCA 1N5QA 1N88A 1RTIA 2HQCA 3L3CA 4H4MB 1FDBA 3DOKA 1K0TA 2CQBA 1YK9A 2HK3A 3TAPA 2CZVC 4JV0A 5IC6B 1C4AA 3Q8QB 1TVRB 1W25A 2LQ8A 2C1EB 4PXEA 4FKYA 2R8HA 1TK8A 5THWA 1E6VB 5JMNA 1UA0A 2BKPA 5CQGA 4NRUA 4ZLLA 1Y0HA 2QMWA 2BANA 2J8SA 4GKJJ 1R6VA 5L38A 3O1LA 1RU2A 4EZ9A 3MTJA 4L75A 3IN5A 2C2EA 3OXGA 5DO2A 3V6HA 2OPQA 3TEHB 3C46A 3ZC4A 1WHXA 5E41A 1HWJA 3VALA 4CIOA 3TO8A 4WP8A 4IH5A 2FGOA 3NS7B 2RDIA 3PACA 3BEGB 3KOAA 4QW8A 2CWKA 4WFYA 2QYCA 4U9RA 4Q45A 5K20B 5HANA 4JI7J 3EVMA 3RYLA 1ZH5A 3D6HB 4NX9A 4DPUA 3Q24A 4JOUA 4P71A 3MAQA 4UUWA 5ETTA 5D4LA 2ZD1A 4NLRA 1FRKA 3VQSA 4IRCA 4C8NA 2OP5A 1OWXA 2DNPA 4C3MA 5CYMB 4ZHRB 1WOSA 1C0UA 4ED7A 4KRWA 3AD8C 1K44A 1FO1A 5IM0A 1JKHA 5HLFB 4YB7A 5LSOA 3M9MB 1XERA 1IKWA 3DXBA 3ILJA 1N6QB 1S0VA 3JQMA 1HYSB 4OHWA 2DIVA 2XY6A 3M2UA 5LL6d 3DRPB 1Y5LB 4U8YA 4JB8B 3ZZYA 2RDDA 1NH8A 1S1VB 3MEDA 4MFBB 2KT2A 4NZ7A 2QLFB 2F9DA 3IGNA 2FC8A 4V1Ak 3W5ZA 4LUBA 1NJIT 2EG1A 1IWGA 3IAS9 1XNRJ 5DDOC 5SUHA 1RAHB 2FVPA 4MH8A 5L8RC 1O8BA 2ROGA 3KTQA 2RHQB 2IVYA 3UVJA 1S0MA 1GTEA 1WI8A 3FJ2A 2V4RA 3G71S 3UR3C 1S1WA 4ED5A 3FEXB 1KQKA 3PNIA 4CQ1A 2C3YA 1TKTA 5DQHA 3TJAA 4OYWA 4DLGA 3OUYB 1RCXB 1BUXA 3FSYA 4PWUA 2QIFA 2OD4A 2IRUA 2DY9A 1WORA 1NKBA 4QR0A 1VISA 1BC6A 2YNGB 2HPUA 3OSNA 3VGVA 2LQJA 3C6TB 2DGQA 2DEIA 2VG6A 3KDOA 1WG4A 2VDHA 4DPYA 2M88A 4Y2MA 3KLGB 4ED8A 1OYEA 4PYAA 4AT1B 3R2CJ 4PZVA 3KUGA 2RDJA 4ECVA 1LV5A 1J5OA 2Z30B 2FHJD 5GAHU 2RIJA 4LQ3A 2RQKA 3EVWA 1GMWA 4CLYA 1F9EB 2J7WA 4LQ9A 4QIVA 2RVJA 2X3DA 3DDNA 5KFJA 4F4ZA 4DMZA 3VHQA 3V4MA 2KFZA 3OQ2A 4JV5J 1DQ8A 4ECQA 2DITA 1B3TA 4J9SA 3V6KA 2YVSA 5KG2A 1TFYA 2AJ4A 4RW7B 3M2VA 1RHMB 1OY6A 3P5TL 1U0HB 2YTCA 3PTWA 1UFKA 3BKUA 4DV2F 1H98A 3IRWP 4MKVA 2ZZTA 1DLOB 3CULA 1H6KX 3W9JA 2D74B 3HSJA 2ZJQQ 3A8KA 3M2RA 3D6FB 3UPFA 4ZITA 3W9IA 1N32J 4KB7A 3RAQA 5FDLB 4RNOA 1YZ7A 3MZIA 1P27B 4NYOA 1RT3A 5ETKA 4O4GB 5KFIA 4ECXA 1ZETA 3HD2A 1RWVB 4Z2XA 2W8KA 1UEUA 5AJ3J 1RTIB 3GTYX 3DOKB 2VICA 6FD1A 2UZAA 2UUCJ 1VLOA 3OTBA 3TQ1A 4J7CA 2JH3A 3D67A 3AB4B 2ZM6F 4IG0A 1T9TA 2IBKA 3Q2TC 4Y2CA 1RHKB 2O1PA 1HNWJ 2CQ0A 3G8SA 2BANB 2DEJA 2JWNA 4DR5F 3NNAA 1PYSB 3KLEA 3EZUA 1RUSA 5GADU 4YB5A 1KC8T 4PUOA 3Q0AA 3O6QA 3Q8VA 4LR8A 4CO5A 2POKA 1M1HA 4KH0B 1UVIA 2OPQB 4PQUA 3NP5A 3NAIA 3WIUA 2ZOFA 2HGLA 2B6AA 3QSYB 2MQNA 3J7YI 3AY0A 2RH3A 3CF5Q 1F3VA 1GH8A 2X1FA 4HYKA 1F0XA 4B3MJ 2UUTA 1EARA 2XMWA 3PW2A 4HI1A 2GFFA 2CQCA 3O2IA 2E5LF 3QJLA 1CSJA 5FIIA 2CG4A 2Y1IA 1OO0B 2MQOA 1RI7A 4BS2A 4B9UA 3OTOF 2W9CA 1V6HA 1VYAA 4DG1A 4ED0A 3EZOA 2KXNB 1SL2A 2ZD1B 2DBBA 4A46A 4CTAA 1QTMA 2BUNA 4YMEA 4CCHA 2EEYA 4CNZA 1C0UB 5DS7A 1S48A 3A13A 4OQJA 5B0EA 5IM0B 1JKHB 1ZBTA 1IKWB 5ADZA 2BA9A 3M2UB 5IV4A 3BO3A 4ID5A 4OI3A 1ZM9A 4A4JA 3K89A 3MEDB 4NCGA 3G9CA 4UT4A 5T41A 1AUSL 3CCES 1YBTA 2ZDOA 2DR6A 2BBEA 2K1RA 1HNZF 3NCQA 3GLJA 5EN1A 3KK2A 3EXCX 3OVBA 1ZPVA 1XR5A 2IHR1 3LALA 3UVJB 2VOOA 4NEYA 2XHCA 1HW8A 1JXEA 2C3OA 3AQPA 5CYQA 1I6JA 1S1WB 4ZP6A 3RG6A 2BW2A 2KM8C 4LT6A 1TKZB 1TKTB 4ES1A 4A8XA 4MJKA 4OX8A 3CT9A 4LSZB 2ALZA 1OY9A 2LU1A 3KK1A 1LKZA 1RQ0A 1RT7B 3D0IE 3GYXB 3SSRA 4DUZF 5GVQA 4ECZA 2N7YA 4Q2LA 2IM2A 3CW2C 1FRJA 2VG6B 4B3SF 1RBAA 1X5TA 3H4BA 2RRAA 3PCOB 2H4WB 1CG2A 2YNIA 1G6BA 2GIQA 5I3QA 4M1KA 3FNNA 3AJDA 1FCAA 4E2FB 1K9MT 4NI2A 2HNDA 1ZAXA 2Z2ZA 3NGDA 3J7ZT 1J5OB 5C7PA 4UOHA 2JFKA 4UTGA 3KDNA 3H40A 1Q16B 5KG7A 1CC7A 2D41A 2LCWA 2VL1A 1FJGJ 4LSLA 5EX3A 2N3LA 2GJFA 4DS5A 5DJBA 1EKRA 1Q79A 2VFSA 1KQGB 5KG5A 2NXNA 3J81j 2H51B 3I0RA 5KFAA 1PAUB 3M2VB 3HLUA 1RYRA 1B4SA 2BJ8A 3UW1A 1FDAA 3LF0A 2WVDA 3MCSA 2YWEA 3BSOA 1EIYB 2PT0A 3RTVA 1E6YA 4KIAA 3HSDA 2LQ9A 1HHTP 4CH0S 1S79A 3M2RB 1V5IB 2UVUA 2G1HA 1S9GA 2QA2A 1FD8A 2F63A 1WDTA 4NYZA 3CCWA 5DDPC 4RZRA 2A6MA 3I9V9 2C2MB 1NSQA 1RT3B 4CLKA 3GSDA 3R7SB 2V8PA 1QE1A 3KJVA 1GNKA 1S49A 5KFTA 4CYUA 3C6UA 4AUKA 2ZZMA 1WHVA 3K5PA 4ICLA 2D9PA 3UDVA 1QTNB 4P10A 4KJIA 2KM8B 2DXFA 4UW2A 3SCLE 4DV7J 5SZTA 3A8IA 4LFBJ 4F25A 4KHMA 3GPAA 3V6DA 2XS2A 2DNRA 2ADCA 4OI1A 2M4MA 2RSQA 2G1DA 4JYAJ 1DTTA 2YKOA 4IG0B 4ZA1A 4B3RF 1RAJA 1ZTTA 5ITHA 1X4AA 3JTPA 1Y5NB 1FDNA 3KLEB 2ZUAA 4ZP8A 3W63A 4I4BA 1FI4A 4IQMA 4PUOB 1RA7A 4X65F 3DLBA 2PC6A 5JVGQ 2FJBB 1P9YA 2V2QA 1M5SA 1XR6A 4NRTA 5IXUA 2HHUA 1KBRA 3IWLA 2B6AB 4E98A 3TEGA 2XGPA 3CTRA 3M8YA 4U7UD 2W2PP 2JEIA 3CO9A 2MZTA 2VKZG 5HBMA 1RAEB 3WDOA 1QLNA 3PFOA 4NLQA 4MK9A 4KV8A 2HKEA 2W9CB 4DG1B 1T94A 1I3OB 4CTAB 4A8WA 3CC4S 1OSDA 2OPRA 1N5SA 2ZOGA 2CPJA 4WF9Q 2XMUA 1YJNS 1NEEA 2B8QA 1NB7A 3AOAA 3C16A 4OHZA 4X4UA 5L39A 5KFQA 5MLCV 1X31C 1X9SA 5JVHQ 3QIDA 1BWVA 3T5LA 2DCUB 3U02A 3FCVA 4EBDA 1XK8A 1J27A 1U1LA 5K8PA 5DZ6A 1R0CB 3VGUA 4DR1J 3IBFB 3FBBA 3BYRA 3T5JA 1UEKA 3RUBL 4XPEA 4DX8H 3ZTSA 4ID5B 1PAEX 1QAXA 4NCGB 5KAKA 3IM9A 4GC6A 3PO4A 2B9YA 5CYJA 3K5MA 4JI4J 2V6AA 2YWWA 4F4YA 2HNYA 1NK7A 1IKXA 4QOTA 1UAWA 1RE1B 2HHPA 2GVDA 2K1RB 2G2YA 5F8IA 4OX9J 4PPDA 1JMTA 1Q5YA 4NCAA 2XCAA 5F8HA 3KK2B 5KFMA 1U1MA 5JJBA 1HQUA 2OPSA 3TA1A 3MFHA 1VFJA 1Y11A 3BPDA 1MWYA 5LT5A 3B54A 3RAMA 1DURA 4ZPWR 3R5BA 2PA8D 1HNXF 4ERDA 5CYQB 3P4UB 1JLQA 4HH0A 1JNZB 3E8OA 1X4DA 4Y00A 3FBCA 3MM5A 2MHEA 1GTHA 3AXMA 4WFAQ 3QPIA 4DQRA 4GKJF 3BH7B 3KK1B 5E33A 1HW9A 3RW6A 4JI5J 1JLAA 2V63A 4R8UA 3MGJA 1LWEA 3L7PA 4OJHA 1WEZA 1WI6A 2F4FA 1VBXA 2MLZA 3SMZA 3KG1A 4F4KA 1SVDA 1YJVA 1RGVA 4WFZA 1KOHA 3NAHA 4KGMA 2PA3A 2H5JB 3W5YA 4NMLA 4C48A 5LMNJ 4OJ3A 2YNIB 1F5BA 1RBOB 1K1SA 3V4IB 3I5AA 1VQ6S 1CJKB 4NI2B 4JI7F 1DAXA 2HNDB 1IVZA 3UE2A 4N47A 2ZWPA 1TELA 2C2KB 4WCEQ 4Y34A 4LSLB 2DXEA 4MT1A 4GC7A 3JAMY 3TUPA 1FNXH 4Z37A 1M5OC 4M95A 3GYNA 1G3OA 4CLWA 3FZBA 5ETQA 4A47A 5J1NA 4HTIA 3I0RB 4KPCA 1DFDA 4X4SA 3BDEA 1FK9A 3ZNJ1 2BDPA 2COLA 1UA1A 3G4SS 1HHQA 2GCFA 1IKYA 3AQOA 1E6YB 2MKYA 2FDNA 4UUXA 4J5OA 2AEMA 1FA0A 4ZPBA 4ETZA 1UVLA 3R7NB 3N28A 5BR8F 1S9GB 1KQSR 4ZVSB 4ELVA 4ES3A 5BXIA 1RT4A 2E1MC 5E3RA 2LU2A 2HW3A 2MY7A 4FF2A 1F5AA 3OFGA 1QE1B 3KJVB 1VQNS 4F3MA 1FEHA 4F26A 2DHGA 2JC0A 3KLIA 4WK3A 1UMJA 4ICLB 1TK5A 2QMXA 2K8GA 1RWWB 2KXHA 4YEAA 3ZO7A 4J9NA 1X4CA 2LA4A 3NWGA 3IS9A 1XJWB 2DHSA 5E3QA 3K58A 1NMEB 2CQ2A 4A8QA 2MSSA 3J7AN 3V6DB 4TU9A 1GXTA 3OLAA 3D9BA 1DTTB 1VQOS 5F3ZA 4A8SA 1TMJA 1MSWD 2R9LA 5KFKA 2FLPA 3RU0A 3P49B 3D0HE 3CVKA 3U7JA 3E51A 2FHOB 3GIKA 3H2VE 2J5AA 4MIAA 2V8HA 3SCIE 4K2XA 2FHKA 2W2MP 2VU5A 3A8JA 1LXNA 4ZPTR 2DR7A 3LO3A 3PJ9A 1ACMB 1SKSA 4LVOP 4F4AA 4QJVA 3TYTA 1N36F 2U2FA 3JSRA 2AZ1A 5HBMB 2HFVA 3H5SA 4QR2A 1T7PA 2JNJA 3OL8A 4KV8B 4JV5F 2XZWA 5IT9U 4ALZA 2V4QA 3TARA 4WYWA 3UWTA 2O67A 2EK1A 2OPRB 4OYIA 2Q6CA 3BB5A 4P7VA 2I1RA 4J9VA 1U1QA 1BHNA 4WIQA 4M5KA 3C16B 3N5BA 2CJQA 2DK2A 4K4SA 4RNNA 5AXKA 1VQYA 4DI6A 2Z0GA 3IO1A 5KFYA 1J5EJ 1HI1A 1UWAA 3BBBA 3ILIA 1S7HA 4TXSA 1I51B 2XNRA 1FVSA 2DISA 2UXCJ 3BZQA 4TQRA 2BQ3A 2CDQA 1S9FA 4X4OA 3D6MB 3EYZA 1NZAA 2MMYA 2HNYB 1FRHA 1AFIA 3C14A 1Z2ZA 1U4BA 1PC4A 1IKXB 1MU2A 3KHGA 2GVDB 1ZZFA 2UXDJ 2R7XA 3MM7A 1T3NA 4LJMA 1HQUB 4M63A 1YITS 5E0OA 5CCLA 5CXTA 4DSIA 3G86A 1RISA 2BW7A 3PYGA 2UXBJ 1C1CA 1JLQB 2KFNA 5J2PA 2RRBA 1N0UA 1GMUA 3X1LB 1X4BA 2HHHJ 3QFHA 1NKEA 1XNQJ 2JLGA 1WWHA 3MM5B 5DQIA 1HNWF 5CD4H 3CSKA 1PJ7A 3I6PA 4YFUA 4K4ZA 1SPBP 2FIUA 2QC3A 3GFYA 1JLAB 2WCXA 4R8UB 2XZDB 1LWEB 4NLYA 3QO9B 1U1RA 2VQEJ 1KFDA 2C2DA 2IA0A 3X3UA 1AUDA 2V5HG 2RS8A 3IFEA 2JEJA 3CD6S 5HK4A 1FXLA 1S6OA 2W01A 2MEWA 4B3MF 2A0FB 3FVYA 2FPHX 3KFWX 2BRLA 2CQ1A 2MQLA 5LMUJ 4P75A 2H3EB 4IG3A 3UD4P 1RHRB 3ZZ0A 2CNNB 4JI1J 4EU0A 1B0TA 3QZ8A 3MEGA 3GONA 2DH9A 3N0VA 1EZZB 5A6WA 2V34A 4QWEA 3T1YJ 4PYDA 2GAGC 3EE3A 2BM0A 4MYTA 1ZM2A 1RBLA 1FK9B 2XMJA 2L41A 1XQIA 2RILA 3HK2A 3I32A 1RKIA 3NGUA 2KTQA 3HFZB 2V94A 2MKJA 3JYTA 3BKFA 2LDYA 1XTZA 2HIYA 4WXWA 5I42B 4AD6A 3DDIA 2PSZA 3TJ9A 2FJVA 3MURP 3ZTPA 2Y0BB 2EC2A 1RTZA 5FD1A 3D1OA 1RT4B 2QMUB 3T41A 4ED3A 3R1LA 1PKUA 4P2XA 3KHHA 1VBKA 1N52B 7FDRA 3ENAA 1MG7A 3ADAC 4F36A 3OSPA 2FVCA 5LXRA 4FDFA 1VRUA 3T19A 3CCQS 3MR6A 2EFPA 4ANDA 2EWHA 2WBMA 2L3MA 5CA5A 3IS9B 3WZ0A 2YQ1A 2XMVA 3EGWB 4I0WA 3PW0A 2XY7A 1RWUA 1VQ8S 3I5BA 3IP0A 5KT5A 5KFFA 4QWDA 3CJ5A 2IY5B 1JLBA 3H5YA 5HQMA 2QA4G 3DRYA 1SI9A 3CPWR 4ZJOA 4WXOA 4JI0J 4XIUA 1VK8A 2XWYA 2ZH6A 5F8JA 1YBAA 5KT2A 3HT3A 3ISNC 1KONA 1M0SA 1CBKA 2VD3A 3MPUB 4YHHJ 4DS4A 1EETB 5L46A 3OPKA 2Z2MA 3N5FA 2MQPA 5A8KA 4BBYA 3EZ5A 3GIRA 3HZEA 1I1GA 1ZM3A 2CA9A 4QIFA 1NK9A 2LMIA 1FXDA 3CJ0A 1R0BG 3TVZA 2RHSB 1FJGF 3KUHA 4LF7J 1NJWA 3MCOA 4F0MA 2B7BB 2V69A 2VF3A 3HFVA 3UFCX 1JIHA 1KHVA 2YKMA 2YWFA 4CNYA 2K06A 1SUQA 1TFWA 4JV1A 4U7CA 4ZJQA 1FE4A 2GHPA 1H72C 2HFZA 2I38A 1S6QA 3QATA 4EEYA 4LF4J 3H5XA 3BPSP 3JSMA 4G6VB 2L9WA 3MDFA 1IBMJ 3B82A 2QT7A 4O23A 5D8HB 3GZ7A 1DJ0A 1M5HA 4K0KJ 5C2CA 2E44A 3F56A 3TJ8A 3C14B 3I55S 3VAHA 1PSDA 1MU2B 1U26A 2XSFA 1V3ZA 3DXSX 2QG9B 1TL4A 1UFLA 3MM7B 3Q8SB 1G1XA 4URSA 3ELHA 4OIXA 5RUBA 5I4MA 2BMBA 2L48A 4KY3A 2OGUA 1C1CB 4JYAF 4YQWA 4LFCJ 1NKCA 5D6GA 2PEBA 5J2PB 5GAGI 1WDDA 3FC9A 5D0GA 4TYBA 4O3QA 3W65A 4PRFA 3ILOA 4X84A 4CLSA 4I69A 1JJ4A 2UVVA 2UVWA 2HYIB 1UJ5A 5U47A 2BX6A 3MUMP 4IO9Q 2H4YB 4F50A 3LP2A 3UN3A 4ZVFA 1T3OA 2XNQA 1NB2A 1UVJA 2YQ0A 3U1LA 4TLRA 1SXLA 3I87A 2F9JA 1MMLA 1KWMA 2HAFA 3CJ3A 3IBWA 4PR6A 4MMOA 2ZH3A 4KT0C 4HH1A 3OFEA 5HN0A 2LECA 1U09A 3MWBA 3TWZA 3K57A 2Z57B 1QAIA 1VCTA 3EGZA 4IG3B 3GV5B 2FZGB 1WOOA 4FS2A 4KAIA 1HMVA 1EX8A 3MEGB 1QAJA 2C3UA 1XBWA 5KFLA 4TN2A 2G2OA 3ICLA 2M2BA 1RHQB 3G6ES 2FZKB 4DCPB 5H9EK 2AF6A 3OFHA 3QAUA 3UI3A 1UFWA 2E5GA 1WELA 2BYCA 2N7CA 3MR3A 1VRTA 1R8CA 2EFOA 1R7IA 3ZZZA 4DR1F 5KFGA 1QJHA 1NUEA 3JYTB 4DQIA 1TZ0A 2MKSA 2CG8A 4X4VA 2KN4A 1QM9A 5ETOA 2KG1A 4UQTA 2Z2YB 4Q0BA 2K7JA 2DNYA 2OI2A 3SFUA 4JI4F 3G6VA 2GAHC 3ILLA 4K4VA 1D8YA 4C9DA 4OX9F 3HDSA 4BWJA 4FXDA 4RWWA 1EP4A 2R7UA 2V4JA 4LRCA 2NPIA 1VRUB 5BJRA 3A12A 2J0WA 4F67A 4USMA 2AGOA 5DGAA 3CCSS 1FX4A 2ADBA 2DR8A 1PYTA 1H3DA 4ANCA 5A2QY 4OZLA 5CZXA 2B9XA 4M5MA 4XPCA 3BQ0A 3CCTA 3CDEA 3JQKA 1JLBB 4RUBA 4JI5F 4P2SA 4OX6A 3M8SA 5K5MA 3RR8A 3PW7A 4PG6A 3MR7A 2CQGA 3B4MA 2RQ4A 3CC2S 3R2DJ 4QR1A 1JLEA 4IO1A 1YJUA 2QTWA 3DRXA 2R7QA 3L9ZA 1RT1A 2MZJA 1H0HB 3CJ2A 5A8KB 2ZITA 1NZ8A 1DRZA 3RRKA 5GMDA 4I6YA 3SXLA 2DGTA 4DPTA 3H0PA 3QLHA 4WBFA 1W7WA 3HHLA 3W62A 4J9PA 1X5SA 2E5IA 4DOZA 4X62J 4Y2IA 1M1KT 2Q66A 1NDKA 1VJWA 3HZGA 2PI5A 1WSRA 3CCVS 2YKMB 4Q5VA 4QYRA 1PC5A 1SUQB 2AZ3A 1UZHA 5ETLA 1FHTA 4A8FA 3QRQA 4TKTA 1YQHA 2JFDA 3TI0A 1T11A 1L3SA 1S6QB 4WYLA 2AWZA 4CWBA 2ACYA 4UF4A 5B09A 5T7LA 3MOJB 2O5DA 2QLWA 2IVMA 2QL9B 3BN4A 1K0VA 5DLFA 2QRRA 3JSYA 5H9EJ 3H7HB 2ASLA 1HBUA 2GW8A 2GMHA 4Y65A 1UVMA 2MDAA 3N6LA 1O0PA 4HDHA 4LIRA 3TZWA 2XM3A 4IOAQ 1KNZA 2QFJA 2ILYA 3AOBA 4EWTA 2HQ3A 4J90A 3OL7A 2ATCB 3HPOA 2BABA 3DDKA 2YNHA 2YPZA 3BS9A 5HVGA 4BCAA 3BGUA 1S6PA 5A0YA 5J2QA 1AW0A 1WF1A 2GHVC 3A4TA 3VQTA 3KLFA 2CVEA 3QT6A 4ENOA 2HMIA 2BJDA 4AE5A 2IBOA 2HBZB 2FJEB 1YBUA 3LP2B 1UEVA 4ZP9A 5KFPA 1S9EA 1WOPA 5IWAJ 4LBIA 3LGNA 1B7YB 1N48A 1CPZA 1GT8A 3BGRA 2GNKA 2YKPA 4FYXB 3LGMA 1N0VC 1SCJB 1VQ4S 1TQLA 4JI6J 4P73A 2X3GA 2W2QP 4OFZA 2XC9A 5HVFA 4C0HA 4CO0A 1HMVB 2AYMA 3HHLC 1UTAA 1HWLA 4NLTA 4WZQA 4FVCA 3TA2A 1SJ1A 2GGPA 2VG5A 5JUMA 4XO0A 2HZVA 3L7OA 4HTJA 4GO5X 2VBYA 2NUUG 2WW4A 2HHVA 3AAWB 3TA0A 2KO1A 4OZJA 1YVFA 2OAUA 4Q43A 1VRTB 1NCLA 4F2SA 2M8DB 3EGVA 3ETMA 2RJZA 2Z58B 1J5EF 3PW5A 2CPHA 3VR1A 4ZVOB 4F0HA 2HHTA 3KLVA 2CJAA 1A7GE 4ITSA 3OL6A 3M9NB 2YH1A 3CB4A 1U1PA 2E5HA 4Q0BB 2J9DA 1WEXA 4C8LA 2MYFA 3FBEA 3AA9A 4MIWA 4IDKA 4XDCA 3UDCA 4TU7A 2OPPA 1WC1A 3QJPA 2KL8A 1HNZJ 3CMES 1NK6A 1EP4B 2FZCB 1PCAA 5J2NA 2V4JB 5KFRA 4DCJB 3RB4A 1RWKB 1RWPB 3EJMA 3GYGA 1LWFA 1C4CA 5D77A 2XMTA 2UXBF 5D4PA 1TVRA 3MUVP 2HWIA 4DBQA 2HHHF 1IXKA 3BKTA 2FY1A 4LREA 1YX2A 4NLVA 2VC1A 2XGQA 4ECUA 5FJ4A 2FJDB 1RAFB 4PXCA 1FWLA 2GQ2A 1TK0A 2VQEF 3F0NA 3W9HA 4K4WA 1U7LA 3IWNC 1TKDA 1JLEB 2F1FA 4A8MP 1WEYA 2VIHA 4L3NA 3RJMB 3RBDA 5M2UA 1RT1B 2HWHA 3TUIC 3PRBA 2CZ9A 4LRDA 1PILA 4ER8A 3CJRA 1VC5A 1IQTA 3T5HA 3D66A 3E3XA 5AT1B 3QLHB 3T1AA 4WK1A 2I6WA 4OYAA 3HHLB 4JI1F 2LKZA 1HWIA 2WAQD 4RKUC 1QUVA 5EDWA 5AE1A 2QO3A 3M8RA 2QA4S 1VI7A 4ZVRB 4UOGA 2OJ3A 3HF5A 2WB4A 1S76D 2KRBA 3T1YF 3R5DA 2DNKA 4NMXA 2KFYA 3CCUS 3MECA 3HHNB 4LRBA 5D0HA 5KFWA 2EFQA 1K8AT 1KP6A 1JX4A 3IAM9 5T7LB 2EKYA 1NJYA 3US5A 3NNHA 4ED4A 2DGWA 3C8YA 1F6TA 1SC3B 1D0EA 4Q8EA 2DR5A 2IMWP 4NCBA 4OL8A 1VBYA 2O01C 4FBUA 3PHTA 1HBUB 2MJUA 2VFTA 4IKAA 2QE5A 1U45A 1VS3A 1N5VA 5FLXU 1FJ7A 2FVSA 2V50A 2ZVSA 1LWXA 4RUHA 1X4EA 3N6MA 1T9YA 5KT4A 2DB1A 2ZHBA 3TAMA 1VQLS 3J7A1 4M5DA 4H54A 3ZZRA 3AFGA 1R8AA 2ZBCA 2YNHB 3GE9A 4USHA 1Q1KA 4NA1A 4O0IA 1S6PB 5A0YB 2EXUA 5J2QB 1TTHB 1IUJA 2A10A 2P6TA 3G2XA 1QSSA 3HCXA 4MTPA 4JI0F 3KLFB 2V8GA 3AD9C 5GAEU 2HMIB 1FJCA 2EKNA 2D3UA 2IJNA 3PJWA 4DN0A 1R6YA 1WKKA 3JS9A 2MSTA 3R97A 2B5JA 4OI6A 2UV8G 1MWQA 1S9EB 3BJYA 1FKPA 4PAAA 3KNGA 1RHUB 5E3AA 3BGRB 2CPFA 3GJRB 4LVNP 2CWXA 1B99A 5C42A 4IQXA 1FFSB 5EGYA 5F9NA 4LF7F 2D7SA 3FCHA 4QWAA 2G9OA 2PMHA 4GVBA 1U24A 3Q22A 4NL5A 4YS2A 1ZA2B 2GMLA 3EWGA 4K5SA 1FNMA 2GGPB 2GO8A 3LH2S 2YBVA 2ZH7A 3C3LA 3HI9A 1REGX 5E7OB 4CH7A 2DGSA 2ZWOA 2PI4A 2B9EA 4Q7AA 3HT0A 3K59A 4K50A 3FFIA 5G0RA 3DRRA 3D3CJ 3O44A 4LF4F 4ECRA 5KG1A 3KUEA 4NLDA 3CMQA 1S72S 1IBMF 2FUG9 1F5CA 5IC4B 1PJ6A 3QQCD 1Q78A 3TQEA 5K14A 4K0KF 5CCMA 2NS1B 4M5HA 4HT5A 3MUTP 2HBQB 3CJQA 3DLKA 4IDKB 4X4PA 4O4GA 4ZCMA 3QGIA 3FCWA 3CO0P 2AJ1A 2OPPB 5LSLA 2XEXA 2J0QD 1VC0A 1HARA 3T9ZA 5J2NB 4IOBA 3RR7A 2F8HA 4USIA 3PR5B 3GG1A 4UY8T 1LWFB 3MFIA 1KRPA 2RS2A 1HNXJ 1TAQA 1T03A 4LFCF 2QYGA 1JB0C 2YKAA 4WFXA 5KFUA 3W5XA 3MXHP 4PG5A 4F7VA 5B0DA 3IBCB 2FHJA 2WONA 3JTNA 5F9LA 4OYMA 2GQQA 1HBOA 4X66F 3OV7A 4B9MA 3J81U 2K3IA 2NZCA 2B9WA 2YKNA 3I56S 4LF1A 3N01A 2J9DE 4HHJA 1VQ7S 5GAGU 1HL6A 4EK2A 4EFAC 4Z7YA 4DV1J 2MKIA 1A6LA 2GJ2A 4X4RA 2WZ1A 3M4XA 4NPOA 1L3VA 1TL5A 3AA8A 1QVGR 4DFKA 1HNIA 4OHVA 4I68A 3PVXA 2YX7A 4RW8A 4F0KA 2LEAA 2ZDPA 2MKCA 2ZH1A 5IOLA 4C0OC 1B64A 3Q8YA 1M90T 1YG0A 2CADA 2LFVA 3MECB 3HHEA 3BSNA 3DLGA 2WVFA 2B4PA 4NOHA 1Y5IB 3FQLA 3IR7B 2DRBA 5DG9A 5KG0A 2V9WA 1WKJA 1O51A 1XMQJ 4RLEA 2DGVA 3OVAA 2QLBB 3NGTA 2CQDA 3H98A 1KD1T 2OD6A 5BR8J 3UD3P 4RBVA 1QD1A 5HL7Q 4USTA 3RBXA 2LXIA 5HQLA 3CMAS 5ETSA 5L1JA 4DR4J 2DHXA 2B3TB 1VHIA 4YR2A 1CQMA 1X9WA 1N33F 1WG5A 2B4VA 1R8HA 1WTBA 4RL1A 1MN7A 2FHMA 1TMMA 3WX4A 4ZKAA 3KXDA 4USVA 2IC3A 5HMXA 4F3OA 3GJTB 3H59A 1MNEA 3NGKA 2MQMA 3W61A 3NG8A 1SV5A 3ET6A 1CC8A 2F8EX 3TAMB 4DV6J 3LUYA 1TKZA 4M5DB 1FF2A 4NZ0A 4ZPCA 2VB6A 2VODA 1W2IA 1WHWA 4NWBA 3QFWA 3VAKA 1RT7A 4RWXA 3CCZA 5KFSA 4Z7CA 1WD6A 4ANEA 1QUPA 4N56A 5CD4A 2B51A 1LK5A 2D69A 2H54B 2WRMA 3MMAA 2ZJRQ 3VAMA 2AD9A 4HI2A 1S77D 2B5JB 3QIPA 1DBDA 1FKPB 4DR2J 3OJUA 3DI6A 1P1LA 4YY3J 2PD1A 1N36J 2VV5A 3HVTB 1VQKS 1KLNA 3NEKA 1ZZNA 3BGLA 5C42B 4ZCKA 2AJ2A 1QVFR 4MK7A 5IS2A 4X62F 2W7OA 4PWWA 3S01A 1V3SA 2V68A 5D4OA 4GVBB 4WKRA 4CO2A 4ZLPA 2A3JA 7AT1B 2IDLA 2DGOA 2P6SA 3CDBA 4X64J 2K3KA 1OYDA 4USWA 4XTTA 3HVWA 2KKHA 1M1GA 4KHPJ 3FFIB 5G0RB 4E0DA 2Z2LA 3DRRB 3ULHA 2UUWA 4ZVGA 4C3KA 4F3QA 5KFHA 3KMQA 1U2FA 2XI3A 4DL7A 4KH1B 2DRDA 1DQAA 5HATA 2IFXA 1YHQS 4LF9J 5K14B 2ZVIA 5KFOA 1BMQB 2MPUA 3DLKB 4KO0A 2BQRA 3KMSA 3T5KA 4OYPA 2KH9A 1UPMB 4AQYJ 1BQXA 2OUGA 3P45B 2OH2A 1IBKF 1HBNB 4EUVA 3RZAA 1ULRA 3M05A 4DL0C 2HEKA 3SFGA 1ZS6A 2HLTA 2RB7A 1BQMA 2CNOB 4C0BA 4F4WA 5EWGA 1T03B 1EAYC 2MB0B 1HQ2A 2B4UA 3J7Z5 3ZZPA 3CJ8A 2IYIA 2UU9J 2WONB 4RPFA 3FSIA 2AHOB 1HBOB 3PX4A 2J8AA 1TV6A 3A3PB 1LOUA 1KVKA 2OMLA 4FYVB 4OZ2A 1GEHA 3D7SB 2YKNB 4FN5A 1IN0A 2FD2A 3OXLA 2KI2A 2WVBA 1D8ZA 5IWAF 2BRKA 2EW9A 4BWMA 3HMJG 4RW9A 4ZVTB 4P52A 3TUJC 1P6TA 2VG7A 1NHVA 1VGYA 2JOQA 4W4MA 1SL0A 5KFCA 1SH2A 2XYHB 2KU7A 1RHJB 4NLSA 4JI6F 2OSRA 2VFRA 3GB0A 3SIPB 1R8BA
chains in the Genus database with same CATH topology
4BDPA 2E1AA 1HNIB 3OR2B 5KT5A 1RTHA 5KFFA 3OL9A 4QWDA 3CJ5A 2RU3A 2JL9A 4I2QB 3MM8A 4RW8B 3GR0A 1T95A 4K5RA 2EK6A 5FDLA 3M9OB 1JLBA 1H38A 4DN9A 1GX6A 2HS3A 3H5YA 2QZ8A 4CH1A 2QA4G 3DRYA 1SI9A 3CPWR 2OSQA 3BDPA 2MZ1A 2ASJA 2OMOA 3SSSA 3SI8A 2JJ4D 4WXOA 4NLWA 4RNMA 2AJFE 4XIUA 2CPEA 1VK8A 2XWYA 2ZH6A 1N4LA 3D5MA 2AGPA 5F8JA 3G8QA 2XSJB 3DLGB 2R7OA 1YBAA 5KT2A 4YR0A 3HT3A 3ISNC 1KONA 3AB2B 2WW8A 1M0SA 4OX7A 3SCKE 1BWEA 4P6QA 2VD3A 3MD3A 2QA1A 2FJWA 1KVIA 1U1NA 1B0PA 4DS4A 3GWCA 1EETB 3LOUA 1N5QA 3OPKA 4IRKA 4YOEA 1N88A 2Z2MA 2PFFB 1RTIA 3SYZA 3N5FA 2KYZA 3L3CA 4H4MB 4O44B 4WU3A 1FDBA 3DOKA 5C24A 5A8KA 2MZRA 4BBYA 2MQPA 1K0TA 3EZ5A 3M30B 2PE8A 4OZ0A 2CQBA 2FGCA 4DFJA 1R3NA 3HZEA 3KG4A 3UQSA 3TAPA 2CZVC 1I1GA 1LQ9A 1ZM3A 2W24A 1F60B 4JV0A 4QCLA 2XI2A 4QIFA 4C97A 3MAHA 1BY9A 1MW7A 3HHDA 2LMIA 1NK9A 1C4AA 4EYIB 5HMWA 1FXDA 3Q8QB 1WNEA 5E5NA 1TVRB 1W25A 2DCLA 3CJ0A 4PXEA 1SJQA 3TVZA 2CRLA 4P7TA 2R8HA 1TK8A 1FJGF 4BHQA 2B56A 5THWA 2VC0A 3O8WA 4GO7X 1L3UA 2U1AA 1E6VB 1HHSA 5HO4A 4O4RA 1UA0A 5CQGA 1NJWA 4NRUA 2MKKA 3ZFVA 1PO6A 2B7BB 1Y0HA 1LFWA 4KE5A 2HFOA 3CXCR 2QMWA 3J81Y 3UFCX 2BANA 1JIHA 2DGXA 4CT8A 2M9KA 1KHVA 2YKMA 2YWFA 1T8EA 4CNYA 3R3TA 1WHYA 3K8WA 1SUQA 1L5UA 4IYQA 5L38A 3DLJA 1HA1A 1TFWA 2XLIA 5BYSA 2RKIA 3O1LA 2LYVA 3J80Y 4JV1A 1QSLA 4U7CA 4NLUA 2IC3B 1RKJA 1XNRF 1FE4A 4EZ9A 5IFMA 7FD1A 3SSQA 1R0AB 3MM6A 3WC2A 2GHPA 3MTJA 2HFZA 2CQPA 2I38A 3IN5A 1SV5B 2E29A 3OXGA 1S6QA 2EG2A 2C2EA 5DO2A 3V6HA 2OPQA 3KLHA 5DM6Q 3C46A 2V8DA 2P9CA 4PQAA 4JUZA 1XEZA 1ZTWA 3DRSA 3ZC4A 1WHXA 5E41A 4EEYA 3C6UB 2VA3A 1HWJA 1HNVA 2BZ2A 3H5XA 3GMGA 2KXFA 3JSMA 3VALA 4G6VB 4CIOA 3TO8A 2L9WA 4IH5A 4DR7F 2FGOA 3DLHA 1KS2A 2NZ4A 5DQGA 3VAIA 2RDIA 3MDFA 3PACA 3BEGB 2JEFA 3KOAA 2P9GA 4QW8A 3B82A 2QT7A 4O23A 5EWEA 4WFYA 1NH7A 2QYCA 4U9RA 5D8HB 3RAXA 2FVRA 4Q45A 3GZ7A 1DJ0A 1M5HA 2C22A 3RYLA 1ZH5A 4NX9A 3MM9A 1S99A 4PKDB 4NLXA 3Q24A 5E3CA 4JOUA 3MAQA 4UUWA 3DYAA 2E44A 3F56A 5D4LA 5C25B 2KJVA 3HKZD 3NMAA 3I55S 2ZD1A 4NLRA 5B08A 3VAHA 1FRKA 1PSDA 3I82A 1B7FA 1MU2B 2XS7A 3M8QB 1U26A 3MMAB 3VQSA 4IRCA 3EX7B 3O3LA 2XSFA 4DL3A 3R1HA 1V3ZA 2CQ3A 3DXSX 4C8NA 2I2YA 2HHQA 2AYGA 1U1OA 1TL4A 2VH7A 2OP5A 1OWXA 3LQVA 3PZPA 4KKOA 1UFLA 3MM7B 1JLCB 3QIPB 2DNPA 3Q8SB 1YJRA 5CYMB 4C3MA 4ZHRB 1G1XA 4URSA 4ZCIA 1RP5A 4ECTA 1C0UA 1Y3JA 4KSEB 4EO6A 4ED7A 3V4IA 2E9TA 4KRWA 3DI6B 1KQFB 4JI2F 1FO1A 4HEA9 5IM0A 4OIXA 2EVZA 2BOPA 5I4MA 1KVJA 1JKHA 5HLFB 2L48A 4IOCQ 3M8PA 4YB7A 2BQUA 1TL1A 4C8ZA 5LSOA 3M9MB 1XERA 1IKWA 3DXBA 3PKYA 1C1CB 2D3OR 4JYAF 4YQWA 1N6QB 1S0VA 4TNOA 1FNOA 1TUVA 1HYSB 4OHWA 1NKCA 2DIVA 3T6BA 5D6GA 2R7SA 1Z1ZA 5J2PB 5AE3A 2XY6A 3VZIA 3M2UA 3RRHA 5BYQA 5GAGI 5LL6d 3RBEA 1YRUA 1Y5LB 3DRPB 4TQSA 1MWZA 3BGFA 1SJ4P 1SJFA 4TYBA 4O3QA 3ZZYA 1NH8A 1S1VB 4PRFA 4R0EA 3MEDA 1S6UA 1NNDA 4X84A 4WE1A 4DL5A 4MFBB 3ZZOA 2KT2A 3I4HX 1U25A 4KGKA 4NZ7A 5LXYA 2WSEC 4I69A 1JJ4A 2E9RX 1RT2A 2F9DA 3IGNA 2FC8A 2KHDA 2BR0A 3G6YA 3CJKA 2UVWA 2UVVA 5KFBA 3BO4A 5IT9Y 4ZVEA 2HYIB 3PR4A 1UJ5A 1NJXA 4LUBA 1NJIT 2EG1A 1FDDA 3IAS9 2ZUGA 1M5KC 5AXNA 2QSFA 5U47A 4ZS6A 3MUMP 2R2UA 4IO9Q 1MMNA 5DDOC 4F50A 3LP2A 5SUHA 4DUYF 4J9QA 4D3GA 4ZVFA 2FVPA 1T3OA 4MH8A 5L8RC 2XNQA 3OR1A 4YUDA 1O8BA 3OTEA 3K8VA 3KHRA 2ROGA 3KTQA 1UVJA 1LFPA 2YWHA 2Q79A 4DL6A 4NZ6A 3U1LA 2IVYA 4TLRA 1S0OA 1SXLA 3I87A 5KT6A 2NPFA 2F9JA 3CEDA 1S0MA 1MMLA 3CCMS 2DD8S 1GTEA 3CJ3A 2DNOA 1WI8A 3SCJE 2R2SA 3KNAA 2E9ZA 3PKMA 3FJ2A 3IBWA 4LSNA 4DL4A 4PR6A 4MMOA 3GQCA 1YWXA 4C4WA 2ZH3A 2V4RA 3G71S 4KT0C 4HH1A 2A18A 4DDFA 3OFEA 5HN0A 2LECA 1U09A 3MWBA 3UR3C 1S1WA 3NMRA 4ED5A 3FEXB 1KQKA 3PNIA 4CQ1A 3K57A 3V6JA 2C3YA 1QAIA 1TKTA 1Y7PA 5AXMA 2IM0A 4IG3B 3EGZA 5EUHA 1JLGA 3GV5B 5DQHA 3GIJA 4B02A 4DLGA 5D3GA 3OUYB 1N32F 4MYUA 4FS2A 4KAIA 1HMVA 4NLOA 4KO0B 2KB2A 3MEGB 3FSYA 1QAJA 2C3UA 1XBWA 4PWUA 1LW0B 5KFLA 2JC1A 2QIFA 2OD4A 2IRUA 4TN2A 3W2VA 4URQU 1NKBA 3UDLA 4NA2A 3ICLA 5K8OA 1VQPS 2M2BA 3G6ES 3B8HA 3V81B 1REVA 2DT9A 5K8MA 1Q86T 2UUBF 4AYBD 4QR0A 3T9NA 2AF6A 1BC6A 3GFXA 3OFHA 2YNGB 2HPUA 3QAUA 2WHOA 3OSNA 4DF8A 3UI3A 1FJEB 2LQJA 4NA3A 3C6TB 3DOLA 1UFWA 2E5GA 2DGQA 1WELA 2BYCA 2XMKA 3I5CA 2EFVA 2N7CA 3MR3A 2PDAA 4X4PA 2VG6A 1VRTA 3N6NA 1WG4A 2I9SA 1R8CA 2EFOA 5AJ3F 1KOOA 1BQMB 1R7IA 2M88A 4LIWA 5B0CA 3ZZZA 4Y2MA 1FD2A 3KLGB 4DR1F 4ED8A 2QLXA 2B7CB 1NK4A 5KFGA 1QJHA 1ZM4A 3H4DA 4N5SA 3JYTB 2W4PA 4DQIA 1TZ0A 1M5VC 2MKSA 2OPSB 4X4VA 2UUCF 4RNHA 2RE1A 4RUCA 2KN4A 3UNGC 4A8OA 3FRYA 3MEEB 5J1EA 2RDJA 4ECVA 1QM9A 2KG1A 4UQTA 2XLJA 4Q0BA 2PEHA 1LV5A 2K7JA 1J5OA 1KLMB 2FHJD 5GAHU 2DNYA 3BM7A 5A8RA 2RIJA 4LQ3A 2RQKA 4ZOSA 2IRYA 3SFUA 3T3FA 4JI4F 3G6VA 5B0GA 3S1TA 3CUNA 2J7WA 3RB0A 4LQ9A 4QIVA 1QY7A 5KOWA 1TV6B 4K4VA 2R8IA 2RVJA 1D8YA 3MMCB 4ZPDA 3DDNA 1P9QC 1FKAF 5KFJA 4F4ZA 4C9DA 1IKVB 4OX9F 2AQ4A 4DMZA 1DQ9A 4B3OB 3V4MA 3HDSA 4OV1A 4BWJA 3OQ2A 4DPOA 2KFZA 4FXDA 1Q8BA 4TY8A 4QBUA 1DQ8A 5L1IA 4RWWA 4ECQA 2DITA 4X4QA 1EP4A 4ECWA 4J9SA 3F41A 3V6KA 3POTA 2YVSA 2R7UA 2V4JA 3VWSA 4YB1P 2CQIA 1ROFA 5KG2A 4UY85 2XB2D 1TFYA 2NPIA 2KZMA 2R7VA 2AJ4A 1VRUB 4RW7B 3M2VA 5BJRA 3PHEA 1TL3A 1C2PA 4RW9B 1UJ6A 1NHUA 2EBEA 2J0WA 3MR5A 3P5TL 2YTCA 4F67A 5KT3A 1MROA 2VG7B 2AGOA 2ROPA 4A8YA 1U6FA 5DGAA 4C11A 5I3UB 4DV2F 3CCSS 1H98A 3IRWP 4M8LA 2NREA 1DLOB 3CULA 2RRNA 1H6KX 2PO4A 2WSFC 2HAIA 2DVIA 2D74B 1RJJA 3DMJA 2J7UA 2J76E 2R2RA 2ADBA 3M1VA 1L3TA 2OFHX 2DH8A 3NLCA 2ZJQQ 2DR8A 2M8HA 2AV5A 1RTDB 1H3DA 3M2RA 2RMLA 2VBZA 4OZLA 5A2QY 2KRRA 5CZXA 5F0UA 5F3TA 3UPFA 2B9XA 1RTHB 4XPCA 3BQ0A 4YB6A 3CCTA 3MM8B 3CDEA 4KB7A 3RAQA 3W3SA 1ZAWA 5FDLB 2ABYA 4RNOA 1JLBB 2UVRA 2M0GB 3MZIA 1SJRA 4JI5F 2DH7A 4P2SA 2HNZA 1P27B 4EGLA 1NK0A 2BACA 2H5EA 4OX6A 1H7WA 3M8SA 2J6SA 4TU8A 5K5MA 2XULA 4FS1A 4NYOA 3PW7A 3RR8A 1RT3A 4PG6A 1OQ6A 1RA6A 1CQNA 2YNFA 2RT3A 2CQGA 2MQQA 3B4MA 4O4GB 5KFIA 2P5VA 2RQ4A 4ECXA 3CC2S 1ZETA 1Q7LB 3QAEA 2VFUA 4FYDA 1CVJA 4QR1A 2DO4A 4C7QA 4Z2XA 2W8KA 1UEUA 2WBRA 1JLEA 4IO1A 1YJUA 5T14A 1UP1A 2VA2A 3PJXA 3DRXA 1VIOA 2R7QA 5BYRA 4CZCA 1RTIB 1RT1A 2MZJA 2IA6A 3S6EA 1H0HB 3CJ2A 1PGZA 5C24B 1NJZA 3DOKB 5A8KB 2N82B 2CYYA 1HQEA 2ZITA 1IJEB 1DRZA 1N5TA 3LP0A 3RRKA 3MPWA 4Y6IA 3SV4A 6FD1A 1URNA 2UZAA 4I6YA 3PV8A 3SXLA 1JWWA 2OLWA 2DGTA 1RK8A 4XK8C 3VAJA 1XC9A 1SQEA 1N5YA 3QLHA 4WCEQ 1IKYB 1DHMA 3DFEA 1R43A 2E1RA 3OTBA 1H7XA 1NK5A 3HHLA 2NLWA 3TQ1A 4JV2A 3S7RA 1S1XB 2JH3A 1XN9A 4AXIA 3AB4B 3DM2A 4J9PA 2ZM6F 2CPZA 1X5SA 2CQHA 4ZMMA 4IG0A 3OJSA 2E5IA 4DOZA 3LAKA 1QSSA 4K4TA 2IBKA 4Y2IA 5H9FJ 1M1KT 4G3IA 4Y2CA 2Q66A 3Q2TC 4X2BA 1D9FA 1XWLA 1FERA 1VJWA 2Q1LA 3HZGA 2PI5A 1KTVA 1AFJA 2O1PA 3SEOA 3CCVS 2CQ0A 3G8SA 4DR5F 2BANB 2ZHAA 2JWNA 3HO1A 2YKMB 4Q5VA 4AL7A 3KLEA 2VBXA 4QYRA 3NNAA 3EZUA 2IM3A 1PC5A 1SUQB 5GADU 3EUNA 4YB5A 3DHWC 2RKIB 5A6PA 1KC8T 3AHPA 4PUOA 1FHTA 3BQ1A 4A8FA 4TKTA 3Q0AA 4NYPA 1YQHA 2JFDA 3O6QA 3TI0A 2GHWA 4CO5A 3NNCA 2V9KA 2POKA 4OLOA 2VPXB 3HVTA 1X0PA 3MM6B 1VC6A 3DHXA 2WB1D 3NKYA 1L3SA 1S6QB 4WYLA 3D1HA 1Z2LA 2AWZA 2OPQB 3LWLA 3KLHB 1UVIA 4PQUA 2ACYA 3NP5A 3NAIA 1HPZA 2HHWA 5GMKa 2ZOFA 2HGLA 2B6AA 3DRSB 4H4KA 3KLIB 3LPYA 1HNVB 5B09A 4MKAA 5IQQA 3PDNA 2MQNA 5T7LA 3J7YI 3AY0A 2RH3A 3CF5Q 2ASDA 1AXQA 4PG8A 3FQKA 4C8OA 1GH8A 2JVRA 2X1FA 1Q81T 3MOJB 2O5DA 4HYKA 1F0XA 2ZKTA 2QLWA 2UUTA 2AGQA 3MTKA 2XMWA 3M32A 4ZP7A 3UCUP 3H2UB 3PW2A 4NXMF 4HI1A 2GFFA 4W90B 2CQCA 2IVMA 3BN4A 5GAEI 3O2IA 3M6UA 2GJIA 2E5LF 3QJLA 2X51A 3MM9B 3VAGA 2CQ4A 1K0VA 5CH7B 1CSJA 5FIIA 2CG4A 3D2WA 2Y1IA 1OO0B 5DLFA 2MQOA 1RI7A 4R5PA 2QRRA 3DYAB 4BS2A 4B9UA 4OI0A 3JSYA 3QO9A 3OTOF 2W9CA 5H9EJ 1V6HA 4DG1A 4ED0A 2KXNB 1SL2A 2ZD1B 1HBUA 2DBBA 2GW8A 4A46A 4CTAA 2ASLA 1GXLA 2GMHA 2LA6A 1QTMA 4FVMA 2P9EA 1LWCA 4Y65A 1UVMA 4DV1F 2BUNA 4YMEA 2MDAA 4CCHA 3N6LA 1O0PA 3N79A 4HDHA 4LIRA 1RDRA 4CNZA 4A8KA 1ZOTA 4KKOB 4Y3CA 4IOAQ 2X1GA 1KNZA 2QFJA 1C0UB 5DS7A 1W2BR 4AL6A 5IT4A 1HD0A 2ILYA 1Q8IA 1S48A 1OPIA 4OI2A 4ZPVR 4OQJA 5B0EA 5IM0B 4EWTA 1JKHB 2HQ3A 3JB9k 3OL7A 3M8PB 3HPOA 1TL1B 3PM9A 5IT0A 1ZBTA 3VTIA 2BABA 1IKWB 3DDKA 1XR7A