3ABKB

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3abkB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3abkB02
4A2EA 4GYBA 2UXTA 4E9RA 4YSAA 3U25A 2GB2A 4HCFA 1NWOA 2PP8A 2YAFA 2IWKA 4YVNA 4HZ1A 1BEXA 5AKRA 2J56A 3TBCA 4KO7A 2FQEA 3D12B 2XUWA 1IBYA 3WG7B 5E9NA 7PAZA 3AG1B 2ZWNA 1E5ZA 4YSQA 3DTUB 3FSAA 1J9RA 1AR1B 2B3IA 1KCBA 3NSDA 2OV0A 5B1BB 1L9PA 2PPDA 5IY5B 2IWEA 1ZDSA 1W6WA 3KW7A 3X1NA 5B7FA 2BP0B 4ZK8A 3SBPA 2H47C 5AZUA 2CBPA 1AANA 3UABA 4DPBX 1W6LA 3WKPA 4DPCX 2PPFA 4WTQA 1NWPA 1NTDA 2PPAA 4WKXA 3FYEB 4F2EA 1ID2A 4M3HA 2A3TA 3QJQB 2PP7A 3ZBMA 2IDUA 1MZYA 1OF0A 3PAZA 2GBAA 4G7QB 1J9SA 5FC9A 2HX8A 2FQDA 1AZBA 4BDVB 2QT6A 3WKQA 3X1EA 5ANHA 2YXWA 1A4BA 1OE1A 2AVFA 1A8ZA 3NJFA 1GSKA 3MBWB 1SHWA 2XU9A 3AW5A 2YAQA 1TEFA 1CYXA 3FSVA 4G7SB 3SBQA 3QJTB 3OMAB 4AI7A 1ETJA 1TKWA 5I5JA 1PMYA 2XX1A 2FT8A 4NERA 5I6OA 5PAZA 1GY1A 1NIBA 2XV2A 2YAMA 1UATA 2BHFA 2VW6A 1AAJA 1JZJA 1XB3A 3EH4B 3NJGA 1KDJA 2HLEB 4KNSA 3RYMA 1NIAA 1NDTA 2AZAA 1IBZA 2ZONA 4YL4A 5D4IA 4CSZA 4QKTA 3UGEA 2ZXWB 2MRYA 3GDCA 3H4HA 1OOWA 4W1TA 2HX7A 3ABKB 3CVDA 2DYRB 2BZCA 1MDAA 3ASOB 2WSDA 3V9EA 2BP8A 2IH8A 4YSPA 1AS7A 4E9QA 5B7MA 3FU7B 2EIJB 1SF3A 2H5UA 3NSYA 3ZIYA 1ADWA 1KDIA 2IH9A 2YAHA 4E9YA 4EF3A 1PNCA 4F7KA 1AZUA 1WS8A 4HIPA 3OM3B 1ET5A 4GP8B 1VLXA 3EF4A 4A66A 5I5IA 4AZUA 1BXAA 1MG2C 4E9SA 2FT7A 1AG6A 3CZUB 1RZQA 1PZAA 2QDVA 2B08A 2BW5A 3UAEA 2X87A 2R7EB 2WO2B 3AZUA 3QJUB 4A2FA 1JXDA 1IUZA 2GHZA 1SFHA 4GXFA 4PAZA 2DYSB 3EHBB 2PLTA 3NJNA 2XV0A 4DPAX 1RZPA 1QLEB 2FQFA 1NINA 5I28A 2I7SA 4DP0X 4UAHA 4BDVA 1L9QA 4G7RB 4MFHA 1JVLA 2DY2A 2IDTA 3PAVA 1QNIA 1KGYE 1SHXA 3IN0A 2AZUA 2YQBA 1QHQA 2X88A 2PP9A 4A2HA 1M57B 2WO3B 2DV6A 3ZDWA 3EH5B 3S3BB 3CG8A 4YSSA 4JHUA 3IN2A 4DP6X 1AOZA 2BP8B 3NJIA 3GXUB 1AS8A 9PCYA 1AZCA 3NP3A 1FA4A 3FPXA 2TSAA 4FA7B 2IWFA 2VMJA 3HEIB 4DP5X 3NJJA 1T5KA 1X9UA 4HCIA 2NRDA 2EILB 4RH4A 5A7EA 4N8UA 3G5WA 4YSTA 2BWIA 1V10A 4BK5C 5B3SB 4YSRA 1ET8A 1SJMA 1L9TA 4A2DA 8PAZA 2P80D 4Q89A 4YSCA 1GS6X 2BWDA 2FQGA 1ASPA 1KV7A 1IC0A 1OCZB 1GS8A 5TK4A 1PZBA 3QJSB 2CALA 2BO0A 5TK2A 1SF5A 4DP9X 1A3ZA 4DP2X 3FU7A 2XWZA 1V55B 1AQ8A 3SQRA 3TU6A 4KO6A 1KCWA 3C75A 3T71A 1WA2X 3NSFA 1KBWA 2MTAA 4ENZA 3FSZA 1SDDA 3KW8A 1JXFA 3OMNB 2XX0A 4QLWA 2UXVA 4KO9A 1BXVA 1FWXA 3T6XA 2VM4A 1OE2A 4FAAB 3AG2B 2UXFA 4KO5A 2R7EA 2JKWA 4AX3A 1ZV2A 1ZPUA 2XVBA 2Y69B 3AG3B 2GI0A 4HCGA 3ERXA 2FWLB 2VN3A 2BW4A 1A4CA 1WAEA 1ZIBA 2AFNA 1NIFA 3DIVA 1WA0X 4E9VA 4YSOA 3CVBA 1AACA 2HZHA 1YLBB 3FYIB 2Q9OA 1ET7A 3NYKA 4X4KA 5B1AB 4AKOA 3NT0A 2EINB 3OMIB 1F56A 3WIAA 1E67A 3S8GB 2CCWA 3S3CB 4K9JA 1R1CA 4L0PB 2TSBA 2VW7A 1L9RA 1NPJA 2XLLA 3UAAA 4BXVA 4YVUA 3IEAA 1OE3A 6PCYA 5B1JC 2PCFA 2JFCA 3N2JA 1N70A 3X1GA 1A65A 2DWTA 1TU2A 1PF3A 2YAEA 5B1JA 3OQRA 3T6ZA 2VM3A 1CURA 5F7AA 3AY2A 3OD3A 2LLNA 1JZEA 1GS7A 1ASOA 1PAZA 2CAKA 6PAZA 1M9WA 2IDSA 3S8FB 4JKNA 1SDDB 2CUAA 4KOBA 3WNJA 7PCYA 3FPYA 1MZZA 1GYCA 1AZRA 5B7EA 1NPNA 1NIEA 2HRHA 4KNTA 1JZHA 3QPKA 5I6LA 2W8CA 4E9XA 3SBRA 4N4YB 1PLCA 3TA4D 3WI9A 3NJMA 3NJHA 5I5MA 2YARA 1ASQA 2GIMA 1PNDA 2H3XC 3PXLA 1M56B 3UACA 4P5SA 4M4RB 1L9OA 1GR7A 2FJSA 3FU9A 2EIKB 3X2QB 2FT6A 1WS7A 1PLAA 5I26A 1KYAA 4TXVB 1ILSA 2PPEA 1JXGA 2E86A 3S3DB 2YXVA 2CJ3A 1E5YA 1JZFA 5EHFA 2XXFA 4AKQA 1CUOA 1PY0A 1NICA 3BVDB 3TBBA 5I6NA 2J57A 2P80A 1BAWA 4UANA 4AKPA 1V54B 2RACA 1WA1X 1FFTB 3NP4A 2Q5BA 4A67A 3T6VA 2GSMB 1EZLA 2JXMA 2UXGA 3ABGA 2IDFA 2HRGA 3CDZB 3ABLB 4G71B 3FSWA 3PLYA 1OCRB 2QPDB 2W88A 5I6PA 3H4FA 2VSKB 1L9SA 1ZDQA 3NSCA 3X1FA 5D4HA 1SFDA 1PCSA 2VW4A 4YSDA 1GY2A 4BWWA 4NAJA 2AANA 5I6KA 1ILUA 3QQXA 1BYOA 3FQ2A 4G70B 4GP4B 3X1BA 4DP8X 1HFUA 2BZ7A 2N0MA 3PCYA 1J9TA 1W8EA 2IAAC 2YAOA 4KOCA 1PZCA 2IDQA 1NZRA 4YSUA 3QJVB 2HX9A 3H56A 3IBOA 2Y1AA 1CYWA 2XXGA 4BXSV 3T9WA 1BQ5A 3EH3B 2XYBA 2YEVB 1DZ0A 1I53A 1OCOB 1OV8A 3TASA 4KNUA 3IE9A 3UADA 4HALA 4A68A 1JZIA 4HHGA 2GC4C 2OCCB 4E9WA 1SNRA 1CC3A 1JERA 1URIA 5D4JA 5AFAA 3NJLA 2DWSA 3V9CA 1XMEB 1GW0A 3MX0B 2GC7C 4GY4A 4DP4X 5PCYA 4PCYA 1DYZA 2PCYA 1PLBA 1IKOP 2UX6A 3CVCA 4UF7C 1EHKB 3JT2A 3T6WA 1A4AA 1MG3C 1XB6A 2ZOOA 3FT0A 1JOIA 3N55A 1OCCB 4G72B 1N68A 3PPSA 4DP1X 5F7BA 1JVOA 3QJRB 1KBVA 2FTAA 3FU8A 3L45A 3AG4B 4F2FA 1RCYA 2QDWA 4HHWA 4NB7A 3FQ1A 5LDUA 4HAKA 1B3IA 1E30A 3ASNB 3NJKA 3CDZA 3ABMB 2I85A 2I7OA 2FNWA 4DP7X 1TEGA 2J55A 2VSMB 1AIZA 4JHVA 2UX7A 2YAPA 2J5WA 1NIDA 1J9QA 2HXAA 3FS9A 1E65A 3JTBA 1HAUA 2EIMB 3HB3B 3GYRA 5I6MA 1X9RA 2XV3A 2BP0A 3FQYA 3ZX1A 1AZNA 1BQKA 1RKRA 1XB8A 2PPCA 2OJ1A 4W9ZA 5B1KA 4A2GA 1AS6A 3BQVA 3WNIA 1ZIAA 2QPEB 3DKHA 4P5RA 4E9TA 1BQRA 1BYPA 1J5DA 3PAUA 4BWUA 4GP5B 4YSEA 1BXUA 1JZGA 4Q8BA 1AG0A 1HAWA 4BWTA 4CSPA 1J5CA
chains in the Genus database with same CATH superfamily
3GSWB 1FNEB 2GYSA 5FKPB 4A2EA 1FL5B 5C3IA 2B0SH 1IGIH 1IAII 2QLVB 2ZE8A 2DL9A 2C9VA 2WWKO 4GAAA 2NLJA 4HZAA 1BMFG 3GWKC 3FSOA 4N0UA 3CJHB 1IGFL 3TL5A 4EE2A 3BPLB 4PTUA 3WUZA 5C0IA 3L75H 3AADB 2H32B 4FFZH 2J56A 1YYLH 3TBCA 3DJ9A 1OOAA 3GJFA 1ZGLP 1LP9F 1JN6A 3KPQB 3MO1A 5FM5M 1OEZW 2E56A 3BPOB 3REVA 1KFGA 3HNVH 3U2SA 3NCYS 3IFNH 5JW4N 1KNOB 2IU3A 3LZFH 3ZDYF 4MD0A 1S72V 4QRTB 1IFHL 1N19A 3FRPB 5F9AC 5I76B 3O9OA 1AXSB 1Y07A 2QSAA 2NY3D 2MCG1 1IAIH 3SKJL 2IOOA 3B4NA 3I9AA 3NESA 4KJPC 2M8XA 3AMKA 3C2SA 1BYNA 1KTBA 3NXSA 3K5NA 1P6WA 2BCKB 4K15A 1M2VA 4FLWA 4NC1E 4M6OH 3PQYE 4X5WA 2OTUA 1JNLL 2QL1A 1A0QH 5J11C 3ALWA 4ZDHB 3WMSA 1HI6A 1I08A 3MLVL 1DLFH 4NBZB 1NTDA 5CLWA 5I18H 1U8OB 1CF8L 4I55A 3D3VE 5JLZA 3BD4A 4UM8B 1JR9A 1QU7A 5AW1B 1DVFD 4Q7DA 4CGUB 3HAEH 3ET9F 4FYRA 4AYDC 2HVKC 3W81A 4G27B 2YZ8A 5KG9B 1G0YR 3HVDA 4HUXB 1PZUB 3LOWA 5I9QB 5LCVL 5MEND 4KXBA 4FKKA 5IVXE 2YBRB 1OE1A 2O5NA 2AVFA 3LKPB 1NQBA 5DS2A 1VQPV 1S78C 5AVWB 5IESL 5L2JB 3ZN0A 4AMKH 3O2DH 4PB9H 3U1SL 1L8DA 1U0QA 3VXOA 1JFQL 3QC6X 2JGDA 2C3XA 4XMLH 3UMTA 4PP2A 3OE7G 2OYMA 1NOLA 4MA8L 2MOGA 3SCMC 4HC1A 4HQQH 3CD6V 3L3IB 4AJWA 3SCMA 1P5UA 4GG8B 1NIBA 3BFRA 3GXFA 2YAMA 4C4BA 4CMMB 5DQJB 4B7EA 3L1GA 2Y06H 4OZ4A 5FPIA 4W6WB 1VEWA 4R7CA 2AZAA 2ZXGA 1IBZA 3OFNG 5IB5B 5D4IA 2YD1A 1AXTL 1VAHA 3CFBA 3S48A 3WUWA 3CJJA 1RPUA 5L2KD 1EA9C 1MCWW 4F9PC 1RZKC 2DMKA 1IKFH 3JTTA 3ISYA 4R83A 5I0VA 1XH3B 5DMKB 1VEOA 4N8VA 2X4QB 1Z5LB 4X6FA 5IKCA 1ZHBB 2X1QA 3JAWA 3BWZA 3UJJH 2ADJA 2NY1D 2ZUUA 1NCWH 4PJBF 4BZ1H 2Q3AA 1YZBA 5TF1H 3I3DA 3F7YB 2NW2A 3S35H 2EIJB 1LP9E 3P2DA 3HG5A 3ECVA 4MCZB 3VG9B 3DYMA 4KHXL 5IHUH 1AZUA 3MDJA 2MCAA 2AC0A 4JYYA 3QZMA 4GP8B 3X11B 2ZCLL 3ZDYE 3V5DB 4JGNA 4XVTL 3SE8H 3WFHA 4JI6O 4MJ5A 1PU0A 4QY8B 1GAXA 1WG3A 4S1RL 4GKNA 4K5MA 3OAZK 2R1XA 2IH1C 3VB8A 4D0DB 4LLMB 4BV1A 3FFCA 1MFBL 4FYQA 5HYIA 1X7QB 3HUJA 2BY1A 2HLAA 2K6YA 1WD8A 1YRKA 1S5IL 1TZAA 4P23B 1S5JA 3CUPA 3H01A 3FBKA 5CZKA 5KN5B 1CGVA 3MV9B 4BDVA 4YBLB 3BPNB 4I1PA 2P5WA 4XPBH 3HKCA 5IM7A 3SDCD 3IN0A 1EPFA 2BTQB 3FCSB 5ES4B 5E5RB 3CLEH 3N44F 1VACA 2DBJA 5C08A 3G6DH 3TJPA 1OAKL 3EG9B 4MNGE 3FTXA 4K0OA 4O51B 2WO3B 5EEVA 3PXJA 4L4JA 2M83A 2WZPA 4JTDB 4MKTA 1Z3RA 2ZF8A 1L1FA 4ZPTA 3VE0A 3W0WB 2A9AA 5CGMA 4PJ7F 1MPAH 3OKNB 2JI2A 2J5LC 1QEXA 5AKVA 2ZOKB 1R46A 2Z34A 4MTOA 4BWAA 1RU9L 4LGSB 12E8L 3DO3A 5I6XC 3ZRSA 4G9FE 3CDCA 4HCIA 4ZFOL 2WLHA 2DAVA 2YEZA 1PL4A 3CZLA 2X9YA 2DWDA 1JTPA 1RZJC 5I66B 5JOEA 5CUSL 5KTEH 1T6WA 1AFVL 1RUML 1WIOA 5AW9B 4OFKA 4G11A 2DF3A 1QFWL 4NNYA 2F53A 3RE0A 5CZVL 3KYOB 5CR1A 2YIBA 4TV9A 3MCLH 3ABKC 3MUZ1 4UOW1 4Q89A 4ZX4A 2VR8A 4QF1B 4YBQD 3GUTA 3TEXA 4Q9QH 2QVKA 1EQWA 2RQEA 4O2EB 1WFMA 3JVGC 1HHKB 1GS8A 1XCTA 3RTQA 4IK7A 4LF6O 2VLLA 3UROR 3VQLA 4I5BA 3JVGA 2V9TA 4I18C 3UZQA 1TITA 3L3HA 1A6ZB 1SF5A 1YEKH 4I18A 3U6XA 3G5XA 5IHLB 1SERA 5L8JB 2LFRA 1DDHB 4JFQA 3QORD 3T0ED 2XWZA 1V55B 2JJTC 2K9PA 4DVBA 1AQKL 3B7TA 5B66Z 4MQSB 1FFRA 5DEDA 2Q7EA 1KBWA 1P4BH 4M5YH 1JGIA 3O4LE 1IGMH 1F4XL 1MSDA 4GKSA 4OUOA 5JH7B 3TM6A 4WI2A 2ZUWA 4PJBE 3TNMB 3MXVL 2BCCH 2EJRA 1WD9A 1K4CC 1UXMA 4JPIB 2BSSB 3BAEL 1FYTB 3VRIB 3CVIL 4OV5A 5I0WA 1XCQA 1FZKA 1A1MA 3B4SA 1MREL 3GTVA 1RJLB 3D3IA 1SJEB 2CZNA 2AVGA 3WFCL 1OAZL 4YSOA 4M43L 3Q13A 1I7TA 1UB6A 5EIIB 3CCMV 3MLRH 1ZVNA 3F05A 4U7NA 4ONOA 1UD2A 3HBPA 2WVVB 5B1AB 4MB5A 4HKBA 1NBYB 1F58L 2ARJQ 4UT9A 1E0OB 1EFXB 3CD4A 4P57B 4Y9BA 4PRID 1FZMB 1L9RA 1F8TL 4HSQA 3ZT6A 3F12A 4JY5H 1GC1C 4WTZA 3WDJA 4HV8B 4QTIL 4TQIA 3UQ8A 2Z8WC 4JY4A 3KGRA 1U96A 1QSZA 3MGAA 3UEQA 1H6EA 3H9HB 4E42A 1IE5A 2GAZA 4G3YL 1MCKA 4HBNA 2MHAB 1G9MC 3O11B 2MPVA 4UTBL 5DHDA 4ZQKA 4DV0O 2FYYB 4BINA 1HEZB 3DGGB 5B3SC 1EJOH 1S7QB 1O7DC 1T4WA 4NX0A 4PJ7E 1AHWC 5J3HC 1L5GB 3GPSA 4P2OB 5J4MA 2JJUA 2NX5A 1AHWA 4K8RC 4N20A 3L71H 1CICB 4LHUB 4Y0GA 5KHIA 5B7EA 5J13B 2IFFH 2OL3L 3SPGA 5GRWA 2W8CA 3JZYA 3JAKB 2AZ2A 15C8L 3WJLC 1FAFA 5KSUB 3VSVA 3UC0L 5I5MA 3KPOB 3WJLA 1MW2A 3BH4A 1KLGB 3QJOA 4QO1B 1PNDA 2ORBH 3VD7A 5IWLC 3CQFA 2W91A 1YMME 4QPEA 4K9EH 4O4HB 3LRSB 4IKKA 3TBSA 4F2MA 2ATPA 4Y5VC 1R5IB 1H6UA 2CO2A 2C2AA 3QQDA 2XN9D 4Y5VA 4TXVB 3CBJB 3PUUA 2E86A 3SDAC 4FQ1L 2VXUH 1E5YA 3EKCA 3STZC 1BECA 3SDAA 3HZYB 4JGSA 4A2MA 4TNVK 1GN4A 1NICA 3G5YB 4MVBC 1XAUA 1A6AA 4LFHG 4QTHA 3CCVV 2ZE7A 1UASA 3STZA 3BE1H 2DQGL 4CRPA 2BDNH 2V33A 3AQXA 5EBLC 3SE3A 1FNFA 3LXAA 4JFPB 4KJWD 4PJ5D 4V11A 2IDCA 3UO8B 5EBLA 1ED3A 2LO1A 1NC2D 1YNKL 3UZEA 2Q3ZA 4PRPE 2VDQB 1BHAA 2FX7H 2KS0A 3O2VH 2B5IB 2P47B 4B3RO 4GW1B 2EH7L 2YS4A 5D7IF 4KI5D 2G38A 1EZUA 1W0VA 3PLYA 5IJDC 3WNOA 1L9SA 3ZMEA 2GSGA 2GUZB 4MVUA 4OF5A 1VADB 1G7JB 4HKZA 3WN6A 4G59C 1E2ZA 5DUML 4TQHA 3CDGB 3CU7A 3O0RH 3ZIMA 3HLAA 1GHFL 1XEUA 5C0CB 3N9GL 1SEBA 5FF6A 3J81N 32C2A 4DP8X 4FKEA 5EU6A 4XMXA 5FUOH 5ESAA 1OARH 2BZ7A 2XI9A 3V6ZB 5JHLL 1W8EA 3KXFB 4JFTA 3V52H 3VXQA 1MWOA 3NCCB 3SOBL 4X64O 1KPVB 2I25N 2IDQA 2VABB 3PAYA 1AVMA 1S5HC 1E4KA 4NCC2 5C0BE 2X9WA 2YUAA 3S98A 3KYMA 1S5HA 4N2BA 2Y1AA 4L5FE 4Z7IA 2XA8L 1A8JH 2NZ1A 1KIPB 2KPNA 5H2FZ 4NZ8A 5FA4A 3V0WL 3EYSL 5MEOA 3EFDH 4AQYB 4NKOB 1CLOH 1JNNH 3UOAB 3FZUD 1BQ5A 3T9WA 4AV5A 1BQHG 1UEMA 3EH3B 5E8EB 3U30C 4C83B 3SJVE 1A02N 3T1HB 1TZOA 5I82A 3P0YL 4JN1H 3IKCB 2AP2A 2Q7YB 4Z78A 4ZZKA 3GLDA 4OX9O 3BWAB 1OTTC 1URFA 1M56C 1NFDB 4JM2B 3ZHDA 4Z3JA 1ORSB 3PQYD 2EYSB 1J8RA 1U8MB 2YSSB 1DEEB 1DE4B 2X6BA 2DQJL 3QIUD 3QQ9C 3VFPB 1J5OH 1QQDB 3X17A 4FTDA 2AEQL 1BPVA 2CHWA 1KB5A 1G9EA 3CFEB 3TFKD 2P8MA 2ENJA 3D3VD 5CBFA 5I1KH 3P2BA 4JAMB 1IM9D 4LCYB 4AT6B 4W9JC 2BRQA 5BXFB 5HJBA 2GC7C 2OZ4A 1FL6A 2JE8A 4O02H 1Q0XL 2WXHA 1TVKB 1DYZA 2IBBA 3WENA 3VDAA 5CCGE 3L1FA 3PDOA 3RX7A 4CILA 4XWOD 4R26L 5D93B 1T04B 3AXLA 3VFSA 3LDDA 2WUBH 4UZUA 2P8LB 2R8SH 3WFEL 3ZL1A 4DP1X 3ELQA 3EO0B 3K2UL 2KI6A 3ML8A 3NMEA 5D7JC 1MAML 2VJ8A 3F7RA 3RHWF 3KJ6L 2FK9A 5D7JA 2EDJA 3C6LB 5K9OA 2A74C 2PW1B 1M4UA 4L5FL 2JELH 3TPUA 1PSKL 2Q7NA 3TZVD 3JD3A 1XUQA 2FNWA 3ARFB 4GQPH 2NXYB 2J55A 1ID5I 3EYUH 3RWIB 4HWZB 4BH8A 1RZGA 1SZNA 1AJ7H 3L2NA 4J6RL 4LARH 4ZFZA 5DJAB 3HR5A 2DZEA 3UPCA 4AQ1B 2ATKC 1UEYA 2YRLA 4ABUA 4L3FA 2AK1H 4NOFA 3A2FA 5D7IE 1FO0A 2ATKA 4NZRH 2PF6A 1NJ9A 3PWUB 1AS6A 3CFDA 3WO4C 5JXAH 3BC9A 4GSUA 5C09E 3V0IA 4QHMA 3VD0A 1AQDA 3PFUA 4Y4HB 1E3XA 3ZK0A 3E8HA 5EWIH 1JZGA 1ZRUA 4QHKI 3IDYC 4LF9B 1VFUA 4QIRA 4BWTA 1ML0A 3OB8A 4GQQA 3K72B 5CP7B 5FO9B 4EI6B 2D2CC 5JXEA 3GMQA 2UXTA 5EC2C 3V4PA 1I8KA 1SYVB 5F3HB 5LMUB 1GMIA 5M95B 2GB2A 5DJ8B 5EC2A 1DEDA 2VXVH 3BUTA 35C8H 2NDGA 5KAIZ 3CFIC 4JO3L 5C7XL 5HI5C 3D52A 3SGEH 3KBFA 3BP6B 1RPQA 3KYNA 3ZKMC 3DO7A 2OTWB 1BZQK 3IVKA 1TSRA 4NUQA 2PXYB 4WEBH 5E8DL 4KRLB 1U3ZA 1J12A 3DHUA 2XWBA 4N24A 1A4JA 3S96B 4YLBA 4KY2A 1JGEB 5HBBA 1C5DB 3GI9H 3MBXH 2GTWA 3JCUZ 5E9AA 1E5ZA 2WYZA 1RK1A 3PREA 2NR5A 3EBGA 4IIJB 1IEBB 3D0AA 3QNEA 4HS6A 2R59A 1H8OA 4KX9A 3CBRA 4GKJO 4R96A 3GHEL 4CADB 4TS6A 4OM1L 4LMQE 5AZUA 1BM3L 4P99A 4XP4L 5GJTH 1T5WA 4L2LA 1AANA 3UABA 4DPBX 2OR9L 3L1OH 4QD2E 2IQ9H 3GBMH 1DVQA 4KRPD 2R29A 3TYFA 2HSIA 1GKEA 3K5RA 3CZKA 5CJ8A 3HPLB 1KN4H 4AQOA 1NCCH 5JHMA 3CLWA 4ZOLB 3O8XD 4L4TB 1S7WA 1FGVL 3VVWA 4JQXC 4HEME 5BZDA 2FO4B 2VN5A 4JQXA 1MZYA 1WAAA 3MRFA 4G7QB 1J9SA 2EYTB 2FQDA 4J11A 3S5LG 2F74B 2I07B 2XZAH 5ICXA 4G9FD 4XP5L 1HNYA 4M1DL 4X1YA 3STLA 3BZFA 4IGBA 3V4VH 5IQOA 5TISZ 3F8UB 5AOJA 2C4FT 5LN8A 1JBJA 3B83A 4LLWB 2OULB 4X20A 4I2XB 4AENA 3CHSA 1S46A 3BKCH 2WBKA 3HFML 1SQXH 1D2DA 2NY0D 3TBYA 2WOYA 3NZ8A 1SQPH 1YNTA 3OPZH 3ARSA 1RUKL 4G8FA 5ACLA 2F43G 4F15C 5ICZB 1FNGB 5E7FA 3B3IB 5DWUL 3MREA 1OPOA 1QO3A 3P3TA 5IMMB 1QHTA 3MV9E 1PL0A 2KT6A 1PMYA 2ZXBA 4TMPA 3VWKC 4I4TA 5I6OA 4U1KA 1Y0LA 1MVFA 1RIVH 5C07B 3VWKA 2WTRB 2FYUH 4ZSOA 1R6NA 2AJVH 1AXIB 2GUOB 1XH2A 2OMBA 2MQ3A 2ZX8A 3EH4B 4MB1A 1X5KA 5JUEH 2G5UA 3J7AU 3EYFB 1IFHH 1JVKA 4O2FB 2OMUB 4ACTA 3N0AA 4NFCA 3O4LD 4CSZA 4QKTA 4NC2B 4NP9A 2ZXWB 2VDLB 3GDCA 3K8KA 3W0WE 3FQRA 4B0MM 1FORL 1YEDB 4P4KA 3UG4A 5HPMA 1JQ0A 3ETBF 1I3GL 1KB3A 3WG7C 3ARWA 1CE1H 3PHQB 4JFXA 1UFUA 3ZTJG 3IAGC 1RSFA 3IXAA 5GRVK 4DV3B 4Y4FD 4G8GB 4X66B 4KKAC 3WL9A 3VGAB 2A7WA 25C8L 4N3TA 3MXWL 4OGXL 3NTCL 3QDMA 3MCKA 2P7TC 4MZ2A 4BRVA 3IAQA 1DJIA 5IB1B 5FM5O 5KVGH 1EN6A 1GTOA 4QXWA 1W80A 4B9ZA 1DUZA 4Z2WA 4NT6B 2ITCC 2AXJA 4MZRA 1K3EA 3MFGB 5I5IA 4AZUA 3MJ9H 2ITCA 1A1OB 3C5ZD 4YN3A 2E7MA 4FFBB 5T5FA 2N4IA 3S4SB 2H8PA 2LGQA 2XPGB 2XC8A 4OD3H 1KJVA 3RYHA 4DR4O 1TQCB 4Q9CA 3GRGA 1GN6A 3U1SH 4JE0A 3K4ZA 4QRRA 2R70A 4PDMA 2WUCH 3OJVC 1AILA 5J1AB 1IBKB 3SJBC 3U9PH 4FVMA 3APNA 4EN3B 3TURA 1WO2A 3DRTA 1I9IL 4LASL 3WLBB 2CO6B 3L7FA 1RZFH 3SE4A 2YDEA 1XL6A 3QAZC 1FYTE 1QTPA 3ZDWA 2X2UA 2VZSA 3V0JA 4HUVB 5BQDA 1MJJA 2L7QA 3RTLA 1WP7A 1DANU 4W9IC 1AXTH 4LEXH 4IDJH 4MXQC 4J3VA 2ZYRA 3NP3A 1Y18A 2YPLA 3BKMH 4XOAA 1VENA 1UT9A 3F6IA 3CFQA 4JI5B 1MCFA 3NABH 5JZ7D 1YMMD 1CXFA 3GKZA 1ZT1B 3MV7E 2Y0PA 2Y1VA 2Y6TE 4HJTA 4O9HL 4PJHA 3S36H 4AL8C 1OB0A 3G5WA 5INDA 4LLUB 1RHHA 4JX0A 2XBZA 3MC0A 5JYLA 1K5NA 2F9BT 3EBAA 4EVNB 5J0BA 5B4MC 1VCAA 1BDYA 4X83A 3KLAA 4WWPA 2EINC 3R7RA 4DR2O 3WIIL 3T2OA 4UQ2B 4YR6A 4YSCA 3O9WC 4FMFA 4WHTA 1X9QA 3O9WA 5TGBA 5TK4A 1U8JA 2CO7B 4J8QA 3WIFB 5DC4B 1T0MB 3CPUA 2IH3C 4YJ3B 2DQUL 3VTMA 4LF8O 2LV4A 4PBDA 1PBYA 1V3MA 3H42L 4NQCA 3QNYA 4Z7UA 4HIJA 1NFDF 1SM3H 4JM2F 4HMCA 3P9LB 4FFKA 1MJ8H 4LDEB 1ZPLA 5CR8A 4WFGE 4ODSH 5EC1B 4ZS7H 1UWXH 1IM3B 3C75A 4FFYL 2VT0A 4PRPD 3HG4A 5H94A 5B8CA 1SDDA 2XX0A 4NPKA 5GGVL 5CGBA 4L8CB 2UXVA 2QR4A 1FJ1B 3HA0A 3FCGA 3EZ8A 3BOVA 4XO8A 4TOIA 1ZEAH 2WQAA 4DH2A 4JDTH 4OLWL 2IQAB 5FUZL 3LH2L 2FSEA 4WSJA 4JKPL 3U0TA 3B9KB 4N6RB 1GGCH 3CFTA 4ZOBA 3MOQA 5F6IB 2E75B 2EUXA 1OAKH 2XOTA 4GSRA 2X44D 2G4GA 1WA0X 3KWTA 5DWPA 4APQB 1Q90A 1M6OB 2HVBA 4LRIA 4MJ6B 1YECL 3WFVA 4UDTB 3C3TA 4M4RA 1BQHA 3VYOA 3QXAB 1MW1A 5C0BD 4FZEH 3D39A 1G7PA 4K73A 12E8H 1N7ML 2VQFO 1P69B 3M6DA 4AKOA 3TESA 2DLGA 3L3DA 4FXGA 4OB5H 1ZGLB 3AWFA 1CLYL 1J10A 3OJDB 2OK0H 4YIQA 5BJTA 1ACCA 1EX0A 5ESQB 3SJVD 4MMZB 4Q2ZB 1YEGH 5EBMB 5B1JC 2H45A 4XMKL 1W9XA 3PP4L 1TU2A 4QWWD 4PGCB 5B1JA 1ZTXH 3CS5A 3CH1A 3FB5C 3CFMA 4KQ3L 2FGWL 1HWHB 3BGFB 2JS3A 5KHKA 1ASOA 5I17B 4L05A 1RIHL 3BAXA 3CH8A 4GX2A 2IDSA 4X1IB 4IT5A 4WI7A 1YNLL 3EFFA 5F72S 4MTXA 5C0CE 4RUEA 4Y1TA 1CE6B 1MOEA 3VFNB 4WW2B 4N0YH 3RVZA 3UIZA 5FW6A 4U1GB 4ZTEA 3KXFE 2VL5A 3SBRA 3TWYA 5E5MA 3TA4D 1HQRA 3K04A 1N5AA 5CA0B 1RURL 3DX2A 4P9HL 4QCIA 3IDXH 3TPKA 4DUXA 1G7LA 4O2BA 2IPUK 2H3XC 4WI9A 3L9DA 3MHSC 4X2UA 3HS0C 4L37B 4ELDA 5AG8A 5DECA 2J8UB 5D55A 3HS0A 2YMXH 4TVUA 3LDBC 1KYDA 3TJTA 2YKKA 1BBJB 3KPLA 2FVNA 3GBNL 1WH0A 1G87A 3QGVA 3CLFL 4OR1A 5I26A 3B40A 4FLTA 1UH4A 4F8LA 4Q97A 1QR8A 5DZOA 1A7OL 3IMTA 3NUKA 4N8CH 2CJ3A 4XAWH 1DHKA 1ZS8A 1NFDE 1HSBB 1I5YA 1NTKH 6CGTA 2L6LA 2EXWD 4UCTA 3DUSA 3HE6C 3P54A 4JEGB 1OAUL 2VUYA 1LK3L 4JFDA 5FGSA 5HYSB 3HE6A 2J6EA 3II1A 1QBMH 3NOIA 2VDQL 2X1XR 1RY7B 1KWGA 3X13B 3C6SB 5IR1A 4F7CB 4ETYA 1U8LA 2BXZA 1T1YB 1EZVY 1X5FA 4XOEA 3TA3B 1U8IA 1N0NA 1AYRA 1EEZB 4FM2A 1IAKB 1NH2B 3ZRVA 4KRNA 5C09D 2JXMA 4ES9A 4B3MB 4G5ZL 4MS8D 2G0LA 4DGVL 5JIMA 4G3YH 3H1ZA 4TQEL 3SO5A 4OGQB 3KWWB 3KNBB 5JWPA 4WY7L 3HI5L 2EUWA 5TDOA 5K1XA 2VW4A 5FKAB 1CXKA 4U1JB 5E0FA 5BR8B 1A14L 1X9LA 1SZTA 3QEUB 1TYJA 4L3EB 3QQXA 2M7WA 3GFUA 1DTUA 5J9PA 3LZLA 4LLDA 4TUOB 4POZC 3H8NA 1XF3B 5B3NA 3Q5OA 2O5YL 2OL3H 4H8PA 1R3IH 1AKJA 3LRGA 3KG2A 4NUGL 4H2AA 5KYYB 1UQSB 1WF5A 1IGTB 2ALWA 4W4OC 2HKOA 2X38A 3LRLA 4NN5C 2ZPKH 4XVUD 5CEXB 4TT3G 4L3CA 4JO4L 2MTPA 4EB6B 3L5XL 4UCRA 5KSAA 1QFWM 1R3JA 4P3WA 4ZUUA 4UMGA 3TN0D 3F7VC 3VBBA 1M1XB 2JI3A 1P7KB 1A21A 3F7VA 3O2WL 1W0KG 4JLRB 1DLBA 2L8AA 2WYIA 1T2JA 4FNUA 2ADQB 1OAQH 5DZJA 5IQNA 1EXHA 2YEVB 3LZNA 3RZCC 3IT8D 3M1CA 1DJXA 1BFOB 5DJCB 2QADB 3H9SE 4FQ1H 4HMDA 4OIIH 4OIFA 4WWOA 5DQ9B 3JASB 5JW3L 2UV3A 3PP3H 1MCNA 1J86A 4UILH 4XE5B 1CFSA 4E9WA 3VD1A 2HTKD 3JVFC 1EWHA 4L1LA 3S5LA 2V8LA 5J6HA 2D4DA 4RMTA 4XP9H 5FLUA 5C0ND 1B0WA 3NGBB 4LSQL 5HHOB 2CO3A 4GY4A 4Z3EA 5DUPH 4DFHA 4JN2B 3K03A 1IKOP 3UJTH 3T1FB 2VUKA 4DZBB 1JWUA 1A6TB 1XB6A 4PWIA 4XZUB 5DJDB 5D1QA 3IGAB 1ORQC 2Y48A 3NACH 4MJIB 4ELKA 3EAKA 3KPTA 2CIIA 3ESNA 4FLOA 1EGJH 1IKNA 1ORQA 5JIQA 2CGZA 4DGYL 1NFAA 3KCPB 3NRFA 1SQ2N 4PI0A 3N9GH 2QDWA 3FCTA 3FT3A 4PUBH 5JDSB 4P23D 3SKOB 3DX4A 1OJHA 3ZKXC 3RIAK 2I85A 2X0WA 3ZMZA 3MV9D 3AG1C 1TEGA 2V7HA 3EOBB 4M7LL 4F5CA 4JHVA 3ARDB 1ND0B 2MPAH 1HK6A 3J27A 3M7OA 4JTCB 1BWMA 2E4FA 4UVBA 3SGDI 1N0LA 4TLKA 4YFDB 3T8VA 4GIOA 4JW3A 3V0WH 4NHUA 5I6MA 1X9RA 1YVLA 3BPZA 2WIIA 3BVVA 4MB3A 4MMXB 4JFSA 1PG7L 4ZAKD 4LF9O 1RKRA 3MRPB 2DYPB 3UTZA 4W9ZA 1NUNB 1YN6A 4IIQC 3DECA 3W0WD 4L4TE 4WJ5A 4LSDA 3P0YH 3LQMA 4IHJA 2PTTB 4E9TA 2RQ6A 1HKLH 1MI5B 2HMID 2BSCA 4IW4C 3ZZQA 4X80L 1CGSH 1KCSH 5EB9A 2OYQA 2XAQA 2NCEA 3K5MA 1ESOA 3BAJA 4JL1A 4GCZA 4UCFA 1OSEA 4GKKO 1CDJA 1D5ZA 1IARB 2P5EE 4I2XE 4M8UA 5CHNB 1CTMA 4OZFH 1OCOC 3SGDH 4J3OG 4A6YH 2PP8A 3RWDB 2CO4A 2VKXA 5DJYB 5G55A 3C9NA 5HHMB 4KMTH 1QZ1A 2GUYA 1MLBA 2X6MA 3D69A 3P11L 5CJOL 2G60H 4Y9EA 5ALCL 2FEJA 3GBLA 4NYLB 4FLYA 5IJ0B 4ZTOH 1CQKA 5AVUB 2D7OA 3I55V 2AI0H 2DJMA 5C07E 5IT2L 1NM4A 3BPCB 3K2UH 3KLSA 4KH2A 2ZWKA 3JXAA 4ELMF 4P9PA 2VDNB 2AKRB 5EBGA 3FT9A 3B77A 5F96L 1N10A 5F1OB 2Z7YA 5SWZB 3ATFA 1AGDB 2ICWA 3U0PB 1OM3H 4XE0A 2CBPA 1ZANL 1L9NA 5LL6Y 2BOLA 2GITA 4ABQA 5HFMA 4HKXB 2P46B 3X3FH 1T4KB 3OMZA 4R7NA 4LFBO 5DD5L 5GGQL 1FYTD 5H5NA 4G8GE 1P49A 1MEXH 2F8VA 2OJZL 2BSTA 2DYRC 1QOKA 3PWVB 2PPAA 5I74C 3AM8A 3SPIA 2WJ5A 3LAFA 1DCLA 1S6NA 2R2EA 4QOKA 3IJHA 2CLRB 3DGDA 4L9LC 3ZRWA 2BRRH 5IEKB 1U21A 1WICA 2IDUA 4L9LA 5D70L 4CSSA 1RSOA 5L9DL 2NLJB 2VO8A 3QPXL 4K7FA 2ITDB 4PTUB 4DV1B 1COBA 3MV7D 3QRBA 5AVVB 1WT5C 2F1MA 3B34A 5C0IB 1LEIA 5K39A 5KJ7E 4C57C 2CHXA 1EFXD 1FRGL 1WT5A 1JPXA 3L6FB 4JFEB 5E2UL 3KYAA 2UUAB 1JN6B 3MO1B 4ZOAA 3GSXB 4B41A 3NJXA 3REVB 4NVPA 3U2SB 3LV3B 4A7TA 4X5LA 4AEIL 3H3KA 4ONGH 3SBQA 5F7UA 4KDVA 1TR7A 2E8ZA 5CZRA 1MFDL 3VQ2C 4BZ1A 1MQ8A 3GDBA 3K4AA 2M26A 1XGPA 2ISDA 3ZZSA 1A5FL 1K8IB 1PZ3A 2Q76B 3RL1A 3ZE0B 3FTZA 2V5TA 1LUVA 3G08A 4JMNA 4CH4A 2LE9A 4YIOA 1TO5A 2VDLL 1M2VB 3I3BA 4P2OD 4WFGD 3BSGA 3AEIA 1CICD 3VM7A 4LHUD 1V7NL 3BH9A 3Q48A 2JS5A 2JK5C 2ZT9C 1TG8A 4HCRA 5I15H 4Y2DC 2NPLX 1YJDH 3EDEA 2HG5C 4X8CA 4A7VA 3CVDA 4L8JA 4I55B 2HG5A 3GHEH 5JLZB 3MRDA 3NRQA 4WW2F 1BM3H 4H13B 3V9EA 5AB0A 4D94A 5ERWA 4A7UA 4IYIA 5ALBH 3NR7A 4QNPE 4HBQA 1JPGA 4WHDA 3DTDA 2JRIA 4JFVA 2FL5A 2XT9A 1N6VA 1XDTT 1FGVH 3I6GA 2VXSL 2NR6D 5HI3C 4RGMB 1PNCA 1ZK9A 2MIZA 3FOMB 1N0XL 3HN5A 2J8UF 2R9IA 3KKYA 4JUTA 3OM3B 1NUDA 1N36O 2NYYC 1E8ZA 4WFBV 2IJIA 2H3OA 3VXOB 3EJZD 1EJFA 2JGDB 5KVFH 1WV7T 4RSYA 4PP2B 1U8KB 2UXBB 4ELME 2C5DC 4G43A 2W92A 3AZUA 4HUKB 4G6KH 1TPXB 3HFMH 1H2MA 3LKSA 1P5UB 5F0JB 4AGMA 1S3KH 1VPOL 1BJ8A 1ICTA 2XV0A 3U9UA 1QLEB 3L74H 4DSYA 3QO0A 2DL2A 1DBBL 3PE9A 3JWOC 4UTAL 4QRQA 2OI9B 2DY2A 4CJ1A 4J7JA 4LCUA 3MV11 3FB7C 4TNVF 3FU5A 4YHPA 3CFBB 5JHDA 3FB7A 1UXWA 3QI9C 3TNNA 3WUWB 3T0XA 2AQ2A 5F7EL 2XJLA 3NFSL 2WINA 3QI9A 2VIRA 3JTTB 4ODTH 1PPIA 4UNVA 5C0CD 2DV6A 4Z7OB 2QQKL 1MVUB 3FUDA 3E7JA 4X6FB 5IKCB 4EZKA 4MVRA 3KXFD 1T7VA 2ADJB 2J1KA 1T21B 1DBMH 5L7XH 3OXRA 1TQWA 1FA4A 3FPXA 2NW2B 4M1GH 5CCHE 1N0JA 3VQVA 4MAYC 1C08B 3V7AG 1HINL 3H6AA 2BSBA 2FECI 4LHJB 4KK5D 4MAYA 4LLVA 1BVNT 4OQTL 8FABA 3WFHB 4ZMXA 2B1IA 3NTCH 3LNEA 5CINL 5D1ZI 3T4YA 3BAIA 1A7NL 1EO5A 1G6RA 1PYWB 3RYFB 5B21A 2P80D 1JRHI 2ZUYA 3ZQXA 4AW7A 1GS6X 3FFCB 4ESKA 5HGHA 2BWDA 4PJ0Z 3HUJB 5FYKE 5C0RL 3H6JA 3UBFA 4YHNA 5DJ0A 1U8NB 3RGVC 3MJ7A 2WXMA 2WLZA 4B97A 3RGVA 4FFZA 5TK2A 4RBPH 3GF8A 2N1KA 2ZKWA 3FU7A 5F44A 3M17A 1XREA 2ZP0T 3U46A 4NZDA 1U95A 2C1PA 3PABA 2IOMA 1A7QL 2UZYA 1U8CA 1VACB 5EH1A 5C08B 5ILTL 4QLWA 3ESUF 1SJXA 5A6LA 4NC0B 1FAIH 2XWEA 3OGCA 2EACA 3AG2B 3GSOA 3FONA 1I7UB 4ZPTB 1HNFA 2GSIA 1CFVH 3VXTA 1V9PA 1X5ZA 2EAEA 1Q1JL 4WZ9A 4HYOA 2WXFA 2GI0A 3QH3B 4MNHB 2ZE5A 2VN3A 2J8UE 5TF0A 1XDCA 1MHHA 1U4FA 2JKSA 5AQ0A 3L4WA 3N40P 1S7VB 4KXAA 2HT4C 4DW0A 2YEZB 3C6LD 1CDBA 2DWDB 4JMXA 3LNDA 1SQQH 3CSYA 4FF9A 1J18A 2AMUA 2EIKC 3ARFD 2YA1A 2NXYD 3FYIB 1HZHL 2WQSA 2W59A 1R0AL 2F53B 3SKMA 1ZE3H 4D3CL 3CSXA 5EF3A 1NR1A 4TV9B 2WBJC 2V5YA 1HE7A 2E6QA 1JOYA 2C7UA 3GEWB 1C8QA 2KG7B 3ML9A 3GUTB 2WBJA 4QDGA 4RO2A 3OLDA 4GKLA 4K9JA 3VXSE 5BQ7A 2R9RB 3RTQB 2VW7A 2F7OA 1E50A 2VLLB 3HZVA 4I5BB 1R19A 4F92B 3K6SA 4JG1L 3PNRB 2QWPB 4NRXA 1U8HA 4X6DA 2NY6C 3UZQB 1VF5B 4AEHL 4EKWA 3G5XB 4XCEA 4PJ8C 4JFQB 1ZLVK 5EU7E 5KEZA 3G6JA 4GKZA 3H9SD 4Y4HD 4DVBB 4OCRL 2ADFL 3EXLA 3GXTA 3N43B 3SHSA 3D2UA 3RKDD 3PS6A 1FFNA 3IK2A 4KK8C 4IOSA 5ITFA 4GKSB 5EZOH 4B3TB 1VF6A 3H7LA 4BCZA 3OKOB 4L3EE 5GISH 4TSBL 2D73A 1Y76A 5DTFA 5I6LA 4Z8FL 4OV5B 3OEEG 1I7FA 1XCQB 1FZKB 3BSHA 1A1MB 4F20A 1LVEA 2YSUB 2NY7H 5FCSH 1R24B 4PRAA 4R8WL 4FZ8L 2PXYD 1MCHA 2FO1A 5BRQA 1SRYA 2KBGA 4JI0B 3GWJA 4S0TD 1LDSA 2KLRA 3FH5A 4KXDA 4JTAB 1I7TB 3WNPA 1LE9A 3SIKA 1H6FA 1LLAA 4YPGB 2B1GA 1UB6B 3Q9PA 1THCA 4F8PA 1V27A 2FT6A 5HYJA 1NLBH 2BIIA 4HWNA 3UH8A 1GZHA 1IFGA 1NCDL 3MLZL 1OCWH 4TV3A 5ELIA 1XF5A 1JMXA 3ARXA 3QNFA 5KMGA 3CC5B 3U10A 3JWNE 4DPRA 5I1JH 1UCBH 5T8IA 3K8LA 2DQEL 4E42B 3EFFK 2GAZB 4LSRL 2XAGA 3JCZA 4B3MO 1CLYH 2IPTH 1ZLZA 5GHWL 3RNQB 4ZQKB 4L4TD 5AVXB 2DQFA 5CS7A 1Q43A 3RWCA 5A2LH 5SX4I 5CEZE 5T5NF 2EECA 2UXGA 2C9QA 3ABGA 4FQ2L 2IDFA 3MMEA 2NX5B 2G2RA 4J3OC 2DD8H 2Y5QA 5GGRY 2Q8BH 4BHUI 4ERSH 4OT1H 3VQ1C 3O6LL 2MW2B 3NSCA 4J3BA 3CPWU 4B27A 2UU9B 4E36A 2FGZA 2P5ED 4PRBB 2XWTA 4CBZA 4MJIE 4XX1G 4FJYA 5TD4A 2W38A 4GP4B 2YMOA 4CH3A 2HN7A 3FU0A 4N87A 4RAHA 3S7GA 5DUBA 3G4SV 3B6SB 1S7RA 2RDCA 1TYRA 3FB6A 4ODXB 3KPSE 5FECA 2WLMA 1F18A 2XNDG 4K94L 4KTEH 5CSZA 1WE5A 4P4RA 4F2MB 2ATPB 3WEBA 4LPVA 3QQDB 5C07D 1TUBB 2CDEB 4H4NA 3VI4B 4M8VA 2QM7A 5CFAA 4KFZC 4DCQA 3NN8A 3T65A 3S97C 2YOCA 5D2LA 3TT3H 3MLUL 4LCWD 4ZS6C 3ES6B 2ZNWA 2ZUVA 5IMKA 1ACXA 3HB3C 3ZE0F 5HYEA 2LAAA 2D9QB 2WVTA 3QHZH 4JRFA 1NJIW 4I8DA 4PMEA 4YDLC 1FCCA 1NCUA 1KXVC 3RILA 3KBHE 1MI5E 1QFPA 2VQ1B 3CHRA 1QA9B 3RVTD 4CS4A 4LVNB 4G8GD 3OKDA 5CEZL 4IKLA 1W0VB 2Z91A 3CXHK 5HHQA 1JHKL 1SOKA 5AFAA 2GSGB 4HT1H 2WHVA 2P8PA 1TJGL 2X9ZA 4HKZB 4ODWB 4ZG1A 1DLHA 3BGMB 3QDJA 4EOWL 1IAMA 5FF6B 5LGKA 32C2B 4KU1A 5HHME 1OO2A 4GG6A 3BN9D 4PLKD 2DQ3A 1BAFL 1JOIA 3ABZA 5F7KC 4ZMYA 1R3KC 3QXWA 1JXKA 4OBRA 2AV7A 1R3KA 1E8WA 1VZIA 1A14H 2PCPA 4YXLL 3SZKC 1BHGA 2FO8A 1Z3GH 3KYMB 2R1WA 3ASNB 3N1FC 5FM4A 4ZXBB 4AE1A 1PKQA 5FA4B 1I4FA 5A6MA 4DRXA 4GLXA 5LMNB 1DVXA 2H0FA 5DC2A 1A66A 1T6VN 3PWJA 4DKDC 5E8NB 2FZ3A 4JM4H 4JK0D 2Y07L 4HFUH 3S37X 4EN3D 1JGLH 2CKBB 4Z78B 2ZSVA 3INOA 1MFAH 2AERT 1N67A 4M02A 1GXEA 3M46A 4AMXA 3CRAA 5LHDA 1JYNA 2EULA 2WKGA 2QMJA 3O2WH 4NZFA 5BVPL 2XXMB 3BUIA 3BQVA 3WNIA 4PB0L 1ZIAA 4WBNA 1KB5B 1J5DA 5E8OB 4LF3B 2P8MB 1BXUA 1TVHA 1HR0B 3DIFA 4KTDH 1E79G 4Z7OF 3ZHVA 2BSEA 4N0UE 4CC4A 4Z23A 1AI1H 1NC4D 2E59A 1FL6B 3JV4A 4H8WL 4IDLA 2ZE0A 5KZCB 2ODIA 2C3VA 5TE4H 2E7HA 4UT7H 1HH9A 3PDOB 1SVCP 2EE9A 4JFEE 2Z0BA 3P9WB 3OZ9L 3VFSB 3W2DH 2Y7SA 1F90L 4B3SB 4J4PA 4R4BA 4HAFA 5LP6A 5JW5B 3ME0A 3TFBA 2F4VB 1E2WA 1UM4L 3LPWA 4WU7A 1GA2A 1WUNT 4XPGL 3MBWA 2UXXA 4L29B 5K9OB 3NIDF 3D4GA 3RG1C 4BH7A 3TPUB 3LY6A 5D6DC 1GRJA 1SY6H 2VDNL 4ZMOA 4HHAA 3C8DA 5D6DA 3ZE0E 3WELA 1XR9A 3HUJF 4FRWA 1E9OB 2J1WA 2JJSA 4BH8B 5JTWA 1RZGB 3C8HA 3QEQB 3P9MA 2Y6SC 1H6TA 2OKMA 2VXQH 4ZFZB 2CR6A 1IM3D 4DEUA 4XCCL 1WQVT 2M2DA 4JHBA 4DUZO 3DBSA 3ZN1A 5LLIC 1DF5A 1FO0B 4KK6C 3TJHD 1Z32X 3JV5A 4XNYH 5JQGB 1PQZB 3CFDB 2D9CA 2VB5A 3B9KD 1W6LA 4KK9C 4QHMB 3HMXL 4PS4H 3AQDA 2OJEA 1E27A 4R6ZA 3BZDA 5AYUH 3B2PA 3JD2A 2HRLA 3K6IA 4G6AD 1PG7H 4Z77B 1MJ7L 5GJSL 3DC6A 1ID2A 4APQD 4BFKA 1NKGA 3GMQB 3WEAA 3V4PB 3HKDB 1SQFA 3R0MA 5JJNB 4A1RA 1JPST 2Y2TA 3AU1B 2UUAO 1YN7B 2P4AB 5EC2B 4JKKA 2LLLA 1Y74A 4S2SB 4TULL 4OF6A 4HUWA 1X5GA 1U41A 4PGDA 2GJPA 2H9GA 3P4OB 1LR1A 4PA9A 4GIAA 4LOUC 1WNSA 4XPHL 3DO7B 3P3SA 2EICA 3FUHA 4IGGA 3VXRA 3SQOL 4YHKL 4K7PH 4U3FH 3OBAA 4PV8B 4UV4L 1MNNA 2XWBB 3H1KH 4X6BA 5ETUB 3WFDL 4OKDA 1G7HA 3QJTB 5FYKD 1UGKA 2W07B 3EGSB 2GTWB 2G0KA 1RK1B 2FATL 3LVEA 5KHJA 1GCFA 1G9NH 1EM1A 5CJOH 5LB1A 4ONHB 5ALCH 3VM5A 3ARBA 1RPKA 4HS6B 5F9WC 4D9LL 3G9VA 1UATA 3KPMA 4R0LC 2ZKMX 1P7BA 3VGGA 4P2RA 4R0LA 1NMCB 4R96B 5IT2H 1J7VR 2B9ZA 4KNSA 1KKCA 1H3WM 1N5YH 4JFUA 5K1JA 3N43F 3HZMB 2ZONA 1T5WB 4YL4A 5DZ9A 3ICXA 4Z7OE 3SSGA 4EEQA 2ODHA 3TYFB 5I2IB 1E6OL 3CFCL 3TH4T 4HS3A 4BKTC 4J27A 2ADIA 2ZM6B 3MNVB 4EMZA 3QF7A 5GRVL 3Q8AA 1ZANH 3TWCH 5IIEA 5BZDB 4MQ7A 3L73H 1XT5A 2ZTBA 3K0GA 4JFFA 3ZHLA 3MRFB 4N86A 1QHOA 2APBA 3ZL4L 2OJZH 1KULA 1S7XA 3FU3A 3LQAH 4X1YB 3GK8L 3BZFB 4FQIH 4IGBB 3STLB 1CXHA 5IP4A 2UXBO 3NIDE 4AENB 3WEMA 1QASA 4HKJA 3OB0H 4FTVB 1CXZB 2YPVL 3FFCE 3H3PL 3NZ8B 3PJLA 3HUJE 3QULB 1H8EG 4HC1L 4F1ZA 1GGTA 1YNTB 4PJ6A 3QPXH 2B4CH 1AG6A 2FT7A 2RR3A 3VXSD 1I0HA 5ABAA 1GKFA 1B6QA 1QLEL 3C09B 1WN7A 1QO3B 1MJUL 4RMQA 3EW3B 4A2FA 5HGAA 4I4TB 2ENYA 4K7PY 4U1KB 1Y0LB 2HKHH 4X0KA 4OFYD 3UIYA 4PLJC 4Y16C 5F88A 3W11D 4I0CC 4OLZH 4Y16A 4WSGA 1NH2D 2HFGL 3CFJA 1C8PA 4OLEA 1RUQL 3SEPA 2AQ3A 4E68A 4M48H 5C08E 1IJ9A 2E0PA 4MKMA 1QG3A 4LGRB 3ZRCC 1HNZO 3B7SA 5HHNA 3GB7B 1D5MA 5E24E 1RZKL 4H88L 2FE0A 3UTSB 4P4KB 5DJ2A 3LEYH 4GBXC 4U1MA 4EKXA 4L3ED 4Y1SA 1Q7YW 5KLVH 1Q9OB 2VDLH 4NKIH 4PD4J 2JH2A 4BUQA 3VW3H 3ECQA 5AB2A 3IN2A 1IV8A 4DP6X 3WL9B 5DHYA 2HUHA 9PCYA 3HMWL 3QDMB 3NCJH 4FA7B 1TSHA 3UO1L 3Q2LA 4PCTA 4X7SL 4DP5X 2A99A 4FG6D 2F53E 1TTRA 3OKLA 4HJ0D 3FQXB 4D0BA 4KDWA 3FQNB 4LRNL 2EILB 2CDYA 2WKLA 4RH4A 1DUZB 4LF5B 4NQEA 2IAMC 3R4RA 4RDBA 4OZIA 2IAMA 3V0GA 2QPUA 3LPFA 4OGYL 3GKWL 5EO0A 2VXSH 4AYBA 1J0IA 2H8PB 1EFRG 1DN0B 2BY2A 3WV0A 1N0XH 4AYID 3VI4F 1KJVB 2KSDA 3RYHB 4P07A 4W68A 5D7KE 5D7HA 1P9MC 2QADD 3HRPA 1ZWIC 2CR3A 2WLKA 1BD2A 1QBAA 3EJYD 4ZFGH 2A2QT 2K70A 3BEVB 4XXCC 4QRRB 2E5LB 3RX9A 5L4JA 2F23A 4XXCA 4Q9RL 4WHCA 1CDCA 1I1FA 1FH5H 3ZR5A 4O4IA 1KCWA 2VS0A 3NSFA 5CEZD 5IJVA 1ODUA 2MTAA 2R0ZH 3DRTB 5IFAL 1Z5YD 1LD9B 3ZZLA 3U7WL 4X9BA 2DQDL 1AGEA 1G1CA 1V5JA 4QXUL 3QEHB 1YEHL 4PW9A 1MJJB 3WNLA 1FDLL 3B1TA 1AVAA 2CJSA 2OXHA 4MJID 1BZEA 1H5BC 5DVMA 4ACPA 3HPJA 5LAXB 1NCBH 3SPVA 2W0XA 1LEGB 1H5BA 1YY9C 4OIBA 4PELA 5AALA 1ZIBA 1JF1A 2V2WA 1QYGL 1QI5A 5CMAA 4NCDA 2YC0A 2F1EA 1VZGA 1BVLA 3L81A 1I8MB 3KPSD 2Q8AH 1R3LA 5LGTA 4KZ0A 4Y5YC 1RHHB 1Q9KA 1VGKB 5ADOH 2EC9T 1K5NB 4TPRL 3EXAA 1L0YA 3TTSA 4A5UB 3DNKA 2EINB 2UY7B 4YR6B 5TFSL 4RMBA 1HHHA 1IRAY 4WHTB 1L0LH 1RZ7L 4DOHB 4AJVA 4HD9A 2A6IA 3DSNA 1U8JB 1G7MA 4OQTH 1ZV5A 2PCFA 2HRPL 2DWEC 3V4VA 2DYPD 1U6AH 1CURA 1EMTL 4R4NC 3RIAF 3SD5A 1A7NH 4NQCB 3OPUA 3QNYB 3R1GL 4Z7UB 1JZEA 3WIHL 1OP5H 4F33B 4B3TO 2F15A 4HS8L 5DFVD 2RA1A 1HNWB 4DR1B 1MI5D 2VLRA 2NX5E 4HZ3A 4HEPG 4HJEA 4HSAC 5H94B 4PGEB 5B8CB 3S8FB 2YD5A 1SDDB 3DIDA 3TONA 2E7DA 2R2CA 2AW9A 2PR9A 4UQIM 2X6UA 5DMIH 5C92A 5CN2A 2OYKA 4DUVA 3M1BA 2H6PA 4NZTL 1GYCA 4XCYA 1BG9A 1JUFA 3HHSA 4LB8A 1AD9B 4NTYA 1GIGL 2FSEB 4JI0O 1SXAA 2X1PA 3U0TB 1U92B 4F58L 4L4VA 2XIDA 3CXDH 3P02A 5HHMD 5IF0B 2OR8A 1FI8C 2F7RA 2N1TE 4DKTA 2FH8A 4YGVA 4N9OB 1OGTA 1QUNB 4F2ME 3BQUD 5D8JH 3V6FB 2P3YA 4EFBA 1G7QB 3GXPA 4B96A 3NAAH 1WFNA 2VN6A 2GY7B 3G5ZA 4M4RB 1Z5WA 3HRZC 1L0NH 1GR7A 3VQYA 4DJMA 4HOZA 3HRZA 4ZKIA 3VI4E 3D39B 4HXAL 4DT2A 2NZ9C 1J05B 2BMKA 3QBTB 1PLAA 2AGJL 1RH8A 1ZT7A 3L3DB 4FXGB 5DHXB 1ILSA 3L9YA 1PX4A 1W0WA 1FS0G 1QLRA 2CIKA 4YIQB 3BUBA 5BJTB 4ZOCA 5EZIL 4FYSA 1EAQA 2B16A 1JZFA 4LSVL 1ZAUA 3VMPA 1NFKA 1N33B 2JWYA 4K3GA 1NFIA 3WTVA 5DSCA 3CH1B 4ICWA 2J57A 4PHXA 1BAWA 1FPTL 3QCTH 2ESVA 4PJAB 4XC1L 3TEUA 1U91A 4ZNCD 4B50A 5ID0B 3OC5A 1V54B 4XNUH 5KVMC 3M8OL 3BHBA 5FYKH 2E27L 1EV2E 1WA1X 5IYZA 4JG1H 2UU9O 3B2VL 1AO7A 1VIWA 4Q6KA 3EFFB 4TSAL 4I4WB 1E4WL 1J8HA 1XFPA 1KJMA 4OCRH 3CX5K 4HWBH 4KVNL 5D4HA 4KITB 3DSFL 4NGHL 1QATA 2PY5A 5IBLC 1N5AB 2XVLA 4JFED 1ILUA 3V0EA 2R4RH 2VZVA 4HXBL 3FQ2A 1G7LB 1A4KA 1BQLL 4O2BB 4NXNO 1P6FA 2XG4B 4G6JL 1J9TA 5HYQA 2KERA 3II3A 3IJSB 4TSBH 4J41A 3HS0B 2V9RA 5IB2A 1J1PL 3C60A 3KLKA 4WLCA 4NM8L 1CI5A 2Q6WB 3KPLB 3THMH 4R8WH 2KQXA 3EGXB 2WXRA 3QUXC 4FZ8H 4BSVA 1MCBA 3NCBB 4XCNA 3V5KA 1NCTA 1U3YA 5HGGS 5GXBB 1UOLA 1ZS8B 2EDHA 5FEBA 4G80A 5CD3A 3DHPA 3HE6B 1THZA 5MEQB 3BMWA 3TASA 4KVCL 1IC4L 1FG2A 3MLZH 5IR1B 5FYLH 4EUPH 1PW3A 3ESOA 3WN5C 1U8LB 3IMBA 5CAYB 3UCRA 3QPQC 2G2PA 1T89C 5AB1A 3WN5A 1WTLA 4M61A 1TA8A 1D5IL 1T89A 3MLSH 2Z1KA 1H3VA 4JM0A 4HIEA 4N5EC 4XWGH 5D4JA 3VX1A 4FM0A 3NJLA 5E0QA 4LF7B 5GS0C 5CBGA 2C7FA 3OZLA 5CD5D 1UD6A 2Q87A 1PV0A 2D0FA 5I1GL 3S3WA 1TJHH 1WAAF 1MOFA 1PLBA 3CVCA 3D48R 3ECUA 1MCWM 1NU1H 1EHKB 4FQ2H 4MDJA 5J9PB 4LLDB 5H6RA 4IEFA 4XPTL 3N2GA 3ZLQC 5GIRA 2UWEA 3QJRB 2KZBA 3BD3A 3WE1A 5KJRL 2PTVA 4AWJC 4DR5B 4LEBA 2JJ1G 3SCMD 4NB7A 4D2NA 1QPXA 2DBLH 2RJMA 1INEL 1YNTF 4HAKA 5DLMH 1BMWA 3QEQE 3L95B 3OHXC 5KSAB 5FR3A 1ZGLM 1R3JB 2XCMC 3UAJC 2LQRA 3ALXA 3OHXA 5DD1L 4TUKL 3AQZA 2CKBL 3UKMA 2Z9TA 3KVPA 4X4MA 5E1GA 3UAJA 3FQWA 3WXVL 2VQEO 1SXCA 4NXSA 4HNAA 5CWSA 1TQBC 3PY9A 4H20H 4RRPA 2B14A 1GZQA 4WRLA 4BIKA 4K0KB 5IY5C 4TV8A 2WZ6A 4GLRH 1J9QA 3WAJA 2EDXA 1EH9A 2AV1A 3GHPA 4FXKC 1HAUA 4M7ZB 4PRDB 2FEDD 1FVDA 4OCXH 1KB5L 2R4SL 1NS1A 1CFSB 3MLUH 4Z7NB 4GXUN 3CRQA 3DKHA 2OZ4L 4XODA 4AH2B 5J6HB 2CMRL 3ZYZA 1RFYA 2O6CA 1II4E 1M93A 3EFOB 3HNSH 1OGSA 4B3SO 1KU9A 2ZXQA 5CEZH 5DS8A 5IGXH 1B2WH 2CNYA 3CZJA 3RFZA 1BJMA 1KZQA 5FFOA 5D1QB 2Y7MA 1RM1B 3W3BA 1ZOXA 2KZKA 2CIIB 2C1OB 1Q6IA 1BEXA 5AKRA 5EOCL 4KJQC 3FFCD 4D8PA 1VQLV 4AG4L 2RJZA 3EBIA 3BEWB 3PWLB 2XKUA 5AW0B 3K1DA 1ZXQA 3CZFA 3K1KC 3N1PC 4WV1C 1PS3A 3GBEA 2EH8L 1MF2H 5GRXG 2VYRE 1J48A 4UQ9A 3AG1B 2I60L 4GUCA 1FO0L 2OV0A 1UA6L 1K3IA 1N0LB 5B1BB 5KANI 4BIZA 4L1TA 4JRLA 5C08D 1HHGB 4IJ3B 5JORB 2WIIB 1OCCC 4UQEA 43C9A 5B7FA 4MCMA 4FLUA 3GXNA 5DK2A 2WZPD 3UTZB 1MMMA 3AREC 4HLZH 4MAUH 4WJ5B 1GH6A 2UUBO 5AZ2L 3T4AC 3HR0A 4QHLA 4JYBA 4YDJA 1H8NA 1I1CA 5DEZA 4WTQA 1F7YA 1WAAE 1A3LL 3V4PL 1HE8A 3CXCU 4UUJC 5DURB 1RZ8B 1OM9A 1UENA 2IALA 4UUJA 2YSTA 2FAUA 1G84A 4OVVA 5BPPA 4JAAA 3QJQB 1R3HA 1Z9MA 1WB8A 3PAZA 5F9DC 2ENSA 3RLSA 1JFHA 4JKMA 4RWYL 2H0PA 4FTVE 4YDVA 2AABH 3ARGC 4XX5A 1RMFL 1DN2A 2F53D 2R27A 3ILPA 3WTTA 3IFLL 2YIBD 3KM1A 3MJ8B 4PEEA 3C9NB 4IBVA 4H8WH 3T8XA 5EOQL 1MLBB 3D69B 3FFDA 4J8RB 4Z5RB 5KVEL 1G0XA 3RTQD 2BC4A 3L9RA 2VH5L 4K71C 4DTGH 1TEFA 3I9PA 4NLAA 1ITCA 2EYRA 2NNXA 3OMAB 4FQHA 1MIEH 4ZSOE 5BOJA 2E76C 5D7KD 1QVGU 1EXGA 3FT2A 1UM4H 4XPGH 3MLYH 5PAZA 1UJ3B 1JSYA 2AJYH 3V2AR 2XY2A 2PZSA 2F18A 2VXTH 4G7YH 3NJGA 2UXDO 1BLIA 4Z7UF 1LJMA 1NIAA 2R29L 3KE0A 2K1EA 2P45B 5FO8B 2Z64C 5D5PA 4PTTA 4KH9A 2GITB 3RVWD 3UZVA 5LHGA 1VCBC 1NR7A 4R7NB 2KPWA 1JDDA 4NKGB 1D6VH 4YXKH 3CN4A 4B5ZA 1KEGL 4Z0BL 2P6JA 3Q4HB 2IXQA 5FA3A 3TV3H 2DYRB 4QOKB 3QDME 4FABL 3EXJA 1X7SA 2NYZA 3O41A 3ASOB 2YXYA 3ZRWB 4HIXL 9CGTA 1XHXA 1AR1C 5MI0C 2BSRB 1NEZG 2W0LA 1RSOB 3MRMB 1W16A 3ZJZA 3RDJA 5LBQA 3QIBC 4BW5A 1LEIB 3IMWA 5K39B 1VQ6V 3QDHA 1WS8A 5I1CH 3ETTA 4RAUA 3GNML 3ULUC 1CCZA 1TTGA 2Y7OA 3L48A 4FNLL 4A66A 2YUWA 4DK5A 4TULH 3GJFH 4WNQA 3TC9A 1K9MW 4DKEH 1XBDA 2ZDIC 3MRHA 3OTTA 3S37L 4QRRE 2QBWA 4LP8A 5B1NA 2WYHA 4JI3B 3LH9A 3VFVB 1KG0A 5GS1C 4TTDC 1CPUA 3S88L 2IM9A 3WMPA 3RL1B 5GS1A 3SYQA 2F54B 4H0GA 3VNZA 1ROPA 1EGJA 4JV5B 5FPRA 5GRUL 3G08B 4DP0X 2X7LB 3AWGA 4PJAF 4XHJC 2NX5D 3NH7H 1W72H 1I3UA 1NCAH 2FATH 1G9HA 3B56A 5GS3A 1CG9A 1NBVL 1AE6H 4EXPX 4FA8A 1QHQA 5E56A 4G8IA 3MRIA 1AP2B 4JO8A 4BA0A 3BP4A 4GRLC 2HG5B 2JQAA 5E2VL 4PJEA 1QABA 3FUMA 2YPLE 4QT5B 3WJMA 2A83A 4ODVL 5A2KH 2GCYB 3O6FC 5LQBL 5ERWB 3GXUB 1AS8A 3DVGA 3TBTB 4LF5O 3IRZA 1JPGB 3WB0A 2TSAA 3R8QA 5AAPA 3CHQA 4TQDA 5LWYL 4NQUA 2FL5B 1D9KA 1FVEA 3I6GB 5IV2A 1UB5A 3F7KA 1CFBA 1KJ3H 2HVJA 3GIVA 3ALPA 1QAWA 5T5FL 1OAXL 5DUJA 1CDUA 1NLDL 4XVJL 2O61A 4DOHE 3SDAD 3ZL4H 1ACYH 3ILQC 3HN3A 4NO3A 4RWUA 5EIBC 5EU5A 4V2BA 5KAQF 1F4AA 4MVBD 3HNTL 3L9BA 1BAGA 1DANT 1JX9A 5EO1A 4H5SB 4NQCE 3ROLA 3LKSB 3SYOA 4Z7UE 1IQDA 3S35X 1WPXA 3HKFA 2HKFL 4DK0A 3QO0B 4FQLL 4GW5A 1DFBH 1UH3A 5IBUB 3O3BA 3BN3B 4LAJH 3RU8H 4BQCA 3Q2WA 4LDLB 4EXKA 1MFNA 4LCUB 3S34H 1KCLA 4WNJA 1JZDC 1MJUH 4YHHO 2B20A 1A7RL 5DJ6A 1D5AA 1UXWB 2AJXH 3TNNB 1E4JA 4DV6B 3OAUL 2FR4B 1MCOH 2V17L 2VIRB 4P5MB 4UCUA 1V8HA 4H1LH 2K1MA 2XKSA 4X7EC 5I1AA 1IBMO 4YXWG 1S9XB 1WAPA 2OMVB 1F23A 3CXFA 1ZLUH 1T7XA 3VI3A 1RZKH 1QTYT 3OXRB 3ERXA 5B39G 3CXHF 4UBDC 5IROC 1WAEA 1EUUA 4NJAL 1XD0A 5KYXA 5IROA 4W93A 4F7TA 3D39E 4P3DA 3CVHA 2ROXA 3GSRA 2G75A 3FRUB 4KXZI 4LLVB 3SYCA 8FABB 1FE8L 2ENPA 2XHNA 4GS7C 4Q52A 3RP1A 3VACA 3SBWA 3VNYA 2YGOA 1CL7I 3WKYA 4YHOL 5C70A 1EHLH 1G6RB 1XF1A 1PVHA 2EVJA 1H3PH 2PYEB 3SY0A 5HGHB 3PWNA 5LGHL 3NSJA 4OD1L 2XLLA 1OTTD 2F19H 4YHNB 5DJ0B 4DR1O 4PJAE 1OAYL 3MJ7B 3C8KA 43CAB 5ABDE 3ZX6A 3RUGA 3RGVB 4NIKB 2JDIG 5D7LA 3HVNA 3OD3A 3QQ9D 3C5XA 3D8CA 3HC4L 1I5XA 1QBLH 3BT0A 1RUAL 3PABB 2C1PB 3CMEV 1M9WA 3OWEA 1CLCA 1EBOA 4KXZH 2UZYB 4RNRB 1U8CB 2MCPH 4Z7NF 3ESVF 3MOBL 3WNJA 5KZCD 5FGCB 3ULVC 5C9JA 1IFRA 1CL7H 1Q94A 3JARA 4ZMPA 3OGCB 3GSOB 4C55A 4ZO7A 3VTTA 2P67A 3U7AA 1D2PA 4Z3FA 3EYQD 4DR7B 5CA1B 4R2GC 3LDEA 5DD3L 4YHLL 3WMQA 1KJ2H 1MHHB 3C6EA 3NJHA 4FXLA 5J7CC 2GIMA 3GRWL 1DUYB 4Q4IA 1FBIL 2VDPH 3PGCA 4G8EB 1WP8A 1Q81W 3CSYB 4HGKC 3ZUNC 2ADYA 1WCBA 4L1DA 1JGVL 4NR1A 3D8MA 2H2PD 3N40F 2EIKB 4NN7C 3K59A 3ZTCC 3AGWA 3QEQD 4PJXA 3X12A 3ZO9A 1RZJH 1QYGH 5HGDA 4ADIA 2C7UB 1R34A 1BZKA 4N0CC 3VA2C 3HAEB 2QM8A 1JPTL 2Y3NA 4JFDE 3ZS8C 4TOYH 4RA0C 1UWEL 3DXAA 2F7IA 3Q2CA 2YXVA 3HZVB 5EOTA 4CVZA 1TMQA 4P5TB 3T3MB 2Y69C 3U6RB 3AG3C 3PHAA 3BVDB 3LKQA 2XQYA 1I94B 1BCCH 4P9MH 5F6HJ 3I6KA 3VRLF 3G6JB 2V9QA 2ZCHH 3BDYL 4GKZB 3AS1A 4GW4A 4JUSA 4DAGL 5HVFB 1QSEA 4Z7WB 1RZ7H 1XNQB 4JO1H 4MZ3A 4OIAA 2PWEA 3D2UB 2EZPA 2E8YA 1NSNH 4Y2NA 5ISZB 4CSTA 5D5MB 5JXED 2J73A 3LZPA 5ITFB 3T6VA 2GSMB 4UV9A 4NZUH 1HNXB 1EMTH 4OTXL 4UYPA 5BMFH 2WVSA 3MNZB 4J2QA 4RFEB 3TTYA 4TVSa 2EDBA 2IBZH 3V6BR 4Y1AA 3GSVA 1XQ8A 2WVUA 2BVEA 5F7NC 5I1EH 5GSRA 3OZKA 3KPPA 1YEJL 4GFXA 4YSDA 1GY2A 3G5VA 2XTLA 1RK0A 1PP9H 5D9SA 2CUIA 5HFLA 1I7RA 4CN6A 4C4UA 4CC6A 1HILA 1T0NB 1BYOA 3QEGH 5J6SA 3X1BA 1EHAA 4DN3L 5F9OH 1HFUA 2RALA 3DTXA 3L7EA 4NHCL 4NZTH 3K58A 3UC2A 4Q6GA 1FVCB 5E08H 3VD4A 1GIGH 3BZ5A 2Y2YA 2HTLC 4Y8DC 3EJCA 3GMNA 1SN2A 1KACB 3DX8A 2VZ1A 3CCEV 3H3BC 1NZRA 4PJDA 5EF0A 5DI8A 3ZKQD 5HYJB 1PY9A 4OM0H 2WXIA 4HGMA 4ONFH 5C0AA 3L3OC 4DZ8B 5CCKL 1ZHLA 3TLRA 1VF7A 4FS0A 3BO8B 3L3OA 1IEAB 1M3IA 3H2QA 1HNGA 4KAQH 1RXLA 2J6EL 1NEUA 4UT9H 1IE4A 3RT3C 4DKAA 1JYWA 2H1PL 5KMGB 2YS8A 1JCKA 4IU2A 4NI3A 3GIZH 2BNQA 4AVKA 5IW3A 3ATEA 5T3ZH 1E6JH 3OF6A 4WF7A 4ZD3L 2EIMC 3SOTA 1GC1H 2FX8L 3W57A 4Z7NE 2IGLA 3RY4A 2EZ0C 4GEIA 5CEYA 4R7DA 3U48A 3OL2A 2CTRA 4HISA 4XNMB 2DQFB 1ZT4A 3RWCB 2OCCB 1L6ZA 1QFHA 2Y36H 4NOBA 2AJSH 2VWJA 3MMEB 4ODHH 2G2RB 1G9MH 4KBPA 1CC3A 1ES0B 1NKDA 3WTYA 3G7TA 2CH7A 1BOGA 1PD6A 4GB9A 2LTQB 4CW1A 3GM8A 3Q6FA 5EZLA 2E27H 4IGBD 3D7PA 5D1QE 1W8OA 3F5WC 1WSST 2XWTB 4OZGB 5ACMA 5GGTL 4ORZC 4K8RH 4PJIB 3M07A 3F5WA 2ZJSL 2PCYA 3HC2A 2XTAA 1CGXA 4FTVD 5PCYA 5IVNA 1MW3A 1CBJA 3N50A 4S1DC 2ADGB 4BFNA 1A4AA 1E4WH 1H15A 1MG3C 5DUBB 1AGFA 4LC1A 2IBZY 3BKJH 3SY6A 2XWJA 1ECYA 1UPGA 4KVNH 5FCUH 3FB6B 5IUSA 2NXZC 3DSFH 4NGHH 3QWQB 5IB3B 3OR7C 2ERJC 4M6NL 4UTCA 2WWMC 4WK2B 5CZXD 4U4IA 3OR7A 1DSFH 1M7DB 4F5CE 2ZKHL 1BQLH 1B3IA 4OI7A 5F7MC 3VWKD 3GO1H 3ZMVA 4K0KO 1F4WL 2EQDA 1P84K 1S7TA 2GJZA 5CBAB 5TPWH 4JI8O 4DCQB 2BNUA 3VRLE 4MSWC 1WFJA 3MUY1 4BFBD 1J1PH 4MSWA 4WJG3 3V8OA 3HE7B 4XPFH 1XMOB 3P0VH 2BIHA 2VISA 5E6IC 5L8LB 1UT1A 4PG2C 1E65A 4P4KD 5E6IA 3HB3B 3DV4A 4N8PA 4QTFA 4PG2A 5MEPB 2XV3A 3ARTA 3D3QA 3RVVC 1N4CA 3ZX1A 2ICEA 4RFOH 2DB8A 2Q9LA 2CGOA 3OKDB 4LVHC 5HHVL 3QRFM 3C08L 1MFCL 5IJ9A 3B2EE 1AZVA 5HHQB 4NO2A 2VZOA 3G6AB 4KVCH 1IC4H 3GLEA 3QDMD 5TH2A 1X6LA 4YNYA 3TH3T 3WBDA 3ZW3A 3QS2A 3QRLA 1KCUL 3MA7A 5AW3B 3APDA 1DLHB 5DMYA 3ZKNC 1MUJA 3K2IA 2BPBA 1D5IH 2DW5A 5GGRA 3UYPB 3OHMB 1MFEH 3S2CA 3UGXA 4GG6B 5AZEL 1MHCB 4F7PA 4EIZC 2HT2D 3I75A 4YWGH 4AQEB 4IS6A 2IWKA 1UM5L 1R3KB 2AV7B 4RDQF 2WXNA 2YPKA 3TX4A 2NYKA 1IBHA 2PCPB 4TNGA 2FQEA 5I1GH 4LKXB 1A6WL 2R1WB 1R6VA 1NBZA 4YHZL 3H0TA 1GO3F 1J0KA 3GS4A 5DEGA 3QUZC 1I4FB 2AJZA 2JF1A 2NMSA 4QRRD 4PS3A 4DRXB 2H7WA 3QUZA 4UV7L 3AT8A 5IHBA 1Z9SA 3MX0A 4UB0L 2XTJC 2ZUSA 3TIEB 5BZZA 1MZFA 2EO1A 3TJEH 2WQXA 3MYJA 3WHE0 4OKVB 4TUKH 3FXIC 1ZVSB 3TF7C 4N2HA 1QR9A 5CGYC 1F4YH 1PJ9A 3RWRD 2QTSA 3E1ZA 5C7ZA 2DIEA 2N7AA 3LEVL 1F3JA 4QOKE 3BVWA 1J1OL 4WBNB 1IGCL 5E9DA 2UZPA 3ZHKA 1TVHB 4MXQD 2PPFA 2NW3B 3A6CL 3DIFB 1NWPA 4ZW3A 2YPLD 1KB5H 2R9AA 1Q72L 3D34A 4Z1MG 3JV4B 1MZEA 2I24N 4MRCA 3WSQL 5I8OH 5HPOA 1P4LA 3MQIA 3C5SB 2WKOA 1OF0A 2CK0L 2HJLA 3UG3A 1JZ6A 2HX8A 4Y8AA 4ANWA 1JI1A 4MQTB 3D85A 4XB8A 2QT6A 5L4IA 4QJ4B 4X5XA 5SWSA 2Z7UA 4F91B 5B4MD 2V6HA 1OK8A 4QRUA 3MODH 5LP6B 4ADJA 3ME0B 1CDGA 5EN2A 3O9WD 4IBSA 1GMGA 4R3SA 3MBWB 1NVPB 4ZO9A 2QHLA 3LS4L 4LHQB 1OW0C 3GZOA 2D3NA 5FW7A 1OW0A 3Q6GH 4FLSA 2F54E 1XR9B 4NQCD 4AI7A 2GEQA 1WVZA 1YY8A 4AG4H 2D7MA 4OAWA 1VJSA 3AK3A 2P44B 3PNWA 4U2ZA 4Y19A 4M29A 1FZJB 4GZRB 3BAAA 1FIEA 2VW6A 4FMVA 2NTFA 2X4SA 3GHBL 2EKSA 2GG1A 1AY1L 4RX4A 1YI2V 2VR3A 4J3XA 3E9UA 3GZQA 1QBZA 5LN4A 1IQWH 4MTFA 1FO0H 4BHUA 5C6PB 4OPAA 1HWWA 5C71A 5MENB 1TETL 1UA6H 2BSKA 1KLUA 2OJEB 5B39A 2GK0A 3HG2A 2CDFA 4AYMC 3WXWL 1BJ1J 1AROP 2B2XH 1JPSH 3TVMC 5DMGD 1A7PL 5SWQB 3CCJV 1CQYA 3LKRB 1Q90D 1EXUB 2UZXA 2P5PA 3CQQA 4JREB 1EBAA 3FW6A 5AZ2H 4OPHA 3P30H 4ZUWA 5HD8C 1VKXA 3QQ4A 4APXA 1Y74B 5B7MA 1LE5A 3D39D 4HUWB 5JVDB 1A3LH 4FJCC 1MW0A 2R56H 4PGDB 1N34B 2F5AH 5KUKA 3QRGH 2FWOA 2H9GB 4CAGA 3F7QA 3WTWA 3CHOA 3TIDB 3N85L 4ZO8A 4KY1H 4J7RA 2ZUXA 4BZ1L 1FSKB 1GL4B 4KZEL 5LXTB 2I5YL 1MHPH 1QCEA 3DYOA 2COQA 4PP1C 2Z31A 1UYWL 4JPVL 3DBXB 4LEEA 2R7EB 4XBEH 1UKQA 3RURA 2VC2H 5GZOC 4J3UA 4RETB 3WY1A 2WLIB 1MN4A 2L3BA 3RDTA 3ARBB 3BI9X 3T3MF 1SEQL 2DYSB 4EDWL 5L2KB 3ETSA 1SA0B 4FDWA 2F1AA 2FQFA 1N4XL 4P2CG 1L4IA 4R0LB 3OKKA 2UVFA 5C0FA 3G6JF 5GRJL 1BSMA 5A9GA 2K8QA 2A6KB 4X65O 1JVLA 1NCIA 1UD8A 2NY1B 3GMOB 4ZW6A 4Z7VA 2KDYA 1SHMA 5B38A 5GTHZ 4TUJA 4YE0A 5D5MF 3HTLX 5FHBH 3CU1A 1HXMA 3E22A 1TT6A 3Q7JA 1C5CL 3GS7A 3B8MA 3Q1EA 2AEPL 3QA3A 2ADIB 4HS3B 3FOLA 2Y0IA 4FFWC 4KHTL 1LHZA 4N0RA 5EU4A 3SDDC 4M4PA 4BZ2H 4M9OA 2EUVA 3SDDA 1UACL 4GSQA 1NCJA 3ZTNL 5IIEB 4MQ7B 1CD9B 3QZPA 5LBGA 4ZMWA 1C5BL 2ED8A 3CN0A 3G67A 3ZYJA 4YXHL 1AZCA 2B1OA 3DK2A 2OT5A 1S7XB 2J88L 3A4AA 3FAXA 3O6ML 1DVZA 1J8SA 3RGBA 1IT9H 3CX5F 5JCOC 2HH0L 2CJTA 2HKAA 1BCIA 2K78A 5B3JF 1MCCA 4W9LC 2R39A 2DRUA 5JCOA 2N3JA 4HKJB 4HIXH 4N8UA 1BQZA 1OF2A 4ZMLA 2PYEE 3AUVA 2HHHO 2F7QA 4BM7A 2VZUA 5T1KA 2HFEC 2J71A 4EIGB 4H0IA 4JFDD 4ZUTA 5DVPA 4O02B 1WZLA 2HFEA 3HE6D 2ZSWA 2P24B 4GMSH 4NRYA 1XGQA 4AVHA 5ITBL 5HGAB 2YMTA 4X0KB 5H37G 1N6QH 5I1IH 1OSPL 3TBVA 4OLXH 2BO0A 4Y16B 3PGDA 4DV6O 2PUSA 3CFJB 4WI3A 1IXMA 4X99B 4UTAA 4MVMA 2AXGA 1KELH 3MHHC 3JUZA 1KBKA 3QWRA 5HHNB 2V37A 3GS0A 2EIEA 2YUXA 3ZRFC 5DMJB 4X5RA 2DLIA 5DJ2B 3A3YB 4N2AA 1BGXH 3T6XA 2GBVA 4OY9A 3R4DA 4MA3A 4HLEA 3KJ4C 2JI1A 2VXQA 2EJ7A 2C3GA 4IRJC 4AX3A 5DHYB 4OZGF 4IRJA 4F57L 1XIWC 3EHBC 3RN4A 1HOCA 3CWGA 1MWAH 1XIWA 1MRCL 1U3HA 2OW6A 2W0PA 4TM9A 3NFNA 1KOAA 4U49A 4XNQA 5E2VH 2MSPA 3OKLB 5KSAD 3W9DB 2IGTA 2FB4L 4D0BB 3CIAA 4M5SA 1TVDA 3VXSB 1PFOA 4KX7A 5L6YL 1JGUL 1G6RL 1QNZH 1PAMA 4NQEB 4ODVH 1YMHB 3TH2T 1H8SA 2IAMB 1IGIL 4NO0A 3QORB 2Q9OA 2W9DL 5EIVA 2N04A 3T3ME 5EO0B 3NT0A 3ZGIA 2D03L 2QGDA 4UZSA 3S8GB 3NEEA 3MBEC 3RYCA 2C9PA 4FFZL 3K9AA 1R1CA 5BNXD 4L0PB 3MBEA 1YYLL 3G6JE 5T5FH 1OAXH 4K3DH 2J8OA 1DJSA 4IQHA 5D2LF 2JFCA 3IDIB 4TUYA 2X2IA 3RWJA 3QG7H 1JGDA 1LO3H 3T6ZA 1VA9A 3HNVL 3S36X 5KYWA 5D5ME 4LAQL 3IFNL 2PMZA 4I5SA 2F2HA 2X3AA 3PPEA 3MRGA 3LZFL 4QGTA 2AAVA