3ABKB

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3abkB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3abkB02
2W88A 1NIEA 1ETJA 3TA4D 3BVDB 1AZUA 1XMEB 1V54B 1I53A 1FA4A 4NAJA 3EH4B 1ET7A 2WO2B 5B1AB 4HALA 5E9NA 3NP4A 3ERXA 2Y69B 1GW0A 1KV7A 2BP8A 4YSTA 2J5WA 1B3IA 1UATA 2ZWNA 3S8GB 2HLEB 4GP4B 2IDQA 2XU9A 3PCYA 3QJSB 3QJUB 3H56A 3T9WA 1BYPA 3ZBMA 3NSDA 1ET8A 3EHBB 2XV2A 2PPAA 1SDDB 3FYIB 1A4CA 1RZQA 2QDVA 2MRYA 1PAZA 3QJTB 1NIFA 2EILB 1RCYA 1PZCA 2BP8B 2PCFA 1SFDA 3NJMA 1EHKB 2JFCA 5F7AA 1NWOA 3FSVA 2BP0A 2VSMB 4A68A 1BXVA 3GYRA 4F2EA 1WA2X 1GY2A 2A3TA 3UACA 3N55A 1AZBA 1XB6A 2XYBA 2MTAA 3HB3B 1L9QA 4E9RA 3QJRB 4UF7C 3ZIYA 1XB3A 3UADA 1OV8A 2XX0A 7PAZA 1KDIA 3NSYA 5F7BA 4AKQA 2HRGA 4AKOA 5D4JA 4A2FA 1WS8A 1MG2C 5I5MA 3U25A 5I6OA 3WIAA 5AFAA 2VMJA 1NPJA 2GIMA 2UX7A 1SHXA 2E86A 1BAWA 2BZCA 2PPFA 3CG8A 2B08A 1V10A 2R7EA 4A66A 1WAEA 4EF3A 4TXVB 2X88A 4BDVB 3DIVA 5TK4A 3N2JA 2ZONA 4AKPA 3FPYA 2I7OA 1A8ZA 2I7SA 5EHFA 3X1FA 2UXTA 5D4HA 4DPAX 1NIBA 2QPDB 2XVBA 2J56A 1AS7A 2J57A 5I5IA 1IBZA 3TASA 2FTAA 3IEAA 1JXDA 2VW7A 1AG6A 6PCYA 2AANA 3NP3A 3WG7B 2YXVA 4HIPA 4YSRA 1JVLA 2BW5A 1ZIAA 1IKOP 3WKQA 3AG3B 3ASNB 3NJKA 2DWTA 1GYCA 3ZDWA 1TKWA 4G72B 3FQYA 3FU9A 3NSCA 1JZEA 4DP9X 1GS6X 1VLXA 2QT6A 2X87A 4N4YB 1L9RA 3PAUA 1MZYA 4KO5A 4A2GA 5PAZA 2P80A 3NSFA 1FFTB 4YVNA 3UGEA 2YARA 1OCCB 1NTDA 1JOIA 3CZUB 3SQRA 4M4RB 1HFUA 2FJSA 1RZPA 4HCIA 2IH8A 3CVDA 1ZV2A 2FNWA 2UXFA 4KO6A 2CAKA 2ZOOA 4KO7A 3DTUB 1OCRB 4YSDA 3PXLA 3AG4B 4PCYA 1NINA 5I6KA 8PAZA 5ANHA 1R1CA 4QLWA 4DP2X 1N68A 2FT6A 4YSEA 3QPKA 4BXVA 3TU6A 1ZDQA 3IN0A 4G7QB 1PMYA 2R7EB 2PPEA 2BZ7A 2WSDA 2EIMB 1JXFA 4NERA 1T5KA 2PP9A 2YQBA 1E65A 3CVCA 3AG2B 2IWKA 3FT0A 3S3BB 1E30A 2AZAA 1L9SA 4GP5B 4N8UA 4KNUA 3FQ1A 4G70B 3CDZA 5I28A 1PZBA 1DZ0A 2Y1AA 1CURA 4AZUA 1KCBA 4GXFA 3UABA 2IDUA 3NJNA 1GS7A 3PAZA 1X9UA 1PNCA 4GP8B 4P5RA 2DY2A 4YVUA 3BQVA 4A2EA 1SNRA 1JERA 2IDTA 2FT8A 2PCYA 1AS6A 2IH9A 3HEIB 5B7MA 1CYWA 2IDSA 3AG1B 3V9EA 3X2QB 3X1NA 2XX1A 4A2DA 2I85A 4A2HA 1MG3C 1ET5A 2JKWA 2CALA 4X4KA 1A3ZA 1JZIA 4BWUA 1N70A 5B1JA 1JZGA 1ASOA 3WKPA 2YAFA 4W9ZA 3G5WA 1GS8A 1JZFA 2GBAA 2EIJB 2UXGA 1WA0X 3MBWB 4DP6X 5B7EA 4YSPA 2LLNA 3PAVA 3TBBA 1BQKA 1BXUA 5I6LA 1ADWA 2OJ1A 1OE3A 2DWSA 3FPXA 2VM3A 1NIDA 2YXWA 2CJ3A 1OCZB 2P80D 1L9OA 1PY0A 4F2FA 1V55B 4AX3A 1FWXA 1A65A 1ID2A 3OQRA 4FAAB 4DP4X 2DYRB 1CYXA 1PF3A 3S8FB 2JXMA 3GXUB 3RYMA 4Q89A 1E67A 1ASQA 2HX7A 5IY5B 2BWDA 3CDZB 2N0MA 4KNSA 4HZ1A 4KOCA 1JZJA 1NWPA 2YAOA 4HCFA 1AQ8A 4P5SA 1A4BA 3FU7A 3X1GA 3PLYA 4G7SB 1KBVA 5D4IA 1DYZA 5AKRA 2XV0A 9PCYA 1HAWA 3FU8A 2GSMB 1JZHA 3QQXA 2VN3A 1M9WA 3C75A 3OD3A 5I6PA 1SJMA 1A4AA 2XXGA 4YSOA 4DP0X 1XB8A 4RH4A 2H47C 4BK5C 3X1BA 5TK2A 1W6LA 5LDUA 4F7KA 3L45A 1SDDA 5I6NA 3ABMB 2YEVB 4DP1X 2VW6A 4ZK8A 3IBOA 4E9VA 3FSAA 6PAZA 3OMNB 3MX0B 5I6MA 1MZZA 4W1TA 1AACA 3ZX1A 2GC7C 5B7FA 1GY1A 1IC0A 3H4HA 2YAEA 4Q8BA 4DPBX 3WI9A 3NJFA 1JXGA 2XLLA 1TU2A 1CUOA 3EH5B 2XV3A 3JT2A 1J9SA 2J55A 4G7RB 1NPNA 2HRHA 5B1KA 2VM4A 3PPSA 4FA7B 3T6ZA 2PPDA 1QHQA 1AOZA 3CVBA 4E9XA 2OCCB 2AFNA 2GHZA 2BP0B 2HX9A 3IE9A 2Q5BA 4GYBA 3WNIA 3OMIB 3NJLA 3FSWA 2IAAC 2YAQA 5FC9A 5B1BB 1BQRA 1QLEB 2FWLB 4YSAA 2FT7A 2BW4A 4HAKA 1J9QA 4KNTA 2QDWA 2BHFA 1PCSA 3OM3B 2BO0A 4UAHA 3GDCA 1IUZA 3S3DB 5PCYA 2XXFA 5AZUA 4DPCX 2CBPA 3FU7B 3NT0A 2HZHA 1URIA 4G71B 1EZLA 2NRDA 4YSUA 1ZDSA 1ASPA 2XUWA 2UXVA 4YL4A 2GB2A 2YAMA 2YAPA 2IWFA 1L9PA 4KOBA 1ZIBA 4WKXA 1NICA 1AZRA 3JTBA 5I5JA 2PPCA 3NJJA 4GY4A 1BXAA 4YSCA 3T6XA 2TSBA 3AZUA 1J5DA 1GSKA 3D12B 2GC4C 4ENZA 1PNDA 4HCGA 1RKRA 2WO3B 1PZAA 1E5ZA 3TBCA 1J9TA 3T6WA 1ZPUA 4JHVA 1OE1A 1OF0A 2W8CA 3ASOB 1SF5A 1SF3A 3EF4A 2ZXWB 2EINB 1AR1B 1E5YA 1KYAA 7PCYA 2CCWA 1F56A 1KCWA 3FYEB 2PLTA 3FSZA 1M57B 5B3SB 2CUAA 4BDVA 2AZUA 4DP7X 3QJQB 3T71A 4CSZA 2FQGA 2EIKB 1NZRA 1J5CA 1KGYE 1HAUA 2DV6A 2FQEA 2PP7A 1W6WA 1MDAA 1TEFA 1YLBB 4KO9A 5I26A 3SBQA 2VW4A 1SHWA 5B1JC 3FQ2A 1AG0A 1X9RA 2YAHA 3WNJA 3UAEA 4E9SA 4E9TA 1BEXA 3ABLB 2B3IA 3IN2A 1L9TA 4BWWA 1M56B 5A7EA 1AAJA 2H3XC 3FS9A 3V9CA 2PP8A 3QJVB 2IDFA 1ILSA 3EH3B 2Q9OA 4E9YA 2BWIA 3ABKB 1WS7A 3KW8A 1OOWA 1AZCA 3S3CB 2XWZA 2TSAA 3T6VA 1QNIA 3H4FA 4CSPA 1PLAA 2FQDA 4HHGA 3DKHA 2HX8A 4BXSV 3OMAB 1NIAA 3NJGA 3SBRA 2DYSB 1BYOA 4A67A 1AIZA 3ABGA 4HHWA 1SFHA 3NJHA 1IBYA 1AZNA 1BQ5A 1PLBA 1KBWA 2HXAA 2IWEA 2QPEB 2VSKB 4MFHA 4WTQA 4JHUA 2AVFA 3UAAA 1CC3A 1J9RA 1WA1X 4K9JA 1NDTA 4DP8X 4QKTA 2OV0A 1TEGA 3KW7A 4E9QA 1KDJA 4DP5X 3AW5A 4JKNA 4UANA 1GR7A 1W8EA 4YSSA 4NB7A 4PAZA 2H5UA 2FQFA 3NYKA 1AANA 4L0PB 1OCOB 2UX6A 4BWTA 4E9WA 1AS8A 3X1EA 4YSQA 1PLCA 3NJIA 4M3HA 2RACA 3SBPA 3AY2A 1ILUA 1OE2A 4AI7A 2GI0A 1JVOA
chains in the Genus database with same CATH superfamily
1LO2L 1MCSA 2Y5QA 3FUEA 2W88A 4YXKH 4OSUL 2ZE5A 2G9KA 5DMJB 1IC5L 2CDGB 4H8UA 5MEQA 4ZZFA 4MQTB 4U1NB 4ZDHA 4ABVA 4U3FH 3VXUA 1SJVA 4ZOEA 5ENWA 1NC2D 5D93C 1YRKA 2ZWNA 5L2JB 1EN6A 1CFNA 1P4IL 1F4WH 1Q90A 4PJCE 1J5EB 4G42A 2R1WA 4TVSa 5H35B 4M9PA 3JV0A 2BHUA 2VXUH 2RIKA 2VN6A 5IVXF 4QNHB 3L3JB 4H26A 5HHOB 1AC0A 3MRQB 4KUCF 4IW4C 3CHSA 4XMPH 1A4CA 2AEIT 4NO2B 4JI5B 3D18A 1JV2B 4XCCL 3U7YH 3Q3GB 1IBDA 3DK2A 1D7CA 1ZKAA 2YWZA 3TS8A 4XN1A 2FGWL 2BP0A 2V9RA 3E6FA 5CJXA 3MLPA 3L7EB 4W70A 4KP4A 3I3BA 4PWIA 5D2NA 3UACA 5H37H 3QQ4A 1QR9A 1HI6B 3QEQE 5D93B 1YQVL 2HH0L 5I73C 4OIAA 5DMIH 4ZUWA 3QORB 4AUJA 4JKKA 4QLRA 3EFFK 4I7ZB 3ARPA 1T03H 5ENWB 4JAMA 4P4RA 2WOBA 4YLQT 1QNZL 1JGUH 1RFDH 4W4LA 1DCLA 3MLUL 5GZND 4OIIH 4YH6A 3ECVA 3VQVA 7FABH 4HWEL 5FK9B 5D1XD 3CSPA 1NC4B 2GIMA 4CN6A 3TCUA 1BWWA 3D3VB 1TQTA 4JM0A 3T0EE 4HMCA 1MXGA 3L3DA 2W9DH 4FLSA 5B66Z 4L3CA 4Y8AA 5F44A 3RNKA 4D3CL 3QIUC 2R7EA 3NCMA 4NRXB 4R4BA 3CX5K 1W2KT 1UFIA 2NYYD 2RA1A 5AUMB 4U3JB 2ZONA 2R4RL 1QKZL 3RTQC 3ZUCA 1Z2KA 4LWSA 4BQBA 2HP4A 1IBGL 1KGXA 4AT6B 3TH2T 1J05B 3IEAA 4DW2H 5JOFB 2VW7A 4DV7B 4P2RD 1QVGU 1R6KA 1AG6A 3U82B 3BCDA 4J3OG 1MDTA 4GO6B 1XGUA 1WPBA 3R66A 5EBMC 4Z7QE 3KD4A 6FABH 4E41A 4XP9L 4I18A 2X4RA 2JKLA 2DL9A 5KTEH 1NGYB 1CICA 2LVEA 3SJVB 1FCCA 3CZFA 1RURL 3F58L 4LLYA 3NJKA 4HAMA 3GXPA 3LIZH 2MNUA 2WLMA 4UT9A 1I7UA 3P9MA 4RBPH 2ZOTA 4JYBA 3HZMB 4IK6A 3JUZA 5FO7A 3PWNA 5DHMC 1CN4A 3RRQA 2UXXA 1MZYA 1SXCA 1MHEA 4H20L 4MAZA 3BUIA 4HLEA 4YHLH 2BSKA 1LNUB 2YXLA 3NSFA 1FFTB 2V2WB 2MKWA 5DJCB 4JYAO 2JIXA 4LLVB 1JOIA 4YZFF 3VXQA 2PCFB 2R72A 5DJ8B 5EO1A 2G75B 3BEWA 5F9JA 3MLXH 3ZTCC 1N0XL 2WTOA 3D87B 3ORJA 4I18C 4KO7A 1QSEE 4Q2ZB 4Y5XC 5AKTA 1A7PH 4PLNC 4ZMYA 4HWZA 3FH7A 2PXYA 2DH2A 2E9IA 3BT2H 3BGFC 1Q43A 4PS7A 4ELMB 1XHZA 5E2UH 3K6SA 1Q0XH 4X80H 4XN5A 1MOFA 1BJ1J 3IDJB 3OTFA 4WENB 1SUHA 3O2VH 1N4CA 2GUOA 1K34A 2YIAA 2R7EB 1FFPA 1DUZA 2CKNA 4FYTA 4PJGA 2A1WH 1XD1A 4KRPD 3RA7L 4UCFA 3MLYH 3PUCA 2DQDL 2O26U 4HOZA 4BD4A 5A40E 2GJPA 5IBLD 2CO3A 4MCYA 1B0GB 4QE7A 3C5JA 2EABA 4ZQTA 2XJLA 2R9HC 3ZTNL 1N6QH 3IDIB 3VI4F 4PGJA 4CH5A 3JCZA 1KNOB 1NEPA 3NJNA 1Z5YD 4Z3GA 3CQQA 3ULUF 1R0AH 1JJUA 4F2ME 2DQ0A 2FR4B 3QDGD 4BQ6A 3FTWA 5KYWA 3SE4C 1TTAA 4UNVA 1KIUA 4UM9D 2QQKL 3W37A 4ZW5A 3EGXB 1WDAA 1SM3H 3EJYC 2J3SA 3KHOA 4R4ND 1PYWA 2ICCA 4P59H 4LF7O 3TIEA 2GIXA 3C5ZD 3WJMA 5MENB 3X2QB 3RLSA 4Y4FD 5I2IA 1FD9A 3KYOB 3RYCA 4NUJB 3EO0A 5BOPA 5KSUB 4Q6GA 1Y74B 5C6TL 2JKWA 4FXGC 3J2PA 4NO2A 1V55C 2OLDA 3ZW3A 4F7CB 4NKOB 1RUAL 3CWBH 1Y74A 1E40A 2TRYA 4FC3E 4JO2L 3L5JA 5FV1L 3VXPA 1X5XA 1WUZA 1WJZA 2P52A 2RCSL 1ASOA 2CLVA 2W9EH 2YAFA 3A6BH 3B7YA 3Q7JA 4TNWF 1JHLH 3FK3A 4R83A 4MVOA 4OIBA 4S1RH 3ZPDA 1E9OB 2FAUA 3TEWA 1R24B 3U7YL 4B7LA 4KH2A 3R65A 2PMZA 1NANI 1OAYL 2V17H 4M61A 3QUZC 4TRPH 3JQOB 1OARH 1JGUL 1RFDL 1OCRC 3FHQA 1QHOA 3MLVH 5ANMA 4F7PB 3FFQA 4U1JB 3UYRH 5A2CA 2Q0AA 5TE4L 2E6JA 4OQTH 2WINB 1IQDB 3FPXA 3R0MA 4FN0A 2CJ3A 3SDAD 3VXQB 5KS9E 2YGOA 1Z6JT 5BV7H 1PLGL 3KYMA 4QHMA 4F2FA 3TV3L 1GPOL 5HYSG 1ZLSL 5DJZA 5IFAL 2ADGA 1MIEL 1OGTB 1MRCH 3Q5TA 3M1OA 4OJFH 1RM1B 1MFMA 4N21A 5AW1B 2WN3A 2P9RA 3NFNB 2WWKO 3U6XA 5KAQF 3FONA 5DHXB 4J1UA 3OB0K 1DANT 5HHPB 3JTTB 3K72B 5EC2C 3QQ9C 4FABH 3DVNA 1AGEB 2OMYA 4JYAB 1W0VA 3T0EB 5K1PA 4J12A 4E41D 4I1NB 3IVKB 2J8UB 5G4OA 2ZXQA 9PCYA 3L3KA 3HS0C 3SYQA 1HKLL 2VIRB 4MNQA 4PJHF 4CMHB 5J2TB 1A3RH 2XZAH 1G6RH 3PP4L 3QZMA 5DUBB 5C0ND 4N2GA 5C0DA 2B1IA 4B9IA 5J1AA 2FVNA 3CFBA 3BP6A 3OWRA 4TSCH 3VQMA 4BFKA 3TFKC 5DMKA 2P67A 4GRWH 4JX0A 4PJDE 4WWPA 1E8WA 3T1YO 4LOUD 5C0CE 5L2JA 3B5TA 4JZJA 3IBEA 1NOFA 5EEZA 4EBQL 4X9FA 5C6TH 4PG9B 1I7UB 3PHAA 1EUTA 1GMGA 4JPKL 4K73A 2K4WA 4OKVA 1SDDA 3MV9A 1JL8A 1HHHA 3RIFF 4RMTA 4FTVA 2JQZA 2H9GB 3WL9A 3DMMA 4GG6F 4M6NH 9CGTA 5C0AA 2YK1L 2R4SH 3QG6B 2GABA 5KS9A 4W1TA 1MNGA 1CPUA 4L37A 5KVGH 5IY5C 2XBDA 4LB8A 5DS2A 5E8DL 2E74C 5T1KB 2YBRB 2KZ1B 1HZHL 1RZGA 2VZ1A 3GMRA 3O6ML 3WEAA 3BAWA 1BG1A 2DEYX 2EYSB 3TTSA 2YAEA 2UUCO 1LEKB 4LFCB 2FCBA 3FUMA 2C9XA 3QR0A 2JVUA 3W39A 1JZ2A 4QHMB 5IQ7L 2HG5B 1CBVH 4DV1O 2B3RA 2QM7A 4NN5C 5DK0A 4WW2C 3GBMH 3B8YA 3VFRB 2QHLA 2IH3B 3JWNE 3BUYA 5T1DL 1AD9A 4QKXB 5E9AA 2HLAA 3VI4A 4XNXH 2Q5BA 3F7VA 3PL6D 3LZOA 4WCYL 4FXGA 5IM7B 4Z77B 5ISZE 3SJAC 4PH8A 3VI3A 4FA6A 2YAQA 3QYCA 1CXZB 1VQ9V 2Y7LA 5HGHB 5L8LB 2WXKA 1H5BB 5L7XH 1JOYA 5T1LA 4LQFL 3CC7V 1P4RA 4U2ZA 2OI9B 4XP1L 4BFNA 5DHVB 2YICA 1FFNB 1QI3A 3NACL 3GXFA 3KPSB 1SBSL 3DC6A 5EN2A 1QEWB 2F5AL 1Q9OB 2YGVA 4HEPA 3GDCA 3S3DB 4KVNH 1BAGA 1BZ7B 4S1DC 5DJ0B 3IRPX 4JPIB 4EXKA 3IJHB 3HMWH 5C08B 4LFCO 5IQ9B 4XNYL 1TZ8A 2IAMB 3PXJA 5IMLB 1U93B 3GPSA 1LO0L 2ED6A 3C6LA 3UBXG 1MWOA 1TETH 1DDTA 1DQKA 3JATA 4LVEA 4M6OL 1VQ8V 4FI8A 4Y4HB 2A3QA 1XF1A 2EEXA 2IWFA 3GI9H 4A55A 4QRSA 1Y66A 2CHZA 2PW1B 4I88A 4GY4A 5E4EB 1S9WA 4PGZA 5KW9H 2AABH 4OFIA 2QSQA 1VCBC 3H1IH 3QUKA 3QXTA 4WHYH 2Y7NA 3QEQA 2GC4C 3G6AB 5F2VO 1Z32X 4JE0A 1Z5LA 4QAMB 4X50A 1N19A 2WO3B 1GA2A 4M6NL 1A0QH 1EK3A 1LE9A 2XTSA 5DUML 3PGCB 2W8CA 4JNXA 3O0RL 5FLXN 3PIQB 1HNZO 2EINB 1T1ZB 3O4LE 4X88A 2CCWA 1HCFX 1S7SA 5E2TH 5I16B 4B53A 3GHBL 1S3KL 1J86A 1H3TA 3CN0A 1J48A 4K94L 5ECGA 4YBHA 4BE6A 1B2YA 4EOWH 4FEMA 4GKZA 1A1MA 2AGJL 3DDGA 4WEBL 2PYEE 2AZUA 2OMNA 5I15H 1MJUL 3QJQB 5D7JD 1C9SA 5IJVB 1ZSPA 3KVPA 3SDXF 2X4TA 3HC4H 2XPGB 5CBEB 1R5IB 3P0YH 4FLQA 1BVKB 3G5YB 3WN5B 3SGEI 4DR7B 2Q4PA 2WUCH 4O4LB 2KLSA 3F7RA 5I26A 5B1JC 4LCWA 2CKBB 4PJAB 1QR1B 5DZOA 1KXTA 1PD6A 2FB4H 1BM3H 3IMBA 4HULB 4RETB 3UAEA 1MA1A 1S9XA 2E9JA 4NKIH 2GW5A 2VN5A 2XUMA 4BWWA 1ZX3A 3HG1D 3II3A 2DMCA 4GAGH 1N7ML 2YPLB 5LBSA 4EN2A 2WBJD 1XEQA 2XN9D 4EDXB 2XZQL 2CBQA 1QSFA 1IGFL 2AV7A 3V0HA 1PV0A 2WOYA 1YMME 4ODUB 5DTFB 4PRIE 1NDGB 1UCBL 4OFYA 2CTPA 1U21A 3KL3A 4JGJA 4PTTB 5IWLC 3QUMA 3RFZB 4L18A 2C7FA 3S34L 1AMYA 5I1AB 3NJGA 2XFXA 2DJMA 4BELD 4KX9A 3FTXA 3RJOA 3HR6A 2EUWA 3UOAB 3DSQA 2CO1A 3D6GA 2H8PB 4KRPC 4UCOA 2L8AA 4BCXA 2I9TB 1DQQA 6FABL 4ODXA 3NCWA 3I6KA 3IFPB 2GFBA 4XO8A 1JRHI 3GBLA 1U95A 2P06A 3VFMA 1MCEA 2OV0A 1MFAH 1S6NA 2JS3A 5JHMA 3DHJA 4N20A 5IJ0A 3Q5OA 2ATPB 1IGIH 1AANA 3VFTA 1OTTD 2F2HA 3CFEA 4HYOA 1U6AH 3DTXB 3SBWA 3UZQA 4L0ZA 2Q7AA 4NSKA 5C0RH 4YSQA 1ACYH 5HHQB 3KGRA 2V3DA 5FW8A 3TL5A 2PO6D 1OE2A 2WGXA 4IOFD 2EDOA 4TQEL 4PI2A 5DK0B 4I7ZC 1D5MA 4M7KH 2J8HA 3VXTB 2LV4A 3EGDB 3CWGA 4IMKA 4YEFA 4JHAL 4YIOA 1KPUB 2FE0A 2AHZA 3FQNB 2GUYA 2R1XA 2Q7NA 4FLVA 5B1AB 1NCWH 3ZKNC 2F5AH 4NAMA 5HVGB 5GRJL 1Q3EA 1H8LA 4FFZH 1XD0A 1MCHA 2YA2A 4URTB 2GBTA 3NCJL 1WD8A 1N6VA 4W9JC 25C8L 2B1AH 4U6VL 3Q2WA 3DECA 5B1NA 3NQKA 1QEWA 1XNQB 2EDDA 3RA7H 4HKXA 4GLRH 2NLJA 4URKA 5CP3A 1CF1A 1VEMA 3QUMB 5LHIA 3MCKB 4B5EA 3BAYA 4HETA 3FFOA 3BGMB 4I50B 3IC9A 4NN7C 2C2AA 3FSVA 1HEJC 3QIBB 2VSMB 5B8CA 3MNVA 4M5SA 4FQLH 5LMUO 2H41A 2NYYC 4N1EA 4FA8A 5C0GA 3MRGA 1XB6A 4WI3A 2MTAA 2R9IA 1L9QA 4TUYA 1NCAH 3D2UB 5F93C 2FBOJ 4Y16D 2VGLM 2LJ2A 5J6GB 4TYUA 1PZUB 1UB5B 4IRJB 3THML 3CJHB 3MHZA 1BCIA 1ZTXE 2MQ3A 3T0VA 5I19L 2HKFL 4M7ZB 4NUQA 4P46D 4WWKB 4TULH 3WXWH 4FTVB 4JFQB 5ID1B 5KW9L 1Z1WA 4YMPA 4WQOA 2E27L 6CGTA 4OLWL 5C3IA 5KS9B 2GJ6B 2JK5C 1IBLB 3IDGA 1URZA 2AXWA 2W0FC 4NPYA 5GGUA 3HKCB 2J21A 1BVNT 1YQ2A 2B08A 5C07B 2R9RB 1WAEA 3TC9A 4TXVB 4BH7A 4FLOA 3VFSA 5FF6A 5T3XH 3ES6B 5AB9A 4F4LA 5BRZD 3FQRA 3N2JA 1BQLH 1AGBB 5CINL 5F1SA 3JAMN 2E8YA 4ALAH 1J10A 1KLUA 3DJ9A 4OV5B 3QUYD 1K5NA 2B9AA 5ECJE 2XVBA 3CSTA 3FQRB 4OLYH 2NMSA 3MFFA 2J57A 4FQ2L 4CC1A 1IQDA 2HJFC 4H0GA 5DHEA 3G6DL 3MODH 4AI8A 4X4MA 4ZX6A 4JAUA 1VACB 4HD9A 1XWVA 4RX4D 1SJHA 4D2NA 4FHBD 3DX8A 1NCHA 3HRZB 4Q9BA 4TOIA 5E6IA 5AVRB 5SWSD 4OD1H 3A5VA 4X5LA 1A14L 2MSPA 2VQ1B 5JOPE 4UQAA 1B0RA 1HHJA 2GHWB 1P7GA 2ITCB 3OR6A 1ZLUH 2YPLA 1LGVA 1TQVA 2OIGA 3J7HA 3MOAH 3O4OB 4WWKA 1CLYH 4OPAA 5KAQG 1V7NH 3F5WC 4PV8A 4OJFL 3PHQB 4HUUA 1MCIA 1V3MA 2D9CA 2WXQA 3ARBD 2BC4A 3GBML 2ADQB 3LSOB 4L3EE 1RH8A 2R69L 5D7KE 3IRZA 1RZ8B 2XVLA 4Y2DD 2Z1KA 4JI1B 4JPQA 5I1HH 3SDCA 2EIKC 3HNSH 2XASA 3R18A 4PS3A 4LFHD 4W4NA 5CZXC 3LN4B 2C1OA 3CYOA 4G7YH 3DX2A 1MFDH 1BV8A 4WO4A 1ZTXH 1MSPA 4WEEA 5DI8A 1XOUA 2GV9A 2FO4B 5BW7A 2WZ5A 4ONOA 1Q9KA 3WUWA 5KX5A 3GEWB 2ITCC 4GJTB 1R3HB 3VJ6A 3DDFA 5JORA 1WFNA 1CGSL 2F7OA 5E1GA 1ANUA 2D2OA 3QBTB 1SRYA 2K1EA 4NWTH 4U05A 3KWVA 2NUTA 3K0WA 3NXSA 5D5PA 1PCXA 4OX9B 4ONHA 1WAAA 3H1JH 4DV2B 1BBJB 4PJ9B 3P3NA 4G7QB 4FG0A 4UIMB 4NX0A 3VGFA 3MRQA 2E76B 1SEBA 4Y2DC 1YNTF 4TV3A 5IUSA 3AG2B 1T89A 5DO2D 5HYSB 4PRNB 3WYRA 3CE2A 3E1ZA 5IHBA 4KNUA 5C0BD 3NN8B 4HH9B 4HP5A 3OAYK 4F9PA 3FCSB 3L8QA 3K2MC 1M2VA 1TG8A 3PWUA 1AJ7H 3NOIA 4WI5A 4X42A 2F1MA 4P57B 4HPOH 4YC2C 4DV3B 1GS7A 3PAZA 4NNPL 4P23B 5CJQL 1IO4C 3FO1B 4RSVA 5DZJA 4ABQA 2UWEE 2DY2A 2LVCA 4Z7OB 1SZNA 1P69B 4FGMA 5E8NA 2UZXB 2YRZA 2X1XR 3AUVA 5DD1L 4OI8A 4H13B 3VRIA 1QFWM 3V9EA 1BMZA 1Y6NR 5I82A 1UKSA 1FIGH 4WBNB 1MG3C 4EOWL 1JMXA 2EDRA 2ESVD 5TFSL 1KNOA 4JDTL 3ZMSA 3SE6A 3WMSA 2EICA 1S9YA 2F68X 4I0KA 4JFDB 4K5MA 4AEEA 4LNUB 1IJ9A 1B4RA 1GZHC 1EJFA 4PWFA 3RX9A 4MTFA 1KTJA 1YEJH 5F89A 2IW5A 4Z78B 3QH3A 4LXFA 1GYAA 2CHDA 5I0VA 3F8UB 2CH7B 2CK3G 3QPXH 2OXHA 4HGMA 4LSQL 2HYMA 4XI5C 5F7WC 2Q6WB 4JM2B 1CQKA 2F74B 1FV1A 3ZMUA 5TDNA 3FTYA 3ZK0A 4AUYA 2CH7A 1NBVH 4CZZA 3FRPB 1DVFD 3HZVA 4XPFH 2JCWA 3UC2A 2X4OB 1UKQA 5SWQA 4UDUA 3FAWA 4EI5D 3WHXB 2H26A 4ZQKA 5DFVC 3BD4A 4PCTA 1A6ZB 2DOSA 4IBUA 3KYAA 3LH2H 4GG8B 4LKCA 3BSZL 4OZ4A 4NI3A 4Y1AA 4RA0C 3CSGA 5G4MA 1M7UA 2WMPA 4MT8A 3OTOO 1WCBB 1CLZL 3WUWG 2BCCH 5CBFA 3HBGA 3HE7C 4P2OC 5KVGE 2VLRE 3Q1EA 4PREB 2NNUA 3LIZL 1AQKH 3E6HB 5KSAD 4KOCA 1NCNA 3EJSA 5FUOL 3SQOH 2VDNL 3F12B 2TAAA 4K9EH 2NY1D 1NVPB 5MERA 2AC0A 5J2UA 7TAAA 3VM7A 5IFHH 4YDKH 2P22C 1V3LA 4X98B 2B5IC 2Z1PA 1NH2D 2EVJA 1XR9B 1R3JC 2XV0A 2YOCA 1K8DA 2BPBA 2CA4A 2F8VA 1CG9B 4PQXA 4Z7VB 2XKUA 4NQEE 2GSMB 2NQ3A 4KKCD 4YHYC 3CRQA 4XCFH 4J3OH 4HC1H 3D85B 1AMXA 4WVRA 1NC4D 2TRHA 1JHLL 1BAFH 1TVHA 4LU5H 4PRPA 4K3GA 5A3ID 3VI3E 5L2KA 3T0EA 5JHLA 1ENVA 2YKLH 5KHGA 3HRPA 1J0JA 1TNNA 2QFRA 2FJGA 2A9NL 4PG2A 2OSWA 5JW5B 1OPGL 2OI9C 1F2XK 1V27A 5AW2B 2Y6SC 2YD1A 1EEUA 3L45A 2VR6A 4EDXA 3HC2A 2EDKA 1UWEL 3VI4E 1OTTC 2MMXA 5A2AA 1FYTB 4M48L 3QUML 5EWIH 2CK0H 5JNYA 3V6FA 3UPCA 5MEPA 1J1XL 1AACA 2FD6L 1UB6B 2FWOB 4DTGH 4F9LC 2OZ4A 2GTQA 3H4HA 1SN0A 5DLML 2KH2B 3LPPA 4X8JB 5C0BE 4QHPA 3P3YA 2M1KA 3SGKC 3V5DA 3ZY7A 3N43F 3NCYS 2AJSH 4JKLA 4R4NC 4GCZA 1TU2A 2NZIA 3HC3H 2CHWA 4R7LA 3H54A 3OUFA 1EERB 3MUHL 1T6VN 2X42A 2ZOLA 4AW7A 3DGEA 5E70A 5FM8A 5BW7C 3Q3GA 1UA6L 4FHKA 2E76C 3RQ3A 1EN4A 4FA7B 1B88A 1M05B 3OXRB 5E95B 1HN1A 1I8UA 2XWTA 3IE9A 3US0A 2BP0B 3E6FB 5D4QA 1EO7A 3VGAC 4IGBD 1UQSA 5BS0B 4ANWA 4NKOA 5BVPH 2WLLB 1UH4A 2OR8A 3S2AA 1MCPL 4IQHA 5GGTL 4RUEA 4JI3O 3W7TA 3VXPB 3IFLH 1QLEB 4R96B 4XXWC 1TZHB 5FUCC 2BW4A 3FOMA 3OSKA 2WLLA 4O4YH 1YDXA 1JCVA 2HKHH 1PZDA 4KJYA 1YJNV 3ZHUA 2IJKA 3OM3B 5MEPB 2HAZA 1DJZA 1FE8H 1PP9H 3GI8L 4DGIH 2ESVA 5ABDE 2JF1A 5T3ZL 5CD3A 1CMOA 1RK7A 3HZ3A 5E6IC 2CBPA 2YIHA 4J23A 1K5WA 1D7DA 5F0JB 1LMKA 3KXFE 1SEQL 3B9KC 3IPBA 1TUEB 1RP8A 2VLJA 1WZMA 4FM0A 4M4PA 5IMMA 5K59E 1CLVA 2YMXL 5E2VH 3V0VB 2WAHA 2EIMC 2Y6TE 3MJ7A 2XQBH 3V4VA 1FHGA 3VCLB 4OVUA 2KSDA 1Z9PA 2G9HA 2CIKA 2W80C 5IB2B 4HUUB 3BUDA 5LGKA 4HBNA 3V6BR 2N01B 2OTPA 4UB6Z 3FULA 1CT8B 3CC5B 3DX9A 7CGTA 4DAGL 4UAOB 3WTUA 2ZCZA 1RVFL 1OF0A 2X7RB 2Y0SA 5IG7B 2QR0A 3G5VB 3ASOB 1SF5A 2JCCB 3CXDH 2YC1A 3PQYB 5D2LE 5EIIG 1NH2B 5IK3B 1XILA 2M6YA 4NP4H 2A6JB 4QWWC 2ZINA 1T1WA 3EOBB 4Q4EA 1FXVA 3HE6B 3IAPA 4FKEA 4FMTA 5SV3A 4TNFA 1D5IL 1A6AB 1KUMA 4GXUM 3I6GB 3GMNA 4S1DD 2L3BA 4ZFGL 3WGUB 1NZRA 4KKAC 4U1MB 4XN7A 4BRVA 1UD5A 4L8JA 1GW6A 1WCBA 3DX7B 2DV6A 5IW1A 1J88A 1VF7A 4X4ZA 2Y7QA 1W6WA 1MDAA 2FD6H 4G8FA 2H3OA 4JV5O 1TCRB 3NGBC 4OFYD 1WG3A 3UBHA 3V0VA 4DN3H 1JF6A 1LNUA 5ACZB 1ZGLM 1I4FB 3HIZA 5SV4A 5CP7A 2WTRB 3FB6A 1BSMA 4A04A 1T66D 4UQCA 1BEXA 2B20A 2CIKB 1MW0A 1PX8A 1QASA 2B3IA 4OJEH 1T7YA 2PTUA 4IBLT 4QXTA 1FYTD 5J89A 5KSBF 2W1NA 5JO5B 3IGKA 1OP5K 2MCG1 2DWDB 4JKPH 2ZSWA 2VDML 4O4HB 2F61A 1LO4L 1MNUH 4YFLI 4KPHL 3C2SA 3D3VA 4XAKD 1OP3K 1O6TA 3MBXL 4TLKA 3ABKB 3TYGH 5LCVH 4P23A 2XG4B 3BC9A 4UMSA 3ZR6A 3VQWA 4PDVA 2WVSA 2FJHB 2C3GA 4EFEA 4RFOL 2N0KA 4XXDB 4X4XA 1PDKB 5I76A 2ZDIA 2IGTA 5JQIB 5M95B 4YIQA 2CDEB 1CF8H 4ZMVA 5TH2A 4FZ8H 2H2SC 1WTGT 4JPWH 1V05A 4LDLB 5C86A 4L8SB 2N74A 2QGCA 5T1LD 3TN0B 5GTIZ 1MFNA 4A67A 4WBNA 2WVTA 1XVSA 3NJHA 4XMPL 2R0WH 1OCCC 3MCLH 3MRHB 4HG4K 4MZ3A 5KYXB 1I8MB 3CH8A 1KCRH 4HIEB 1DBBH 4ZNCD 2NXZB 2YN3A 3BAKA 1OVZA 3EJQA 4DP8X 5L3DA 5B1AC 1XTMA 1J87A 1JWUB 2BWQA 5CU9A 2CHNA 1MNNA 3ILEA 3V4VL 4CBCA 1LILA 3GIZL 3KJ6H 3QEQD 3EGXA 1DR9A 3NSXA 1Q9LA 5KHKA 4Y5VC 5DD6A 5FYLE 4AL8L 5GS0H 2JIZG 3TFKD 1GZQB 3WFBL 2IO5A 1V5JA 2OQJA 3DOSB 1HCVA 4JO4L 5DJ2B 5LBSL 1B2WH 2QGDA 3A67H 3X1EA 3T77A 4C4KO 2GEQA 4DOHB 1Q7YW 4L3EB 4DR5B 3MN8A 1JPTL 3RJQB 2VL5A 4O4JB 3MLSH 2D0GA 4DFHA 1AZUA 1XMEB 3C90A 1UASA 4MTMA 4GUNA 1BP3B 1JZDC 3V5KB 3OKMA 4DAGH 2H3NA 5IWLA 5AVTB 4H8WH 1XZ0B 1PKQE 2B59A 5KYXA 3M1BA 4QJ3B 2GUZB 1I8MA 3S8GB 1T7WA 2UU9O 5EOTB 3ROOB 1LE5A 4N2EA 4GP4B 2R29A 3OF6A 4XX1G 3O3DB 3SODB 3IS1X 1P5VB 4HIIB 1X4ZA 2BY0A 1I8IB 2Y48A 2J8OA 3RW0A 3D8CA 1U41A 2V2XA 4Z5RB 3BSZA 1GGYA 3QJTB 1KCVH 5BOJA 4LBEC 2FK9A 4NHUB 2BP8B 4OCSL 2R2EB 1BX2A 2C3WA 3EFDL 3G67A 5JPNB 1THZA 3P3UA 2XG5B 3QEHB 5FUCE 3QFJA 3X3FH 1FZJA 3II1A 3QCUL 4QHUA 4FXKC 4U0QB 5ANME 5HDQL 4OI9A 2XYBA 3MV8A 5A9GA 2EDFA 1JGEB 3VG0H 3ZIYA 2YPLE 3UCRA 1XMQB 4PDRA 1A7RL 3DROB 3ISYA 2XX0A 1H2LA 1KMGA 2ZG2A 3MJ9L 3GJEB 3LX9A 2AXFA 1WBZB 2XQYG 1XZ0A 4Q6IB 3BP7B 3MREA 5HGAA 5JVDB 4RDQG 1GN4A 1J8HB 4B95C 4CADB 3MLZH 5AKVA 1YAZA 3ICXA 5AFAA 3K2KA 1U58B 1K4DC 3C6LB 4N5UA 2AHIA 2J1WA 1TFPA 4OGXH 4X6FA 3SGJA 3T6QC 4EI6A 1OY3B 1AR1D 3QK0A 4JMNA 5DD3H 5I1DB 1V10A 2BSEA 1T7VA 4OFDA 1IVTA 4BDVB 3L4ZA 3CFCL 1G87A 2X10A 3G9VA 3WY3A 4NP4L 5DK3A 3BJ91 2OTWB 5IB5B 4GW4A 3C8DA 4AGQA 1TEYA 3JUYA 2VXUL 4RGOH 5DFAA 2WSKA 3NIFB 4DN4L 3RBSA 1QYGH 4KHTH 4R7VA 5INDB 2X7LA 1EDYA 3W57A 3R7QA 4BH8B 3AS2A 5AW5B 3SSGA 4C4UA 3ARED 3GHEH 1PL4A 4QT5A 3V52L 5C0FB 1DQJB 2OW6A 1UOVA 2K45A 1XF4A 5K39B 1DJGA 4O4JA 5T3ZD 4BFBD 1LP9A 3GNMH 4O58L 3O6FB 1ZIAA 1RHHB 1VRSA 4MZ2A 3IAYA 1GGBH 1UZ6F 4TV8A 1DP0A 2JKXA 4OUUB 4U6XA 3S34H 3ELQA 2HG5A 2APFA 4WTXA 4BV1A 3APDA 4DP9X 1U8CA 5E4AA 2BVEA 3PWUB 1VGKB 4BQ8A 1T03L 5CD3B 2FJHA 1ZANH 3QVAA 4PJEF 1NCDH 3CC4V 2HKFH 3WXWL 3AXIA 1RZ7H 3PXHA 4XCEA 1JNLL 3RZCB 5IB3A 3PDGA 3VD3A 2J44A 3GFUA 3ATEA 4V1DE 4OF5A 4HS6A 4C83B 5EYPA 3L3IA 1I1YB 3HG1B 3DTUB 2XNDG 4JPWL 1H2KA 4FQ1L 1OT1A 1F18A 3DO7A 5D7JA 2P49B 1CZ8H 3WB1A 5FO8B 1MJ8L 4KQ4L 4NNXB 4X9HA 2IWGA 2BX5A 1LL1A 4DVRL 1U8IB 2NY5C 4FFWD 4BXVA 1DLHB 4OLWH 1EJ6A 2H1XA 1JXFA 1R33A 2L0DA 3KPSE 4DH2A 4O5LH 2WBKA 1R3LC 1R3HA 4YUEL 4ESKA 2IWKA 3FT0A 2YD6A 4XNMA 4EQ3A 2QV2A 4JY6B 3VRLE 2D03H 4Z76A 5IT2L 4JFPA 3ETSA 5CWSB 2VLJE 1NL0L 2Y1AA 5ICXA 4ZO6A 3LQZA 5LAXA 2OYQA 1NCJA 1YEEL 4AQ1C 1JN6A 3WSQH 4C4KT 3E8HA 3RTQD 1N5YH 1LEKA 3UTSB 1KYUA 1AVMA 5JUEL 3UX9B 1KENH 4WFED 5D2NB 1XH0A 4ADJA 1M3JA 4WW2A 3NRQA 1NCBH 2I9LB 2A99A 3SPJA 2DIBA 3DTXA 3IETB 2XNAB 4WO4C 5KVFH 4YO0B 2EUXA 3C08H 3BE1H 3F7VC 4WSGA 2DL2A 2IBZY 3RKDC 4MASA 5JMRA 4JAVA 4MJIA 1QZ1A 2P6JA 3P40A 4LKXB 3V0DA 2JDIG 2ICWA 3DVFA 1QRNB 3KL0A 4LF5O 4HKJB 4BIOA 2WXLA 1R5IA 3N40F 4PPTA 2BZDA 1NMAH 1QSED 2ZCHL 3ES6A 4PWKA 2HWZL 1QRNA 4QR7A 5IR1B 4BR6A 3H1KH 2FMLA 3T4ZA 4MD4A 1A6UH 1A9EA 1NAMB 1K5NB 2HLFD 3F6IA 4V1DA 1UWXH 3N2GB 2C5DC 2OYMA 4K7FA 4UTAH 2ZQMA 1WBYA 1E9PA 4ELDA 1YCSA 4GG6B 4BQCA 3IB4A 3WNPA 3APFA 1A9BA 3ARFB 4PGBB 4PB9L 2VE6A 3MBEC 2CIIA 2KPNA 1YPZB 1UT2A 5FFOA 4YHLL 2CNZA 5LGNA 2ZR2A 5C8JA 4QRSB 2JXMA 3CDYA 3RYMA 5EU6E 1VIBA 1S9WB 4IRSD 1IE5A 2V9QA 5J8OA 2DTSA 2A9CA 4IDLA 4MMXB 3O0LA 4ERSL 5SWQB 4OD2A 4CW1A 4M03A 2WA4A 5E8EB 1OZUA 3QDJB 3LQAH 1LHZA 1U3JA 2G2NA 3B83A 4K5LA 2OQJB 2B1HH 1L5GB 4HK3J 2DI7A 5DWPA 1MSWD 1ETB1 3A4DA 4XE0A 4P06A 3K91A 3WNKA 1X44A 3L5WA 2BM3A 4G8GD 2VMEA 3LDCA 1O9ZA 3ARSA 1JYNA 1QUNB 5CZVH 3QJFA 5ITZB 3ZRWB 3NRFA 4KRMB 2RCSH 5DRWA 3MA9L 3NTCL 3QCTH 4N0FA 1P4LB 2EVFA 1WSST 5H6RA 3G7TA 4AJWA 4OBSA 2X05A 3B9KB 5C07D 1H9VA 2AJ3A 2RQ6A 4HPYL 1Q90D 2F66C 2DLIA 5IJ9B 1MWAH 4PGEB 3UAJC 4HH8A 4XCNB 1NTMH 3WFVA 4IRZA 4BK5C 1GM8A 1TCMA 1TDQA 1KIRB 1KCKA 3D39E 3OZKA 4GW1A 4OCLC 4FI7A 4WWNA 5TK2A 3PN1A 3ZE1F 4B0MB 3M7OA 1QVFU 2VZUA 5F3BA 5F9OH 5B5EZ 3RIAK 5CBHA 2VW6A 2EDHA 5E99L 1XH1A 1XIWD 1CFBA 2ESVE 4UCRA 3ZDZB 1XR8A 5GZNA 4Z7UF 3BKYH 4OCRL 4XCEB 3MX0B 3ZTDC 2CBMA 2VDMB 4TNWK 4Q0XL 2BY2A 1HX0A 5K9KB 3E1F1 4UQ2B 3V6OA 5IV2A 3NCEB 3AGVA 2P5WE 1NMCC 2VRZA 2YD9A 3QZOA 2ZCKH 4YHOL 3DV4B 3WEXA 5J1TC 1GOHA 4GX2A 2A77H 1YNKL 5EIIB 3O2WL 2O57A 4MA7L 3ZQ9A 4PB9H 2F54D 3H53A 3LS5L 2J55A 4PJIE 5D7IA 4NR1A 3UJIL 3BSZH 2XIBA 1FZMB 4JQXC 4DR6O 2HVJA 2HRPH 5IB1A 1N18A 1IFHL 2H8PA 3A4EA 4MAYA 3M17B 4Y19B 5FPOA 1KCRL 2F54E 1WITA 3CVBA 3RWGB 5ABZA 4JS7A 3G04B 1G9EA 5CEYA 1EFQA 1U58A 4CS2A 5GGTA 1QRND 4O4IA 3MJWA 5FHBL 4WCYH 1A2YB 3LEXB 2QMKA 3UTPE 1A3LL 3HAEA 2VUOA 4F3FB 2VDNH 2Y4TA 1CXKA 3OF6D 3BH9B 3FUKA 1GJIA 3FL7A 5C0DB 1WWBX 4O4IB 3I2CH 2GK2A 2ITFA 2QVTA 3FN9A 4UV7H 4XNDA 3UBFA 1B9ZA 5IB5A 4TUJB 1KLGA 4C56A 1S9VA 2BO0A 3UP6A 2RQEA 4UAHA 3I9AA 4WJKB 2VRAA 3NR7A 3QG6A 2E7BA 3OJDB 3DYOA 4UB0H 4LK4A 1WFUA 2UY6B 1I9IH 1AR1C 5IIEA 2EYTA 4DK3A 1NFIA 4GQPH 4XNYH 5AW9B 2JJSC 4MDIB 2M26A 3N1MC 5EIIA 1SN2A 3MRJB 1G7MA 3OD4A 1Q38A 5JUEH 3VXNA 3FB6B 1M56C 2VJ0A 3QXWA 5H37G 4KROD 1XF3B 2E5LO 4UQ3A 3WIHH 3QRFM 2EUZA 5GONA 5C0BB 4S1QH 1IM9D 1MLCA 1R3IC 1W59A 3APQA 1F4XL 1J5DA 3DHPA 3CMEV 3QORA 5GSRB 4QRAA 4B9FA 5KOVC 4ENZA 1FIEA 1PNDA 5JXED 3KGSA 1MVUB 1ZLWK 1FBIL 2VCOA 4BZ1L 1E5ZA 1SDAB 3LKRB 3UTPD 4JFOB 2NQCA 2IV9A 1ZPUA 1MXDA 4N0CD 3MRBB 3T1YB 2NSQA 4MD5B 3GSOB 1IMHC 4P4KD 3EF4A 1IX2A 2QTOA 5JPNA 1OD7A 5EU4B 3CX5F 1F56A 3US1A 2WB7A 4J1UB 5EF1A 3OZLA 5T8IA 3VWKA 5EF2A 3GSVB 5DEZA 2VWJA 1KV3A 4ZMOA 1I5XA 2AJZB 5CKAA 5EZIL 3V9FA 4B3SO 2GVYA 1TZOA 5AKSA 1ZVSA 1E5CA 2YI8A 4WFGA 1X4YA 4X4ME 4AYFA 1UYWH 5K93A 4PV9A 1OW0C 1DHKA 3BZDA 5TGBB 2ALAA 3VW3L 4CH4A 4JL2A 4JZGA 1J8RA 1SHWA 2LQRA 2YOAA 4F7TA 5LLIC 3P77A 35C8H 3ZKQD 2ZCEA 2B4CL 2KYIA 2ZR3A 1MCKA 5ANMB 4F7PA 3U4EB 5TQ2L 2OP4H 4NQED 2B39A 2CO4A 4HNAA 3D08A 1FXHA 3L6FB 2MNJB 4YDVB 4ZS6C 1PZ3A 1AI4A 1QX1A 1UM4L 2APXA 2OSYA 2D7OA 2EXTA 1KGJA 1OPOA 1TO4A 2FHBA 1RI8A 3L6FA 3T3MB 2HFEA 3GKWH 4RMRA 2H1PH 2NPLX 4HX1A 3WN6A 5LGTA 1OGAB 1IQWH 2CLVB 2WTRA 4G5AA 5MHSD 4LSVH 3CJJA 2AQSA 1C1EH 2MOVA 2JQMA 5F7YC 4JQIA 5EIVA 2V7NA 5FHBH 1NPUA 4ZUSA 2DLFL 4HIHA 1S7UB 4GW5A 4TOYL 43CAA 3GSUA 4AOFA 1RMFH 4NHCH 5F7EH 4JF3A 4FX5A 4Y2NA 2AZ2A 4LFAO 1SQQH 2KUTA 3H2PA 4OUOA 4KZDH 5KYUB 4KKLD 1SFHA 3GJFA 5DA0B 3GSNL 3ZDXF 4HUXA 3AG7A 3WJMB 5DHYB 2NY1B 3AWGA 5C07E 2ETNA 3QAQA 5IHZB 3T1FB 4X98A 3DTDA 5B1CA 4XODA 3QNYB 1A1OA 5I66B 1PNKA 2PXYB 4BK5A 2DMKA 4OV6F 1JK9A 2J43A 3AQXA 1Z3GL 4DP5X 2N7AA 2EINC 4F7CA 1R3KC 4QO1B 3ZIMA 3EOTH 1UOWA 3MSPA 4PHXA 1BVOA 4MMZC 3ZN0A 4FXKB 1NBYA 1A4JB 2HKAA 2YS8A 1I8LC 4E0RB 3WIFB 1IEHA 1MFVA 4ZMNA 2NR6C 4S11A 1BQHA 3KPSA 4FZ0A 5HP5A 4Q9QH 1AZVA 4UYPA 2Z93A 5LG6A 1U8PA 3MNZA 2QQKH 1BPLB 5LHGA 4ODHH 4LCIH 4X6CB 4WWKC 5GRUL 1K9MW 1HNZB 4MHHG 2FR4A 4RQFA 2DEXX 3RIFK 5L3FA 4FJ6A 1IZJA 1I53A 3JT0A 3QQ3A 3K74B 4C58B 3LN5A 4ZI7A 5E9NA 4GKKB 2XRAL 4N90E 2EKSA 3LHPH 1NGXB 1TSHA 3B2PA 5DR5H 4X4YB 3OBAA 3DX9B 4FD0A 4H1LA 4WUKH 2X4OA 4MKTA 3SGEH 4B5ZA 3KZ8A 4LGPB 1C5CL 4LPWA 3JSLA 2WNGA 4LFBB 1FJ1A 1YG9A 2EZ0D 3MRGB 4NXKA 3S98A 1JTTA 4H1LB 4M5ZH 2XI9A 1KB5H 1AKJB 1XGPB 5D55A 4MJ6A 1A7PL 2C4XA 1E43A 2UXCO 4R7CA 2BVPA 2GCYA 2X4UB 4NQDA 5BQDA 4DF9A 3LHAA 2JFCA 3QO7A 3HZMA 2X2UA 4RQQB 3R8QA 5TF0A 4JG0H 3L3HA 1WA2X 3ULVC 4DUYO 4TUKH 1P4LA 2IH3C 5BS0D 3E6HA 4U1GB 1U8PB 5J13B 4X66O 1BDYA 2X89A 2LU7A 2WQUA 3EJJX 4QHNB 4HISA 5DZLA 3IDXL 4Y4KC 2AF2A 3ZT7A 4D7TA 1MIEH 3KJ4B 2V7HA 5F0PB 4QO1A 4NQQA 1KOAA 1BVKA 1JMZA 1JPSL 2X70A 4Y1AD 4X9IA 5FYJE 5I6OA 3WIAA 4ZKIA 5AOKA 4PJ8B 2WKOF 1E4XH 2H1LM 2WYHA 5DVMA 5BO0D 3QNYA 1ZSDB 4M1CD 5I66A 2FEJA 1DLBA 4XBPA 4ONFL 1KTCA 4DV1B 2HWZH 3WD5L 4D0CB 5D7LD 3LNGA 3SDXB 1Z2GA 1OLZA 2I7OA 4IU3A 3JTTA 2YRBA 1VQ7V 3TEXA 3WEBA 1A9BB 4KI5C 1HIML 1VGEL 4JG5A 2K9UA 2IPTL 4J9ZB 3RYCB 4JO2H 3B8NA 3WTSA 4XMKH 1R3LA 3HKEB 3JD1A 4ZXBC 2ZXDA 4ZUWB 4APQC 1YAIA 2B2XH 4PJ5D 2ZT9C 3VFPB 3WG7B 3K6OA 4V11A 4HJJL 4IHJA 3O3BA 3MRKA 4GQ9L 4FI6A 3IJYB 4RCAA 3DYPA 5LQBH 1NEZG 1F45A 3VXUB 2FO4A 1RZKC 3HR0A 2VQUA 4J3OC 1TKWA 4AG4L 4Z7NF 1K8IA 2N59A 1A7RH 1JR9A 5LBQA 4JZOB 1AIFA 4TVPL 2XY1A 4XP9H 3D36A 1ADQH 3JWOH 5IOPB 1I3GL 2FL5B 2HVKB 2PABA 4TT3G 1L1FA 1II4E 1JPEA 1U8NB 4RFNC 4WTZA 1JBJA 1ETZB 3BRCA 4HKZA 5KA5A 3SQBB 1XCTB 2JELL 4QD2E 4JANB 3CZUB 4EI5A 3ETBF 5DC2A 4TSBH 2V33A 2YD7A 3M6DA 3JV4B 3A0HZ 3QAZB 2GQHA 4FLZA 2BS9A 3U46A 2BMKA 2IPKB 4YAQA 5J3HC 4PBDA 4YSDA 1H6FA 1AJNA 3FO0L 3ECQA 3MMEA 4L9LB 4DV4O 1SMAA 1R1CA 2QQLL 5HYJA 1FFPB 3SDYH 1IGCH 3DXAD 2DYSC 1KJ3H 1TQSA 4MXQC 5EA0H 4LF5B 5GHWH 3N85H 3QHFL 1PMYA 1FORH 2VXVH 3VWJB 5HXMA 1NUGA 25C8H 2VT0A 2EIMB 5C7XL 4LPYA 5L4JA 3UZEA 5CJBA 4KJWC 3FUIA 1MQKH 3K5NA 1BF8A 2J5LB 2YO3A 3STZB 4IJ3B 3VH8A 1TJHL 1ICTA 3IRCA 2VDOB 4G7YL 2Z93B 4QXUH 4XOAA 5DRXA 2XA8H 4OZGB 4UTAA 4R3SB 2F53A 1AD0A 2HT4D 3M88A 4FQJL 5EPMB 3TJPA 3L3GA 3B3BA 3MOBL 4NDMA 1M9NA 1X5ZA 5CA3A 1YEFH 4OAWA 5BMVA 3E22B 5DZNA 3AADB 2ZKXA 4X64O 2VLJD 3C6SB 4P9HC 5IMKA 3VNYA 3ULSB 4ATTA 3GI9L 1CYWA 5CIPH 3HE7D 3O6LL 4U1SB 4A2DA 3MBED 2CM5A 4M1GH 3DOSA 4PS4H 4DZ8B 4JREC 5DFWH 3QIWA 5KTEL 4QRUB 1G5AA 2LU3A 3BAJA 5TDNB 3STZC 1F58L 2J5LC 4HWBA 3CVHA 3N1QC 1TVDA 1QFUH 4TUKL 2ICWI 2Y5EA 1F2QA 3MODL 4UZGA 5DUMH 5EUOA 5F3FA 2OJEA 5H2BB 2XOTA 4HJTA 3BDYH 4GBXA 2NN4A 3WKPA 3FOMB 1S8DA 5DMGD 1SYVA 1H19A 2V7NB 2UXGA 4P4KA 1HSBB 4DV0O 1TJIH 3PPEA 5DXWA 2K7QA 2AJVL 3O45B 1HU8A 1OCOC 3ARGB 1LO5A 5F0MB 3PAVA 1I7RA 1X6NA 4G59C 3H01A 2J20A 4UOQA 3HB3D 2KLRA 4PMFA 2NLJB 5FEBA 2B14A 5JHLL 3AT0A 3JD2A 2X3BA 5ICZA 1D5MB 4WO4D 3OKNA 1Y07A 3V0JA 1DQLH 2NSMA 1NL0H 4LEOB 3FFCB 3QF7A 2YD4A 5EOCJ 5I1JH 2BJMH 1KGIA 2NUPA 2W6JG 2XTLA 5I8EA 1KIPA 1TLMA 5H5NA 4U6XB 3MOQA 5TE4H 3LQAC 4RVBA 5K59F 1K4CA 1IRAY 2H7WA 3B2VL 3GZOA 2H0FA 3FO1A 5AG8A 1BZ7A 3MV7A 1WAZA 5IJCC 2JJ2G 2ZIDA 4ZTPH 1QFWH 4P5SA 5GISH 3DA0A 5I74C 3FU7A 5FX3A 3ETDA 2XTJD 5AKRA 4L1BA 2WAQA 3RX8A 5FO9B 4ODWA 3ZVVA 5D9SB 1D5IH 2DWEA 2VXQL 1X7QB 2VLKB 3ECUA 3FZUC 5BO1L 1LEGA 1LO5B 2CRYA 3K6DA 3OD3A 1UFGA 4PJGE 4OM0H 3H9SA 1KC5H 1UVQA 5EU7C 2JKNA 5I6PA 5AVZB 4GSRA 1LQSR 4HJIA 4ICGA 1QVOA 4PJFA 4ABUA 3LIUA 4JB9H 1NCCH 3UEQA 4MVRA 4XMKL 4L8DB 1Q9KB 4PJEA 4OGAD 4NXSA 3KLLA 4GLXA 2FWOA 1LVEA 1TJGH 5GSVA 3LZNA 1BBDH 4Q9QL 5IT9N 1G7QB 1PYWB 3C3TA 3HUJE 1AJQA 2CR0A 2XJKA 5DRNB 3MCYA 4F7KA 6TAAA 2IQAA 1QBMH 3CDGA 4NKMB 2AK4B 2BSBA 2DMBA 2VDLB 4LF3A 3CUPA 1QCEA 5I18H 4JFFA 4YZWA 1H3XA 4JANA 5F21B 5C0RL 5EU6B 4Z7NE 2PO6A 5DJYB 3M1BB 1O9VA 5IIEB 1XMOO 4IS6A 3G5XB 5EFIB 2YKKA 1GKOA 4D8PA 4K8RL 4PRHE 3BZEA 3LSOA 4OCNC 4Z9KB 1EMTH 1KLUB 3RGVD 3STLB 2DLGA 2NW3B 5AYTA 2B0SL 4UOW0 4X5QA 5D1QE 5DGQA 5BVJB 2ROXA 3AM8A 3FTUA 3ENEA 4R2GD 1A7NH 2UUBO 1ZSHA 2NY6B 3PPSA 4NIYE 4PIRF 3HR5A 2BDNL 3IGUA 1HNXO 3H7LA 5J2UB 2HX9A 3NZUA 4JR9H 4M02A 2OMXB 5DS1A 3SDLA 3WE6B 3W0WB 5EEYA 3B8MA 1SMDA 4K3EL 1AKPA 1AHMA 4HKJA 5CUSL 4Z7WE 5IP4A 2YEZA 3CLFL 2P26A 3UYPB 1QLEH 3GKZA 4HIJB 4G27B 1I1YA 2AQRA 2FT7A 3UM7A 3FTSA 5H37A 3M8AA 5TE6L 5BMFL 1XMQO 4PJ0Z 1YEJL 1U3HC 3HFML 3HW7A 3GSRA 1B6QA 1MLBA 1X7QA 4IU3B 2IXQB 5GRVL 5FGCB 2R23A 5FF6B 4P5KB 4NO3B 1AXTH 5D1XC 2OMZA 2A6IA 2J1YA 1N67A 1DZBA 2OM5A 4QAWA 4U6VH 4J80A 3RVUC 3P02A 3FU7B 3TBYB 1S7VB 4N2MA 1L0NH 2DIEA 1Q5OA 3BN3B 1BQZA 2NRDA 4WHYG 5B8CB 3BA9A 4OXSA 1XQ4A 3PU7A 3QIBA 2A9AA 3KPNB 3DV6B 2DWYA 3B56A 2VDMH 3CFUA 3FCUB 3FRPA 1HILB 4JDEA 5DU7A 3SOTA 2QDOA 1CICB 5C0GB 1ZIBA 3OJDA 2UYLA 1CDHA 2TSBA 3L1EA 4LLUB 1E79G 1PX4A 5HJ3B 1G9MH 5E51A 5FV2A 1VF6C 2PI4A 1CFQA 1CFTA 3UDWA 4BGDA 2X7LB 3WEMA 3KWXA 4PP1D 3E8BA 4BGLA 3HHMA 5LGJB 5T5FA 3E3QC 4JHVA 4YC2B 5BJTA 5DA4A 5DRNA 2MOQA 1RZKH 3QULB 1IGIL 2LU4A 1QQDB 1SMOA 5EV7A 1I4FA 1MJ7L 3AMKA 3DXAA 3E8UL 4PSRA 4X7CC 3AJ7A 2Y0IA 4X1KB 1BD2B 4H44C 4PLKC 2JI1A 5HGDB 3T71A 4C57C 2FQGA 3AG4C 2CUIA 4O4YL 2O5ZL 3DX6B 3RIAF 1U8HA 5IEKB 3Q4HA 2NUPB 1HAUA 2R51A 4O02B 3RGVC 4CC4A 2C4FT 2I5YL 2WWKT 3MZGB 4YGVA 5F97E 3A6CL 2DQUH 4JPVH 3FQ2A 2WPGA 4IKLA 3QDGB 4E9SA 3EDEA 5EIBC 1HKFA 1KPUA 4GQZA 2QJDA 1YUKB 5HBBA 2AK4D 2C3HA 3LQMA 3VNZA 2HT2C 1A5FL 2BINA 5B3JF 4FFBB 4MS2A 2R0LL 2PWEA 1ZLZA 3RWFB 2B0SH 3B2DC 1FAFA 1KXQA 2OMZB 4N6QA 5HHMD 2JS5A 3EBHA 4MAUL 2IJJA 2IDFA 4WUUB 2ALWA 3KCWA 4JI0B 4JV5B 5GRZA 3RWJA 3TOPA 5DF0A 1ZJAA 1OOWA 3B34A 5K5YA 3MOAL 1O9WA 2YD2A 4IEFA 4GLRI 4E42A 1M71B 2A9ML 4HHGA 5BZZA 2R23B 4FQCH 2IBZX 3K8KA 4GAAA 4P48A 3SDDB 3VGBA 4ZOAA 2ARJQ 2GDSA 4PJXE 1S5LZ 2VQFO 4YWGH 2NY6D 4FKKA 4JO1L 3S36L 2VDPH 2X1WL 4PGCA 3ULVH 1PZ5B 3O8XB 1KB5B 1K4DA 4I85A 5SWZA 1NGYA 4KZEL 3ZHLA 5IMOA 1PPIA 1A1NA 2YFNA 3PJLA 4Z7QF 3FB8C 1KB3A 4KDVA 2OJEB 5B3NA 4F91B 4JN2B 4CJ1A 2GJZA 5L3EA 4YHZL 4A38A 4UANA 2F5BH 3L73H 2A77L 1JD7A 2BP5M 5DUPH 4YSSA 1BMFG 1NH6A 1BOGB 4L4VD 3KPOA 2ZF8A 2FSEA 2ODMA 3FU6A 4AYDC 4MZIA 2AMGA 3GMLA 4ODUA 4XZUA 1BD2E 3S88H 1JF1B 1X5AA 3V55A 1VZHA 4ANUA 3TCTA 3DLQR 4L1HA 1GTFA 5IJDC 4IBWA 4QNPF 5I1KH 2O5ZH 2VL4A 3EYQD 1NIEA 3HHSB 2Q0OC 5EIQA 3PWVB 3TZVB 4C54A 5EOCH 1G6RA 5D6DC 3NBNA 1NFKA 4DK1A 1KCUH 4FXKA 4WFFA 1A8JH 2XA3A 1ET7A 2PR9A 4MXWL 2BP8A 4YSTA 4C56D 5IMOB 1G7IA 5LXGL 5BV7C 3CBJB 3KCPB 3CFMA 2CGNA 5JJEB 2ZE0A 5GHWL 2WXHA 1CDGA 3ETTA 3GIVA 5DO8A 2WQRA 3AG1C 1BYPA 3SE3A 4N23A 3UO3A 5JHLH 4WO0A 2PN5A 5LBVA 2APBA 3H9ZA 2EJRA 3K46A 3MCLL 4L1DA 5BMFH 3AY4A 2IGFL 3ML9A 4N5ED 2AQ2A 3GWKC 2G5BB 4PP2B 4HMEA 4RESB 3VWKB 2E59A 3NJMA 2PCXA 4KL1A 4M62L 1QRKA 3NCJH 1I1AD 1IKFL 1BD2D 3SE9L 3CDCA 4QTHA 1V3JA 4PP2A 3L4UA 1RIUL 1G1OA 4ELME 4O2BB 1MFDL 3HLKA 1NUNB 4TUYB 4F6RB 1I1FB 2G4EA 2QLVB 5JORB 5H4ZA 1IAIL 4G6AC 4H26B 2R15A 5E7BA 1DFXA 2FH6A 3BZFA 2D3LA 3UPRB 4JFED 4PCSA 1XT5A 3ZE2B 4B50A 1N8RW 3VFPA 1A3QA 2QTEA 4R5XA 5D1XE 3AGWA 1VFAB 2HPOA 2Y23A 2A7BA 4M1GL 3PQYE 5D4JA 3WKMH 1NFDA 2WXFA 4I55B 3W9DB 2V7QG 1S7WA 1F3RB 1RJCA 2IPUG 1VQLV 2BNQE 3GB7A 4OJAA 3E83A 4DR2B 1NPJA 3BI9X 4PRBB 4P9PA 3D3IA 4ZFOB 3WB0A 4WUUD 1A7QL 1EFRG 1C08A 5C09E 1SYVB 3LRHA 2EDYA 3VGDA 3HKZA 3HI6H 3QAZC 5LOVA 5J7CC 3PYCA 3ARGA 1JTPA 4PJ7A 1A8ZA 2IALA 1X5GA 3KPOB 3B7UX 3P4MA 1EGJH 2WCSA 2NTFB 4HT1H 4JKMA 2Q7EA 2J56A 3HMXH 4O2EA 1HDMA 3HCVA 5JTWA 4Y7OC 2VABA 4Z7VA 3N40P 1K2DB 3RVXC 2NT1A 3VDCA 1W72B 4WTZG 4KY1L 1CR9L 2VUYA 3BPCA 3CSFA 2YHGA 3QJXA 2BSSA 1IGML 1QLEC 5GZOC 3IC7A 4NYLA 1OWWA 4HIPA 4OGYH 4EIBA 3OHXC 1KTKE 1ODUA 1PD1A 3CX2A 5A2FA 3ASNB 1WBZA 4DR2O 3H1HH 3EGSB 3MGTB 4X0KA 4L4VB 3CFJB 3WNOA 2J2ZA 4F7MA 1QPXA 3RP1A 2HLDG 3MGAA 3DI2B 2BOLA 3SY0A 1JP5A 2C9UA 4NDMB 5E6SB 5KOMC 1XNRB 4LCWD 4MA8L 4CGTA 4XAWH 1E9QA 3FSOA 4U7SA 2Z0AA 3A47A 1NGQH 2NR6A 3UTQA 2WKLA 4DKEH 4ZX3A 4NQEB 4WF9V 2VABB 4PI0A 1O75A 1AILA 2EDQA 3PABB 4QGTA 4Y19E 1FO0L 1MF2L 1USZA 2BIPA 3BEVA 5LG1A 1KLGB 4JFWA 5D5ME 5SX5K 3N44B 4C56B 4HOWA 3OX8A 2MCAA 1DVTA 3PGDB 5TDPA 1YCIA 4RMBA 3TN0C 2N4IA 4PRHA 3BEVB 2JK5B 1I31A 5JZ7D 2G2RB 3FUNA 1S3KH 3GXDA 3PJSK 4Q14A 1YVWA 4UCVA 4PRNA 2JKIS 1C7TA 2PPEA 3D8MA 3APCA 4DW0A 1RJYB 2J88L 4G1EA 4WSJA 5AOZA 1KN4L 3X13B 5D72H 1M57C 1WA8A 1XSJA 3S3BB 2R70A 2AZAA 1L9SA 4BFIB 3GB7B 5JQHC 4GP5B 4YL9A 3PUUA 3VDBA 5EDSA 5GGSB 1PZBA 3RUGE 5CEZL 3ZKXC 1CURA 1PX3A 1DJSA 2OYKA 5KJRH 1YYCA 4R26H 4WI6A 3FRUB 3BFRA 1QAWA 3D3VE 2XPGA 3FHEA 4RRPG 5CBEA 1JK9B 1IIIA 4G9FD 4JGUA 4YHKH 3MGOB 5HY9A 3BQVA 5DECA 1WZ1L 4P2OD 5DD6B 3BY6A 3IMSA 4OB5L 1HHGA 1D5NA 5JJNB 1PIGA 2ORBH 4JJOA 2BIIA 5JQ6H 3FO9B 5LO7A 3AG1B 1PFOA 1TTBA 4P2ZA 3H6AA 4GS7B 1I7ZA 1L0XA 2WY3B 1NBYB 4OLZL 1G9NH 1L9NA 3IU3A 4TS6A 5LYJA 5C0IA 4EUPG 4LOVA 3TH4T 4DUZO 3KPTA 5DJAA 2O5YL 2NZ9D 2OCHA 3H8NA 1P5UB 5L2KB 4HIEA 2I25N 4J7KA 2NYZA 1R73A 1A3ZA 2NY3B 3L08A 4P2RA 1KF9B 2ZX9A 3QIWC 5DJAB 1N70A 2UY7B 1PEZA 3CZSA 2E0PA 4WI4A 4PY7B 2YUAA 1B4TA 3MROB 4W9ZA 5FO9A 2A6IB 4MXVF 1GO3F 4BM7A 1WYJA 2C3XA 1YI2V 2I07B 3N85L 3MROA 3OJMB 4IDJL 4BFEA 5LP6C 2V5SA 4X5RA 5AVUB 4NFDA 4YSPA 3EJZC 4CH6A 1SVZA 3SJVE 1MI5B 4LLMA 1FYJA 1VEPA 3A22A 3EJYD 2AK1H 3L9RB 4JRFA 3GGWA 4L3EA 4CS4A 4BBWA 1NFDB 1T5WB 3W9DA 4IMKC 5IB4B 4EI0A 5AAPA 4TM9A 1KTDA 1OGAA 4Y9BA 4ZFFA 1A65A 3RWCA 1KT2B 3AFLA 5LVEA 4X7FC 1CYXA 4DP4X 1UH3A 1CFNB 1PF3A 1JGVL 1SN5A 1MLCB 1MEXL 1ASQA 3VOUA 3S48A 1JIBA 4KQ3H 2F0CA 4UUJC 3W2DL 4L8CA 4XZUB 4X66B 3BRDA 1C8QA 1LMIA 1NANH 1EAQA 3VMPA 1FNHA 5H94B 5J12C 4G7SB 2BOBA 2OTJV 5CHNA 1IGMH 4JM2A 3TNMB 1E3XA 3A0RA 3SPVA 4BFIA 3ETBJ 1VQOV 5EBMB 3HMXA 5KVDE 3F58H 5CXPA 2FYVA 2NY6C 2XVKA 3ZRXA 4J4PC 4K71C 3QQXA 2X4NA 3T0EC 1T2XA 3HRZA 2DDQL 3U0TA 4R7NA 5K69A 1ZMYA 3KG5A 4DV3O 1F4YH 2CQVA 4GRWB 4OTXH 4YSOA 3ARUA 3EHBD 4X6EB 2Y3NA 4FCHA 3U0TB 3R7RA 2F7RA 3K6SB 4Z7WA 1RM1C 1CT8A 4YDLB 2LO1A 5L0QC 4UV4L 3BPOB 4EDWL 4DGVL 4U3JA 3WMPA 1QABA 2F7IA 1TPXC 2L4OA 3CFJA 3WFHB 1P1ZB 3VX1A 4H5SA 4S10A 2ADFH 4WI7A 1J5HA 5EZLB 3V4VB 1DF4A 1IC5H 2ZKYA 5A3IC 3SY0B 3C9NB 1WEJL 4OCWH 4Z7UA 1KELH 3IBOA 3MPCA 1KXHA 3U10A 4LSUL 1TTCA 2BNRB 2D7TL 4BUQA 5JH7B 5GW7A 2YQGA 4UBDD 4RGMB 4LNUA 1B2WL 4OZGA 3TFBA 1IURA 1GY1A 3MRCB 4FERA 4QRQA 1T4KB 3ILQC 3I9PA 2YFOA 3GQFA 3WI9A 4JO3L 2EH8H 1SQPH 3VQYA 5LMUB 4ETYA 3PS6A 1FJ1B 5J6GA 3N5AA 4XC3H 1N7MH 3LZPA 3AQZA 1J9SA 1KN4H 2MW2B 2OX5B 4LMQE 1RJZA 1MQKL 3HG3A 2JJVA 1BBJA 1OTSC 3ATDA 4XZ4A 2XKNB 1KJ2A 1KBPA 4DXWA 4U1GC 4AQZA 2Y5TA 2O6FA 4NI6A 5L2KD 1DQJA 1SVCP 3VFWB 1MN4A 2AJ3B 2YMOA 3HKDA 2Q8BL 2YRLA 2Z8SA 5DGRA 4JGNA 4FPPA 5DD0H 2ATPA 1BIIB 1RUKH 1ZEAH 2LAAA 4QTFA 4DUXA 2HRLA 4WFFE 2BNUB 2B5IB 4PGDB 3TM6A 3LPOA 5DRWB 5I1GL 2BHFA 4LCCA 5D8JH 4HBCH 3IXTB 1XGTB 1WUNT 2AEOA 4XBEL 4DO6A 5F6HI 1XR8B 5FECB 3MBXH 1KCSL 1T6WA 4R4FL 3LVEA 3U6RA 3A0BZ 3IJSA 1XH3A 3OTTA 1RSFA 4JAMB 1F4AA 4P4RB 1MG1A 3L17A 3C2AL 4U1NA 3ARBB 2FIKB 4ZDHB 3D3VD 4I0PC 4X0NA 4WFEA 1HSAA 1URIA 4J9YB 4U6HB 3RZCA 2HPTA 3DPDA 4GKSB 1N26A 4BCZA 4UM9A 3VU1A 4F8OA 4OCRH 2WIIA 4O51B 1RLWA 3BH8A 5ETUA 4S2SB 3FFCA 2K3TA 4Z8FL 2QSCL 3H0TB 4UOW1 3QDGA 1RXLA 1L9PA 4KK6D 2F23A 2R69H 1EHLL 3AXLB 3JTBA 4QF1A 3NJJA 2XDHA 4JO4H 3TH3T 1VKXA 4I0PD 1JFFB 1JHTA 2DJ4A 2PF4E 1JQ0A 2Y1ZA 3HI5H 2BNRA 1DBJL 3RYHA 3K5MA 3OC8A 1YPZA 1ZUQA 5E5RB 4B9PA 2IV8A 5C7ZA 5CEZD 4DIXA 4HVBA 3HKFA 1BVZA 3ESUF 4IRJC 3V4VH 3HAEG 2VS0A 1IC7L 1OE1A 3LEYL 4KU1A 3VG9B 4PV9B 3P69A 2DEWX 3VD1A 2DQDH 2ZDIC 3HPLB 3N41F 4W68A 3CSBA 4AL8H 5GS0L 4TNVF 5A6IA 3EFFA 7PCYA 4K0KB 3AQDA 4FNSA 3RG1C 2GIYA 3WFEH 3D4YA 2E7DA 2ZKHL 3AB0C 1OZTG 5B3SB 2CUAA 4M5TA 3ASOC 2OCJA 5KX5B 5IBTH 3ZRFC 3CVHB 1ORSB 2GSGA 4QRBA 5HJBA 2ED8A 4HNAB 4YDVA 3A21A 2LW7A 3D5OF 2A6KB 5DD3L 5G4NA 1OAQH 3HG2A 4Y2OB 4X8JA 4GSDH 2NY0B 1NGWA 2BDNH 1TVKA 2P48B 2VW4A 4XNXL 3F5WA 2XN9E 4JFUA 1XBLA 1B0IA 4NO0D 1XF2B 2CJUH 1RIVH 3KM1A 3ABLB 2NNXA 2VC2H 2X0WA 2ZKMX 4JI8B 4DKEL 2C3VA 1M56B 4TF4A 5D5MF 4RMVA 4PM1A 1KJ2L 3ZN1A 2FSEB 3JV4A 4PYHA 5E00B 3T4AC 4EN3A 4JREB 4L48A 4Z0BL 4FNUA 2D7MA 3VG0L 4X1YB 3HZYB 1TVBA 3RDJA 4MMXC 1FVEB 3ABTA 2HHHO 3ESNA 1FYTE 1JF1A 3T08A 2R2HA 3BVXA 2IADB 2P5WB 2ZE6A 1DVYA 3KW8A 3HMWL 4PW3A 3SGDH 3V2AR 3QXDB 3BN9C 5E1AC 2QV4A 5LWYL 2LR4A 2IBBA 3VXSB 1S7QA 1VACA 3T8MA 3VWJA 4TRPL 2CO7A 1VF5C 2ZE7A 2FUTA 5TE7L 1AQDB 2XBZA 1H3VA 2DMXA 4O9HH 3FZUD 3UTTA 4WIQA 4Z1MG 4X5WB 1IBYA 1BQ5A 4WTQA 3AS3A 3PWJB 4MFHA 2WXNA 5C3TA 3KLKA 2I26N 2V1DA 3REVA 1U8JB 5JPMB 2AVFA 4W9KC 2Z0BA 3ZHDA 4FP8L 4KXCA 1OAJA 1I3UA 1EO8L 1E7VA 5FO8A 5FO7B 1N0LB 3NEOA 4Y19A 4HSAC 2Q9LA 3CFKA 3PWPA 4YHHB 3WLBB 3MNZB 1W8EA 3QZPA 4G8EA 1VKXB 2AXGB 4MQSB 2XAHA 1CBVL 4L5FL 4L0PB 4E2LA 3ML0A 4OBRA 3IK2A 3CXDL 3EDJA 4CDHA 2OZ4H 4LNRA 1NKDA 3BP4A 1O6SB 3T1WA 2YIBD 3I84A 1U42A 5C9JA 4OLUL 1MOEA 1QLRA 3WSQL 3AY2A 2WBJC 4NQTA 2OX5A 1CE1H 2H26B 4ZQKB 5KVEE 3LKPB 1BZQK 3DV6A 3KWUA 4ELMF 3O9WC 4ZAKA 3QFJE 1NVPD 2YSSB 5ESQB 4G8IB 4N2FA 3UTZA 5L9DH 2YC0A 4JFFE 1CD0A 1RJLB 2BSTA 1KV7A 1KBGL 2BHZA 4NKGB 2AW2A 3GWJA 1TR7A 1NR1A 5EEWA 4UCSA 1GK9A 4LSDA 3MACL 3LKNB 4LHJB 5DMGC 3QO1A 4I9WE 5CA1B 3D09A 3D85D 2Q6AA 4JY5H 4LRNH 4F9LA 4Y0GA 4J3UA 2GJRA 3F2LA 4HLJA 4PWHA 4DETA 4E2OA 3QO1B 4JO1H 3MRIA 3QI9A 4NN7B 2VDPL 4HIHB 1MWAA 5I8KH 5ICZB 3CP1A 1K6QH 5C6WH 4HQQL 5IGXL 2YLHA 1CGSH 5GS1A 2CPUA 5FIEA 1ONQA 1U8KA 2NDFA 3KCPA 1KZYA 1M1XB 5LWYH 4A68A 1LO3H 3LRSA 4B96A 2R8SL 1KQSU 1JNLH 3B6SB 4ZW8A 1IAKA 4Y9CA 5FUZL 2UZXA 4FNRA 2P1YA 4ZD3H 4F57H 4M7ZC 5KG9A 4MJ5A 4I2XB 2NXZC 5ACLA 3WO4B 2PCPB 1DCEA 2GPZA 5TQ0H 2DIAA 4PGEA 4PGBA 2K6YA 1T7XA 3SHSA 4G6ML 4AKOA 1P7HL 2AXGA 2GI7A 4M8QA 4ZI7B 2FATH 5IESL 4A2FA 4DZ8A 5CIPB 3PWPE 3MLVL 4KTDL 1P4UA 1UXSB 2UX7A 3GRWL 4WGVB 1EAJA 5IW3A 5KVEH 4OQTL 1KTRL 4PVBA 2VZ3A 4XGZA 2A6DA 1M7IB 4BFOA 3BAIA 5C8YB 3B2UC 5LA6A 3PNWB 1AKJA 2RN9A 5AD0B 3CK0H 5FGSA 4J7ZA 1N64H 4I18B 4YHMH 1ZK5A 4F24A 1OAYH 3X1FA 4XC1L 1EDHA 1NIBA 4S1SH 3ZTEA 3EYFA 1DLFL 1MY5A 5AD0A 2BTQA 3UERA 3GGWB 4L05A 4AJ0A 1PEWA 4XN4A 3I9GH 1LNQA 3D0LA 1Z5WA 4U33A 4X62B 2HVJC 4YZFE 5LXVA 4ACPA 5D6CB 1FNGA 2JTDA 4LBEA 4ODSL 1I7FA 4QHKJ 3GSNA 2X38A 3KMDA 3DPBB 3OLDA 4UT9H 4MVBD 2ZG1A 3GBEA 4K71B 4MJIB 5I17B 4G3YH 4KJPD 1ETZA 4UXNA 5CZVL 5J3HD 7FABL 5EFIA 1YMMB 4EN3B 3S37L 3NZHH 3AG3B 1XF5A 5E99H 1W8NA 3DVNB 3B1UA 2N1KA 5JW4N 3TVMD 4M48H 1IC4H 5EWIL 3CZGA 5FK9A 2CXKA 4HFUH 4PJHB 3TK1A 1C16B 3CHRA 4PV1C 3PAUA 1ZJBA 4PJXB 4XNZB 2DWDC 4KO5A 5TJWK 2P45B 3EO0B 2C9RA 5KSUA 4O4LA 1NLDH 2RGSA 1NS1A 3ECBB 4RNRA 3V4PL 5DSCB 3VAEA 5M94B 5T1KD 1F5WA 3ZL4H 1EWHA 4WHDA 1NBZA 5E9DB 4TMPA 2FJSA 2E6QA 1JZ6A 1P7QB 3D36C 1KECA 2HTLD 4E5XA 1YDPA 2XPYA 2HB0A 2GY7B 1HTYA 4R0LC 3JARA 4GSXA 2CR3A 4EAEA 5C0CA 4PCYA 1PKQA 4NQXB 1OZ0A 2BIOA 3RVXD 5KBPA 4CU7A 2RFXA 4L8DA 4PJEB 3VYPA 2X9WA 4A7TA 3SDXA 4YSEA 3HC0A 3TU6A 1H3GA 1P4IH 3BVWA 4NN5B 2ZF9A 4XGZB 4MNGB 2NY4C 1A7OH 2RBLA 1FZKA 1DQIA 1T5KA 2QHRH 3V4UL 1E65A 4X8CA 4BRJA 4U1LA 5IJKA 1I3GH 2COQA 5DYOA 4I9WD 1E30A 2EDMA 2R1WB 3SN6N 3BH4A 1F1AA 4AMKL 3T1CA 3TIEB 3MBEA 1I3RA 4N3TA 4ODTH 3LKPA 5IROD 1DZ0A 2JEXA 5EU4A 2WQXA 4NUJA 3FFCE 4K7PX 4D7SA 2WLJA 1BZOA 4HJSA 2BS8A 3T0AA 3KS0J 1E8ZA 1PNCA 1VIWA 1MJJA 2YBGA 4XH2A 4GS7C 2RNBA 4XHJC 4HIQA 5EMYA 2AV1B 5F72S 1CE1L 1T89C 1FDLL 1JCKA 4GB9A 1JERA 1FO0B 3ZMNA 4EIZC 1CD9B 4PY8J 2BFGA 3GMOA 3P4OA 1MABG 1A14H 5C09B 5KVMC 1IBKB 3ZDXE 3GMLB 1HL5A 3QWNA 1NMBL 2E7CA 3GSWB 3N04A 2APSA 2R29H 4OF3A 1EXHA 5DHVA 4UM8A 2DQJH 4MCMA 5CJXC 4Z3TA 4YDMA 5ESVB 2EECA 3IDJA 3I9GL 2DAVA 4AILC 2QGBA 4ONGL 4IIJB 3VACA 4CU6A 3O65A 2DQHH 1AI7A 2XG4A 2V2TB 5IROC 5I1GH 3UZVB 3IDMB 3MLTA 3QUYA 4LBAA 3US9A 4OQTA 4MSWB 4MD5A 2ZUVA 3K1DA 4HUKB 3VXSA 4LVHB 5F1IA 4XBPB 3B5HA 3UZVA 1VGKA 2EILC 1J9CT 4TULL 4NQSA 1NGQL 2V5RA 4N2LA 5ALBH 4A7SA 5EPMA 4NPKA 3U0ZA 4EEEA 2WQWA 5T1KA 5JR1H 1F1DA 3VMOA 4IOSA 3AS0A 1YTFD 3ZKMD 5IB2A 1YMMD 4R50A 4FAAB 5L4MA 2DYRB 4FKHA 1EHNA 3T4AB 1D5BB 5LB1A 3C9NA 2Y06L 1WICA 3RKPA 4PA7A 1OCZC 3IDNA 5HTSA 2VWKA 2CDYA 1UWYA 1W16A 4OZHB 5J9PB 4K8RH 15C8H 2VZTA 2ORBL 3FB7B 2YAOA 2YPLD 5C92A 2XN9B 1T1WB 4CMHC 1TTRA 2HUHA 2OBGA 2P5EA 1NCOA 3N9GH 3S3PA 1WP7A 2VDLH 3BH9A 1WO2A 5KVDL 3S4SA 3MZTA 2LHAA 2VZVA 1ZT7A 4YDJA 3H2WA 4NPJA 2VAAA 1N4XH 3LKSB 4NRZB 5D1ZA 1JVMA 5ERWB 1YN6A 2A38A 4D9QD 4I3RL 1SA0B 3HZKA 2IBGA 4I1RA 3RIKA 2B59B 4FFZA 4ZUSB 4L4VE 4DP0X 3G4SV 2G3ZA 3ULVF 1L0QA 5AVVB 3IT8D 5CHNB 3IJEB 4OI7A 5KYUA 2PO6B 5ACMA 3QGVA 4KKLC 3ZE2F 3RY5A 2NLJC 4PJ7B 3C60C 4G80B 1XAKA 2F54A 1W6LA 4E36A 3AWFA 1AYOA 2VH5H 1DVXA 1AVAA 1LJMA 2OMUB 4NJ9L 4NJAL