3ABKB

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3abkB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3abkB02
3NJLA 1NPNA 1J9TA 3NJNA 3DIVA 3X1NA 3X1BA 3S3DB 3JTBA 1PZCA 2BP0A 3PAUA 5A7EA 1A65A 1OCCB 1DYZA 2AZUA 2FJSA 4YL4A 1ILUA 2HZHA 5AKRA 3T6VA 1ASQA 3S8FB 1ETJA 1HAWA 1BXUA 1PAZA 2DYRB 3EH4B 1EHKB 3FPXA 2PCYA 8PAZA 2QDWA 2XX0A 3IN0A 2VN3A 5ANHA 3CG8A 2HX8A 3OM3B 3FS9A 4N8UA 4FA7B 4HHGA 2H47C 1SJMA 4G72B 4YSOA 4JHUA 4A68A 2R7EB 3PAZA 4W1TA 1XB8A 2PLTA 5I5IA 5B1KA 2Q5BA 4M4RB 1SHWA 3PPSA 4E9SA 2IDTA 1CUOA 2PPCA 1PF3A 3V9CA 4A66A 4P5RA 1SDDA 1OF0A 4BK5C 2GC4C 1PMYA 4G71B 5D4JA 3IE9A 2IAAC 3UGEA 3OMIB 2XU9A 2YARA 1RZPA 1ZIBA 4NAJA 4N4YB 1NWOA 2MTAA 3ERXA 2TSBA 2DYSB 2VMJA 4Q8BA 1RZQA 2BZ7A 3T9WA 1NWPA 1PNDA 3NJMA 1NTDA 4BDVB 3TU6A 4NERA 2IWFA 4AKQA 1NZRA 3KW8A 6PAZA 1NIEA 4E9TA 4YSCA 2HLEB 1OCRB 3QJVB 2EIMB 3EH3B 3JT2A 2VW6A 3NJGA 2IDFA 4BXVA 3EF4A 1NDTA 4YSQA 2I7SA 2ZONA 2WO2B 4UANA 3BQVA 3X1GA 4A2DA 1GYCA 3IN2A 3EHBB 1EZLA 3H4HA 1OE3A 2GC7C 3FYEB 4DP5X 4KNUA 4DP8X 2MRYA 2VSMB 1X9RA 2JFCA 2LLNA 1JZHA 1PNCA 1BAWA 4A2FA 4Q89A 1IUZA 1AZRA 2OJ1A 3FSAA 4P5SA 4DP2X 2VM4A 3CDZA 2YEVB 3AG2B 1ILSA 1BXVA 3FU7B 2PPFA 3V9EA 2AZAA 1URIA 3CVDA 1TU2A 1GY1A 1KV7A 3FU8A 3FQ1A 4E9RA 2AANA 1R1CA 3ASOB 2UXTA 1AZBA 3NP3A 1L9SA 2BW5A 2IH8A 1N68A 2QPDB 2YAFA 4DPBX 2X87A 1KGYE 1ZDQA 3UADA 2TSAA 4GYBA 4CSZA 4DP4X 2EINB 1AS8A 1L9TA 2YAQA 4KO9A 4M3HA 4BWUA 2ZOOA 2DY2A 1AACA 3QJQB 5LDUA 2DV6A 4ENZA 2RACA 1JZJA 1NIFA 1JERA 1AG0A 1CC3A 5D4IA 4YSAA 2DWTA 1AG6A 1ZPUA 3HEIB 7PCYA 2HXAA 2UXGA 2ZXWB 1AS7A 3TBCA 2J5WA 1A4CA 1W6WA 1KYAA 3X1EA 1MZZA 2P80A 1QNIA 5B7FA 5B7EA 3DTUB 1JXDA 1E30A 2PPDA 3WNIA 1KCWA 2Y1AA 2P80D 1PCSA 2BHFA 1A8ZA 2X88A 3WI9A 2PPAA 3FQYA 4CSPA 3GYRA 1TEGA 4F7KA 1WS7A 2Y69B 1ET7A 4A2HA 3WG7B 2FTAA 4GP4B 1JZGA 4YSEA 2XV3A 3QJTB 3C75A 1BQ5A 1J9QA 2I85A 3NSCA 4KOCA 1J9SA 1OCOB 1RCYA 3UAAA 3SBPA 2FT8A 5B1AB 4YSDA 3CZUB 1SHXA 4PCYA 1JXFA 1KBWA 2PP7A 2QT6A 2R7EA 1ZV2A 3TA4D 4AKOA 2QPEB 2IWEA 1SF5A 4KNSA 2H3XC 3NJHA 3FSWA 3CVCA 3FYIB 1PLAA 5AZUA 4JKNA 3OMNB 1BQKA 1NIAA 2HX7A 1IBZA 1AS6A 1HAUA 3NJFA 1V10A 1L9RA 5TK4A 1L9PA 4AX3A 1E5ZA 1NPJA 1RKRA 4HZ1A 2GHZA 3X1FA 2W88A 1AZNA 3QJRB 5I6OA 2PP9A 3WNJA 4A2GA 5PAZA 2FQEA 2YAPA 2PCFA 4E9WA 2FNWA 2NRDA 2UX7A 2I7OA 1A3ZA 1NIBA 1W6LA 2XVBA 2YAHA 3FT0A 1E5YA 1E65A 1ET8A 1PY0A 2BP8A 2CCWA 1B3IA 1BYOA 1MG2C 2J56A 1JZFA 1KBVA 3GXUB 4G7SB 1IKOP 3AY2A 4YSRA 5F7BA 2VW4A 3NYKA 5I5JA 2VSKB 1SDDB 2VM3A 2IH9A 1XB3A 4G7RB 3SBRA 5I6PA 4YSUA 1YLBB 2YXVA 1HFUA 2IDQA 3NT0A 3WKQA 1GS6X 3T6XA 5I28A 5EHFA 4L0PB 1FFTB 1SF3A 1ZDSA 3FU7A 1AZCA 1SFDA 1J9RA 3TASA 2BZCA 3AG3B 2GB2A 3SQRA 3QPKA 4A2EA 2XXFA 2BW4A 5I6LA 1GS7A 4HHWA 5I6MA 1GS8A 1WS8A 2PP8A 4F2EA 5AFAA 2CBPA 4KNTA 5B1BB 2XXGA 4EF3A 1A4BA 3NSYA 2J57A 3WIAA 4BXSV 4DP9X 1J5CA 4GY4A 1TEFA 3ABKB 1PZBA 1SNRA 3G5WA 2E86A 5B1JC 1M56B 2PPEA 2HRGA 3UACA 2XUWA 4BWTA 2BO0A 1CURA 4E9VA 1L9OA 2XWZA 2IDSA 3AW5A 1IC0A 1SFHA 1ASPA 1AQ8A 1FA4A 4TXVB 2BWDA 2IDUA 3T71A 2YAMA 1AOZA 4DPAX 1JXGA 1WA1X 3WKPA 3N55A 4YVUA 5I5MA 3AG4B 2XX1A 4KO5A 3L45A 1MZYA 4JHVA 1ADWA 2FQGA 3IEAA 4FAAB 1ASOA 2FT6A 1PLCA 2HX9A 1L9QA 1JZIA 3TBBA 4K9JA 1BQRA 2JXMA 1QLEB 1OCZB 1IBYA 1OE2A 3NSDA 5I26A 1WA0X 1AZUA 3N2JA 2XV0A 3ZIYA 1M9WA 1W8EA 3D12B 1XMEB 3AG1B 4W9ZA 3NJJA 3H4FA 2B3IA 4WKXA 3UAEA 3MX0B 2BP0B 1JVLA 2GIMA 1JVOA 2J55A 3ZBMA 3NP4A 2IWKA 2UX6A 1QHQA 1KDIA 2YQBA 3FPYA 3KW7A 3MBWB 9PCYA 1WA2X 1GR7A 3IBOA 3HB3B 4KOBA 3UABA 4UF7C 3PAVA 4G7QB 2VW7A 1XB6A 1OE1A 4HCFA 1V55B 3PCYA 1V54B 4G70B 3PXLA 3NSFA 1X9UA 3OQRA 1BXAA 4KO6A 4BWWA 4GXFA 3QQXA 3ABMB 2UXVA 5I6NA 1CYXA 1FWXA 1GSKA 4E9QA 3S3CB 4HCIA 3AZUA 1VLXA 4GP8B 2ZWNA 2WO3B 5TK2A 4AZUA 4BDVA 4YSSA 4RH4A 5D4HA 2GI0A 7PAZA 1AAJA 3ABGA 2OCCB 3T6WA 3ASNB 2XLLA 2FWLB 1NICA 1M57B 1KDJA 2WSDA 1ET5A 2CALA 3NJIA 4HALA 4YSTA 4E9XA 3S3BB 1PZAA 2CUAA 2AFNA 3FQ2A 4GP5B 5I6KA 5B3SB 2CJ3A 4AI7A 2OV0A 1JZEA 2A3TA 3H56A 4PAZA 1J5DA 2CAKA 2GBAA 4AKPA 4NB7A 3OMAB 4F2FA 5B7MA 1E67A 2EIKB 5E9NA 4HCGA 3U25A 1PLBA 4DP7X 3FSVA 4UAHA 2XV2A 2BP8B 1I53A 4DP1X 4QLWA 3DKHA 1WAEA 1ID2A 1DZ0A 1KCBA 1TKWA 4HIPA 5FC9A 3FU9A 3FSZA 1AANA 2UXFA 1BYPA 3NJKA 3OD3A 2W8CA 1OOWA 4E9YA 2HRHA 2DWSA 3QJUB 1OV8A 3CVBA 1BEXA 2FQDA 1UATA 3EH5B 1GW0A 4QKTA 2B08A 6PCYA 3CDZB 4HAKA 2JKWA 1JOIA 3GDCA 1A4AA 4DP6X 3SBQA 3RYMA 1AR1B 1AIZA 1MDAA 4DP0X 2YAOA 1NINA 1ZIAA 3QJSB 4X4KA 2AVFA 3T6ZA 3PLYA 1NIDA 4YVNA 3X2QB 1GY2A 5F7AA 2QDVA 4YSPA 4MFHA 1F56A 5PCYA 3ZX1A 2EILB 4A67A 1CYWA 5B1JA 1T5KA 4DPCX 1MG3C 2XYBA 3S8GB 2FT7A 2H5UA 5IY5B 2YAEA 2FQFA 2Q9OA 2YXWA 3ZDWA 3BVDB 2GSMB 2N0MA 4ZK8A 4WTQA 1N70A 3ABLB 2BWIA 2EIJB 4KO7A
chains in the Genus database with same CATH superfamily
2Y7LA 1FZOA 5I66A 1ZHNA 4WI7A 2D0FA 4FC3E 4L4VE 5BY1A 3MNWB 3NJNA 4NC1E 3KJ6L 1UXMA 2BY3A 4RMRA 5KYWA 1UQSB 4BCXA 5GRVK 5EOTA 3SDAC 2EDEA 2EADA 2IQAB 5JQIB 5JHLL 2LE9A 3L6FA 1ZHBB 2VQ1B 4NQVA 5AKRA 3T6VA 5D7JA 5GGVL 3Q8EA 4U6HB 1ETJA 4GJTB 1LR1A 5LGJB 4PTTA 4Z18A 5F1SA 1D3CA 4LQFL 25C8H 2PTTB 4OLVL 3EH4B 4HMDA 4PJXE 4G9FA 2ZNWA 3ZHKA 5IK3A 3P4OB 3UKMA 4D9LL 3RIKA 1U3ZA 2PI5A 1QSED 1CIDA 1P5UB 3BMVA 3MRCB 5JPMA 3WNPA 4JDTH 4XBMA 2G3NA 5D1XC 5E5LA 2WP3O 1RIHH 1E3XA 4NN7C 4IS6A 4YHKL 2HH0L 4BH7B 1R6TA 1OCRC 4O4LB 3F7YC 4LCCB 4RRPA 2RQEA 1F2XK 2DB8A 4KQ4L 2E76B 3IK2A 5F97E 1KBGL 4HV8A 2Y1YA 4MQSB 4X83A 4UZSA 2FMLA 4EVNA 1FNFA 1KP2A 3V9CA 1PZ2A 1LLAA 3PN1A 3EAKA 3HAEB 4BRVA 1PX8A 3LIZL 4FXGB 2PYJA 1TA8A 1ED3B 2X4TB 3W0WD 5JOFA 1J18A 1U4EA 5AENA 1MQ8A 1S5IL 3MRPB 1H3UA 2XN9D 1JV5B 5D7LD 4I7ZB 1BQSA 3LHAA 3W7WA 3OSVA 1B9KA 1EHLH 3MLRL 4K8ZA 3FH8A 4QJ3B 5H37G 4D7BA 4NBZB 1Q86W 1S9XB 5DJXA 3KW8A 1K33A 2DOCA 4I77H 2XAHA 5EDSA 4BFIB 2RNBA 4KJYA 2L8AA 4BXVA 1JJOA 1FFOB 1UEYA 2B20A 3L3HB 4ZTOH 5B1CA 4WFED 4X9HA 4BW5A 3DV6A 2ZSVB 3N1QC 5DD5H 2ODIA 3FB5B 1DZBA 1CLOL 1EZLA 2WZPD 1H9DA 4UIMA 3IFNL 3FYEB 2EDBA 4MA3A 3VWJC 5KMGB 2ICEC 4GKNA 3WYRA 2BIQA 4OGYL 4AL8C 1D7CA 1E3ZA 4P5TC 3Q1SH 1ACYH 2AXJA 1JYXA 1R3IC 1MWAA 1M3JA 2V5SA 4NQSB 4RBPH 2VDMH 3LKNA 4LCVA 4R8WH 3AG2B 4W4OC 3OTOO 5EO9A 1MQKH 3K6FA 2NW3B 4JQXC 3FT4A 4M4PA 1I7ZA 4GKOA 2ZPKL 3D2UA 2Q9LA 1TU2A 2QEXV 3INUH 4IJ3B 3VX0A 4JDZB 5E8NA 1LEGB 1R1CA 3ZDXE 1D9KC 1NFIB 4YQXH 3APDA 3GSNH 4Y8AA 4YXLL 4PMFA 4O2AA 4XTRC 5GSVA 1HX0A 2QVKA 2DN7A 3IDJA 1HHGA 1YEKL 2IAMB 4FQXC 1FHNA 4IGBD 1YYLH 2HTKC 4JO5A 4L8SA 4X6DA 1PW3A 2E8ZA 5HDQH 2GTZA 3BLPX 2GBOA 3G9VA 3LPPA 1XEQA 5C9JB 3FTGB 3WJMA 4RETB 2X4SB 4UXNA 3T8XA 3S96A 1SZNA 5FIEA 1DBAL 1RUQL 1VB9A 2Y5QA 3PDDA 5GRZA 4FTVA 1OCOC 1PD1A 4G8FA 4HJGA 5CIPH 5D4IA 1EAPA 1FNHA 2DWTA 2H9GA 3F58L 3HE7B 3ZHQA 1KC5L 3PP4H 3PNWA 4W6YB 3RE0A 3WFBH 1FH5H 1OM9A 3NCMA 2EECA 1KYAA 2UWEB 4X0NA 3NH7H 1UOKA 2NDGA 1BX2B 1U95A 2QSCH 3QCTL 5B7EA 3MO1A 5IHZB 3M17A 4FFTA 3MRIA 2VDOB 1IM3B 4M6OL 4M7LT 4FMFA 1ZJAA 4UBDD 2FSDA 1H3VA 4NZRH 3ULSB 2PNDA 3G5VA 3LMJH 3OAAG 2IJJA 1WUZA 4ZFOB 5TE4H 4PREB 4MS8C 4GO6B 4XDJA 3QXTA 4KWUA 3RIFK 5JNYA 2C3GA 3OR6B 5KSBA 4KKLC 2L7EA 2Y25A 4X9BA 1QR9A 2E74C 1MWOA 3KDMA 4D9RE 2DAVA 2X2JA 2FL5B 1IKNC 4RZCB 5BW7A 1NEPA 3MCKB 5SWZB 4YSEA 1D5NA 3O4LE 2IPUK 4M7JL 1J9SA 3SDCC 3IMRA 3I6GB 5GXBB 4D6TH 2HLFC 5I2IB 5BZWA 3LNDA 2OL3B 1U3JA 4ZQKA 3K58A 4MMYA 2APWA 4JY6A 3RVTD 4JI1B 5BUPA 5CEYA 4XPTH 5FM5O 4QHMB 3V0FA 4GI9A 1U33A 2R72A 4HJTA 1SEQH 3IDYC 3NFSH 4FG2A 4TL5A 2QV4A 3DTDA 3UTSB 3EUDA 1Q82W 2NY6C 2NUPB 3GGWB 5CINH 1NIAA 3CXHF 3FRPB 5JW5A 4K94C 4LSDA 3OG6B 4XGZB 3II1A 5ANMA 1T20B 5J06A 4RFOL 3B7UX 1BIIA 1PIFA 3QUZB 1L9PA 3NMEA 4LLDA 1XH3B 2V3EA 1PKQB 5EO0A 4DXWA 4MNGE 25C8L 5H2FZ 1U6AH 5DR5H 4NKDA 4K0KO 4YLQT 3SZKC 3B9EA 1AZNA 2XFGB 4P4RB 3C5ZA 2YSTA 3S34H 1MFEH 2ILLA 5PAZA 1O7DE 3CLWA 2D7MA 5FR3A 1NR1A 4ZUSB 1KN4H 4QPEA 1M7DB 4AQYO 1HIMH 3LZLA 2PO6C 4JDTL 1Q9WA 2ZICA 4IIQB 5L6YH 5GSRB 1E65A 1RIHL 4E0RA 5JJNB 4UDUA 5E8EB 1P6AB 2YA0A 3KR3H 4PJEF 2WB1A 4KXDA 1JNLH 4XN1A 3UG5A 2ENYA 4QRPB 3ZTDC 1NBYB 3MJWA 4HH9A 5FA3B 2IANB 2YC1A 4MB5A 1QNZH 4WTZA 5DHYB 5AW9B 3PABB 4B9JA 4KJWD 4MJ6A 5I8CB 5C0RH 4BZ2H 5MENA 4P46A 4QRUB 1XIWC 1DQQB 3B8NA 2WZ0A 3S35X 2DZEA 2VXTH 3HJEA 5IKCA 1MCEA 3P9LB 3EJZD 3RHWK 3TASA 2YD9A 4AYGA 1EHLL 4IRJD 3SDDD 4L8BB 3TZVD 1BFVH 2UXDB 4U1JB 1GS7A 2J21A 4R9HA 1HZLA 5KA6A 1PJ9A 5F1KC 5I23A 1FP5A 3AY4A 3UTTB 1T1XB 3GZQA 3ZDZE 4X5WA 5IHLB 2ZQMA 3NA9L 3JWNG 1C08B 4NQTA 2GT9A 3VSUA 5DI8A 1CE6B 2MOVA 1BSIA 1OD7A 4H20H 1XAKA 5DD5L 3TIEA 1T6VN 3VXPA 4FJCC 3ABKB 4U1MB 4G8GD 4LLQB 1G8MA 2WXLA 4D8PA 4IIJB 2PW2B 4L9LB 1NS1A 1W8NA 2FX7H 5KSVA 1QBAA 3Q1SL 4GIPD 2XKNB 1ACYL 4B7KA 2I9TA 2IPUG 2MPVA 1TO5A 3N44F 3RWFB 4W81A 4QJ5B 3T2QA 4XBPA 1OT1A 2DWDA 2E27H 4JFFB 3BJLA 3NEXA 3OJVC 1ASPA 2VDML 3VI3F 4R8WL 1OGAB 5KVEH 1BW8A 5L9DH 3M7FB 1MFAH 4GT0A 1HSAA 3CHOA 4N2FA 1MQKL 2OMTB 4QLRA 2BE3A 4RGNC 2NY4B 1PEZA 4DCQA 3BIBX 2XRAH 5HYSA 2ZE8A 4KI5D 4OKVA 3SYOA 3QARA 3ZT7A 1N4CA 4LRNH 3INUL 2VDKB 3E89A 2WBJB 3CHQA 4FE9A 3HZKA 1XH1A 2NW2A 1BCCH 4KO5A 5E1AB 3ARFA 4MZIA 1MZYA 3GSNL 3QXAA 1CBVH 4WW2B 1BFSA 3E80A 4R4ND 2ATPB 3MNZA 2VAAB 3RPBA 4OH2A 1YYLL 2K45A 3FRUB 4ZAKA 5I1AA 4C56A 5ISZE 3HTLX 2DKSA 5HDQL 5JDSB 1J86A 2WC7A 5DLMH 3HKBB 4QXTB 2COVD 3VXUA 5I26A 3SJQC 1T4WA 4I48B 4NUJA 4EFEA 4PJ9D 5F3BB 1TVHB 5LMNO 4PSPA 2AQ1A 1S76D 2YGOA 2F66C 4QXVA 1XMEB 2O1AA 3WFBL 4ODBD 1GMGA 3PP4L 2JEUA 1Q5OA 5KA5A 1FH5L 4OZIF 1FORH 4HJ0D 1ZHKA 4XXCC 3NH7L 3SDAA 2QSCL 1A7QH 4I0PA 5LGHH 2JJSC 3MLTB 4LOEA 1F3JA 2C3XA 4RFEA 4U1HB 2YFNA 4MMXC 1EGJA 4ZD3H 4KOBA 4L4TA 1QSFE 5TE4L 1FJGO 3ZTEA 2DMKA 5JLZA 4B9YA 3TEYA 2ZJSH 1OAXH 3SDLA 4YXKH 3PCYA 4DR4B 2EE3A 5ICZA 5DC0A 4AJVA 2HKHH 4PJHB 4WFBV 1XMQB 1CVSC 3BN9C 4YDLC 5JVDB 1VFMA 2HLAB 1L6XA 2Q68A 1DE4B 3QEUB 4OM0H 1TR7A 3K0DA 3U4BH 3HKDA 2VLRD 2WKLA 3P77A 1BWWA 3ZMEA 4DOHB 2J4WL 3F7YA 2L4OA 2IGFH 2UUBO 2CIIB 2Q2EB 3PL6C 1QO3A 4FFYH 4DVRH 1SEQL 1HVXA 3NFSL 2JGUA 1N3NA 3SQOH 3VFRB 1DF4A 2YMTA 2VQFO 2MFNA 2BS71 4Y4HB 5E0QA 3SO5A 4JI7O 1RZJC 3I75A 4F6RA 4J10A 3PDOA 4Q9QH 2OV0A 3JV5A 4WFFA 2N74A 1H5BC 3H56A 4TS6A 3O4OB 3ULUF 2EVHA 1CDCA 5LO7A 3OXSA 2G2RB 1R0AH 2IBGA 3MFFB 4JCLA 1XD0A 5A2JH 4AT6A 1U6AL 3LS4H 5DR5L 1YUHB 2B9AA 2OJEA 3FOLA 3U25A 5AW1B 1F4XH 5JWPA 4UQAA 1MFEL 3NRQA 1QP1A 3S34L 4AYBA 4DP7X 3RDTB 3MBXH 2QR4A 3L7FB 3GSWB 3G67A 1A47A 4O2CA 4AYID 1P7BA 1HIML 3ESPA 1KTCA 1TCMA 3WGUB 1E2WA 5L6YL 4RLDA 1XF2B 1KJVB 3PHQA 4FQCH 5FC9A 1U3HB 2DWEB 5C0NC 1BYPA 3EYUH 3KR3L 1QSEE 5GS0L 3OD3A 4JL1A 1V7ML 2W8CA 4GW4A 3L2NA 3VWJA 1JNLL 2ICEA 1AXSA 3KWWA 5HYJD 1T83A 2DWSA 3DTXB 3GHEH 2V9TA 2BY0A 3FMGL 4P5TA 2VB5A 2ISDA 3RI5K 3TX4A 1MCWM 1QNZL 4IJTA 2V7NA 3ZYIA 2QV2A 1OP4A 2DLIA 2Z31B 5C0RL 3EH2A 4AQ1B 4BZ2L 3K9SA 3O41B 3US9A 1MNGA 4X20A 5AQ0A 3RWGB 5ITBH 4GG8A 3AXLA 1CXLA 4W4OA 3PIQA 2QMJA 1F3DH 2VXTL 3VH8A 3WHE0 3N44B 4GQPH 3VAEA 2QQKH 4DP0X 3CDFA 4Z7UF 1NINA 2CDYA 2ZKMX 1C5BH 3EOBB 3VI3B 4DK6A 2F6AA 3FF8A 1RZKH 2O6DA 3W0WE 1KEML 1UFIA 1NC4D 2GABA 3KYKH 2FIKA 1BFVL 1VA9A 4ZNEE 4LF6O 1FF5A 1N33B 5D7LE 4P2RA 4MFHA 4I88A 1WFNA 4G11A 1BT8A 1WN7A 1RV6X 2JH2A 3QUYD 5E1IA 5IEHB 4FQXA 3W7UA 2B77A 4NGHH 2VERA 2OMYA 2BLFA 4H20L 4MHHG 1GJWA 4HF5H 4MCYA 4MLIA 4UM8A 4EKJA 4JQIH 4I0XA 4B9FA 4MTMA 1J48A 3PFQA 5ABAA 2F53D 2MCMA 4IGGA 3O6KH 2GG1A 4HIHA 3RW0A 2NLJC 3KH4A 3F7RA 4AEFA 3RVTC 1EANA 2FX7L 4XN5A 4WFEE 4BELD 2X5PA 1EN6A 2BWIA 3TO2A 5FXCH 4CN4A 1LVEA 2UUAB 1VARA 4EIGB 1J9TA 2E27L 2WM0A 3RPIA 5L9DL 5KVEL 1IO4C 1UB5B 1MFAL 3MOAH 4PJGA 4YL9A 3A6OA 3VRIA 4ZZFA 4ZHQB 1OM3H 3BGFB 1SJXA 2XRAL 3IXTA 2ZOLA 2G2PA 5A7EA 4G82A 4B60A 2IV9A 2V1DA 3EZJB 4LRNL 3GXMA 2J71A 3ZQWA 5L2JB 4FXLA 3SD2A 4PYGA 2VLJA 4J3OG 5J5EA 2FJFA 4ODUA 2F23A 1P1VA 3MLUH 2YKKA 2DQUH 1CBVL 2DYRB 5C0BB 4HLZH 4DUYB 1NCGA 4WF9V 1RUAH 2Q76B 3OQ3B 4EUPA 4Q97A 2ZNXA 4L8CB 4UB8Z 4PBDA 2R2HA 1MFUA 4HUCA 3SDCA 1WIOA 4ZO7A 3S36H 5HGHB 1JDDA 5IVZB 4IBUA 2R2BB 4Q2ZA 1GTFA 1HNXO 4U1LA 1AGDA 2AZ0A 1WSST 4QHPA 5GS1A 2PLTA 2YUAA 5E2VH 4B5EA 2EIMC 4DV4O 3BKMH 3IMUA 1CQYA 3NZ8A 4Q6IC 3B2DC 2R1WB 2HHHB 2X05A 3PV7A 3BPOB 2BERA 3ZYZA 2E7LC 4G80B 3HZMB 1VGKB 5CBAB 1KB5B 2F74B 4LIQE 4YUEH 5DFAA 4KJWC 1NCIA 1WFOA 4FG4A 1A7QL 5LGHL 2VNCA 4BK5C 4YJ2B 1H8NA 3OMIB 5F89A 2ZX7A 3C09B 4NT6A 4D7PA 1HQRA 1ZIBA 5MERA 5J6HB 4GI8A 1ZVSB 4HFWB 1AD9A 3G6EV 2ZJSL 1OAXL 2GFBA 4MGXA 3LH9A 4YXKL 2E4FA 1YNTA 4DR5B 3E2HC 3IMWA 4PQXA 2E56A 4BDVB 2WV3A 2CE4A 2PCFB 1NZRA 1J8HD 5C0JA 2DYPD 1AMYA 2FLRT 1G9MC 2K7PA 1I08A 3I9PA 2PO6A 4WUKH 4F5CA 1F1GA 4OM0L 4Y2NA 4YSQA 1DQTA 4XN4A 3ZDYB 4EKXA 1XF3A 3IDXH 3CU1A 3U4BL 5JOEA 4YC2B 3P3SA 3ASOC 4FI6A 3KPTA 1HN1A 1FL3B 1WCBA 3X1GA 3UP1A 2IGFL 1PX4A 3MZTA 3KVQA 4FFYL 4DVRL 3PWJB 4KNUA 1ZT7A 4EIBA 1DJGA 3GEFA 3LY6A 4JTAB 4NKMA 5H37H 1B0RB 4FI8A 3CD6V 1NSNH 2OMZA 1MIMH 2OS7A 3CXHJ 3HLAB 4DZBA 1YO4A 1AZRA 3IJ7A 2H32A 3UPAA 4OUOA 4PGDB 4X6FB 2FYYB 4YR6B 1E4KC 5J8OA 4CGTA 4DR7B 1Q9OB 4JG1H 1RXLA 4QOKD 5EU5A 2EJ1A 3T1FB 2DQMA 1UH4A 5LHGA 5FB8B 1R0AL 4QY8B 2BCKB 3LS4L 4KI5C 4ONGH 5HD8C 1RP3B 1F4XL 2OIGA 4P0DA 3RB7A 3MBXL 1AQMA 1M90W 2AANA 3RURA 5L8JB 2AJ3B 3CIQA 2IMMA 2IGLA 2LU5A 4Z7UB 5C3TA 2E75C 5FM8A 2R51A 4FQCL 4AG4L 3I3DA 1K8DA 4HIXL 3VUAA 1BEYH 1N32B 4N0RA 2EINB 1L9TA 3EYUL 3HHSB 1MPAH 1F11A 2Y69C 3UCSC 4M3HA 3GMLB 3MYZA 4PJXF 4WI0B 4Z6AT 5C09B 3GHEL 1WFMA 4KJQD 4XMTA 4X7CC 3IRPX 3X13B 1G9HA 3RWJA 1WD8A 4H0HB 3JAWA 3T1HB 1CGSH 4YSAA 3V8OA 4PY8I 5E2TH 4U1KA 1KJ2B 5ITBL 1TTGA 4AJ0A 3DK0A 4RQQB 2XPZA 4MB4A 4CC4A 4ZPTA 4P2AA 1KLGA 2P5EA 2QQKL 4JPIB 1K5SA 5EF2A 1PGRB 1C5BL 3ESNA 3HUJA 1U92B 1RZKL 3CFJA 1ES0B 3D85A 2R2EA 3KYKL 2F8XC 1S9KC 1A8ZA 4NJAH 3ZKQD 5BZDB 2NXZD 4MD5A 4OZFA 2P24B 4NI6A 1UWFA 5CEZD 2HR3A 2N7BA 5DVLA 4FS0A 3U0WH 1VESA 3DX7B 4LCWB 1U9KA 2E47A 1KYOF 1G7PB 2G0LA 2JELL 3NSJA 4HF5L 4NGHL 4FNSA 4JG9A 4JQIL 2OWOA 5E1GA 3T0WA 2VYRE 4IHBA 2AJSH 1J7VR 3O6KL 1VCAA 4PJCB 4CBPA 4F8NA 1GH7A 3HNVH 3ZW3A 4P23B 3U4EB 1GGCH 3CPLA 3BWAB 4GUQA 3NJHA 3OLDA 4G8GE 1OP9A 2PWEA 4FDWA 3FB7A 3TV3H 3FYIB 1ITCA 1HWHB 1BLNA 5HBBA 1VERA 3MOAL 4GRLA 4U3JB 3L4UA 4TTDD 1G7HA 4XXCA 1OM3L 4OB5H 2W6IG 4XCNB 2JJSA 2W0PA 5CJQH 4ZPVA 2DIJA 4J9ZB 1O6SA 3DSQA 1U58A 5TISZ 1JZDC 3MV8D 2PI4A 4M93C 4MMXA 3G5XA 1T0MA 4OAWB 3MLUL 2ODHA 5LP6B 2FJGB 2P5WA 1R3HA 2WYHA 4LCUA 1E5ZA 4D0DB 3QUMH 4OFKA 4Z7VA 5LXVA 4PWEA 2XSKA 2BSCA 2ZX8A 4EOWL 5L3GA 3DX4A 4XMPH 2XT1B 1DBMH 1RHHA 4U1IB 5HI3D 5I5RA 2JQAA 1BHGA 1YSOA 3S36L 4R4FH 1E9OA 4ODXA 4F3FA 3LKQB 3CPWU 2XVBA 2YAHA 3CSTA 2OMWA 3IGAB 2CCWA 3PWLB 2C34A 5FYKU 3A4EA 5D1QE 1JRHH 3U9WA 3ZDXF 2EYTA 3MJ8A 1NJ9A 5E2VL 4FA6A 1JDCA 3BKML 5EC2C 2VW4A 3PL6A 5I17A 2UYLB 4IOSD 1GYWA 5FHAH 4OZGA 9CGTA 2WYZA 1J8SA 3SBRA 2E9IA 1DVYA 3SO3B 3LKOA 3ZKXB 5FGBA 1L9MA 4O4IA 2LGNA 3HBPA 3JUZA 3MJ9H 4LASL 1K4CB 1YEDA 3DRTA 4Z23A 4FZEL 1H5BA 2X53A 3O11A 3X12A 4H8VA 2NX5A 4B3RB 5FPRA 5LXGH 5FF6A 3W11C 5AAWA 2X40A 1TMQA 4PM1A 2WLLA 4HWZA 4ALAC 5ECJE 3BVXA 3QZOA 4S2SA 5D1QB 5EUKA 4YHHO 1A6PA 4JO4H 4MXVE 4XH2B 4P4KD 1OHHG 2B16A 2O57A 2XIDA 3CVIH 2Z91A 4PJBE 4P5MA 1X5JA 4XO9A 4WW1A 3IDXL 5IJCC 4PJ7A 4TVPE 4PA6A 1J5CA 3WNMA 4FCHA 3DJTA 1TEFA 5DQ9B 2I27N 2WQRA 4PGBB 5IMKA 4EI5D 1IBKB 3UACA 5I0VA 3IU3A 1UH3A 5MEQA 2VLRE 4NRYA 4UDTB 1CURA 1NSNL 4PJXB 1BJ1J 3D39D 1MIML 1OCZC 3AW5A 5B21A 1DQVA 1J5HA 3V4PB 3RLSA 2C9XA 2M6YA 4JG1L 3JWNH 1X5MA 3UC0H 1O6VA 3MREB 3H9YA 3BP4A 1AQDB 3CE1A 2WAHA 3IU4H 4I5BA 1EQWA 1GN6A 2P90A 1FL5B 4V1DE 1SF9A 4ONGL 1F4WH 1FAIH 1YY8A 3AG4B 2VCOA 1NGWB 2XX1A 3FT2A 3NTCL 5EBLB 1KBKA 3MACL 4J2QA 4GSUA 3RVXD 1M53A 4LLYB 5CHNB 1EFQA 3VGDA 5T1LD 4UU9B 5KYUA 4FQLH 2NMSA 4B3TB 2XXCB 5KSAC 1BEYL 3LZFH 4XMKH 5IZ7A 2JK5C 1E5CA 1NDGA 1MPAL 1KT2B 4X9YA 1KV3A 1HXMB 1U8LA 4JI6B 1BD2D 1V3JA 1Q9LB 1K34A 1G4RA 3EO9H 1SBSH 4N8VG 4NBYB 3EYQD 2I60L 5DHDA 3KPMB 4EE2A 1M9WA 4UCUA 5D96B 4G28B 5J2UB 1CGSL 3D12B 4RX4D 2V4LA 2NY5C 2XG4B 3DX1A 5FO9A 4QCIB 3SGKC 5A2FA 5E2TL 5GRVL 4F7CA 3QF7A 1IBLO 1PG7W 1UOWA 3B83A 1PCXA 3BUQA 3ROOA 3DNKA 4AQAA 1XR8A 4JFPA 1UHVA 3AC0A 1E4HA 4FGMA 4LVHB 5ECGA 3ECQA 4ELME 2GIMA 3B8MA 4LKCB 2D4FA 3VFPB 2UX6A 1QHQA 1KDIA 2AK4A 3R4DA 3WUZA 3WNOA 1SLXA 3GB7B 1ULVA 2VQTA 1IBFA 4WHDA 4NJAL 4UF7C 1J0HA 3TTYA 5JR1H 3KCPB 1LK3H 5IFJB 2O93L 4Z7WB 1V55B 2F19H 3U0WL 4YOKA 3NG5A 3NGBC 3O6MH 2A9HA 4PVBA 1UB6A 1LO0L 5F72S 3GHPA 4I55A 1LE9A 1N7MH 5BMVB 3D4GA 2ARJB 4F1ZA 4TNVK 3ZHVA 4ELKA 3HNVL 1E8WA 4UV7H 1GGCL 1FNGA 2WN2A 3DUSA 1S7UA 1AAJA 3ZDZF 4N2GA 4Q6IA 4AENA 2VDRH 2E9WA 1ECYA 4F7EB 1HL5A 2XLLA 4PW3A 4MA1C 3TV3L 2E7LA 4MXQC 3ZDXB 1ET5A 1UUNA 2NY1B 3CVHB 4U4IA 4OB5L 2NUTA 4OBSA 3T8MA 3CN1A 4JHWH 4V33A 4BK5A 3JYCA 4DJMA 1Q72H 5CJQL 1NH6A 3BH8B 3A23A 4FD0A 2WA4A 1GGYA 2YPLA 3OXRA 3CC7V 1FO0B 1JZEA 1LD9A 4NQCE 2X9XA 4I2XE 3ZJZA 1Z9SB 2VITB 3P3PA 3OMZA 5F44A 3VQWA 1ZS8A 4RDQF 1I4FB 1A8JH 2FZ3B 5EG6C 3WJJC 3C2SA 3QUML 1MI5B 2FO8A 4NFCA 4WI3A 2EXSA 1U8OA 4ASUG 2WNGA 1DBML 3FH7A 4IK7A 4XMPL 2CTQA 5AVXB 1WJZA 2X4NA 1WT5C 3MPCA 4KKZA 2LFGA 2EZOA 2J8UA 4R4FL 4BQ6A 4FG6D 4M5YH 5IOPB 2XN1A 2ZCEA 1UGNA 2BNQA 1Y4MA 3FU9A 2E8YA 3N0PB 1JRHL 2WAQA 4HU8A 3CCMV 1OW0C 3AWFA 4GS7C 3MHHC 1H19A 1JZ5A 2BVPA 3HAEG 3T0BA 4P9PA 1HKLH 2BIHA 3E0GA 4A7VA 3VQYA 2DI9A 3M88A 4MX7A 3GS7A 2D3LA 1N0LA 3MJ9L 3BZEA 3UAJA 5CLZA 3K5RA 4Y1AD 2B08A 3T4AA 4FABH 5A2CA 1OK8A 3HZYA 1LUWA 1QRKA 3GTTA 5IW6A 3SQBA 1IARB 1Q1JH 2QZQA 3V55A 2Z7ZA 4JFWA 2A1WH 4P3WA 2VN7A 4KZEH 5J4MA 3CN0A 3CMGA 1GOFA 1GH6A 4YY3O 3B9KB 1BFOB 4LFBB 3PLYA 4JO4L 5EIIA 1UWGH 3CVIL 4XR8C 5A1AA 5BJTA 5E6IC 3X2QB 4YFLF 1DQDH 5F21B 5ES4B 1KXTA 2MHAB 2W07B 3BRFA 4QYOA 1HQ4A 1FSKB 3G08B 5FYKL 3UCQA 4W9LC 3BN3B 3QFJA 2W0XA 3WG7C 1AGCB 1AVMA 1NFDE 3C9NB 1RJCA 1J8HE 2DQGH 1XNQB 2XI9A 4F8QA 4ZFGL 3A0BZ 2YEQA 4QKXB 1HOCB 3ARFD 1N12A 3P2DA 1ZHLA 1QEWB 1A9BA 4EN3D 1DDTA 5A2AA 3D07A 5AYUH 3EVKA 4MNGB 3KKYA 1RU9H 2CU9A 5TQ0H 3VNZA 3FQRA 3W9DA 4YXHH 2YI8A 5HPOA 2CGZA 4ZAKD 3VX1A 4GAYB 4I13B 4YHOL 3VGEA 3PE9A 4P2OB 4JRYE 2X2IA 3FHEA 3CC2V 5EC1C 1TQBB 1CXFA 2BP5M 4F7TA 4QNPE 5HI5C 4M9OA 3OC8A 3TC9A 4LFAO 2GCYB 3IU4L 1OCCB 3WKYA 5LAXA 4EBQL 3MBWA 2W6JG 1LEIB 1OVZA 1FAIL 4N2AA 4QOKE 4OY9A 5F2FA 1F23A 2AQSA 1PKXA 4ZI7B 1PPIA 3L7EA 5DJCB 2ZKOA 4U1GB 2YD8A 5E9DD 4FQLL 1G6VK 1N2RA 2DPKA 1YEHH 2QWQB 4XMKL 2DLHA 1IAOA 3GI8H 3RY5A 3T0ED 2HCZX 5HGBA 4X5XB 5IIEA 4MVBC 2XPGA 2H47C 3EO9L 2DQ3A 3ZN1A 1SBSL 1J05A 1EFXA 4TUYB 2W80C 4JY4B 4N5ED 1XB8A 4Y5XB 4J3OH 5I5IA 1F00I 1M1SA 1YMHA 2PTVA 1VADB 2P7TB 1MCDA 1ORSA 3H1HH 2VMFA 3ENEA 1ESOA 1BIHA 1TF4A 3CMEV 3ES6A 3QUXB 3VXSA 5T1JA 5C08A 3ZDZB 1B88A 2YRBA 5DJ6A 5C92A 3FX7A 2YD2A 1K5NA 3AT8A 3GSRA 2YSUB 3QNZB 3KPSE 4QRQA 4X7TB 1QUNB 5D4JA 4BA0A 6FABH 3GVMA 1OZTG 1KUMA 3JASB 1DQJB 1IC5H 4KZCA 2EO7A 3BDBA 3G6JA 4G43A 1LK3L 4OF5A 3GMRA 1UT2A 3SSGA 3QH3B 3VD3A 1NLBH 1OCWH 2DS4A 3O6ML 3JD0A 3KPRA 3OEEG 2FCBA 1NOAA 4DV2B 3F7VC 3FCTB 1E90A 2E59A 1DANU 4FKEA 3QJVB 3VYNA 1BV8A 4NKIH 4NQUA 2VW6A 2JGDA 2BOBB 4XNMB 4BFEA 3TYFA 5CEZE 1UXSA 3ZR6A 4IBQA 4JAMA 4UV7L 1CFMA 1KCUH 2G9HB 5EC2A 3QDJA 4AK1A 1MAKA 2K6YA 3VDAA 3FRPG 4AY0A 1VAHA 2GJPA 1IC1A 3B2XA 3OKOA 3KPNA 3QHZH 3FQNB 4MTOA 1Z1WA 3H42L 4JCWA 3WO4C 2AJYH 3EOYG 3UBXB 1C16A 2QVTA 2VOTA 5IQ9B 2KQXA 3RZCD 4XOCA 4JHWL 1I7UA 2WTRA 3B2VH 1Q72L 2Y4TA 4WQOA 5BVJA 5AW6B 1T2QL 1TVDA 2BMKA 2DQIH 5ISZB 4FYRA 5B39B 1RERA 3MV7D 4IHOB 1RZIB 3CUPA 2PPFA 3DLQR 5CJ5A 1Z5HA 4Y4KC 2M83A 2HVJB 2CM5A 4PDVA 1JZ4A 3MV8E 4P2QA 5J9PB 2KG7A 4LLUA 4U6YA 4MASA 3PWNB 4OFIA 4WHYG 4H5SA 3RVXC 3VWKC 5C8YA 3MZGB 3WN6A 4M5YL 2X09A 1AZBA 5EB9A 2IH8A 2Z35B 4AEIH 4PJAE 3VQ1C 2QPDB 1MJUH 2X4PB 3ARZA 3ZHNA 4BZ1A 4K7PY 4BSWB 3CXHK 2DW5A 1YDPB 2IJIA 1HKLL 3QJQB 5FYJU 3W9EA 5DJDB 4BINA 1JZJA 4OIBA 1NAMH 5D6CA 1SJEB 2F7IA 3EYQC 5AOJA 1HC1A 4AEEA 5FDWA 1IILE 3EXJA 3TBYB 3G71V 4RVBA 2QGCA 1GGBH 3BIKB 4N2IA 4FABL 2EUWA 4IRSD 3U9PH 1E8ZA 1MHPH 1Q1JL 1GKEA 1XHZA 2HAZA 2L35A 2A1WL 1XGUA 5H35A 4KZEL 4W4LA 3TF7C 3EF7A 4WO4C 1QA9B 4NIKB 4BFNA 5LQBH 3UJTH 5GZNC 1UWGL 2WINA 4XRCA 3AQXA 1DQDL 3H85A 3MV11 4N1CA 3HFFA 5C2BL 3SE6A 4MJ5A 3A24A 2ARJQ 2J8HA 5KSAA 1VQMV 2F5BH 3ZHRA 3QZBA 3C8KB 2FTAA 4P3DA 3QT2A 1I85C 1UH2A 2JK5A 2DQGL 1BPVA 4IBWA 1GM9A 1GN4A 4WFHD 3MUY1 2XWTA 2DM2A 1SHXA 1F7YA 1XGZA 1QVOB 2JLLA 5AYUL 3CFKB 5BR8B 1IBMB 1ICTA 1SUJA 3A6BL 4OCWH 5E5MB 4YXHL 5TQ0L 1N8ZB 1SF5A 4AGNA 2UUCB 1ZSDB 5L8LB 4PCTA 2RDCA 4JPKH 3SGKA 4MSWC 1X9QA 4ONOA 1JJUA 4JI8B 5K9OB 4GB9A 3UMNA 5IBTL 1WA8B 5CKAA 1PQZB 3QG6B 1R5VB 3D39E 2I26N 3B7YA 3MRGA 4KAQL 3F7KA 5IV2A 4HUWB 1L7TH 4BYHA 4HDIA 1N19A 1V10A 4G6MH 4JJ5A 1BZ9B 5JHLA 3EO0B 4WGKA 3U6XA 3TCLA 4OSUL 2QA4V 1WC7A 1WZMA 3SY6A 1HEZB 2BNRD 2GHZA 3HG1D 3PHAA 1L6PA 3AXHA 4KY2A 1YEHL 4UT9H 5EEYA 4PELA 2A6KA 3GI8L 3H9SA 4X99A 2YAPA 4R0LB 4CMHC 1XBRA 4GINA 1DLBA 2CBMA 2KS0A 2X9YA 3CIAA 2F54D 3O8XB 4MQ7A 3VSTA 2K1EA 3OKEB 1BYOA 1DCEA 5IB1B 3QE5A 4K5PA 5KLVH 3N9GH 5D9SB 2YRLA 3ZN6A 2YMXH 4FFBA 2XWXA 4HOMA 3BJ91 4CUCA 5DO2D 3W0WB 4FLWA 1BD2E 5I0YA 1MAJA 2VM3A 4HZLA 3VG0L 3Q9PA 2N4IA 1XR9B 5I6PA 3MHZA 4BKSC 2WHVA 5L4MA 1R3LB 6FABL 2YO3A 1W72B 2BC4B 3MUUA 2A9AA 5JMOC 3UPRA 4NRZB 4FHBD 3MUJA 3L75H 5E56A 5HPMA 3GMNB 4DUVA 1IC5L 3FU7A 1XEDA 3KBEA 5AALA 3BKYH 4KY1H 4LPWA 1KGIA 1NLBL 1OCWL 1N5YH 3DC6A 1G9NH 3BUPA 2JEXA 4UOW1 1WT5A 4PV9B 4ANWA 4M29A 4NZDA 5TDOB 2NYYD 2LVCA 3VI4A 4FIPC 2XVGA 2JQZA 2IOMA 4OKDA 4GBXA 3DUUB 1JYWA 5DEFB 3WIAA 4DP9X 1KCUL 1SETA 1L3WA 2P8PB 3LN4B 4GY4A 2R9RB 1OW0A 3B7SA 4UV4H 3TYGH 4DVBB 5JDJA 3K71A 1SNRA 3IJYA 5B1JC 1FZJA 4QO1A 5GS0C 3QHZL 3KPQA 2QTSA 2AJYL 4CL7A 1R6NA 2YPKB 4AXWB 2J6EH 4JB9H 4M5TA 1U2YA 2IDSA 4FNRA 3B2VL 4QTHA 1IZ3A 1TUBB 1J95A 3O3BB 3OGIB 2YLKA 3QIBD 4M5SA 3RL1A 2DQIL 4HUNB 1WPBA 1J8KA 5GGTL 3IMBA 2JLPA 4AQ8C 2VLMD 3BHBB 3M45A 3QJOA 4L5FH 2ICES 1N0XL 3GXTA 2GBUA 5BRQA 3KLHD 2R0WH 3VFUA 2ZR3A 2EUXA 1AO7D 1AIFA 2O26U 2CXGA 5E6IA 1KIQB 3L45A 4J42A 5SV3A 2NYZA 1HXYA 1DBJL 4IDLA 1XGRA 4JPSA 3RWIA 1BE3H 5AWNH 4AEIL 5MENE 2X9ZA 1MJUL 5FUCE 1SQQH 3S5LA 4H0LB 2BSKA 1HILA 1L9QA 4HD5A 1S9YA 3TBBA 1AY1H 1NJIW 1A6TB 4WJG3 5LBSL 5C0AA 4F27A 1DJSA 1DN0B 3ZIYA 5CBHA 2CO1A 2V7HA 4YNYA 1I1RA 5C0CB 1UA6H 4DGUA 2NY2D 1DUZB 1H3WM 5D7KD 1ZA3A 3UP6A 1GGBL 2QR0A 2VZ1A 3CZFB 3TVMD 1SJHB 3U9PL 5LL6Y 3AUWB 3HPJB 4HS8H 1MHPL 2H6PB 5EC1A 3MX0B 3VB8A 1ZT4A 5B38A 2J55A 3PY9A 4OF0A 4Y1AE 3ZRSA 2A3QA 4Y7MA 2DQCH 4FHJA 4WWNA 3LQZB 1GR7A 5LQBL 5HHNB 4RFNB 3FW6A 3UJTL 3W7TA 4AILC 2A0LC 5DJ8B 4GCZA 2GTQA 4I3RH 3TOPA 1IEBB 3EYVA 1THCA 3PAYA 1XXFC 5EZLB 3D3VA 5E94B 2W0FC 4KO6A 1WZKA 2JE8A 3W1ZA 4NPYA 2K3TA 1K92A 1ZA6A 1OF2A 5FYJL 2YPVH 4JFEA 2GSIA 1KENL 5IMOA 5FO8A 4PJBF 3IETA 4LRIC 4LP5A 4OCWL 1QSVA 1VRSA 3ZYOA 2HB0A 4RMWA 2OCCB 4LH6A 2J1YA 4JPKL 2B9ZA 1KDJA 5I0XA 5FUZH 1WB7A 2IV8A 3RZCC 2D31A 3S3BB 3TPKA 1IIKA 4LVEA 2ZAGA 4NTWA 3FB6B 3O6FB 4OIFA 5EFIB 2CUAA 4XWOD 1GGIH 5F0PB 1NGZB 2LOEA 5EO1A 2P8LB 4C56E 4DEUA 5CZVL 4BR6A 1L7TL 4RWHA 2X6VA 4P30A 4JFSA 1YG9A 3MR9B 4JI1O 2KZBA 4G6ML 1J5DA 2CAKA 5G5DB 2HMID 3AADB 5KSUB 1GOHA 2K4WA 5FDYA 4LHUB 1CFSA 1F1AA 5LA6A 4F2FA 1E1QG 4HWBL 2WVSA 4Z1PA 1MVYA 4UT9L 5DSCA 3F7VA 3FBQA 2XV2A 1EZVH 4DP1X 3KJ4C 2F2HA 4TMPA 4L2LA 4Z5RB 1KCBA 2UV3A 2AI0H 2OMNA 4K8XA 3HA0A 3IXAA 5DUPH 2NTFA 1O9GA 5E9DE 2WQAA 2C8NA 4PBXA 4G6KL 1XF5B 3N9GL 3T0EE 2YMXL 2ICWB 4E9YA 3U1SH 2V4DA 2VKWA 4HUKB 4AV5A 2ZNJA 3SPVA 4LF9O 4X6CB 3ISRA 4M7LH 3AMKA 4YS4A 3L3OB 2HEPA 3TZVB 3BWUF 4ZW5A 1QPXA 4OZ4B 4XMVA 2XC8A 5JIMA 4FFKA 3TEZA 4MTGA 4QT5B 3U2JA 3IGKA 4B3VA 4CDGC 3BKYL 3TJPA 4KY1L 5CNHA 3DO7A 4KQ0A 1M4KA 1Y7VA 4Y4KA 5H94A 3VTAA 2FUQA 2PN5A 4YJZL 3HAEH 1N5YL 1N59A 2P44B 2WJ7A 1KLFB 4ELMF 4X7DC 3K4AA 3GM8A 3VWKA 3QR1A 3ARTA 3CRQA 4LF8O 3IS0X 4M8QA 2VZ3A 3KXFA 3IDIA 4BE6A 2C9UA 4XWGH 2A6JB 3OWRA 4UV4L 3UTZA 4P48A 4WFFE 3TYGL 4R96B 3VD0A 15C8H 2O30A 3BVDB 1T04B 3ZHSA 4KVCH 4DRXB 4JPRA 5BS0B 4ZK8A 1VF6C 4XZUA 3NFPA 4PRIB 2HPOA 4Y5VA 1Y0LB 2J6EL 3C6EA 4JB9L 4KO7A 2GSGB 5E0FA 1ERNA 3VO0A 4JYYA 4Q7DA 1FL6A 1Q8MA 2BOCA 4FNLH 4FQ1H 3ULVL 3I6LD 3DI3B 3KYNA 4F37K 2H26B 4L5FL 2HTLD 3VFNA 4WO4A 1CPUA 2R0WL 2FJSA 3SGDI 4AUUA 1HNFA 2CCVA 1NGPH 5GZNA 3V5KA 2UVEA 2D7TH 3MBEC 4FXTA 4YPJA 1UENA 4R97C 4MTXA 1RZKC 5C6TH 2IM9A 3VXMA 1EK3A 4PJ9B 4GLRH 5KBPA 1ZTXH 5EU4B 3KM2A 4M1CC 4L0YA 5K39B 4H8UA 4NQXB 4JFYB 1I85A 4L3AA 3F8UB 3HMXH 3AS1A 4WBNB 1WJ3A 4NO3B 3SE4C 5AL0A 4LEOA 1AY1L 1JPST 4FA7B 3BAJA 4JM2F 2DH3A 3MMEA 1V7NL 4G72B 5FNVA 2DL9A 4YO0A 1IRAY 5ETUA 1SOXA 4JASA 2WSSG 4A68A 1UA6L 2EXTA 5H4ZA 4PJ8B 4Y16C 3TGXA 1GC1H 1VFAA 2GTWB 3LNNA 5GGRY 4XBFA 2G5BA 4JVPA 5DO2C 1YJ9V 3AT9A 4FFVD 3O9WA 3R65A 3U1QA 4MNQA 5FEBA 4PJBB 4HS8L 1W0WB 5SX4H 4EI6B 5F6HI 1SQVH 5EU7E 1ACCA 1SDDA 4J80A 4QF1B 1VKXB 5FFGA 5D1ZI 2DQCL 2QADB 1J0IA 5DYOA 3B56A 3ZY7A 1BVKB 1Z32X 2X4RA 3HKCA 3C60D 1I8AA 1KIUA 2NXYB 4M1DH 5DK3A 4CVZB 2DYSB 4X64B 1YZZA 4I3RL 4Q8BA 3ROLA 5BXFA 3N40F 3BWSA 4O2FA 5ELIA 3T9WA 4RMBA 3VA6A 3GPEA 5IMLB 1S7SB 3HRZC 2VDOH 1HINH 3NJMA 1Z5VA 3RFZB 4GX5A 1M7IB 4IRZH 4X0KB 4ZG1A 2WYIA 1G7QA 3TNMA 1A6ZB 1TPXB 1FUNA 1FV1B 2YPVL 2IDFA 2KMWA 5DM6V 3NJGA 5CZKA 5CAYB 3SB3A 4RQEA 5GIRA 3UTQB 4G1MB 1WZ1L 4MJJA 3CS5A 1EZVY 1UXLA 1RJZB 1VIWA 2VABA 4PLJC 4V1DB 4LF4O 2CTPA 3U83A 4ZMVA 4JUSA 4DR4O 1CGWA 2AVGA 3K2MC 1NFDF 2WKGA 3RVWD 1S3RA 2OL3H 4BFFA 4AGPA 3D4CA 4KXBA 2G75A 1XNRO 1CS6A 5F9WC 4BK8A 4E41A 4N90D 1GGIL 5F88A 1NL0H 2G60H 2RR3A 1CDBA 1M3IA 5E2WH 4NKQB 1AP6A 5FOBB 1M71A 1YPZA 5DHXB 2KI6A 1QX1A 1R3KA 4PRBB 3STLB 3FO1B 5D1ZD 5IJ9B 3NAAH 3OTFA 1URIA 4YIPA 4Y9GA 4KROB 4QNPF 1J0YA 1N5AB 2B14A 2FUTA 3K0YA 3NCWA 5EF0A 1GYUA 3MUGA 1MJ8H 5EEXA 2IW5A 2R0ZH 3F7QA 4DV5B 2FWOB 5J3HD 2AI0L 1Q43A 2H2PD 2OXGA 4PTUB 1ZVHA 2BNRE 2LTQB 1JGDA 2OX5B 2Z93B 1CCZA 3NP3A 5DUPL 3SKUD 1WAZA 3WY3A 4ELMB 2BRRH 1TENA 1FZKB 1G7IA 1H38A 3ZL2A 3OX8B 2NY0C 5A2KH 3DXAA 1I9EA 2EXYC 1DVFC 3C5JA 3U1SL 3L5XH 5C70A 2DV6A 2O6FA 1PZUB 2F54E 2YWYA 2P49B 1YMMD 5IE9A 1EEYB 2HJKB 2YDEA 4X1IA 4ISVA 2NY2C 3L4VA 4ZSOA 3QHFH 4M7LL 3OVUB 1R3JB 1CGTA 4MCNA 4WHYH 5DZJA 1NC4B 4I3GA 2H1PH 3TVMC 4ZDHB 2GUZA 3WY1A 5IT9N 2ZUSA 1UG9A 1WGVA 4NNYB 1BGXH 5CEXB 3O3UN 3BPLB 2P80A 1BYNA 5TDPA 3O2WH 3QUYB 4X65B 2GTSA 3DTUB 1JXDA 4NZTH 3L9RA 3MSPA 3W57A 1QEXA 3CXDH 4PV1B 1K8IA 3BP5B 5LDSA 4HT1H 1XTLA 2MKWA 1YY9D 3RX7A 5IHHA 4DERA 2DRUA 4R5VA 3U2SB 5GS2H 4EEEA 1EERB 2ICWJ 4YDVB 3MAQA 5GGSB 3RA7L 4UQCA 1OSZA 1H2NA 2H3NB 1LP9A 2BVTA 4XWGL 2FL4A 2HT4C 1JZGA 3QDMD 3QJTB 3MRMA 3MKKA 4HWEL 1F41A 3UDWA 4X66B 5DQDH 2FT8A 4FMKA 15C8L 2DJUA 4NQCB 3D3IA 1A4JA 1WLHA 1JWUB 1HHIB 4K55A 4KVCL 4AITA 3S5YA 5K69A 2YI9A 4WEEA 3OZKA 4JM2B 5I82A 4QGYA 3C5SB 5I1IH 3AK3A 4I5SA 2E9GA 1KFAH 3WIFB 3AQZA 2IH1A 3IGUA 3TO4B 4FNLL 2CK3G 4FQ1L 3K3WA 3FO9B 2F1AA 5HHOA 5K9JH 4YIQB 1IURA 5KYYA 4JY5L 3K2UL 5BOPA 1P49A 3WTVA 3L72H 5B3SC 1IAIM 1TTFA 2VISB 1NGPL 3L3IA 5TK4A 5A6MA 2D7TL 5A2LH 3RGHA 2A0LA 5BOJA 4I9QA 2ZAIA 4QR7A 2MNJB 2OSWA 2H2SC 5C6TL 2VLME 2YXMA 2UUAO 5C7XH 4BFOA 4NYLA 2Y22A 4RMQA 4AHCA 1ZTXL 2W88A 1SYSB 3GBLA 5CSZA 2VE6B 3UROR 3US1A 5IMMB 4PP1D 4BCZA 1AO7E 3K5MA 4WUUA 4PA9A 3HMXL 2WQWA 3CWBH 4N21A 2VDKH 3C8DA 1M1XA 3JV6B 3OB0H 4XNQA 2IG2H 4ODHH 4AJYV 1NIBA 2JKLA 4JI0O 1B4JH 3UTPD 2P5EE 5EBWB 3DOSB 3LKPB 2FSEB 2G3MA 1AGEB 2RQ6A 1B3IA 3GXUB 4I18B 1T1ZA 1H6EA 2QJDA 1GC1L 1OSEA 1BQHB 4PJAF 2AXFA 5HI4D 4JYCA 4UB0H 4J39A 2ATKC 2DMBA 1XV8A 5D5ME 4CH5A 4OJYA 1JFQH 2D9QB 1FFPB 2FECI 3E8UH 5DVPA 1N8OE 3LHPH 2LQTA 1IFHH 1NFDB 4P8QA 1J8HB 2DW4A 3N1GC 3DVNA 1DVXA 5HYFA 4JKMA 5D2LA 3AVEA 4KQ3H 1SYVA 4NCC1 5IB4A 2R4RH 3GMMA 3JALA 4OQTL 4LNVA 5A40E 3SQRA 1UTDA 4L8DB 2WLIA 3LRKA 3BD3A 3A5VA 5D7SL 1T0NA 2VDOL 1HINL 2VRZA 3S4SB 5EF1A 2MJWA 1B04A 4IRZL 1E6OH 1JXJA 1N64H 1ZGLA 5IHBA 5MEOA 4LBEB 3HC0B 3T4ZA 1E28A 1UD8A 4JRYB 4B6ZA 5DQJB 3SKOA 3CAFA 4UV9A 4NVPA 2IFFL 4HEPA 1A4BA 4MQXD 4D8OA 3ZZQA 4N28A 2C9RA 1KYFA 4JN2B 1M93A 1EBPA 5D71H 1NM4A 5DVMA 2V7QG 4J3OD 3EGXA 3LZNA 4FFYA 1NCWH 1SQBH 4XPBH 1E5BA 2OL3L 4HOXA 4TSBH 2P45B 2EE9A 3HS0A 5CD5D 5ITZB 1DUYA 1QHPA 2EIJC 1NL0L 1EHXA 2H4EA 2C3WA 5E2WL 4Q6KA 1RM1C 2CNYA 2WB7A 3RY4A 4KMTH 1D7FA 1LEKB 3CFTA 3U0TA 3CFEB 1A6AA 1MREH 5F7UA 2OYKA 3NAAL 3Q8AA 4G59C 4OGAC 4B50A 2JKRM 1TUEB 5LLIC 1DVZA 3JTTA 3KBPA 3WS3A 4KUZH 1MJ8L 2FWSA 2R0ZL 1NBCA 4YHNA 3K8MA 3RNQA 5F1NB 4O02A 1WWAX 2FQGA 4R3SA 3IEAA 4IU2A 5FYLE 5SWSD 2BRRL 1GZQA 4DESA 1E4XI 5IJVB 4IEFA 3PXHA 3KPSB 1U96A 3INOA 3B37A 3QWOA 2VMDA 1D5RA 1MABG 5E23A 5EU6B 3L5XL 3UERA 3TBWB 2OSLB 2ED7A 1Q8IA 1VF6A 3RYCA 5DJZA 1DDHA 2UXCO 2YEZA 5LGUA 1R5IA 1U93B 1RZGB 4ZXBD 4B41A 1FZOB 5KS9A 4CBZA 1ZHNB 5I66B 4RMTA 35C8H 4FFVC 2Q0AA 2F7PA 3RP1A 2IQ9H 2NXZB 2NQDA 4WKXA 1BGXL 1IZJA 3RKDD 2HA1A 3WSQH 5KYWB 1EZUA 5EOTB 4NSKA 3O2WL 1OQXA 1EH9A 1DVTA 3IF1B 4M6NH 1MN4A 3JWNC 4HNAA 2ZQKA 5KSBF 4NZTL 4Z0BL 3L6FB 4NQVB 5IYCO 4Y2DD 4B9PA 1VQ8V 5D7JB 4FPPA 2XTAA 4JE0A 4HT1L 3MBEA 4C7UA 2FX9H 3C60C 1D5ZA 5E00A 1RZ7H 4PTTB 2GK0A 1MFDL 4LVNC 5AZEH 2Z0UA 1U8KA 3HG0A 1HJBC 1GO3F 4G9FB 4N2EA 3OD4A 4JYBA 1V54B 5IK3B 2HJLA 2CUGA 3ABMB 3SE4A 5JPMB 4XN8A 4L23A 1FFRA 5DQDL 5HDOA 5TF1H 1J1XL 3TA3A 4JQIA 5FO7A 3WXVL 4F8TA 4IS6B 1UA3A 3O3AA 3QNEA 2OTLV 2A38A 2C7UA 1PD3A 2YD1A 4Y16A 4EO5A 3T6WA 3IFLH 2FWLB 2UU9O 4HV8B 4K3JH 5I1IL 1OY3B 2CJUL 4OCXH 3PFUA 3FB8A 5JJJB 1KFAL 1X7TA 3QEQA 1E2VA 4LSPH 1CIUA 4F33B 4XPGH 2SEBA 1NCBH 3LEVH 2OXHA 5KHGA 4WNSA 5K9JL 5HJ3A 1HYSC 3FUNA 2Y7QA 2N1KA 4XVOA 3G5ZA 2HVKC 4FLRA 4XDLA 2VMEA 1Y74B 3CHSA 1L3NA 5IVNA 3FTVA 2FO4A 4WFGD 1E40A 3OGOE 4X62B 5D1ZC 1ZK5A 4XT1C 4HCGA 4K3DH 1HSBB 3POHA 3VQLA 3HRZA 1HHHB 5DJXB 2FEDD 2NCEA 4X9GA 4B7EA 3DKHA 1BVNP 4ODHL 2DBLL 5FPOA 2FO1A 1B4JL 3GSXA 2VZOA 5DC2A 5ICXA 5J7CC 1JR9A 2YIBD 3DV6B 1TZ8A 3GEWB 3AU1A 3DXRA 1KKDA 4PS3A 4D7TA 4UIMB 3V0EA 4QRTA 1OOWA 4MA3B 4GKNB 4DV1B 5D2NA 2DLGA 4JFQA 3RGVD 3BHPA 3CDCA 1BEXA 4PB0L 1KTKE 3K79A 1SHSA 4JANB 1HT6A 4WU7A 3E8UL 1CICA 1MWAB 3LHPL 5FW8A 3REVA 1JSYA 3G7TA 3LKNB 1IFHL 3K5NA 3GDCA 3BO8A 4PBWD 4C4BA 1WBXB 2FR4A 5CCKH 3REWA 4OV5A 3LX9A 1RAMA 3FT4B 3PREA 1CTNA 4KQ3L 3SPCA 1KB5H 3MRJA 1Q90A 1O6TA 2DQEH 2R4RL 3D2UB 4HKZA 2Z8WC 4W93A 3GSVB 2K9PA 5E8NB 3MV9A 5D4QA 4XVUC 1E6OL 1N64L 2VLKD 4MD4A 4BKLA 2FB4H 4YSPA 3MXWH 1N34B 1SMDA 4UCOA 4TV8A 1BJ1H 1WIUA 2J5LB 2QVMA 5CF3A 3IDJB 3QRGL 1HHGB 1OB1A 3ARED 3TJTA 2PYED 1SKVA 2LGWA 3D39B 4L8SB 4B3RO 3UBXG 2GTZB 3ZTCC 3ULUH 4KHPO 1VFOA 3Q8CA 1DVFA 5IM7B 2N7SA 2AW2A 4PWKA 2XASA 2VRAA 1SQXH 2YXWA 4I9WD 3T8XB 3VMOA 5B1AC 3WJMB 3E22A 1NCWL 4XPBL 4FP8H 5DRXA 4TSBL 2CUIA 2VJXA 5B39G 1LJMA 4AEHH 4G8FB 1TTBA 1EAPB 2H9GB 3PNWB 1SHMA 5L2KA 3HNTH 3TGUH 3M99B 4QJFB 3OZ9H 4ZOCA 1KXQA 1MLBA 2ENPA 4KMTL 3BP6B 2BNQE 4EQ3A 3H2PA 3PRZA 5BZBA 2PABA 4NQEA 4PRHA 1U95B 1MREL 3LJ3A 4GO9A 2NT0A 5IROA 3L73H 3CXFA 2ZCLH 3M17B 4N90E 5G4MA 5JOPD 5JW4R 2NNAA 1IBKO 1DYZA 3LH2H 1FCGA 4CC1A 4YHIA 1RZ8A 1TNMA 3G5VB 5AZ2H 4NQDD 4KUZL 1SERA 4QHKI 4UFZA 5JNYB 3BXNA 5KSBB 4IBZA 1KIRA 3T0VA 5TQ2H 3DETD 1WFUA 3KDMB 4XNDA 1FHGA 2PCYA 3KHQA 3DGCR 2FWUA 3MRRB 1YHQV 3ZR5A 3L2MA 1YVWA 4L3FA 3K6DA 4ZQKB 5HYJE 4FLUA 3NIFE 5EPMA 4JY6B 4A63A 5LN8A 1MLCA 3AM8C 3WELA 4HHAA 2CWRA 5CEYB 2IBZY 1T66C 5AOZA 2XPYA 2FBJH 1O5PA 2Q5BA 1F45A 3V7AE 4OD2B 4MVMA 3RVVD 35C8L 2DQJH 4H26A 4RWYH 5IYZB 1YMME 1NDMA 2GVYA 3LQMA 5CN2A 3WSQL 2CO7A 1CWVA 3QFJE 1RVFL 5JW5B 4M6NL 3EJRA 1G6RA 4R8CA 4M9PA 4IT5A 5ANMB 2ETWA 2NR6D 3N2KA 1BIIB 1IGCH 4U0RC 2WK2A 4W9DC 4LLDB 2FX9L 1KJ2H 3ARDC 1RZ7L 5AZEL 2FVNA 4NKDB 1KTRL 1I3VA 5SX5K 3C5ZB 4LEBA 1NWPA 2Y36H 2CRIA 3CD4A 4NERA 2X2HA 3ESUF 4GNKB 5KBNC 4KZDH 1SLVA 5TF1L 1Q9WB 4WY7H 4G6JH 4X4XA 2W9LA 3CSGA 3B34A 4MQXC 3LTVA 3N41F 4UDUB 3U6XS 2Q7EA 4ZKIA 1SPDA 3GJEA 3WEXA 3IFLL 4JPWH 1FC1A 4K3JL 5LBVA 3CFDA 4M1GH 4J3OC 4HH9B 3BAAA 1TVKA 4OCXL 1N18A 2YC1B 1CGXA 3OKLA 3K6SA 3NACL 2LLNA 2VL5A 4MJ6B 1NCBL 3LEVL 5CD5C 1NOFA 4NO0D 5MENB 2C3VA 4P46B 4FFWD 5TDNA 1OTSC 2VJ0A 1BXVA 3ZMSA 5IKCB 3U4KA 1JTOA 3ILQD 3VXOB 2CIKA 2ORBH 3V9EA 2PTUA 2YICA 4K3DL 5I9QC 3MVSA 4FYQA 3P54A 3QUMA 1HDJA 4RDBA 3VXSE 5DJYA 1LWHA 4PY8J 1KN2H 4JDEA 2CH8A 4X5WB 3NCJH 1A3RH 2BW5A 2GT9B 3BUYA 1U91A 5DI8B 5EZIH 1AYRA 3TIEB 4J3BA 3VXPB 2OMBA 1SVBA 3ETGA 2YAQA 4OUUA 4N9GA 2E4TA 4Y1AB 4U7SA 4LL4A 1ZOXA 1S7TA 4D8PB 1S77D 3DHPA 3P0VH 3GFUA 3UTPE 2DM3A 1I9JH 4UQEA 1QOKA 5KSVB 1QG3A 2ARWA 4EZMA 3ZIAG 4NN5C 1DVSA 2I9TB 4APQA 4ZXBC 4U2YA 2ITCC 4F8OA 2ZWLT 2LU3A 4XBPB 2DWDB 1FGVH 4HIEA 3F62A 3TETA 1S9VB 1RURL 4QMEA 2ZXWB 3AU0A 4HU2A 3VFOA 3RTQD 1HSAB 3M07A 5B8CA 3QO8A 3WFCH 3CZKA 4DCQB 4CJ0A 5CA3A 3MLWL 3OPUA 4OKVB 4JZNA 5HY9A 2JCCE 5KJRH 3OR7C 4Y2DC 5DZAA 4LKXA 4YMPA 2QZ5A 2DE0X 4WEBH 5DGQA 2NW2B 2OP4H 4GG6A 1JPFA 3ARFB 2X6UA 3GUFA 1JHKH 2FB4L 2BX5A 3QXAB 5H6RA 3MXWL 4H1LA 4HMEA 4HLEA 3MNZB 1UVQA 3QEHA 2B39A 4YBLB 4ZAKB 5I1AB 5F9AC 4C56B 2NNXA 2ZG1A 4NUGH 5EORH 3ULUL 1UWXK 3UAAA 1KBBA 1QHOA 2D2CB 2NZ9C 4NZUH 1MCCA 2C9PA 1GGUA 4Q4EA 5F96H 4NUJB 4ANUA 2IJKA 1JXFA 3D2TA 2UY6A 4P2QE 4AEHL 1LWJA 3IJEB 1EIBA 32C2A 3F01A 4NQQA 5A2BA 4OFQA 3HNTL 3OZ9L 1JCVA 4H44B 2TRHA 2CGRH 3KBFA 3G4SV 2I07A 5IJBC 1ZHKB 4HBCH 5K9QG 3SDAB 3A4DA 3JWDH 4I0PB 5E9DB 5I0ZA 2ZCLL 4I0KA 4Y9CA 4PW9A 1F3JB 2IPKA 4Y1TA 3T0EB 3TPUA 3V4PH 2Z7YA 5AZ2L 1L9RA 1NMCC 5D7IE 5F9JB 5JLZB 4G2AA 3N85H 4M02A 5TQ2L 1NPJA 5ICZB 1L0LH 3G6DH 4UMGA 1QATA 2ESVA 3F65A 3EJYC 1P7QA 1DJYA 1T4KA 2FEDC 4XNZC 4KTYA 5CWSA 2V3DA 4OQ1A 4NN7B 2QDOA 3OKNB 3HKDB 3P77B 1XQ4A 2K0RA 3F7YB 2DMXA 2J56A 5EOQH 6TAAA 1U2HA 4L2YA 4A7TA 2FBJL 4A39A 1QO3B 4TQDA 3VA2C 2Y5TA 5SX4I 1V05A 5FGSA 1VCBC 5EEWA 3JVGC 2X4QA 1N3NB 2DQJL 1S7XA 4RWYL 3N41B 1F58L 3IJ4A 1YLBB 3BPNB 1ZRUA 2O5ZH 3FZUD 2D7OA 4PJ5A 3TS8A 3NT0A 4F6RB 3DARA 3PDOB 2F4VB 2QHLA 1IGCL 1Y6KR 1N0NA 4UMSA 4KUCD 1KJ2L 2AGJH 5FGRA 3ECVA 3IGFA 2OJEB 3FOLB 5KVMC 1S0VA 3ZBHA 1WRFA 3QDGA 4A2EA 5CLWA 1NKGA 4O2CB 4KZDL 1CYGA 4NM8H 3A8TA 1NKDA 5BXZA 4WY7L 3PHQB 4PIRF 3FF7A 3P4NA 1BLIA 3AREC 1JTPA 3I74A 4LNRA 3ZQ9A 4GW4B 3DHJA 5I16A 2ICEB 4ABVA 2E86A 4XAWH 4KK5D 1TLMA 4DK3A 3KWWB 4M1GL 1WFJA 3CB2A 2IAMD 4X9FA 4P5TB 2JF1A 1CLYH 4DV2O 1IBDA 4ICGA 5E6YA 2V7NB 5HYEA 4HSQA 3ZT5A 4C58B 3BP7B 2YIHA 3UCRA 4LHUG 3MRBA 3FOMA 4B27A 1AR2A 4X20B 4MRBA 2YRZA 1AQ8A 1Q6UA 1INQA 4GG8B 3AXLB 4PJ0Z 5JHDA 4OGQC 2IDUA 1CF8H 3PIQB 3D0VA 3V0IA 3VH8B 2HYMA 3WFHA 3FTZA 1ZV5A 1BVNT 2APBA 2ORBL 3HE7D 4C4KO 3CVHH 5I1DA 3UOAB 4HKXA 4LSSH 1WA1X 4TPRH 3RRQA 1RQ5A 2FIKB 1JTTA 1JZ8A 3SYAA 3CCJV 3CNKA 4OX9O 1Z9MA 5F7WC 1FO0H 4P2RB 1KN2L 3O0LA 3GSQA 3K8KA 1IM3D 1AP2A 3H7BA 4KXZI 5EYPA 3NCJL 1A3RL 1AI5A 4FQXB 5HVHC 2A83A 2OMYB 1YN7A 4MCYB 4UM8B 4WKZA 2FT6A 2Y06H 3LSSA 1BREA 2VC2B 3U0PA 1JZIA 4NZFA 3ZUNC 4IRSB 3P0VL 1HCZA 4R7DA 3HE6D 5A2IH 4HIHB 1I9JL 1DLHA 1OALA 5BO0D 3ZRXA 5SWZD 4XMXA 3TO2B 1CF1A 3S5ZA 4FTDA 2E6PA 1J87A 1FGVL 1Z5YD 5DK2A 3NCEB 1SXNA 3Q4HA 4WHCA 1NEUA 3JCUZ 3VI4E 4PJGB 3P3RA 4UTAH 3VRIB 3WFCL 3EJUA 1TZGL 3ASNC 2H0JA 4UOJA 2ZOLB 1YN6A 5DRZA 1EJOH 5EZOL 5AG2A 4JN1H 3UTSD 5D5MF 4KK9D 2ZOWA 1PL3A 3EJPA 3KW7A 5K5YA 5KJRL 3ULVC 3SDXA 3ZLQC 1A7NH 3D50A 4WEBL 2FJFB 1V5JA 2OP4L 3KL0A 1JHKL 4BFJA 3SCMC 2E74B 3IPFA 2CR6A 3TTSA 1DN2A 4EUPB 1MSDA 4OLXH 3M8OH 3WIIH 3BISA 3QUZD 4ABUA 1K5WA 3EJTA 4NUGL 5EORL 1S8DA 3HMWH 3WLBA 2CHXA 4NZUL 2Q87A 2BHUA 5I6XB 4Q2ZB 1HZHH 1U8NA 4HCIA 2VQEB 5DVKA 2KT6A 3VCLA 4U1LB 5F96L 5SWQA 3AM8A 1AGDB 4Q74A 4N2LA 1OZUA 4PRPA 4ZUVB 5GS1B 4F2MA 3VG9B 3NZ8B 4N2KA 4JFVA 2JS3A 1Z5WA 2IADA 5F7KC 3U7YH 4QRRA 1EVTC 1OAUH 3EHBC 1SRDA 3ZE2E 2X9WA 2X6BA 5EA0H 2WSDA 2CGRL 1S5HC 2O6PA 2NY6B 1WP8A 5J11B 3BPZA 1I1AC 4HBCL 1DSFH 1JNNH 4N86A 3JWDL 4K5NA 5HGAA 3VTTA 4CW1A 2APTA 1PZAA 2VT0A 2Q3ZA 4Z7VF 3N91A 4OJCA 5F89B 3P3YA 2VL4A 5AKSA 1IGFL 5MEPA 1SJVA 1G7MA 4FFWC 3WB2A 4LESA 1HQRB 1WE5A 5BR8O 2ED6A 1RK7A 1K4DA 4J7RA 4NT6B 3ARDA 2AQNA 1AD9B 3ILQC 4DIXA 5IBUB 3GLZA 2GFBB 1SA0B 3L3GA 3G6DL 2QKSA 5GS2D 4YPGB 2R15A 2Y4UA 5C0JB 3TXAA 3QISA 2HVBA 2ZX9A 2PO6B 4NJ9H 1XDCA 2EXWC 2F1EA 2QLVB 3U2IA 1XF3B 2ZOKA 4FHKA 4C47A 1YC7A 3OKDB 4TV3A 3GS0A 1WEJH 3ZHFA 1WCBB 5EOQL 3V9FA 1KJ3H 2RD0A 2TRYA 4H25A 2ZCHH 5F0JB 4PS4H 3UTTD 1AJPA 3N2GA 3ABTA 1JHTA 1KOAA 2R1XA 3QWNA 1EX0A 1ZT7B 4ICXA 2DQTH 3ABUA 2HT3C 4GKKO 1XZ0A 3D4YA 3UGXA 3AGVA 1WB8A 1ORQC 2Y9RT 3OWEA 2FQDA 2OMZB 3KMDA 4BFGA 2YMOA 3B5GA 2O5ZL 3Q48A 4Z7AA 4DZBB 2H32B 1ZE3H 3K74B 4HW6A 1TQUA 6PCYA 4KUMA 4JKKA 5EU5B 2OFQA 4EB6A 3CFCH 3RTQC 3V4VH 2AGJL 2PYLA 5DD3H 4YE0A 4JFFD 1OZ0A 2YAOA 4G9DA 1OGAD 2E7DA 4LR3A 2AVFA 1LO4L 2JKIS 1N67A 3VQVA 2W92A 2XWJA 3P73A 5CZRA 1T80A 4N87A 3EYOA 1ANUA 3R18A 1X5GA 2NY4D 3MXVH 4FLYA 4Q0XH 1L0YA 4WI2A 4G6AD 1RUPH 4PJFA 4DHLA 1VQPV 2R0LH 4LOFA 1A7RH 2WBJD 3JT0A 2E5EA 1K8DB 4OFDA 1CYWA 1G5GA 2YQ2A 4DO2A 1MG3C 1SGKA 1F11B 2EDKA 3MHSC 4KKBC 2C4XA 4XAWL 4Z77A 3CV5A 2F8OA 2OLDA 4DTGH 4G6FB 3IVKA 2XY2A 3RWJB 3JAWB 2ITCA 2YZ1A 4HLZG 3OKYA 1QSZA 4H8WH 4F9LC 2A9DA 1MZFA 1AO7B 4U1KB 4WAFA 3APNA 3RG1C 4AVKA 3P4LA 3QXVA 3CHRA 1CF8L 4LCCC 4RGNB 4B9CA 4ZPTB 1KLGB 2E76C 2P5EB 3DYMA 3JTBA 3CVHL 2CUMA 4ZMOA 4FLQA 4LSSL 5GGTA 2Z0BA 3OR7A 3SGEI 3CFJB 3D85B 2R2EB 1KGUA 4PG2C 5IJ0A 2XHNA 5K59E 4MD5B 1FYJA 4OZFB 4MW8A 3WEBA 2VO5A 4IYIA 4F57H 4FXGC 4AC4A 3D69A 3N5AA 4JI2B 1M05A 1Y18A 3EGDA 3I6SA 5CCHE 4JK0D 4AC2A 2HX8A 2OYQA 1BJMA 3H8NA 1MHCA 4HGMA 1ROCA 4GBXC 2AKRA 2RMKB 5LBSA 3CPLB 4DW2H 4XHQA 2AAVA 4CVXA 4JFZH 5E5UB 3L5WB 3ATBA 1U2CA 2EDWA 3BE1H 3EYFA 2W5PA 3FB7B 4NFBA 1MRCH 4RMVA 1BLNB 4NCC2 2EX3A 1E8YA 2IDTA 4GRLB 4MNHA 1G7HB 3EFFA 3N6YA 3C6SA 1T22A 4TQFA 3VM5A 4K5MA 4ZPVB 4UV8A 1QWUA 3M6DA 1O6SB 4JN1L 4UQ2B 4KRPC 1U58B 1N6QH 3GMPA 1LQBC 1A7NL 2Y2YA 3OLGA 4W9EC 2CKBA 2IC2A 3G5XB 2MIZA 5B3JE 1RZPA 4PP2A 4Y4HD 2ZE7A 5HFLA 1EBAA 2OBGA 2V17H 2ZT9C 3GS4A 3MOQA 1BF2A 4QRSA 4ZMWA 2P5WB 1R3HB 5JQGA 4LCUB 4Z7VB 2BXZA 4LGSB 4OLXL 3KS0J 3M8OL 3AG2C 1RHHB 3LZRA 3B4NA 3T1YO 1BAFH 3PGCA 4PLOB 3WIIL 2R70A 2BZDA 3PWPA 6PAZA 3HMWL 4ODXB 1HZHL 1Z2KA 2OMWB 1P9MC 3RIFF 1T21A 3RDTD 2CUHA 2EYTB 3MJ8B 5B1BC 4RGOH 4YDJA 1H2GA 5I17B 5AUMA 3PL6B 1FXVA 3RZWA 4NFDA 2C9QA 3B3IA 3U7YL 4A6YH 3KYOA 1LQSR 1OAUL 4KK5C 3RKPA 3VXME 5DS1A 2IAMC 1GC1C 5EA0L 1U3HD 3ARYA 4TLKA 4NI3A 1WP6A 1IBBA 3LKOB 1DSFL 4O4IB 1OGTA 3SN6N 5ID1A 1HH9A 1UCTA 4TL4A 5A43C 4B08A 1YEDB 3DRTB 1CXIA 4A2FA 5E8DH 1Y1UA 3ZIMA 2O6EA 3DDGA 3FFQA 2FTKA 4JYAO 3O11B 4FQIH 3X12B 3K4DA 2NX5B 2IIJA 3LNGA 1HEJC 5FF6B 3HE7C 2J8UF 2MCG1 3LPFA 2WLLB 4HWZB 4XX5A 2YN5A 4DKTA 3CVDA 4FL4C 4S2SB 2QTVA 5EUKB 3RVYA 4HWBA 2Q69A 2E9BA 2WO4A 2ZG3A 5A3IC 2Z91B 2G3XA 3CQFA 3BQUA 3OG4B 4P5MB 2RMNA 4JPVH 1OP3K 4F7PB 5IJDC 1KY7A 3KL5A 4WV1A 4XO3A 1I9IH 5LB1A 1OWRM 1DQKA 4WW1B 1BQHG 1L9SA 4PJ7B 3K9AA 2BNUA 3QS3A 1NBVH 1WEJL 1SN5A 1KJ3L 3OR6C 2ZCHL 1H2MA 4PS4L 4KO9A 5E6UB 2ZOOA 1Y67A 5IMKB 4CBCA 1EXUA 2DQTL 3IU3B 5MEQB 4NRYB 4YFDB 2OZ4H 4LE8A 1DHKA 4GFTB 1AG0A 5IBLD 1SQFA 3U46A 1ZPUA 1T3FA 1WV7T 3QBTB 1IAIH 4DR3O 3RWHB 4NIYE 1HL8A 3CFCL 2J5WA 2O61A 3A67H 4LLAA 3S4SG 3V4VL 3VGFA 5F7YC 3MOBH 3QUKA 2PWGA 4NCDA 1AFVH 4I5BB 5C07A 3NIDE 1A1NA 4F9PA 5LGNA 3QC5X 1YY8B 2XXMB 2ITDC 2M7WA 3FT2B 3L95A 4JRLA 1SVZA 3TNNA 4KX9A 4F93B 5E24E 1W72H 4Q0XL 1GJUA 5F7FA 1RUPL 1FYHB 2R0LL 4E41E 1A7RL 3STZA 3MKGA 2QPFA 5KYUB 2XHBA 1TYJA 3FFCA 3QUZC 3LNHA 4J3WA 4XODA 3RHWF 3UFIA 4R26H 4GP4B 1J1PH 5F1OB 3STBA 5LBQA 1E9PB 1U8LB 4HA1A 5C0BD 2VDLB 2FJHA 3QCVH 4L1BA 4QRAA 4YSDA 5C7ZA 3TBTB 1CDUA 2LAAA 4DNLA 2BTQB 1NANH 3D9AH 1QKZH 4DTGL 1Z6JT 1ZLZA 4NM4H 4WWKC 2ZXQA 1DQIA 5FO9B 1HJCA 4H8WL 3WMQA 4LBAA 2YUZA 4F7CB 4FXKB 1CG9A 4XP6H 3ROOB 4AQAB 1XR8B 3APFA 4JFPB 4JG0H 4JX0A 2F5AH 4M3JA 3A0HZ 1R47A 3L1EA 3NJFA 2DTSA 2WZ6A 1CZ8H 3DV4A 1J1OH 1TJHH 2ZCKH 2XACC 3FU3A 3MLYH 3SCMA 4R7CA 3A6CH 4F57L 4OLWH 1HU8A 3BSGA 1RKRA 1NLDL 4FX5A 1GTOA 3T4YA 1UB6B 4BUHA 1FFQA 2UUDH 2XVKA 4I55B 2UZPA 4NNXA 1LE9B 3F12B 5DFVC 1QBMH 2WQVA 3O2DA 2AJUH 4ELKB 5K93A 3ULUD 4RAIA 4JO3H 2BP8A 2BVYA 4L3ED 1FNGB 1JA8A 3HG2A 3L9YA 1S7UB 3QDAA 3DMMA 4LIQH 4Q6IB 4QXWA 1V3MA 4AENB 4DW2L 5L7XH 2WQ8A 4F15C 1UM5L 3BE1L 1BHAA 4DW1A 3BWZA 3MA7A 4XOAA 1I31A 1MRCL 3OUFA 1FKAO 1S5HA 2IH9A 3GT6A 5AYTA 4G7RB 3SE3A 4Y1SA 2GJZA 1I1AA 2KLTA 3LKSA 3ABKC 3P2TA 2NUTB 4U4BA 1SXAA 3K57A 3G6JF 2X7LB 3ATEA 3FK3A 4JVUA 3V6OE 4ACPA 1GS6X 2K9UA 3NZSA 1B2WH 4DEWA 3LRGA 3E8VA 3OXRB 2YPLB 4RMUA 5I28A 5KW9H 4PWHA 3BSZH 3GZOA 2V17L 1ZS8B 3E3QE 1YJNV 2YOCA 4HUXA 3UTSE 1FBIH 3GBNH 1U8OB 4HOZA 3L3DA 1BAFL 3OAZK 2BW4A 2NY4C 1A9EA 3SPJA 2J8UB 2JCCF 4G6AC 2YS4A 2L7UA 5HHOE 2BNQB 5JUEH 2HG0A 5GGRA 5E2UL 4HSCX 5E1AC 2DJMA 5EIBD 4LSTH 4C8XA 4B3MB 5IT2H 3QIWC 2C9SA 2ENJA 4X64O 1ZPLA 1XHXA 2CLZA 4ZS6D 4A6YL 3KGRA