3ABKB

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3abkB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3abkB02
4BWTA 1L9OA 1V55B 2FNWA 2I85A 5B7MA 1ZV2A 1BYOA 2J56A 4KOBA 3QQXA 2FQGA 3UGEA 1MZYA 2YAPA 1FFTB 3OMAB 4G72B 2BWDA 5FC9A 1NIBA 2YAMA 3FU7A 3WKQA 2DWTA 4GYBA 1CURA 3FT0A 4A68A 2DYRB 2HXAA 3OM3B 3IEAA 1HAWA 1SJMA 3OD3A 1L9PA 2PPDA 4HALA 4AKOA 1JXFA 5D4JA 1BXAA 4HIPA 1KCWA 5E9NA 3NJLA 3TASA 3NYKA 1IBZA 1ZDQA 4KO5A 4NB7A 1M56B 4YSRA 4P5RA 1AZUA 3WIAA 2CJ3A 1TU2A 2PLTA 4DPBX 4EF3A 1L9QA 4G70B 1SHXA 1NINA 1XMEB 4DP0X 5I5MA 2BO0A 3KW8A 2PPCA 5I6PA 1JXGA 3NSYA 4A2FA 1KCBA 2OV0A 3CDZA 5B3SB 3MX0B 4JKNA 1W6WA 3ABGA 1XB3A 3IN0A 4E9TA 3WG7B 4PCYA 2YAQA 4YVUA 5B1BB 2GSMB 1M57B 2VSKB 2XWZA 3T9WA 1IUZA 1AZNA 4BDVA 3H4HA 2PPEA 1A4CA 3T6VA 4AX3A 4F2FA 3V9EA 2IDSA 1WA1X 2FQEA 2R7EB 3RYMA 1GYCA 2VM3A 1OV8A 2Y69B 5PAZA 1UATA 4G71B 1HFUA 4HCIA 3S3DB 1TEGA 1L9TA 2YEVB 5AZUA 5LDUA 1SDDB 1WS8A 2PP7A 4YSUA 5I6KA 2H5UA 3EF4A 4W9ZA 5I6LA 2IH8A 2GC7C 3AG3B 1ASOA 4KNUA 1JERA 4KOCA 1PNDA 1PLCA 4TXVB 3QJVB 3N55A 1EHKB 1X9UA 1DZ0A 2HLEB 1AS6A 1AACA 2RACA 1F56A 2UXVA 2VW4A 2J55A 3TBCA 2W88A 4WKXA 1ASQA 2FQFA 1BYPA 1GS6X 3ASNB 2XX0A 4AKQA 2AVFA 1IBYA 3FSWA 1J5CA 2BP0B 2PPAA 1AR1B 4YSEA 3SBPA 1VLXA 2CUAA 2Q9OA 2BP8A 3S3BB 4A66A 3AZUA 3FSVA 2JFCA 4YSOA 1GY2A 1MG3C 2FWLB 3ASOB 1PMYA 2I7SA 2XXFA 2BZ7A 3PAUA 1N70A 3TA4D 3ZIYA 5I5IA 1SFDA 3PPSA 4DP7X 2P80D 2GIMA 1OCCB 3NJFA 5ANHA 5I26A 3X1FA 3DTUB 1A4AA 1TEFA 2ZOOA 4YSPA 3FU7B 1KDJA 1AG0A 3U25A 3OMIB 4E9SA 1OE1A 2H47C 1JVOA 1V10A 4DP9X 3ABLB 2QPEB 4K9JA 5PCYA 2YXWA 1RKRA 4FAAB 3JTBA 1V54B 1PF3A 2AANA 1URIA 2UXFA 3QJQB 2JKWA 2QDWA 2FTAA 2XYBA 4BXVA 1KGYE 1W8EA 4GP4B 1SF5A 1L9SA 3FPYA 2HX9A 1KDIA 3NSCA 4A2DA 2CAKA 2I7OA 1RZQA 3HB3B 3FU8A 5D4IA 1NPNA 5I6OA 3D12B 2WO3B 1T5KA 1DYZA 1JZJA 4P5SA 1WS7A 1PAZA 2QT6A 3T6ZA 1E67A 4DP2X 2OCCB 4JHVA 1NDTA 1NTDA 5F7BA 4BWUA 4KNTA 1PZAA 4DP6X 3EH4B 3X1BA 1PLAA 3ABKB 3NJNA 3SQRA 2HRGA 4PAZA 4ENZA 1AZCA 2XLLA 4BDVB 2AZAA 5AFAA 1AQ8A 3S8GB 3AG4B 5I28A 2E86A 2MTAA 1ADWA 3NP4A 2PCFA 3H4FA 1ZPUA 5F7AA 3SBRA 2EILB 4G7RB 1ILUA 3NJHA 3NJGA 3UACA 6PCYA 1OOWA 4RH4A 4M3HA 4YSDA 5EHFA 5TK4A 3WNJA 4E9RA 2XUWA 3G5WA 3PAVA 1I53A 2LLNA 2MRYA 1CYWA 1ET5A 2DY2A 2J57A 4HAKA 4YL4A 2W8CA 4KO6A 4M4RB 2VN3A 2FQDA 3X1EA 4JHUA 1B3IA 2FT7A 1QHQA 3IE9A 2DWSA 4GP5B 4N8UA 1NIAA 3T71A 4E9YA 5TK2A 2PP9A 3WKPA 1KV7A 4YSQA 3DKHA 1CYXA 2FT6A 4A2HA 1ZDSA 1N68A 1FWXA 5B7EA 1FA4A 3UABA 5B1JA 1NIDA 1E5YA 4G7SB 2WSDA 4DP5X 2GC4C 3NJMA 1W6LA 1NIFA 2BW5A 3GYRA 4GY4A 4DP1X 3FQYA 1GSKA 2IWEA 4MFHA 5I5JA 1NWOA 3FYIB 1WA0X 1MDAA 4AKPA 2GI0A 2OJ1A 1JZEA 1ETJA 1OE3A 2BWIA 7PAZA 4KNSA 2CBPA 1AS7A 2VM4A 4HCGA 3ABMB 2B3IA 4KO7A 1BXVA 7PCYA 2EIJB 2GB2A 3CG8A 2UXTA 3CVCA 3PAZA 2ZONA 2GBAA 4Q8BA 1AZBA 5D4HA 1QNIA 2VSMB 1ET8A 3FQ1A 2QDVA 3KW7A 1AANA 1GY1A 5I6MA 1AOZA 4G7QB 3AG2B 3NSFA 4A67A 3NJJA 2XXGA 3QJSB 4GXFA 3WI9A 5I6NA 1GS7A 2GHZA 3NSDA 3S8FB 1X9RA 2ZWNA 2IWKA 3HEIB 1TKWA 3IBOA 1EZLA 1RZPA 4Q89A 4UANA 2AZUA 2TSBA 1PNCA 4AZUA 1SNRA 2IAAC 3X1NA 2UXGA 3QJUB 3QJRB 3FSZA 2X88A 1J9TA 1NIEA 2B08A 2CCWA 2N0MA 2YQBA 1ZIAA 3PLYA 3ZX1A 1JZFA 3QJTB 2J5WA 3FU9A 3NP3A 2XVBA 1QLEB 3BVDB 2VW7A 4ZK8A 4BK5C 3ZDWA 2XV2A 1XB6A 5B1AB 3C75A 1JZHA 3AY2A 1J9QA 1A3ZA 2YAOA 3PXLA 4AI7A 2JXMA 3OMNB 2YAFA 3T6WA 2Y1AA 3CZUB 4CSPA 3T6XA 1SHWA 4E9XA 1J9RA 2HZHA 1E5ZA 4YSAA 1MG2C 8PAZA 1PZCA 1AS8A 1BEXA 2YAEA 3X1GA 4NAJA 3CDZB 4KO9A 4HZ1A 3TBBA 2DYSB 2XV3A 4UAHA 3WNIA 1R1CA 2HX8A 1NZRA 1AIZA 2UX7A 4N4YB 1JXDA 2A3TA 2EIKB 2XV0A 1BQ5A 2YARA 1NICA 3N2JA 2PPFA 3DIVA 1BXUA 1KBVA 3S3CB 3OQRA 4QKTA 2HRHA 4A2EA 3NJKA 1A65A 2FT8A 2YXVA 1PY0A 1PCSA 2IDQA 1ASPA 3X2QB 1OCOB 1CUOA 3TU6A 3FS9A 4BXSV 1CC3A 4F7KA 2X87A 1WAEA 3QPKA 3FQ2A 3CVBA 4HHGA 2P80A 4QLWA 4BWWA 2NRDA 4W1TA 1KYAA 4DPAX 1BQKA 3EH5B 2TSAA 5IY5B 1E65A 1BQRA 3FSAA 3NT0A 2PP8A 4L0PB 2PCYA 2CALA 3IN2A 3JT2A 3UADA 3ZBMA 2ZXWB 4YSTA 2H3XC 3SBQA 1NPJA 4X4KA 1WA2X 1NWPA 4DP8X 3EHBB 1E30A 1JOIA 4FA7B 4HHWA 1RCYA 2IDTA 4DP4X 2IWFA 3NJIA 1PZBA 2VW6A 1OF0A 4GP8B 4YSCA 3BQVA 2FJSA 1JZGA 2YAHA 3UAAA 1L9RA 3MBWB 1BAWA 2R7EA 1IKOP 2XX1A 2BHFA 5B1KA 1IC0A 1A8ZA 1AG6A 1PLBA 1JVLA 4E9VA 1ZIBA 2BW4A 2IDFA 1A4BA 3L45A 1ID2A 5AKRA 4E9QA 2BP8B 6PAZA 4DPCX 1SDDA 3ERXA 2EINB 1OE2A 2IDUA 2XU9A 1KBWA 3GDCA 1JZIA 2VMJA 1OCZB 2Q5BA 1GR7A 4E9WA 2WO2B 1J9SA 4WTQA 1OCRB 4UF7C 1M9WA 3AW5A 3PCYA 3CVDA 4CSZA 2AFNA 2HX7A 1AZRA 1ET7A 2DV6A 4YVNA 2UX6A 2BZCA 1HAUA 3H56A 1ILSA 1SFHA 3GXUB 4A2GA 2QPDB 1AAJA 4HCFA 1YLBB 3EH3B 1SF3A 2BP0A 2IH9A 4NERA 3AG1B 9PCYA 5B1JC 3V9CA 2EIMB 1XB8A 5A7EA 4YSSA 5B7FA 1GS8A 3FPXA 3FYEB 1J5DA 1MZZA 4F2EA 3UAEA 1GW0A
chains in the Genus database with same CATH superfamily
2HJDA 1D5XB 5EDXA 1L9OA 4G7VL 4AENA 2I85A 3S48A 5F1OB 2Y1YA 4ZODA 1WLEA 3FU3A 2JCCF 4CS4A 4PUBH 5K1PA 4UB0L 1X7SA 4DVRL 1YTFB 3QDGB 4LARH 3OR7A 5GONB 3NABL 3HBQA 4I5SA 1EFXA 3ATBA 3D3VE 2DPKA 4XMUA 4UVCA 2JMRA 3TZVC 5JJNB 1ZLEA 3AU1B 5IVXF 5CP3H 2VZSA 4NJAH 4CC1A 5CF3A 4O4LA 1FZOB 1AGFB 1CICB 2A1WL 3HUJE 5HHOD 1KIQB 2ARWA 2NX5B 5D7KE 2GBOA 2DWEA 5E8EA 4NQXB 3OD3A 4O2BA 2LGWA 4ELMF 1KPVA 4YDJA 5D4JA 2VJXA 3J27A 3Q6GH 1JGUH 4I85A 3SY6A 3TASA 2V37A 1HKFA 2A5UA 1VQLV 2FEEL 4OIIH 1ZWIA 1ZVSB 2EDEA 1FYTA 2VDMB 2V2XB 2XIBA 2P5ED 1WCBB 4HS8H 2XA8L 2NMSA 4PDMA 1BQSA 4DK0A 3L1EA 1PL0A 4CADA 1DBBH 5JMRA 3U9PL 1SLWA 4HJGB 4KH2A 2M1KA 5EO0B 4JQXA 4ZW8A 4AQ8C 5L8LB 1LP9B 2FO1A 3D69A 3FB5B 3PE9A 1BJ1J 4JE4B 4OQ1A 1TVBA 1JXGA 4APQC 1OARL 1JV5B 4XE5B 4KKBC 2R4RL 4EPSA 2KLSA 3FTYA 3UDWA 2ZM6B 1MFEL 4YDKH 4AIZB 3APDA 2ZXGA 3U6XS 3MCG1 4DQOL 3IC9A 2VXVL 2CIKB 4YXLL 3ZTNH 5DMKA 3CRCA 1XCTB 1A4CA 4OZGE 3MLTB 4HCRA 5SWSE 2B1AH 1RLWA 4LCIH 5FUOL 3FB7A 2EXWD 1BZDA 4RAIA 2DTML 4WFEE 2R7EB 2VDKL 1ID5I 1WPXA 1EJ6A 4BH7A 3D2UA 2FD6H 1F4NA 3FBKA 2Z0AA 4N21A 3VXOB 3QO5A 4DV4B 3VI3A 3KYKH 4FTVA 3HFMH 5GGVH 5I73C 4QHUB 4TRPH 5CGMA 3LHPL 3LKNB 3QO8A 5HYSB 1SBBA 1VZGA 5DD6A 3MROA 2F1AA 5EIIG 2NXYC 1VFBA 1Z7JA 3GMRA 4KTYA 2IH8A 1CFSA 3N40P 1H2KA 3DX7A 1ETB1 3ZRXA 2X0VA 3O4OC 1U95A 4KNUA 2HT4D 3IJ8A 5ESQA 3TZVB 3ZPDA 2OR9L 3RWCA 1CQKA 1QSZA 1S72V 1PLCA 2OW6A 4JI2O 2J1YA 1VGEH 2CLZB 5B3JE 2YGOA 3SDCD 5IV2A 5HPMB 3MRBA 4U6YA 3CCRV 1ZUQA 4NP4H 2X41A 2WXMA 1T66D 3L4XA 4ORGB 4PIBA 3SB3A 4GX0A 1RM1C 1A0QH 1UM5H 3MRMB 1KYDA 2DJ4A 2JK5A 3UT5A 2X0WA 1TVKB 3DRQA 4I0PD 4BK5A 4NZRL 3T0ED 4Z3TA 2HFFB 1GS6X 1GGIL 1FFOA 2DJVA 3ELAT 2NR6D 2B1IA 4XNXH 4ZRGA 5E70A 5MENA 1VLXA 1E4KC 3GMNA 4JKLA 1YNLL 3GZOA 4WZ9A 5JLZB 4HD9A 2XQBL 3RWIA 2V9TA 4FLSA 3JD4A 3K5MA 2VH5L 3T4YA 3C6LA 4DN3L 3GSRB 3L9RB 4RESB 5AW2B 3RVXC 4APQB 4V11A 3WIFA 3PAUA 4AYID 4X7CC 2DLGA 5KOMC 5INDA 3BC9A 3GRWH 4AENB 1AQHA 3WLBB 3SKMA 2NNCA 4IJ3C 4N0FB 4C57C 2WLYA 2Y72A 4HU8A 3NJFA 4QXWA 5KBLA 4P30A 3ZL2A 5C8JA 3DVNA 1X5FA 1TEFA 4IOFD 5HDRA 3LS5L 3MAWA 1UACL 1DEDA 5DQDL 1EFXB 4G11A 3LRLA 1O9HA 4K8XA 5CEZL 2H47C 3QZMA 1S5JA 2R72A 3K1DA 3OZ9H 4HJ0D 3ZKND 4TSAL 4O4LB 4Q9CA 3ALWA 3FQTA 2YXWA 5FV1L 3WFCL 4BR6A 3N91A 5JOFB 4MW8A 2DWEB 5E8EB 5C0AA 2IGFL 2C3WA 4O2BB 4FKEA 4OFVA 1KPVB 2IWGA 3QK0A 3HLAA 1PPJH 4R26L 4DETA 1MZFA 5JIQA 2MCAA 4H88H 1T1WA 2ORBL 4L3EB 3CSYA 5I73B 3JWNC 2P24A 3A67H 3OJDB 5FCUH 1P7HL 1AJNA 1RIUH 2EVJA 1YY8B 2NXYB 5HGGS 1PD0A 3ET9F 4NUPA 2R1YA 4F6EA 3SDDD 1SC5B 1WAAA 2XQYG 3T3PF 3O4OB 3LMJH 3KLQA 3ABMC 3C6LC 3LYRA 1MZEA 1YEDA 3D69B 5G5DA 3NR7A 1TVBB 5D7LE 4B3MB 2W95A 4HV8A 3L72H 2O5YL 3AB0C 4FHJA 1UPGA 2VUYA 4L5FH 1Y0LB 2ODHA 2VXQA 4N2FA 4BWUA 4EUPG 1J5OH 3EH4B 3ECVA 4DUYO 4FFTA 4N25A 1T6WA 4Z7VE 3V52H 2Y6TE 3SDXE 3VXUA 4XP9L 2FLBT 1IC4H 4KITB 4LF4B 4TVPL 4NHCL 3VWJA 5GS1C 3BYYA 4LOUD 1PKQA 5F9AC 3RNQA 5FDWA 5KEZA 1R3IL 4UVAA 1N33B 2LAGB 3MRPA 3MJWA 5ACLA 2F15A 3GRGA 4KK8D 4ZUUA 1FNFA 4PGJA 5JHLL 3FB7B 1YCIA 3ZN1A 4ZQKA 4LGSB 4ZFOA 3SPGA 5IBLD 2VR3A 2CTPA 1XF5B 3L5XH 3NMEA 3R0NA 3D2UB 1V54C 3VI3B 4JF3A 1H2NA 4P9MH 4Y4HA 2Z9TA 1DDHB 1LGVA 3AJ7A 1MA1A 4NO5B 2BIQA 5DD6B 2B77A 2HHHB 3ABTA 4FABL 3GMRB 1I53A 4M8VA 5D70H 1CFSB 4X8JA 1X59A 3DX7B 5IHZB 1ZSDA 3CXCU 5ESQB 3AS3A 4OZHF 3ISYA 4JO4L 4DV7O 4A7VA 3RWCB 4HJ1A 1SEBA 4K35A 4ILDA 2ZUVA 4MXWL 3UCSC 4A2HA 5IV2B 2QQLH 1XMQB 2F54D 3RW0A 3QWQB 2Z91A 4P99A 5B1JA 3VM5A 1CTOA 4MQXC 4P2QD 3ZJAA 1QEWA 4WNQA 1E2ZA 2VLKA 1WFNA 2KQXA 3KR3H 3DRQB 3ZHTA 1ZSPA 4PJDE 5CINH 2XAHA 4UOZA 2X28A 1FFOB 4LK4A 4JRYA 4WI4A 1NL0H 1O0VA 4ETYA 5DN6G 5MENB 3ZMTA 2OMZB 3APMA 3JXAA 2J1KA 4HDIB 1D9KD 1NOLA 2KBGA 3RWIB 4JRXD 3ABMB 1CEZA 3C6LB 3T4YB 3K79A 1BXVA 3NACL 4I1NB 3F12A 2QV4A 3QRFM 4RRPG 3SDAA 4HZAA 4NRXA 1YJNV 5B39A 5INDB 3E35A 2AJXH 2W9LA 1Y67A 4HD5A 4ZMYA 2CM6A 3SKMB 1NH2B 4HPOH 3TV3L 1T6VN 2F8XC 1MFBL 1Q9KA 3MRJA 1L9MA 3GMMA 4NKMB 5DC2A 4G2KA 4HWUA 4PJ7E 3DVNB 3V4PH 4G7QB 1LR1A 5DUBB 3DO4A 5A2QN 5GS1B 1E9PA 2YS8A 3NSDA 4ZMWA 3VFUA 3S8FB 2PKDA 2JIZG 3F6JA 4IL6Z 3HEIB 2MCPL 3JV6A 4TLKA 1I3VA 3PWVA 1MW2A 3QO1A 2BNQA 3FQTB 4HGKC 3PJLA 4LSSL 4A39A 1QZ1A 3HI5L 5C0AB 5BXFB 2VLLA 1PBYA 2ID5A 3AQZA 1J9TA 1KN4H 3ZKQD 3HLAB 4TOIA 4PDVA 3QEQE 5GGRY 4FQCL 3ZX1A 1YMHA 1JIBA 1LEKB 1MCDA 1YA5A 3BP6A 2X0UA 1T1WB 3DARA 3ETEA 4K3EL 4KJQC 1NVPD 4BD4A 4E5XA 2WD0A 4GLRH 3QPQC 1MHHA 1XEUA 3CMAV 3LKSA 1J9CT 1BMFG 4N9GA 1E28A 2JS3A 2HUHA 2J12B 4LSQL 1D2OA 1YDPA 5AL0A 4R7NA 2E59A 3L9DA 2CDEA 2LGQA 1EO7A 2XQYK 1DQVA 3JWDC 4HJSA 4IS6A 4JL2A 1CGSL 2AQSA 4L1DA 4V1DA 2ZYIA 1YEDB 4TVUA 2ITCA 5JTWA 4MDJA 4IRJD 1CFQA 2IU3A 5F7KC 4LCWE 4X7TA 2HZHA 3KPMA 1MH5A 2CZNA 4HV8B 1SQBH 1BFOA 1MI5A 1QI5A 2BTQA 2LVEA 4DV0O 5E1QA 5F7MC 3EOBB 1AQMA 4QTHB 3OAYK 5EU4B 2YAEA 2Q8AH 2QDOA 4JO1H 4LKXB 2XBDA 4MNQA 3KHOA 1XAKA 3OGOE 1VQ4V 5BO1L 4JI0B 4NM4H 4N2LA 1PKQB 3ZRWA 1N8RW 1HE7A 2APWA 2UX7A 5DD3L 5FDWB 4YY3O 4ZTOL 1VEWA 5T1DL 1HEZA 4IMKA 3WJLC 4M62L 4PY7B 5CHNA 2FNBA 4H1LH 3WFBH 1USQA 4ZQKB 2JIXA 2JJSA 4MZ2A 2CE4A 3ARGC 2NW3A 4HS6A 2YUAA 1AD9B 2YMTA 4PRPA 4MD0A 3JALA 4R90H 1WJZA 3STZA 1DCEA 4I9XA 4W9KC 5HHXL 2WW8A 4QXUL 1PY0A 2YPLD 4Y4HB 1UH3A 1KBGL 1RUKH 2X4RA 1IEAA 3G4SV 3KLKA 4TLUA 1VF6A 1RSYA 2W9DL 5AB0A 2M6YA 4GQ9H 4OXSA 3VFRA 4PHZA 2QWOB 2Q3ZA 1V55C 2GG1A 3X17A 2DJSA 1Z9OA 3FAXA 2HLDG 3ZL4H 3MUUA 1G6RL 4XOCA 2O61B 1DL7H 2ATKC 1FLTX 1QHOA 3EW3B 3QFJA 4PJBE 3ZBMA 2DWXA 3SBQA 4X4KA 4KGLA 1YEWA 1SYSB 3CV5A 1XTLA 1OAKL 4F20A 1EUTA 2QTEA 2Z91B 4HHWA 3B2EE 43CAA 1C16A 1MAKA 1QEWB 3CZNA 2ZAHA 3CZFA 1KFGA 2VLKB 4X42A 5DJYB 2VSDA 4M7KL 1HS6A 2W0KA 1PLBA 3ZE2B 2NY2C 3FFCB 4PJ5E 2ZP0T 5D5MB 1QFUH 3Q1SH 2O57A 4HKXB 4Z76B 3Q5YA 1OY3B 3IJ9A 4Z1VA 4WLCA 3L3DB 3STZC 2K7PA 4J11A 4IIQA 4LF9B 3ZIMA 3F12B 2H7WA 4NRXB 5B39B 4NQTA 2F53D 4K5NA 1VFAA 1BQHA 3E22A 3HNVH 5EF2A 3DROB 3MRJB 4GKNA 3GMMB 4RAUA 3J81N 1A9VA 2JLPA 3UJTH 1KFAH 4UUJA 4QOKE 1DF5A 3P0YL 3ML0A 1J11A 2DV6A 1ZD6A 4QRPE 1X5JA 2CRMA 1E9PB 2Q0ZX 4Z78A 3VFUB 4AITA 4KQ0A 2UX6A 4ENEC 3PWVB 3QO1B 1U97A 2BNQB 1H8SA 1O7DC 4OAWA 1ILSA 1SFHA 3ARGB 5D72L 4ELDA 3QYNA 1JMKC 5B5EZ 2VLLB 1G7HA 1TJGL 5DK0A 3WNKA 2Z0BA 3BGMA 1KJ3H 1AFVL 1NSNL 1SF3A 4UNIA 1YMHB 5GRJL 3NQKA 3OF6D 5E99H 2Y5EA 3BP6B 9PCYA 5DMYA 1J0ZA 3S7GA 2D2OA 4F58H 2X6BA 5I1LB 3LZLA 4R9HA 4BSWB 2QWRB 3DO7A 4X1IA 3LKSB 1H3PL 2FB4L 5FS5A 4MDRA 2VWJA 4IKIA 2DLEA 1ZS8A 1GW0A 4ZOBA 5ECJE 2JLLA 4R7NB 5TPWH 4I13B 2YEZA 4IS6B 1V55B 4OLUL 1R34A 4LHUD 1F2XK 4GMSH 3QDJD 2ITCB 5FGCE 4XB8A 3MYJB 1CFQB 3V7AE 4PJ8D 4Z6AT 4OBSA 2ATKB 3KPMB 4YXWG 1IVLA 2VR8A 4PGBA 3D09A 2BNRE 1BFOB 1MI5B 5CD5D 5DEFA 1O7VA 4BCZA 2EDHA 5JIPA 4C56D 1C5BL 2YZ1A 3FQ4A 3EHBD 4MNQB 2WWNA 3IJ7A 1BHBA 4HEMA 4AEIL 4FCAA 2EDKA 3A24A 1ENVA 4JASA 3O3DA 2R39A 5HI3C 3WFEH 4UMSA 3WNMA 2YA2A 4YC2C 2ZX5A 3KLSA 3QGVA 3FO0L 4G82A 1HEZB 4QF1A 3HBGA 1E2VA 3A22A 4R83A 5CHNB 3WY4A 2FX9H 1E9QA 2NY2B 4GKOA 3HKZA 1EVUA 4HIPA 3NG5A 1F23A 2D31A 3ARFC 1GKEA 4I55B 4HS6B 1E79G 4MD0B 4FFYL 4JDTL 4DR1B 1BPLB 3STZB 2HFGH 3L5JA 2P7TA 4XOBA 5FO2A 5GGSA 4ONOA 1R73A 3GTNA 3MJ6A 4G70B 1ZPLA 2KLRA 2X4RB 5KVFL 5T3ZD 4NM8H 3UTSD 4PV1C 2DBJA 2VOTA 5TH2B 3ASOC 1UWGL 4WEMB 4CC4C 3QUZA 4PLOB 3VFRB 4FLYA 3ESVF 4ZTEA 2QQKH 4PMEA 4X6CE 1UJTA 2CMRL 4ZO7A 1WZKA 2X3AA 5E6ID 4MS2A 3MJ9L 3FD9A 3QFJB 5ALBL 4HU2A 4P2RB 5E6SB 1SA0A 1JK8A 3C5ZD 5FKAA 1G9HA 5IT2L 2J20A 1BZQK 1C16B 2A6DB 3ECBB 3CZFB 5DDHB 5FNVA 5EZIH 3RPIA 2DJUA 1A14H 3H7BB 2F66C 4P46A 3ARXA 4XHJC 3V0VA 2ED9A 4XBPB 3P73B 1MF2H 1DJXA 3QUYA 4ZNEE 3C9NA 2RHEA 3O9WC 3BH8A 3BPZA 2VMFA 4H13C 2E9BA 2CRIA 4PJXE 3CHRA 3TWCL 5IHUL 1HILA 2H0FA 1DUZA 4G8GA 3ZDXB 5KAFZ 1L9TA 1E4WH 1OP5H 3OC8A 2FUTA 1CL7H 4N68A 5AZUA 4JDEB 1I8MA 1Y74A 4D9QE 4GUOA 1FO0H 3TN0D 4FYSA 5H8DA 3K6IA 3E22B 1BEYH 4FQIL 5DTFA 3STLC 4U33A 5A2CA 4RAUB 4GKNB 3RWGA 4AGLA 3B5HA 4UUJB 4KKZA 2I26N 1BX2B 1J88A 5EEXA 3PXJA 4ZUWB 3NESA 4Z78B 1WV7T 4YC2B 1VIWA 4PYGA 4BE6A 4Z8FH 1KC8W 3JWNG 3GXTA 2GTAA 2Y06H 2UXVA 2Q69A 1IBKB 4Q2ZA 3GB7A 4UTBL 1G5AA 2ZKHH 3CLEL 4S1RH 4NDMA 4OLXL 4EBQH 1J0KA 2IIJA 1HDJA 5IP4A 1G7HB 25C8H 3APCA 4HC1H 3AMLA 3ETDA 1AGBA 3BGMB 2AP2A 4EEEA 2HTLD 3SSGA 1HNGA 3T8VA 5KYWA 4U7OA 3M8OL 1AKPA 4Z0BH 1RUQL 4UIKH 2F5BH 2NUPA 3DC5A 1DBAL 1KLUA 3S35H 4A66A 4QRFA 3CVIH 3SJVE 3DO7B 4YSOA 4X1IB 1GY2A 5LUMA 1JYXA 5GJTL 5ES4B 3ASOB 3U7WL 2YXMA 1YYMH 3CX5F 1ZS8B 1N34B 2BY3A 2WXHA 1C1EL 1WUZA 1X5MA 1N70A 3SDLA 3CXFA 4Y1AE 4YOKA 4UCUA 3Q8BA 4FFWC 1WJ3A 2GIMA 3BVNB 1W9XA 3DDGA 5GRZA 5CWSB 3TBVA 4P5KA 5DEFB 3DX1A 1N5AA 35C8H 4OCMC 1UASA 2FBJH 3HZMB 4GXUM 1BBDH 2F8VA 5H9CA 1AG0A 1MCCA 2FIKA 4JFDB 3ULVH 5FLXN 3EH2A 3FO9A 4OX9B 5DLML 4FG0A 2WMPA 1R3LA 3O3DB 1E8YA 3SPVA 3JUYA 4TUYA 4AVKA 4QF1B 5BV7C 2HT3C 4YIQA 1K72A 4BKLB 1DQMH 5B1NA 2XYBA 3FOLA 3N6YA 1W8EA 3T5WA 4M8QB 3MRDB 3BPLC 3V6BR 2FB5A 2VRKA 1T6BX 3NSCA 3DUUA 2BRRH 4IQHA 4FXTA 3ECUA 2X2YA 3PG2A 5GGSB 3ASNC 2EEBA 2OL3A 1I4FB 5DS1A 5D1XA 3STLB 1U8CB 2HFTA 3M99B 1WBYB 1QRNE 4UM9D 5LQBL 1FCGA 3QIWD 4UT6H 1V7MH 2DRUA 4PIRF 4XVUD 4WO4D 2JB5L 4OVVA 5DJ6A 4XO9A 3RPKA 2HLAA 3O2WH 3ABKB 2XTSA 3NJNA 3ZUCA 5L6YH 3OX8A 5ENWB 3FTZA 1SA0B 4D3CL 1JK8B 3GS0A 5BRQA 3DJ9A 2IW5A 1Y18A 4WU7A 2ZM6O 1OD7A 4NFDA 1B0RB 5FNVB 4MAYA 5AFAA 1LDPL 1ONQA 1X7TA 3K2MC 4MHHI 4OCRH 3R7RA 3RPIB 5LHDA 4OI7A 4P46B 4PJCF 2O6EA 1R3LC 3OGCA 4XNUL 3V0VB 3EFFK 3DOSA 1PNLA 1GYVA 2B7DT 3QUYB 1HQ4A 2Z8VC 3C9NB 1IGMH 2Q7YA 3BH8B 1I7RB 5BS0A 5KZCD 1Q6IA 3IM1A 3UG4A 1KWKA 2ATAA 1HILB 1ZHKB 4F1SA 5ESVA 2YK1H 2AQRA 3BE1H 1TQWA 1QPKA 1LWRA 5T3XE 1A7PH 4DTGL 2QQNH 2D7TL 3MI6A 1H19A 4FXLA 1KXHA 5B1AC 1Y74B 1NBZA 1ROPA 1MKFA 5E5MA 5JOEA 4M1GL 3P9LA 2AABH 5LJYH 3A6BL 3G6DH 5DTFB 3VYOA 1VQKV 5EUOA 5D1XC 1RUAL 3O3EA 3K0DA 2MOVA 4U3XA 3RDTD 4JREC 1QKZL 3VSTA 5F3BB 1U8NB 2WUBL 1CDCA 4FLZA 3REWA 2C9SA 4LCVA 5A3IC 3ISRA 5LWYH 3TEXA 1W91A 5KHHA 2A7WA 3HAEA 4XN2A 4CVXA 1P49A 4WEBL 1L1FA 3AFLA 3S3WA 1J1OH 4Q2ZB 3VFGH 1RPUA 5ABDE 2BW5A 5C0GA 4MB4A 4XNBA 4KQ3L 1GSKA 3Q9PA 2VR9A 2RD0A 1AGBB 3LB6D 3G5VB 1SS3A 4I88A 4MAYC 1RERA 1MOFA 2Z3FA 1FIEA 1A3LH 2NUPB 2EVIA 3GSNL 3M7MX 1BCIA 1IAII 2VM4A 3K04A 5ERWA 5F9OL 4B41A 4GKLA 2KKQA 3WN5C 5TE4L 3LRGA 5CAYB 1LO5A 1AI6A 3KPSA 1AD0A 2M26A 1S7WA 1YEIH 3GJFH 4UAOC 4Y9GA 3RWFA 4KJWD 5GZOD 3VX1A 2YS4A 2QWPB 4P5KB 4LLYA 1N5AB 2ZKYA 3L7EB 4JFZL 3QJSB 1EHXA 1P2CA 2FIKB 1YIJV 5D1QD 3BKMH 1FXVA 1F8TL 3P2BA 4KI1A 2WMPB 3O2DL 1R3LB 3F5TA 3CBKB 3HZ3A 3X1NA 3BA9A 5KG9A 3DXAE 4EQ3A 3SPVB 2OZ4H 4TUYB 3U6RA 2G60H 3MV8E 4DO6A 4YIQB 3V0GA 2YUZA 1DP0A 3EJYC 3IGKA 3RILA 3FOLB 3G3LA 2J3SA 3SOTA 2XY2A 4AILC 3MNZA 1QWHA 1CL7I 2VISA 2BSRA 4H2CA 2BJMH 2GUYA 1CLCA 3GI9H 1MCWM 3BVDB 3NCFB 1NKDA 4JI1O 4NNXA 4EN3A 1R3IC 5B1AB 2ZZUT 3KCXA 5JQ6L 4ZS7H 4NIYE 3H01A 4GT1A 5C93A 5D1XB 4NC0B 1T20B 1MAMH 1QSEB 4XP1H 3D0VA 3FN9A 1L0QA 4JREB 1R5VB 2R69L 3MNWB 4NFBA 1IAKB 4MX7A 3MV9E 2A74A 2GJRA 2IF7A 3L7FB 4O58L 3K74B 4YSAA 4MZIA 1FKAO 2D7NA 2XKSA 3G9AB 4O5LL 4FQJL 4R4NC 4PVBA 2AJZA 3OX8B 5DD1L 5JH7B 3KPTA 4NI6A 3TGUH 3TBBA 2V5TA 2NSMA 1DVQA 4B3MO 4N5EC 5K59E 2PF4E 2EC9T 4WFFD 4YAQA 1OAYH 1Y18B 2R59A 4PLKC 4OD2A 3FZUC 4MAYB 1OCWH 4N4YB 5GZOC 1JPXA 1BQ5A 2HPOA 4LPUA 4NQQA 4MJIB 1CK0H 2WTOA 3A21A 2PPFA 1F0LA 3QG7L 3OGCB 3DGEA 4LF4O 4FLHA 1I31A 3SPIA 1HQ4B 3GGWA 3F7PC 1XDCA 1P1VA 4CH6A 2HRHA 3EOAA 3WN5B 4JB9H 1QQDA 1KJ2L 2H9GB 2IANA 5E1AA 4XP4H 5F89A 3VTMA 4AGMA 1N33O 2IDQA 5ESVB 5F0MB 2ICES 1HR0B 3IDNA 5BZWA 4BXSV 3T3PB 2IFGA 3BYTA 4XDLA 1USZA 2X44D 3MLRL 2DICA 1P7BA 1F2QA 5E5MB 3QG5A 2RCSH 1IGFH 3T4ZA 4K23L 2YMXL 1MVYA 4JG1L 1U58A 5EU7E 3VQMA 5IQMA 3PJSA 1MFDH 3QJOA 4DPAX 1QFWM 4XC1H 6FABL 1KB5B 1Y6NR 1ZHNA 4Z7QE 5BRZE 15C8H 2HHHO 4AH2A 2A74C 3SEPA 3OLGA 4WUUD 3REWB 3HIZA 1JOIA 3K4DA 2RA1A 2GTZA 4QE7A 2IDTA 3HAEB 4CVXB 5TFSL 1R19A 3NIDF 4YDVA 4D0CB 3OSKA 1PZBA 1VFMA 3JTTA 4TULH 1UURA 5HDQL 5B1OA 3W11D 4FM0A 1CCZA 1XBDA 2XZAH 4HOWA 2CBQA 1L9RA 5C0GB 2X9ZA 2N7BA 1JGLH 5HHOA 1FNAA 3I75A 1XMQO 4UQBA 3DI3B 2LTQC 5EUKA 1P4LB 3JATA 4M4PA 5CIPB 4Y9BA 1YEGL 5FK9A 4FP8L 3D0LA 3QG6A 1PQZA 4V2CB 2WZPD 1RJZA 3UBXG 5ERWB 3CGTA 4OCNC 3CUPA 2BP8B 4I9WD 2Q10A 2BS8A 3OUFA 2J8UA 2UZYA 3TBWB 4RIRA 4F7PA 1XR9A 1LO5B 3LRSA 3KPSB 4A1RA 3QIBC 4YHYB 2R2BA 4WTQA 2XTJC 1B2WL 2EUWA 2Y24A 3CVDA 4OZHB 3RWFB 4PRHD 5B38G 3L17A 4N20A 5BMFL 3TK1A 4OF0A 1AZRA 3ZDYE 4LLYB 1NS1A 4GUQA 1URZA 1M4KA 1O6VA 1P2CB 1UG9A 4XAKE 4K2UH 5EO9A 1O6SA 2V3FA 4W6XB 3EYOB 4IGGA 4OLWH 1G6RA 5E0QA 2VLJD 1G84A 3WB1A 2OJZL 4E0RA 1DE4A 4ASUG 5I8KH 3PFQA 3U6RB 1U92B 4YHNA 4C54A 4CNIA 2NY6D 1SQQH 4XH2B 3PREA 1DBJL 1W2BU 3U4BL 1EZVY 2IJJA 4RO2A 2N59A 3QS2A 1JQ0A 2GTSA 1EXUB 1KBPA 3MNZB 3V9CA 2VISB 4G6FD 2WSSG 3RYIB 4XO5A 3J07A 2WC7A 3N1FC 1DSFL 1RVFH 2E27L 1GJWA 1HHHA 5F9WC 2WYTA 5DHDA 2Q5ZA 3WTSA 3JTSB 2ZQKA 2Y7QA 4L2YA 4P2OA 3VO0A 2CGZA 3D0VB 1SKVA 4WY7H 5D8JH 2VABA 5C0BA 3UPCA 3V6OA 3QQXA 3HG1A 2A74B 2E46A 4CC5A 1F6FB 1SQPH 2VN5A 1H6TA 3D18A 2AJZB 4OI8A 2QADD 3BPCA 3QSKB 4GQZA 4GYBA 5KWYC 1KT2A 5C3TA 3W7WA 2PI5A 4RISH 1CR9H 3IEAA 4Y2LA 1ZT7A 3CZEA 3WJJA 4YAQB 1I1CA 3EVKA 1SJMA 3PGCA 2VDLH 5GS2H 2PR4H 1FQ9C 4QHKI 4RQQA 5FEBA 1BXAA 3NIFF 4X5PA 4CBCA 1PG7W 3NJLA 3GGWB 4MNGE 2CHDA 3TGXA 1MJ8H 1ZDQA 3CCMV 3EOAB 3K81A 1QQDB 2BLFA 4PUBL 2IANB 4NRZA 4WWKD 1VQPV 1F86A 2RQ8A 4LARL 2VWEC 4HW6A 1TQSA 5H2FZ 1NCBH 2EXWC 1THCA 3HN8A 5E03A 4DCQA 1XMEB 2XTJB 3IGUA 4MJ5A 3NIGE 4NJAL 4C47A 4HH9B 4GZRB 2EEDA 3PP3K 1FGNH 1FJ1B 4Q9RH 1U58B 3WKNA 3WO3B 4MAUL 1B0IA 2ZWSA 4Y89A 5L3FA 1ZHNB 1GHFH 2FSEA 2QKAA 5LBQA 3WG7B 3ARRA 3Q6GL 2ADFL 3RTLA 1JGUL 2ZG1A 1AJ7H 2GTZB 4B08A 1H2MA 2HT4C 3H7LA 3QJHA 1DLFL 4WO0A 4YDVB 5HHMB 2Y2YA 3HRPA 2B59A 2W94A 4AX3A 4EI5A 3ZHLA 3SDCC 5HHOB 4TNEA 1XMOB 4F7EA 1FJGB 3F3HA 5EUKB 2VM3A 1GYUA 3JATB 2P26A 1G7QB 3DOHA 4XMWA 5F9WB 5PAZA 1D5RA 1OGAA 3D0LB 3T0EC 5C7XL 3SYPA 1RJZB 3EF7A 4YDKL 2I9TB 3BFQG 3VOUA 3E6FB 4AT6B 1UT1A 3CUPB 1BS3A 2NR6C 4FFYA 4ZJ9A 4MQTB 2UZYB 4F7PB 3QWNA 2QKIA 4PJAE 1XR9B 2YOCA 3ARDA 3ZTNL 4YSUA 3LRSB 4N26A 5I6LA 1HHGA 3QXAA 2R2BB 4WFHD 2XHNA 2PYEA 2LLGA 4S10A 3LNDA 2B1AL 4LCIL 4ABVA 1II4E 3PHOA 3V0IA 4M3JA 3RVUD 3B5GA 1PGRB 1IZJA 1ZK9A 5HXMA 1M9SA 1BAFH 4JCMA 1YMMA 2RTTA 3OKKA 5EO9B 3CFDA 1E7UA 2X70A 2BPBA 2FD6L 1FC1A 1JGIA 5L9DH 3KYKL 3HFML 5GGVL 5B8CA 2OTWB 2ZE0A 3EJSA 3MJ9A 1W0VA 4IOFC 1DE4B 3QXWA 4TRPL 3VD9A 4E0RB 3B7RL 5FA3A 4BUHA 1QR4A 2BM3A 4LFHG 1OZ0A 5KVEE 2PXYA 4F8PA 4QEGA 4ZUVA 4YGAB 3RYHA 4OW6A 4AVIA 1AO7E 4AUUA 2AMGA 1VGEL 4HVBA 1E43A 1Q1PA 1HHHB 4U1IA 2V17H 1FL5A 4QRRD 4F80A 1A02N 1A3QA 4AVHA 3RZCA 2Y7QB 4O2EA 4K55A 4P2OB 3CZJA 1A6UH 4G6JH 5IM7A 1A0QL 2X2HA 5C0IA 4JFEE 3F2LA 3HG1B 2XG4A 2EDTA 4GG6F 2ADIA 4HIXH 3SDDC 4CW1A 1JFFA 4NSKA 3CS5A 3V0HA 1HEHC 3LH9A 4J4PD 4XNXL 3D18B 3VQ2C 3Q8FA 1KB3A 3BPCB 1XBLA 1KT2B 3RTQD 5SX4I 2QA4V 1RKRA 1ZT7B 4Q9QH 1W8OA 5GIRA 1CDJA 3WYRA 4GBXA 1A6ZA 4OCLC 3OT7A 2BVTA 3B1UA 1WAPA 5B8CC 3BZ4B 3GRWL 1F4WH 4BXVA 3T0EB 4AJWA 3HS9A 3ULUD 3RDJA 4L37B 4LOUC 4NI3A 2GT9B 3ZE1F 1BV8A 4NRZB 5DI8A 3T1CA 1VSCA 3HC3H 2PXYC 4Z0XA 5CU5A 1L5GA 4KK8C 7TAAA 5JPNA 3RWRD 5LMUB 1XD1A 4EE2A 3MLXH 2X7RB 3D9AH 3VXTB 4MJ5B 3JCZA 4JRXA 2KZKA 5IBLC 2YR3A 3OZ9L 4EO5A 2GSIA 3T6ZA 1OW0C 4DR1O 3W37A 3RIFK 3U30B 3V2AR 1JNNH 3ULAB 4R8WH 3RZCC 4WGKA 1SYVA 2RAMA 4M7JH 4KKAC 1HK6A 4DP6X 5D2NA 1JD7A 4RDQF 3DIDA 3GMPA 5JIKA 2OX5A 4H88L 3IWVA 2EXTA 2HRGA 1OTUD 2VSCA 1X9LA 4LQ1A 3D36A 5KS9A 5C0DA 4ENZA 2WKOF 5FCUL 3QJHB 2YBRA 5G4MA 4LLMA 4I3GA 3S8GB 2XUMA 4WF9V 1KBKA 2BXZA 5I75C 4EI5B 1AGEB 2WQSA 3LMJL 4OZFG 1J5IA 4PPTA 5T1JA 3ALPA 1OSZA 4PMFA 1JPEA 4OLVH 1JCHA 1BZKA 3O4LD 4HWZA 4PJGA 1UD4A 1RSOA 1WNSA 1I8KB 1U91B 4L5FL 3L4VA 3MRFB 3NJGA 4X5WA 2WZ0A 3V52L 4R7CA 1MCWW 4YSDA 3CTTA 2CPUA 1IC4L 5FYLH 2XUWA 3WNJA 1N4CA 2QKIB 3ARDB 2QJ1A 5HHQA 1E5CA 1HHGB 1ET5A 1J8RA 3SDDB 4EVNA 3QXAB 1D9KC 2ENPA 2PYEB 4LHJB 4JPKH 1M1KW 4MXVE 3UTZA 1WPBA 1F02I 4JI8O 2KZBA 4UT7H 3LD8C 2WV3A 3V0JA 5KTEH 4YSQA 4FK5C 1YMMB 1VCBC 3L5XL 3HHMA 1TF4A 2XHBA 2X2IA 1S9YA 2X70B 2M83A 3MRNB 3H9HA 2OMYA 1CU4H 1ML0A 1N59A 1NOFA 2BH0A 2GC4C 3ATEA 4P9ML 5B8CB 1JPGA 1IBBA 1BAGA 3CHQA 3KBEA 3REVA 4U1LA 2A4ZA 5EU6E 4PJCA 4U7SA 4Y4FA 5I1GH 1BREA 5FA3B 1S7RA 4S1QH 3RL1A 4PQXA 5D70L 2PXYB 3FHAA 4HIEB 3BLBA 1IBKO 4HNAA 1OE3A 1ZVNA 4LT7A 3RYHB 1NKOA 3GBMH 4YS4A 4HCGA 4XPAH 2X42A 4E68A 4LWSA 3GXMA 4U1IB 3DTXA 1EAOA 4F5CE 3CG8A 4HJIA 4OKVA 4PTTA 2VXTH 3RZCB 4O2EB 4C8XA 1RZ7H 1U41A 5C0IB 3UJJL 3LKPA 5F8RC 5FUCC 1QNIA 5M94B 4F1ZA 3KR3L 3KDPB 3TV8A 2GITA 3BWUF 1KCRH 3KW7A 2XG4B 1OAXH 1GY1A 4DR7B 1NT2B 4L8DB 5CINL 2Y4SA 4XE0A 1N34O 5SV4A 4CW1B 4PBWD 1JFFB 4NSKB 5DRZA 1GOHA 2ZOKA 1MWAH 2XI9A 1KY7A 2AXGB 5IK3B 2JGDA 3ZW3A 3KG2A 4CS3A 3OMZA 1Z9MA 4IRJC 2RNBA 2AQ1A 3LEYH 4M00A 4Q89A 5FA4A 4KZ0A 5I75B 4OJEH 2OYKA 3L70H 2UXGA 2KUTA 2F54B 4XN5A 5IUSA 4G80B 1A6ZB 1LO4H 4GBXB 4R97C 4IHBA 3Q8AA 1G4MA 1FF5A 3IFLH 1X5IA 3RL2B 2JCWA 3BOVA 3UGUA 5I24A 2AJXL 5SWZD 4OF5A 4OX9O 3OHMB 4HPOL 2LHAA 3UCQA 1KEGH 3LUTB 1NKRA 1RFDH 2FVNA 3UOAB 4Z0XB 5JPNB 4U4BA 1RPKA 5ESAA 3Q4HB 4HT1H 1XF3A 1D9KB 1J9QA 2CUIA 2YAOA 3GSNA 2ZIOA 1DJGA 3PWJA 4JRXB 5FO9A 4ANKA 2GSIB 1UENA 1XUQA 2XWEA 3L4YA 4E9XA 3ESMA 1PG7X 3LD8B 2EEAA 3BN9D 1EN5A 1QUNA 2IPTH 4PLJD 5HGDA 1KN4L 4R96A 3Q06A 3GMPB 3IMWA 1WT5A 2OX5B 3VH8A 1T1ZB 4OZIF 4L4TA 1AXTH 1S3RA 2XZCH 5KS9B 2PTVA 4UAHA 5C0DB 1JTPA 4F15C 2H41A 4XB7A 4JO5A 3ARQA 2DM7A 3D5OF 1IM9A 3RI5F 5HI4D 1J1PH 1NICA 2ZR2A 2QV2A 4JO3H 3O2DA 3NCEB 5KX5A 1OSZB 2R56H 4ZI8A 2XVLA 1XR8A 2MHAA 2WZ6A 4HBQA 3BAYA 2CHXA 3DMMA 3QEGH 4HWZB 4WIQA 1JJUA 2UVEA 4JGMA 1MN4A 2YXVA 2YLKA 3AG1C 1CUOA 3CZLA 1NVPB 1JVKA 3FS9A 2Q8AL 1ZKAA 1PYWB 3RA7H 2Z64C 3I85A 2VUOA 3II3A 5BJTA 3CFTA 3QPKA 5HHQB 4GEJA 4NM4L 1WBXA 4EVNB 2AQPA 4YXHL 3IDXH 2H32H 3QDJA 3W39A 3WFBL 3VD4A 4IRJB 3MRCB 3B43A 5KUKA 1JRHI 3QZPA 4ZXBA 1V7NH 3IN2A 1CN4A 2L6LA 1GKOA 3EBAA 4R90L 4YN3A 1S9YB 5CCHE 3GLDA 2WSKA 4PY8I 4RBPK 2OMYB 1N59B 1OF0A 3SGJA 4B97A 1RUKL 4LC1A 1JPGB 5DQ9B 3F01A 3REVB 1U6AH 2DYRC 3L3KA 3N41F 2VDPH 4PJCB 2FJFA 4Y4FB 1S7RB 5HYEA 3BQUD 3DYPA 4XXWA 1QYGH 2VIRA 3GFUA 2EE3A 4GQ9L 5H35A 4G8IA 1NBVH 2XBZA 4Z7OE 4HNAB 1ZCRA 5IUCA 3ZL4L 1ID2A 4LWSB 5E00B 1DL7L 1IKNA 1ES0A 2FWSA 3DTXB 4OKVB 4PTTB 4XNZC 1KJ2A 3ERXA 5G4NA 2YPLB 4DW2H 3PABA 1F4AA 1KBWA 1JA8A 3OC5A 4QKXB 2QELA 4BFOA 4YXKH 2A2QT 3RVZA 1Q94B 3LKPB 3AW5A 5C2UB 2GITB 5T5FH 2DTSA 1LDSA 2R1XA 5IW3A 4KL1A 4D9RE 4FFKA 4R5VA 1KULA 3CEIA 3EXAA 4C4KT 3PL6A 2ZOKB 4F15B 2GY5A 2BWQA 5I9QC 3CU7A 4BZ1A 2JGDB 4BCXA 1CXEA 1JHTB 1QFUL 2AERT 3AABA 3D4CA 3DJSA 2BFVH 3HZYB 3OAYH 4PJ8C 4U1MA 5FA4B 3SBWA 4K71C 5CD5C 1M7XA 5SWQB 2FR4B 3PQYD 1OAUH 3A4DA 4G1EA 1W59A 2YZ8A 3SGJC 4EIGB 5IB3B 4GS7B 5CKGA 3CBRA 3EHBC 1L9NA 2HRPL 3AG1B 4JQIH 5J06A 2JCCE 2WUCH 3HCVA 4QRQA 2P45B 2WWKO 3HNVL 1NFKA 5D7IA 4XXWC 2K6YA 3UJTL 5ELIA 5C71A 3K5SA 3FYEB 3KYNA 1NCNA 2Q7EA 4E41D 2WAHA 4I7ZB 5E9DE 2EDYA 1T7VA 3T77A 4JCWA 3UPAA 4X80H 2XKNB 3GSNB 2XPGA 5FO9B 1F13A 1KACB 1RJCA 1W0WB 4YDIL 2Y0PA 2XN9A 3NCJH 4U1JA 1Q9OB 3UGEA 2CO6B 2SEBA 1OF2B 2V0AA 1EN6A 1QUNB 2F53B 3F5WC 4Y4KA 2CR3A 4L1LA 2J88H 5E95B 4FA8A 4R96B 1AC6A 1MIEH 5FF6A 5DZJA 1WFUA 5E99L 2DWTA 3D3VD 4PG9B 1OCZC 4RNRA 4FJ6A 4XMLH 4F58L 1X9QA 1JR9A 2QSCL 2DYRB 5F7EH 3TNMA 3PL6C 1RP9A 1FSKC 1RIVH 3H85A 4YHHB 4OJDH 2HEPA 3O41A 3LV3B 3V5KA 1M90W 4DR2B 1IM9B 5D7KD 4CRPA 1BGXH 2MMXA 3SYQA 5E0FA 3QZBA 5KX5B 2WCGA 5B22A 1XR8B 1I9RH 1PTZA 4PRIE 2APTA 1EX0A 4P5RA 4XNZB 3U0PB 4CUCA 2OPCA 3ULUF 5EOQH 1UXSB 5I5MA 2PPCA 1TUPA 5I6PA 1UUNA 2BFGA 3APNA 3K7UA 5C09E 1K4DA 3LZFL 3V4VH 1F11A 3WFEL 3IMVA 4IIJA 1KCBA 4ABMA 4KX9A 1R75A 2N05A 1AR5A 5LHIA 4LHUB 5I9QB 3QDJB 2FX9L 3W39B 2G38A 3X13A 2GFBB 4KKCD 4PJ8B 1QCEA 5T3XH 4B9FA 4NQEE 4AL8H 3MO1A 3FUIA 1PLGL 4Y4KC 3LKRB 3MGTA 4M43H 5IMMA 1DUYB 3MODH 2HFGL 3S4SG 1R9FA 5HYJD 3TO2A 4QHMB 1MCJA 2X6UA 2X09A 3QFGA 4NM8L 2VZOA 3L3KB 5SWSD 1P6AB 1KB9F 2W60B 3JSSA 3L9EA 2VIRB 3RYMA 1G87A 4JTAB 1MHPH 4WFED 1FVDB 5H35B 4G8IB 2V5YA 1UATA 4LP8A 2E6PA 5GPRA 2QQKL 3TT1H 2JF1A 4NQCE 4OCWH 3S37H 1ES0B 4FQ1H 4H0LC 3VQXA 1A4KA 5KJ4A 1AZVA 1KJ2B 3BX7C 2UY6A 3PABB 3B1TA 3F5WB 4PS4H 1N7MH 1TZGH 1QBLH 2J4WH 3VI4F 5CN2A 3ATDA 4Q74A 1JERA 5KMGA 5EZIL 4B3SB 3W82A 3E3QE 1A14L 1NFDF 5CP3A 5J56B 2R1XB 3STBA 4B9CA 1K4DC 4JYYA 3QJZA 1MF2L 1TENA 3PL6B 5EB9A 1R3HA 1Z0NA 2H1PH 3JASA 4FHBD 2Q87A 3MBWA 1WICA 4U1MB 2G9KA 4YBHA 1EZVH 1WP8A 3BAEH 2NW2A 3UO1H 5DLLA 1KCVH 1W72H 1ZAGA 1TKWB 1E4WL 4S0HA 3FW6A 5AZEL 3HRZA 1CVRA 4G1EB 4WWPA 1S9XB 1FO0L 4MVRA 4GUCA 1WH0A 2FUQA 3Q2LA 4FI7A 2LT9A 1BEYL 3KAAA 1I8UA 2OQJA 3DX0A 5D7IB 4O2AA 4PS7A 2Y23A 2NNXA 2W9EH 4I89A 3UMTA 3KYNB 5I1KH 2LLLA 1CFBA 4PHXA 1SY6L 5FM5O 2Y7LA 4LQFH 4PS8A 3T77B 1RU9H 3VAEA 4P57A 3PNWA 4MRCA 1PVHA 4EDWH 2CK0H 5I23A 2Y06L 4QJFB 5GGSY 4U3CA 2GJPA 4P4RA 4U1JB 5F1NA 1Q4NX 4HUVA 3I6LE 5ANHA 1OSPH 1P4UA 2UWEA 4EBQL 2SEBB 3WNNA 2OYMA 4Y4KB 3C8DA 4O2FA 3J8F7 25C8L 3QI9D 1WEJH 4HC1L 5FF6B 2NZ9D 5L3BA 1QSFA 1EMTL 1D5NA 2YI8A 3PHAA 5KVDE 5IFJA 12E8H 2VR6A 4RNRB 4Z0BL 3ATAA 4UIKL 2F5BL 3QIWC 1KP2A 4PRAB 1INQB 3S35L 3CVIL 2D4FA 2CBTA 3IU4L 1AQKH 3GSXA 3K0WA 2RCVA 2AANA 3I9IA 3KJ6H 2YD5A 4H8QA 3O41B 3V5KB 1YYML 4YIOA 4IT5A 2QDWA 5L2KE 2FL5A 3GBNH 1OQXA 3WV0A 2CCVA 5JMOC 2OSXA 5IKCA 4IIZA 4H0LB 5DFWH 3UC2A 2N56A 4A2DA 3WELA 5D2LA 35C8L 2YXHA 4ZIBA 4NO0A 3BGFC 5CO1A 4AQ1A 3ZHVA 5DXWA 2PO6A 1BBDL 5KBPA 1NPNA 1G0XA 2VR4A 1M2VB 1T5KA 2P06A 4ZSOA 3MJ8A 4WFAV 2JJTC 3P11H 1K4DB 4FZ8H 4JL1A 1F11B 5ADPH 1NDTA 3DX9B 3N43F 4GG6A 5D7LD 4WNSA 2CTWA 1WCQA 5ITFA 3X13B 1DQML 4N1HB 1UWEH 4NN7C 5L88L 2DLIA 3PHQA 5LGTA 4TUJA 3U1SH 5L4JA 2VWKA 5IJKC 1X5KA 3ZOAA 5IMMB 3H1HH 2BRRL 2HCZX 4G9FD 3TO2B 5AWNH 3RDTC 1U8QA 2GTWA 5I28A 3SJQC 4DGIH 2DWDA 4HWBL 4JI3B 2CG9X 3LKQA 4JLRA 5DEGB 2PCFA 3H4FA 5L8JB 5LKNA 5C07E 4RSYA 4WKZA 4UT6L 4YGVB 5L4IA 2ICCA 4FPPA 1KKDA 1CLZH 4KAQH 4TSCH 1RY7B 1S9WB 4TPRH 2EX3A 3W5NA 3GRWA 1CYGA 3O2WL 4MSWA 1XMOO 5L6YL 3LB6C 2IJIA 3LPFA 5JJEB 1FJGO 1A4KB 1HH6A 4DR5B 4I77H 3P4LA 4TSBH 4AQ1C 5D4QA 3DSFH 5LMNB 3BHBB 3X14A 2IJHA 3X1EA 6CGTA 1B3IA 4GP5B 1NAKL 4OCRL 1K34A 4UM9B 2PP9A 1WFTA 3FQNB 1TZIA 3QIWB 1FL3B 3V5HB 3QUMH 4PWEA 2VERN 5BW7C 4OCXH 1TLMA 1B6DA 4ZT1A 2OCCC 5LYJB 4J28A 1G9ML 2EO1A 4UV4H 5CEZE 4KJWC 1Q3EA 3BMWA 4DP5X 1IE5A 1J12A 3IU3B 2NW2B 2YK1L 3BE1L 1JAEA 1R5WA 4MTMA 4TKWA 4Y5XC 1A7PL 2MPAH 2QQNL 4YHMH 1NBMG 1PY9A 4WFFA 1XH3B 5D1QC 5I16A 5IJVA 5DMJB 1U8KB 2AABL 3G6DL 3BGFB 2OQJB 4JGJA 4ZUTA 1XTMA 1ETJA 3I02B 3L73H 4O2AB 3O8XD 3APOA 5E5RB 1P7GA 4OVUA 4DR3B 1LNUA 2A79B 1NLBH 5TDOA 4L8SA 4BK8A 5KZCB 4MNHB 3S0PA 3LXAA 3CCHB 1K73W 4P57B 3IGAA 3PNWB 2PWHA 1SVCP 3E9TA 4FNRA 2F7PA 2J1XA 4P4RB 3NFNA 4HUVB 1J1OL 1ET8A 3GQFA 4NN7B 3O81A 2AKRB 1D7FA 4O2FB 1JWUA 4KY2A 3QXUA 5EBMC 4GXFA 3VGDA 2AZ2A 5I6NA 3WS6A 2P5WE 3RDTB 1PD6A 2HJKA 2IWKA 3ESNA 2G2RA 2O6DA 4BQ6A 1A3LL 3FQRA 1K92A 2NSQA 3IBOA 3W0WA 1IU1A 4FM1A 3TIEA 2C26A 3GSXB 1A7OL 3FSZA 4V33A 1BZ7A 4G83A 1SJEA 1MSWD 3G6JA 3WENA 4F33B 2IADA 2FL5B 3WEXA 2AEWA 3QEQD 2XN2A 2X2UA 3U11A 1YEIL 1T21B 4DO4A 2K0RA 3FO2B 4S1DD 3SHSA 3CQFA 2I60H 3AXHA 4R2GC 1T2QH 3BW9B 4NO0B 5EIQA 4AQ1B 4NAMA 4QR7A 2PO6B 1L0XA 3T2QA 1NLDL 3ZMSA 1JOYA 4GPVA 1SQGA 3HBZA 3BKML 4ZSOB 1I7UB 5HFMA 4AV5A 3MKKA 1VA9A 4Z7UE 4N2IA 1JZDC 2VR5A 4WFGD 5KYNA 4K5OA 1E5ZA 1O9ZA 5LMUO 2OZ4L 2AJSH 1MG2C 2G60L 3VQLA 1N0JA 4GG6B 1BEXA 3L6FA 5F88A 5ITFB 3FAWA 3CRRA 5LXTB 1VACA 4NZTL 3PHQB 2FO8A 3IFOA 4KVNH 3AWFA 1PM9A 1FNHA 4TUJB 4B7LA 4ETQA 1PD3A 4JGNA 4Y5XB 1TEYA 3IMSA 2EDOA 1JPFA 1YQVH 3G08A 5CP7A 2UXBB 1R47A 5BQDA 1U8QB 1WGVA 4FD0A 2P5EE 3Q6FA 3JWNH 3U2JA 3KDMA 2DWDB 4OGZA 1MAML 4JI5O 1T0MA 4JLRB 1WZMA 2O4EA 2KDYA 3OHXA 2CHNA 4JGUA 4LNRA 5FWRA 1HEJC 4WKZB 1YO4A 1MCRA 2MH4A 5ID0A 1LMIA 4WFBV 3W11C 3AT9A 4YFLF 2FT8A 1JS4A 2R70A 3G6BA 4KHPB 4JJHA 1DQLH 5FUZH 3N0AA 1EVTC 3VFVB 2AXFA 2DIBA 4WI5A 1SOQA 4DV1O 3B9DA 3V4PA 4HHGA 4J2XA 3O6KH 1M6UA 1I0HA 4FEIA 5CSZA 1OAYL 5EBMB 3X14B 1PY4A 4LNUA 1E65A 2BNUA 3RRQA 3P32A 3FSAA 1CK0L 3BWUC 1MHEA 3UGXA 4FYQA 4FA7B 1TQBB 4JB9L 3KXFD 4DP4X 4PBVC 2DDQH 4XVUC 3E7JA 5LN4A 2UY7B 4CZZA 3WSQH 4QIWF 4I2XB 3BEWA 1JZGA 4QGYA 4AYEC 2D3NA 1R5WB 3CDFA 3OB0K 2VQEO 3THOA 4UU9A 2G9HB 4KRLB 4UM8A 5I16B 5IJVB 2OFQA 4R2GB 3DC6A 2RCSL 3QDHA 4OUUA 3EJPA 1IGFL 4OZGF 4ZUTB 4HIHA 3V0WL 2D3OW 1MFDL 5A6MA 4I4TA 2IAMD 4GRWE 3OHXC 4PJ5D 4XC1L 1LNUB 4E9QA 15C8L 4L8SB 1M56C 2DQIL 2Y48A 4IRZH 5LGKA 6PAZA 3CVHB 5DJ0A 3OB8A 4G43A 5K93A 1UWFA 1U36A 1CFMA 1OE2A 4WI3A 4NO3A 2VXSL 3MOAL 4TULL 3NFNB 2BOBA 1S7UA 3X2QC 3BSHA 5F1KC 2AAAA 1JGLL 3H9SA 4NAQA 2FZ3B 5LP6A 1XV8A 3JSNA 5KANI 4QRPD 2HJKB 3G6AB 2G2RB 1J8HE 4QDGA 4Y2OB 2ZUTA 3R8BB 4H1LA 3W0WB 3TIEB 4DR7O 1RJLA 4L1TA 4WI2A 3O6FA 4K7PX 4HETA 4X4YA 5AOZA 1BZ7B 4WI9A 2QADC 4UIMB 1A9BA 2FATH 2IADB 3WEXB 2N04A 3E8BA 2Y6SD 1H2SB 4DUZB 1FLRH 3E1ZA 4PYHA 3MA9H 3JAWA 1PCXA 4NUQA 3BFRA 4WHTB 1FNEA 2VO8A 4C4UA 1BL8A 3VXQA 3SGKA 4J39A 4E36A 1KOAA 3GTTA 2Y69C 5GS0H 1HESA 1TZHA 1U8JA 2GI7A 4K2UL 1BP3B 1NEZA 1S7QB 3N85H 5AVQB 5IJCC 1WK0A 4NRYA 5C0JA 4B6ZA 4OLWL 4IU2A 4WWKC 4Z3EA 3THMH 2YC1B 2YAPA 4N2GA 1GA2A 5I8KL 4LVNB 1OAQH 1WE5A 2HFEA 4JN2A 2VLRA 3L6FB 1N36B 4KUMA 1I94B 4J2QA 2BNRD 4AGPA 1I9IL 1VACB 2Q3XA 4QRSA 3IFOB 3FT0A 4YQXH 5JHDD 3AM8C 4K9EL 3WMQA 5I19H 2P4KA 4XVSH 3RWEA 4HHAA 2N74A 1JPFB 2CBOA 4JFQB 5LP6C 4FMVA 5F0LB 5DSCA 3ZQ9A 4K3JH 1RVFL 3Q05A 3L5HA 5DD5H 3OKEA 3FCSA 1N18A 1EIBA 1L8DA 2VLJB 1VIBA 5FECB 2D9QB 1T0MB 3OHXB 4B60A 4LNRB 2A83A 5D8JL 5ID0B 1M56B 1V27A 4WI7A 3WIAA 4MJHA 5IQ9A 1YPZA 3JWDH 5DMGD 5MEQB 1CF8L 5BVPH 4O4HA 1RPQA 2WA3A 4DP0X 2QWNB 1T5WA 1YEEH 4HMDA 3S5LG 2CKBL 1CR9L 4X4MA 1ZT4A 3AU0A 3D6GA 3QDME 3GT6A 4AM0Q 2CLVA 5CSZB 3D3IA 4KTGA 4OZ4A 3O11A 2LGNA 5L0QC 1Z3RA 2WCSA 1HHKA 1UGKA 2BNUB 4NJ9H 2PR4L 3UTTE 4RMRA 4E9TA 1SXZA 2BHYA 1H3VA 3BESR 4OZIB 2DI7A 1IUZA 1ZA6B 4H7VA 3EXJA 1RHFA 2QADB 2ISDA 3BEWB 5L3DA 3RVUC 4Z7VF 3SDXF 1AHMA 1JYNA 1K4CA 3VWKA 4Y16D 2APBA 3D4ZA 1EHAA 4UU9B 1DQTA 2WVSA 4UM8B 4FNQA 4HMCA 2XN1A 5GISH 2WBWB 3V4LA 2Q0OC 2Y69B 4CU7A 4HIHB 3F84A 3CHXA 3MV11 4K94H 1GHFL 5HGHA 3FSOA 3GSQB 3S3DB 4PA3A 4X65B 1N3NA 3F7YA 5DJ0B 1UD5A 3CLFL 4G43B 4MB1A 4YDNA 1AJ7L 3IFNH 1HXMA 4NO3B 3GSWA 3NA4A 4LNVA 4CMHC 3HE6A 4ODVH 4MYWB 4D9QD 1IEHA 5D7JA 3RUGE 1N4XH 3C60A 2BOBB 4RUEA 1WPCA 4MD4A 3ZZSA 3VD5A 2EZOA 2DH3A 1MCSA 3H9SB 1EWHA 1MCHA 3G80A 4TXVB 3EYQD 4LP4A 4X4XB 3U9UA 4F37K 5LP6B 2WYIA 2Z7ZA 3UG5A 4PJHA 4X1KA 2N4IA 3CC5A 1JZ7A 2XWBA 1CGVA 2ZSWB 3MQIA 2VW4A 5KYYA 1RJLB 3QZWA 4Y19E 4AK2A 3O6FB 5JIIA 3N41B 4J4PC 3ZMRA 1NUNB 3HR6A 2Z4QA 4ZFZA 1Y7VA 2YD1A 4I0XA 1A9BB 3LH2L 5D1ZD 4DGWC 3KE0A 3RTQC 2DJMA 3CFUA 1H5BA 3FUNA 1NCWL 5F3BA 1WC7A 3JAWB 2VLMD 3HB3D 3MA7A 2ZE7A 1FNEB 3JT0A 4AEHH 4DZ8A 5T33L 1FFRA 2MJWA 4JVPA 3T3MF 3UYOD 4U3FH 2FWLB 4PJEA 5GZND 3SJVD 4KPHL 4E5XG 4BA0A 1BAFL 3VRJA 1T3FA 3W2DH 1DN0B 1Y1DA 4BEIA 5L0QB 1NEZB 1R24B 3ULUC 1U8MB 3N0PB 1N64H 3ECQA 5C0JB 5L9DL 4Y1AD 4PVMA 3F7YC 2FWUA 3CHPA 4F7TA 1KV3A 3PP3H 4JN2B 3HE6C 2VLRB 3IS1X 1U30A 4O2CA 5ACZA 4NYKA 2C5DC 2Z1KA 1HCVA 1JFQL 3ZGHA 4P23D 1YUKB 1BD2E 3BSGA 4MA7H 4QTIH 4K9JA 2YGPA 4PJ7F 4HHAB 1T89C 5CMAB 3RWEB 3JTBA 5EBWA 1OWWA 4TTGA 3ILDA 3C6EA 4AIEA 3WDHA 1U8HA 5KJRH 3ORJA 3FCSB 2V17L 3ARUA 1DQJA 3D30A 3G5XA 1M4UA 1R3KA 1UD3A 1OTUC 4GFTB 3ETBJ 1A6UL 1PIGA 2WXPA 3L54A 3S88H 2A83B 4NLHA 4JFYA 4L4VE 5IT9N 3LZPA 3EJRA 4YHHO 2MKLC 4R7XA 1N5YL 1DTUA 2D7MA 3PWLA 5F0JB 5IQ9B 3B7TA 3SYCA 1P4RA 1KLGA 1H5BC 4HIXL 1FO0A 5FKPA 3K6SA 1G7MB 5I66A 4O4HB 2DIAA 1PZUB 3D12B 3TF4A 4HEPG 5IMOB 1T5WB 2PW2B 2C4XA 3E83A 1E67A 2Z8WC 2DMGA 1DF4A 5IVXA 4PA7A 4QRRB 3BFOA 5IYDO 1ZJBA 4Q9QL 4OZ4B 3O11B 1QRND 4JKKA 5I0DA 2FEJA 5F7BA 1QATA 3SE4C 1ZAUA 3OKMA 2E74C 4I18A 4YJ3A 1Z9SA 2IH1A 1F4WL 4GKZA 5F2FA 3FTVA 3PWPA 3CMOH 2PW1A 2FO4A 1FAFA 3C2AH 2BK8A 4HC1A 5E6RB 3OKYA 3HC3L 3QAZC 5GTHZ 2OMWB 1KUQA 3RTQB 2CLRB 4FEMA 3D9AL 3AK2A 3SZ6A 3VWKB 4M7ZC 3MJ7B 3ZN0A 1P6FA 3CFEA 3QULB 2NQDA 2QE7G 4HOMA 4ODTH 5J12B 1ITCA 5F7AA 3S5ZA 1JNNL 3P3TA 1JYVA 4R8WL 3IDYC 3UCRA 3SKJH 1AMYA 2JQMA 4K4KA 5MI0B 4LSVH 5DJ2A 4XVTH 2ZG2A 5HGHB 1U2YA 4KI5D 1IFRA 3IJEB 3M1CA 5TK4A 1XQ4A 1N3NB 3F7YB 5EHFA 5I0ZA 4LESA 2P48B 2ZAIA 3GBLA 4FNSA 1EJFA 1QZNA 2LLNA 3GSWB 1CYWA 3RNKA 3HE6B 3E89A 2VE6A 3FFDA 3IKCA 3JAKA 1S3KH 2EYTA 4HP5A 4J3OG 3FRUB 1NDMA 4PGCA 5D7JB 5AW7B 4A7GA 4IW4C 5FPRA 1BQHG 3WKPA 2EC9U 4QWWD 5T1MA 3U9UB 5ICYB 1HHIA 1NA8A 1RULH 4N0UB 5I5RA 4OLVL 1OP3K 4PJHB 1F3DJ 4X1KB 3OW2U 3GLZA 3UABA 4J80A 4CN6A 2XWBB 3WIIH 2IH1C 3EUDA 3OV6A 4B3SO 1Z9NA 3LAFA 4MVMA 1TITA 3FN3A 3QZWB 3RWDB 4PJBF 4KDVA 2VNCA 2CAZC 4FQQB 3UIYA 5FYLL 1HHJA 2BVPA 4GUPB 3FYIB 4I0XB 4JFUA 2HVJA 4LBAA 3ZZ1A 1FYTE 4LXFA 2YIBD 1H5BB 4DW1A 1GN6A 3VGEA 1VB9A 2FECI 1MRCL 1V3MA 2BCMA 1S7TA 1WC7B 2WXNA 3GIZH 3MA7B 2P90A 5E51A 2OAAA 5DUPL 1QW8A 1IFHH 2Q9LA 2PGGA 5EU5A 4UT7L 4PJEB 5CSBA 5KTEL 4UT6A 2NDGA 3OAUH 1HNZB 2BVEA 4I1RA 3DX6B 1XGQA 2VZ1A 3TPUA 1FV1A 2Y25A 2E74B 3VI4B 4ADIA 2ITFA 2VSMB 1GTNA 2B9BA 2BDNH 2BVQA 4QXTA 2DQDH 3S36L 2A4EA 3T4DA 3L3HA 3GHEH 2BZDA 3BUIA 4S1QL 5ACZB 4Z7WF 1IB5A 4D0BA 5TTRA 2R2HA 1L0NH 2DQMA 3QAZB 4WW2F 2YLHA 3VXNA 2GEQA 3U9WA 3NABH 2UUCB 3BN9C 3GBML 5C08A 3AXLA 3F85A 4M7ZB 3ZZQA 1ZEAH 4W9LC 1U8HB 4LAJH 4PA6A 2E8ZA 1DQJB 2B08A 3G5XB 3IDYB 2VXTL 4JE0A 1YAZA 1DO6A 2YQBA 3B40A 3E86A 2A1WH 1RZ7L 3MV8D 3PLYA 4XMKH 1JZFA 1U3HD 3VI3E 4JFYB 4FTVE 4FQHB 4ZPVA 1KELH 1NCDH 4Y1SA 1KCRL 1OAXL 2HVJC 1MFVA 3P3YA 1N19A 1KLGB 1FO0B 3DJRA 1JZHA 1WYJA 5FKPB 5HI4C 5IGXH 2Y7SA 3AY2A 4L8BA 1MWAL 3B8MA 2X53A 4M61A 4RWHA 5AYTA 4JVUA 4Q6KA 3ARED 3W7UA 2Q76B 3LEYL 4LAQH 1GN4A 1Q72H 4RGOH 4W9JC 2UXDB 2Y1VA 1IJ9A 2V1DA 5IE9A 1LO4L 3MV9D 2RIKA 3ZTEA 3OKMB 1Y6KR 2FE0A 4I18B 4QIRA 2IH1B 1Z9SB 2BSTA 4MMYA 3L81A 4MS8D 1JGEA 4GKZB 5DUMH 4HZ1A 3U36B 2C9UA 2FO4B 3QIUD 5BV7H 3NBNA 1KEGL 1MFEH 4U6VH 3EJTA 1NZRA 3CZGA 2DD8H 4DQOH 3KBPA 1JXDA 1W80A 5KVGE 4HT1L 4L23A 4FZEH 4YDLC 5MENE 1ZX3A 1BXUA 5F97E 3U46A 2M7WA 4X6DF 5F21B 1CQYA 2Q86A 1G9MC 2R9IA 4GEIA 2Z31D 5TE6H 5IIEA 2DTMH 2IPTL 5DJ2B 5SWZB 3RP1A 2VKWA 3HS8A 4PJ9A 4QJ5B 2DEXX 3NFPA 3FU5A 3B6SA 1F42A 2XWJB 4ES8A 1AXTL 2IXQA 5JIDA 2XZCL 3CVBA 1TFHA 4G6AD 2VE6B 1XGTB 3IKCB 3JAKB 4LBEA 4POYA 3WB0A 2FTKA 3BEHA 3OEHG 1NDMB 3N43B 4O02A 4XC3L 2QPSA 1BJ1H 2TSAA 4LPWA 5EBLC 4FFBA 1D7BA 1VPOH 3VFMB 4FLWA 4DR5O 1A6AA 5T1MB 2R56L 5BRZD 5ITBH 1HHIB 3NEXA 5AVZB 5LG1A 3TNNA 3CCVV 2R2EB 1E30A 3QEGL 1RUMH 2OZ4A 5LMNO 3NCXA 1DJIA 2HTKD 2W0FC 1Q6UA 1CXIA 3HS0A 4GQRA 1MHCA 4X6CF 5FR3A 2ZICA 2RBLA 3D3VA 3MUY1 4D8OA 1KTDA 4GCZA 1QAWA 4UI2A 3MRRA 1NUGA 1WA8A 4EI0A 5HY9B 4DNLA 5CGYD 2HVJB 4JQVC 3HUJA 2KMWA 4DOHE 3CXHF 1F3RB 2E5EA 1S7TB 2XKUA 4WSGA 2C8NA 3RJQB 4KZCA 3DYOA 3IDXL 3C90A 2EIKC 3BIAX 5EU5B 1V7NL 3D85D 2W65A 2HPTA 3ES6A 5AG2A 3DYMA 3DURB 3BD4A 5E2UL 1XGQB 1J9SA 5DFTA 5FLVA 1YHQV 1IGYA 3FBQA 3FT4B 4DR3O 5D6CA 2BVQB 2L7UA 1U6AL 1XDTT 4JYCA 2UUBB 3VXUE 3L3HB 4HIIA 1XQ8A 4MJ6A 4D0BB 4D2NA 2R2HB 1IBMB 1CJYA 1S7SA 2DYPD 3VXNB 1PKQE 5LL6Y 2H26A 3B3IB 3BVVA 1EH9A 3M45A 5IFAL 1NBVL 1NFIA 2OTUA 5DQDH 5FLUA 4L29B 5C08B 1LWHA 4YDLB 4ZNCD 5CEZH 1FYHB 5D71H 2XTLA 3FF8A 4X6BA 1QUPA 3HS0C 4G6KL 5D5PA 2AEQL 1UQSA 4DW2L 2XXMB 2Z4TA 4H25A 1HZLA 3CDCA 2VERA 4YXKL 4GIAA 4LHQB 2GBVA 3ZYOA 5T5FL 4HX1A 4A2MA 3L1OH 1DDTA 1AJQA 2BP5M 4P5TD 3CWGA 5DMIL 3UAEA 4OV5B 4L8BB 1JI2A 4BSVA 1NGXB 5B4MD 3B56A 4Q9BA 5B7MA 4ZOEA 4G3YH 2BFVL 5KW9H 2WAMA 1IBFA 4UOW0 1L3NA 4QXGH 1XL6A 5G55A 3FOMB 1OAUL 1KB5H 4ZW6A 2OW7A 1GMEA 2W0FB 2BSTB 4OFYD 2W6JG 2B1OA 4JQIL 4U2ZA 2O5YH 3P77B 3HG3A 3S9DB 2J44A 1HW7A 2OCJA 4TMPA 5HVWA 2VLKE 1CGTA 4NHUB 3C09B 3P3UA 3P40A 4MMZC 4Z7NE 2QZ5A 5KBNC 3TPKA 1JMXA 1SUHA 4KKCC 4JRYE 2EECA 4RBPH 4X80L 1KIRA 3U46B 4G6ML 1KCWA 3PQYB 1FIGH 3NCJL 5CIPH 3K80A 2Q6WA 2UXBO 2J6EH 1E9OB 2JTYA 3GO1H 5IIEB 1TU2A 4BKTC 1XNQB 2V7HB 2A9BA 1QTYT 3SKOA 4KRNA 4PJ9B 1MIEL 4M5YH 1LL1A 1XCQA 3GJFB 3RJDA 3RG1C 1MCOL 2Z1PA 4OGXH 3B6SB 5EC2A 1AE6H 4XMLL 1JZ6A 1WWWX 4GFXA 4A2FA 1RIVL 2G2PA 3L74H 2P8MA 3ARBA 4KHPO 1H8EG 1UFIA 3HKCA 4MKMA 5KLVH 1CB4A 3RGBA 1F97A 1JD9A 4FFBB 1BGXL 5CGTA 4AQYB 3RKDD 4GAAA 4D8PA 4M6MH 3TNNB 2BNQE 4GAGH 3QI9A 5DJDA 1QLNA 3BP5A 1RZIB 4N0YH 1P4IH 4OF3A 3RI5K 4BDVA 3HS0B 1MHCB 3B3BA 3WKYA 3KMDA 3D3VB 3HAEG 3POCA 3DWTA 3N44F 3E0GA 1GZHC 3QRBA 5BPPA 3MRRB 4JYBA 1WA8B 2X3BA 2OXGA 2NLJA 1EERB 2FEEI 3FQWA 3HUJB 3V4VL 1J8KA 4XO8A 1GCYA 2B2XH 4HF5H 2Q73A 2NZIA 2C7FA 1FXKA 2K3TA 1UGNA 3MV7D 2ZYRA 1XHZA 4V1DE 3NVQA 5T3XL 4ZX3A 1QLEH 4ZAKA 2P4VA 2H5UA 3ES6B 4M43L 4W9ZA 4KI5F 2AHIA 5DO8A 2GC7C 4FYTA 2FH8A 3UH8A 2H3KA 5D6CB 3D39A 2J43A 1AIFA 1S9KC 2BSDA 4UCRA 3T8XA 4MJ6B 4XVJH 2QTOA 5CLZA 3TV3H 4FJYA 4MMZB 4NYLB 1B4RA 1JPTH 1PZ5A 2CTRA 2K70A 3Q3GA 4H5SA 4LPCA 1H3GA 1NFIB 4FLQA 3FH7A 5AEAA 3AGVA 3TT1L 3T0WA 2A6JB 1XSIA 2LW7A 2CE6A 2NCEA 4UQ2B 3CIAA 3QI9C 3SDXA 4ZMAT 2WXLA 2ZF8A 4OCWL 2NZ9C 2MCPH 4FQ1L 5EN2B 4BGLA 4OSUH 2ZCLH 4AKQA 1JGVH 4LSSH 4PRPE 1XD0A 4H25B 4IOSD 2PPAA 3HI5H 2J4WL 1TZGL 1ESOA 1QBLL 4PS4L 5JW4N 4K9EC 4O4YH 1Q9LB 4K7PY 4RQFA 1TCRA 4H4NA 4UOQA 4QCIB 4NTXA 1F1AA 4RDBA 2L35A 1AO7D 1DJZA 4CN1A 5I1JH 2H1PL 5BVJA 4DUZO 5H94A 3TA4D 1CI5A 2YFOA 4X6FA 4Z9KB 3WIHA 1MFCH 4HGWA 2DMHA 4LSQH 2ZYHA 3BAEL 3CH1A 4YBLC 3UO1L 1PG7H 1KCVL 1W72L 1F58H 5EC1C 2ADYA 2V7NA 3QFJE 3VU2A 4PSRA 3CN0A 4LVEA 4U3SA 3OMIB 2YD7A 3NCWA 3VSVA 4F9PC 1V10A 3P69A 4DP9X 3K9SA 5EBGA 2KHAA 5ANMA 1AILA 1LE5B 5FHBL 2YJQA 2NY1D 3EGXA 2XSKA 4TS6A 4IRSD 4JG0L 3MLVH 5JQIB 1N36O 4ZHQA 1I94O 2CPCA 4UILH 5I1KL 3HHSA 1YVLA 3AT0A 3LX9A 4LQFL 2NY7L 2EUVA 1KIRB 4EDWL 2CK0L 4NKOA 3US9A 3NRQA 3CYOA 4PJDA 1OSPL 1U9KA 3AQXA 1FPTH 4PA9A 4FG6D 1WEJL 3DLQR 1AXIB 3D1MC 2Z35A 1XCQB 1S9VA 5EC2B 12E8L 5GSVA 2WBXA 2IALB 1I7TB 4KRPD 3KJ6L 1AQKL 4JM2A 2P8MB 2ZT9B 5I8EA 5IB4B 1PLAA 2W9DH 3SCMA 43C9A 3HA0A 4I0KA 4MDIB 3GBNL 2XRAL 3C87A 2WB7A 3QI9B 5BOZG 4BDVB 2QTVA 4GJTB 3CFCL 1XWVA 1VZIA 1EA9C 1I7FA 4IBYA 1OAKH 3NP4A 3CC7V 4Q0XH 1X5AA 2I9LB 4IU3A 2OXGB 2NLJB 2A99A 4XNDA 3FQWB 3P11L 5K59F 1YXBA 2W6IG 4FZ8L 5ADPL 5HD8D 4JI4O 1A21A 3IPFA 2F19H 4R0LA 3NJHA 3OKLB 4EIUA 1I3GL 2H1LM 4RH4A 3ZT6A 1WGOA 1M93A 4X1YA 3U1SL 3NCMA 4YBLB 5DJXA 3T1WA 3PAVA 4Y5VA 5EC1B 4TV8A 4WUUE 5AWNL 3O8XC 2VN3A 1IBGH 2FQDA 2FT7A 4UQ9A 3D39B 2BRQA 2EACA 4GRWH 2NY4D 4X65O 2CKBB 1SXSA 4P9PA 3RVYA 4JM2C 3T8XB 3VSUA 3ZRSA 4LCWA 3QR0A 1J1XH 1PZ5B 2DQTL 3Q3GB 4H5SB 3B2UC 1CLZL 1FGVH 4TSCL 3ZZLA 4KK6D 4BQ8A 4TPRL 1KB9K 3NJMA 1OSEA 2ZWYA 3LPOA 4Z7VB 3SDXB 5DR5H 2QSTA 4ODUA 4DJMA 4W9DC 1FI8C 3N27A 2R0ZH 2GK0B 1D5IH 4I77L 4OLYL 2WK2A 3K1KC 3BKYL 3DSFL 5D72H 1JP5A 3LN4A 3D8MA 2ARJB 4BHUI 3GDBA 4LRIC 1AS7A 1F6AA 3UZVA 4TQIA 4DR6B 2ZJSH 1A3RL 5GGVY 2AHZA 3CN1A 4PRHE 2WINB 3QUML 5D55A 5BVJB 4OCXL 1TETL 2UYLB 4HPHA 5L4FA 4X6FB 5HPOA 1XHHA 2FB4H 4UV4L 4S1DC 2F68X 2XVKA 3GSOA 5C97A 1Y6XA 3N2GA 2XACC 3CH1B 3NN8A 5FPIA 5E5UB 4MD5B 5CFAA 4W4OC 3W7SA 4YHML 2ALAA 2MPAL 3U2IA 5CKAA 1TO5A 4JFFD 5IEHA 3OLEA 1DJHA 3CCQV 1PDKA 4YX2H 2CO4A 1AY1H 5IROD 1ANUA 1DN2A 3WHXA 5BZXA 1EXGA 1PZ2A 1NGPH 1HXKA 1PZ3A 2WXFA 3F6IA 3P4MA 4UANA 5ANMB 3S96A 3EGXB 3PUUA 3ZDYF 1SNRA 1HKLH 1K9TA 1NLBL 3HHRB 3QJRB 4G8FA 4PJBA 2DOSA 3HHSB 3R0MA 2I5YH 5C0RL 1PIFA 5ICZB 5IG7A 3EO0A 3UYPA 1QASA 1HTYA 2E9JA 5KHJA 4QD2E 2KZWA 1G9EA 2KPNA 4G8GE 4PJDB 1Z5VA 4LLUA 4X9HA 1UA6H 2VL5B 4ISVB 4YIPA 2Z35B 3L9YA 2YRZA 1S9VB 1QR8A 3MTXA 4K5MA 1J05A 5E2VH 5CCGE 1FN4B 1QLRA 2JV6A 3K8LA 1MFNA 5DECA 1AROP 2WVTA 4J7KA 3SY0A 3FF7A 4XN8A 4NBYB 4JM2B 4LLVA 3VXMD 2JWYA 4S1SL 1UJ3C 5B21A 4UT9H 3SCMB 43C9B 2AXJA 2W38A 3CDZB 3IK2A 4RZCA 5H37G 3VD7A 3ZYIA 3PJSK 5K33A 1CLYH 2QLYA 3NJVA 5LVEA 3SIKA