3ABKE

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 45
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abkE00
5IY5E 2OCCE 3AG2E 3AG1E 3ASOE 3ABKE 1OCOE 3ABLE 5B3SE 1OCCE 1V54E 1V55E 2EIKE 3AG3E 1OCRE 2DYRE 2EILE 5B1BE 2DYSE 3WG7E 3ABME 1OCZE 2Y69E 2EINE 2ZXWE 3AG4E 3ASNE 5B1AE 2EIME 3X2QE 2EIJE
chains in the Genus database with same CATH superfamily
3CVWA 2GRRB 3ML9A 4A1GA 4HI9A 2FO7A 5AQ7A 3CSTA 3QJZA 2DYRE 3NZSA 1X81A 3EHNA 2J8SD 4Q94A 1O1RA 2CG2A 1FCHA 2WVIA 3EHMA 4U0SA 5JA4D 5FQ4A 4HB5A 5FT9A 2J49A 3AS5A 4LNUD 3P1UA 4UWLA 2WXFA 2XEEA 2XRYA 4FC8A 2X3MA 3MYVA 3NBNB 2WM9A 1HG2A 2L0IA 1NI1A 1VDYA 4BSZB 1TYQG 4EBAA 4J8DA 1OWMA 3FUFA 4YDOA 3BU8A 3APCA 3ZN3A 4F1SA 3S7FA 2XGSA 2IJGX 3LY8A 3PUJA 3FUHA 3LPZA 2DYSE 1E8ZA 4IYPA 4GTQA 3B7BA 3Q49B 5EYLA 3LKUA 4FULA 4HLEA 1A5EA 3VLFA 2ONDA 3EIQC 4FADA 2FF4A 3D3MA 1KZOA 3DPYA 2CFUA 2PM7A 1OCCE 2V5FA 4KBQA 5AJDA 3MZLB 4EBAG 3PREA 3PZDA 3ZRHA 2WXKA 5AYWD 5KJLA 4UWFA 1IHBA 3TWXA 4RG6A 2FO1E 1JWGA 2FBNA 5AQBA 2BF0X 4FLHA 4MRUA 3ABKE 3RRUA 3D9OA 4ILIA 1S64A 3E33A 4AY6A 2CHWA 3IBEA 1MZCA 5HKPA 4I1AA 4UWGA 4GTPA 1ELRA 4RVBA 2DCPA 5BV1A 4JL0A 3UM2A 3FP3A 3RSEG 5CRVA 2A4ZA 3R7RA 4L7TA 1NP7A 3RO3A 2XS8A 3GYZA 3ULYA 3ABME 1H2VC 1ELWA 4B8AA 3CVVA 3ONLA 2F8YA 5DBKA 2WXGA 4IRUA 3FEXA 2LNIA 4J6IA 5FZQA 4DPRA 4CDNA 2L6JA 2LAIA 2OEWA 4A55A 5EYPF 4U96D 2EILE 2C2LA 2VSXE 4I2ZA 4KVOA 4G8LA 3S7DA 4ANUA 5G04C 1OXJA 3U3WA 1H6OA 2LSVA 5JJ7A 1YYHA 3ASOE 3T8KA 4BX8A 3FTYA 4JA9A 4OVVA 4GA1A 4UUCA 2VTBA 3SHFA 1BLXB 4A63B 1O5MA 3CR3A 1NFIE 3OXGA 3Q5MA 3B7SA 3RIBA 4DJAA 4ATGA 3HVEB 3T8MA 2H6GA 2WXPA 3J5PA 2KCVA 4AP2A 2J4DA 3B13A 3V30A 4A3VA 1FVFA 4XIFA 3GW4A 4CT4A 3SO8A 5FIOA 4O1PA 4OAUC 2V5QC 2R03A 4JHRA 3CHQA 3W9FA 3SQVA 4HNAD 2YHCA 2VGXB 4O6FA 2Y4TA 1IXVA 3O4ZA 2IY0C 1OCRE 3ZVVA 3V79K 5FQ6A 1MX6A 3CQCB 2DVWA 2UY1A 1N9AA 1MX2A 2WQ6A 2WXRA 5JJ6A 3MEKA 1N11A 4WNFA 3RO2A 3FDHA 1E90A 4KMOA 4XI0A 3ASNE 2IF4A 3UKRG 3AAAC 3FTSA 3C3QA 1HU3A 3PH0C 2Y3AA 3LY7A 5ENNA 1E8XA 1TR4A 4GPMA 3ZYQA 1A17A 3Q79A 3VLEA 3AG3E 1UOHA 3RU0A 4P29A 2GW1A 2GRMA 2X6IA 1WDYA 4FLBA 3LY9A 3EUVA 5KWDA 5G05J 3QNKA 1HG5A 4GMJA 1TN6A 3CV0A 2BKGA 3HG0D 3L17A 2R2LA 2F8XK 4DI3A 2RG8A 5LX8A 1N0QA 3ESLA 3I3NA 4DX7D 3TL5A 4QFVA 3ZU7B 4GYYA 3Q7FA 4JC8A 2MRIA 3IHVA 3O48A 3LS8A 3C5RA 4BETA 3HVEA 3IV0A 1K8KG 4RLYA 4O60A 1Y6IA 3EHQA 3PUKA 4BX9A 1DCEA 2WXLA 1U2VG 2Y1LE 4M7CA 1UJJA 3PZ3A 3CVQA 3ZUVB 5BNWA 3ZYMA 4RQIA 4K03A 1LD8A 5AARA 3BG0B 4DX5D 4KZ0A 1EPUA 5CERB 4GTOA 4CT0A 2XEVA 2XHEA 4K0RA 4K5BA 3ASDA 2XRZA 3UIPC 5C2YA 4AOFA 3E30A 3MA5A 5J08A 1BI8B 5JHBA 5LP0A 4D10C 3CVUA 3FH8A 1N4QA 2VGXA 3HDXA 4JB8P 3LCAA 4F6RD 4ATZD 2E2EA 4BEPA 3JYSA 1SA5A 3ZFWA 3U66A 3ASGA 3TXNA 2Y0BG 4I1OB 2J4BA 3EIJA 1N94A 2Y69E 4LRZA 4XX5A 3SI5A 3RRMB 1HO8A 5ITZF 1FT2A 4YDWA 2MOWA 1D9SA 1MJ0A 4HQDA 4J8EA 1OWPA 4PS8A 2J08A 3QB2A 2IFUA 3FTUA 5EIDA 4K5AB 4J0UA 2VSYA 1SQMA 2J9QA 1MQSA 2I6HA 2P9LG 2KZTB 4TV3A 2HO1A 2VSOE 2JEKA 2FULA 3FUJA 4C48B 4NURA 5CCMA 4NACA 3V2XA 1HXIA 3NQPA 1SW6A 3BUAA 4TXPA 3VTXA 4L9PA 3G2VA 2WMNA 1UN8A 1OWLA 5HRYA 4JZYA 3FTXA 4EPZA 4CYMD 3KS2A 2XS1A 3QKYA 5T8IA 2WXHA 5AQAA 5G55A 5CBNA 2PZIA 3D9NA 1SZ9A 4JVSA 1DC2A 3UPVA 3NF1A 2ZISA 3HXEA 3AG2E 4I1MA 3DBSA 2DBAA 4WNEA 4Y6CA 3NB2A 2ZIRA 4G1TA 3ZXPA 1UW4B 2QC9A 1H6KA 3C72A 2A5EA 2GRQB 4AM9A 3G2TA 5FINA 4B89A 3S7BA 1HFAA 3MCXA 4DX6D 4FJYA 3ONKA 3ZYKA 3CVYA 3QK0A 5CRUA 4BWRA 4WAFA 1FT1A 1JPLA 3CQGB 4KVMA 1O1TA 2XPZA 4UQXA 2FEZA 4BERA 3LYAA 3PS6A 2AVPA 4GZCA 2R02A 2BKKB 5EN5D 1S70B 1ZBPA 4A1SA 2ETCA 4H7XA 2WXIA 4GB9A 1IHGA 4BT8A 4MKTA 2IO2C 4BFRA 3OTNA 5D66A 4N5CA 1K3ZD 3UKUG 3UT7A 3Q47B 4I6EA 3DSVA 1HX8A 3FTVA 3URZA 3LDZA 2NXPA 2QYUA 1BD8A 4V3IA 2HR2A 4I6GA 3R9AB 4F3VA 2OEVA 4ANXA 4EZJA 1K1BA 3C3OA 3TWRA 2I9CA 4CCAA 3APFA 4TRQA 5CECB 3AS4A 4ACLA 2KCKA 4G2VA 2GGFA 4XZ4A 1Q2ZA 4FA6A 5M72A 2PQNA 1AWCB 1LTXA 4C9BB 3FU5A 4OAVB 4AXHA 4JXTA 3PNLB 3Q9UC 1E96B 4EHMA 3FUDA 2I1JA 3CHRA 2XEHA 3L82A 3U64A 4BY6A 4HOTA 1KT0A 4B8CB 5ENSD 4QQIA 3PE4A 2GROB 1TN7A 2ZXWE 2EINE 3BG1B 2KXPC 2LO6A 5AQ9A 3CK9A 3JXIA 2XPYA 4JW1A 3ZIMA 3EDTB 4PUCA 3FUEA 2GRLA 1H0AA 2H6FA 2OOEA 4N3BA 5HQ8A 4HXIA 2V4LA 5FQ8A 3PRZA 4GU5A 4Q96A 3CHPA 3CGHA 1RZ4A 1H6PA 4F1PA 2C0LA 3SF4A 1QYMA 3QAQA 1SVXA 1QNFA 3IKOB 4HVBA 3SBTB 2HM8A 4UQZA 3AS8A 2GRPB 1OCOE 3TWWA 5CMYA 1QBQA 3L6AA 3ZXSA 2R05A 3D9PA 4G24A 2VQ2A 3CKBA 1N95A 4HFGA 4R7LA 5G05C 3UUXA 2XPIA 1E7UA 3HRAA 3C3RA 4NQ0A 4GMRA 4NIKA 3C98A 1TEZA 4FP7A 4CZ2D 4HRNA 5FWQA 5HI7A 2IOLA 3DXMG 3UX4A 2AWIA 1MX4A 2L6BA 2RD0A 2CG3A 2I1KA 1OUVA 1MYOA 4G23A 5LCWJ 3AU5A 3DXKG 3G2UA 1IQRA 5G04J 3UIOC 2EIME 4GCOA 4G26A 4LUNU 3PE3A 5KNHD 2V4HC 3UT8A 4HI8A 3FUNA 4GCNA 5KNGA 1L5JA 4LCTA 4HBDA 2EIKE 2MYOA 3V2OA 5B1AE 3CHSA 1EDUA 3X2QE 3MKQA 3ULEG 3I5PA 4J8SA 3LJ3A 5ARFA 4UWKA 1GW6A 3ASHA 2C0MA 4U63A 3DSUA 4FHKA 3JUEA 2P9SG 3EJNA 1N54A 4Q69A 3R9MA 3FY4A 4G8KA 4O1OA 4U8VD 3DRAA 1EYHA 4BT9A 3KSLA 4ANVA 4I17A 5A7DB 4GTVA 5BXOA 3ZGQA 3L16A 3PDNA 1N4PA 2PM6A 1S63A 3DSXA 2JLBA 4KT6B 4HOSA 4MLPA 3TWUA 4DLQA 5FJYA 2EIJE 4U04A 3JCKC 2X6JA 4CDMA 5LFAA 1TNOA 3K9IA 4Y6WA 2VSNA 5BPPA 5FZSA 4TXQA 3Q7AA 4GTRA 3G2SA 1NL4A 3E4BA 2Q7FA 3IEGA 1TNYA 4GMLA 3PZ4A 4ZHBA 5ENOD 1E8WA 3AG4E 1Y8MA 1U3DA 3CVPA 2LUHA 3VTYA 3UM1A 1JCRA 3TWQA 3SFZA 3CVXA 2H6IA 3ABLE 2ILRA 3KAEA 5BUZA 3P2BA 3DSSA 3E32A 5FQ7A 5EIBE 2UY1B 2X6KA 4W9RA 3CK7A 3V31A 3WXXA 3T5VA 3B95A 2XGOA 2XZDG 2LXMA 2X6FA 2IOSA 4WNGA 5D0QD 5KBAA 4OYSA 3L08A 1V55E 2WPVA 5H7PA 4BTAA 4L23A 1OY3D 4B93B 3TAXA 4I6JA 4GA2A 3EU5A 3FWVA 3F6QA 3CIAA 1XGWA 3QWVA 1TN8A 3LJNA 3MX3A 4UI9K 4GTSA 2ZGGA 2WXOA 2QZAA 4GZ6A 3CK8A 3OXFA 4MBGA 1YMPA 4TXRA 4DLOA 3L9TA 3LVRE 4APFA 4URKA 3FUIA 3S2AA 2ETAA 3DEOA 1OWNA 4DUIA 2DIWA 3JXJA 4PDXA 2NYJA 1X5BA 2AXVA 4YNDA 3TWSA 3TG4A 3FTWA 2WQ7A 3S7JA 1Z3XA 4GYWA 3LXUX 3D9MA 4PH4B 4YDYA 1INZA 2AW6A 3FU0A 1OWOA 4YVOA 3NZUA 4JHJA 4F53A 4ILHB 3MJWA 1WY6A 4DRXE 4CEMA 4J7WA 4N3AA 2ZGDA 3FUKA 4U7EB 3JUIA 3MKRA 4L2YA 3B7UX 2KCLA 3QWPA 3ZNGA 2B6CA 1ZU2A 3D9HA 3RJVA 2WXQA 1FPPA 2ETBA 2J07A 4WWOA 4U95D 1BPOA 4TUMA 4EZKA 5CMWA 5ENTD 4XI9A 3UMVA 3QWWA 4JEHA 3U4TA 4GA0A 4AJWA 4DK5A 4LEUA 2WXJA 3EHRA 2EQXA 4CDRA 3SY2A 4KXKB 5JMND 4HS2A 4GZDA 1NA3A 3CKCA 2Y4UA 4AVXA 3FTZA 3ZYLA 2IONA 1JUQA 3W9GA 1ZB1A 3UT4A 2BUGA 4BTBA 2YQ8A 4DX1A 4HOUA 2H6HA 3NAWA 3TG5A 3G2WA 3UI2A 3EU9A 3KEZA 5T4YA 1Z3YA 1B89A 3UM3A 3FU3A 3Q78A 4XKBA 3DPDA 4GZ3A 4L1BA 1PAQA 5AIJA 4XKCA 3HXCA 3OXLA 2MHKA 1TNBA 3APDA 4ILGA 5C1DA 3B7RL 1E8YA 1IYGA 4CGVA 4B0ZA 1HH8A 3GZSA 4JHKA 3D9LA 4N2QA 3QARA 3PNTB 2R59A 3HXBA 4E6HA 2PQRA 1PC2A 3NOGD 4LERA 3LEWA 1KPSB 5AAOA 2AXUA 2P9UG 3PEVB 4CRWA 3FH7A 4ZFHA 1HF8A 3L22A 3TWVA 1HZ4A 2IO3C 2KC7A 3TGOA 3SBSA 4PS3A 2VGYA 2A5UA 5EKQD 2GRNB 2WXMA 2M63A 5LCWC 3SZ7A 1KZPA 3AU4A 3ISMC 1H2UA 3RRNB 5AENA 1BU9A 1Z5SC 4GPKA 1N52A 3Q75A 3MV2B 4EECA 4JA7A 3HYMB 2IEJA 5DIZA 3PVLA 5EX3A 2LXLA 1N0RA 3FHEA 3SGHA 3ENEA 1UJKA 3KEAA 4L2LA 2CHXA 1RW2A 3D9IA 4I9CA 4AEZC 2V0PA 4LSZE 3KD7A 4ACKA 3MKQB 3Q73A 1OT8A 1DCQA 4U07A 4J8FA 2L9BA 1TNZA 3E37A 3SNXA 2VTBB 1IKND 3BEEA 4AIFA 3ZHEA 2WB2A 2XCBA 4X8QA 1Z6TA 3L13A 4MS6A 1DVPA 3UINC 1FVHA 4C0MA 2P9KG 3UQ3A 1N4SA 1XNFA 3QDNA 2OCCE 4DX2A 5BT1A 1K1AA 3UTMA 4U0UA 4ANWA 3CEQA 3RKVA 2AXZA 5EILA 5E75A 5KJKA 3AG1E 3ZPJA 3TWTA 2XENA 3GZ1A 5BXUA 4XE0A 1O1SA 5KCMA 3PZ1A 5CHEE 4EZLA 4NRHB 4RG9A 3OAWA 1IQUA 3I4GA 3CLJA 2RFAA 1NA0A 2LAHA 4UQYA 4XEIG 1H2TC 2OVBA 4F7AA 1LD7A 2CHZA 2F0YA 2PL2A 3U9WA 4Z68A 1E7VA 3UM0A 4U8YD 2RKKA 1WM5A 3ASFA 3FEYA 3ZHEB 4ME2A 1W3BA 4IN3B 1BI7B 2NC9A 2DZNA 2HE0A 1D8DA 4HRMB 4PS7A 4N5QA 4KZCA 1D8EA 4WWPA 2IU1A 3L54A 2HYZA 1EF1C 5E76A 5ANLA 3WG7E 4H7YA 2IQCA 4N39A 3JQ1A 4A3TA 4UI9J 3FUMA 4GTTA 3MGBA 3ZEFA 2OV8A 4HORA 3LVQE 1WAO1 3TXMA 3FH5A 3ZKJA 3Q4AB 4BESA 2XGMA 5JJTA 5BW8C 5LOZA 4HOQA 5A6CA 3DWLG 2YINA 4N2SA 4C0EA 3QOUA 3DSTA 4G11A 5AJLA 2QY7A 3AJIA 4WNDA 3E34A 5CBOA 3CHMA 3MV3B 5JHAA 3TJPA 3HIZA 1NZNA 1MHQA 1U3CA 4UI9C 4WWNA 3Q9NC 4UWHA 5EDSA 2KBXA 4KYOB 5FTPA 4I9EA 2X6HA 2E0IA 1YA0A 4GTMA 2P9IG 3B7TA 4HRLA 3ZW3A 5ENPD 2BEDA 3JQ0A 5FZRA 4BSXA 1TNUA 2WQHA 3SD5A 4JEUA 5HS0A 3FU6A 4AV7A 2V8SE 3UXGA 2KM4A 3T9KA 1QQEA 2YHEA 2JABA 2KATA 2VYIA 4LG6A 1UG3A 2P2CP 3BQOA 2XQ0A 3GZ2A 3HHMA 3ULQA 3FFLA 3FULA 1OCZE 3I4RB 3RK6A 4U8HA 5IY5E 2RFMA 4RSYA 2P9NG 4FHJA 4U0ZA 2FI7A 4GYOA 1YCSB 4GZ5A 1N4RA 2R5SA 1S0PA 3IXEA 5KJNA 2BTDA 4G25A 3RAUA 1JCSA 4K5CA 3HXFA 2P9PG 2QFCA 1V54E 2XCCA 4I43A 3QC1A 1JWFA 4LNBA 4N3CA 5CEAA 3D9KA 2DZOA 1DNPA 1TJCA 3R7QA 2WMOA 3VLDA 3J5QB 2B0OE 2P58C 3PEUB 3CHOA 5ARGA 1KLXA 2NSZA 2OVFA 3ESKA 5ENQD 2QYJA 3KSQA 2I2OA 1PY1A 3Q15A 2F37A 4FJZA 1HE8A 4GAAA 2UWJG 4IULA 3SFXA 4AY5A 4FU3A 1QZ2A 1HS6A 1WG0A 5ANRA 2AJAA 4ABNA 3T5XA 2R17C 3PZ2A 4JPSA 5J90A 4JD2G 2VJ8A 4CGWA 3D9JA 4APOA 3CVLA 4TUUA 2VGEA 1TJFA 4M3OA 5B3SE 2KZTA 5AN8A 1SA4A 4OVUA 5G2NA 5B1BE 5BV0A 2DWZA 1SZAA 4B94A 5T3RA 5EX0A 1JCQA 1UN9A 1H19A 3CSFA 5CCLA 4YDEA 1LF8A 5ENRD 4E85A 2L0TB 1KT1A 5KJMA 5CEDB 5D2MC 2J09A 1G3NB 3DEPA 2YNQA 2ZU6B 2LSUA 4I2WA 3IHYA 3HXDA 5D0OD 4EQFA 4J8YA 2X38A 1ELKA 2XZTG 3SFYA 3CVNA 1AP7A 2WXNA 3ML8A 4DI4A 4WUYA 3NOCD 3N71A 2CFZA 5A23A 4YVQC 2PNNA 4HLLA 1P5QA 4LNGA 3DSWA
chains in the Genus database with same CATH topology
5IY5E 2OCCE 3AG2E 3AG1E 3ASOE 3ABKE 1OCOE 3ABLE 5B3SE 1OCCE 1V54E 1V55E 2EIKE 3AG3E 1OCRE 2DYRE 2EILE 5B1BE 2DYSE 3WG7E 3ABME 1OCZE 2Y69E 2EINE 2ZXWE 3AG4E 3ASNE 5B1AE 2EIME 3X2QE 2EIJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 E;  2OCC E;  3AG2 E;  3AG1 E;  3ASO E;  3ABK E;  1OCO E;  3ABL E;  5B3S E;  1OCC E;  1V54 E;  1V55 E;  2EIK E;  3AG3 E;  1OCR E;  2DYR E;  2EIL E;  5B1B E;  2DYS E;  3WG7 E;  3ABM E;  1OCZ E;  2Y69 E;  2EIN E;  2ZXW E;  3AG4 E;  3ASN E;  5B1A E;  2EIM E;  3X2Q E;  2EIJ E; 
#chains in the Genus database with same CATH topology
 3CVW A;  2GRR B;  3ML9 A;  4A1G A;  4HI9 A;  2FO7 A;  5AQ7 A;  3CST A;  3QJZ A;  2DYR E;  3NZS A;  1X81 A;  3EHN A;  2J8S D;  4Q94 A;  1O1R A;  2CG2 A;  1FCH A;  2WVI A;  3EHM A;  4U0S A;  5JA4 D;  5FQ4 A;  4HB5 A;  5FT9 A;  2J49 A;  3AS5 A;  4LNU D;  3P1U A;  4UWL A;  2WXF A;  2XEE A;  2XRY A;  4FC8 A;  2X3M A;  3MYV A;  3NBN B;  2WM9 A;  1HG2 A;  2L0I A;  1NI1 A;  1VDY A;  4BSZ B;  1TYQ G;  4EBA A;  4J8D A;  1OWM A;  3FUF A;  4YDO A;  3BU8 A;  3APC A;  3ZN3 A;  4F1S A;  3S7F A;  2XGS A;  2IJG X;  3LY8 A;  3PUJ A;  3FUH A;  3LPZ A;  2DYS E;  1E8Z A;  4IYP A;  4GTQ A;  3B7B A;  3Q49 B;  5EYL A;  3LKU A;  4FUL A;  4HLE A;  1A5E A;  3VLF A;  2OND A;  3EIQ C;  4FAD A;  2FF4 A;  3D3M A;  1KZO A;  3DPY A;  2CFU A;  2PM7 A;  1OCC E;  2V5F A;  4KBQ A;  5AJD A;  3MZL B;  4EBA G;  3PRE A;  3PZD A;  3ZRH A;  2WXK A;  5AYW D;  5KJL A;  4UWF A;  1IHB A;  3TWX A;  4RG6 A;  2FO1 E;  1JWG A;  2FBN A;  5AQB A;  2BF0 X;  4FLH A;  4MRU A;  3ABK E;  3RRU A;  3D9O A;  4ILI A;  1S64 A;  3E33 A;  4AY6 A;  2CHW A;  3IBE A;  1MZC A;  5HKP A;  4I1A A;  4UWG A;  4GTP A;  1ELR A;  4RVB A;  2DCP A;  5BV1 A;  4JL0 A;  3UM2 A;  3FP3 A;  3RSE G;  5CRV A;  2A4Z A;  3R7R A;  4L7T A;  1NP7 A;  3RO3 A;  2XS8 A;  3GYZ A;  3ULY A;  3ABM E;  1H2V C;  1ELW A;  4B8A A;  3CVV A;  3ONL A;  2F8Y A;  5DBK A;  2WXG A;  4IRU A;  3FEX A;  2LNI A;  4J6I A;  5FZQ A;  4DPR A;  4CDN A;  2L6J A;  2LAI A;  2OEW A;  4A55 A;  5EYP F;  4U96 D;  2EIL E;  2C2L A;  2VSX E;  4I2Z A;  4KVO A;  4G8L A;  3S7D A;  4ANU A;  5G04 C;  1OXJ A;  3U3W A;  1H6O A;  2LSV A;  5JJ7 A;  1YYH A;  3ASO E;  3T8K A;  4BX8 A;  3FTY A;  4JA9 A;  4OVV A;  4GA1 A;  4UUC A;  2VTB A;  3SHF A;  1BLX B;  4A63 B;  1O5M A;  3CR3 A;  1NFI E;  3OXG A;  3Q5M A;  3B7S A;  3RIB A;  4DJA A;  4ATG A;  3HVE B;  3T8M A;  2H6G A;  2WXP A;  3J5P A;  2KCV A;  4AP2 A;  2J4D A;  3B13 A;  3V30 A;  4A3V A;  1FVF A;  4XIF A;  3GW4 A;  4CT4 A;  3SO8 A;  5FIO A;  4O1P A;  4OAU C;  2V5Q C;  2R03 A;  4JHR A;  3CHQ A;  3W9F A;  3SQV A;  4HNA D;  2YHC A;  2VGX B;  4O6F A;  2Y4T A;  1IXV A;  3O4Z A;  2IY0 C;  1OCR E;  3ZVV A;  3V79 K;  5FQ6 A;  1MX6 A;  3CQC B;  2DVW A;  2UY1 A;  1N9A A;  1MX2 A;  2WQ6 A;  2WXR A;  5JJ6 A;  3MEK A;  1N11 A;  4WNF A;  3RO2 A;  3FDH A;  1E90 A;  4KMO A;  4XI0 A;  3ASN E;  2IF4 A;  3UKR G;  3AAA C;  3FTS A;  3C3Q A;  1HU3 A;  3PH0 C;  2Y3A A;  3LY7 A;  5ENN A;  1E8X A;  1TR4 A;  4GPM A;  3ZYQ A;  1A17 A;  3Q79 A;  3VLE A;  3AG3 E;  1UOH A;  3RU0 A;  4P29 A;  2GW1 A;  2GRM A;  2X6I A;  1WDY A;  4FLB A;  3LY9 A;  3EUV A;  5KWD A;  5G05 J;  3QNK A;  1HG5 A;  4GMJ A;  1TN6 A;  3CV0 A;  2BKG A;  3HG0 D;  3L17 A;  2R2L A;  2F8X K;  4DI3 A;  2RG8 A;  5LX8 A;  1N0Q A;  3ESL A;  3I3N A;  4DX7 D;  3TL5 A;  4QFV A;  3ZU7 B;  4GYY A;  3Q7F A;  4JC8 A;  2MRI A;  3IHV A;  3O48 A;  3LS8 A;  3C5R A;  4BET A;  3HVE A;  3IV0 A;  1K8K G;  4RLY A;  4O60 A;  1Y6I A;  3EHQ A;  3PUK A;  4BX9 A;  1DCE A;  2WXL A;  1U2V G;  2Y1L E;  4M7C A;  1UJJ A;  3PZ3 A;  3CVQ A;  3ZUV B;  5BNW A;  3ZYM A;  4RQI A;  4K03 A;  1LD8 A;  5AAR A;  3BG0 B;  4DX5 D;  4KZ0 A;  1EPU A;  5CER B;  4GTO A;  4CT0 A;  2XEV A;  2XHE A;  4K0R A;  4K5B A;  3ASD A;  2XRZ A;  3UIP C;  5C2Y A;  4AOF A;  3E30 A;  3MA5 A;  5J08 A;  1BI8 B;  5JHB A;  5LP0 A;  4D10 C;  3CVU A;  3FH8 A;  1N4Q A;  2VGX A;  3HDX A;  4JB8 P;  3LCA A;  4F6R D;  4ATZ D;  2E2E A;  4BEP A;  3JYS A;  1SA5 A;  3ZFW A;  3U66 A;  3ASG A;  3TXN A;  2Y0B G;  4I1O B;  2J4B A;  3EIJ A;  1N94 A;  2Y69 E;  4LRZ A;  4XX5 A;  3SI5 A;  3RRM B;  1HO8 A;  5ITZ F;  1FT2 A;  4YDW A;  2MOW A;  1D9S A;  1MJ0 A;  4HQD A;  4J8E A;  1OWP A;  4PS8 A;  2J08 A;  3QB2 A;  2IFU A;  3FTU A;  5EID A;  4K5A B;  4J0U A;  2VSY A;  1SQM A;  2J9Q A;  1MQS A;  2I6H A;  2P9L G;  2KZT B;  4TV3 A;  2HO1 A;  2VSO E;  2JEK A;  2FUL A;  3FUJ A;  4C48 B;  4NUR A;  5CCM A;  4NAC A;  3V2X A;  1HXI A;  3NQP A;  1SW6 A;  3BUA A;  4TXP A;  3VTX A;  4L9P A;  3G2V A;  2WMN A;  1UN8 A;  1OWL A;  5HRY A;  4JZY A;  3FTX A;  4EPZ A;  4CYM D;  3KS2 A;  2XS1 A;  3QKY A;  5T8I A;  2WXH A;  5AQA A;  5G55 A;  5CBN A;  2PZI A;  3D9N A;  1SZ9 A;  4JVS A;  1DC2 A;  3UPV A;  3NF1 A;  2ZIS A;  3HXE A;  3AG2 E;  4I1M A;  3DBS A;  2DBA A;  4WNE A;  4Y6C A;  3NB2 A;  2ZIR A;  4G1T A;  3ZXP A;  1UW4 B;  2QC9 A;  1H6K A;  3C72 A;  2A5E A;  2GRQ B;  4AM9 A;  3G2T A;  5FIN A;  4B89 A;  3S7B A;  1HFA A;  3MCX A;  4DX6 D;  4FJY A;  3ONK A;  3ZYK A;  3CVY A;  3QK0 A;  5CRU A;  4BWR A;  4WAF A;  1FT1 A;  1JPL A;  3CQG B;  4KVM A;  1O1T A;  2XPZ A;  4UQX A;  2FEZ A;  4BER A;  3LYA A;  3PS6 A;  2AVP A;  4GZC A;  2R02 A;  2BKK B;  5EN5 D;  1S70 B;  1ZBP A;  4A1S A;  2ETC A;  4H7X A;  2WXI A;  4GB9 A;  1IHG A;  4BT8 A;  4MKT A;  2IO2 C;  4BFR A;  3OTN A;  5D66 A;  4N5C A;  1K3Z D;  3UKU G;  3UT7 A;  3Q47 B;  4I6E A;  3DSV A;  1HX8 A;  3FTV A;  3URZ A;  3LDZ A;  2NXP A;  2QYU A;  1BD8 A;  4V3I A;  2HR2 A;  4I6G A;  3R9A B;  4F3V A;  2OEV A;  4ANX A;  4EZJ A;  1K1B A;  3C3O A;  3TWR A;  2I9C A;  4CCA A;  3APF A;  4TRQ A;  5CEC B;  3AS4 A;  4ACL A;  2KCK A;  4G2V A;  2GGF A;  4XZ4 A;  1Q2Z A;  4FA6 A;  5M72 A;  2PQN A;  1AWC B;  1LTX A;  4C9B B;  3FU5 A;  4OAV B;  4AXH A;  4JXT A;  3PNL B;  3Q9U C;  1E96 B;  4EHM A;  3FUD A;  2I1J A;  3CHR A;  2XEH A;  3L82 A;  3U64 A;  4BY6 A;  4HOT A;  1KT0 A;  4B8C B;  5ENS D;  4QQI A;  3PE4 A;  2GRO B;  1TN7 A;  2ZXW E;  2EIN E;  3BG1 B;  2KXP C;  2LO6 A;  5AQ9 A;  3CK9 A;  3JXI A;  2XPY A;  4JW1 A;  3ZIM A;  3EDT B;  4PUC A;  3FUE A;  2GRL A;  1H0A A;  2H6F A;  2OOE A;  4N3B A;  5HQ8 A;  4HXI A;  2V4L A;  5FQ8 A;  3PRZ A;  4GU5 A;  4Q96 A;  3CHP A;  3CGH A;  1RZ4 A;  1H6P A;  4F1P A;  2C0L A;  3SF4 A;  1QYM A;  3QAQ A;  1SVX A;  1QNF A;  3IKO B;  4HVB A;  3SBT B;  2HM8 A;  4UQZ A;  3AS8 A;  2GRP B;  1OCO E;  3TWW A;  5CMY A;  1QBQ A;  3L6A A;  3ZXS A;  2R05 A;  3D9P A;  4G24 A;  2VQ2 A;  3CKB A;  1N95 A;  4HFG A;  4R7L A;  5G05 C;  3UUX A;  2XPI A;  1E7U A;  3HRA A;  3C3R A;  4NQ0 A;  4GMR A;  4NIK A;  3C98 A;  1TEZ A;  4FP7 A;  4CZ2 D;  4HRN A;  5FWQ A;  5HI7 A;  2IOL A;  3DXM G;  3UX4 A;  2AWI A;  1MX4 A;  2L6B A;  2RD0 A;  2CG3 A;  2I1K A;  1OUV A;  1MYO A;  4G23 A;  5LCW J;  3AU5 A;  3DXK G;  3G2U A;  1IQR A;  5G04 J;  3UIO C;  2EIM E;  4GCO A;  4G26 A;  4LUN U;  3PE3 A;  5KNH D;  2V4H C;  3UT8 A;  4HI8 A;  3FUN A;  4GCN A;  5KNG A;  1L5J A;  4LCT A;  4HBD A;  2EIK E;  2MYO A;  3V2O A;  5B1A E;  3CHS A;  1EDU A;  3X2Q E;  3MKQ A;  3ULE G;  3I5P A;  4J8S A;  3LJ3 A;  5ARF A;  4UWK A;  1GW6 A;  3ASH A;  2C0M A;  4U63 A;  3DSU A;  4FHK A;  3JUE A;  2P9S G;  3EJN A;  1N54 A;  4Q69 A;  3R9M A;  3FY4 A;  4G8K A;  4O1O A;  4U8V D;  3DRA A;  1EYH A;  4BT9 A;  3KSL A;  4ANV A;  4I17 A;  5A7D B;  4GTV A;  5BXO A;  3ZGQ A;  3L16 A;  3PDN A;  1N4P A;  2PM6 A;  1S63 A;  3DSX A;  2JLB A;  4KT6 B;  4HOS A;  4MLP A;  3TWU A;  4DLQ A;  5FJY A;  2EIJ E;  4U04 A;  3JCK C;  2X6J A;  4CDM A;  5LFA A;  1TNO A;  3K9I A;  4Y6W A;  2VSN A;  5BPP A;  5FZS A;  4TXQ A;  3Q7A A;  4GTR A;  3G2S A;  1NL4 A;  3E4B A;  2Q7F A;  3IEG A;  1TNY A;  4GML A;  3PZ4 A;  4ZHB A;  5ENO D;  1E8W A;  3AG4 E;  1Y8M A;  1U3D A;  3CVP A;  2LUH A;  3VTY A;  3UM1 A;  1JCR A;  3TWQ A;  3SFZ A;  3CVX A;  2H6I A;  3ABL E;  2ILR A;  3KAE A;  5BUZ A;  3P2B A;  3DSS A;  3E32 A;  5FQ7 A;  5EIB E;  2UY1 B;  2X6K A;  4W9R A;  3CK7 A;  3V31 A;  3WXX A;  3T5V A;  3B95 A;  2XGO A;  2XZD G;  2LXM A;  2X6F A;  2IOS A;  4WNG A;  5D0Q D;  5KBA A;  4OYS A;  3L08 A;  1V55 E;  2WPV A;  5H7P A;  4BTA A;  4L23 A;  1OY3 D;  4B93 B;  3TAX A;  4I6J A;  4GA2 A;  3EU5 A;  3FWV A;  3F6Q A;  3CIA A;  1XGW A;  3QWV A;  1TN8 A;  3LJN A;  3MX3 A;  4UI9 K;  4GTS A;  2ZGG A;  2WXO A;  2QZA A;  4GZ6 A;  3CK8 A;  3OXF A;  4MBG A;  1YMP A;  4TXR A;  4DLO A;  3L9T A;  3LVR E;  4APF A;  4URK A;  3FUI A;  3S2A A;  2ETA A;  3DEO A;  1OWN A;  4DUI A;  2DIW A;  3JXJ A;  4PDX A;  2NYJ A;  1X5B A;  2AXV A;  4YND A;  3TWS A;  3TG4 A;  3FTW A;  2WQ7 A;  3S7J A;  1Z3X A;  4GYW A;  3LXU X;  3D9M A;  4PH4 B;  4YDY A;  1INZ A;  2AW6 A;  3FU0 A;  1OWO A;  4YVO A;  3NZU A;  4JHJ A;  4F53 A;  4ILH B;  3MJW A;  1WY6 A;  4DRX E;  4CEM A;  4J7W A;  4N3A A;  2ZGD A;  3FUK A;  4U7E B;  3JUI A;  3MKR A;  4L2Y A;  3B7U X;  2KCL A;  3QWP A;  3ZNG A;  2B6C A;  1ZU2 A;  3D9H A;  3RJV A;  2WXQ A;  1FPP A;  2ETB A;  2J07 A;  4WWO A;  4U95 D;  1BPO A;  4TUM A;  4EZK A;  5CMW A;  5ENT D;  4XI9 A;  3UMV A;  3QWW A;  4JEH A;  3U4T A;  4GA0 A;  4AJW A;  4DK5 A;  4LEU A;  2WXJ A;  3EHR A;  2EQX A;  4CDR A;  3SY2 A;  4KXK B;  5JMN D;  4HS2 A;  4GZD A;  1NA3 A;  3CKC A;  2Y4U A;  4AVX A;  3FTZ A;  3ZYL A;  2ION A;  1JUQ A;  3W9G A;  1ZB1 A;  3UT4 A;  2BUG A;  4BTB A;  2YQ8 A;  4DX1 A;  4HOU A;  2H6H A;  3NAW A;  3TG5 A;  3G2W A;  3UI2 A;  3EU9 A;  3KEZ A;  5T4Y A;  1Z3Y A;  1B89 A;  3UM3 A;  3FU3 A;  3Q78 A;  4XKB A;  3DPD A;  4GZ3 A;  4L1B A;  1PAQ A;  5AIJ A;  4XKC A;  3HXC A;  3OXL A;  2MHK A;  1TNB A;  3APD A;  4ILG A;  5C1D A;  3B7R L;  1E8Y A;  1IYG A;  4CGV A;  4B0Z A;  1HH8 A;  3GZS A;  4JHK A;  3D9L A;  4N2Q A;  3QAR A;  3PNT B;  2R59 A;  3HXB A;  4E6H A;  2PQR A;  1PC2 A;  3NOG D;  4LER A;  3LEW A;  1KPS B;  5AAO A;  2AXU A;  2P9U G;  3PEV B;  4CRW A;  3FH7 A;  4ZFH A;  1HF8 A;  3L22 A;  3TWV A;  1HZ4 A;  2IO3 C;  2KC7 A;  3TGO A;  3SBS A;  4PS3 A;  2VGY A;  2A5U A;  5EKQ D;  2GRN B;  2WXM A;  2M63 A;  5LCW C;  3SZ7 A;  1KZP A;  3AU4 A;  3ISM C;  1H2U A;  3RRN B;  5AEN A;  1BU9 A;  1Z5S C;  4GPK A;  1N52 A;  3Q75 A;  3MV2 B;  4EEC A;  4JA7 A;  3HYM B;  2IEJ A;  5DIZ A;  3PVL A;  5EX3 A;  2LXL A;  1N0R A;  3FHE A;  3SGH A;  3ENE A;  1UJK A;  3KEA A;  4L2L A;  2CHX A;  1RW2 A;  3D9I A;  4I9C A;  4AEZ C;  2V0P A;  4LSZ E;  3KD7 A;  4ACK A;  3MKQ B;  3Q73 A;  1OT8 A;  1DCQ A;  4U07 A;  4J8F A;  2L9B A;  1TNZ A;  3E37 A;  3SNX A;  2VTB B;  1IKN D;  3BEE A;  4AIF A;  3ZHE A;  2WB2 A;  2XCB A;  4X8Q A;  1Z6T A;  3L13 A;  4MS6 A;  1DVP A;  3UIN C;  1FVH A;  4C0M A;  2P9K G;  3UQ3 A;  1N4S A;  1XNF A;  3QDN A;  2OCC E;  4DX2 A;  5BT1 A;  1K1A A;  3UTM A;  4U0U A;  4ANW A;  3CEQ A;  3RKV A;  2AXZ A;  5EIL A;  5E75 A;  5KJK A;  3AG1 E;  3ZPJ A;  3TWT A;  2XEN A;  3GZ1 A;  5BXU A;  4XE0 A;  1O1S A;  5KCM A;  3PZ1 A;  5CHE E;  4EZL A;  4NRH B;  4RG9 A;  3OAW A;  1IQU A;  3I4G A;  3CLJ A;  2RFA A;  1NA0 A;  2LAH A;  4UQY A;  4XEI G;  1H2T C;  2OVB A;  4F7A A;  1LD7 A;  2CHZ A;  2F0Y A;  2PL2 A;  3U9W A;  4Z68 A;  1E7V A;  3UM0 A;  4U8Y D;  2RKK A;  1WM5 A;  3ASF A;  3FEY A;  3ZHE B;  4ME2 A;  1W3B A;  4IN3 B;  1BI7 B;  2NC9 A;  2DZN A;  2HE0 A;  1D8D A;  4HRM B;  4PS7 A;  4N5Q A;  4KZC A;  1D8E A;  4WWP A;  2IU1 A;  3L54 A;  2HYZ A;  1EF1 C;  5E76 A;  5ANL A;  3WG7 E;  4H7Y A;  2IQC A;  4N39 A;  3JQ1 A;  4A3T A;  4UI9 J;  3FUM A;  4GTT A;  3MGB A;  3ZEF A;  2OV8 A;  4HOR A;  3LVQ E;  1WAO 1;  3TXM A;  3FH5 A;  3ZKJ A;  3Q4A B;  4BES A;  2XGM A;  5JJT A;  5BW8 C;  5LOZ A;  4HOQ A;  5A6C A;  3DWL G;  2YIN A;  4N2S A;  4C0E A;  3QOU A;  3DST A;  4G11 A;  5AJL A;  2QY7 A;  3AJI A;  4WND A;  3E34 A;  5CBO A;  3CHM A;  3MV3 B;  5JHA A;  3TJP A;  3HIZ A;  1NZN A;  1MHQ A;  1U3C A;  4UI9 C;  4WWN A;  3Q9N C;  4UWH A;  5EDS A;  2KBX A;  4KYO B;  5FTP A;  4I9E A;  2X6H A;  2E0I A;  1YA0 A;  4GTM A;  2P9I G;  3B7T A;  4HRL A;  3ZW3 A;  5ENP D;  2BED A;  3JQ0 A;  5FZR A;  4BSX A;  1TNU A;  2WQH A;  3SD5 A;  4JEU A;  5HS0 A;  3FU6 A;  4AV7 A;  2V8S E;  3UXG A;  2KM4 A;  3T9K A;  1QQE A;  2YHE A;  2JAB A;  2KAT A;  2VYI A;  4LG6 A;  1UG3 A;  2P2C P;  3BQO A;  2XQ0 A;  3GZ2 A;  3HHM A;  3ULQ A;  3FFL A;  3FUL A;  1OCZ E;  3I4R B;  3RK6 A;  4U8H A;  5IY5 E;  2RFM A;  4RSY A;  2P9N G;  4FHJ A;  4U0Z A;  2FI7 A;  4GYO A;  1YCS B;  4GZ5 A;  1N4R A;  2R5S A;  1S0P A;  3IXE A;  5KJN A;  2BTD A;  4G25 A;  3RAU A;  1JCS A;  4K5C A;  3HXF A;  2P9P G;  2QFC A;  1V54 E;  2XCC A;  4I43 A;  3QC1 A;  1JWF A;  4LNB A;  4N3C A;  5CEA A;  3D9K A;  2DZO A;  1DNP A;  1TJC A;  3R7Q A;  2WMO A;  3VLD A;  3J5Q B;  2B0O E;  2P58 C;  3PEU B;  3CHO A;  5ARG A;  1KLX A;  2NSZ A;  2OVF A;  3ESK A;  5ENQ D;  2QYJ A;  3KSQ A;  2I2O A;  1PY1 A;  3Q15 A;  2F37 A;  4FJZ A;  1HE8 A;  4GAA A;  2UWJ G;  4IUL A;  3SFX A;  4AY5 A;  4FU3 A;  1QZ2 A;  1HS6 A;  1WG0 A;  5ANR A;  2AJA A;  4ABN A;  3T5X A;  2R17 C;  3PZ2 A;  4JPS A;  5J90 A;  4JD2 G;  2VJ8 A;  4CGW A;  3D9J A;  4APO A;  3CVL A;  4TUU A;  2VGE A;  1TJF A;  4M3O A;  5B3S E;  2KZT A;  5AN8 A;  1SA4 A;  4OVU A;  5G2N A;  5B1B E;  5BV0 A;  2DWZ A;  1SZA A;  4B94 A;  5T3R A;  5EX0 A;  1JCQ A;  1UN9 A;  1H19 A;  3CSF A;  5CCL A;  4YDE A;  1LF8 A;  5ENR D;  4E85 A;  2L0T B;  1KT1 A;  5KJM A;  5CED B;  5D2M C;  2J09 A;  1G3N B;  3DEP A;  2YNQ A;  2ZU6 B;  2LSU A;  4I2W A;  3IHY A;  3HXD A;  5D0O D;  4EQF A;  4J8Y A;  2X38 A;  1ELK A;  2XZT G;  3SFY A;  3CVN A;  1AP7 A;  2WXN A;  3ML8 A;  4DI4 A;  4WUY A;  3NOC D;  3N71 A;  2CFZ A;  5A23 A;  4YVQ C;  2PNN A;  4HLL A;  1P5Q A;  4LNG A;  3DSW A; 
#chains in the Genus database with same CATH homology
 5IY5 E;  2OCC E;  3AG2 E;  3AG1 E;  3ASO E;  3ABK E;  1OCO E;  3ABL E;  5B3S E;  1OCC E;  1V54 E;  1V55 E;  2EIK E;  3AG3 E;  1OCR E;  2DYR E;  2EIL E;  5B1B E;  2DYS E;  3WG7 E;  3ABM E;  1OCZ E;  2Y69 E;  2EIN E;  2ZXW E;  3AG4 E;  3ASN E;  5B1A E;  2EIM E;  3X2Q E;  2EIJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...