3ABKE

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 45
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abkE00
2OCCE 5B3SE 3ABKE 3AG2E 3ASNE 2DYRE 3AG4E 2EIKE 3AG3E 1OCCE 2EIJE 2EINE 1OCRE 3ABME 2EIME 1V54E 3ABLE 2DYSE 2Y69E 3WG7E 2ZXWE 3AG1E 3ASOE 1OCOE 5B1BE 5IY5E 5B1AE 1OCZE 1V55E 2EILE 3X2QE
chains in the Genus database with same CATH superfamily
3RAUA 1HZ4A 2V4LA 4FHJA 3SBSA 4OYSA 3ENEA 3LJ3A 1N0QA 1RZ4A 2HM8A 3SD5A 3TG4A 3QAQA 3AS8A 3Q5MA 2LAIA 4JD2G 4UWGA 2P9PG 3UT8A 4XIFA 4ATZD 4BEPA 1HH8A 3VLDA 3PZ2A 4YVOA 3FU5A 3DXKG 1MHQA 1HXIA 3UTMA 4MS6A 3HIZA 4LNGA 1Y8MA 4FJYA 1N4RA 2OVFA 4NQ0A 3ZYMA 3ONKA 4HRLA 3O4ZA 2XEHA 5EYLA 3QNKA 4GCOA 4G26A 3RU0A 1Z3XA 2ZGGA 3PREA 4HOQA 2XGOA 3NBNB 4RVBA 5M72A 2ETCA 3HXCA 2L9BA 4AIFA 4DLOA 4R7LA 4DI3A 5FZSA 3VTXA 3R9MA 1FCHA 3DRAA 3D3MA 3TWUA 4FHKA 3Q7AA 3L16A 3Q4AB 3W9GA 4TXPA 3CHQA 3KS2A 1OCZE 3JCKC 3NAWA 3DSSA 4MLPA 3SZ7A 3PNLB 4XI0A 3CVWA 2L0TB 3E4BA 5FT9A 2YHEA 5EKQD 3V31A 2WXJA 3T8KA 4EECA 2YNQA 4EZLA 4XE0A 2I1KA 3E33A 5JHAA 4U96D 1NL4A 4OAVB 2WVIA 3E30A 3ML9A 3PNTB 5AARA 3DSTA 2YINA 3JQ1A 4BX9A 1OCCE 5BXUA 3ISMC 2IY0C 3LY7A 2HE0A 4WNDA 3FY4A 3ULYA 3FP3A 4JB8P 5CRVA 2EQXA 3ZNGA 1SW6A 2WXOA 4F1PA 4FA6A 5BPPA 3ZYLA 4RG9A 1HE8A 1QZ2A 1E96B 2XZDG 1X5BA 3V79K 1IKND 3ZHEB 3FTZA 2MHKA 2B0OE 5KJLA 2F37A 3UM0A 2WPVA 4GA0A 2L6BA 2KZTB 4KZ0A 3TGOA 4PS3A 3ABLE 4N39A 2XGSA 3ZXSA 1TYQG 5AQ7A 5AAOA 2KXPC 2OVBA 4HFGA 3ZGQA 3D9IA 5ITZF 1N0RA 3JUEA 2PQRA 2IONA 2MRIA 2WXIA 3FTWA 2JEKA 3ABKE 4TRQA 2Y1LE 4ANWA 1KZPA 1BI7B 3R9AB 3RK6A 4NRHB 2CHXA 1SZAA 4GTRA 3TWVA 4GTMA 1QYMA 4U0ZA 3LPZA 5IY5E 1K1AA 3NB2A 3UX4A 1N9AA 3SBTB 3UM1A 3IHVA 3V30A 3L54A 3B13A 3QWWA 4U0UA 2IQCA 3PE3A 2V5QC 2VSXE 2XQ0A 5G55A 3CLJA 4HBDA 3K9IA 4CCAA 3V2XA 4LNBA 3UMVA 2R17C 1TEZA 1YMPA 4OVUA 1O1SA 3PZDA 2IO2C 2PM7A 5G04J 3KEZA 3S7JA 2EIKE 2CG2A 2DBAA 3CVXA 3UI2A 5D0QD 4EQFA 3RKVA 2DYSE 4J8EA 3FUNA 4GZ5A 1D8DA 2ETAA 2PL2A 2RG8A 2BTDA 2GRMA 4UQXA 3AS4A 2XS1A 4F1SA 5KJMA 3TAXA 4G8KA 4ANUA 4BY6A 1WDYA 1MX6A 5LCWC 2R05A 4CT0A 1N4PA 4B94A 3HG0D 5EYPF 5A7DB 2CHZA 3CVPA 1EPUA 1Q2ZA 4L23A 3C72A 4Q96A 4UQZA 1UN8A 3LDZA 4CGWA 4HVBA 4MKTA 2XRZA 1KLXA 2AXUA 1TR4A 3UQ3A 4B93B 1ZBPA 2CG3A 4P29A 4UI9J 1DVPA 5EDSA 5KBAA 4GMRA 4UWKA 2HR2A 3MKQA 4JEUA 4RQIA 5KCMA 2LXLA 3Q73A 1S63A 4N3AA 3LYAA 1FPPA 3D9HA 2FEZA 3Q49B 2P9LG 3GYZA 2WXQA 5EX0A 1E8ZA 3HXBA 5HKPA 4U95D 3PEUB 3Q7FA 3CVNA 1H2UA 4W9RA 3U64A 4N2QA 3TL5A 1A5EA 2X6FA 3U3WA 3QARA 4CEMA 2XPIA 4LEUA 2ONDA 4PH4B 1JCQA 4TXRA 3Q15A 4ME2A 2GRPB 3MV3B 5G05J 5FIOA 5KNGA 2VGEA 2R5SA 3SGHA 2AWIA 3DSVA 1K1BA 1ZU2A 4YVQC 2Y4UA 3B7SA 5A23A 1DC2A 4N3BA 3B95A 3QWVA 3AU4A 3ZEFA 2R2LA 2AW6A 4I1AA 1OY3D 1EF1C 4J8SA 4JHKA 3U66A 3VTYA 1TNOA 4C48B 3MGBA 3TG5A 2WXRA 3P2BA 3OTNA 2WXGA 2DWZA 4K0RA 2P2CP 3WXXA 1AWCB 2NSZA 4YDWA 3ZVVA 4HRNA 4EBAG 2KC7A 3G2UA 5KNHD 4A3VA 4FADA 3D9LA 1S0PA 2QYUA 3V2OA 2AXVA 4G2VA 1FT2A 4I2WA 2E0IA 4JA9A 1OWNA 2J4DA 4JVSA 1MZCA 4I1OB 4JHRA 3ULEG 3FUMA 4AVXA 2JABA 4L9PA 1N54A 5JJ6A 4IRUA 3EU5A 1KPSB 4GB9A 1OUVA 3N71A 3JXIA 2E2EA 2OCCE 2JLBA 5G2NA 2X6KA 5C1DA 3QC1A 3SNXA 4HQDA 3FH5A 2FI7A 5DBKA 1FVHA 4C0EA 4ZHBA 3CVVA 4A63B 3QDNA 1TJCA 2CFUA 2X38A 4DX2A 4UUCA 1WG0A 1A17A 2BF0X 5AJDA 2Y0BG 4H7YA 4I6EA 4DI4A 4C9BB 4WWOA 2IJGX 3C3OA 4TUUA 3I4GA 3RRMB 2WQ7A 3BG1B 1BD8A 1K8KG 1OT8A 4ACKA 4RLYA 3CHPA 3TJPA 2HO1A 3HVEB 4O1OA 4HOUA 3F6QA 5T4YA 4I9EA 3KSQA 3FUDA 1YYHA 3AG2E 1H6OA 1WY6A 2GRQB 5FINA 1JWFA 2VGXB 2KCKA 3CVQA 1MX4A 3ZIMA 3JYSA 4CRWA 5ENPD 1H2TC 4XKCA 3ZHEA 4H7XA 5FJYA 4JC8A 1MJ0A 5LP0A 1YA0A 1HG5A 4HI8A 1S70B 2KCVA 2KZTA 4F53A 3G2WA 4ILIA 2BUGA 4K03A 2P58C 2VGYA 4M3OA 3ASNE 4BFRA 1TNZA 3UKRG 1JCSA 3APFA 4XI9A 2J9QA 3L17A 2PZIA 1HS6A 4KVMA 3FTVA 2WXPA 1IYGA 2NXPA 3U9WA 3SO8A 4BETA 4C0MA 2OOEA 3HRAA 5BNWA 2MYOA 4GMJA 3TXMA 1O5MA 2A5UA 3IBEA 2ZISA 2J08A 3FULA 3OXGA 2R59A 4KBQA 4FLHA 3S2AA 1UJJA 1MX2A 3HHMA 2F0YA 1FT1A 4GZDA 3VLFA 4JHJA 5ARFA 3GW4A 1E7UA 4KMOA 3NOCD 1YCSB 2VSNA 4GTTA 2WXHA 3RSEG 2NYJA 1NFIE 4GZ3A 5E75A 5FQ4A 5BT1A 2UWJG 2VYIA 3ZYQA 2WQHA 4J8YA 4GU5A 4WWPA 4BSXA 1TNYA 3G2VA 3Q9NC 4MBGA 5FZQA 3RJVA 4URKA 1JPLA 3L6AA 1H2VC 4D10C 1E8XA 3DSWA 1DCEA 2OEWA 4DX6D 4I6JA 4DRXE 1S64A 2H6FA 2CHWA 5CHEE 3J5QB 5HRYA 4NURA 2WXMA 1OXJA 2VTBB 4KYOB 5JHBA 5FQ7A 2QC9A 2I6HA 3PDNA 1OWMA 3IXEA 4HNAD 3T8MA 1NP7A 4J0UA 5T3RA 4TXQA 2F8YA 4X8QA 2V5FA 3VLEA 1LTXA 3CSFA 5G04C 3DXMG 3C3RA 3AG4E 3CHSA 2LXMA 4L2YA 1TNBA 2XRYA 2P9SG 4GCNA 4M7CA 4F6RD 3RIBA 1IHGA 3CR3A 3CVLA 3CQGB 3E32A 3HXEA 4WNGA 2ZU6B 2WMOA 4EBAA 3SF4A 2V4HC 3KAEA 3C3QA 3FUFA 2XZTG 2OEVA 4AY5A 3S7DA 2V0PA 4PUCA 2P9KG 1O1RA 4AP2A 3ZFWA 1TNUA 2BKKB 1KT0A 4J7WA 4U63A 1SQMA 3EIQC 5CRUA 1E90A 4DX7D 1H0AA 1U3CA 4AJWA 4IULA 4DJAA 1JCRA 3QK0A 4L7TA 3DWLG 2ILRA 2MOWA 4A55A 1HG2A 1KT1A 1IQRA 2XEEA 4HOTA 2IF4A 3AG1E 1TN7A 1VDYA 3CK8A 4UI9C 4HB5A 4E6HA 4ACLA 5CMYA 2XS8A 4EZJA 3ML8A 5HQ8A 3LEWA 2X6JA 1AP7A 2WM9A 3R7RA 5CBNA 2J4BA 4PS8A 5ENSD 5E76A 3PH0C 5CBOA 1MYOA 5CEAA 3LKUA 2FO7A 3Q47B 4U04A 2P9NG 4N2SA 5BXOA 4E85A 3AG3E 4UWLA 3L13A 5EIDA 1UW4B 4B89A 4FC8A 4U0SA 4CDMA 4RSYA 4G1TA 4KT6B 5G05C 3FTSA 3MCXA 3UUXA 1Z3YA 2I2OA 1NA3A 5KJNA 4QQIA 3E34A 3RRNB 2C0MA 2RFAA 2A4ZA 4GYWA 4AXHA 3MJWA 4AV7A 2A5EA 1OCRE 2KM4A 3FHEA 4O1PA 2QFCA 2IOSA 2Y4TA 4BT8A 3C98A 3CVYA 2L0IA 5AYWD 1V55E 3IV0A 3CK9A 3PZ3A 4B0ZA 1DNPA 1NA0A 3MZLB 4OAUC 3AS5A 1BI8B 5BV1A 3GZ1A 5JMND 3DPDA 2GROB 3CQCB 3DEPA 2I9CA 4BESA 4HLEA 5T8IA 3S7FA 4HXIA 3APDA 4XEIG 5JJ7A 1TN8A 4JEHA 5CCMA 2C2LA 2QYJA 2PNNA 3EIJA 1SVXA 3FTUA 1SZ9A 4LCTA 4K5AB 1WM5A 2BKGA 2YQ8A 2DIWA 5B1BE 1QNFA 4G23A 3HVEA 4XX5A 3PUJA 3FUJA 3L08A 2WXLA 2AVPA 2FBNA 3UPVA 3B7UX 3UXGA 2EINE 3G2SA 3HYMB 3QB2A 3UT4A 3BUAA 4B8AA 2ZGDA 4J6IA 3E37A 3OXFA 4BSZB 4EHMA 3SY2A 2GRNB 2VGXA 4GPMA 3CVUA 3JQ0A 4LRZA 4QFVA 1G3NB 3J5PA 3QKYA 2RFMA 3FFLA 5KJKA 3ZPJA 3NOGD 2FULA 4YDOA 4GA2A 3RO2A 3BG0B 3LCAA 2WXKA 3T9KA 3OXLA 4GA1A 3MEKA 3NZSA 3ZW3A 1SA5A 3NZUA 1GW6A 3ZKJA 3CKBA 3FUIA 2KCLA 3APCA 4UWHA 3PRZA 3WG7E 4N5CA 4DUIA 1Z5SC 3FWVA 4CGVA 1JWGA 4O6FA 3ASFA 4DPRA 2WXFA 2ZIRA 1N4SA 2WMNA 4EPZA 2DCPA 2Y69E 3R7QA 2F8XK 4AEZC 4LERA 3SQVA 3I3NA 4HOSA 5CCLA 5AJLA 2DZNA 1E7VA 3AU5A 1OWLA 3RRUA 3JXJA 4GMLA 2J09A 2L6JA 3DSXA 5BW8C 3D9OA 4GTOA 5AENA 4DK5A 2NC9A 4Y6WA 3IKOB 3ZU7B 3FU3A 3IEGA 1JUQA 3ESLA 1QBQA 4KXKB 2X6HA 4WUYA 3CEQA 3PVLA 2XHEA 3PE4A 4CYMD 3EHQA 5JA4D 5FZRA 3BQOA 1KZOA 4AM9A 2RKKA 2DVWA 5ENTD 1UN9A 5LFAA 1W3BA 4TUMA 1X81A 2UY1B 3CV0A 1H6PA 3PS6A 3D9KA 3C5RA 3LY8A 3Q75A 4LSZE 4TV3A 5CEDB 2PQNA 1N95A 3W9FA 2GRLA 1LD8A 3QWPA 4WNEA 4GYOA 3DBSA 1ELWA 5LX8A 2QY7A 4JXTA 3MYVA 2VQ2A 3QOUA 1FVFA 4BTAA 2XGMA 3LS8A 3TWSA 3TWWA 3CHRA 3PZ4A 4KZCA 4FLBA 4DX1A 2H6IA 3OAWA 3T5VA 1N94A 3U4TA 2VTBA 1INZA 2YHCA 4BTBA 4A1GA 3DSUA 3PUKA 2LO6A 2RD0A 3CHMA 2WQ6A 3QJZA 5EN5D 1NI1A 2C0LA 3FUKA 3TXNA 4L1BA 3FUHA 5EIBE 2DZOA 2Q7FA 3P1UA 4GTPA 3ULQA 4WWNA 1UG3A 4ILGA 5FQ6A 1HX8A 4APFA 3ZRHA 4AOFA 3EJNA 3ASHA 3TWTA 2P9UG 4I1MA 3AJIA 1P5QA 4BERA 4I9CA 3T5XA 5ENRD 1D8EA 2LAHA 3L82A 5J08A 3L22A 1N4QA 3CKCA 4LNUD 2IEJA 4DX5D 2B6CA 3LVRE 1D9SA 2ZXWE 3PZ1A 1BU9A 4Z68A 1H6KA 1WAO1 1RW2A 1QQEA 3TWQA 3MV2B 1HF8A 3FTYA 4LG6A 3LJNA 4FULA 2X6IA 1PY1A 3ASGA 2XCCA 4JPSA 4JL0A 3HDXA 2J8SD 2XENA 3Q79A 1TN6A 4WNFA 5ENNA 4O60A 3O48A 1OCOE 4GYYA 2GRRB 3FH7A 1IQUA 3ZUVB 4G8LA 1XGWA 3GZ2A 2GGFA 3D9NA 2VSOE 3ONLA 4OVVA 5EILA 1HFAA 3GZSA 2IOLA 2VJ8A 3FTXA 1LD7A 4K5BA 4UQYA 3SFYA 3EUVA 1E8YA 1OWPA 1EYHA 1ELRA 5A6CA 5ANLA 3EU9A 4GTQA 2XPZA 5AQAA 3DPYA 1ZB1A 5CERB 3S7BA 5ANRA 5FQ8A 3L9TA 4U7EB 3EHNA 5ARGA 5AN8A 4HS2A 5DIZA 5D0OD 5EX3A 3CGHA 3CK7A 5H7PA 3ZN3A 1PAQA 2GW1A 2OV8A 3ZXPA 5B3SE 4EZKA 4BWRA 1XNFA 3FEXA 5CMWA 3CIAA 4V3IA 4F7AA 3URZA 3KEAA 2EIME 4U07A 4ILHB 4PS7A 4FP7A 3AAAC 4K5CA 5FTPA 2ETBA 3ESKA 1Y6IA 5LOZA 2M63A 4HRMB 3IHYA 1IXVA 4A1SA 3UM3A 5HS0A 3D9PA 3UIPC 2R02A 1NZNA 4APOA 4I17A 1E8WA 4I2ZA 3ASOE 4G25A 2X3MA 3EDTB 4ATGA 5JJTA 2R03A 4NIKA 3G2TA 4GPKA 4G24A 3UIOC 1K3ZD 3CSTA 4U8YD 4Y6CA 3SFZA 4J8DA 5LCWJ 4PDXA 3PEVB 3MA5A 1MQSA 2H6GA 2I1JA 3Q9UC 2WXNA 4U8VD 5KWDA 4CDNA 1HO8A 5CECB 4ANXA 3I4RB 1H19A 1UOHA 4J8FA 4Q94A 5ENQD 4L2LA 5C2YA 2FF4A 5FWQA 4YDEA 2HYZA 3ZYKA 2KATA 1UJKA 3UM2A 1ELKA 1PC2A 5D66A 2FO1E 2IFUA 1U2VG 3NQPA 3LVQE 3MX3A 3KD7A 3UINC 2AXZA 3LXUX 3FH8A 4GTSA 3FUEA 3EHMA 3JUIA 4JW1A 3SI5A 1Z6TA 4ZFHA 4DLQA 3D9MA 3MKRA 4HLLA 1N52A 5AQ9A 4N3CA 3FU0A 3UT7A 3FDHA 3TWXA 2LUHA 4I6GA 4KVOA 1SA4A 3D9JA 3HXFA 5J90A 4FJZA 2VSYA 4MRUA 4FU3A 4ABNA 1B89A 4I43A 2XPYA 5D2MC 1TJFA 4BT9A 2LSUA 1O1TA 4HI9A 3UKUG 5BV0A 2EIJE 3I5PA 2LSVA 4HORA 4CZ2D 2XEVA 2AJAA 3ASDA 3FEYA 4JA7A 2KBXA 5ENOD 4UI9K 3HXDA 1BLXB 5B1AE 4U8HA 2CFZA 2UY1A 4XZ4A 4GTVA 2DYRE 1BPOA 4GZCA 2H6HA 5HI7A 2QZAA 2LNIA 4IN3B 4G11A 4YNDA 1N11A 2P9IG 4Q69A 3CHOA 3MKQB 4AY6A 2EILE 3X2QE 1U3DA 4F3VA 5BUZA 3SHFA 2J49A 2BEDA 4IYPA 4CT4A 3DEOA 3LY9A 3EHRA 3B7BA 4RG6A 3BEEA 3KSLA 1IHBA 4GZ6A 1DCQA 4BX8A 1OWOA 5AQBA 4WAFA 2XCBA 2IO3C 2Y3AA 1HU3A 2WB2A 3BU8A 3ABME 1V54E 1LF8A 4JZYA 4UWFA 5AIJA 3FU6A 1EDUA 2V8SE 3SFXA 4YDYA 4ANVA 3NF1A 2PM6A 3B7TA 4GAAA 4NACA 4B8CB 4N5QA 1L5JA 2IU1A 4LUNU 4A3TA 4CDRA 3B7RL 3RO3A 3Q78A 4XKBA 3TWRA 2J07A
chains in the Genus database with same CATH topology
2OCCE 5B3SE 3ABKE 3AG2E 3ASNE 2DYRE 3AG4E 2EIKE 3AG3E 1OCCE 2EIJE 2EINE 1OCRE 3ABME 2EIME 1V54E 3ABLE 2DYSE 2Y69E 3WG7E 2ZXWE 3AG1E 3ASOE 1OCOE 5B1BE 5IY5E 5B1AE 1OCZE 1V55E 2EILE 3X2QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCC E;  5B3S E;  3ABK E;  3AG2 E;  3ASN E;  2DYR E;  3AG4 E;  2EIK E;  3AG3 E;  1OCC E;  2EIJ E;  2EIN E;  1OCR E;  3ABM E;  2EIM E;  1V54 E;  3ABL E;  2DYS E;  2Y69 E;  3WG7 E;  2ZXW E;  3AG1 E;  3ASO E;  1OCO E;  5B1B E;  5IY5 E;  5B1A E;  1OCZ E;  1V55 E;  2EIL E;  3X2Q E; 
#chains in the Genus database with same CATH topology
 3RAU A;  1HZ4 A;  2V4L A;  4FHJ A;  3SBS A;  4OYS A;  3ENE A;  3LJ3 A;  1N0Q A;  1RZ4 A;  2HM8 A;  3SD5 A;  3TG4 A;  3QAQ A;  3AS8 A;  3Q5M A;  2LAI A;  4JD2 G;  4UWG A;  2P9P G;  3UT8 A;  4XIF A;  4ATZ D;  4BEP A;  1HH8 A;  3VLD A;  3PZ2 A;  4YVO A;  3FU5 A;  3DXK G;  1MHQ A;  1HXI A;  3UTM A;  4MS6 A;  3HIZ A;  4LNG A;  1Y8M A;  4FJY A;  1N4R A;  2OVF A;  4NQ0 A;  3ZYM A;  3ONK A;  4HRL A;  3O4Z A;  2XEH A;  5EYL A;  3QNK A;  4GCO A;  4G26 A;  3RU0 A;  1Z3X A;  2ZGG A;  3PRE A;  4HOQ A;  2XGO A;  3NBN B;  4RVB A;  5M72 A;  2ETC A;  3HXC A;  2L9B A;  4AIF A;  4DLO A;  4R7L A;  4DI3 A;  5FZS A;  3VTX A;  3R9M A;  1FCH A;  3DRA A;  3D3M A;  3TWU A;  4FHK A;  3Q7A A;  3L16 A;  3Q4A B;  3W9G A;  4TXP A;  3CHQ A;  3KS2 A;  1OCZ E;  3JCK C;  3NAW A;  3DSS A;  4MLP A;  3SZ7 A;  3PNL B;  4XI0 A;  3CVW A;  2L0T B;  3E4B A;  5FT9 A;  2YHE A;  5EKQ D;  3V31 A;  2WXJ A;  3T8K A;  4EEC A;  2YNQ A;  4EZL A;  4XE0 A;  2I1K A;  3E33 A;  5JHA A;  4U96 D;  1NL4 A;  4OAV B;  2WVI A;  3E30 A;  3ML9 A;  3PNT B;  5AAR A;  3DST A;  2YIN A;  3JQ1 A;  4BX9 A;  1OCC E;  5BXU A;  3ISM C;  2IY0 C;  3LY7 A;  2HE0 A;  4WND A;  3FY4 A;  3ULY A;  3FP3 A;  4JB8 P;  5CRV A;  2EQX A;  3ZNG A;  1SW6 A;  2WXO A;  4F1P A;  4FA6 A;  5BPP A;  3ZYL A;  4RG9 A;  1HE8 A;  1QZ2 A;  1E96 B;  2XZD G;  1X5B A;  3V79 K;  1IKN D;  3ZHE B;  3FTZ A;  2MHK A;  2B0O E;  5KJL A;  2F37 A;  3UM0 A;  2WPV A;  4GA0 A;  2L6B A;  2KZT B;  4KZ0 A;  3TGO A;  4PS3 A;  3ABL E;  4N39 A;  2XGS A;  3ZXS A;  1TYQ G;  5AQ7 A;  5AAO A;  2KXP C;  2OVB A;  4HFG A;  3ZGQ A;  3D9I A;  5ITZ F;  1N0R A;  3JUE A;  2PQR A;  2ION A;  2MRI A;  2WXI A;  3FTW A;  2JEK A;  3ABK E;  4TRQ A;  2Y1L E;  4ANW A;  1KZP A;  1BI7 B;  3R9A B;  3RK6 A;  4NRH B;  2CHX A;  1SZA A;  4GTR A;  3TWV A;  4GTM A;  1QYM A;  4U0Z A;  3LPZ A;  5IY5 E;  1K1A A;  3NB2 A;  3UX4 A;  1N9A A;  3SBT B;  3UM1 A;  3IHV A;  3V30 A;  3L54 A;  3B13 A;  3QWW A;  4U0U A;  2IQC A;  3PE3 A;  2V5Q C;  2VSX E;  2XQ0 A;  5G55 A;  3CLJ A;  4HBD A;  3K9I A;  4CCA A;  3V2X A;  4LNB A;  3UMV A;  2R17 C;  1TEZ A;  1YMP A;  4OVU A;  1O1S A;  3PZD A;  2IO2 C;  2PM7 A;  5G04 J;  3KEZ A;  3S7J A;  2EIK E;  2CG2 A;  2DBA A;  3CVX A;  3UI2 A;  5D0Q D;  4EQF A;  3RKV A;  2DYS E;  4J8E A;  3FUN A;  4GZ5 A;  1D8D A;  2ETA A;  2PL2 A;  2RG8 A;  2BTD A;  2GRM A;  4UQX A;  3AS4 A;  2XS1 A;  4F1S A;  5KJM A;  3TAX A;  4G8K A;  4ANU A;  4BY6 A;  1WDY A;  1MX6 A;  5LCW C;  2R05 A;  4CT0 A;  1N4P A;  4B94 A;  3HG0 D;  5EYP F;  5A7D B;  2CHZ A;  3CVP A;  1EPU A;  1Q2Z A;  4L23 A;  3C72 A;  4Q96 A;  4UQZ A;  1UN8 A;  3LDZ A;  4CGW A;  4HVB A;  4MKT A;  2XRZ A;  1KLX A;  2AXU A;  1TR4 A;  3UQ3 A;  4B93 B;  1ZBP A;  2CG3 A;  4P29 A;  4UI9 J;  1DVP A;  5EDS A;  5KBA A;  4GMR A;  4UWK A;  2HR2 A;  3MKQ A;  4JEU A;  4RQI A;  5KCM A;  2LXL A;  3Q73 A;  1S63 A;  4N3A A;  3LYA A;  1FPP A;  3D9H A;  2FEZ A;  3Q49 B;  2P9L G;  3GYZ A;  2WXQ A;  5EX0 A;  1E8Z A;  3HXB A;  5HKP A;  4U95 D;  3PEU B;  3Q7F A;  3CVN A;  1H2U A;  4W9R A;  3U64 A;  4N2Q A;  3TL5 A;  1A5E A;  2X6F A;  3U3W A;  3QAR A;  4CEM A;  2XPI A;  4LEU A;  2OND A;  4PH4 B;  1JCQ A;  4TXR A;  3Q15 A;  4ME2 A;  2GRP B;  3MV3 B;  5G05 J;  5FIO A;  5KNG A;  2VGE A;  2R5S A;  3SGH A;  2AWI A;  3DSV A;  1K1B A;  1ZU2 A;  4YVQ C;  2Y4U A;  3B7S A;  5A23 A;  1DC2 A;  4N3B A;  3B95 A;  3QWV A;  3AU4 A;  3ZEF A;  2R2L A;  2AW6 A;  4I1A A;  1OY3 D;  1EF1 C;  4J8S A;  4JHK A;  3U66 A;  3VTY A;  1TNO A;  4C48 B;  3MGB A;  3TG5 A;  2WXR A;  3P2B A;  3OTN A;  2WXG A;  2DWZ A;  4K0R A;  2P2C P;  3WXX A;  1AWC B;  2NSZ A;  4YDW A;  3ZVV A;  4HRN A;  4EBA G;  2KC7 A;  3G2U A;  5KNH D;  4A3V A;  4FAD A;  3D9L A;  1S0P A;  2QYU A;  3V2O A;  2AXV A;  4G2V A;  1FT2 A;  4I2W A;  2E0I A;  4JA9 A;  1OWN A;  2J4D A;  4JVS A;  1MZC A;  4I1O B;  4JHR A;  3ULE G;  3FUM A;  4AVX A;  2JAB A;  4L9P A;  1N54 A;  5JJ6 A;  4IRU A;  3EU5 A;  1KPS B;  4GB9 A;  1OUV A;  3N71 A;  3JXI A;  2E2E A;  2OCC E;  2JLB A;  5G2N A;  2X6K A;  5C1D A;  3QC1 A;  3SNX A;  4HQD A;  3FH5 A;  2FI7 A;  5DBK A;  1FVH A;  4C0E A;  4ZHB A;  3CVV A;  4A63 B;  3QDN A;  1TJC A;  2CFU A;  2X38 A;  4DX2 A;  4UUC A;  1WG0 A;  1A17 A;  2BF0 X;  5AJD A;  2Y0B G;  4H7Y A;  4I6E A;  4DI4 A;  4C9B B;  4WWO A;  2IJG X;  3C3O A;  4TUU A;  3I4G A;  3RRM B;  2WQ7 A;  3BG1 B;  1BD8 A;  1K8K G;  1OT8 A;  4ACK A;  4RLY A;  3CHP A;  3TJP A;  2HO1 A;  3HVE B;  4O1O A;  4HOU A;  3F6Q A;  5T4Y A;  4I9E A;  3KSQ A;  3FUD A;  1YYH A;  3AG2 E;  1H6O A;  1WY6 A;  2GRQ B;  5FIN A;  1JWF A;  2VGX B;  2KCK A;  3CVQ A;  1MX4 A;  3ZIM A;  3JYS A;  4CRW A;  5ENP D;  1H2T C;  4XKC A;  3ZHE A;  4H7X A;  5FJY A;  4JC8 A;  1MJ0 A;  5LP0 A;  1YA0 A;  1HG5 A;  4HI8 A;  1S70 B;  2KCV A;  2KZT A;  4F53 A;  3G2W A;  4ILI A;  2BUG A;  4K03 A;  2P58 C;  2VGY A;  4M3O A;  3ASN E;  4BFR A;  1TNZ A;  3UKR G;  1JCS A;  3APF A;  4XI9 A;  2J9Q A;  3L17 A;  2PZI A;  1HS6 A;  4KVM A;  3FTV A;  2WXP A;  1IYG A;  2NXP A;  3U9W A;  3SO8 A;  4BET A;  4C0M A;  2OOE A;  3HRA A;  5BNW A;  2MYO A;  4GMJ A;  3TXM A;  1O5M A;  2A5U A;  3IBE A;  2ZIS A;  2J08 A;  3FUL A;  3OXG A;  2R59 A;  4KBQ A;  4FLH A;  3S2A A;  1UJJ A;  1MX2 A;  3HHM A;  2F0Y A;  1FT1 A;  4GZD A;  3VLF A;  4JHJ A;  5ARF A;  3GW4 A;  1E7U A;  4KMO A;  3NOC D;  1YCS B;  2VSN A;  4GTT A;  2WXH A;  3RSE G;  2NYJ A;  1NFI E;  4GZ3 A;  5E75 A;  5FQ4 A;  5BT1 A;  2UWJ G;  2VYI A;  3ZYQ A;  2WQH A;  4J8Y A;  4GU5 A;  4WWP A;  4BSX A;  1TNY A;  3G2V A;  3Q9N C;  4MBG A;  5FZQ A;  3RJV A;  4URK A;  1JPL A;  3L6A A;  1H2V C;  4D10 C;  1E8X A;  3DSW A;  1DCE A;  2OEW A;  4DX6 D;  4I6J A;  4DRX E;  1S64 A;  2H6F A;  2CHW A;  5CHE E;  3J5Q B;  5HRY A;  4NUR A;  2WXM A;  1OXJ A;  2VTB B;  4KYO B;  5JHB A;  5FQ7 A;  2QC9 A;  2I6H A;  3PDN A;  1OWM A;  3IXE A;  4HNA D;  3T8M A;  1NP7 A;  4J0U A;  5T3R A;  4TXQ A;  2F8Y A;  4X8Q A;  2V5F A;  3VLE A;  1LTX A;  3CSF A;  5G04 C;  3DXM G;  3C3R A;  3AG4 E;  3CHS A;  2LXM A;  4L2Y A;  1TNB A;  2XRY A;  2P9S G;  4GCN A;  4M7C A;  4F6R D;  3RIB A;  1IHG A;  3CR3 A;  3CVL A;  3CQG B;  3E32 A;  3HXE A;  4WNG A;  2ZU6 B;  2WMO A;  4EBA A;  3SF4 A;  2V4H C;  3KAE A;  3C3Q A;  3FUF A;  2XZT G;  2OEV A;  4AY5 A;  3S7D A;  2V0P A;  4PUC A;  2P9K G;  1O1R A;  4AP2 A;  3ZFW A;  1TNU A;  2BKK B;  1KT0 A;  4J7W A;  4U63 A;  1SQM A;  3EIQ C;  5CRU A;  1E90 A;  4DX7 D;  1H0A A;  1U3C A;  4AJW A;  4IUL A;  4DJA A;  1JCR A;  3QK0 A;  4L7T A;  3DWL G;  2ILR A;  2MOW A;  4A55 A;  1HG2 A;  1KT1 A;  1IQR A;  2XEE A;  4HOT A;  2IF4 A;  3AG1 E;  1TN7 A;  1VDY A;  3CK8 A;  4UI9 C;  4HB5 A;  4E6H A;  4ACL A;  5CMY A;  2XS8 A;  4EZJ A;  3ML8 A;  5HQ8 A;  3LEW A;  2X6J A;  1AP7 A;  2WM9 A;  3R7R A;  5CBN A;  2J4B A;  4PS8 A;  5ENS D;  5E76 A;  3PH0 C;  5CBO A;  1MYO A;  5CEA A;  3LKU A;  2FO7 A;  3Q47 B;  4U04 A;  2P9N G;  4N2S A;  5BXO A;  4E85 A;  3AG3 E;  4UWL A;  3L13 A;  5EID A;  1UW4 B;  4B89 A;  4FC8 A;  4U0S A;  4CDM A;  4RSY A;  4G1T A;  4KT6 B;  5G05 C;  3FTS A;  3MCX A;  3UUX A;  1Z3Y A;  2I2O A;  1NA3 A;  5KJN A;  4QQI A;  3E34 A;  3RRN B;  2C0M A;  2RFA A;  2A4Z A;  4GYW A;  4AXH A;  3MJW A;  4AV7 A;  2A5E A;  1OCR E;  2KM4 A;  3FHE A;  4O1P A;  2QFC A;  2IOS A;  2Y4T A;  4BT8 A;  3C98 A;  3CVY A;  2L0I A;  5AYW D;  1V55 E;  3IV0 A;  3CK9 A;  3PZ3 A;  4B0Z A;  1DNP A;  1NA0 A;  3MZL B;  4OAU C;  3AS5 A;  1BI8 B;  5BV1 A;  3GZ1 A;  5JMN D;  3DPD A;  2GRO B;  3CQC B;  3DEP A;  2I9C A;  4BES A;  4HLE A;  5T8I A;  3S7F A;  4HXI A;  3APD A;  4XEI G;  5JJ7 A;  1TN8 A;  4JEH A;  5CCM A;  2C2L A;  2QYJ A;  2PNN A;  3EIJ A;  1SVX A;  3FTU A;  1SZ9 A;  4LCT A;  4K5A B;  1WM5 A;  2BKG A;  2YQ8 A;  2DIW A;  5B1B E;  1QNF A;  4G23 A;  3HVE A;  4XX5 A;  3PUJ A;  3FUJ A;  3L08 A;  2WXL A;  2AVP A;  2FBN A;  3UPV A;  3B7U X;  3UXG A;  2EIN E;  3G2S A;  3HYM B;  3QB2 A;  3UT4 A;  3BUA A;  4B8A A;  2ZGD A;  4J6I A;  3E37 A;  3OXF A;  4BSZ B;  4EHM A;  3SY2 A;  2GRN B;  2VGX A;  4GPM A;  3CVU A;  3JQ0 A;  4LRZ A;  4QFV A;  1G3N B;  3J5P A;  3QKY A;  2RFM A;  3FFL A;  5KJK A;  3ZPJ A;  3NOG D;  2FUL A;  4YDO A;  4GA2 A;  3RO2 A;  3BG0 B;  3LCA A;  2WXK A;  3T9K A;  3OXL A;  4GA1 A;  3MEK A;  3NZS A;  3ZW3 A;  1SA5 A;  3NZU A;  1GW6 A;  3ZKJ A;  3CKB A;  3FUI A;  2KCL A;  3APC A;  4UWH A;  3PRZ A;  3WG7 E;  4N5C A;  4DUI A;  1Z5S C;  3FWV A;  4CGV A;  1JWG A;  4O6F A;  3ASF A;  4DPR A;  2WXF A;  2ZIR A;  1N4S A;  2WMN A;  4EPZ A;  2DCP A;  2Y69 E;  3R7Q A;  2F8X K;  4AEZ C;  4LER A;  3SQV A;  3I3N A;  4HOS A;  5CCL A;  5AJL A;  2DZN A;  1E7V A;  3AU5 A;  1OWL A;  3RRU A;  3JXJ A;  4GML A;  2J09 A;  2L6J A;  3DSX A;  5BW8 C;  3D9O A;  4GTO A;  5AEN A;  4DK5 A;  2NC9 A;  4Y6W A;  3IKO B;  3ZU7 B;  3FU3 A;  3IEG A;  1JUQ A;  3ESL A;  1QBQ A;  4KXK B;  2X6H A;  4WUY A;  3CEQ A;  3PVL A;  2XHE A;  3PE4 A;  4CYM D;  3EHQ A;  5JA4 D;  5FZR A;  3BQO A;  1KZO A;  4AM9 A;  2RKK A;  2DVW A;  5ENT D;  1UN9 A;  5LFA A;  1W3B A;  4TUM A;  1X81 A;  2UY1 B;  3CV0 A;  1H6P A;  3PS6 A;  3D9K A;  3C5R A;  3LY8 A;  3Q75 A;  4LSZ E;  4TV3 A;  5CED B;  2PQN A;  1N95 A;  3W9F A;  2GRL A;  1LD8 A;  3QWP A;  4WNE A;  4GYO A;  3DBS A;  1ELW A;  5LX8 A;  2QY7 A;  4JXT A;  3MYV A;  2VQ2 A;  3QOU A;  1FVF A;  4BTA A;  2XGM A;  3LS8 A;  3TWS A;  3TWW A;  3CHR A;  3PZ4 A;  4KZC A;  4FLB A;  4DX1 A;  2H6I A;  3OAW A;  3T5V A;  1N94 A;  3U4T A;  2VTB A;  1INZ A;  2YHC A;  4BTB A;  4A1G A;  3DSU A;  3PUK A;  2LO6 A;  2RD0 A;  3CHM A;  2WQ6 A;  3QJZ A;  5EN5 D;  1NI1 A;  2C0L A;  3FUK A;  3TXN A;  4L1B A;  3FUH A;  5EIB E;  2DZO A;  2Q7F A;  3P1U A;  4GTP A;  3ULQ A;  4WWN A;  1UG3 A;  4ILG A;  5FQ6 A;  1HX8 A;  4APF A;  3ZRH A;  4AOF A;  3EJN A;  3ASH A;  3TWT A;  2P9U G;  4I1M A;  3AJI A;  1P5Q A;  4BER A;  4I9C A;  3T5X A;  5ENR D;  1D8E A;  2LAH A;  3L82 A;  5J08 A;  3L22 A;  1N4Q A;  3CKC A;  4LNU D;  2IEJ A;  4DX5 D;  2B6C A;  3LVR E;  1D9S A;  2ZXW E;  3PZ1 A;  1BU9 A;  4Z68 A;  1H6K A;  1WAO 1;  1RW2 A;  1QQE A;  3TWQ A;  3MV2 B;  1HF8 A;  3FTY A;  4LG6 A;  3LJN A;  4FUL A;  2X6I A;  1PY1 A;  3ASG A;  2XCC A;  4JPS A;  4JL0 A;  3HDX A;  2J8S D;  2XEN A;  3Q79 A;  1TN6 A;  4WNF A;  5ENN A;  4O60 A;  3O48 A;  1OCO E;  4GYY A;  2GRR B;  3FH7 A;  1IQU A;  3ZUV B;  4G8L A;  1XGW A;  3GZ2 A;  2GGF A;  3D9N A;  2VSO E;  3ONL A;  4OVV A;  5EIL A;  1HFA A;  3GZS A;  2IOL A;  2VJ8 A;  3FTX A;  1LD7 A;  4K5B A;  4UQY A;  3SFY A;  3EUV A;  1E8Y A;  1OWP A;  1EYH A;  1ELR A;  5A6C A;  5ANL A;  3EU9 A;  4GTQ A;  2XPZ A;  5AQA A;  3DPY A;  1ZB1 A;  5CER B;  3S7B A;  5ANR A;  5FQ8 A;  3L9T A;  4U7E B;  3EHN A;  5ARG A;  5AN8 A;  4HS2 A;  5DIZ A;  5D0O D;  5EX3 A;  3CGH A;  3CK7 A;  5H7P A;  3ZN3 A;  1PAQ A;  2GW1 A;  2OV8 A;  3ZXP A;  5B3S E;  4EZK A;  4BWR A;  1XNF A;  3FEX A;  5CMW A;  3CIA A;  4V3I A;  4F7A A;  3URZ A;  3KEA A;  2EIM E;  4U07 A;  4ILH B;  4PS7 A;  4FP7 A;  3AAA C;  4K5C A;  5FTP A;  2ETB A;  3ESK A;  1Y6I A;  5LOZ A;  2M63 A;  4HRM B;  3IHY A;  1IXV A;  4A1S A;  3UM3 A;  5HS0 A;  3D9P A;  3UIP C;  2R02 A;  1NZN A;  4APO A;  4I17 A;  1E8W A;  4I2Z A;  3ASO E;  4G25 A;  2X3M A;  3EDT B;  4ATG A;  5JJT A;  2R03 A;  4NIK A;  3G2T A;  4GPK A;  4G24 A;  3UIO C;  1K3Z D;  3CST A;  4U8Y D;  4Y6C A;  3SFZ A;  4J8D A;  5LCW J;  4PDX A;  3PEV B;  3MA5 A;  1MQS A;  2H6G A;  2I1J A;  3Q9U C;  2WXN A;  4U8V D;  5KWD A;  4CDN A;  1HO8 A;  5CEC B;  4ANX A;  3I4R B;  1H19 A;  1UOH A;  4J8F A;  4Q94 A;  5ENQ D;  4L2L A;  5C2Y A;  2FF4 A;  5FWQ A;  4YDE A;  2HYZ A;  3ZYK A;  2KAT A;  1UJK A;  3UM2 A;  1ELK A;  1PC2 A;  5D66 A;  2FO1 E;  2IFU A;  1U2V G;  3NQP A;  3LVQ E;  3MX3 A;  3KD7 A;  3UIN C;  2AXZ A;  3LXU X;  3FH8 A;  4GTS A;  3FUE A;  3EHM A;  3JUI A;  4JW1 A;  3SI5 A;  1Z6T A;  4ZFH A;  4DLQ A;  3D9M A;  3MKR A;  4HLL A;  1N52 A;  5AQ9 A;  4N3C A;  3FU0 A;  3UT7 A;  3FDH A;  3TWX A;  2LUH A;  4I6G A;  4KVO A;  1SA4 A;  3D9J A;  3HXF A;  5J90 A;  4FJZ A;  2VSY A;  4MRU A;  4FU3 A;  4ABN A;  1B89 A;  4I43 A;  2XPY A;  5D2M C;  1TJF A;  4BT9 A;  2LSU A;  1O1T A;  4HI9 A;  3UKU G;  5BV0 A;  2EIJ E;  3I5P A;  2LSV A;  4HOR A;  4CZ2 D;  2XEV A;  2AJA A;  3ASD A;  3FEY A;  4JA7 A;  2KBX A;  5ENO D;  4UI9 K;  3HXD A;  1BLX B;  5B1A E;  4U8H A;  2CFZ A;  2UY1 A;  4XZ4 A;  4GTV A;  2DYR E;  1BPO A;  4GZC A;  2H6H A;  5HI7 A;  2QZA A;  2LNI A;  4IN3 B;  4G11 A;  4YND A;  1N11 A;  2P9I G;  4Q69 A;  3CHO A;  3MKQ B;  4AY6 A;  2EIL E;  3X2Q E;  1U3D A;  4F3V A;  5BUZ A;  3SHF A;  2J49 A;  2BED A;  4IYP A;  4CT4 A;  3DEO A;  3LY9 A;  3EHR A;  3B7B A;  4RG6 A;  3BEE A;  3KSL A;  1IHB A;  4GZ6 A;  1DCQ A;  4BX8 A;  1OWO A;  5AQB A;  4WAF A;  2XCB A;  2IO3 C;  2Y3A A;  1HU3 A;  2WB2 A;  3BU8 A;  3ABM E;  1V54 E;  1LF8 A;  4JZY A;  4UWF A;  5AIJ A;  3FU6 A;  1EDU A;  2V8S E;  3SFX A;  4YDY A;  4ANV A;  3NF1 A;  2PM6 A;  3B7T A;  4GAA A;  4NAC A;  4B8C B;  4N5Q A;  1L5J A;  2IU1 A;  4LUN U;  4A3T A;  4CDR A;  3B7R L;  3RO3 A;  3Q78 A;  4XKB A;  3TWR A;  2J07 A; 
#chains in the Genus database with same CATH homology
 2OCC E;  5B3S E;  3ABK E;  3AG2 E;  3ASN E;  2DYR E;  3AG4 E;  2EIK E;  3AG3 E;  1OCC E;  2EIJ E;  2EIN E;  1OCR E;  3ABM E;  2EIM E;  1V54 E;  3ABL E;  2DYS E;  2Y69 E;  3WG7 E;  2ZXW E;  3AG1 E;  3ASO E;  1OCO E;  5B1B E;  5IY5 E;  5B1A E;  1OCZ E;  1V55 E;  2EIL E;  3X2Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...