3ABKE

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 45
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abkE00
5B1AE 1OCOE 5IY5E 2OCCE 2Y69E 1OCRE 3ABME 1OCCE 3ASNE 2EILE 1V54E 3X2QE 2DYSE 3ABLE 3AG4E 5B3SE 2EIME 2DYRE 2EIJE 2EINE 2ZXWE 1V55E 5B1BE 3WG7E 2EIKE 3ABKE 3ASOE 3AG1E 1OCZE 3AG2E 3AG3E
chains in the Genus database with same CATH superfamily
4AVXA 4L23A 4Y6WA 4LEUA 4I9EA 4JHRA 3UM2A 3JXIA 3HHMA 5ENTD 2EILE 4GZ5A 1FVHA 4A63B 1A5EA 1SW6A 2A5UA 3LPZA 3PH0C 4GU5A 4JB8P 1IQUA 2I1KA 4L9PA 3VLDA 2FBNA 3GZSA 4J8FA 4I17A 1UN8A 3ZYQA 4JA7A 5EYPF 2PM7A 2XZDG 4MKTA 4LSZE 3TG4A 3FTYA 3UTMA 1ELWA 5ENNA 4G23A 1HZ4A 3WXXA 3V31A 4Q69A 2J4DA 3TWXA 2FI7A 3IHVA 4I9CA 4EZJA 3AS5A 1Y6IA 3BUAA 2WXNA 3I4RB 3MKQA 4J7WA 3SFYA 1Y8MA 2H6IA 2ETBA 2XEVA 4N2QA 3DSWA 1N4PA 4AP2A 4UQXA 2F37A 3QDNA 4A3VA 1V55E 4JEHA 4XI9A 3LCAA 3ZVVA 3RRUA 3EIJA 3VTXA 3FU3A 5LCWC 3RO2A 5G2NA 3CHMA 5AYWD 1YCSB 4G25A 2ETAA 3JUEA 5HS0A 3FY4A 5CEDB 3UMVA 3FUFA 1HE8A 5G05J 4BY6A 4XE0A 2PNNA 1O1SA 2XPZA 3FUEA 2DZNA 2Y0BG 2WQHA 2C0LA 3IHYA 1WDYA 2Y4UA 5BV0A 4ZHBA 2KCVA 3TJPA 1TNYA 4J8SA 1NA0A 3MA5A 1NI1A 4DX6D 3FUDA 3LY9A 4JZYA 2LO6A 4IYPA 1TNZA 2VYIA 4IN3B 1EF1C 3G2UA 3MV3B 3DXMG 3APDA 1Q2ZA 3E34A 2YINA 2WXMA 4WUYA 2IEJA 4KVOA 5CHEE 2VSNA 3HXBA 4XKCA 4C48B 4RG9A 5AQAA 1SVXA 2GRMA 2LSVA 1BLXB 3I5PA 5AN8A 4BESA 4G8LA 1D8EA 1LD7A 5BXOA 3TXMA 4GTOA 5JMND 1PY1A 2XGSA 1RW2A 2FF4A 2KZTA 5HI7A 3D3MA 5ENPD 1ELRA 2E0IA 4GTTA 1KZOA 2OOEA 4BX9A 1TJCA 2FO7A 2FEZA 3ZRHA 4B89A 3D9IA 3Q9NC 5A6CA 4N3BA 3DEPA 4NQ0A 3CVLA 4UI9C 3B7RL 2Y4TA 4A3TA 2BKKB 5DBKA 4L7TA 5EX3A 2VGYA 4EPZA 4ZFHA 2VTBB 3S7DA 3C98A 2V8SE 3B7UX 2VGXB 1QQEA 3CVNA 4H7XA 5EDSA 3LXUX 4M7CA 5CCMA 5HRYA 2WQ7A 4NURA 5FWQA 4LG6A 3ULEG 5AARA 1DC2A 3Q73A 1X81A 3HRAA 4PDXA 3FUIA 4TRQA 1FT2A 4KVMA 3B95A 4JC8A 3KEAA 2H6HA 3FU0A 5ANLA 5IY5E 3V2OA 2BF0X 2R05A 3ASFA 3CEQA 4HOUA 4U8YD 3OXGA 5JHBA 3OXLA 3AG4E 3PE4A 2I9CA 3FDHA 4HBDA 2WXKA 2H6FA 1UW4B 1P5QA 3SD5A 4FC8A 3D9KA 4AOFA 4UWGA 3JCKC 3EDTB 3U9WA 3SY2A 3Q7FA 4FLBA 3X2QE 1W3BA 3FTVA 2XRYA 1KPSB 3GW4A 4LERA 5AJLA 3CVYA 4J8YA 4HLEA 1OCZE 4YDOA 4I1MA 3PDNA 2KC7A 2JLBA 2ONDA 3N71A 1SA5A 3SO8A 3C3QA 4GMRA 1YMPA 3D9NA 1O5MA 1A17A 3DRAA 2DVWA 4DLQA 4ANVA 4EHMA 2P9PG 5T3RA 3ISMC 2DIWA 2YNQA 5FQ4A 4QFVA 3UXGA 1OWLA 3PNTB 5AJDA 4GCOA 1FCHA 4GZCA 4HVBA 5HKPA 2X38A 3EUVA 3RRMB 1LTXA 5C1DA 4AJWA 3RK6A 2RKKA 3ZW3A 4D10C 4B8CB 3UM0A 4I2WA 5AAOA 1N11A 3GYZA 4GTQA 1TNUA 3PZ3A 1QYMA 4P29A 3Q79A 5FTPA 4N5QA 3AS4A 3OXFA 3SI5A 1IKND 2XCCA 3C3OA 2J09A 3PREA 1D8DA 2JEKA 2GROB 2IQCA 3UI2A 3CHQA 4UWKA 1EPUA 1WG0A 2WXPA 4F7AA 2VGEA 2IY0C 5EYLA 4O6FA 1IYGA 3MKQB 3PEVB 3BG0B 4LRZA 3SBSA 3T8MA 4QQIA 2XCBA 3FHEA 2CFZA 2P9SG 3FU6A 3SZ7A 2J07A 3E33A 4B94A 1HF8A 2CHZA 2WQ6A 3B13A 4B0ZA 3LDZA 3FTWA 1SQMA 4K03A 3ZIMA 2IO3C 4U8HA 4JPSA 4I2ZA 2AWIA 3NZSA 4GTSA 2HYZA 4JA9A 1TNBA 1OCOE 2I1JA 4OVUA 5CCLA 3Q5MA 3EU5A 2OVFA 3APFA 1N0QA 3ASNE 4GZ3A 3MGBA 5B1BE 3P2BA 3EHMA 1WY6A 3IEGA 2J8SD 3OTNA 3K9IA 4WNDA 4C0EA 3UT8A 4WNEA 3S7FA 5AENA 2J4BA 1UOHA 3L54A 1QNFA 3FULA 3ML8A 3L16A 5ARFA 5KWDA 3FTZA 4EECA 5BXUA 1NA3A 4LCTA 1FT1A 3LKUA 2KZTB 3CVWA 3D9OA 4WNGA 3W9GA 4CEMA 4OAUC 3PE3A 5LFAA 4DLOA 3FTSA 4U0UA 2P9NG 3P1UA 2NSZA 3ONKA 3NAWA 1VDYA 4CT4A 4E6HA 2QY7A 1U3DA 4YNDA 3Q49B 4Y6CA 4FHKA 4EZKA 4XI0A 2XZTG 2YHCA 4U04A 1UG3A 4U07A 2WXFA 4F1SA 3BG1B 5CMYA 3ZYKA 2GRRB 5M72A 4HQDA 5FZRA 4LNBA 4GCNA 2XEEA 3E37A 3HXDA 3QJZA 2LXMA 2WM9A 3NZUA 4BTBA 5G55A 1H6KA 3RSEG 3ZU7B 2LUHA 3QC1A 3NQPA 4L1BA 1N52A 4Q96A 2QYUA 2LAHA 3AG3E 2WXHA 4MRUA 4I43A 4CT0A 1OXJA 1H0AA 4HOQA 2KM4A 1UJJA 4KMOA 3KS2A 4CGVA 5BUZA 5D2MC 4ANUA 4WAFA 3EJNA 5FJYA 3FUNA 4JXTA 2WXJA 2V4HC 4OYSA 3RAUA 4YDYA 3MYVA 2AXVA 2DWZA 1NFIE 4C0MA 4G8KA 3NOGD 3CKBA 3G2TA 3PUKA 3UQ3A 4UWLA 4BEPA 1JWGA 1K1AA 1H2TC 4HS2A 1QZ2A 1JUQA 3D9JA 1H6PA 4EZLA 5EN5D 5FQ6A 2XS1A 5J90A 5FINA 4GTRA 4AIFA 3CQGB 5CRVA 1JCRA 1L5JA 1X5BA 2XQ0A 2LNIA 4RLYA 3ASHA 3ASOE 4BSZB 3KEZA 4GYWA 4K5BA 4A55A 2R03A 5LOZA 4CDNA 3FU5A 2MHKA 1EYHA 4RVBA 2HO1A 4I6JA 5H7PA 5AIJA 1H6OA 3MEKA 3ABLE 4K0RA 1JCSA 3CHRA 4ILGA 4DX5D 3IXEA 4XKBA 3DSTA 4FU3A 4A1GA 3ULQA 1SA4A 4UWHA 1Z3XA 4GMLA 3LY7A 2QZAA 3L6AA 2MYOA 2IFUA 2UY1B 2J08A 3SBTB 1N9AA 5KJLA 3S7JA 5A7DB 4O1PA 3PZ1A 3BEEA 4HFGA 5D66A 1KT1A 3U4TA 2XPIA 1MJ0A 1BD8A 3RKVA 5B3SE 3B7SA 2L9BA 3LVRE 3RO3A 3TAXA 2RG8A 3F6QA 4HOSA 4RSYA 1XNFA 2Y1LE 4BX8A 2AJAA 3FFLA 4GAAA 4JD2G 4URKA 1OCRE 5DIZA 3KD7A 5BPPA 1E8YA 1AP7A 5EX0A 4G11A 1GW6A 2B0OE 3UIPC 3ZGQA 3Q9UC 4HNAD 4BSXA 3B7BA 2ZU6B 4G1TA 3D9HA 3CHSA 3QWWA 2BKGA 2XPYA 5FZQA 2GRPB 2AXUA 4TXQA 2WXRA 4G24A 3UX4A 4CYMD 1TN8A 2PL2A 4HRLA 3TL5A 2IF4A 2HR2A 4CRWA 1TN6A 4JW1A 3HVEA 4EBAA 3E4BA 2CG2A 2ILRA 3QWPA 2M63A 4UI9K 5ARGA 2XEHA 4C9BB 2WXGA 4FJZA 3AS8A 5EIBE 5JJ7A 3JUIA 5ENRD 5G04J 4HRNA 5KJKA 4U0ZA 1DNPA 2GW1A 3TXNA 2X3MA 3PS6A 4DPRA 5BNWA 3PNLB 1JWFA 3ZFWA 1U2VG 1PAQA 3NBNB 2NXPA 3DSSA 5A23A 2QC9A 3SGHA 4AY6A 4GB9A 1HH8A 2GRNB 5EKQD 2EINE 1N4SA 1DCQA 2C0MA 3VLEA 1MQSA 1BI8B 3HXCA 3FUHA 4ANXA 3Q47B 1BPOA 3ZYMA 3RU0A 5KCMA 5CMWA 4AXHA 2XRZA 2ZISA 3UT7A 3LEWA 3FH5A 5ANRA 3HIZA 5E76A 3UKRG 3ZEFA 3Q4AB 3DPYA 3V30A 3R7QA 3ZHEA 1OUVA 1Z6TA 4HI8A 4I6GA 2L0IA 3RJVA 1FVFA 4GZ6A 4ABNA 1MX4A 3PEUB 1INZA 3L13A 1OY3D 2E2EA 2DYRE 2ZGDA 1B89A 4WWOA 2DZOA 2R59A 5CBNA 4BERA 3CV0A 3CVVA 5B1AE 4N3CA 4LUNU 3IV0A 4XZ4A 3EIQC 4YDEA 2VSXE 3FUKA 2VJ8A 2QFCA 3UKUG 2OEWA 4MS6A 4GTPA 3MZLB 1KT0A 1U3CA 3L17A 3TWUA 3V79K 4OAVB 3B7TA 3DSUA 1JCQA 3ESLA 3W9FA 3ZYLA 3GZ2A 3CKCA 3CVUA 4L2YA 3WG7E 1PC2A 3AG1E 3UUXA 3L22A 3BQOA 2VTBA 2RD0A 2B6CA 5AQBA 2OEVA 3LJ3A 2I6HA 3C3RA 5E75A 4IULA 3CK8A 3IKOB 4MLPA 4JVSA 1N4RA 4IRUA 3UPVA 4DI3A 1H19A 4TV3A 5FQ7A 3HG0D 3AG2E 2C2LA 4CDRA 3ASGA 2HM8A 4Q94A 1BU9A 3ZXPA 3TWVA 3E30A 4FULA 2OCCE 1TJFA 3ASDA 3IBEA 3Q78A 4PS3A 4U96D 5ITZF 2FULA 5FT9A 4BWRA 5BW8C 3KSLA 4DRXE 1UN9A 2V5FA 2L6JA 2NC9A 2WXQA 4G2VA 3KAEA 2P9UG 4O60A 3G2WA 1E7VA 5BV1A 3J5QB 2XGMA 2P9IG 4NACA 5EILA 1HFAA 3PUJA 3ZN3A 4E85A 1N4QA 2XGOA 1EDUA 4KZCA 3EHRA 3OAWA 4FA6A 3GZ1A 3DBSA 3PZ4A 4APOA 4PH4B 3DXKG 3O48A 3URZA 3AJIA 4UWFA 4GA1A 3CLJA 3VTYA 3T5VA 4O1OA 4NRHB 1OT8A 2F8YA 3UINC 4G26A 3PZDA 1E7UA 2A5EA 4GYOA 3ULYA 4BFRA 2AXZA 2KXPC 3U64A 3TWSA 1H2UA 5FQ8A 3Q15A 4XEIG 5JJ6A 5EIDA 1RZ4A 4GA2A 4U0SA 4PUCA 4B93B 3EHQA 4BT8A 3NOCD 4K5CA 3SNXA 3ESKA 2L0TB 3T5XA 3HDXA 3ABKE 1S0PA 2LXLA 3T9KA 4RG6A 5CRUA 4DUIA 1Z3YA 4UQZA 1HXIA 3HXFA 4AEZC 4U8VD 5LCWJ 2WXLA 2NYJA 3FP3A 4AY5A 4TXPA 1DCEA 5AQ7A 2WVIA 3G2VA 3C5RA 3JYSA 2F0YA 3CK7A 3HVEB 3QAQA 3DSXA 2P58C 1IQRA 4AM9A 3TWRA 2IO2C 4PS7A 2AVPA 1WAO1 5ENSD 4KXKB 1HG5A 1QBQA 4J8EA 3ABME 4TXRA 4JHKA 4Z68A 2XENA 2WMNA 3V2XA 5D0QD 2UWJG 5LX8A 4HI9A 3U66A 3D9LA 3AU4A 4U95D 2LAIA 3MCXA 2DBAA 3FH8A 4A1SA 3QOUA 3TG5A 1N95A 4J0UA 3ENEA 5G05C 4PS8A 4FHJA 2WXIA 2CHWA 1OWMA 1IHGA 4I1AA 3FUMA 2KBXA 3O4ZA 3ZNGA 1TYQG 2WXOA 4HLLA 1N0RA 4ATGA 3SF4A 2KATA 3VLFA 3ZHEB 4HB5A 4R7LA 4GYYA 5FIOA 4I1OB 4U7EB 4UI9J 4FP7A 4WNFA 3DSVA 1E8WA 3QARA 4TUMA 2YQ8A 1OWNA 3DEOA 1NP7A 4F1PA 2Y69E 3FEYA 1V54E 3UIOC 3SFZA 2VQ2A 2P9LG 5CEAA 1N54A 2IONA 3CHOA 4GZDA 5HQ8A 2V0PA 3PRZA 3CK9A 1HU3A 2IJGX 3JXJA 2A4ZA 4ACLA 1OWPA 1FPPA 2JABA 3C72A 1HX8A 4BETA 4EBAG 5CBOA 4JHJA 3EHNA 2F8XK 1SZAA 5JA4D 1Z5SC 2KCLA 3ZUVB 2OVBA 1ZB1A 1TNOA 1E8XA 4FJYA 2Q7FA 3SHFA 1YA0A 3FWVA 1S63A 2PM6A 3NF1A 3PVLA 2X6FA 3LY8A 1XGWA 1JPLA 1IXVA 2BEDA 5D0OD 4U63A 5JJTA 3AAAC 1HO8A 4KZ0A 2KCKA 2PQRA 3DWLG 4YDWA 5BT1A 3QNKA 3Q75A 4APFA 4EQFA 4AV7A 2WMOA 3T8KA 2XS8A 5T8IA 5KBAA 3I4GA 2CHXA 3FEXA 2L6BA 2X6IA 3CVQA 4GTMA 1BI7B 4XX5A 3S7BA 4OVVA 2X6HA 4K5AB 4ATZD 2R02A 3I3NA 5JHAA 1OWOA 1ELKA 1IHBA 3EU9A 4BTAA 4JL0A 4ME2A 2R5SA 4CCAA 4RQIA 3TWTA 1AWCB 5KJMA 1D9SA 3G2SA 1HS6A 3AU5A 1LD8A 2IOSA 2XHEA 2EIME 3APCA 3CVPA 2RFAA 4I6EA 1N94A 4XIFA 1G3NB 3QKYA 3QWVA 1MX2A 2CG3A 3PZ2A 4GTVA 5KNGA 1NL4A 4DX7D 5G04C 2RFMA 4CZ2D 3HYMB 3RIBA 2ETCA 2J49A 2Y3AA 1K1BA 4DX2A 1HG2A 3MKRA 1H2VC 2GRQB 4LNUD 2X6JA 2H6GA 2R2LA 4DJAA 4UUCA 2EQXA 4ACKA 1E96B 5ENOD 4BT9A 2BUGA 2MOWA 2P2CP 3D9MA 3R9AB 4FLHA 1OCCE 1MHQA 3CHPA 4HXIA 3UM1A 2ZXWE 1YYHA 4FADA 1LF8A 2WB2A 4HOTA 2DCPA 3DPDA 4TUUA 3CSFA 3S2AA 4CDMA 4KT6B 1K8KG 3RRNB 2I2OA 3R7RA 5CECB 5AQ9A 3TWWA 2PQNA 4F6RD 4M3OA 3UM3A 3FUJA 3UT4A 2HE0A 4N5CA 2UY1A 2YHEA 3FTUA 2J9QA 4HORA 3L9TA 1DVPA 4B8AA 2R17C 4KYOB 3TWQA 5T4YA 2P9KG 3LJNA 4GA0A 1MZCA 4WWNA 4J8DA 4KBQA 2AW6A 5KNHD 4GPKA 4W9RA 1E8ZA 5KJNA 4DX1A 3CQCB 3L08A 4H7YA 2IU1A 2VGXA 3CSTA 3LS8A 5FZSA 3ZXSA 3ML9A 5C2YA 3U3WA 2BTDA 3ZKJA 3MJWA 3R9MA 1MYOA 3QB2A 3CVXA 4WWPA 3LVQE 4N3AA 2EIKE 2ZGGA 1KLXA 4ANWA 1WM5A 3E32A 4CGWA 5LP0A 1O1TA 4V3IA 4F3VA 2VSYA 2QYJA 3HXEA 3TGOA 3MV2B 5CERB 4GPMA 4L2LA 3LYAA 1S70B 1O1RA 1TEZA 4N2SA 2EIJE 1E90A 3CGHA 1TN7A 4N39A 1UJKA 4ILIA 5ENQD 1TR4A 4GMJA 2VSOE 4DK5A 3SFXA 3QK0A 4UQYA 4X8QA 2V4LA 4F53A 2GGFA 2FO1E 3CIAA 2LSUA 1SZ9A 4MBGA 3L82A 2GRLA 4ILHB 5J08A 2IOLA 2V5QC 2CFUA 3KSQA 2PZIA 3FTXA 2MRIA 2OV8A 2X6KA 3NB2A 4J6IA 1S64A 3FH7A 4YVOA 2WPVA 3CR3A 3BU8A 4YVQC 4LNGA 3MX3A 4HRMB 1ZU2A 3D9PA 3J5PA 1K3ZD 3ONLA 4JEUA 3JQ0A 2ZIRA 2DYSE 3Q7AA 3ZPJA 1MX6A 1NZNA 3JQ1A 4DI4A 1KZPA 4NIKA 3SQVA 1ZBPA
chains in the Genus database with same CATH topology
5B1AE 1OCOE 5IY5E 2OCCE 2Y69E 1OCRE 3ABME 1OCCE 3ASNE 2EILE 1V54E 3X2QE 2DYSE 3ABLE 3AG4E 5B3SE 2EIME 2DYRE 2EIJE 2EINE 2ZXWE 1V55E 5B1BE 3WG7E 2EIKE 3ABKE 3ASOE 3AG1E 1OCZE 3AG2E 3AG3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1A E;  1OCO E;  5IY5 E;  2OCC E;  2Y69 E;  1OCR E;  3ABM E;  1OCC E;  3ASN E;  2EIL E;  1V54 E;  3X2Q E;  2DYS E;  3ABL E;  3AG4 E;  5B3S E;  2EIM E;  2DYR E;  2EIJ E;  2EIN E;  2ZXW E;  1V55 E;  5B1B E;  3WG7 E;  2EIK E;  3ABK E;  3ASO E;  3AG1 E;  1OCZ E;  3AG2 E;  3AG3 E; 
#chains in the Genus database with same CATH topology
 4AVX A;  4L23 A;  4Y6W A;  4LEU A;  4I9E A;  4JHR A;  3UM2 A;  3JXI A;  3HHM A;  5ENT D;  2EIL E;  4GZ5 A;  1FVH A;  4A63 B;  1A5E A;  1SW6 A;  2A5U A;  3LPZ A;  3PH0 C;  4GU5 A;  4JB8 P;  1IQU A;  2I1K A;  4L9P A;  3VLD A;  2FBN A;  3GZS A;  4J8F A;  4I17 A;  1UN8 A;  3ZYQ A;  4JA7 A;  5EYP F;  2PM7 A;  2XZD G;  4MKT A;  4LSZ E;  3TG4 A;  3FTY A;  3UTM A;  1ELW A;  5ENN A;  4G23 A;  1HZ4 A;  3WXX A;  3V31 A;  4Q69 A;  2J4D A;  3TWX A;  2FI7 A;  3IHV A;  4I9C A;  4EZJ A;  3AS5 A;  1Y6I A;  3BUA A;  2WXN A;  3I4R B;  3MKQ A;  4J7W A;  3SFY A;  1Y8M A;  2H6I A;  2ETB A;  2XEV A;  4N2Q A;  3DSW A;  1N4P A;  4AP2 A;  4UQX A;  2F37 A;  3QDN A;  4A3V A;  1V55 E;  4JEH A;  4XI9 A;  3LCA A;  3ZVV A;  3RRU A;  3EIJ A;  3VTX A;  3FU3 A;  5LCW C;  3RO2 A;  5G2N A;  3CHM A;  5AYW D;  1YCS B;  4G25 A;  2ETA A;  3JUE A;  5HS0 A;  3FY4 A;  5CED B;  3UMV A;  3FUF A;  1HE8 A;  5G05 J;  4BY6 A;  4XE0 A;  2PNN A;  1O1S A;  2XPZ A;  3FUE A;  2DZN A;  2Y0B G;  2WQH A;  2C0L A;  3IHY A;  1WDY A;  2Y4U A;  5BV0 A;  4ZHB A;  2KCV A;  3TJP A;  1TNY A;  4J8S A;  1NA0 A;  3MA5 A;  1NI1 A;  4DX6 D;  3FUD A;  3LY9 A;  4JZY A;  2LO6 A;  4IYP A;  1TNZ A;  2VYI A;  4IN3 B;  1EF1 C;  3G2U A;  3MV3 B;  3DXM G;  3APD A;  1Q2Z A;  3E34 A;  2YIN A;  2WXM A;  4WUY A;  2IEJ A;  4KVO A;  5CHE E;  2VSN A;  3HXB A;  4XKC A;  4C48 B;  4RG9 A;  5AQA A;  1SVX A;  2GRM A;  2LSV A;  1BLX B;  3I5P A;  5AN8 A;  4BES A;  4G8L A;  1D8E A;  1LD7 A;  5BXO A;  3TXM A;  4GTO A;  5JMN D;  1PY1 A;  2XGS A;  1RW2 A;  2FF4 A;  2KZT A;  5HI7 A;  3D3M A;  5ENP D;  1ELR A;  2E0I A;  4GTT A;  1KZO A;  2OOE A;  4BX9 A;  1TJC A;  2FO7 A;  2FEZ A;  3ZRH A;  4B89 A;  3D9I A;  3Q9N C;  5A6C A;  4N3B A;  3DEP A;  4NQ0 A;  3CVL A;  4UI9 C;  3B7R L;  2Y4T A;  4A3T A;  2BKK B;  5DBK A;  4L7T A;  5EX3 A;  2VGY A;  4EPZ A;  4ZFH A;  2VTB B;  3S7D A;  3C98 A;  2V8S E;  3B7U X;  2VGX B;  1QQE A;  3CVN A;  4H7X A;  5EDS A;  3LXU X;  4M7C A;  5CCM A;  5HRY A;  2WQ7 A;  4NUR A;  5FWQ A;  4LG6 A;  3ULE G;  5AAR A;  1DC2 A;  3Q73 A;  1X81 A;  3HRA A;  4PDX A;  3FUI A;  4TRQ A;  1FT2 A;  4KVM A;  3B95 A;  4JC8 A;  3KEA A;  2H6H A;  3FU0 A;  5ANL A;  5IY5 E;  3V2O A;  2BF0 X;  2R05 A;  3ASF A;  3CEQ A;  4HOU A;  4U8Y D;  3OXG A;  5JHB A;  3OXL A;  3AG4 E;  3PE4 A;  2I9C A;  3FDH A;  4HBD A;  2WXK A;  2H6F A;  1UW4 B;  1P5Q A;  3SD5 A;  4FC8 A;  3D9K A;  4AOF A;  4UWG A;  3JCK C;  3EDT B;  3U9W A;  3SY2 A;  3Q7F A;  4FLB A;  3X2Q E;  1W3B A;  3FTV A;  2XRY A;  1KPS B;  3GW4 A;  4LER A;  5AJL A;  3CVY A;  4J8Y A;  4HLE A;  1OCZ E;  4YDO A;  4I1M A;  3PDN A;  2KC7 A;  2JLB A;  2OND A;  3N71 A;  1SA5 A;  3SO8 A;  3C3Q A;  4GMR A;  1YMP A;  3D9N A;  1O5M A;  1A17 A;  3DRA A;  2DVW A;  4DLQ A;  4ANV A;  4EHM A;  2P9P G;  5T3R A;  3ISM C;  2DIW A;  2YNQ A;  5FQ4 A;  4QFV A;  3UXG A;  1OWL A;  3PNT B;  5AJD A;  4GCO A;  1FCH A;  4GZC A;  4HVB A;  5HKP A;  2X38 A;  3EUV A;  3RRM B;  1LTX A;  5C1D A;  4AJW A;  3RK6 A;  2RKK A;  3ZW3 A;  4D10 C;  4B8C B;  3UM0 A;  4I2W A;  5AAO A;  1N11 A;  3GYZ A;  4GTQ A;  1TNU A;  3PZ3 A;  1QYM A;  4P29 A;  3Q79 A;  5FTP A;  4N5Q A;  3AS4 A;  3OXF A;  3SI5 A;  1IKN D;  2XCC A;  3C3O A;  2J09 A;  3PRE A;  1D8D A;  2JEK A;  2GRO B;  2IQC A;  3UI2 A;  3CHQ A;  4UWK A;  1EPU A;  1WG0 A;  2WXP A;  4F7A A;  2VGE A;  2IY0 C;  5EYL A;  4O6F A;  1IYG A;  3MKQ B;  3PEV B;  3BG0 B;  4LRZ A;  3SBS A;  3T8M A;  4QQI A;  2XCB A;  3FHE A;  2CFZ A;  2P9S G;  3FU6 A;  3SZ7 A;  2J07 A;  3E33 A;  4B94 A;  1HF8 A;  2CHZ A;  2WQ6 A;  3B13 A;  4B0Z A;  3LDZ A;  3FTW A;  1SQM A;  4K03 A;  3ZIM A;  2IO3 C;  4U8H A;  4JPS A;  4I2Z A;  2AWI A;  3NZS A;  4GTS A;  2HYZ A;  4JA9 A;  1TNB A;  1OCO E;  2I1J A;  4OVU A;  5CCL A;  3Q5M A;  3EU5 A;  2OVF A;  3APF A;  1N0Q A;  3ASN E;  4GZ3 A;  3MGB A;  5B1B E;  3P2B A;  3EHM A;  1WY6 A;  3IEG A;  2J8S D;  3OTN A;  3K9I A;  4WND A;  4C0E A;  3UT8 A;  4WNE A;  3S7F A;  5AEN A;  2J4B A;  1UOH A;  3L54 A;  1QNF A;  3FUL A;  3ML8 A;  3L16 A;  5ARF A;  5KWD A;  3FTZ A;  4EEC A;  5BXU A;  1NA3 A;  4LCT A;  1FT1 A;  3LKU A;  2KZT B;  3CVW A;  3D9O A;  4WNG A;  3W9G A;  4CEM A;  4OAU C;  3PE3 A;  5LFA A;  4DLO A;  3FTS A;  4U0U A;  2P9N G;  3P1U A;  2NSZ A;  3ONK A;  3NAW A;  1VDY A;  4CT4 A;  4E6H A;  2QY7 A;  1U3D A;  4YND A;  3Q49 B;  4Y6C A;  4FHK A;  4EZK A;  4XI0 A;  2XZT G;  2YHC A;  4U04 A;  1UG3 A;  4U07 A;  2WXF A;  4F1S A;  3BG1 B;  5CMY A;  3ZYK A;  2GRR B;  5M72 A;  4HQD A;  5FZR A;  4LNB A;  4GCN A;  2XEE A;  3E37 A;  3HXD A;  3QJZ A;  2LXM A;  2WM9 A;  3NZU A;  4BTB A;  5G55 A;  1H6K A;  3RSE G;  3ZU7 B;  2LUH A;  3QC1 A;  3NQP A;  4L1B A;  1N52 A;  4Q96 A;  2QYU A;  2LAH A;  3AG3 E;  2WXH A;  4MRU A;  4I43 A;  4CT0 A;  1OXJ A;  1H0A A;  4HOQ A;  2KM4 A;  1UJJ A;  4KMO A;  3KS2 A;  4CGV A;  5BUZ A;  5D2M C;  4ANU A;  4WAF A;  3EJN A;  5FJY A;  3FUN A;  4JXT A;  2WXJ A;  2V4H C;  4OYS A;  3RAU A;  4YDY A;  3MYV A;  2AXV A;  2DWZ A;  1NFI E;  4C0M A;  4G8K A;  3NOG D;  3CKB A;  3G2T A;  3PUK A;  3UQ3 A;  4UWL A;  4BEP A;  1JWG A;  1K1A A;  1H2T C;  4HS2 A;  1QZ2 A;  1JUQ A;  3D9J A;  1H6P A;  4EZL A;  5EN5 D;  5FQ6 A;  2XS1 A;  5J90 A;  5FIN A;  4GTR A;  4AIF A;  3CQG B;  5CRV A;  1JCR A;  1L5J A;  1X5B A;  2XQ0 A;  2LNI A;  4RLY A;  3ASH A;  3ASO E;  4BSZ B;  3KEZ A;  4GYW A;  4K5B A;  4A55 A;  2R03 A;  5LOZ A;  4CDN A;  3FU5 A;  2MHK A;  1EYH A;  4RVB A;  2HO1 A;  4I6J A;  5H7P A;  5AIJ A;  1H6O A;  3MEK A;  3ABL E;  4K0R A;  1JCS A;  3CHR A;  4ILG A;  4DX5 D;  3IXE A;  4XKB A;  3DST A;  4FU3 A;  4A1G A;  3ULQ A;  1SA4 A;  4UWH A;  1Z3X A;  4GML A;  3LY7 A;  2QZA A;  3L6A A;  2MYO A;  2IFU A;  2UY1 B;  2J08 A;  3SBT B;  1N9A A;  5KJL A;  3S7J A;  5A7D B;  4O1P A;  3PZ1 A;  3BEE A;  4HFG A;  5D66 A;  1KT1 A;  3U4T A;  2XPI A;  1MJ0 A;  1BD8 A;  3RKV A;  5B3S E;  3B7S A;  2L9B A;  3LVR E;  3RO3 A;  3TAX A;  2RG8 A;  3F6Q A;  4HOS A;  4RSY A;  1XNF A;  2Y1L E;  4BX8 A;  2AJA A;  3FFL A;  4GAA A;  4JD2 G;  4URK A;  1OCR E;  5DIZ A;  3KD7 A;  5BPP A;  1E8Y A;  1AP7 A;  5EX0 A;  4G11 A;  1GW6 A;  2B0O E;  3UIP C;  3ZGQ A;  3Q9U C;  4HNA D;  4BSX A;  3B7B A;  2ZU6 B;  4G1T A;  3D9H A;  3CHS A;  3QWW A;  2BKG A;  2XPY A;  5FZQ A;  2GRP B;  2AXU A;  4TXQ A;  2WXR A;  4G24 A;  3UX4 A;  4CYM D;  1TN8 A;  2PL2 A;  4HRL A;  3TL5 A;  2IF4 A;  2HR2 A;  4CRW A;  1TN6 A;  4JW1 A;  3HVE A;  4EBA A;  3E4B A;  2CG2 A;  2ILR A;  3QWP A;  2M63 A;  4UI9 K;  5ARG A;  2XEH A;  4C9B B;  2WXG A;  4FJZ A;  3AS8 A;  5EIB E;  5JJ7 A;  3JUI A;  5ENR D;  5G04 J;  4HRN A;  5KJK A;  4U0Z A;  1DNP A;  2GW1 A;  3TXN A;  2X3M A;  3PS6 A;  4DPR A;  5BNW A;  3PNL B;  1JWF A;  3ZFW A;  1U2V G;  1PAQ A;  3NBN B;  2NXP A;  3DSS A;  5A23 A;  2QC9 A;  3SGH A;  4AY6 A;  4GB9 A;  1HH8 A;  2GRN B;  5EKQ D;  2EIN E;  1N4S A;  1DCQ A;  2C0M A;  3VLE A;  1MQS A;  1BI8 B;  3HXC A;  3FUH A;  4ANX A;  3Q47 B;  1BPO A;  3ZYM A;  3RU0 A;  5KCM A;  5CMW A;  4AXH A;  2XRZ A;  2ZIS A;  3UT7 A;  3LEW A;  3FH5 A;  5ANR A;  3HIZ A;  5E76 A;  3UKR G;  3ZEF A;  3Q4A B;  3DPY A;  3V30 A;  3R7Q A;  3ZHE A;  1OUV A;  1Z6T A;  4HI8 A;  4I6G A;  2L0I A;  3RJV A;  1FVF A;  4GZ6 A;  4ABN A;  1MX4 A;  3PEU B;  1INZ A;  3L13 A;  1OY3 D;  2E2E A;  2DYR E;  2ZGD A;  1B89 A;  4WWO A;  2DZO A;  2R59 A;  5CBN A;  4BER A;  3CV0 A;  3CVV A;  5B1A E;  4N3C A;  4LUN U;  3IV0 A;  4XZ4 A;  3EIQ C;  4YDE A;  2VSX E;  3FUK A;  2VJ8 A;  2QFC A;  3UKU G;  2OEW A;  4MS6 A;  4GTP A;  3MZL B;  1KT0 A;  1U3C A;  3L17 A;  3TWU A;  3V79 K;  4OAV B;  3B7T A;  3DSU A;  1JCQ A;  3ESL A;  3W9F A;  3ZYL A;  3GZ2 A;  3CKC A;  3CVU A;  4L2Y A;  3WG7 E;  1PC2 A;  3AG1 E;  3UUX A;  3L22 A;  3BQO A;  2VTB A;  2RD0 A;  2B6C A;  5AQB A;  2OEV A;  3LJ3 A;  2I6H A;  3C3R A;  5E75 A;  4IUL A;  3CK8 A;  3IKO B;  4MLP A;  4JVS A;  1N4R A;  4IRU A;  3UPV A;  4DI3 A;  1H19 A;  4TV3 A;  5FQ7 A;  3HG0 D;  3AG2 E;  2C2L A;  4CDR A;  3ASG A;  2HM8 A;  4Q94 A;  1BU9 A;  3ZXP A;  3TWV A;  3E30 A;  4FUL A;  2OCC E;  1TJF A;  3ASD A;  3IBE A;  3Q78 A;  4PS3 A;  4U96 D;  5ITZ F;  2FUL A;  5FT9 A;  4BWR A;  5BW8 C;  3KSL A;  4DRX E;  1UN9 A;  2V5F A;  2L6J A;  2NC9 A;  2WXQ A;  4G2V A;  3KAE A;  2P9U G;  4O60 A;  3G2W A;  1E7V A;  5BV1 A;  3J5Q B;  2XGM A;  2P9I G;  4NAC A;  5EIL A;  1HFA A;  3PUJ A;  3ZN3 A;  4E85 A;  1N4Q A;  2XGO A;  1EDU A;  4KZC A;  3EHR A;  3OAW A;  4FA6 A;  3GZ1 A;  3DBS A;  3PZ4 A;  4APO A;  4PH4 B;  3DXK G;  3O48 A;  3URZ A;  3AJI A;  4UWF A;  4GA1 A;  3CLJ A;  3VTY A;  3T5V A;  4O1O A;  4NRH B;  1OT8 A;  2F8Y A;  3UIN C;  4G26 A;  3PZD A;  1E7U A;  2A5E A;  4GYO A;  3ULY A;  4BFR A;  2AXZ A;  2KXP C;  3U64 A;  3TWS A;  1H2U A;  5FQ8 A;  3Q15 A;  4XEI G;  5JJ6 A;  5EID A;  1RZ4 A;  4GA2 A;  4U0S A;  4PUC A;  4B93 B;  3EHQ A;  4BT8 A;  3NOC D;  4K5C A;  3SNX A;  3ESK A;  2L0T B;  3T5X A;  3HDX A;  3ABK E;  1S0P A;  2LXL A;  3T9K A;  4RG6 A;  5CRU A;  4DUI A;  1Z3Y A;  4UQZ A;  1HXI A;  3HXF A;  4AEZ C;  4U8V D;  5LCW J;  2WXL A;  2NYJ A;  3FP3 A;  4AY5 A;  4TXP A;  1DCE A;  5AQ7 A;  2WVI A;  3G2V A;  3C5R A;  3JYS A;  2F0Y A;  3CK7 A;  3HVE B;  3QAQ A;  3DSX A;  2P58 C;  1IQR A;  4AM9 A;  3TWR A;  2IO2 C;  4PS7 A;  2AVP A;  1WAO 1;  5ENS D;  4KXK B;  1HG5 A;  1QBQ A;  4J8E A;  3ABM E;  4TXR A;  4JHK A;  4Z68 A;  2XEN A;  2WMN A;  3V2X A;  5D0Q D;  2UWJ G;  5LX8 A;  4HI9 A;  3U66 A;  3D9L A;  3AU4 A;  4U95 D;  2LAI A;  3MCX A;  2DBA A;  3FH8 A;  4A1S A;  3QOU A;  3TG5 A;  1N95 A;  4J0U A;  3ENE A;  5G05 C;  4PS8 A;  4FHJ A;  2WXI A;  2CHW A;  1OWM A;  1IHG A;  4I1A A;  3FUM A;  2KBX A;  3O4Z A;  3ZNG A;  1TYQ G;  2WXO A;  4HLL A;  1N0R A;  4ATG A;  3SF4 A;  2KAT A;  3VLF A;  3ZHE B;  4HB5 A;  4R7L A;  4GYY A;  5FIO A;  4I1O B;  4U7E B;  4UI9 J;  4FP7 A;  4WNF A;  3DSV A;  1E8W A;  3QAR A;  4TUM A;  2YQ8 A;  1OWN A;  3DEO A;  1NP7 A;  4F1P A;  2Y69 E;  3FEY A;  1V54 E;  3UIO C;  3SFZ A;  2VQ2 A;  2P9L G;  5CEA A;  1N54 A;  2ION A;  3CHO A;  4GZD A;  5HQ8 A;  2V0P A;  3PRZ A;  3CK9 A;  1HU3 A;  2IJG X;  3JXJ A;  2A4Z A;  4ACL A;  1OWP A;  1FPP A;  2JAB A;  3C72 A;  1HX8 A;  4BET A;  4EBA G;  5CBO A;  4JHJ A;  3EHN A;  2F8X K;  1SZA A;  5JA4 D;  1Z5S C;  2KCL A;  3ZUV B;  2OVB A;  1ZB1 A;  1TNO A;  1E8X A;  4FJY A;  2Q7F A;  3SHF A;  1YA0 A;  3FWV A;  1S63 A;  2PM6 A;  3NF1 A;  3PVL A;  2X6F A;  3LY8 A;  1XGW A;  1JPL A;  1IXV A;  2BED A;  5D0O D;  4U63 A;  5JJT A;  3AAA C;  1HO8 A;  4KZ0 A;  2KCK A;  2PQR A;  3DWL G;  4YDW A;  5BT1 A;  3QNK A;  3Q75 A;  4APF A;  4EQF A;  4AV7 A;  2WMO A;  3T8K A;  2XS8 A;  5T8I A;  5KBA A;  3I4G A;  2CHX A;  3FEX A;  2L6B A;  2X6I A;  3CVQ A;  4GTM A;  1BI7 B;  4XX5 A;  3S7B A;  4OVV A;  2X6H A;  4K5A B;  4ATZ D;  2R02 A;  3I3N A;  5JHA A;  1OWO A;  1ELK A;  1IHB A;  3EU9 A;  4BTA A;  4JL0 A;  4ME2 A;  2R5S A;  4CCA A;  4RQI A;  3TWT A;  1AWC B;  5KJM A;  1D9S A;  3G2S A;  1HS6 A;  3AU5 A;  1LD8 A;  2IOS A;  2XHE A;  2EIM E;  3APC A;  3CVP A;  2RFA A;  4I6E A;  1N94 A;  4XIF A;  1G3N B;  3QKY A;  3QWV A;  1MX2 A;  2CG3 A;  3PZ2 A;  4GTV A;  5KNG A;  1NL4 A;  4DX7 D;  5G04 C;  2RFM A;  4CZ2 D;  3HYM B;  3RIB A;  2ETC A;  2J49 A;  2Y3A A;  1K1B A;  4DX2 A;  1HG2 A;  3MKR A;  1H2V C;  2GRQ B;  4LNU D;  2X6J A;  2H6G A;  2R2L A;  4DJA A;  4UUC A;  2EQX A;  4ACK A;  1E96 B;  5ENO D;  4BT9 A;  2BUG A;  2MOW A;  2P2C P;  3D9M A;  3R9A B;  4FLH A;  1OCC E;  1MHQ A;  3CHP A;  4HXI A;  3UM1 A;  2ZXW E;  1YYH A;  4FAD A;  1LF8 A;  2WB2 A;  4HOT A;  2DCP A;  3DPD A;  4TUU A;  3CSF A;  3S2A A;  4CDM A;  4KT6 B;  1K8K G;  3RRN B;  2I2O A;  3R7R A;  5CEC B;  5AQ9 A;  3TWW A;  2PQN A;  4F6R D;  4M3O A;  3UM3 A;  3FUJ A;  3UT4 A;  2HE0 A;  4N5C A;  2UY1 A;  2YHE A;  3FTU A;  2J9Q A;  4HOR A;  3L9T A;  1DVP A;  4B8A A;  2R17 C;  4KYO B;  3TWQ A;  5T4Y A;  2P9K G;  3LJN A;  4GA0 A;  1MZC A;  4WWN A;  4J8D A;  4KBQ A;  2AW6 A;  5KNH D;  4GPK A;  4W9R A;  1E8Z A;  5KJN A;  4DX1 A;  3CQC B;  3L08 A;  4H7Y A;  2IU1 A;  2VGX A;  3CST A;  3LS8 A;  5FZS A;  3ZXS A;  3ML9 A;  5C2Y A;  3U3W A;  2BTD A;  3ZKJ A;  3MJW A;  3R9M A;  1MYO A;  3QB2 A;  3CVX A;  4WWP A;  3LVQ E;  4N3A A;  2EIK E;  2ZGG A;  1KLX A;  4ANW A;  1WM5 A;  3E32 A;  4CGW A;  5LP0 A;  1O1T A;  4V3I A;  4F3V A;  2VSY A;  2QYJ A;  3HXE A;  3TGO A;  3MV2 B;  5CER B;  4GPM A;  4L2L A;  3LYA A;  1S70 B;  1O1R A;  1TEZ A;  4N2S A;  2EIJ E;  1E90 A;  3CGH A;  1TN7 A;  4N39 A;  1UJK A;  4ILI A;  5ENQ D;  1TR4 A;  4GMJ A;  2VSO E;  4DK5 A;  3SFX A;  3QK0 A;  4UQY A;  4X8Q A;  2V4L A;  4F53 A;  2GGF A;  2FO1 E;  3CIA A;  2LSU A;  1SZ9 A;  4MBG A;  3L82 A;  2GRL A;  4ILH B;  5J08 A;  2IOL A;  2V5Q C;  2CFU A;  3KSQ A;  2PZI A;  3FTX A;  2MRI A;  2OV8 A;  2X6K A;  3NB2 A;  4J6I A;  1S64 A;  3FH7 A;  4YVO A;  2WPV A;  3CR3 A;  3BU8 A;  4YVQ C;  4LNG A;  3MX3 A;  4HRM B;  1ZU2 A;  3D9P A;  3J5P A;  1K3Z D;  3ONL A;  4JEU A;  3JQ0 A;  2ZIR A;  2DYS E;  3Q7A A;  3ZPJ A;  1MX6 A;  1NZN A;  3JQ1 A;  4DI4 A;  1KZP A;  4NIK A;  3SQV A;  1ZBP A; 
#chains in the Genus database with same CATH homology
 5B1A E;  1OCO E;  5IY5 E;  2OCC E;  2Y69 E;  1OCR E;  3ABM E;  1OCC E;  3ASN E;  2EIL E;  1V54 E;  3X2Q E;  2DYS E;  3ABL E;  3AG4 E;  5B3S E;  2EIM E;  2DYR E;  2EIJ E;  2EIN E;  2ZXW E;  1V55 E;  5B1B E;  3WG7 E;  2EIK E;  3ABK E;  3ASO E;  3AG1 E;  1OCZ E;  3AG2 E;  3AG3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...