3ABKE

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 45
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abkE00
2EIJE 1V54E 2DYRE 3X2QE 3ASOE 3AG2E 5B3SE 2EILE 3ABLE 1OCZE 1OCRE 3WG7E 5B1BE 1V55E 1OCCE 2DYSE 1OCOE 3ASNE 2EINE 2Y69E 3AG1E 3ABME 2OCCE 2ZXWE 2EIME 5IY5E 2EIKE 3ABKE 3AG4E 3AG3E 5B1AE
chains in the Genus database with same CATH superfamily
1HZ4A 3SY2A 3CVQA 3SD5A 2H6FA 3GZSA 4X8QA 3L08A 2KXPC 4RG6A 3ZYKA 5CEAA 3TGOA 2X6KA 3OXLA 5G04C 3CV0A 3MV3B 2MYOA 3FU0A 3IHVA 3Q15A 4I9CA 4YVOA 3UT4A 4GA2A 2I1JA 5FZSA 2XCCA 3DRAA 4JXTA 4GYWA 3ZPJA 1NP7A 2ETAA 1JCQA 3HRAA 3JQ0A 1NA0A 1RW2A 3UKUG 3ZNGA 5BW8C 4C0EA 1E7UA 2LAIA 3L82A 2V0PA 3NOCD 2HM8A 1TNZA 4B8AA 4TUMA 4AEZC 4E85A 3W9FA 1Q2ZA 3DPDA 2J9QA 4GTQA 1SA5A 3BUAA 1ZB1A 2IEJA 1HG2A 1HF8A 5HRYA 2GRLA 3FP3A 2PM6A 3WXXA 2XGMA 4KZCA 1NI1A 3SFZA 4LUNU 1MX6A 2WXOA 4L2LA 5BNWA 1QYMA 3FUEA 4LNGA 3VLDA 2VJ8A 3HDXA 4BY6A 4HVBA 2GRPB 3LKUA 4P29A 3ZFWA 2PQRA 1INZA 4GZ6A 4FLHA 3U3WA 4WNEA 2P9NG 3EHRA 3RKVA 4V3IA 1HXIA 3FTVA 3O4ZA 4YVQC 2WB2A 5A23A 1HG5A 5G55A 4LCTA 5D0QD 3QNKA 5BV1A 4U0SA 3S7JA 2EILE 4G8LA 2YNQA 2B6CA 4TXPA 1LD8A 3PZ1A 3MGBA 2P9SG 2J8SD 3LY7A 1EPUA 3JUEA 2L9BA 3CVLA 1BD8A 3TXNA 4UWLA 4BFRA 4BT9A 3KD7A 4L23A 2OCCE 4A63B 4ACLA 1OWNA 2XCBA 4EPZA 2BKGA 2HE0A 3TL5A 1H0AA 3QDNA 1SW6A 2QYUA 3HXBA 1TEZA 1A5EA 3B7TA 4CDMA 4PS3A 2I6HA 3L16A 5FTPA 1EF1C 4L9PA 5JJ7A 3UPVA 4I2WA 3ONKA 2XGOA 4KT6B 5EN5D 2IJGX 4K03A 3CVUA 1TJFA 5G04J 1UN9A 3ZKJA 3HVEB 1UOHA 4U8HA 3PZ4A 3BG1B 4ANXA 2XS8A 4YNDA 4J8DA 2BUGA 3Q9UC 4JL0A 5JJTA 2OOEA 4GMRA 3PEVB 4KYOB 3EU5A 1N4QA 5G2NA 1N9AA 3Q49B 2WXJA 4A3TA 3AAAC 2DVWA 2WM9A 4PS7A 5EYPF 5FQ4A 2PL2A 2XQ0A 4UI9K 3ABLE 2KATA 2WXFA 4WNDA 4GZ3A 4EZKA 3IHYA 3FUIA 3RO2A 1FVHA 2V8SE 2RG8A 2XHEA 4UUCA 5ENSD 3OXGA 2NXPA 2VSOE 5AARA 3D3MA 3FH5A 3E32A 2C2LA 3FH8A 3ONLA 2HYZA 4ILGA 4NQ0A 2JEKA 2X6FA 2OVFA 4LNBA 1IQRA 1DC2A 5G05J 3U64A 5A6CA 5LFAA 4ATGA 4F1SA 4APFA 3EU9A 4FC8A 5FJYA 1S70B 3JYSA 2V4HC 2WXHA 2VGYA 3UI2A 4N5QA 1VDYA 5CRUA 4RVBA 3UMVA 3NB2A 4I1OB 3CGHA 1YA0A 3IEGA 2H6HA 4IRUA 1FT1A 5KJNA 2RD0A 4HNAD 1TNOA 3V31A 5A7DB 3SQVA 3LY8A 4FHKA 3AG4E 2HO1A 4GYYA 3TG5A 3FWVA 5ENTD 3L22A 4U7EB 5KWDA 2MHKA 3ML9A 3QAQA 2ILRA 3LJNA 4EBAA 3VTYA 3MKRA 2XRYA 1N52A 3LY9A 4WWNA 5E75A 3OXFA 4CGWA 3CQCB 2IONA 4A55A 4HI8A 2BTDA 4B94A 5ARFA 4O1OA 3AS8A 5EX3A 3RK6A 4N2SA 2L6JA 2EINE 2VGEA 3UM0A 1IXVA 2Q7FA 3QWWA 3R9MA 3G2TA 3PH0C 4ILIA 2KC7A 5BUZA 1QZ2A 3T5VA 5EIBE 3OTNA 3SFXA 4DX2A 3I4RB 4YDWA 5HS0A 5ENRD 5CMWA 1JWFA 4AXHA 2CFZA 4W9RA 5CCMA 2OEVA 1OCRE 5AQAA 3KEAA 2WXRA 1UJJA 3L54A 2A5UA 1Y8MA 2LSUA 4UI9J 4BSXA 3V2XA 3FTUA 3UKRG 3PZ3A 5KNHD 2P9LG 2NSZA 5D66A 3ZXSA 5AN8A 2X6IA 4ANVA 2FBNA 2HR2A 3LPZA 3QWPA 4J0UA 3D9NA 1S63A 2AW6A 5C2YA 5JHBA 4CZ2D 4YDOA 4ME2A 4DLQA 5AQ9A 3D9KA 4GMLA 4F7AA 2WXNA 4C9BB 4U63A 3B7UX 3ASOE 2X6HA 3C3QA 5CMYA 3L9TA 3QK0A 2F8XK 2QC9A 2DCPA 1TNYA 3RU0A 3KEZA 3G2WA 3FHEA 3TG4A 2CHXA 2QYJA 4HORA 2WPVA 2WQHA 3UTMA 1KLXA 2BEDA 2CHZA 3NF1A 3DPYA 3EHQA 3R7RA 5JHAA 4HOQA 3KS2A 4U07A 4Q96A 1ZBPA 4CYMD 1L5JA 3ML8A 3CHMA 4U95D 3HXFA 2DIWA 1TNUA 2H6IA 3O48A 2QFCA 3D9HA 2P9KG 3D9JA 1TNBA 3NAWA 2GW1A 2Y4UA 4JC8A 2LUHA 4HI9A 4HFGA 4J7WA 1FCHA 2I2OA 1MX4A 4GTRA 3EHMA 4A1GA 2WXIA 3ULEG 2CFUA 4F1PA 3D9OA 3BEEA 4I9EA 4AV7A 4MKTA 3UQ3A 2IOLA 3CHQA 4HB5A 2NC9A 3EIJA 4DRXE 1O1SA 1OWOA 1SA4A 1MJ0A 4GTMA 3G2UA 1V55E 4FU3A 5CERB 3T8KA 3ASNE 3Q79A 3DSTA 4UWKA 3KSLA 2XPIA 3ABME 2EIME 1N95A 4DUIA 2ETBA 3HXDA 3ZW3A 3FUNA 4A3VA 4MBGA 4Q69A 4N3BA 1JUQA 5HKPA 4TUUA 3ZEFA 3FU3A 4I6GA 2LXLA 4DX5D 2DWZA 4BTBA 4BTAA 4PS8A 1O1TA 2IQCA 3QWVA 4L1BA 4FJYA 2KCLA 3DEPA 4DI4A 3SHFA 4B89A 4N3AA 1PY1A 4I6JA 4ACKA 4TXRA 4GZCA 4FHJA 4BX9A 2J07A 1HFAA 3UT7A 3DSSA 3ULQA 3SBTB 2X38A 4HBDA 1ELKA 4JD2G 2M63A 4I43A 4LNUD 5ITZF 4QFVA 5IY5E 3E33A 1H2TC 4GZDA 3FDHA 4C48B 5AIJA 1X81A 4JZYA 1ELRA 3FUMA 5G05C 4ANUA 1N4SA 3TWXA 3NQPA 5AQBA 3PNLB 4H7XA 2BKKB 3CK7A 4XKCA 3T9KA 3SNXA 4I6EA 2ZGGA 3X2QE 3Q9NC 3AG2E 4GTTA 1Z5SC 4XEIG 2XENA 2XPYA 5EIDA 4GZ5A 4G1TA 4L2YA 1SVXA 2UWJG 3D9PA 3QARA 2WQ6A 4EBAG 2AXVA 3HIZA 2UY1B 3ASHA 4DPRA 3RJVA 3AS4A 4XI0A 2FO7A 2J4BA 4UWFA 3DXKG 2PQNA 2KBXA 1QQEA 4U0ZA 3ESLA 1OWLA 2P9UG 1N11A 3Q47B 3APFA 1MZCA 3E34A 4IULA 3RRNB 3I4GA 1TR4A 4FULA 3ZGQA 2XZDG 4E6HA 1SZAA 4RQIA 4BESA 4B8CB 2VSXE 2QZAA 4EHMA 5ENOD 4AJWA 3B7RL 3ESKA 4AVXA 3QOUA 4EZJA 5EX0A 5BV0A 3B7BA 4ZFHA 3B13A 3Q7AA 2PNNA 3DSUA 4G8KA 4C0MA 5JMND 2LNIA 4LEUA 1KZPA 4B0ZA 4GPKA 3KAEA 1MHQA 1EDUA 5LP0A 1SZ9A 3CLJA 3FTSA 4HRNA 4EQFA 4RG9A 4LG6A 1HO8A 3UUXA 2J09A 2H6GA 3DXMG 1OCCE 2XS1A 4JEUA 4QQIA 5EILA 4R7LA 4UQXA 2Y3AA 3HG0D 4LERA 5HI7A 4FA6A 4GB9A 2JLBA 3AU4A 4WAFA 2R17C 3RIBA 5JJ6A 4N2QA 2AXUA 3QKYA 2LSVA 1TN6A 3ISMC 1NA3A 2WXQA 3MZLB 4OVVA 2NYJA 3URZA 4XIFA 1N94A 1UJKA 1UN8A 1TN7A 4UWGA 2E0IA 4OYSA 3ZIMA 5KCMA 3ZYLA 3KSQA 2LO6A 2MRIA 1IHBA 3Q75A 2P9PG 2ZU6B 2DZNA 3ASGA 5CRVA 1E8YA 2JABA 1Z3XA 1B89A 3FUHA 1O1RA 4HOUA 1BLXB 4RLYA 4KVMA 1DCQA 2IY0C 1E96B 4N5CA 2R02A 3MX3A 2J08A 1O5MA 5KJLA 4TV3A 3WG7E 4MS6A 4AOFA 3UM3A 2XPZA 4O60A 3PVLA 4HLLA 2A5EA 4NRHB 3DEOA 3CKBA 4WNFA 2RFMA 2WVIA 1KT1A 2IU1A 5B3SE 1BPOA 3CQGB 3FUKA 2GRNB 4G11A 3K9IA 4CEMA 2L6BA 4XKBA 3SF4A 3UX4A 3TWQA 4DX7D 4K5AB 3DSWA 5J08A 4KBQA 3ZXPA 4RSYA 4EECA 2R59A 2XZTG 5EDSA 5KJKA 3IXEA 3UIPC 1NFIE 1Z3YA 4KVOA 2XGSA 4GYOA 3ZUVB 5C1DA 1Y6IA 2WXPA 3HXCA 1N4PA 4K0RA 2L0TB 4CDRA 3CVPA 3ZYMA 2EIJE 4ANWA 5FT9A 4HOTA 3TWWA 4GTOA 3S7DA 4JB8P 4M7CA 4MLPA 1W3BA 2IF4A 2P58C 3RRMB 2X3MA 2LAHA 4KMOA 1H19A 3LYAA 3Q7FA 1DCEA 3S2AA 2PM7A 5BXUA 4YDEA 3FU5A 2J49A 4WUYA 2R03A 5FWQA 2WXMA 2XEVA 3J5PA 4LSZE 1OXJA 3GYZA 4GTPA 2KCVA 3GW4A 5CBNA 1RZ4A 3J5QB 1U3DA 5EKQD 1IYGA 2VQ2A 2WMOA 2AXZA 2F8YA 3S7BA 3SBSA 2WXLA 3CHPA 2CHWA 5T4YA 3ZRHA 5FZRA 1MQSA 4NACA 1N0QA 4DX1A 2IO3C 5ENPD 2FULA 3VTXA 2DYSE 5E76A 4IYPA 3DSVA 4TRQA 2ONDA 5ENQD 2R5SA 5M72A 1LTXA 4G24A 2CG2A 4PDXA 5EYLA 3FFLA 4G23A 4KXKB 1TN8A 2UY1A 4U04A 4GTVA 5DIZA 4I17A 2CG3A 3MKQB 2VTBB 5FIOA 3FULA 5FINA 3PUJA 2AWIA 1IKND 2B0OE 3ENEA 5KNGA 3QB2A 4G26A 2VYIA 1WDYA 4J8FA 2AVPA 2Y4TA 3S7FA 2GROB 2QY7A 2GGFA 3GZ2A 2V4LA 3SGHA 4N3CA 3ZHEB 2WMNA 4J8EA 3PNTB 3G2VA 3R7QA 5CBOA 5T3RA 4G2VA 3L6AA 1ZU2A 3UINC 2BF0X 4GU5A 3V30A 4UWHA 1HX8A 3PUKA 2P2CP 5D0OD 4BEPA 1JCRA 3ZYQA 2L0IA 5JA4D 3RRUA 4HS2A 1DNPA 1G3NB 2OV8A 4J6IA 1QBQA 5ARGA 4PUCA 3PEUB 4Y6CA 1JWGA 4BT8A 3MEKA 3ABKE 3D9MA 1WY6A 3JUIA 2ZISA 2F0YA 2DZOA 3U9WA 3RO3A 4N39A 5DBKA 1KPSB 2X6JA 4FLBA 5AAOA 3L17A 4AM9A 4CCAA 4J8SA 2VGXB 3R9AB 3VLEA 3E4BA 2P9IG 2V5QC 1OCZE 3P2BA 3SI5A 3APCA 1UW4B 4GMJA 4GCOA 3QC1A 1LF8A 3T5XA 2J4DA 5LCWJ 3EUVA 4DJAA 3ZVVA 3AJIA 3JQ1A 3CKCA 4F6RD 5CEDB 3U66A 3EHNA 3TWUA 2Y69E 1D9SA 1BI8B 4BSZB 1PC2A 4DLOA 3GZ1A 3TAXA 3HVEA 4TXQA 2WXKA 1NZNA 4AIFA 4U8VD 3JXJA 3UM2A 4JEHA 4HRMB 2VSNA 1ELWA 2MOWA 2GRQB 4WWPA 3HXEA 4BETA 1BI7B 3CVYA 3FTWA 4APOA 2A4ZA 4AY5A 3G2SA 4JA9A 4IN3B 2KM4A 3TXMA 4CT4A 2OEWA 3CEQA 1IQUA 4U8YD 2RKKA 5D2MC 1A17A 4F3VA 5FQ7A 3ASDA 3QJZA 3CVVA 1PAQA 2I1KA 3V2OA 3DSXA 5B1AE 5FQ8A 1P5QA 3UXGA 2WXGA 5FZQA 1XNFA 4WWOA 3CSFA 3FUJA 2WQ7A 4HXIA 3T8MA 5B1BE 4FADA 1E7VA 1N0RA 4NURA 3MKQA 3DWLG 3CHRA 4GA1A 4KZ0A 3NZSA 1DVPA 1E90A 3FUDA 3CK9A 2YQ8A 3JXIA 5BT1A 4Z68A 1BU9A 3RAUA 5LCWC 1FPPA 4XZ4A 3FEYA 2GRMA 4DX6D 1FT2A 1KT0A 1TJCA 3LDZA 4L7TA 5BPPA 1S0PA 2KZTA 1MYOA 3Q73A 1MX2A 2GRRB 4YDYA 3FTXA 3PZ2A 1QNFA 4HOSA 3F6QA 3UIOC 4B93B 2I9CA 4K5BA 1HU3A 4BWRA 4XX5A 1AP7A 1H2UA 3TWRA 3BU8A 4U0UA 1OY3D 5ANRA 1U3CA 3MV2B 5AQ7A 3Q78A 1X5BA 4CDNA 1OWPA 4K5CA 3MCXA 1WM5A 2FF4A 4D10C 2EIKE 2VTBA 4JHKA 4U96D 1YMPA 2IOSA 3CIAA 3VLFA 1V54E 3SFYA 3ZU7B 4URKA 1UG3A 4AY6A 2KCKA 1HE8A 4BERA 5T8IA 3EJNA 3PREA 3BG0B 4ILHB 2RFAA 1YYHA 1SQMA 2EQXA 5ENNA 4HLEA 3LS8A 2ZIRA 1E8ZA 4OAVB 2VSYA 4Q94A 3JCKC 3PS6A 3TWTA 4UI9C 3ULYA 4GA0A 5HQ8A 1D8DA 3L13A 3I3NA 3BQOA 2R05A 3C72A 3PE4A 3B95A 4NIKA 4UQZA 1WG0A 3HHMA 1EYHA 4HQDA 3OAWA 1K3ZD 1D8EA 3TWVA 5BXOA 4CT0A 5ANLA 3AG3E 4JHJA 3P1UA 3FUFA 1N54A 3LEWA 1E8WA 4I2ZA 1IHGA 2XEEA 4OVUA 3N71A 1NL4A 5CECB 3FTYA 3CVNA 2ETCA 4DI3A 3EIQC 2C0MA 3E37A 2DYRE 5AJDA 4ABNA 1N4RA 3C98A 1E8XA 2IFUA 4HRLA 3EDTB 1TYQG 1K1BA 3V79K 1JPLA 2YHEA 3CVXA 4FP7A 3U4TA 1H6PA 2AJAA 3CK8A 5AENA 3ZHEA 3AS5A 4LRZA 3D9LA 4XE0A 3C3RA 1KZOA 4JHRA 1HS6A 2KZTB 3B7SA 3FY4A 4OAUC 3ZN3A 2ZXWE 3SZ7A 3LVRE 1H2VC 3TJPA 4G25A 4I1MA 5AYWD 5KJMA 1OUVA 4M3OA 3HYMB 4CRWA 4I1AA 4BX8A 4JVSA 3LCAA 3LVQE 1LD7A 4JA7A 1YCSB 3CVWA 4GAAA 3IV0A 2C0LA 3IKOB 3PDNA 2YINA 3FH7A 2XEHA 1JCSA 1AWCB 5CCLA 4GCNA 3W9GA 1H6OA 3AG1E 3CSTA 3NOGD 4O6FA 4XI9A 5CHEE 2E2EA 2YHCA 5KBAA 5AJLA 4ATZD 5FQ6A 4A1SA 3CHOA 4AP2A 4F53A 2Y1LE 3AU5A 3SO8A 3Q4AB 5LX8A 5H7PA 5LOZA 1FVFA 2IO2C 1K1AA 4GPMA 2VGXA 2DBAA 3PE3A 4JPSA 4UQYA 3FEXA 2F37A 1GW6A 3C3OA 4ZHBA 4FJZA 4J8YA 3MJWA 3PRZA 3TWSA 3I5PA 3LXUX 3DBSA 3UT8A 4JW1A 1OT8A 1XGWA 1HH8A 3RSEG 1U2VG 2R2LA 3UM1A 3PZDA 3MA5A 4PH4B 2OVBA 4CGVA 3IBEA 2V5FA 3NZUA 4O1PA 1OCOE 1K8KG 2FI7A 4DK5A 1Z6TA 1WAO1 4H7YA 4GTSA 4MRUA 5J90A 3NBNB 4EZLA 3APDA 2Y0BG 3Q5MA 2PZIA 3ASFA 3LJ3A 3FTZA 3CR3A 3E30A 4Y6WA 2XRZA 2ZGDA 2FO1E 1H6KA 3MYVA 3FU6A 2FEZA 1OWMA 3C5RA 3CHSA 1S64A 2LXMA 3D9IA 4WNGA
chains in the Genus database with same CATH topology
2EIJE 1V54E 2DYRE 3X2QE 3ASOE 3AG2E 5B3SE 2EILE 3ABLE 1OCZE 1OCRE 3WG7E 5B1BE 1V55E 1OCCE 2DYSE 1OCOE 3ASNE 2EINE 2Y69E 3AG1E 3ABME 2OCCE 2ZXWE 2EIME 5IY5E 2EIKE 3ABKE 3AG4E 3AG3E 5B1AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIJ E;  1V54 E;  2DYR E;  3X2Q E;  3ASO E;  3AG2 E;  5B3S E;  2EIL E;  3ABL E;  1OCZ E;  1OCR E;  3WG7 E;  5B1B E;  1V55 E;  1OCC E;  2DYS E;  1OCO E;  3ASN E;  2EIN E;  2Y69 E;  3AG1 E;  3ABM E;  2OCC E;  2ZXW E;  2EIM E;  5IY5 E;  2EIK E;  3ABK E;  3AG4 E;  3AG3 E;  5B1A E; 
#chains in the Genus database with same CATH topology
 1HZ4 A;  3SY2 A;  3CVQ A;  3SD5 A;  2H6F A;  3GZS A;  4X8Q A;  3L08 A;  2KXP C;  4RG6 A;  3ZYK A;  5CEA A;  3TGO A;  2X6K A;  3OXL A;  5G04 C;  3CV0 A;  3MV3 B;  2MYO A;  3FU0 A;  3IHV A;  3Q15 A;  4I9C A;  4YVO A;  3UT4 A;  4GA2 A;  2I1J A;  5FZS A;  2XCC A;  3DRA A;  4JXT A;  4GYW A;  3ZPJ A;  1NP7 A;  2ETA A;  1JCQ A;  3HRA A;  3JQ0 A;  1NA0 A;  1RW2 A;  3UKU G;  3ZNG A;  5BW8 C;  4C0E A;  1E7U A;  2LAI A;  3L82 A;  2V0P A;  3NOC D;  2HM8 A;  1TNZ A;  4B8A A;  4TUM A;  4AEZ C;  4E85 A;  3W9F A;  1Q2Z A;  3DPD A;  2J9Q A;  4GTQ A;  1SA5 A;  3BUA A;  1ZB1 A;  2IEJ A;  1HG2 A;  1HF8 A;  5HRY A;  2GRL A;  3FP3 A;  2PM6 A;  3WXX A;  2XGM A;  4KZC A;  1NI1 A;  3SFZ A;  4LUN U;  1MX6 A;  2WXO A;  4L2L A;  5BNW A;  1QYM A;  3FUE A;  4LNG A;  3VLD A;  2VJ8 A;  3HDX A;  4BY6 A;  4HVB A;  2GRP B;  3LKU A;  4P29 A;  3ZFW A;  2PQR A;  1INZ A;  4GZ6 A;  4FLH A;  3U3W A;  4WNE A;  2P9N G;  3EHR A;  3RKV A;  4V3I A;  1HXI A;  3FTV A;  3O4Z A;  4YVQ C;  2WB2 A;  5A23 A;  1HG5 A;  5G55 A;  4LCT A;  5D0Q D;  3QNK A;  5BV1 A;  4U0S A;  3S7J A;  2EIL E;  4G8L A;  2YNQ A;  2B6C A;  4TXP A;  1LD8 A;  3PZ1 A;  3MGB A;  2P9S G;  2J8S D;  3LY7 A;  1EPU A;  3JUE A;  2L9B A;  3CVL A;  1BD8 A;  3TXN A;  4UWL A;  4BFR A;  4BT9 A;  3KD7 A;  4L23 A;  2OCC E;  4A63 B;  4ACL A;  1OWN A;  2XCB A;  4EPZ A;  2BKG A;  2HE0 A;  3TL5 A;  1H0A A;  3QDN A;  1SW6 A;  2QYU A;  3HXB A;  1TEZ A;  1A5E A;  3B7T A;  4CDM A;  4PS3 A;  2I6H A;  3L16 A;  5FTP A;  1EF1 C;  4L9P A;  5JJ7 A;  3UPV A;  4I2W A;  3ONK A;  2XGO A;  4KT6 B;  5EN5 D;  2IJG X;  4K03 A;  3CVU A;  1TJF A;  5G04 J;  1UN9 A;  3ZKJ A;  3HVE B;  1UOH A;  4U8H A;  3PZ4 A;  3BG1 B;  4ANX A;  2XS8 A;  4YND A;  4J8D A;  2BUG A;  3Q9U C;  4JL0 A;  5JJT A;  2OOE A;  4GMR A;  3PEV B;  4KYO B;  3EU5 A;  1N4Q A;  5G2N A;  1N9A A;  3Q49 B;  2WXJ A;  4A3T A;  3AAA C;  2DVW A;  2WM9 A;  4PS7 A;  5EYP F;  5FQ4 A;  2PL2 A;  2XQ0 A;  4UI9 K;  3ABL E;  2KAT A;  2WXF A;  4WND A;  4GZ3 A;  4EZK A;  3IHY A;  3FUI A;  3RO2 A;  1FVH A;  2V8S E;  2RG8 A;  2XHE A;  4UUC A;  5ENS D;  3OXG A;  2NXP A;  2VSO E;  5AAR A;  3D3M A;  3FH5 A;  3E32 A;  2C2L A;  3FH8 A;  3ONL A;  2HYZ A;  4ILG A;  4NQ0 A;  2JEK A;  2X6F A;  2OVF A;  4LNB A;  1IQR A;  1DC2 A;  5G05 J;  3U64 A;  5A6C A;  5LFA A;  4ATG A;  4F1S A;  4APF A;  3EU9 A;  4FC8 A;  5FJY A;  1S70 B;  3JYS A;  2V4H C;  2WXH A;  2VGY A;  3UI2 A;  4N5Q A;  1VDY A;  5CRU A;  4RVB A;  3UMV A;  3NB2 A;  4I1O B;  3CGH A;  1YA0 A;  3IEG A;  2H6H A;  4IRU A;  1FT1 A;  5KJN A;  2RD0 A;  4HNA D;  1TNO A;  3V31 A;  5A7D B;  3SQV A;  3LY8 A;  4FHK A;  3AG4 E;  2HO1 A;  4GYY A;  3TG5 A;  3FWV A;  5ENT D;  3L22 A;  4U7E B;  5KWD A;  2MHK A;  3ML9 A;  3QAQ A;  2ILR A;  3LJN A;  4EBA A;  3VTY A;  3MKR A;  2XRY A;  1N52 A;  3LY9 A;  4WWN A;  5E75 A;  3OXF A;  4CGW A;  3CQC B;  2ION A;  4A55 A;  4HI8 A;  2BTD A;  4B94 A;  5ARF A;  4O1O A;  3AS8 A;  5EX3 A;  3RK6 A;  4N2S A;  2L6J A;  2EIN E;  2VGE A;  3UM0 A;  1IXV A;  2Q7F A;  3QWW A;  3R9M A;  3G2T A;  3PH0 C;  4ILI A;  2KC7 A;  5BUZ A;  1QZ2 A;  3T5V A;  5EIB E;  3OTN A;  3SFX A;  4DX2 A;  3I4R B;  4YDW A;  5HS0 A;  5ENR D;  5CMW A;  1JWF A;  4AXH A;  2CFZ A;  4W9R A;  5CCM A;  2OEV A;  1OCR E;  5AQA A;  3KEA A;  2WXR A;  1UJJ A;  3L54 A;  2A5U A;  1Y8M A;  2LSU A;  4UI9 J;  4BSX A;  3V2X A;  3FTU A;  3UKR G;  3PZ3 A;  5KNH D;  2P9L G;  2NSZ A;  5D66 A;  3ZXS A;  5AN8 A;  2X6I A;  4ANV A;  2FBN A;  2HR2 A;  3LPZ A;  3QWP A;  4J0U A;  3D9N A;  1S63 A;  2AW6 A;  5C2Y A;  5JHB A;  4CZ2 D;  4YDO A;  4ME2 A;  4DLQ A;  5AQ9 A;  3D9K A;  4GML A;  4F7A A;  2WXN A;  4C9B B;  4U63 A;  3B7U X;  3ASO E;  2X6H A;  3C3Q A;  5CMY A;  3L9T A;  3QK0 A;  2F8X K;  2QC9 A;  2DCP A;  1TNY A;  3RU0 A;  3KEZ A;  3G2W A;  3FHE A;  3TG4 A;  2CHX A;  2QYJ A;  4HOR A;  2WPV A;  2WQH A;  3UTM A;  1KLX A;  2BED A;  2CHZ A;  3NF1 A;  3DPY A;  3EHQ A;  3R7R A;  5JHA A;  4HOQ A;  3KS2 A;  4U07 A;  4Q96 A;  1ZBP A;  4CYM D;  1L5J A;  3ML8 A;  3CHM A;  4U95 D;  3HXF A;  2DIW A;  1TNU A;  2H6I A;  3O48 A;  2QFC A;  3D9H A;  2P9K G;  3D9J A;  1TNB A;  3NAW A;  2GW1 A;  2Y4U A;  4JC8 A;  2LUH A;  4HI9 A;  4HFG A;  4J7W A;  1FCH A;  2I2O A;  1MX4 A;  4GTR A;  3EHM A;  4A1G A;  2WXI A;  3ULE G;  2CFU A;  4F1P A;  3D9O A;  3BEE A;  4I9E A;  4AV7 A;  4MKT A;  3UQ3 A;  2IOL A;  3CHQ A;  4HB5 A;  2NC9 A;  3EIJ A;  4DRX E;  1O1S A;  1OWO A;  1SA4 A;  1MJ0 A;  4GTM A;  3G2U A;  1V55 E;  4FU3 A;  5CER B;  3T8K A;  3ASN E;  3Q79 A;  3DST A;  4UWK A;  3KSL A;  2XPI A;  3ABM E;  2EIM E;  1N95 A;  4DUI A;  2ETB A;  3HXD A;  3ZW3 A;  3FUN A;  4A3V A;  4MBG A;  4Q69 A;  4N3B A;  1JUQ A;  5HKP A;  4TUU A;  3ZEF A;  3FU3 A;  4I6G A;  2LXL A;  4DX5 D;  2DWZ A;  4BTB A;  4BTA A;  4PS8 A;  1O1T A;  2IQC A;  3QWV A;  4L1B A;  4FJY A;  2KCL A;  3DEP A;  4DI4 A;  3SHF A;  4B89 A;  4N3A A;  1PY1 A;  4I6J A;  4ACK A;  4TXR A;  4GZC A;  4FHJ A;  4BX9 A;  2J07 A;  1HFA A;  3UT7 A;  3DSS A;  3ULQ A;  3SBT B;  2X38 A;  4HBD A;  1ELK A;  4JD2 G;  2M63 A;  4I43 A;  4LNU D;  5ITZ F;  4QFV A;  5IY5 E;  3E33 A;  1H2T C;  4GZD A;  3FDH A;  4C48 B;  5AIJ A;  1X81 A;  4JZY A;  1ELR A;  3FUM A;  5G05 C;  4ANU A;  1N4S A;  3TWX A;  3NQP A;  5AQB A;  3PNL B;  4H7X A;  2BKK B;  3CK7 A;  4XKC A;  3T9K A;  3SNX A;  4I6E A;  2ZGG A;  3X2Q E;  3Q9N C;  3AG2 E;  4GTT A;  1Z5S C;  4XEI G;  2XEN A;  2XPY A;  5EID A;  4GZ5 A;  4G1T A;  4L2Y A;  1SVX A;  2UWJ G;  3D9P A;  3QAR A;  2WQ6 A;  4EBA G;  2AXV A;  3HIZ A;  2UY1 B;  3ASH A;  4DPR A;  3RJV A;  3AS4 A;  4XI0 A;  2FO7 A;  2J4B A;  4UWF A;  3DXK G;  2PQN A;  2KBX A;  1QQE A;  4U0Z A;  3ESL A;  1OWL A;  2P9U G;  1N11 A;  3Q47 B;  3APF A;  1MZC A;  3E34 A;  4IUL A;  3RRN B;  3I4G A;  1TR4 A;  4FUL A;  3ZGQ A;  2XZD G;  4E6H A;  1SZA A;  4RQI A;  4BES A;  4B8C B;  2VSX E;  2QZA A;  4EHM A;  5ENO D;  4AJW A;  3B7R L;  3ESK A;  4AVX A;  3QOU A;  4EZJ A;  5EX0 A;  5BV0 A;  3B7B A;  4ZFH A;  3B13 A;  3Q7A A;  2PNN A;  3DSU A;  4G8K A;  4C0M A;  5JMN D;  2LNI A;  4LEU A;  1KZP A;  4B0Z A;  4GPK A;  3KAE A;  1MHQ A;  1EDU A;  5LP0 A;  1SZ9 A;  3CLJ A;  3FTS A;  4HRN A;  4EQF A;  4RG9 A;  4LG6 A;  1HO8 A;  3UUX A;  2J09 A;  2H6G A;  3DXM G;  1OCC E;  2XS1 A;  4JEU A;  4QQI A;  5EIL A;  4R7L A;  4UQX A;  2Y3A A;  3HG0 D;  4LER A;  5HI7 A;  4FA6 A;  4GB9 A;  2JLB A;  3AU4 A;  4WAF A;  2R17 C;  3RIB A;  5JJ6 A;  4N2Q A;  2AXU A;  3QKY A;  2LSV A;  1TN6 A;  3ISM C;  1NA3 A;  2WXQ A;  3MZL B;  4OVV A;  2NYJ A;  3URZ A;  4XIF A;  1N94 A;  1UJK A;  1UN8 A;  1TN7 A;  4UWG A;  2E0I A;  4OYS A;  3ZIM A;  5KCM A;  3ZYL A;  3KSQ A;  2LO6 A;  2MRI A;  1IHB A;  3Q75 A;  2P9P G;  2ZU6 B;  2DZN A;  3ASG A;  5CRV A;  1E8Y A;  2JAB A;  1Z3X A;  1B89 A;  3FUH A;  1O1R A;  4HOU A;  1BLX B;  4RLY A;  4KVM A;  1DCQ A;  2IY0 C;  1E96 B;  4N5C A;  2R02 A;  3MX3 A;  2J08 A;  1O5M A;  5KJL A;  4TV3 A;  3WG7 E;  4MS6 A;  4AOF A;  3UM3 A;  2XPZ A;  4O60 A;  3PVL A;  4HLL A;  2A5E A;  4NRH B;  3DEO A;  3CKB A;  4WNF A;  2RFM A;  2WVI A;  1KT1 A;  2IU1 A;  5B3S E;  1BPO A;  3CQG B;  3FUK A;  2GRN B;  4G11 A;  3K9I A;  4CEM A;  2L6B A;  4XKB A;  3SF4 A;  3UX4 A;  3TWQ A;  4DX7 D;  4K5A B;  3DSW A;  5J08 A;  4KBQ A;  3ZXP A;  4RSY A;  4EEC A;  2R59 A;  2XZT G;  5EDS A;  5KJK A;  3IXE A;  3UIP C;  1NFI E;  1Z3Y A;  4KVO A;  2XGS A;  4GYO A;  3ZUV B;  5C1D A;  1Y6I A;  2WXP A;  3HXC A;  1N4P A;  4K0R A;  2L0T B;  4CDR A;  3CVP A;  3ZYM A;  2EIJ E;  4ANW A;  5FT9 A;  4HOT A;  3TWW A;  4GTO A;  3S7D A;  4JB8 P;  4M7C A;  4MLP A;  1W3B A;  2IF4 A;  2P58 C;  3RRM B;  2X3M A;  2LAH A;  4KMO A;  1H19 A;  3LYA A;  3Q7F A;  1DCE A;  3S2A A;  2PM7 A;  5BXU A;  4YDE A;  3FU5 A;  2J49 A;  4WUY A;  2R03 A;  5FWQ A;  2WXM A;  2XEV A;  3J5P A;  4LSZ E;  1OXJ A;  3GYZ A;  4GTP A;  2KCV A;  3GW4 A;  5CBN A;  1RZ4 A;  3J5Q B;  1U3D A;  5EKQ D;  1IYG A;  2VQ2 A;  2WMO A;  2AXZ A;  2F8Y A;  3S7B A;  3SBS A;  2WXL A;  3CHP A;  2CHW A;  5T4Y A;  3ZRH A;  5FZR A;  1MQS A;  4NAC A;  1N0Q A;  4DX1 A;  2IO3 C;  5ENP D;  2FUL A;  3VTX A;  2DYS E;  5E76 A;  4IYP A;  3DSV A;  4TRQ A;  2OND A;  5ENQ D;  2R5S A;  5M72 A;  1LTX A;  4G24 A;  2CG2 A;  4PDX A;  5EYL A;  3FFL A;  4G23 A;  4KXK B;  1TN8 A;  2UY1 A;  4U04 A;  4GTV A;  5DIZ A;  4I17 A;  2CG3 A;  3MKQ B;  2VTB B;  5FIO A;  3FUL A;  5FIN A;  3PUJ A;  2AWI A;  1IKN D;  2B0O E;  3ENE A;  5KNG A;  3QB2 A;  4G26 A;  2VYI A;  1WDY A;  4J8F A;  2AVP A;  2Y4T A;  3S7F A;  2GRO B;  2QY7 A;  2GGF A;  3GZ2 A;  2V4L A;  3SGH A;  4N3C A;  3ZHE B;  2WMN A;  4J8E A;  3PNT B;  3G2V A;  3R7Q A;  5CBO A;  5T3R A;  4G2V A;  3L6A A;  1ZU2 A;  3UIN C;  2BF0 X;  4GU5 A;  3V30 A;  4UWH A;  1HX8 A;  3PUK A;  2P2C P;  5D0O D;  4BEP A;  1JCR A;  3ZYQ A;  2L0I A;  5JA4 D;  3RRU A;  4HS2 A;  1DNP A;  1G3N B;  2OV8 A;  4J6I A;  1QBQ A;  5ARG A;  4PUC A;  3PEU B;  4Y6C A;  1JWG A;  4BT8 A;  3MEK A;  3ABK E;  3D9M A;  1WY6 A;  3JUI A;  2ZIS A;  2F0Y A;  2DZO A;  3U9W A;  3RO3 A;  4N39 A;  5DBK A;  1KPS B;  2X6J A;  4FLB A;  5AAO A;  3L17 A;  4AM9 A;  4CCA A;  4J8S A;  2VGX B;  3R9A B;  3VLE A;  3E4B A;  2P9I G;  2V5Q C;  1OCZ E;  3P2B A;  3SI5 A;  3APC A;  1UW4 B;  4GMJ A;  4GCO A;  3QC1 A;  1LF8 A;  3T5X A;  2J4D A;  5LCW J;  3EUV A;  4DJA A;  3ZVV A;  3AJI A;  3JQ1 A;  3CKC A;  4F6R D;  5CED B;  3U66 A;  3EHN A;  3TWU A;  2Y69 E;  1D9S A;  1BI8 B;  4BSZ B;  1PC2 A;  4DLO A;  3GZ1 A;  3TAX A;  3HVE A;  4TXQ A;  2WXK A;  1NZN A;  4AIF A;  4U8V D;  3JXJ A;  3UM2 A;  4JEH A;  4HRM B;  2VSN A;  1ELW A;  2MOW A;  2GRQ B;  4WWP A;  3HXE A;  4BET A;  1BI7 B;  3CVY A;  3FTW A;  4APO A;  2A4Z A;  4AY5 A;  3G2S A;  4JA9 A;  4IN3 B;  2KM4 A;  3TXM A;  4CT4 A;  2OEW A;  3CEQ A;  1IQU A;  4U8Y D;  2RKK A;  5D2M C;  1A17 A;  4F3V A;  5FQ7 A;  3ASD A;  3QJZ A;  3CVV A;  1PAQ A;  2I1K A;  3V2O A;  3DSX A;  5B1A E;  5FQ8 A;  1P5Q A;  3UXG A;  2WXG A;  5FZQ A;  1XNF A;  4WWO A;  3CSF A;  3FUJ A;  2WQ7 A;  4HXI A;  3T8M A;  5B1B E;  4FAD A;  1E7V A;  1N0R A;  4NUR A;  3MKQ A;  3DWL G;  3CHR A;  4GA1 A;  4KZ0 A;  3NZS A;  1DVP A;  1E90 A;  3FUD A;  3CK9 A;  2YQ8 A;  3JXI A;  5BT1 A;  4Z68 A;  1BU9 A;  3RAU A;  5LCW C;  1FPP A;  4XZ4 A;  3FEY A;  2GRM A;  4DX6 D;  1FT2 A;  1KT0 A;  1TJC A;  3LDZ A;  4L7T A;  5BPP A;  1S0P A;  2KZT A;  1MYO A;  3Q73 A;  1MX2 A;  2GRR B;  4YDY A;  3FTX A;  3PZ2 A;  1QNF A;  4HOS A;  3F6Q A;  3UIO C;  4B93 B;  2I9C A;  4K5B A;  1HU3 A;  4BWR A;  4XX5 A;  1AP7 A;  1H2U A;  3TWR A;  3BU8 A;  4U0U A;  1OY3 D;  5ANR A;  1U3C A;  3MV2 B;  5AQ7 A;  3Q78 A;  1X5B A;  4CDN A;  1OWP A;  4K5C A;  3MCX A;  1WM5 A;  2FF4 A;  4D10 C;  2EIK E;  2VTB A;  4JHK A;  4U96 D;  1YMP A;  2IOS A;  3CIA A;  3VLF A;  1V54 E;  3SFY A;  3ZU7 B;  4URK A;  1UG3 A;  4AY6 A;  2KCK A;  1HE8 A;  4BER A;  5T8I A;  3EJN A;  3PRE A;  3BG0 B;  4ILH B;  2RFA A;  1YYH A;  1SQM A;  2EQX A;  5ENN A;  4HLE A;  3LS8 A;  2ZIR A;  1E8Z A;  4OAV B;  2VSY A;  4Q94 A;  3JCK C;  3PS6 A;  3TWT A;  4UI9 C;  3ULY A;  4GA0 A;  5HQ8 A;  1D8D A;  3L13 A;  3I3N A;  3BQO A;  2R05 A;  3C72 A;  3PE4 A;  3B95 A;  4NIK A;  4UQZ A;  1WG0 A;  3HHM A;  1EYH A;  4HQD A;  3OAW A;  1K3Z D;  1D8E A;  3TWV A;  5BXO A;  4CT0 A;  5ANL A;  3AG3 E;  4JHJ A;  3P1U A;  3FUF A;  1N54 A;  3LEW A;  1E8W A;  4I2Z A;  1IHG A;  2XEE A;  4OVU A;  3N71 A;  1NL4 A;  5CEC B;  3FTY A;  3CVN A;  2ETC A;  4DI3 A;  3EIQ C;  2C0M A;  3E37 A;  2DYR E;  5AJD A;  4ABN A;  1N4R A;  3C98 A;  1E8X A;  2IFU A;  4HRL A;  3EDT B;  1TYQ G;  1K1B A;  3V79 K;  1JPL A;  2YHE A;  3CVX A;  4FP7 A;  3U4T A;  1H6P A;  2AJA A;  3CK8 A;  5AEN A;  3ZHE A;  3AS5 A;  4LRZ A;  3D9L A;  4XE0 A;  3C3R A;  1KZO A;  4JHR A;  1HS6 A;  2KZT B;  3B7S A;  3FY4 A;  4OAU C;  3ZN3 A;  2ZXW E;  3SZ7 A;  3LVR E;  1H2V C;  3TJP A;  4G25 A;  4I1M A;  5AYW D;  5KJM A;  1OUV A;  4M3O A;  3HYM B;  4CRW A;  4I1A A;  4BX8 A;  4JVS A;  3LCA A;  3LVQ E;  1LD7 A;  4JA7 A;  1YCS B;  3CVW A;  4GAA A;  3IV0 A;  2C0L A;  3IKO B;  3PDN A;  2YIN A;  3FH7 A;  2XEH A;  1JCS A;  1AWC B;  5CCL A;  4GCN A;  3W9G A;  1H6O A;  3AG1 E;  3CST A;  3NOG D;  4O6F A;  4XI9 A;  5CHE E;  2E2E A;  2YHC A;  5KBA A;  5AJL A;  4ATZ D;  5FQ6 A;  4A1S A;  3CHO A;  4AP2 A;  4F53 A;  2Y1L E;  3AU5 A;  3SO8 A;  3Q4A B;  5LX8 A;  5H7P A;  5LOZ A;  1FVF A;  2IO2 C;  1K1A A;  4GPM A;  2VGX A;  2DBA A;  3PE3 A;  4JPS A;  4UQY A;  3FEX A;  2F37 A;  1GW6 A;  3C3O A;  4ZHB A;  4FJZ A;  4J8Y A;  3MJW A;  3PRZ A;  3TWS A;  3I5P A;  3LXU X;  3DBS A;  3UT8 A;  4JW1 A;  1OT8 A;  1XGW A;  1HH8 A;  3RSE G;  1U2V G;  2R2L A;  3UM1 A;  3PZD A;  3MA5 A;  4PH4 B;  2OVB A;  4CGV A;  3IBE A;  2V5F A;  3NZU A;  4O1P A;  1OCO E;  1K8K G;  2FI7 A;  4DK5 A;  1Z6T A;  1WAO 1;  4H7Y A;  4GTS A;  4MRU A;  5J90 A;  3NBN B;  4EZL A;  3APD A;  2Y0B G;  3Q5M A;  2PZI A;  3ASF A;  3LJ3 A;  3FTZ A;  3CR3 A;  3E30 A;  4Y6W A;  2XRZ A;  2ZGD A;  2FO1 E;  1H6K A;  3MYV A;  3FU6 A;  2FEZ A;  1OWM A;  3C5R A;  3CHS A;  1S64 A;  2LXM A;  3D9I A;  4WNG A; 
#chains in the Genus database with same CATH homology
 2EIJ E;  1V54 E;  2DYR E;  3X2Q E;  3ASO E;  3AG2 E;  5B3S E;  2EIL E;  3ABL E;  1OCZ E;  1OCR E;  3WG7 E;  5B1B E;  1V55 E;  1OCC E;  2DYS E;  1OCO E;  3ASN E;  2EIN E;  2Y69 E;  3AG1 E;  3ABM E;  2OCC E;  2ZXW E;  2EIM E;  5IY5 E;  2EIK E;  3ABK E;  3AG4 E;  3AG3 E;  5B1A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...