3ABLB

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ablB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ablB02
3MX0B 1BAWA 2B3IA 2BW4A 3ERXA 1ID2A 2BZ7A 3FPXA 1KDJA 1KBWA 1ETJA 2IAAC 5F7BA 3FSAA 4YSDA 4E9YA 1UATA 4BWWA 1NIDA 1ZV2A 1BXAA 2VW7A 3X1FA 1JVOA 1PLAA 2IH8A 2I7OA 2UXTA 2VN3A 2UXFA 1J9SA 4BWTA 3NSFA 4HHWA 2VSKB 1NIEA 3UGEA 3PPSA 3ZX1A 3AY2A 3TBCA 2FQEA 2Q9OA 3UACA 5ANHA 2GB2A 1JZFA 1WAEA 4KOCA 1E5ZA 6PCYA 1KYAA 3V9CA 2BZCA 2HRGA 4WKXA 5LDUA 3AG4B 5I6LA 2YAHA 4E9SA 1FFTB 1NDTA 2PPCA 3AW5A 4JHVA 3ABGA 1ZPUA 2PPFA 2QT6A 3FU9A 2IDTA 4GXFA 4ZK8A 1DYZA 1NPNA 2YXVA 1MZYA 3SBRA 3AG3B 1W6WA 5AFAA 1WA2X 4DPCX 4W9ZA 4UF7C 3T6VA 4KO7A 4AKPA 4FAAB 4YSUA 1SHWA 2BWIA 4G71B 1M56B 1ZDQA 4HHGA 1VLXA 2Y69B 3PAVA 4KO9A 1BYOA 2IWEA 2PPEA 3DIVA 1SDDB 1XMEB 1WA1X 3FSVA 5B7MA 2IDQA 4E9TA 5B1JA 2BO0A 3TU6A 4DP0X 2QDWA 2XU9A 4YVUA 2VSMB 2FT6A 5B1JC 5B1AB 4PAZA 2DYRB 2GI0A 2X87A 5B7FA 3NJLA 1JXDA 2P80A 1J9TA 2E86A 4HCIA 3T6ZA 1PLBA 3OD3A 4K9JA 3CDZA 2RACA 5AZUA 1JXGA 4UAHA 3QJUB 4CSPA 4N8UA 2OV0A 3BQVA 3C75A 1MG3C 1WS7A 1PMYA 2PPDA 3X1NA 4E9VA 1WS8A 2HX9A 3SBQA 2N0MA 4JHUA 2PP9A 1L9PA 3S3CB 2QPEB 2CBPA 1ADWA 3UADA 2EIKB 1OF0A 1F56A 1PZAA 2XUWA 1L9OA 2VW6A 1A65A 1AZNA 3FU8A 2ZXWB 4E9QA 4HCFA 2YQBA 2A3TA 4YL4A 4F2EA 1AOZA 1NWOA 4KOBA 4P5SA 2VM3A 1SHXA 3S8FB 2FNWA 1E30A 3OMIB 1IBZA 3CDZB 1NZRA 2DWSA 2CUAA 3T71A 4YSOA 2PPAA 4KNTA 2AZUA 3X1EA 4FA7B 2I7SA 2EILB 1L9RA 3X2QB 1OE1A 1N70A 3OQRA 4Q8BA 1TKWA 3OMNB 3JTBA 1OE2A 2MTAA 3WNIA 2I85A 4ENZA 2J56A 2UXGA 1BQKA 2XV0A 3S8GB 4DP8X 2PCYA 3TBBA 1AANA 1AZCA 1NINA 2FJSA 2XYBA 1AS8A 1PNDA 5B1KA 1GSKA 3GYRA 3NJGA 1JZIA 1A4CA 3ABKB 3EH3B 3FU7B 1PCSA 3KW7A 5IY5B 5I5JA 1OV8A 2ZOOA 4GY4A 1NPJA 3NJHA 4YSEA 3BVDB 3H4HA 4G7SB 4F2FA 1BQ5A 2B08A 2W8CA 1MDAA 3PXLA 4A2FA 1NWPA 3WIAA 3UAEA 3WKQA 1GS7A 2WO3B 3EHBB 3NJNA 3FPYA 2PCFA 2DYSB 5D4HA 4P5RA 4HIPA 2IWKA 3CVCA 2BW5A 4AX3A 3NJJA 3NJIA 4N4YB 4G7QB 5FC9A 4Q89A 1KBVA 2H5UA 5B3SB 2YAFA 2CCWA 5PAZA 1CURA 5B1BB 2YAMA 2UXVA 1W8EA 1AZBA 2R7EB 4HZ1A 1AIZA 3JT2A 3UABA 4MFHA 2TSAA 2H47C 3QJVB 4KO6A 1M57B 2J55A 4CSZA 2PLTA 2BP0B 1E5YA 2GC7C 2WSDA 2GIMA 3TA4D 5B7EA 2W88A 2YEVB 1ZIAA 3H4FA 5D4JA 3GXUB 3D12B 2YARA 3ZBMA 3QJTB 4AZUA 7PAZA 4HAKA 3PAZA 4L0PB 3H56A 1RZQA 1A4AA 1NTDA 1AZUA 2AVFA 4W1TA 4G72B 3RYMA 2FQGA 1JZEA 4DPAX 4BXVA 4E9XA 4YSTA 1TEFA 3IN2A 1SNRA 1L9SA 2HZHA 3FS9A 3MBWB 1E65A 4JKNA 1SF5A 2Q5BA 3CZUB 3L45A 2VM4A 1PZCA 2HLEB 2XX0A 2IDFA 4PCYA 1BXVA 2BP8B 1TU2A 3IE9A 1OCCB 3HB3B 4GP5B 3SQRA 1JERA 5AKRA 1MZZA 2BP8A 1GS8A 1SJMA 1A3ZA 1HAWA 4G70B 2FT8A 1PAZA 3N2JA 2YAPA 3IN0A 3FYIB 4BDVB 3FQ1A 1SFHA 3HEIB 3PLYA 3NSDA 4NAJA 3FSWA 1PF3A 1EHKB 3QPKA 3EF4A 5I6OA 2OCCB 1RKRA 2TSBA 3S3BB 5I6PA 2ZWNA 5I6NA 4DP6X 4A67A 1NIFA 1ET7A 1DZ0A 5I6MA 1ASQA 2PP7A 3ZDWA 4TXVB 1OE3A 1ASOA 2ZONA 4YSPA 2AANA 4NB7A 2BP0A 2CJ3A 4HALA 2DY2A 5PCYA 1PLCA 3OMAB 4GYBA 1GS6X 1A8ZA 1ZIBA 1E67A 1L9TA 1JVLA 1KGYE 2XV2A 3QJRB 1B3IA 1GW0A 1L9QA 1FWXA 2H3XC 2J5WA 2EIMB 4GP4B 2HX7A 3FQYA 1J9RA 2YAQA 3G5WA 3QJQB 4UANA 3N55A 2CALA 4QKTA 6PAZA 1AS7A 8PAZA 3OM3B 1XB3A 1JOIA 1V10A 4KO5A 2GC4C 1ZDSA 1HFUA 4KNSA 3X1BA 3ASNB 2PP8A 1JZJA 2UX7A 2MRYA 4M4RB 1NIAA 4HCGA 1T5KA 2BHFA 1GR7A 3GDCA 4DP9X 3DKHA 3IEAA 3PCYA 4DP7X 2IDUA 3NJFA 1I53A 2BWDA 2XLLA 4A2GA 2QDVA 5D4IA 1GYCA 3NSCA 2IH9A 2UX6A 3AZUA 1OCOB 2HRHA 4YSQA 1X9RA 1JZHA 2XVBA 4GP8B 1PY0A 2Y1AA 1V54B 2IWFA 1XB8A 2DWTA 5I5MA 1IKOP 2AZAA 3NJKA 1NIBA 1OCRB 1GY2A 1XB6A 4DP2X 4WTQA 3FU7A 9PCYA 1OCZB 5TK2A 2EINB 1PZBA 3AG2B 3QJSB 3X1GA 4AKQA 2FT7A 2FQDA 1IBYA 3WI9A 1RCYA 1SF3A 1J9QA 1KDIA 4A68A 3NJMA 3FYEB 2WO2B 4KNUA 1V55B 1IUZA 2EIJB 3FSZA 1CYWA 1AG6A 3UAAA 4DP1X 4AI7A 2NRDA 5TK4A 4RH4A 7PCYA 3T6WA 1QLEB 1GY1A 1RZPA 2HX8A 2XXGA 3CVBA 3EH5B 4A2DA 3DTUB 1M9WA 2GBAA 4BK5C 1ASPA 3FQ2A 4NERA 3ABMB 4X4KA 1BXUA 1QHQA 3ASOB 1TEGA 2YAOA 3IBOA 3NSYA 2J57A 1CC3A 2GHZA 1IC0A 4DPBX 1WA0X 1BYPA 5I6KA 5F7AA 2FQFA 1URIA 3WKPA 3CVDA 4BXSV 5E9NA 2AFNA 3T6XA 1KCBA 2JFCA 4YSAA 2FWLB 1N68A 3NP3A 3V9EA 4DP5X 4E9RA 1AS6A 1PNCA 1AG0A 2YXWA 3T9WA 1JZGA 4A2HA 1ET8A 4F7KA 4YSRA 1BQRA 1AACA 3FT0A 1ILUA 2GSMB 1AAJA 2YAEA 4BDVA 1MG2C 3EH4B 1R1CA 3NYKA 4M3HA 2XV3A 5I28A 2R7EA 4BWUA 1NICA 1OOWA 1ET5A 2P80D 5A7EA 1FA4A 1ILSA 2HXAA 1AZRA 1KV7A 1SDDA 2FTAA 4A2EA 4YSCA 1QNIA 3NP4A 4G7RB 1AR1B 4DP4X 3WNJA 1CUOA 1KCWA 1JXFA 2QPDB 3U25A 3ABLB 1HAUA 5EHFA 3QQXA 3WG7B 1W6LA 3TASA 4A66A 1A4BA 2JXMA 3NT0A 3AG1B 4YVNA 3PAUA 4E9WA 2CAKA 3S3DB 4QLWA 3KW8A 2XXFA 4AKOA 2XX1A 1AQ8A 1YLBB 2OJ1A 2JKWA 4EF3A 1J5DA 1BEXA 3ZIYA 2LLNA 3SBPA 1J5CA 1X9UA 2IDSA 1EZLA 2XWZA 5I5IA 2VMJA 2VW4A 5I26A 1SFDA 4YSSA 1CYXA 2DV6A 2X88A 3CG8A
chains in the Genus database with same CATH superfamily
4C4KO 4LKXB 4IRSD 3GSQA 4A55A 1AY1L 4QTHB 2QEJA 3GUTB 1D5ZB 1GRWA 2V3DA 1OAUL 4RETB 5K1JA 4ETQB 3W7WA 3AUVA 4Y2NA 1OD7A 2W91A 1LEGA 3VH8G 3AWFA 3OTOO 2VGLM 3OJDA 3QPXH 3KPRA 1NGZB 4N2AA 1NGWA 3KXFE 5T1KA 1QI5A 4DR4B 4FFWD 1O6TA 2XZAH 2YUWA 4KUCD 1PLAA 2YOAA 5GRJH 2IH8A 4BFRA 1R3IH 1IFHL 1FRGL 2D7QA 2ODMA 4Y2DC 4S0HA 2EJ7A 4S1SH 4CC5A 3EKCA 4TLTA 3CAFA 4PJ7A 2H2SC 3UJTH 3DARA 3STLA 2RAMA 1K2DA 3MRQB 4A6YL 4RRPM 1BVNT 4QRRD 4LIQL 4S1QH 3VD9A 1TYJA 1N9PA 4P3WA 5AKVA 1D9KC 5I9QB 4OZFG 1XH1A 4EN3A 5INDB 1NFAA 1RZJL 4LNRA 3RGHA 3L9DA 5CJOL 4RUFA 4OI8A 1JG9A 4G9FB 2ZX9A 3MJ8A 3STBA 4AEHL 4BCZA 3IMBA 2VDQH 4AL8L 4JFPB 1A3RL 5D96C 3M6DA 4PIRF 2EX3A 1EUTA 4G6AC 5AFAA 1QVGU 2YA1A 4YFEA 5CMUA 4WV1B 2Z4QB 2EULA 4J1UB 4AGLA 3HB3D 3HKZA 1FORH 2LABA 1VSCA 1YJDH 2LGWA 4Z0XA 1P5VA 4MDJB 4WRLA 3AGVA 2UUCB 2R2HB 2DBLL 4X4ME 3CK0H 5HGHA 1MHHA 1J86A 1ZKAA 4PJEB 4WHYH 5K59E 2ED6A 4XPHH 4L4TB 5DMKB 4Q20A 4DERA 2VR3A 3MV9A 1EMTH 3BQUC 1YF2A 4JHWH 2A77H 2VSMB 1K5NB 5TDNB 4PB0H 5FUOL 3F7VC 1U96A 5E2TL 3RRQA 2PF4E 2V0AA 2QTSA 3K4AA 1PLBA 3TNNB 2EH7L 2KZBA 3W39A 5KX5B 3EFDL 1KBHA 5SX4H 2VMEA 4XO9A 4M1CC 3P3YA 4P5KA 1A1MB 4UAHA 43C9A 4YDJB 5GTHZ 2RA1A 3KYAA 3N2KA 2P1YA 3AM8C 3HG1E 4AOFA 3LEXA 4HHAA 2FBOJ 5GRUH 1IC7L 2R1YA 1NS1A 4IEFB 3ZTNL 4I9QA 4GMTL 3K5NA 4OGXL 5TPWL 4WO4C 4XTRC 4AE0A 4OCRL 4YDVB 4MA3B 3NSJA 1IVSA 4EB6A 1HZKA 4KRPC 1QO3A 2HLAB 4ORZC 1GCFA 2PGGA 1AO7E 1CS6A 3DTDA 4J12A 4NR1A 1LUWA 2XIIA 2DWDC 2E56A 2V7QG 2ENYA 5C7ZA 4E9QA 3P3RA 3BP7B 1NGYB 1LWHA 2OR9H 1UFGA 3I9IA 4EE2A 4HS6A 1T1WA 3PQYB 2DN7A 1MCPH 3BFWA 2ZX6A 2IADB 2V4DA 4KKPA 1Z3GL 2WLNA 2PI5A 3BAEH 5HYJA 4PJBE 3LKNB 2AV1B 1LJMA 5K1PA 1NBVL 4JM2C 2DQGH 3CSYB 1TSHA 4UM9D 1KTBA 2IG2H 3WSQL 2WLLB 2Y36H 4N0CC 4UTBL 2I7SA 3CLWA 1OCCC 3ARGB 5CZVL 3P3TA 5C0CA 4RIRA 1RMFH 3VXUE 5ICYB 5IZ7A 5AB2A 3C9NA 3LNDA 1Q94B 3OB8A 2J56A 2UY7B 3B1TA 1U3HB 2NSQA 1AZCA 2IH1A 4XPAH 2O61A 3QO1B 3UO1H 4R4BB 4LPVA 1N3NA 2FX8H 1WVZA 3X17A 1FZKA 2QGDA 3KW7A 5IY5B 3L3HA 4LCYB 3RPIA 3MOBL 2GSGA 4WHDA 4TSBL 3QQ3B 1A7QL 2WIIB 3L3DB 3P2DA 1M6UA 5IW3A 5EZYB 3O3BA 1AQDA 3FN0L 1SOQA 1UWEH 3RVXC 3BUYA 5F21B 1E8WA 1UXSA 1GJUA 3ZMSA 1DQLH 3QFJA 1Y7VA 3EHBB 2DQ3A 1IC5L 3L3HB 3MVSA 4GB9A 4Q2ZA 3PJSA 1KJVA 5F8QC 5KAQG 5CA0B 2QLYA 3TNNA 4HAMA 1JPTH 4JFTA 2DYSB 3U6RA 1CR9L 2AABL 2JB5H 2FUQA 2EIBA 1U8IA 1MCCA 5GGTL 3RURA 1KC8W 4AIXA 1Z5WA 1UA6L 4EN3C 4PJDA 4Q89A 2ZZUT 4MAUH 4B9CA 1EBPA 1FF5A 2CCWA 3MLPA 5I19H 3PP3H 1CURA 5KVDH 3GXMA 1J7VR 2VR4A 5IFHL 1W72A 5K9JL 4HU2A 5TQ0L 1AZBA 2H1LM 4HKZA 4HPOH 4RAHA 1A7RH 3QCUL 4KMTL 2IW5A 3RZCA 5B1AC 4HJIA 5K9KB 5IBLC 4TTGA 2B5IC 2Z3YA 3O11B 4X88A 1T1WB 3CFUA 2J55A 1N18A 3PQYA 4FJYA 4R0LA 1J18A 2WBXA 4FZ8H 4X4YB 4U1HA 1GC1H 2EDLA 3H8NA 4YBLC 4RQQA 2GIMA 2YSSB 3SN6N 3ZKNC 5F7HA 3D18A 3LH9A 4WU5A 4QRPD 4NUGL 2QR0B 4PREB 2VLKA 2CLZB 3IJEA 3H53A 4CMMA 1KTCA 2XG4B 4N2EA 3TZVD 5D4JA 1JCKA 4YEFA 4YHNB 4NZDA 3ATFA 2CCLA 5HGAA 3CZNA 3OVUB 3DMMA 5L7XH 2LR4A 4X4YA 2J4WL 2RFXA 1O0VA 3P4NB 5IWLA 3ZQ9A 5DLLA 5DWPA 3JV5A 3P0VL 4LSTH 4YWGL 4ELDA 3ZEDA 3S5YA 3D4CA 4LOUC 2XWDA 2CH7A 2F53E 2HFEC 1GA2A 4PRBA 2HRPH 1XHHA 1OTUD 5C8YA 3HJ0A 4HDIA 4ZMLA 5GGSA 1OGTA 1F5WA 2NY0B 2GSGB 4K0KB 2VDPH 4G5AA 1WZAA 4FF9A 3G04B 4NJ9L 1UUSA 1AE6H 5GGTH 1IXMA 1IE5A 4XAWL 5L6YL 2BFVL 3QHFH 1SXAA 5D71L 3MJWA 1QSEB 2B1AH 1NMAH 2HEPA 4IK6A 1QVFU 3MRCB 1T83A 4KROB 5A6MA 2CRZA 1J05B 1TU2A 5CJXA 4WWPA 1OCCB 5CA0A 5B5EZ 1JERA 1L5GB 5T3XH 1NC2A 2DWDA 3VWJD 3ISWA 2IBZX 4XH2A 4PJFF 3US1A 2FT8A 2YXFA 4JB9H 1WIUA 2V6HA 5FF6B 2J5LC 2YAPA 1XWVA 4JS7A 3H6AA 1A6ZB 1ZVHA 5ICZB 1TTRA 4Z76A 4LLQB 1VFBA 2ZJSL 1NANH 5L0QB 3CFTA 3OX8A 3ZZSA 1UACH 4LVOB 1WPCA 4GYCB 1LO4L 4MSWB 1IKNA 5HGDB 3K7UA 2X1WL 2OR8A 1BD2B 2YXHA 3ETQA 3BZ4A 4YHPA 1K8DA 1BOGA 2GVYA 4K9EH 2UWEF 3E1F1 3RWFA 5CILH 1HS6A 2V5YA 4P4RA 3WGUB 5EMYA 3Q44A 3OZKA 4V2CB 1A4KA 4QXGL 4DN4H 3ZQWA 2GT9A 3CXHF 4NRXA 5HDQH 1T21B 4HALA 4ZJ9A 1U3NA 1ACXA 3T2NH 5IQOA 2V17H 5IIEA 1CK0L 1GYVA 1Q0YL 4NZRL 3MRHB 1S0VA 2COQA 1D5XB 4FQXD 5I6XB 1WFMA 1JXKA 2OR9L 2AW2A 3ARFD 4G9DA 3UJJL 3IRZA 4L2LA 5I75C 2H6OA 4H8WH 3VFPA 4YHHO 3BDXA 4X1IA 2X4PA 4R90H 2G5BB 1PD0A 3BH8B 2DWEC 4U1MB 2XFXA 3SE3C 1I8MB 2AJUH 2OSXA 1MY5A 4JFFA 1EPFA 1QNZH 3OF6A 4HWZB 4KNSA 5D7LB 1E1QG 2WXHA 5KBDA 1CDJA 4F7MA 2W0XA 2A9ML 4H8UA 5H94A 5C3TA 2XA3A 1DL7L 4BUQA 1BFVH 5C0AA 3QIUB 5E2WH 2NXYD 4AL8C 4GX0A 2ICEA 2XAFA 5D2NB 4EEEA 1UOKA 4DP9X 1XGQB 3FQWA 3L9RA 3FB6A 3VG0H 1FFXA 3IFLL 2VWKA 1EAOA 1JGEB 5D4IA 1E8ZA 1AVAA 1VFAB 2NR5A 1XSJA 5F97E 4UILH 3MLUH 4YX2H 3CXFA 4ODHH 1JE6A 2DIJA 4AYSA 3EYUH 5BXFB 1JZHA 4ZOLB 4FXGB 4PRPB 2R9HC 5E6ID 3VRLE 4NVPA 3FQWB 1EDHA 4K8XA 4JM2B 1XGTB 4RSYA 1FPOA 3BKML 2IEPA 3SIKA 1UHVA 4N0YH 5E1HB 5HDOA 2LGNA 2CIKB 4IBSA 1G43A 2PR4L 3U9UB 2CPCA 3A23A 5TE6L 4I9XA 3U6XA 5EBGA 5C8JB 5E24E 3GPSA 1JPSL 4M00A 2XHNA 1A3RH 1I7RB 4HPYL 1GGBH 3UC0L 3VA2C 3CPLB 1P4IL 4BA8A 4ENEC 5I1JL 5FO8A 4GIPD 3DLQR 4EI6A 2EAEA 3MV7B 3FUKA 4X7TA 1DZBA 4GAJL 4M5YH 4XPTL 5LXVA 1W0WB 1DJGA 2WHVA 3HZKA 5KSUA 3N1QC 3JTSB 3EH5B 3ZKXC 4FXKB 1JK9A 32C2B 1PLGH 4XBMA 3QUZB 1QHQA 3KBFA 4OM1L 3DA0A 1TTCA 3OB0K 4BYHA 5KBLA 5I1LA 4LOUD 2VR6A 1WA0X 2AMGA 2JI2A 3K57A 3BAWA 2KUTA 1NKDA 1B0RA 1EVTC 4U0QB 4ZW8A 2CKNA 1A4JA 4IJ3B 3PJSK 2B4CL 3S5LB 1VADB 3NP3A 1S7QB 4HJGA 4MMZB 5J3HC 2ESVB 1H3PH 1O9GA 1WAAA 1GKFA 1FZOA 1JZGA 1ET8A 4A2HA 3N0AA 2GTWA 1INEH 4HJ0D 1NBZA 3T1YB 3JSLA 1R5VB 2W65B 2MW2B 4HT1H 1GJWA 4BDVA 4FFZH 3DECA 4NCC2 3IE4A 3B40A 1PU0A 5EULV 5DO2C 3QORC 4LCUC 4FMTA 1TZAA 5DMJB 1PEWA 5IBLD 4DGVL 2EE2A 3B2UD 5HGGS 3QNZA 4NO0A 4O4IB 2BNQE 2N01B 5IQ7H 4PRIA 2Y9RT 4BIUA 2G75B 4P04A 5AG2A 3RY4A 3LH2H 3GXNA 1URFA 2K9PA 2Y69C 1GGCL 1KV7A 3P3SA 3DPBA 4P3DB 4U1IA 2CJSA 2W38A 3CX5F 4MAYA 5DJDA 5EU6B 5HP5A 2WN2A 5TJWK 5CD3B 3OEHG 1NMAL 5BUAA 1MWAB 4YDZA 5DD3L 5E1GA 3EH2A 4KTYA 1EFQA 1UWXH 3O4LE 3OJ2C 1DN2A 3KPOA 1UD8A 4M7LT 4DUZB 4UV7L 5IW1B 5MENB 2HVKC 1F6AA 1BFSA 2GAZB 2OMYB 4E9WA 2NNCA 2WCSA 4I3GA 5AW1B 3JUZA 1MPAL 4FP8H 3EUDA 1DBJH 3O4LD 5IYZB 1WHPA 4NIYE 1VEWA 4HXBL 4JFHD 5ICXA 2P46B 1WB8A 4PGBB 4D0BA 1J5CA 3DSQA 3TF4A 4GUPB 1MAJA 1BX2A 2CM5A 3CXHK 4MBRA 3SPIA 5I26A 4Y1SA 1YPZF 1R5IA 3BZDA 3PL6D 2PWGA 4NUMA 4UAOB 2WO4A 3PDOB 3E83A 5HJDA 5I17B 5KS9B 5KHHA 1SYVA 3I6GA 3DXRB 1LNUB 2UXCB 4KV5F 5FA3B 3ZO9A 3GMNB 1O6SB 1G6RL 2WSKA 4XXCA 3AWEA 4BIKA 1MZFA 4OTXH 1H8OA 3IB4A 3Q9PA 2OWOA 2WYIA 2ZCLH 4KMTH 3I55V 4N0CD 5I17A 3D85A 1CWVA 2G2RA 1DSFH 3CFNA 3WNKA 2XWJB 4TV9A 2X09A 4CZZA 1ODUA 3RVTD 3LDBC 3B2VH 5AZEL 1HHGB 1G9HA 4FVMA 1I8KA 1PX8A 3KNBA 3BN9D 4S1SL 1U6AL 2DL9A 4ICWA 4B7KA 3RFZC 4B3TO 3VFGL 1ORSB 3MPCA 1T22B 1L6ZA 4G7VH 4KOCA 4ZAKA 5T1LA 1A7BA 5GJSL 3CRQA 3PHOA 1YEFL 3D39D 3AG4B 3QHZH 4OJFH 5FFLA 5JLZA 2GCYA 1J1XL 4X6CE 5ES4B 2WUBH 2WQUA 3HI6L 3AABA 4IBZA 4HOZA 2F7RA 3LNHA 4CSTA 1UXMA 4KRPD 5M94B 2C9UA 1OM3H 3T1YO 4K3JH 1AKJD 1YQVH 5JOFB 5LWYL 3F6JA 1XBRA 4WDIB 4V1DE 3RI5F 1NR1A 2KZWA 3DGEA 4ZDHB 4RBPH 4KKNA 1IGCH 5TDOB 5JW5A 2D3LA 4F2MB 4EDXB 5EN3A 4M1CD 4W6WB 5L7XL 4F92B 1OCZC 1WT5C 3Q6GL 1VCAA 1DEEA 4DEWA 2SEBA 1FVDA 4U6YA 3SDAD 1K5NA 5FA4A 4LLWB 1RURL 2PYLA 3Q8BA 2BOBB 2XBDA 3K46A 2QPSA 4UTCA 5JW5B 3NRQA 3FTUA 3QEUB 2FWSA 3ESUF 3JALA 3AAZB 4FTVA 2YFNA 1MQKH 1AJ7L 4HCIA 1R3HA 5EIBD 2BS71 3IJ7A 4GKJB 1JXGA 1A9BB 3BE1H 1SESA 4N85A 3DXAE 4K3AA 1C9SA 4WZ9A 5H2BA 3DDGA 2EIDA 5IEHB 4LL1A 5AZ2H 1KLGB 5D8JL 3RKPA 4I77L 4RMRA 5IT2H 3T0EB 3X12B 1KGJA 1WWBX 2PO6B 1ZSHA 5KOVC 3L08A 5E5LA 2PP9A 4G9FE 1OO2A 3HKEA 4LOFA 1UD6A 1N64H 1U42A 2E46A 2LOEA 1MNNA 1FE8L 2W9EH 3UADA 1TZGH 4JGJA 2W59A 2VRQA 4FADA 3ABMC 1M3JA 2F19H 5GGQH 5IF0B 1YEKL 3QJHB 1EHLL 3CHXA 1D9KD 1UKTA 3QDMD 2E5EA 3FTWA 3ZHNA 4AYID 4KKCC 1MCBA 5I19L 4RMVA 3HUJF 1SHXA 1AHWB 4G3YH 2FNWA 3OJMB 4DGIL 5K9QI 2YD4A 2FSDA 1WD9A 4CJ1A 3WU2Z 4L2YA 3VVWA 1IURA 1IMHC 5FDWB 5KW9L 3HHRB 3R19A 4NP9A 3FAVB 5AOJA 3ZUNC 4FFWC 5I1CL 2AZUA 2ED9A 4UOJA 4K5LA 5HPOA 3CHSA 3PPEA 4PJ9D 5CEXB 1TQBB 3MV9B 2O72A 5J12C 3PHQA 3LTVA 2MTPA 2UWEB 4I48A 5FYLL 3L9EA 3CN4A 4F7CB 4FQ2H 2XYBA 2C2AA 1Q9KA 1EN4A 4PY8I 4AL8H 4JO3L 4HGWA 4FFZL 4TSAH 1B04A 3LS4L 3KLKA 3BVDB 4TSBH 1FHNA 4F8TA 3QWRA 2VTFA 4WI8A 5DRZB 4HUCA 2G60H 1CP9A 5F0MB 3K5RA 1IQWH 5F7UA 5ABAA 1NWPA 5HHXL 2EO1A 4HBNA 5L3BA 3GBML 4E5XA 3CHQA 4ZSOE 5F1NA 4O58L 4U3XA 5FYJE 2IVFC 2Q0AA 1T7YA 1UOLA 4MJHA 2I60L 4C59B 3A4EA 3FB5A 1DCLA 1UXWB 3C8KB 3JARB 4R4NC 1NJ9A 4PJXF 5JPMA 1RUAL 3FCTB 5LAXB 4KBPA 4FQPA 3PHAA 4NHUB 4XXWC 3I84A 3MRBA 5C0JB 4E2LA 4JFXB 2A1WL 5TE6H 5ABZA 2N04A 2ZOLA 3OKDA 1P84J 3ZMNA 2PXYD 5BRPA 2KLTA 1P4LB 2O5YL 4XPBL 4YXHH 3OLIA 4MMYA 2CO7B 3ZDYE 2H47C 1VESA 2GTZA 4N0YL 5DD5L 3S6CA 3FN9A 1QUPA 2WV3A 1U91A 4RGOH 3EOTL 3OKOA 2WM0A 3G4SV 4PJFE 1EEZB 1JGVH 1EBOA 5GS2D 1XCWA 4QYOB 3GGWB 5FYLH 3UAJC 2VLRB 2SODB 4FZ8L 4GSUA 2JE8A 1SF9A 3HC4L 4AQOA 3P4OB 4MDIB 1QFWH 3LRGA 1TETH 1I1RA 1K8IB 5INCB 3FZUD 2XN1A 4X65B 1RUQH 5GW7A 4N8VA 4ZFFB 5DRXB 1HL5A 4F9PA 4XBEL 3PGDA 4AI8A 1VQPV 1JFQH 2LFGA 1Q9LB 5AALA 3T3ME 5DT1H 1Q1JL 3FW6A 5LCVH 4OZIA 4MNHB 4W1TA 2LLLA 2OTUA 3CXDL 3T0WA 2F95B 4N2OA 1KBGL 5LLIC 1LHZA 3VFUA 4YBQC 3F58L 3BA8A 3GXTA 3IN2A 3KPRB 2Q73A 4HH8A 1B88A 4Z7UF 4P5KB 3FS9A 2VQEB 3NRFA 2J6EA 5BV7B 5JXEA 3GNMH 5DD6A 1M2VB 3ARGD 4I87A 5ALBH 2FLMA 5F7NC 2P5OA 5FFOA 1ZJBA 3D3VB 4RMWA 2P8MA 3RUGB 1F58H 4TNFA 3FRPA 4EOWH 2VJ0A 4PBVC 3C6SB 4FLHA 4GRMB 1FORL 1AXSB 1UC6A 1E3ZA 3LAFA 1J1XH 3QHTC 4HLZH 3OXRB 3ULUL 3U2IA 5IQ7L 2YBRB 3DUSB 1I3UA 3SQRA 4UM9B 4WY7H 5CSZA 4KK5D 4XZUB 5KVFL 1M2VA 1B0IA 4DVBB 3ZS8C 3DI3B 3K0WA 5EOTB 3BVWA 2P8MB 3RUGA 4GMSL 3RWCA 4J39A 2ENQA 3UIYA 4KQ4H 1FKAO 5KG9A 5DS2A 1S9YA 2WLHA 2YMXL 4FG6D 4HJJH 4QPEA 1VZHA 3O0LA 3ARPA 1Y74B 4KGJA 4F9LC 1HJCA 5F6IC 2FECI 3UTOA 1KTJA 1R3KA 5D1XA 1DVFC 3FU6A 5IBUG 2BNRB 3II3A 2DTML 3C3TA 4XXDA 2APWA 1Q6UA 1NIFA 1PZ2A 4YHNA 4DV5O 4P46C 3U48A 2PTTA 2EVJA 4DJMA 1XMOO 2X4NB 3P4NA 5GRJL 2HT4D 2QZQA 4K9EL 4MJ4A 4Z0BH 2EEXA 1ASOA 2ZONA 1WFUA 5FGCE 1CQYA 1S7TB 1R5WB 1EEZA 2Z35B 4JHZA 3V5KB 5BV7H 3GMMB 4YJZL 3OMAB 5BW7A 1MH5A 5KYYB 4ODVL 4FXGC 3QJRB 1G0DA 4M6NL 1C16B 1JPSH 2MKLC 4M8UA 2LW7A 4PB9L 1ZWIC 1CFTA 2R0ZH 5L88H 3ZHKA 4MZ3A 4A7GF 2QGCA 3IAPA 1O7SA 4HXBH 4X9BA 3PWVB 4X5WA 4HSQA 1T04B 4L29B 2AJZA 4NYLA 3H7LA 1GKEA 3MZGB 4JO5A 5FK9A 2XAHA 4CA4A 2NNAA 4ZBMA 3HI5H 4MBOA 1ZAUA 4MLSA 3ZL2A 3SDAC 3ZCCA 1F1GA 5H4YA 1FYTB 5JHLH 1CXKA 4GKSA 2OMVA 4PRDB 2G9HA 1IAIL 4M4RB 2JK5C 3ARTA 4JPIB 2R2EA 2R4RH 5DUPH 1T7ZA 2DQMA 4YWGH 3HLAB 3GBDA 1A1NB 1SBSL 2ALAA 1QFWI 4LFCB 1XIWA 2HCZX 5ERWB 5E95B 5DQ9B 3PWUA 4A04A 4LL9A 1CG9A 5BXFA 3NSCA 1JZ7A 4Q74A 3AZUA 3CFQA 3QUZC 1E90A 3KYMB 1TTBA 3KYKL 2QPUA 3M1OA 2A74C 1JHTB 4ODUA 4RFEB 2NW2B 4HJSA 2X6AA 2WYZA 2CK3G 4MNQB 2Z64C 4PJ9B 1H15A 4GO6B 5J57B 5DUBB 2XOKG 3UMNA 1DUZA 2RCSL 3O3AA 1KN4L 3SPVB 3WLBB 5D2NE 2JV6A 3D34A 1CICC 3M1BA 1TOXA 3CX5J 5DGQA 2AXJA 3MRLB 4JO2L 5CN2A 3VI4F 3WI9A 3VI4B 4WF7A 4WCYH 1QX1A 7CGTA 3VWJB 3KPMB 3BYTA 2WO2B 3FAXA 4DIXA 3LMJL 5D1QC 1CF8L 1E3FA 3P73A 3UAAA 3F12B 3SKOA 1IGCL 2JWYA 3H1HH 4OLVL 1MQKL 1QBLL 2VZOA 1PLGL 3IGAA 3K6DA 4C54A 1KJ2B 5HHOA 1Z9SB 3PL6C 4P99A 2JIXA 4J3TA 3HLKA 4KUCF 1N8OE 1IGYB 3RPBA 3GHBL 1N4CA 1XHZA 3MGTB 1U8QB 1Q0XL 4PJAA 2YR3A 1E9QB 4ISVB 1CFSB 4QXGH 4NAMA 4DF9A 4WI0A 4APQB 5IMLA 1BYPA 4E4EA 1ZCRA 1FAFA 5DVOA 4HSCX 3I6LD 1ZA6B 3CZSA 4LBAA 1J0JA 4FM2A 4M1GH 4OKDA 3UGUA 3HAEB 3V4VL 1IKFH 1E50A 2XG5A 2I25N 2IPTH 3ZKMD 1NKGA 3OTTA 1YYMH 4LLMB 3MGTA 5AAWC 2WQ8A 5FKAB 5B3JF 1BZ7A 3JATB 3I3BA 2IFFH 4FQXB 4PRHA 4DK5A 2Z8WC 3Q2NA 1UXLA 5GZOD 3WFEH 2JJ2G 5DYFA 4H44B 4FL4B 3IDIA 2QM4A 1RMFL 4ZI7A 4ZUTA 4XZ4A 2IPKA 3QG6A 3TO4C 4BEIA 4CC4C 5GGVY 5GRZA 5ADPL 2JELH 1UM5H 1WIPA 3PXHA 1Y6MR 2AP2A 2VE6A 4PJ8A 5D1QA 3VXQB 1THZA 4HV8A 2NUPB 4EVNB 5T3ZL 2YWYA 4P3DA 2IJJA 3AXLA 3EFFK 3MRFB 1NQBA 3LKRA 3QEHA 1KSRA 3AG7A 1SVBA 4QRFA 1P7KB 3B2UC 3LKQA 2DM2A 3WS3B 2YIBD 2DYRC 5FFGA 3VG0L 3I74A 1NLBL 4OF7A 3MA7A 4ONOA 3NCYP 4Y19E 1OAYH 5CBEB 1P7QB 1ZTXE 5BR8B 3U4KA 5CGMA 1BVLB 3QI9B 2F66C 4PA4A 3OF6D 3U0TB 4NT6A 2AJXH 3TASA 3PREA 2EDBA 3T65A 2M6YA 4LLYB 1GJIA 1GGBL 4NQED 1U8OB 4UT9H 3DIFB 2OYQA 1LK2A 4Z7QE 1AR1D 1XH3B 2YGOA 3MXWL 5HJ3B 3ZN1A 5D5MB 2P5WA 3BCDA 3WXWH 1MABG 2LVCA 2C3XA 2D31B 4NQEE 4OFQA 4Z7AA 3ULVF 4UQAA 1UQSA 3EF7A 1JYXA 4JCMA 2JK5A 3LEYH 4PRPD 1AGDA 2DQDL 5H94B 3K2UL 4LLUA 2BX5A 5EU6D 3RTQD 4KGLA 4AYDC 2NPLX 5CB4A 2OYKA 3ERXA 3BXNA 1ID2A 2UZYB 5I74C 5CFAA 2HT3D 3ENEA 2IAAC 1VF6C 1BIIB 1UURA 1Q5OA 1Q72L 1G7PB 3O0RH 1ETZB 2FECL 1S9XB 1QW8A 2CGYA 3X1FA 3O3UN 5KVMC 4ZPVA 4L3CA 1RIUH 4HEMA 4TNWK 5LA6B 3EOTH 5C9JA 3CU1A 2QKSA 3MV7D 4JY4A 4P2OC 5F72S 4KXZH 2WZPD 1T66C 3APQA 3UACA 3BCFA 1GMGA 1LE9B 2A7WA 2MQ3A 5LDUA 2ESVD 1INEL 2R9HD 4L9DA 3PL6B 2EVGA 1FFTB 1AHMA 1PZ5A 2XAJA 1BOYA 4QF1B 3OLDA 4HT1L 4AQAB 3FU9A 4ZK8A 4WDIA 5CBGA 2QV2A 4LR3A 2JJUA 2YXVA 3B2MA 3HN3A 1XHXA 1OL0A 1A7QH 3GMQB 1CXFA 3T0VA 4I88A 4KO7A 4FNQA 5EOCJ 1EXGA 3B6SA 5KVGL 4DK1A 4X8JA 2NXYC 1Z66A 2EVFA 4UV4H 4G71B 4YL9A 1BQSA 1E4XH 4BA0A 4L37A 1F90L 1LDSA 3RDTA 4HOWA 1ZT7A 1NCAL 3GWOA 3PDOA 3FSVA 5FIEA 2R0KL 4MVUA 3ZL4L 1G6RA 4HU8A 4E9TA 1ZY9A 3T8MA 5JQGB 4P49A 3ZMZA 4U1KA 3OW2U 3H0TA 4R3SB 1WTLA 4PWJA 2FT6A 3CDCA 5E6UB 4PDMA 3RYFB 1CBVH 4L18A 5B7FA 3RA7L 1VPOL 2P80A 1N6QH 3FKSG 1UUNA 5EDXA 3T6ZA 4OZ4A 4ZS6D 5A43C 5CIPB 4BKLA 2BSSB 1WLEA 1OAXL 4TKWA 2F1MA 3F8UB 4MQXD 1XQ4A 5I8CB 2WOYA 5IHWA 4CSPA 2YGVA 2ZKOA 4UBDC 3E22B 1NM9A 1WS7A 5KVEE 1OK8A 2ED7A 4DEPB 4QD2E 1FGVL 3SBQA 2HX9A 4FLSA 5I23A 4IU2B 4JN2A 4Y1TA 5BO0D 1ORSA 3GEFA 5K33A 4GLXA 2JTYA 3V7AG 2N3JA 5KVFH 3MREA 1W15A 3S5LG 2J2ZA 2XUMA 4LC1A 5JLZB 3QDGA 2ZUVA 5FM8A 5DUML 5K9JH 2IXQA 5KBKA 4MTXA 1AZNA 2YHGA 4ZPVB 4PJ0Z 3BW9B 4HCFA 3AU0A 4XP5H 5C9JB 1I1AA 5J56B 1IFGA 3S8FB 3TJEL 3VXMB 2HKOA 2EKSA 4I50A 1EANA 2O93L 1ZWIB 43CAA 4AH2B 4PJIB 3S35L 2ZYIA 3M88A 4YIOA 1E27B 5J11C 4ZT1A 4LCWD 3VWJC 1FPTL 3LNNA 4PJFA 3LXAA 4XBPB 2PMZA 5IUSA 1U3YA 5F9WB 3BHBB 4LKXA 3RU8H 4FHBD 4FZEL 3VXNB 2OW7A 4JYCA 4IYIA 1TKWA 4FM0A 1N8RW 3OMNB 1VERA 3JTBA 3MRGA 4LARH 4K71B 1RK0A 3H3KA 1CD1A 4YAQA 2NW3A 5ILTH 1F7YA 3VD4A 2XV0A 5H9CA 1UD3A 3NCWA 4MA1C 2UUBO 4X8XA 3V0VB 4LT7A 3MJ9A 4D0BB 1DFBL 3ESNA 4X6BB 4JE4B 1PNDA 4GUPA 5B1KA 3ZHUA 4UIKH 5IQMA 4F58L 4DV0B 4N90E 3E35A 3HZ3A 3D25B 1OV8A 2ITCA 1DLHA 3ARDB 1KTDA 1CGXA 2F1BA 4LGSB 4N2CA 4UDUB 2LU4A 3F3HA 5A2FA 4YSEA 2EEAA 5GJTH 3L5XL 3L13A 4CKVX 1SA0B 4XMKL 3G5ZB 3T2QA 1U58A 3BVNA 3GQFA 4YHOH 1FJGB 3MCLL 2XZQH 5LQBL 5INDA 2DTSA 1CVRA 3ZHRA 2CM6A 3P3UA 4OZ4B 4WK0B 4BE5A 1BVKB 3M99B 3MJ8B 4KFMA 4KX9A 3GXIA 1T0OA 4KKLD 1AKJA 4XX1E 1URZA 3H85A 3FTVA 4LASH 4ZBJA 4AX3A 3EJPA 5H37A 1ZS2A 3FO2B 4JDVB 3VGHA 1HE7A 3DPBB 4X5LA 3MI6A 4UI2A 1DVZA 2YD3A 3VOUA 1M57C 3SDXE 4LPUA 4F7EB 3TIEB 2Y24A 1W8EA 4Z0XB 2Z34A 4K3EH 4ZMAT 3C5ZA 1WUZA 2VABA 4JPVH 4XNQB 5DZPA 4O2BA 2ADIB 2CPUA 1LK3L 4AEIL 1D5MB 4C57C 2WK2A 5D7HA 3IJYA 2YD0A 4HNAA 3QRBA 2YPLA 3AQDA 1KXVC 2WXLA 3EBHA 3QORB 1FIGL 4FG0A 5BRZE 1M57B 3IDNA 1DBMH 4DV0O 3A47A 3D0VA 4JVPA 2VZSA 4R2GC 1E5YA 4OLZH 5MERA 3O0RL 4EN3D 1NOLA 2AGAA 2HJFB 4P23B 4QRUA 3UTSA 2A99A 3QISA 3BKJL 2LFRA 3ULAB 4UTBH 3V2AR 3ZBMA 5DFVD 2XWBA 5BW7C 5ACZB 3CFEA 4DPRA 3ROOB 4KHPB 4LLVB 3ULSB 1IC1A 3RE0A 5GRXG 4J6IA 5B4MD 3RNKB 1JZ6A 5ISZD 2Y07L 4GKLA 5FO7A 2F6AA 2IC2A 4TVPH 4XPHL 3TOPA 1K4CC 1EV2E 5I76A 2Y5TB 2Q20A 2FBJH 3E3QC 2XJLA 3M7MX 4PRAB 2IJIA 5DS8B 4IHOA 2LAGB 1ADQA 1J8HE 4GINA 3SJVD 3P40A 3P9LB 5J1AB 2FLRT 1XF2B 2Q69A 1KTKE 1KTDB 5HHMD 3CMEV 1OQOA 2BH0A 3LH8A 3N3EA 2V5TA 3VWKA 2G9KA 2GI7A 4A1RA 2Z93B 4H8HA 1XAUA 1IM3A 1WZKA 4ODTH 4PRIE 2HLEB 3C87A 4N0FB 3KJ4B 5C2UB 1FO0L 4X6EA 4QOKD 4QJ3B 5LBVA 1JZ2A 1CDBA 2F58L 5I73B 4N68A 3L9BA 4C8XA 3E2HC 2ZUUA 2A83B 2ATPB 3BIKA 1BLIA 2UUDH 3NZHL 3OV6A 2R0KH 5DSCA 1AR5A 3AG2C 4WFGA 4MXWL 2R2HA 2X3CA 1BHAA 3FT1A 1OD9A 3WMPA 4U7KA 5LCVA 3D48R 2VDNB 1KNOB 2EYTA 2BJMH 4GT7A 5FYJD 1OHQA 3T2PA 1VGEL 3EW3B 2OI9B 1CPYA 1YUHA 1PZ3A 1PF3A 3PE9A 2C26A 4L5FH 3S98A 2X0LA 8FABA 2EVHA 2MPAH 2ZKXA 2XPGB 5IMMA 2KQXA 3MLRL 1N0JA 1HQ4A 4DP6X 1UA7A 4RGNC 2WLKA 4PFEA 2HTLD 3FQNB 1MRFH 5E4EB 4OM0H 4XNAA 3QQ3A 3SD5A 3QWRD 2I27N 2FYUH 2CE6A 1LE5B 4H0HB 1BGYH 2AANA 4GW5B 1PYWB 4JN1H 4YEEA 4L3FA 1FH5H 1HSBA 1A5FL 5MERB 4BZYA 3R0NA 1AYRA 1ZV5A 1HXYA 2FATL 3ATAA 4LSPH 2HPTA 1X5YA 4G82A 5F0PB 2BTOA 2P5EB 3A6BL 1D6VL 4Z7OE 1CO1A 3O6FA 4JMXA 3C6EA 3GI8L 2DWEA 4Y16C 1VA9A 2AJZB 2Y1VA 3CVIL 4NYLB 1GZHA 3G5WA 3VNYA 1SZTA 4G8EA 2XPYA 4XI5C 5EOQH 1XSKA 3QPQC 4XXWA 1NGYA 1AS7A 4U2YA 1LO5A 2WMPB 4AMWA 2B1AL 1H8HG 2C4FT 3L1OH 5KW9H 2F19L 3FONB 2K45A 4E36A 2VC2B 3QZLA 3L7EB 3VXPB 1VF5C 4JZJC 3WIFB 3O6MH 1LQBC 2BHFA 1GR7A 3FKUS 2OA9A 2VSCA 4OZGA 1F4WL 4OI9A 3HPLC 3NJFA 3OT7A 4EB6B 1WFNA 3DRTA 2GJZB 3DWTA 3FCBA 3JV6A 1OAJA 1MJ8H 5GGSY 3VXUD 3KPPB 4X7SH 2AQRA 3OTOB 2ZPKH 2J5LB 2IH9A 4N6QA 1KIRA 1WO2A 2KT6A 3AITA 1XSIA 5CLZA 5ICUA 5DXWA 4YSQA 4KTEH 1DDHB 1HZHH 4L4VB 5EUKA 2CO7A 4YHHB 4CBPA 4GW4B 3OAWA 3L4TA 4LVOC 4DHLA 2RQ6A 3HZVA 1DBBH 4A63A 3KPPA 3PIQB 1KN4H 1KXVA 2H2SD 3H9HB 2XN9B 3QZBA 3O3DA 5GRUL 5B1CA 2R29H 4WTQA 2CDEB 2X5PA 3S48A 4NBZB 1QBBA 2XKNB 3X1GA 4AGNA 1II4E 2FT7A 5GHWH 2XVKA 3E38A 1SF3A 2RHEA 4QTFA 3VMOA 2PTUA 4C83B 4YLBA 3Q06A 4NQUA 1FH2A 3GBNH 3KZIZ 2CJUH 2MOVA 1M1XB 3ZDXB 2EYRA 2NY3C 4U6XA 5F88A 5HGBB 3RWDA 1FC1A 1OAQL 2OXHB 3HRZB 1JN6A 1YSCA 1IIIA 4G27B 5C2BH 2D03H 2AJXL 3FT4A 4IRSC 3CHRA 3VFUB 2I32A 3MD0A 4MASA 5AB1A 2EIZB 2WIIA 2ADPA 2ROXA 1BXUA 2IQ9L 4RISL 2H9GA 4JMNA 1FNHA 2D8KA 3ZRVA 2C9AA 5E6RB 5E94A 1KJ3H 5AD0A 2GHZA 5C3LD 2CTWA 1MRCL 1A1NA 2VLKE 2Q7YB 5I30L 4UQDA 3OLEA 3VD1A 3V4VH 5BUPA 3E86A 2JVDA 3U6RB 4U1JA 4QRTB 1Z9NA 1OM9A 4KUMA 2WKGA 3PP4L 1KULA 4RGMC 4W4LA 1HH6B 2ZCLL 3BZ4B 3Q43A 3JASB 4YHPB 2WKLA 2X6MA 3K79A 1OGSA 3FBKA 2ZUQC 3K8KA 5CBAA 5DC0A 4PJBF 2P26A 4R7XA 3OD4A 3HE7A 2IFFL 3HG4A 4PCSA 5BVPH 5IB5A 2GTZB 5HHVH 1H5BA 1JNNL 3SODB 4B3MB 3BCCH 2EDTA 2JNZA 4M8RA 1LO2L 3CLEH 3OHXC 4WU7A 3MROB 3WHXA 1H2LA 1E43A 4PA6A 1V3JA 4HEME 5L8LB 3P3NA 4ZX4A 2BXYA 4MCMA 3MJ7B 2E6JA 3BKCL 2W94A 2LO1A 2VLMD 3M1BB 3NN8A 4DVRL 3P9WB 1ANUA 3LKQB 4MS8D 3W9EB 3Q1SH 2XOTA 4L0ZA 2KKWA 2A4ZA 2ZWZA 1MFVA 3GDBA 1QNIA 1Q0EA 4AT6A 5B3NA 2QLVB 2YJLA 1SM3H 4L8SC 3U7YH 3CFJA 1ZHKA 5HVHB 2UXBO 3UTPD 3ZR5A 4YDLB 4OIIH 2Q8AH 4Y5VA 3TL5A 4M7ZC 5HDWA 5KZCB 2PR4H 2DN9A 2LP7A 1T89A 1MLCB 2CUGA 1SLUA 3B9KB 1A4BA 4DK3A 1JUFA 1RJYA 5J2TA 4WHCA 1K5QA 1MF2H 2VDOB 1XH3A 4J42A 2NYKA 3FTXA 1MFBH 2Z92A 4A7GA 3RDJA 3X3FL 2IAMB 3POCA 1B90A 3C6LC 1MN4A 1CD9B 3CZLA 5BS0B 2QMKA 4EF3A 1WUNT 1MPAH 4FP8L 1NFIA 1WCBB 3TT3H 1PCXA 4JY5H 1RHFA 3DGDA 4AVHA 3V0WL 4OF3A 2LAAA 2ZWYA 4O4JB 4GO9A 1B6UA 1MCDA 2X9ZA 3QUHA 4RQFA 5HDLA 4M4RA 4NOFA 4PM1A 1Z0MA 5LNEA 3SDDB 4WW2A 5DU7A 4ADIA 2X4RB 3SKMB 5DQJB 1ACYL 4OX9O 1CU4L 3RKDC 4LF3A 3IDIB 4NKDA 2AXFB 3AGWA 1Z5LB 3WIHA 2DB8A 1G7PA 3D51A 4Z7VA 3EG9B 1DQVA 3QIWA 4PRHE 4POZC 1U8NA 4RAVA 5C0FB 1S9XA 2HP4A 2YZ1A 2AC0A 1H2MA 3J27A 1DQTA 2WYHA 4W81A 2X4QB 4M7LH 4CN6A 3ML9A 4HUMB 3BMWA 2VXUH 5K1VA 3G5XB 2C7FA 2VN3A 1SOXA 2PW2A 5CA1B 4BK5A 3CC5A 1CL7L 3I75B 3ZZ1A 1AO7A 2GFBA 3IXAB 3AY2A 4LCCC 5IROC 1KLUB 2Q4PA 2PF6A 3QUXB 2D0FA 2HLDG 3U6XS 2K7PA 5GISL 2HRGA 1WP6A 5T3ZH 4I0PC 5E6ZA 3GTVA 3AM8A 4CMMB 2JDIG 5HI5D 5A40E 1NDTA 2HVJA 2PPCA 3IRPX 2X6UA 5I1GL 3VM5A 1G9ML 4QRBA 2XTAA 1K4CB 4LDLB 2A3QA 1YNLL 3U0PA 4NQCD 4ZMZA 1DYZA 3UO3A 3A8TA 4QCIA 3MQIA 1T89C 3P73B 4JFED 4WFHE 4QXUL 3ZGHA 4PWFA 4AILC 3T3PB 4NUJB 4P05A 2JMRA 1F2QA 4R6UA 1YNKH 5KYWB 4MXQC 3B9KA 4S1DC 2Y69B 1EEYA 1SETA 2AGJL 2XNAB 3NA9L 1TJHL 1HYSD 2E75C 2Z0BA 1SDDB 1XMEB 3W1ZA 1Q4NX 4R3SA 5EU4B 4UQIM 4X6FA 4TSAL 3SGJA 1PZUB 4XXCC 4FKEA 1JV5B 1NCGA 1S2EA 3QZMA 3T1HO 1H3GA 2OCFD 3P9MA 3BQUB 4OF6A 4RBPK 5I1JH 5L9DH 3QUXC 1VEOA 2H4EA 1IILE 1XCQB 4NN5B 1GO3F 2XNAA 2YA2A 2B0SL 3LZLA 5JZ7C 3ZHTA 1C5BH 1E9OB 2D7TH 4HXAL 4MTMA 1YZZA 3BPCA 4Z7UA 3GSOB 1FFRA 3Q7JA 2NY2B 4WGKA 4X6DE 4N8UA 4U1SA 3VXME 3NH7H 5D7EA 4Q97A 1G7LA 1PMYA 4FKHA 1M7DB 4LF3B 3VE0A 4QI3A 4PA3A 4LLDA 4JYAB 1Z5HA 5D2NC 5IJ0B 1WHOA 1W9XA 3QNYA 4Z7VF 2DM4A 4WBNA 1L9PA 4JO2H 4MKTA 5BMFH 4Y2DA 4ORGA 1V27A 4UT6A 4X42A 3P11L 3QUZA 4KK9C 3VQYA 1FYTE 2J73A 3I75A 4LESA 3KLLA 1AOZA 5GS3A 5EUOA 2EDNA 4OR1A 1RP8A 3UBFA 3K71A 1F11A 3CHPA 4PW3A 1TIUA 3T4ZA 3LIZA 2LTQC 3QA3B 3QWOB 1JGVL 5I8EA 5T8IA 4MX7B 2DWSA 4N9GA 3G6BA 1JHKL 1S5IL 1RZIA 4TTDC 3VYNA 4BFJA 3S8WA 4LQFL 5E00B 1WWCA 1MSDA 3VH8A 5H37G 1MW0A 5C09D 5IMOB 2EILB 3W0WD 2MK3A 3APOA 1FZOB 2CBQA 1VKXA 4UNIA 4J9YB 1Z5VA 3HR6A 3UPAA 4BELD 1LNUA 1PGRB 4J3UA 2CK2A 3E8HA 2WWMC 1R1BA 3K5MA 1I4FB 4HC1L 2A0LA 2Q76B 2J6WA 4GS7B 3W81A 4YDLC 3C5JB 3POHA 3IPBA 3B43A 4KKBD 3OJVC 4R7VA 4P5MA 1YZBA 3BZFA 3ZDZF 1INQB 1PCSA 2MNWA 1UTDA 3M8AA 4Q4EA 1KFAH 4OZFB 2XNDG 1QRND 1XGPA 3QDAA 2Q87A 4DT2A 4JR9H 4AENA 1F4WH 1SMOA 4FNLL 3O2VH 1T0NA 3CPUA 3VMPA 3RWRD 4GNKB 4DVRH 3FOLA 2P8LB 2ESVA 1GS7A 5E2JA 3AUWB 3I85A 1ZLVK 2NSXA 1XH0A 4X62B 2B20A 4B9KC 2PCFA 1XGPB 3KG5A 5H4ZA 5E08H 1G4MA 2VXVL 5GQBA 1AQKH 1IGTB 2JCCA 3QGVA 5FYJH 2DEYX 3UGXA 4XO5A 3LKRB 3U0WH 5KUMA 1F18A 2PYJA 2B2XL 2VQ1A 4N4YB 5DJ2A 2WKOA 1KBVA 5I1IL 1UT1A 4X20A 3QDGE 1C8QA 1AOHA 1OTSD 1UEMA 3PFQA 4H2AA 4JFZH 4Z7WE 4EPSA 3KCPB 3MBEB 5FYKD 2CIKA 4CKQA 2NTFB 5D7IB 5BZBA 3FUEA 5I75B 2X6VA 1E6OL 2OCHA 4GAGL 5I82A 5KJ4A 2UXVA 1MFBL 2R7EB 4UQ3B 4JFHE 2QSCL 1NFDB 5CR1A 3SQBA 4JYAO 2JQZA 3GSNA 4K2UH 2CHDA 3FB8C 2TSAA 1SMDA 4L4TD 1E28A 4CN4A 5HVHC 4G59C 4NGHL 1TFPA 3WDHA 4PGZA 2GY7B 3KL0A 2ADJA 1EH9A 2KC0A 3P32A 4WK4B 1KTLA 4YO0A 3Q6FA 1DBAH 3BWAA 3M07A 1EZVY 3TH4T 1ZIAA 3CCLV 3H4FA 2MQCA 4Q7DA 1KZYA 5I8KH 1FNLA 3CFDA 3H2WA 4LKCB 3ZT6A 1KGCE 2J21A 1E5UI 5J89A 5MP6H 3K8LA 1HCYA 1O9HA 3CX5K 1BMGA 1HDMA 3EGXB 4G8GB 2VLRE 4R5TA 4F5CE 5DJ8A 1CI5A 3JV4A 5DUJA 4ZMQA 3RL1A 2QVKA 2FB4H 3N44F 1BMFG 2JGDA 1IQDB 2R69H 1GYUA 4H40A 3CIQA 1XF3B 2GBUA 1TEFA 4JBSA 4U1GB 4Z2WA 4FI6A 1E65A 1SHSA 2QWNB 4RCAA 1M71B 4LPTA 1KYOJ 2ICWJ 1LP9E 2NX5E 2W60A 1IBLO 2CO3A 2VR5A 1SBSH 2BSTA 2YLKA 1F4XH 3AFLA 3UG5A 4HZAA 3MXWH 2F58H 4I0XB 4GLRH 4G1EA 3DRQB 4J8RB 3C5SB 4MZIA 3VCLA 3DC6A 5KAFZ 1NA8A 2A9DA 3MRRB 3HB3B 3QNZB 4WWKA 4X98B 1C12B 1I75A 5I8OH 1MZZA 4JO1L 4G70B 4GBXC 4JQVC 4HUXB 2JCCF 4NN7C 4B0MB 3N50A 2WJ5A 2ZXGA 4OB5L 5HJBA 2CO6B 4HEPG 1WFJA 2A9NH 4IYHA 1AXTH 3MYJA 1MLBB 2DD8H 5L2JA 4ZW6A 4QO1B 2ZQMA 3F85A 1NLDL 2XPGA 5IMMB 1ZE3H 3QS3A 4X6DB 4X6DF 1YJDL 4KUZL 5T5NG 1TENA 4POUB 4X4ZA 3T77A 4LQ1A 4ZXBD 1BZOA 1ES0A 2W9DL 3S37L 4A67A 3JWDC 1AFVL 3SKJL 1QFWL 2FSEA 5K39A 5D1XC 4Z3EA 1QBAA 1YJ9V 2H26A 4WQOA 4JE0A 3CX2A 3ZDWA 1TZHA 4CL7A 4Y7OC 1OE3A 1RK0B 4I55A 3QIBD 1S9WB 3LN4B 5T1MB 4NO2A 4ANWA 4CH3A 2H0PA 2H2PC 5CLXA 2WQAA 4UOW0 3EFFA 4HETA 5KSAB 5T5FH 3T0EA 4LSRL 1RFDH 2CG9X 1E67A 1KGUA 4MCYA 3DO7A 3UTTA 5FW6A 3F7YB 3N44B 4NO0D 1FIGH 4FLQA 1DSFL 4MJID 3QJQB 4Z5RB 2VL5A 3FOMB 3MNZA 1AHKA 2ZOUA 3N55A 4BHUA 3VQMA 3BUDA 1J1OL 3JV4B 2PYEE 5ISZE 3FH7A 5JXEC 5CS7A 5T33H 3ZE2F 2QVMA 3FUDA 1PG7X 4KXZI 2DQJL 2O6CA 3INUL 3IM1A 4Q9CA 5IJ9A 1MQ8A 4P48A 3BZ5A 1SYSB 5E5MB 2XKSA 2YPLD 4HK0B 2MNUA 1WZMA 1TA8A 2QFRA 4FQCL 3X12A 4ZW5A 3FO2A 5C0DB 2CLVB 2KZKA 2NOYA 4ODXB 1X4ZA 4JY6B 1XCTB 2MCPH 2HA1A 3B5GA 1I53A 4QY8A 3VXOB 2BCCH 1LGVA 1TF4A 4MB1A 4LH6A 4W68A 5IQ9A 3US0A 1YDPA 4MNQE 4K07A 2UX6A 4U6VL 3F5TA 1S7XB 1K5WA 1KTRL 4RZKA 3TA3B 5IJDC 2OMUA 5JHDB 4LARL 3CCMV 2HWZH 3X13A 2VL4A 2X40A 2Y1AA 3ULVL 1U2CA 4HUXA 2Z5UA 3D8MA 4O2CA 5GJTL 4CGUB 1CGTA 3CU7A 4ZMOA 3OTFA 1H6UA 1T4KA 3ALWA 3QF7A 4JFUA 2O61B 3DO3A 1LMKA 3QO1A 4X4MA 5BVJB 3VDBA 4I2XB 2VLLA 4IU3B 2A2QT 2NW3B 3TBSB 1FZKB 4PVNA 4YJ2A 1GN4A 2FWUA 3V4PL 1X7SA 3V0FA 5DC4B 5SV4A 2GUZB 1F6FB 2GITA 1XEUA 3TNMA 3RIFK 1NBCA 4G8FB 4FFBA 4DR2O 3EDKA 1E7UA 1DEEB 3DK0A 4HUKB 2UWEA 1KWKA 4HIHB 2Y6SD 5GONA 4O00A 3K2UH 1PNKA 2ZXAA 1YCIA 2LT9A 3SR2C 4M6OH 3RHWK 3UCQA 3L4XA 1XF4A 1ZHBA 3HG1A 3LQAH 1CVSC 4Z7NF 4NWUL 4Z95L 4C58B 4H1LG 3EGDA 3ZX6A 3MRBB 3D36C 2GBAA 1R3JB 3V6ZB 5DJZA 3N1GC 2RGSA 1QLFA 3CN0A 3ARQA 3D2UB 4HUNB 4P2ZA 4PJ7B 2C9QA 4OZGB 4H26B 3L4WA 4FQCH 5IROA 3QC6X 3ZTCC 3TF7C 3KD4A 2PO6A 2IIJA 3H1JH 4YSAA 1NSNL 1IGFH 1QR8A 2XTSA 1S46A 2OJZL 3QR0A 2X0WA 5AQ0A 5T5NF 2WIMA 4ETYA 5LKNA 4JI3O 2QKCA 3TJHC 2VLRA 3V9EA 5IV2B 5AYQA 1PNCA 5K9KA 4P23D 3RPKA 1KLFA 2Y5EA 3S37X 4F37F 4NGHH 2DLFL 1ZA3A 5HYJE 4LPXA 2NNXA 2C1OB 1IVLA 4U1HB 1IGML 2K1MA 4B3SB 1MCWW 4XCFH 5F0JB 3WBDA 4LVHC 1HJBC 1J5HA 4YDJA 5C0JA 4XCYA 1QCEA 3MRNA 3EJZC 1A7OH 1I5XA 1QAWA 3V4LA 3N5AA 1BJ1H 1N3NB 2WP3O 3BPZA 3N85H 1PM9A 1FBIH 4OZHF 1AVMA 4YHOL 5EPMA 1FGNH 2FO8A 2VLJD 4ZMPA 1SQFA 1SBBA 2EH8L 4OGQB 4PJEA 4UT9A 5A3IC 2EXSA 4ONHA 1N5AB 1XH2A 4LXFA 1IBKB 1FVEA 1NCAH 2DM7A 3I3EA 5DD6B 1X7TA 1E9PA 5ESVA 4EKJA 4KQ4L 5B39G 2JKLA 2HKHL 1RK1A 1WWWX 3WG7B 1KJVB 1MXDA 3ZE0B 5F9OH 2ARHA 3OZ9H 3ZE0F 1U2HA 3HI6H 4MD4A 1MY7A 5IJKA 4HIJA 2PNDA 4EFBA 5F7KC 5J1AA 3S3DB 1PFCA 2ERJC 5HPMA 2XX1A 3BT0A 5FECB 1XV8A 1UJTA 2OTUB 3RWCB 2KHAA 3MFFA 1PX3A 4B96A 5C2BL 4CU8A 3TBTB 3LVTA 4H88H 4GRWB 4QHMB 4HIQA 2YEVA 3UO2A 1UB6A 3MV8B 3WIIL 3H3PH 1Q94A 2IOIA 2L0DA 3ZW3A 3RVZA 1NMCC 2WVVB 2CJUL 3EBIA 4NZFA 4RISH 3QXUA 4K7PY 5BUGA 5E0FA 3SE9L 5DJZB 5FUZH 5EF0A 4DKTA 2FTKA 3DHUA 4IKLA 3ZR6A 4AQ1B 3FRPB 3O11A 2F0CA 3S96A 2E5LB 3U83A 2A9HA 3K4ZA 2IJ0C 2X0UA 4GRWH 5DD1H 4RAVB 5FYKU 1Z1WA 2QKIC 1FL3B 5IGXH 5HYJB 3MRKB 4XBEH 2NT0A 2NY3B 2K3TA 5LN8A 5GTIZ 1RU9L 2ZOLB 4HKXA 1UATA 4A2LA 1D2DA 1RV6X 2YI8A 3N40P 1IAIM 2YD9A 4AQ1A 1VQKV 2V2WA 3WFCL 1DJZA 3JQOB 1LQSR 1KN2H 1VDGA 4HZLB 1XXDC 4I77H 4FN0A 4AYGA 1XIWD 4XODA 3CMAV 4F1ZA 2Q9OA 2XN9A 4G80B 1NDGB 3WLWD 2YC1A 1I9IL 5EWIH 3FFDA 1NTMH 3B7UX 3WS6A 1ZVSA 5KSAD 4QT5B 2VLKD 1HKLH 1U95A 3ECQA 3KYNB 1M4KA 5E8NB 2PPFA 2QT6A 3P0YL 4ZAKC 5SWSA 3CZFB 3GS4A 3O3BB 1LO2H 1G94A 2ILMA 2QADC 1TYEB 2ZNWA 3CLEL 3NZ8B 4U6XB 1TO4A 4P3CH 3NG5A 2YD7A 2A6IB 1WAZA 5EBLB 1R0AH 2QVIA 5ERWA 4ALAC 1KT2A 4DW2L 4YUEL 4IKIA 3RVWD 3PAVA 5KVGH 3DROB 2HWZL 1QSFE 3QIUA 4G6KL 3FFCA 4N24A 2XXCB 2IWGA 1I3GH 4LF8B 3SDDA 2BP5M 2AJVH 4K3DH 4KHXL 4Y88A 2PWDA 4CH6A 4OCSH 4AE1A 1AIFB 2NUTA 2B0SH 5A7BA 1IEBA 3QQ9D 3I50L 5DFAA 1MCOH 2UWEE 3RLSA 2HUEA 5HHOD 2NUPA 4EVNA 3RBZA 3REVB 5BRZB 1JPGA 3LKNA 3VYOA 3D3QA 1BZKA 2RACA 4FGMA 5CJ5A 3LKPA 2E59A 1E40A 3JASA 3OFNG 5C8YB 1MG3C 3U36A 4UNVA 3HE7B 2PPDA 3QJXA 4MNGB 1YI2V 3ZTJH 2NY4B 5FO9A 5BS0D 4HKBA 4JHUA 5JNYB 3A6CH 4FA8A 4DR5B 3RQ3A 3WENA 4R9HA 2EIKB 4M5SA 2NY2D 2R56L 2EO7A 3QTCA 2D73A 4X0KA 4X7EC 1CL7I 1AB3A 3V0AC 4M3KB 1ID5I 1BBDH 2HTKD 4JZ2A 1IAOA 3IFOB 4Y4HB 1LO0H 1HN1A 4RNRA 4PJAB 5DLMH 1C5CH 4ZUUA 3U7AA 4F3FB 4FFTA 1BAGA 5LMNO 1AR2A 4F20A 1G4YB 3OMIB 2LU5A 4LQFH 2OXHA 1A6ZA 1OJHA 3HBPA 4AGQA 4EMZA 4UOZA 2CUAA 4NEHB 3VI3F 4MVOA 2I24N 4FA7B 1BG1A 3B7SA 1L9RA 4JM4H 4YDIL 1HHJA 3VFVA 1YMME 4P2QA 2MQGA 5ILTL 3BXNB 4NC0B 4XC3H 3TH3T 3CDFA 3QIWD 4N2GA 2QELA 3DX8A 3S8GB 4BWAA 4I18B 1FC2D 3FRUA 4NXSA 1T80A 3VX0A 1V5JA 3IU4H 4NFCA 3VFMA 1AS8A 2IGLA 3QJFA 2ICWA 2HRLA 3MZTA 4HISA 3AXHA 3AS3A 4P5TA 3V6BR 4F2ME 4ISVA 3GF8A 1MVUA 2BVEA 3LRSA 5DFWH 1MFUA 4H5SA 2P28B 2Z0AA 1IU1A 1SN2A 2BSBA 4X5XB 3IFLH 3L3KA 4X2UA 2Y06H 1IBMB 2C8NA 3ESMA 5I0ZA 4F9PC 1KIPA 3CXDH 3PWUB 4FLRA 4KX8A 1S7WB 4TVUA 1QYGH 4G1MA 2FNBA 4LLMA 5CCKH 1W2KT 2Q7GA 3EYOB 1KUQA 2FL4A 3SYPA 4WEMB 3TN0B 1X4XA 3GWJA 5EU6A 4DOHE 4Z7WF 2UXDB 2ZICA 3JWOH 4J6RL 3U1QA 5JJNB 4OX9B 3NPSB 5FC9A 4YHKL 1TUBA 1HI6B 1W0VB 3T08A 1FL5B 3IMTA 1TZOA 3VXQA 2X0VA 5CEZE 3AQYA 3QUXA 4KQ3H 4XNZC 1C5BL 3D07A 4Z3JA 5GS0D 5KHKA 2A6DA 2C34A 2WBJB 3H9SE 3OPZH 1N6UA 4GKNA 1VMGA 2CGNA 4LH7A 1AZZC 4PV8A 3VXRB 3PNWB 3ARUA 3CRAA 4XC1L 3VH8B 2BS9A 4CC6A 4CVZA 5L4JA 1FFQA 1CI3M 1MFCH 2ENPA 5B1OA 4XPTH 1V7ML 1K4DB 2MQ0A 1J1PL 1T5WB 1OGAD 1VEMA 1WA8B 3L4YA 4XMZA 1IZJA 3TT1H 2DICA 4HPYH 1VQ4V 3UC0H 4ELMB 3QQDB 3EJUA 4N1CA 2E7CA 1FZJA 4ZMTA 1FRGH 1N10A 2WQRA 2YARA 5FV2A 2HUHA 3GMOB 4TUJB 3ES6B 3IYLW 2WLIB 2X70B 4XPGH 1V7NH 1X4TA 2X9XA 4NWTL 5T5FL 2RMKB 1R6TA 1IGJA 2YPVH 4OW6A 5DM6V 4WGWB 1G7HB 4G72B 4BZ1L 4LLQA 1ZLSH 3RYMA 2FQGA 5I1KL 3HVDA 1AI7A 5CCKL 3GMLA 3A67L 5F7EH 1B2WL 4AUUA 4Z7NB 1WJZA 3TBWB 2R8SL 3C8DA 2DRUA 1CFNA 2J25A 2HFGL 1U21A 2XBTA 5D93C 4Z7WB 2WOBA 1GZQB 3CQFA 4Y0GA 2Q5BA 1UH3A 2FO4A 4M02A 3RWGB 4EAEA 4I0XA 3CZKA 1Z9LA 3U30C 4EDWL 1HEJC 5GSVA 3C5SA 4JFEB 3N6YA 1ORQA 3V8CA 3K6IA 2JCCE 2VDQB 2EIJC 3JUYA 3ZRWB 3EFOB 2ZR3A 1EEQA 3BFOA 2YIAA 3MAQA 5LOVB 2OSYA 2XN0A 2EEBA 3EYOA 3J81N 4Z7WA 3BHBA 4NBXB 1Q90A 3N2JA 4TUYA 3KLAA 4PGCB 4QWWD 5DUMH 2VERN 5E99L 5TH2A 1U97A 3EZJB 3RWGA 3FYIB 2PO6C 4FQQB 2D9CA 3VRIA 5TDOA 8CGTA 3DC5A 4PJIF 4IRJC 4PVLA 3HPLB 2AQSA 1PKOA 5CZRA 5HXMA 3KL3A 3EF4A 3EJYD 1VQ9V 3SGDH 3LV3B 3NCJH 3ZLQC 2VO8A 2FJHB 4J11A 4JI0O 5FYKE 1UZ8A 3KCWA 3FB7B 1ZVNA 2VDLH 1DZ0A 5C7XH 5SWZD 5LMUO 1OF2B 1T3FA 2PP7A 4S2SA 1S9WA 3LN4A 5T1MA 4GW1A 4LAQL 1I8IA 4PCTA 5I1LB 4L9LA 4ODWA 5D7JD 3K2MC 4DN3L 1RZ7L 1KYFA 4DFIA 3OR7A 1LO3H 2EXYD 5IEKA 3WUZA 2Z8RA 4BZ2H 2CLRA 3WIIH 4PIBA 1SXBA 4X7CC 5EZLB 2AEWA 2I07B 1GS6X 3WDJA 1F02I 2HG5A 5E8OB 1WBXB 2V17L 5EU5A 5D72L 1WFIA 2QJ1A 1KJMA 2XWJA 4RAUB 1SVCP 2J1ZA 4RSVA 4DGWC 4CADA 5DD1L 1ONQA 4BIZA 2DQHH 3DX6A 3GI8H 4KI5D 2EACA 4NJAL 3QDMB 1T4WA 4IKJA 2I07A 4KK6D 4LCUA 1XB3A 2PYFA 3TJTA 3G67A 1HZLA 2G60L 1ZDSA 4HD5A 5EU5B 3O4OC 3LHPH 1LP9A 2NX5A 5GIRA 3MRJA 1URLA 3F64A 1X5XA 3ROLA 1RVFL 3UTZA 2YFOA 2EC8A 4YXKL 3QZPA 2J88H 1B2YA 2WKOF 4N3TA 5EU7E 1ACZA 1A6VL 3PCYA 1LEIA 4E41A 2BWDA 5F9JA 1COBA 5CKAA 4Y4HD 4FZ0A 3ARBA 3LB6C 5TTRA 5CWSA 1GM9A 4IHBA 3WSQH 4ZD3L 1BM7A 4HK3N 5B39A 1BYNA 5DGRA 3QNXB 2AGJH 4JB9L 4IJ3C 3DV4B 1YN7A 4NPYB 2DM3A 2VH5L 3D25A 5KSBA 5EIVA 2ENSA 5D71H 5C0EB 1PZSA 1BVNP 3UX9B 2F8OA 4Z7IA 1IIKA 4LCWE 3VO0A 2RNBA 1GY2A 3NGBC 5DJCA 3R7QA 3WV0A 1Q82W 2HJKA 3BKMH 4AEFA 4HAFA 1HKLL 5ECGA 2EINB 4G7YH 2QWQB 3WIHL 5HI4D 3RVUC 4ZQTA 5A1AA 1YITV 3WN5A 3VXNA 3UOAB 5T1KD 3CFBB 1J9QA 3GZKA 2EDKA 3WUWG 2ICCA 3QW9A 1RPKA 2EIJB 1FO0A 3EYSH 4IRSB 5D6DA 2VL5B 3FOMA 3FSZA 1XSOA 3MNZB 4R7NB 5JUEL 1Q38A 4B9ZA 1Q81W 2IANB 4AI7A 5EO1A 4PBWD 1XZWA 2QSQA 4QKXB 4Z95H 5IW6B 4PUBH 4UWQB 2EH7H 5ITBL 1DQJB 4M6OL 2VR9A 1XF3A 1BP3B 5LG1A 3TIEA 3FCUB 4UZGA 1ROCA 3FQ2A 3OSKA 3EBGA 2GTQA 4NDMA 1MOEA 4OF8A 1BEYH 2E9JA 4M7LL 3QJHA 3IBOA 4Q14A 3TN0D 2Q7AA 1KB9J 5D8JH 4J3SA 1H38A 2O1AA 2VRAA 5TPWH 3VB8A 1Y76A 3Q1EA 4JN2B 1T22A 4YY3B 3D0VB 2D4DA 1D5NA 1DTOA 2DWXA 1EXHA 3IMRA 1AS6A 2Y4UA 1AG0A 2PYED 4ODBD 4FLVA 1VZIA 1PL4A 1U8MB 4UUJC 5IW1A 3VXRD 3WXVL 1R3KC 4LNVA 1IM3D 1TLKA 3AS1A 3G7TA 2ZUXA 4I9WE 4RDQG 3MJ9H 1EZSA 4JDTL 1JHLL 2XVGA 2HFFB 4QTHA 3LD8B 2JKJA 4OGYL 1NAKL 1MI5A 2IV8A 5TDPA 4DFHA 2CTPA 3T5WA 5IVXA 5E8DH 4M3HA 5C0NC 1N12A 2OXGB 3F62A 1S5HA 2A4CA 4J9ZB 3O3EB 3WMSA 1ZK9A 4GX2A 2XY2A 4I9WD 3FHAA 4MJ6A 4NRYB 2GEQA 2R8SH 2MKWA 1WT5A 4FFBB 4OCXH 2AEIT 2Z65C 1K97A 1DQQB 3ETTA 1RUPH 3G71V 1W72H 3K4DA 4ZMYA 4G7RB 1G7MA 5IB1A 3I3DA 2AF2A 4BZ1H 4PV9B 2E7MA 2F15A 3DJRA 2VDPB 4N0FA 2B4CC 3RYIB 3S3JA 4GT1A 2ITDB 2XZQL 1ND0A 4E5XB 1EM1A 1PKQB 4LIQE 2JXMA 5B8CC 1L0QA 4GOSA 3VDAA 3QXAA 2EEDA 3SGKA 4UDUA 1EAPB 3A22A 5LWYH 1G4RA 2CAKA 5E23A 5FO7B 1TSRA 1MOFA 1UB5B 5IOKA 4WFFE 1MCEA 4HS6B 2BIPA 3U79A 2EXWC 3N1FC 3TLRA 2O6FA 2Y7SA 1XGRB 2VXSH 4JRYE 4O4LA 1E4KC 1EZLA 3H1IH 3GO1L 3MGOA 2YEQA 4G6KH 1YDXA 1Y1DA 2E9GA 4P07A 4K35A 4R96A 5J9PA 3D05A 4UYQA 3NA4A 1MHCB 4TQDA 5L4IA 1SYSA 2JKSA 2Z3FA 2L6LA 2XPZA 3MRIB 1ZT4B 2F7PA 4QEGA 5IWAO 4P2RB 4HJJL 4XNUL 3GVMA 3BY6A 1U91B 3ECBA 3C9NB 3FXIC 4KJWC 4Z78A 4UOW1 2ZKHH 4JRLA 4LBEA 4JO4H 3RX7A 2YD2A 1NEZB 3IC9A 1H3WM 3ZSTA 3MRNB 4OAWB 2GEEA 1JF1A 1EZVH 2JH2A 4F6RA 1CLOH 5FKPB 5IFAL 4OJYA 4P4KD 1YMHA 1G6RH 4U1GC 1M5IA 1YEGH 4UOQA 5FDWA 4XC1H 2FHCA 2ZKYA 2OZ4H 3HPJB 1BLNB 3WEMA 4P2RE 1TQUA 1FNSH 2UXTA 5D7IE 2CDYA 1CTMA 3D3VD 4KJPD 3KYKH 1S7TA 2VMFA 2ADGB 2MOQA 2WBJC 4LRNH 2VSKB 1M93A 5JA8B 5DURD 3F01A 3RX8A 3HG1D 5EC2C 3BD4A 3FH8A 3VXSB 1WAEA 2DQTL 3SQOH 1F8TH 5B21A 1FS0G 3D3VE 1RZKH 3ZRFC 4QRUB 3UTSB 1RUQL 2YAHA 3FQXA 4N5ED 5LGYA 4GH7B 4YXLL 1OVZA 3ARDD 3AWGA 1TDQA 4B7LA 4XN5A 4IRZA 1ZJAA 4HCRH 4TVPD 3K81A 5EBLA 1A9BA 1IEAB 2WQWA 2ZCKH 1OP9A 3EDJA 4JUTA 5E6YA 5EB9A 3SBRA 4WKZA 2Q5ZA 4JDEB 3JTTA 1HNWB 1DBBL 3IPFA 2ZP8A 1LEGB 1YN6A 1G9NL 1V8HA 2R0WL 2VERA 5DZJA 3MA9L 3W39B 1GL4B 1YYCA 1NKRA 2OX5B 3GB7B 4ANVA 4JM4L 1LLAA 4DVBA 3IJSA 2CRMA 2MCPL 3QCTH 1KXHA 1NGXB 2EDFA 1FFOB 4DR1O 5DK0B 2W92A 1IM3B 4PJ7F 4YVUA 5EBWC 3LD8C 4DO4A 3BDYL 3WHXB 2RDCA 4MQTB 3TCUA 3H9HA 3GXFA 3MLYL 3QQ4B 3MJ7A 5LGKA 1UZGA 3VU2A 5ETUB 3OGOE 4DV1B 1NU1H 2R72A 4FFYL 3PGFL 2IADA 1EGJA 3X13B 5EEVA 4W9KC 1HT6A 1S3RA 2H41A 1IQWL 5JOPD 4FCHA 1F4MA 3ZY7A 3LRKA 2C9VA 2Z35A 3V5KA 4BFOA 3F5WB 3RYCA 4MTGA 1RZGB 2L8AA 1JNNH 4UCSA 4L8BA 3GS0A 1QVOB 1YJDC 3LHAA 2IMNA 3R18A 1RFDL 5HDBE 4CNIA 3E8FA 2J1WA 3HNTL 4J6RH 1IBLB 5LVEA 1SGKA 3G9AB 3CV5A 3BKCH 1OANA 1M7XA 1T0MB 2TRYA 3MMEB 3K58A 4DV3B 2UY7A 3H9SA 5ACMA 1CFMA 3PWPA 4O2FA 2NQCA 3QPXL 1CDIA 1TNNA 4AMKH 1GGIL 4BQ9A 5KSVA 5HHVL 1WBZB 2F7IA 2IAND 3OR6A 2Z31B 3OPZL 4JRXA 4LEEA 4NNPL 4PJCF 4Q6KA 1YC8A 5FUCC 3TXAA 1TITA 1AP5A 3QRGH 2R0WH 4GSQA 2Z8SA 4JI6B 4HS8H 5D70L 1R9FA 4PRNA 1XF4B 1R47A 2YUVA 4NAQA 4YSOA 1JI1A 4KDTA 4N23A 1A1MA 3JT0A 4K15A 2NZ9C 3WCYA 4XCCL 1OE1A 4Q8BA 3QG7L 5F88B 5HGBA 4FKKA 1OE2A 2BOCB 3VFGH 2X4TB 1N0LA 1TVBA 2UXGA 5LN4A 4Q58C 1CLZH 2BNUA 2UZPA 4Q9QH 2BTQB 3GLDA 3FB7C 2VSDA 2FJSA 3GHPA 4QIRA 4YHIA 3MV9E 4I8DA 4UILL 3CZJA 4OKVB 4MS6A 1MAMH 1L0YA 3VGFA 1L7IH 1X3DA 1JHTA 2CR3A 3MHZA 3ARXA 4ZUTB 3MCKA 3M17A 3NJHA 3D9AH 4MDRA 5KG9B 4MW3A 2XN9D 3RIKA 4G1MB 4GX1A 3G6EV 1FIEA 4B3EA 2CTRA 4AYFB 5F93C 3ILQC 2YLHA 1MJUH 3OKLB 5T3XD 1LDPH 4OKVA 4WTWA 4P06A 3UTPE 4BKSC 5LB1A 5I1HH 2ZKWA 4P5TC 2BIMA 4FFVD 1EJ6A 1NCWL 5BJTB 2P67A 4LEXH 4LPWA 5SWSD 3ZHLA 2L4OA 4WO4B 3MA7B 4W6YB 1T7VA 4DV3O 3WTWA 1TQTA 4GKSB 1SQVH 2KH2B 4ZUVB 1DJIA 5ISZB 1CB4A 3RFZA 2BSCA 4G80A 5D93B 5TQ0H 2I5YL 1MVFA 5ANMA 3ABZA 5HHOB 4G43B 5DCCA 1NEZG 4A6YA 2PW1B 4YJ3B 1WE5A 3TURA 5CU9A 2CSPA 3DX9A 3F65A 1X9LA 3QCUH 1UWYA 3OEEG 3PWLA 4UMSA 3NZ8A 3T1FA 4KO6A 4O2FB 1QHPA 4MQ7A 3S36X 4GUQA 3JD0A 3K04A 1LWRA 1W0JG 1LVEA 3QC5X 4N90D 4J41A 2JK5B 2VN7A 5I2IB 3VYPA 1OHHG 5LXGH 2YEVB 3RGBA 1U8IB 2KPNA 3GXUB 2Y3AA 4LOVA 1DQDH 1BD2A 6FABH 3CQQA 4NQCA 4TL5A 1P4BH 4V1DD 4XR8C 3C60C 4N8VG 1D5BA 1RZQA 2Q7YA 3U46B 2ZYSA 4N2LA 1CDHA 5AW4B 4ZNCD 4WJKB 1YMMD 2WBJD 1S3KL 3AB0C 3FTSA 3KCYA 2RALA 1JZEA 3KYMA 4ZNEA 4HKZB 1JPGB 4J3VA 3CE1A 3REWB 1SNRA 2HZHA 5F3HB 2DQ6A 2YZ8A 1AZVA 1TZIB 2Y1ZA 1QLRA 1PFOA 4KI5F 3MXVH 4LEOB 3RZCB 1D5XA 2ZE7A 4PRHD 1VQLV 1U6AH 3QFJE 4Z7VB 2VDOL 2J8UB 1DBKH 3V5DB 2Q67A 1LD9B 5LHIA 4X7TB 1HI6A 4OGYH 3CRMA 1U3HD 5DZNA 2CUHA 4F15B 4KJWD 2ENJA 2EYSB 4JPKL 1IM9B 2IDFA 5MI0C 1TQBC 3PNRB 1BW8A 1YG9A 1A9VA 1BECA 2DDQH 1TCRA 3QIUC 1U8LA 4LGPB 3KWTA 5KYWA 4GAYA 1QA9B 3S88L 3V5DA 1EUUA 1PY9A 3FTGB 4GRLB 4WO0A 7FABL 1K6QL 2K78A 2GV9A 3ZHDA 2QKIB 1N34O 3UBHA 4KROC 3LNMB 3BT2H 2XHBA 2X1QA 2J8HA 2BVTA 4JFYB 4KY2A 5HJ3A 4TVSa 4NAJA 1MUJB 3CRCA 4PD4K 3CVHB 2ZNXA 1R6VA 1NCDH 5JIDA 5I6PA 2ZXWC 3HKDB 4G42B 4Q9BA 4UUJA 1UVQB 3L7FB 1Z32X 2H3KA 5IHZB 1HQRB 2AK4E 3T4YA 1E6JH 3PABB 3V4PA 1RD6A 3CLFH 4B6ZA 2EADA 4EI5B 4PYGA 2XQYG 4I7ZB 4ABVA 1J8KA 3OC5A 2H7WA 5FLXN 4HGKC 3THMH 4YSPA 3HE7D 1T2XA 4JEGB 4ZQKA 4IBLT 5IJ0A 4TVPL 2ZT9C 3CUPA 4GKZB 4HPOL 1XQ8A 1A47A 3EO9H 4NUGH 5TGBB 1A8ZA 5MEQB 5EO0A 1AI5A 3PF2A 1GGUA 1ENVA 4K5NA 3E22A 2R69L 5IK3B 1BFOA 1XF5B 4RQQB 3M86A 4CADB 2MIZA 4JM0A 3O9WD 4OCLC 3F7VA 2XWRA 1YSOA 5AWNH 4S1RH 5LGTA 3UT5A 2A79B 5CEZD 3FQYA 1S9KC 2YAQA 5C0ND 3RTQA 1NZ6A 1N59A 2R0ZL 4NKDB 3TYGL 4BSWA 1I7TB 2W1NA 3PWJA 2NTFA 3O2DH 5TE7H