3ABLB

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ablB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ablB02
1DYZA 5F7AA 1PZAA 2AANA 1ZPUA 2GB2A 5I28A 3T6WA 1MZZA 1M56B 1ET5A 2AZUA 1L9QA 2IWEA 2BWIA 1OF0A 1WA0X 3BQVA 3TBBA 3WIAA 4YSQA 4A66A 1PNDA 2BW5A 2MRYA 1CC3A 2CALA 1JZGA 3T6VA 4NERA 4WTQA 3CZUB 3NJGA 1GR7A 1KDIA 2XVBA 2B3IA 2XYBA 3X1FA 2BW4A 2PP7A 2CAKA 3NJHA 1AAJA 1W8EA 1AACA 1PNCA 2H5UA 1L9TA 4Q89A 3PAUA 4F2EA 2YAQA 1X9RA 1BQ5A 5ANHA 2IH8A 3PAZA 4PAZA 4FAAB 1E67A 1L9SA 1W6WA 4AKOA 4BXSV 4KOCA 5I5MA 1ILUA 3UGEA 5I6OA 2RACA 4G72B 1RZQA 4GP4B 2H47C 4PCYA 2VSMB 1OE3A 3WNJA 4CSPA 1JXGA 1A4AA 2W88A 4JHVA 1KYAA 2I7OA 1KBWA 2VW7A 3TASA 1AOZA 3IN2A 1AQ8A 2VM4A 1SHWA 1I53A 1QHQA 1OOWA 3X2QB 4N8UA 5B3SB 4A2EA 2FT6A 3FYIB 5D4IA 5E9NA 1OCRB 3UAEA 1IKOP 5I6KA 4CSZA 3ASNB 1RZPA 5TK4A 2EIKB 3AG4B 1JZHA 1J5DA 1JVOA 1YLBB 1QNIA 2ZXWB 5B7FA 1HAWA 3FSWA 1W6LA 1XB8A 1TU2A 1EZLA 2R7EA 1MG3C 3L45A 2A3TA 1SDDA 3FPXA 4HALA 3AW5A 4GY4A 2IDUA 1OCOB 4A67A 1AIZA 1ZV2A 1SFHA 2AVFA 4E9WA 2NRDA 4TXVB 2PPEA 4M3HA 1JVLA 1BXAA 4YSSA 1E5ZA 2QDVA 4GXFA 4HIPA 5I6PA 4DP2X 4DP9X 1QLEB 4A68A 7PCYA 4P5RA 3NJKA 3FQ1A 4BK5C 4ENZA 4E9VA 1ASQA 3EH3B 5PCYA 4YSCA 2LLNA 1CYXA 2J57A 3X1EA 4HCFA 1PY0A 3WKPA 2DYRB 2HX8A 2XX1A 5I26A 1A4BA 3ERXA 4Q8BA 1IBYA 1JZEA 3FYEB 2I85A 4DPAX 2EINB 1ILSA 1J9RA 2BZ7A 1ZDQA 3PLYA 3U25A 3OMAB 4UF7C 2VW6A 3GDCA 1OE2A 2XWZA 2J56A 1PLCA 1PLAA 2BZCA 3NSDA 2HRHA 4KO9A 1KV7A 1XB3A 2B08A 2GC4C 2GSMB 3V9EA 5AFAA 5AZUA 1A3ZA 1AG0A 2CCWA 1XB6A 1GS7A 1ASOA 2YAEA 4KO6A 2IWFA 1AS7A 3QQXA 1EHKB 3RYMA 3FT0A 2GIMA 1L9OA 2PPCA 2YAHA 1BXUA 2HX7A 2E86A 2JFCA 3ZBMA 2FQDA 4AI7A 1HAUA 1BQKA 2ZONA 3QPKA 2QPDB 2XX0A 5D4HA 2QPEB 3BVDB 3FQ2A 3OD3A 3NSCA 1HFUA 2TSAA 4W1TA 2X88A 1VLXA 2FQEA 4DP5X 1GS6X 4DP7X 4G71B 1XMEB 2IDFA 1KBVA 1OV8A 1CURA 3EH4B 3AY2A 2HLEB 4HAKA 1E5YA 2MTAA 4RH4A 1SF5A 5B1KA 4GP5B 1MZYA 7PAZA 1CUOA 1NWOA 2WO3B 3UABA 3MBWB 1SJMA 2CJ3A 1ZIAA 2UXGA 3IBOA 2X87A 1TEGA 1J9TA 1KCBA 2YXWA 4YSRA 4E9QA 1V10A 5I6MA 1ETJA 1M57B 4AX3A 3SQRA 5IY5B 4EF3A 1ZDSA 2OJ1A 2HXAA 3ASOB 2FT8A 2YXVA 2PPFA 1NIEA 1NPNA 1AR1B 1WA1X 1MDAA 2YAOA 3GXUB 3KW8A 1BXVA 2IAAC 3T71A 1WS8A 5TK2A 2CBPA 1GY1A 1NINA 2XUWA 2YQBA 1KCWA 4JKNA 2BP0A 4BWWA 1NIAA 2PP9A 1AZCA 3NP4A 2PLTA 1V54B 2YAPA 3CVBA 2PPDA 1AZUA 4E9XA 1JZFA 3IE9A 4GP8B 1NICA 1T5KA 3C75A 1WS7A 3PCYA 1A65A 3OMIB 2DV6A 5F7BA 1OCCB 3S8GB 6PAZA 3ABMB 3NJFA 3NJIA 4DP4X 3NJJA 1IC0A 2YARA 3UADA 1JXFA 3SBPA 2DWSA 1GW0A 3TA4D 2WSDA 4QKTA 1BEXA 3FU7A 1PMYA 2AFNA 2PCYA 5B7MA 1NWPA 1MG2C 1ZIBA 4A2HA 3S8FB 1BYOA 3QJVB 3CG8A 3T9WA 4MFHA 2DYSB 1JXDA 1PCSA 2Q9OA 3DIVA 2R7EB 4AKQA 3FSVA 3NJLA 4G7QB 4YSPA 3AG1B 1AG6A 2IDQA 2PCFA 4YSTA 4E9SA 3V9CA 2FNWA 3NSFA 4BDVB 1KDJA 2P80D 1KGYE 1ID2A 1J5CA 1J9SA 1IBZA 3D12B 2VM3A 2FTAA 1PZBA 2GBAA 4G7SB 1TKWA 1PZCA 3ABLB 5D4JA 1F56A 2BHFA 3ABKB 5FC9A 2UXFA 2BO0A 3PPSA 1NDTA 2PPAA 1L9PA 4KNSA 2FQGA 3UACA 1E65A 4YVUA 2XV2A 1N70A 4AKPA 1WA2X 4YSOA 5I6NA 3CVDA 4M4RB 3ABGA 4YSAA 3X1NA 1GS8A 2J5WA 1FA4A 2VSKB 3H56A 1JZJA 1BQRA 3S3CB 1ET8A 3JTBA 3CDZB 3PXLA 3HEIB 4A2FA 4DP1X 1BYPA 3NP3A 3FSZA 3T6XA 4E9YA 1NTDA 2XLLA 1JOIA 1SHXA 3H4FA 2BP8B 4HHWA 2Y1AA 5AKRA 4YL4A 4DPCX 5LDUA 1AANA 4KNUA 4UANA 4NB7A 5B1BB 4WKXA 5PAZA 3DKHA 1JZIA 2YAMA 2IWKA 2HRGA 3G5WA 2UXTA 4FA7B 3FQYA 4X4KA 2ZWNA 4YSUA 3EH5B 1RKRA 2VN3A 3FU8A 4A2DA 4YSDA 3AG2B 3FPYA 1WAEA 1X9UA 1E30A 3UAAA 1ET7A 3FSAA 2EIMB 3CVCA 4L0PB 1IUZA 2XXFA 3QJRB 4UAHA 4QLWA 4KO5A 1SNRA 4BDVA 3S3DB 3SBQA 2FQFA 1PLBA 4KOBA 5B1AB 2XV0A 3S3BB 2VMJA 2DWTA 5B1JC 2CUAA 1NIBA 1PAZA 1AZNA 4ZK8A 2BP8A 5B7EA 4E9TA 1GYCA 2DY2A 4N4YB 3JT2A 1L9RA 3PAVA 5I5JA 2YAFA 1R1CA 3NJMA 1OE1A 4YSEA 4DP0X 3CDZA 4E9RA 2EIJB 2HX9A 2XV3A 2IDSA 5A7EA 2AZAA 5I5IA 4HHGA 3EHBB 3NJNA 8PAZA 3H4HA 3NYKA 1AS6A 4KO7A 2OV0A 2Q5BA 1JERA 1AS8A 3AZUA 3QJSB 4HCGA 4JHUA 9PCYA 3FU9A 5I6LA 1A4CA 2ZOOA 2BWDA 1AZBA 4BWTA 2EILB 4GYBA 4AZUA 3DTUB 1FWXA 4NAJA 3ZIYA 3QJQB 1DZ0A 3X1BA 2HZHA 2XU9A 4BXVA 3TBCA 1PF3A 4KNTA 3NT0A 2I7SA 1A8ZA 5EHFA 3N2JA 2GI0A 1NIDA 3N55A 1URIA 3WG7B 1NIFA 4DPBX 2JKWA 1GSKA 4DP6X 1ASPA 2BP0B 4G70B 1UATA 5B1JA 1M9WA 2GHZA 1N68A 4G7RB 1NZRA 2H3XC 2PP8A 2Y69B 2VW4A 3FS9A 4BWUA 2OCCB 2FJSA 1TEFA 3GYRA 3QJTB 3OM3B 2IDTA 3NSYA 4P5SA 4HZ1A 2IH9A 4K9JA 4A2GA 2UXVA 1SFDA 3QJUB 1GY2A 2JXMA 1CYWA 1ADWA 2J55A 2P80A 2XXGA 1NPJA 3T6ZA 4W9ZA 3IN0A 4YVNA 2N0MA 3KW7A 3WKQA 1J9QA 1V55B 2UX7A 4DP8X 1RCYA 1B3IA 1SDDB 3IEAA 2FWLB 2GC7C 2YEVB 2QT6A 3X1GA 3AG3B 1OCZB 3WI9A 3FU7B 3MX0B 3ZX1A 3EF4A 3ZDWA 4HCIA 3SBRA 1BAWA 6PCYA 2WO2B 1FFTB 3OQRA 2TSBA 3OMNB 2W8CA 1SF3A 2FT7A 4F2FA 1AZRA 4F7KA 3TU6A 3HB3B 2UX6A 3WNIA 2QDWA
chains in the Genus database with same CATH superfamily
2KERA 2P8LA 1XMWA 2B59A 2CTRA 1ZWIC 4KI5E 4XGZB 3CDGB 1ROCA 1XMQO 2DQUL 4X0KA 1L9QA 3VXRD 4AEFA 2V8LA 4PS7A 2O6DA 2CU9A 1IBGL 2BWIA 5BZDA 4HCRA 1MFVA 3D69A 1QR1B 2V5TA 2DB8A 1OW0C 3H3BC 4YAQA 4F93B 3QCVH 1OSPL 5BVPH 4DR7O 1CXHA 2FECL 5JW5A 4IMKA 3AFLA 4PJGA 5JQ6L 2XVBA 4WCYL 5CEZH 1CFQB 2PP7A 2A5UA 4XWGL 4QPEA 5JOPD 3UZVB 1QTSA 4HHAA 2P44B 1CO1A 1IU1A 4KK8D 3SDCA 3SGKC 1A6AA 1NGPL 3MFFA 2EIMC 3ETDA 3LTVA 1GJWA 1K97A 1HI6B 2WHVA 4RGOH 2Y7QA 5CSBA 4DV4B 4BH7B 5ESAB 2ARJB 1WQVT 4FXLA 2YAQA 1BQ5A 4A1RA 1UXSB 3OKNA 4PAZA 1A9EA 2NY3B 4FAAB 5CEXA 5KS9F 3B2VL 3FFDA 4NZTL 4UQCA 2YEZA 2OMYA 4O02B 1ZPLA 3I6KA 4JRYB 1ILUA 4B3TB 1CBVH 2NR6D 4CVXB 1CQKA 4NQED 2WKOA 3MA7B 4WI8A 3WLBB 4ICWA 4I5BB 1Y76B 3JVGC 4CSPA 4ZI7A 2VW7A 5IWLA 1DJSA 4N2IA 2F0CA 2VQ1B 3IN2A 2G75B 4PIRF 4FQHA 4MVSA 3ZDXF 5K1NA 4FMTA 3DJSA 3UO1H 4A2EA 2YD0A 3ZHQA 3WEAA 3GJEA 1JGEB 3ZZLA 4N24A 1KNOA 3IAQA 4JO5A 3K7UA 4MXWL 5EPMB 1OCRB 5CN0A 5L88L 3ARGB 3LHPL 2QL1A 1B4JH 4GS7C 5D96C 1AYOA 1G7HB 1GPOH 3QVAA 1AGBA 5B7FA 2I26N 1KGUA 2W0LA 1DQJB 3CFBB 5F6HJ 5FV2A 1FXKA 4MXWH 4CS3A 5AVTB 3K5SA 1XB8A 3NCYP 4LQFL 1DVFC 5ISZA 1MG3C 2R69L 3QXDA 4PWJA 2ICCA 4AM0Q 5IJBC 5KYYB 2LGWA 1CFNB 1A6TA 1SDDA 3JCUZ 4PS4H 1NR7A 3VQVA 2QQNL 4ODXA 2WKGA 5ISZD 3QFDA 1SDYA 4NDMB 2Z35B 4TXVB 3GB7A 3QQNA 2DQJL 3RKPA 1RJYB 3WU1A 1CD1A 5E1AA 1QLEB 1TJHH 1Z5LB 4ZAKA 2WYHA 5HPOA 2ZOKB 4WI0B 3HUJB 3WLWD 1ZTMA 4BW9A 5IHZB 2E75B 1X7TA 3F7RA 2AXFB 2UZYB 1TJHL 1X5XA 3QXAB 2A06H 3LN4B 4DRXB 2QKIC 1ZLUK 3TA3D 2O6EA 4K5NA 3D51A 3WKPA 2ZD9A 2DH3A 4MQXC 3CZFB 4MRCA 1A6UH 3GIZH 1NBVL 3FF7A 4M1GL 5LN4A 1F3RB 4PVNA 1BIIA 4X7DC 4ELMB 2BSKB 4GI6A 5LL6Y 3ECWA 4Y0GA 5C0BD 1QSFB 2LLGA 1IFHL 3L4XA 4JO4H 4ODWA 4OCWH 4R90L 5D8JL 5FUOL 2RCSH 1T22A 3NH7L 4QYOA 3TWCL 4IRSA 4APXA 4BZ2L 3RWFA 1NVPD 3L13A 5AAWA 3UTSB 5CFHA 3FZUD 2F1AA 4KTGA 1ZHLA 2BC4B 1UB5B 5DURD 2IJKA 2CCWA 1HXYB 4ZTEA 3DROA 1GS7A 3SQBA 5EIBC 1SJHB 3MSPA 4RFNB 4PRPD 4LASH 4YHMH 4CKVX 2Q3AA 4L1SA 5JHDB 1MI5D 3PWPB 4X7TB 5JIKA 5FA3B 4AYFB 3FB7C 2QSAA 1U3HC 3LEXA 4S1QH 4KQ0A 1AJPA 3HAEA 3VXRA 4D7PA 3LH2L 4OQTH 4GSRA 4DESA 2XAFA 1OGSA 3IU4H 4MRBA 4GEJA 1ZA6A 4RO2A 1UJ3C 1DF4A 2YC1A 2D4FA 5DRXB 5ENWB 1DUZA 1G9MC 1IBDA 4N2LA 1J1OL 2EUWA 5LB1A 4GQ9H 3FQUB 1E8WA 4E42B 2F74A 5SWZE 4NQCE 4U0RC 4IU3A 1QVOB 3O0RH 4LMQE 1AILA 3KS0H 3QWOA 4NO0B 5DMIL 2X6UA 4OF0A 1TZIB 1WFMA 1GOFA 1A1OB 4PGJA 4XBFA 4UIKL 4UVBA 1IVSA 4WY7L 5C07E 4YFEA 3MBEB 1QOKA 3ZKSD 2YZ1A 1Q9WB 1WAAA 2Y22A 1MVYA 4H26B 5A16B 3ARBB 2NZIA 1U2CA 3VFMB 2G5UA 4WF9V 2ICES 4ZXBD 1CB4A 1J8HB 1JV5A 3Q8EA 2V8MA 2KLTA 4BJLA 3ARGD 4FQPA 4XCEA 1U97A 1A9BA 3RYHB 2AITA 2BP3A 3P73B 4WDIA 1W8NA 1SRDA 2G5BB 3RUGB 4YSRA 2EUXA 2I9LA 4NFBA 4RWUA 4I85A 3FUJA 4I3SL 3HRZB 1L7TH 5DJ8A 4JX0A 1E9PB 1JGVH 3BP4B 1WZMA 3UO8B 2YWZA 1S7WA 5L9DH 4MB4A 2ZPKL 4KXRA 2W60B 3KYKL 3L8QA 4Y88A 4J10A 1GMIA 5I9QB 3ZE0E 2AMUA 5E9DB 5G55A 3T71A 4IRSB 3ESUF 1YEGH 1JPSL 1OCZC 3L7EA 1U8QA 1LUWA 2ZKWA 2M1KA 3I6GA 4UB0H 4NI3A 4B53A 2YQBA 4ZUUB 4P5KA 4XP6L 4P9OA 3K9SA 2VXQA 4J3VA 1PPIA 4N8VB 1N59B 1WPXA 4NT6A 1CLZL 3RVVC 4BWWA 1PX4A 3QUYA 5AW2B 5HGDA 3KYNB 2EEBA 4NQEA 1KU9A 1T5XA 3MLXH 3FRPB 1Y66A 4XT1C 3AREC 4ASUG 1IC7H 2NDFA 3ZHNA 2X89D 3JAWB 1S7TA 3TBSA 3OMIB 2L7UA 5F7BA 1RAMA 3HKBB 3L5IA 5HHME 5F0LB 3PDGA 3JWNH 5E5RB 1W0WB 5DEGB 1F23A 3T8XA 1HINH 2ZE5A 1PIFA 2DQEL 3OB0H 4UTBA 1U91B 3ZE0B 4L3ED 1G8MA 3BSZL 1VHPA 2ICWA 4P3WA 5I8OL 3FCTA 4JFZL 1BF8A 4BFKA 5E9AA 1G5AA 5ADOL 4XC3L 4G8FB 1NU1H 1P0SE 2B14A 4U6YA 1JF1A 2PCYA 3K91A 2XZCH 4D9RD 4IJ3B 2NQDA 4BCZA 4MB5A 5F7KC 1MH5B 1I8AA 1IC5L 2VLJA 4R4NC 1B3QA 2Q9OA 3DVFA 4IQHA 3VH8A 4L4TD 3W9DA 3PABA 1QLFB 3AG1B 2ITDA 3BGFB 4MYPA 4P23C 2HT2D 4FFKA 5KAQF 2ICWI 4JCLA 2JJUA 3MLTA 1KGYE 1W0WA 4P46D 1YNTB 3WL9B 1CIUA 1BAGA 4FJ6A 4HMCA 1L5GB 3X12B 5DVNA 1JGEA 4UILH 4AYEC 3N41B 1MAML 4DR5B 1VACB 3RW0A 3MV01 4MDRA 3ARDB 3NDZE 1CT8A 3MJ9A 2AI0L 5D1XE 4JTCB 3BISA 3IVKA 3F64A 3APOA 5T1JA 4KXAA 3NZUA 5A6LA 2C2AA 3NCJH 1RPRA 4HEPG 5D2LE 3GC3A 5IJCC 1MH5A 1RPOA 5D7IE 2GJJA 3VG0H 4G80B 1WFNA 1MEXH 1PL3A 2X7LA 3I6LE 4R4FL 3UYRH 3K2KA 3NZHH 1XH1A 2NQ3A 3VX1A 5HHOD 1F4WL 2QEJA 3JATB 3IGAA 5DJ2B 5E5UB 3SHSA 4RAUA 4KXDA 1R5IA 3EJJX 3GSXB 1AO7A 1TLMA 1U3HD 4MD5A 3N85H 5I1CH 1QZ1A 2YD7A 3CSGA 4BFFA 2EEXA 5IR1A 5IP4A 3HB3C 4E0RA 4W9EC 4B5ZA 1FZOA 1TYRA 1NDGA 3C87A 3FSZA 3R1GH 4M3JA 2EZOA 1GMGA 5I1HH 5I1CL 1QNMA 4WKZA 2ED7A 1KFAH 3QGVA 1SJXA 2WXRA 2Q67A 1QASA 1GM9A 1FZMA 2RCSL 1OAXH 2Q69A 1DQLH 1SXBA 2Y1AA 4N8VG 4U05A 4UUJA 5AOKA 4DPCX 5I1JH 1HDJA 3MI6A 3VFMA 4H33A 2PYEA 1J1XL 3G3LA 1NBVH 5AQ0A 3FQYA 3KVQA 2H8PB 1NH6A 2NNCA 4LU5L 1DJGA 1YEDA 4S1RL 1NSNH 5CJXA 2BVOA 1HHIA 2MPAH 3AG2B 3FPYA 3CSXA 1EEQA 3JTTA 3CFEB 1NI8A 4UB6Z 3SPHA 3QJZA 4YGVA 2HG5A 5JPMC 2B1GA 2QJ1A 1BHGA 3AJ7A 3K0GA 2AJSL 2DBJA 3I74A 5DMIH 1Q1PA 1CICC 1SXCA 4X20A 3RYCB 1C08B 4PWEA 3SKNA 4Z3FA 4QXGH 5CINL 3GMPB 4HT1L 1XF3A 5FA4B 4L37A 5EBWA 1QWHA 2CUAA 3LZPA 1VCAA 2IPKB 3KHQA 43CAA 2C3VB 2JWYA 4LC1A 4OQTL 3OZ9L 5CZRA 3C6LD 1T20A 2LP7A 2WZ5A 3RYHA 2Z8SA 3NJMA 4I4WA 2HJFA 5F9OL 1M2OA 4N86A 3NIDB 1A3LH 1XF3B 2FX9H 5FLVA 3FRPA 4PN6A 3O65A 5FYJD 1J86A 1NCDH 2RGSA 2NTFA 1G7PA 3RWCA 3VD7A 4ZS7H 5K93A 3STZB 1JX9A 3OPZL 5CUSL 2ZM6B 4PW4A 3KR3H 4NIKB 2NY3C 4Y5VC 4QJFB 2FBJL 2FHCA 5JXEA 2B4CH 3MRQA 2YSUB 2FATL 1UD5A 4FJYA 4NFDA 4U1JB 1WIPA 1JZ3A 5GTIZ 3OKMA 4KKNA 1NC2A 3MYJA 3D85D 3MJ9H 4EN3C 1DZ0A 5J4MA 1TFHA 1U9KA 3OAUL 3ML9A 4V1DA 3MJ6A 3DC6A 4J3SA 3BVXA 4YPJA 2VLKE 4LLMB 3UEQA 3T2LA 4DKEL 1FN4B 5HYEA 2Y06H 4PA9A 2C9SA 4AM0A 4DP6X 4BFGA 2XNAB 1U4EA 4WCYH 2BP0B 2VUYA 1GN3A 1O7DE 2ITCC 2P45B 3DARA 1F7YA 1VAHA 1YZBA 4QT5A 2CBMA 4R97C 4YHOH 4X9IA 2ZIDA 2D7TH 3CCJV 5F9AC 2IDTA 4P5SA 1CLYL 3JARB 4K8ZA 1CDHA 4D7BA 4J39A 5LMNO 2IW5A 1UB5A 4CW1A 3RZWA 4KMQA 1UWXH 4E36A 4L0YA 5E8OA 3DUSA 3IN0A 4YVNA 3ZKXB 3EBAA 4JPVH 3FO9A 1E28A 4N2FA 3CPLA 1R4XA 4AEHH 3IJHA 1SDDB 3B7YA 3QCUL 1TQBB 4NHCL 3QRLA 1RMFL 4D3CL 4KZDL 4B3MB 2HAZA 4Z7UB 4X1YB 4YPGB 1AQMA 3BPNC 5J1TC 5F7EH 5D1QE 3CZFA 3SBRA 4PA6A 2P46B 3QDGD 1KP3A 2AVGA 1P4IH 1WC7A 3LCYA 4YHYC 5C09B 1BJ1J 4BSWA 1AZRA 3TU6A 2IXQB 1GM8A 3D3VA 2NW2A 4J3UA 2HR3A 4OM0L 4DZBB 4DK0A 2AANA 1MNNA 4FVMA 3X3FL 2ENSA 3ZX6A 2DKMA 4IBQA 5EC1B 3L6FB 1FVDB 1G6RA 4QYAA 1DR9A 3QZBA 2APFA 2QWOB 2AW2A 2VRAA 3JZ7A 4UILL 2PTVA 1OF0A 2ZXCA 3AT0A 4MTMA 4X64O 2B4CL 1NBYB 3UDWC 4JZNB 3D3QA 1GH6A 4RBPK 5KSAA 1GYVA 2YFNA 5IW3A 4GX5A 1RHFA 1KUQA 5CU9A 4PDLA 3RDJA 1MFAL 2Y7QB 4O2CB 4NUPA 4IHBA 5DI8B 5KYYA 4MQXD 2DQDH 3UTTD 5I1GL 4GG8A 3ZE2E 4NQQA 4U4IA 3V6ZA 1BQLH 3CFKA 4HHAB 4PGCB 1DO6A 5FGBA 5HGHB 2F5AL 2AJUH 1BAFH 2VDMH 5KS9E 2Y72A 3V0DA 4DR6B 3MODL 3OX8A 3ZGIA 1Z1WA 3LDDA 1RUAH 2ADPA 2D2OA 2HVJB 4LOUD 1ZLSL 5CP3H 1LP9B 4B97A 2RACA 4R90H 3CQPA 4NC0B 4R2GC 4L8SC 4FQHB 1O7VA 2CM5A 3ASWA 4Z0BL 1MCSA 4G8AC 1JXGA 1I85C 3WNJA 2I7OA 2PWGA 2QEXV 1I3GH 4DV2O 1NMCB 2IV8A 3DVGA 3QUYB 5DK0A 5DQJA 3LNNA 3FUKA 1Y74B 2VLRB 5EC2C 3WE1A 4QPJA 2OTLV 1BLNB 1U8KA 3LSSA 1KBKA 5I75B 4GRWB 4QPKA 4HPOL 4OGYH 4RAUB 1T7XA 3EOYG 3QO1B 2G9HA 2WM0A 2CUMA 4M8UA 5E2JA 1J8HD 1XO8A 3EJTA 1JZHA 3DUUA 4FQJL 2ZR2A 4K07A 2YSSB 4LBEA 4LLQA 1Q94A 1R3LA 3CZLA 4BZ2A 3UC0H 4ADJA 3HRZA 4W9GC 3RTLA 3DO4A 4PJBE 2WUBL 2XKSA 3ARGA 3GT6A 4DV3B 5FOBB 2DI8A 1MWAH 2KPWA 3HRZC 4GY4A 1RLWA 1OCOB 1JFFB 1YSOA 1ORQB 2OQJA 4U33A 4CBCA 5KVGE 2DQ0A 1AIZA 1JRHL 4NUMA 7FABL 1AHWA 2AJYL 2YRPA 1YHQV 3CFDA 4PJFA 4WGWB 4BFEA 3MXWL 3BH4A 3ZRXA 1I7ZA 1RD6A 3HE7D 2Z5UA 2EBOA 5TDPB 3RFZC 4OLZH 2BFVH 3EYUH 1DANU 3BD3A 2CJTA 4NM4L 2FLBT 2W92A 3HBGA 3OLIA 4BELD 3DUUB 1OTSC 3CH8A 4N0FB 4QXGL 5CINH 2OMNA 1HE8A 4WFFA 4ODHL 5KBNC 3FU3A 4Y7MA 2QR0A 3GSOB 1ZOXA 4FGMA 3VM5A 4LFBB 4FXKC 5EWIL 5KYWB 2FH6A 1XDTT 2J8UE 4MJIE 4Y19D 4F9PC 3E22B 1WD9A 4HOXA 3H1KH 2K3TA 1QRND 3L5WB 2IPUG 3H1JH 4MS2A 1D6EB 4AQ1B 5HD8C 1E3ZA 1UA7A 2BOBB 1I1FB 1PYWA 3H9ZA 1HXMB 4PRPE 2N56A 5IFJB 1V8HA 2V17H 2ZKMX 3EXJA 4LSRL 1QR9A 3LH2H 3PREA 3IRCA 4UWQB 3NEXA 2K4WA 4OZIA 5MI0C 5TE6L 4L3EA 4PJCF 4HIEA 4OAWA 1IXMA 1P7QA 3C6SB 4IJ3C 3UJTH 5IQ7L 3UTQA 4KI1A 2VISA 3AGWA 1YNKL 2VWEC 2DN9A 4CGUB 3ABLC 4R84A 5A2IH 4PRHD 3W0WD 4FCHA 2VNCA 5HGBA 5HHMD 2QHRH 1JF1B 3QFJE 4JDEA 3ETSA 3V8OA 2EULA 4HV8A 3H6AA 2JIXB 5ITZB 4JDVA 4AK1A 3AG4C 4DCQA 2IALA 3FQ4A 3BHBB 1N3NB 3BVDB 3FQ2A 3QZPA 4GIAA 1QI5A 4R4FH 3K2MC 3QO5A 4BK4A 2VMFA 1CFSB 2G2PA 3DHMA 3PQYA 2P8MB 4GAJL 2IFFH 1YN6A 5GISH 3N1PC 1OTTD 2ZXQA 4S2SB 3SO5A 4M62L 4ZYKB 3L95B 5CILH 4Z3IA 4X4MA 1GS6X 1P6AB 2XN9B 2CKBA 3L3IB 4X5LA 4YIQA 2C3HA 2AABL 1KWKA 2UY7B 1DVTA 5F72S 5E79Z 2HHHO 3EH4B 4NZTH 1J95A 3ECUA 3BESR 3PWLB 4FA8A 4OCLC 4CNIB 2VAAB 3ZMUA 1HTYA 4XO9A 1CUOA 1UEYA 1WSST 1WICA 3QIUC 1ETZA 4K8RD 1QG3A 1SYSB 3VFVA 4NWUH 4WW1B 5DN6G 4JHBA 4TMPA 4XPFH 2CJUL 1XNQB 4XO5A 3RWEB 2DWYA 4N5UA 2YPKB 2GG1A 5LGYA 1ACYH 4G8GE 2CDFB 5HHVL 3K72A 3O11B 4TTGA 4PV9B 1KCKA 3H53A 3VQLA 3B7UX 1S9VB 4MMXA 1MW0A 5FOJA 3SY0B 3VJ6B 3BP4A 3D87B 4PBDA 5DHVB 3SDAC 2V17L 2VJ0A 2BMKB 2Z34A 4IGBD 4IOFC 1THZA 3OAYK 1GGIL 4YHKL 3O9WA 4PDRA 5CJOL 5JPMA 1IGJB 4KK5C 2VLKA 2PLTA 4R26H 4JGNA 1M6OA 1R24B 4WWKB 5C0BB 1NCIA 3T1WA 5EF2A 4YMPA 3GSWA 2BMKA 2ZSWB 1S5IL 3K3WA 3X11A 1AJ7L 3STLA 4OBSA 1NUDA 1VJSA 3HKCA 1U58A 2VUKA 3RWGA 5I24A 1SY6L 4DGUA 1MQ8A 2P5EA 4X88A 3I56V 1C1EH 2XSKA 2OTWB 5TQ0H 3NJJA 4M6ML 3NFPA 2X7RB 2W91A 1J1PL 1TZGH 2NPLX 3P0VH 3V0AC 3U6RA 2F5BL 3QP3A 1UFUA 2GCYA 1GIGL 2RDCA 1QVOA 3QR0A 4HF5H 3HG3A 4WNSA 2VAJA 2DW4A 2XG5A 2E7HA 4FZEH 3WJLA 3EO1B 2CTPA 32C2B 4L3FA 1BEXA 3THML 4AH2A 1WFTA 3K57A 4MKMA 1R6VA 5DJCA 3HNVH 1KXQE 1QA9A 2IBZX 1QLEL 5K9OB 5KOVC 2YEVA 4EFEA 4HEME 3S8FB 4DKFL 2XIBA 4LEEA 4MMYB 1XHHA 5AVWB 1H2SB 1DUYB 1FO0H 1PZDA 3S3XA 1FZOB 1KCVH 1MCHA 4AG4H 5IVNA 2H3OA 3JSNA 5DHMC 1SJHA 3MUGB 1CD9B 3GXIA 4EUPG 2R9HD 2JKXA 3Q8FA 1R0AL 1TTRA 2Q8BL 4YC2B 1OARH 2PW2A 3BLBA 3L4UA 2P80D 5J3HC 5AVXB 5LNEA 3QORB 5JW5B 4L3AA 4UT9A 3FB6C 5JJEB 2HLFC 3MV7E 1THAA 1AVMA 3CCSV 1WK0A 1PZCA 4YGVB 2HUHA 5LAXA 4AOFA 1F56A 2Y2TA 1EDYA 1XGQA 1XH2A 1MLCB 4APQD 2BHFA 1KSRA 1CFNA 4OCRL 4ELMF 1FNHA 1IM9A 4D7TA 5F21B 5B8CC 4KRMB 43C9B 2PPAA 1FHGA 3CU7A 3JYCA 2YO3A 1ZL8B 2FQGA 4J3WA 2BSTB 2ESVD 1OTUD 2NY6D 1G6RH 1GSMA 3A24A 4N21A 1ADQA 2X1OA 2W9EH 4MCNA 2HT3D 5DQ9A 5MHSD 1ZHBA 4UIMA 5E2UH 4DUYO 1R5VB 1N67A 2BY3A 4BIKA 4LHUD 3S4SB 2Z64C 2PW1A 2ZXDA 2NY1D 3W5MA 1DBAL 4LRIA 4MLIA 3HZMA 4DKEH 1DBBH 3HNSL 5T5FH 1Z66A 4HFWB 4TL5A 5EZIH 2VDNH 1WAZA 1YY8A 1NTDA 4MAUH 3ZCCA 2G3XA 4WI5A 5GJSH 3AT8A 4IRJC 3D2TA 3C2AH 1A7PH 2QVTA 1XMOB 2B2XH 2OX5B 5CN2A 3L81A 3A22A 1KYOJ 5EFIB 1UA6L 3F7YA 5J6GA 1JPXA 1LNUA 3U2IA 1A7OH 3I50L 3RY4A 2WMPA 4G43A 5I74B 3PQYD 2CLRA 3QZWB 3U2JA 4C8XA 5DFVD 4CC5A 4XVSL 2HRGA 2AQRA 3HNVL 4XOEA 3O81A 3VH8G 3BWUF 5K9JH 5FHBL 1E90A 5HFLA 1CGWA 1Y7VA 2R9AA 5DWPA 2H2SC 3BVNA 2EIMB 2NCEA 1QLEC 3QYNA 1N18A 5ICZA 1CN4A 4HWEL 2YGVA 5L2KE 5BR8O 4Z7NF 3FD9A 1G7LB 3H0TA 4UDUA 3WFCL 1ADQL 5IMKB 4MCMA 3CUPA 1FFNB 4HIIB 2ZKXA 4R7LA 5ETUA 4ZUVA 3RPIA 5KJRH 3I6SA 5M7QA 1RIVH 4BWAA 2ATKB 3B1UA 1FL5B 1NAKH 4P0DA 5DMKA 4K0KB 2Y23A 2RMKB 3JT2A 2BP5M 2BSED 1L9RA 3IMSA 1CXEA 5I5JA 2FE0A 3FONB 4C56B 1MHEB 2BY0A 4HZLB 4KRPB 1CXZB 1OM3L 5H6RA 4MA1B 4NX0A 5HVFB 4NSKA 1NSNL 2F7QA 2WBXA 4ODTH 3UERA 4L2YA 2UUDH 2O5NA 3C9NA 4F7MB 2BIOA 4P4KA 4K7FB 5I5IA 1U58B 2FECI 1TMQA 5CA3A 5D7KE 4JV5B 5IYCO 4UMGA 4AEEA 4NQEE 2BWDA 4BWTA 3OGCA 5DWUH 3GD1C 4UTCA 5C0AA 1J12A 1D7CA 4HGWB 1RULL 3TX4A 4CBZA 1CGXA 3GO1H 4MAYA 3CVIH 3BAEL 3MRLB 4AXWB 1RUML 2F66C 4O2BB 2VL5A 2WQUA 4JFEE 3WS6A 1ZHNA 5BJTA 5EN2B 1UWEH 3E3QC 4LHJB 3VA6A 3A6BH 3WO4B 1D5XA 1FFPA 1EAQA 4JZOA 5CGYD 2HRPH 3QXUA 2WUCL 3UTTE 3R0MA 1NIFA 5T1MA 3EFFB 4YR6B 5J7CC 4XMKH 4TV9B 1UGKA 2WXHA 3V55A 4ABVA 4XXDB 1NEZG 2AK4D 2GTWB 2QADB 5IBUB 2VO5A 2ZE6A 1KJ3L 1NZRA 2PP8A 1AVAA 3RWEA 4CL7A 2GJZA 4I7ZC 1AJNA 1VP7A 3BSGA 1UM4H 1ZXQA 3GUFA 5FM5O 4AEIH 2JRIA 5DVKA 4NO2B 3ZJZA 4HS8L 5B3JF 4ALAH 2R2HB 5IYDO 2QVIA 3J7AU 3EOAA 4LSUL 4AYID 1FNSL 2AI0H 3JYBA 1VF5C 4POZD 3N9GH 3F6JA 4K73A 4QRRE 2OR8A 2ZJSL 4PVBA 3ULVC 3AUVA 3QDMB 2A0LD 1RCYA 3E1F1 1H2LA 3L1FA 3N1GC 4IRZA 3WENA 4WK2B 1F4HA 4L9DA 5F1NA 3RUGA 3FQTB 3I55V 3NIDE 3MNMA 1RJLA 4GCZA 2HLFD 4M1DH 3PWUB 4NZRH 2QT6A 1NFKA 3ABMC 1H5BB 3PFQA 4LSQH 5J06A 5GQBA 7TAAA 5C0EB 2P8MA 2IDCA 4K4KA 4M1DL 2Z4QA 3ARBA 5IBUG 2GJPA 3LSOB 1UCBL 1N3NA 3A23A 3RNQB 5TFSL 4F2FA 4JGSA 4CA4A 1A3QA 4MJ5B 2UX6A 2QDWA 4PJDB 2NY6C 3HNTH 2IFGA 4IRZH 3WXVH 3OXSA 1MZZA 1YYCA 2EDTA 1LNQA 2K8QA 4LOVA 5SWZA 2C7FA 4XOBA 2P4VA 5HDWA 1DQKA 2WN2A 3OKLA 3HE7C 3DJRA 2NY1C 5GRUH 1KCSL 3LKRA 4HIQA 2O93L 2E4FA 3EUUA 3QG6A 5DRWA 4D9LL 1DUZB 1O75A 4H8VA 5D2NC 5H37A 4F8LA 3F5TA 2EDXA 2VDRB 4ZTPL 2O57A 2MCAA 3CFUA 4AENA 3U9PH 3UJJL 1IGYA 3AY4C 2J88H 1AAJA 1O6SA 3OKEA 2P06A 3PGDB 4U3SA 4MB1A 1KFGA 4XWOC 5CZVL 4ZPTA 2G38A 2P26A 4WJKB 5ESVB 4BFIA 5B38G 3R8QA 5FYLL 2XNAA 3KYOA 5ID0A 3ZQXA 3IDMA 3MA9H 2FUQA 3ZN6A 3KM2A 3OTFA 4TUOB 1UASA 3ALXA 3PE9A 2JF1A 3OJVC 3P30L 4GOSA 1J87A 2WW8A 3PAZA 2EZ0C 3JATA 3L1OL 1DBKH 4MJJA 1SQXH 5DJ2A 4XAKE 3ZTJH 4DNLA 5KW9H 3FUIA 4NRXA 4JFYB 3MV9E 5FYLD 2IGTA 2FIRT 3UBXG 2Y36L 3IFOA 4JAAA 4Y2DC 3E8UH 1Q9KA 4NQCD 4K71B 3DGGA 5DZAA 1I9IH 1AXSA 1KLFB 2VLMD 1IFGA 1ZVYA 1ZLZA 3TASA 3IDGA 3FN3A 4P57A 3FBQA 3IJ7A 2WUBH 4PVMA 4DV1O 4ACPA 1NCGA 1FRGH 4J4PD 3S37H 3GWOA 4IBLT 4XMLH 2HJKB 3A8TA 4NUGH 2WVVB 3RUGF 4H8QA 3HA0A 3KCPA 5JDJA 3UTOA 1VIWA 2AXFA 3OQ3B 1CYGA 4JQVC 2WBJD 3VGAB 3LKNB 1XF1A 2W9DL 5KMGB 3NCCB 4M8VA 3TV3L 1ZGLA 2W5PA 4UCSA 1FDLL 5FO8A 3ABZA 3Q0HA 2AQTA 3QCTL 2UXBB 1IAIH 2BTQA 4H2CA 2ERJB 4P2QA 3O3BB 4Z3HA 4RGMC 2UXCB 1QSEB 1UZ6E 2VE6B 3CHPA 3U7YL 4B5EA 4XNBA 4CAGA 5BMFL 1IV8A 4MSWA 2Z93B 4S1SL 2XG4A 4HS6A 1Y6NR 4PW3A 5IBLC 4MTXA 3U7YH 4V2CB 4AIXA 3TURA 1KJMB 2X4QA 1MCJA 1RVFH 3RZCD 5HY9A 1GKEA 1KTBA 3HI5L 4Y4FC 2BERA 3LKPA 1U91A 2BVOB 5D7EA 3APCA 4DGWC 5CF3A 4P59H 3NJKA 2CLVB 3LSQA 3B4NA 4S1QL 4HUWA 2O5YH 4FA6A 1EANA 2WWKO 1S6NA 1MCNA 1PJ9A 5HHVH 4G6KL 4ZS6C 3X1EA 4F8QA 4EKWA 5C0FA 3HCVB 4JKWA 3RGVB 4O2EB 4MAYD 4AMKL 3JASA 3CBKB 3L3OA 3MA9L 4MJHA 1YJ9V 2EDEA 3NQIA 3FMGL 1Z9SB 5IMOB 4AE1A 3WNMA 1Q0YH 3FYEB 2A9NL 2I85A 3ILQC 5T5NF 2OMXA 1E3XA 4F15B 3VXUB 5DA4A 1ZDQA 2X9WA 2F19L 2WNGA 1CICD 4WSJA 4W81A 1OAJA 4R8WL 5JW4Q 3K06A 2XKUA 1E1RG 2Y6SD 4DR2B 2GSGA 2GBVA 3QNXB 2GITA 2HKFH 1O6VA 1OK8A 2WLIA 1LD9B 4K0KO 1P2CB 3A6BL 1JPGB 5CBFA 4NQVB 2B3RA 1C1EL 2QE7G 5GISL 2MH4A 1R47A 3STBA 1UFIA 1ZK5A 3SQOL 2IWFA 4IHOB 5ACMA 3VFRB 2UUDK 1X3DA 4CBPA 3RYMA 2NY0C 5LYJA 3HAEH 3ZR5A 5FKAB 1XR9B 1MHPH 3MREA 5JDSA 3BABA 2OL3L 4X1KA 1RZ7H 3ZDYF 1B6DA 4FM2A 2QVKA 3FUEA 4X50A 3U36A 1AQDB 1CTOA 1LEGB 1ORSA 1XWVA 3OSVA 3QG6B 5DRWB 1LP9E 4RESB 1YQ2A 1Q0XH 2EIZA 2CKNA 4KROD 4ESKA 1N33O 1TJXA 1SHSA 1P6WA 2XRAH 3DX9B 3FDWA 3HZ3A 3MJ8A 3T1CA 3GMRB 2VZSA 4RRPG 4WY7H 5INCB 5CEZD 1BOGA 3FJTA 4JVUA 4EXPX 4Y2DA 1TMCB 3CDGA 4X0KB 3ILEA 2Y9RT 2ADFL 4X1YA 5TE6H 3BPLB 2VR8A 1Q9LB 4IS6A 5JO5B 4GKJB 4MZIA 1QLRB 2IDFA 5JHBA 5FV1L 3OHXB 4I9WA 5ICZB 1J1OH 2J12B 1Y67A 2W95A 4R7CA 2AV1B 3FXIC 4APQA 1XZ0B 3DUSB 1AZZC 4HKJA 3KPPB 4HETA 2MQ0A 2IG2L 3QDJA 3S36L 1XGPB 5TDOB 4NBZB 4PM1A 2CJ3A 4Y4KC 3TF7C 1I94B 2MJWA 2YBGA 5EU5B 5JW4N 1RM1B 2I5YL 2YSTA 4PGDB 4E9QA 4Q56A 4X6CB 1FVCB 3D39B 3DETC 1W9XA 3UM7A 1QO3A 3C60B 4OZHB 5DJXA 2AC0A 3SCMD 1UCTA 3QDGA 2H3NB 2HXAA 4HJ0D 3AXHA 5K1XA 5SV3A 1MJ8L 4LKXA 5E99L 4R2GD 2VERA 3NEOA 3GXUB 3CC4V 2MCPL 3KW8A 1BXVA 4UMSA 1RHHB 2GSGB 3TJEH 1OTUC 3PF2A 1MUJB 3B34A 3EYOB 4I3RH 5AAPA 4YH6A 3R66A 4P2ZA 1IEBB 4NQEB 5KSBB 3P54A 1QRNB 3CQFA 4NNYB 5IVXA 4JKNA 5CBHA 5I74C 4GUPB 1C7TA 4A6YH 1V54B 1NAMA 3FB5B 1OB1A 2BSKA 2J5LC 3FH8A 5GIRA 3SDXA 4LKCB 7FABH 1B0GA 2PGGA 3VI4A 2EDDA 1NICA 3C75A 1SXSA 1TQBC 1ZTXL 2LFRA 4Y16D 4U3HA 5GZNA 1OPOA 3O8XA 1R6TA 4RGNE 1YZZA 43C9A 4YDLB 4XCNA 4DOHE 1WE5A 3BD5A 4KMLB 5E6YA 5KVDH 3QRGL 3L5JA 3E22A 2DN7A 2G3NA 1SVBA 1KB9F 4ES9A 5LBSL 3UO3A 4OD3L 1MJ7H 1K4DC 4M5ZL 5ID1B 3MRCA 5EIIG 3C9NB 2M6YA 4LF6B 3DO7B 4DUYB 4I50A 3OTTA 5HDBB 4O4HB 1WYJA 4KHXL 1NCUA 4GW5A 3V5HB 4G82A 1UB6B 3QUXA 5L8KB 1ZSHA 2CK3G 4JFED 1PCSA 3SJVB 3G71V 3DIVA 2R7EB 2OR7A 3N41F 4IJTA 4TTDD 1GK9A 3ZLQC 4MAYC 2ADIB 4E9SA 5JCOC 2P5ED 1OD9A 1DVSA 2GFBB 3ZDZE 3Q06A 1M05A 1O5DT 3T0AA 5MEPA 3DGEA 2WQ8A 1BBJB 1ID2A 4I48A 4N2AA 1YPZE 2WVVA 4EEQA 3EO9L 5IJ9A 1ZE3H 5HI5D 3MACH 3L08A 3LS4H 4OV5B 2ZXEB 5I73C 2FTAA 2GBAA 3ULVE 3NRPA 3D0LA 2CGRL 2VLKD 1H2NA 3T0EA 4ZMPA 2E46A 1CFMA 4HGMA 2R29A 2EE2A 1MZFA 5T1KA 2FX8H 1KLUB 2MQCA 5EZIL 1N2RB 3PPSA 4ZXBB 1XR8B 2XTAA 1ZSDB 3QQ3B 5C2UB 1IDSA 3BKYH 1E65A 2XV2A 3QUXB 2ZT9B 1U8KB 3CVDA 1QI4A 4D0BB 4MD5B 1G9EA 1RVFL 1IGFL 1U6AH 1V9PA 2BC4A 4FYTA 3AS1A 3X1NA 4QOKB 5B1BC 1BLIA 5FF6B 2RQEA 3VD3A 3VACA 1H8LA 5KJ4A 4BH7A 1JNLH 3BP7B 4QCIB 2DS4A 2GAZA 3OAZK 3LPPA 1N0JA 2DJVA 4ZPTB 4F5CE 4MVMA 1A6AB 1UA3A 3GDBA 3NP3A 2MPAL 3TXQA 2WGXA 3EIFA 4DV7O 4KJQD 3FB8A 5C07B 2A38A 5AYQA 5JQIB 5JQ6H 1J1XH 2PF4E 3MGOA 4P4KC 4JYCA 3GKWH 3BIAX 4NM8H 1O7SA 4UANA 4KAQH 2Z65C 3WLWC 1ZRUA 2Y2WA 3MLUL 1LJMA 3SDAA 1YNTA 4Z7OB 3F7YC 2VN7A 1ORQC 3ZRCC 1XGQB 1SYSA 3EJZD 3DIDA 5T8IA 3VFVB 1QRNE 1UB6A 1V55C 5E6IC 4XMZA 1FNLA 1P4LB 5JHLA 1YCIA 2OMUA 3X3GH 5K1JA 2AJUL 2V5RA 3BUPA 2RH0A 3SPVA 2ZX7A 5EC2A 5L4IA 3OJMB 1OV9A 1K5WA 4WHCA 1BZDA 3G6JA 3PJSA 1HCZA 3SCMA 1VFAB 2AW9A 3ARSA 3IKCA 4KO5A 1T1XA 1S9YA 2O72A 2Y36H 5GGSY 1FHNA 2VDQB 1A02N 1Q6UA 1QBAA 4NXNO 3N42B 1DLFH 1I9JL 4HAGA 3FHEA 3OAYH 4MVBD 4PCKA 4UNUA 1T0MB 4Z7OF 3ZHFA 5BV7C 1IC7L 1EERB 1N0LB 1T1WB 3FO2B 4OZGE 3VD1A 2FJUB 2CGNA 5D1QC 3MV8B 3OF6D 4OT1L 1TTCA 4H2AA 3DRTA 5GGRY 2IAMA 2JJVA 1SA0A 2NNAA 3HI6H 4LEOA 1CVSC 4DCQB 5D7LA 3RIFK 4EIZC 3D18B 5BRZA 2JIZG 4OUUA 4ERSL 5C0CA 4ZIBA 3ZMVA 3CXHJ 3CS5A 5IVZB 3MLPA 1KLFA 1ZV9A 3FCGA 8PAZA 3EGSB 3H4HA 1OPGH 2OV0A 2QGBA 4MJIB 4KKLD 3C5XA 2W07B 3PWVB 1F45A 4XAWL 1JGDA 3JWNG 4GUNA 4J2QA 4Y5YC 5C0ND 3UIYA 4OJDH 1QHPA 4B96A 2DMBA 4Y2DB 5CGTA 3FO0L 4PJAB 3WMSA 1JYNA 3T65B 4JANA 4BQ9A 4D6TH 2OXGA 2EYSB 4ZUUA 3G08B 1NMAL 1VFMA 1IC5H 1KCRH 4FG6D 3X1BA 5KA5A 3O6FC 1U8OA 3IS1X 3KWWB 1JGIA 3ARFA 1NH2D 1WFOA 5BJTB 3M17B 1URIA 5EK0A 1QBMH 3LB6D 4MA8L 4G6ML 3WCYA 4ZBMA 3VG9B 3O45B 1F00I 1R75A 3DV4A 3VXTB 3W2DH 2HT4D 2AJZB 5B1JA 4FNRA 1SJEA 3E35A 4K8RC 1J0IA 3QF7A 3I9PA 1AKJD 1PX3A 2GUOA 3GUTA 2DEXX 3K3QA 3GSOA 1S9VA 3QJUB 1Q9OA 1CF8H 1OJHA 2ERJC 4KJPD 2OTUA 1ZJAA 1S8DA 1X5LA 3CSTA 3GMOB 4UT6L 4W9ZA 4E2OA 5C2BL 2VZOA 3B2UD 3SE3A 2N0MA 4C56A 3AG7A 4ZI8A 4X9GA 4M5TA 3HPJB 1P6FA 1EFXB 4HYOA 2UWEE 1HEZB 3OEHG 3MLXL 4NRZA 5CR8A 1E5UI 1W91A 1OZ0A 3JZYA 4XP4L 1WT5C 5HJGA 2YMXL 3QS3A 5CXPA 4JFEA 4CNIA 1DQML 5FK9A 1AJQA 1AQDA 1ZV5A 4O4JB 2YUVA 4YX2H 3FQTA 4YLQT 5BQ7A 2BSSB 1G7QA 4Z95L 1R73A 2P43B 5IZ7A 3LH8A 2JK5B 5L9DL 2NLJA 3CJHA 2GB2A 4AQZA 3FRPG 4PG2C 2ZOLB 3NN8A 4MZ2A 2BE3A 5B8CA 2IFFL 3CVHA 1RIUH 2DQMA 1B88A 1YEIL 4ETYA 3TFKD 5EZLB 5G2NA 1VERA 5B39G 1N26A 6TAAA 4PJHB 3ESMA 3UBXI 1OAYL 1ZT1B 4HOZA 2AJXH 1N4XL 2XAQA 3MUUA 2DYPA 4U1HA 5A40E 1VESA 2HG5B 3M86A 4LIQE 5KHGA 3OJ2C 1QYGL 3QS2A 2VLRA 4PGBA 1MI5B 3BW9A 2MCMA 3X1FA 1QSEA 2VE6A 1QCEA 2H6UA 4ZS6D 1KELL 4M4RA 3IFXA 1L6PA 1AACA 2V2XB 5AG2A 2R0LH 3OHMB 1I3GL 1YQVL 2P5OA 4IKIA 1PKQB 3RZCA 2X1QA 2BVQA 3SYOA 4P5TA 5AW7B 1ONQB 1SXAA 2W0FC 1MW2A 4NP4H 4FM1A 1J0ZA 1FZMB 4B9YA 4TOYL 1MNGA 5IVXE 3S5LB 5KSUB 1E8XA 4P5TD 1NQTA 1E67A 1W0JG 4G8EA 5J9PC 5CZXD 4K3EL 4BXSV 4U7OA 3LXCA 3BH9B 4OTXH 1SBBA 1WBXA 3U0WL 5MENA 2W88A 2C9VA 1WPBA 4Q4IA 1SOKA 1T0MA 4AT6A 1OF2B 3TYGL 1AOZA 3ZYZA 1A21A 1Z9MA 1AXIB 4YBLC 3QDGE 1F97A 1TQSA 4ELKB 4ZAKB 5L3BA 2IADA 4Z76A 1F4MA 3L3OC 1UJTA 2NY0D 1VRSA 3NDYE 1HH9A 4QOKA 2OTPA 3UAEA 2VXSL 4L8BB 3CFMA 1UWEL 2EIKB 2VIRA 3HBZA 1VGKB 4KP4A 1A14H 4PB0H 3T0WA 3N50A 3V0FA 4IBYA 3PU7A 2X4OA 4JG9A 1HE7A 2X3BA 1T21A 5KBMA 3DXAE 2A6JB 4GFXA 4OZGF 4NC2B 2XXMB 2WINA 3G4SV 1K8DB 3WEBA 4QHMB 4K7PL 2P7TB 5DD1H 5GRVL 1AHWB 4PJ8D 1DJYA 3A6OA 3D48R 4KZEH 5CBEA 2F58L 4L8DB 5IEHA 1FCCA 2CO7A 1PX8A 3CZSA 2OT5A 3FT4B 4WWKC 3RA7L 4ATTA 4QOKE 1DQIA 3QDAA 7CGTA 4LU5H 4BAYA 2YA0A 5LYJB 4JQXC 5F8RC 1MFMA 1DSYA 1BZ9A 1NLDL 1BM7A 1WNSA 4OZ4A 1O0VA 4HIPA 5I6PA 3EKCA 2G9KA 4L8BA 1I9JH 3LD8B 4FXGC 2AKRA 4PTTB 3EHBD 4FHBD 1EVTC 5LBSH 3MLWH 4YE4H 2VXVH 1YMME 3RX7A 4J6RL 2ADIA 2DM3A 2DWEB 2WCGA 2DQFB 1PFCA 1BVLA 4FQIH 5GZOA 3PWPD 3K8KA 3FO1B 3LB6C 2C4FU 2R9IA 1F4AA 2GTZA 2X4RA 1EXUA 4Y2LA 1KG0B 3DSNB 3PL6A 5DK2A 1JYWA 1YF2A 5IFHH 2PR9A 5C0EA 5JA9A 3TTSA 4HJ0C 2F18A 4HYTB 4LSPH 3GJFK 4I0CC 4GSUA 4DPAX 1UXSA 4POUB 4JFTA 1LO5B 3TH3T 3V7AE 5G4NA 4UF7C 5DYFA 5IMOA 4P2QE 2JTYA 4PYHA 1QQDA 1QNZL 4UTAA 5C92A 3Q6GH 3LZFH 4EPSA 1NLDH 3Q1EA 1QD0A 4GBXD 1JHTB 2BVUA 2RBLA 5BZWA 2P90A 1AHMA 2DD8H 3D0VA 3EDJA 4CZZA 5FPOA 4ZFOL 1MCWM 5CSGA 5IJDC 3V9EA 1HHHA 2QTEA 1I94O 3G5YB 2MHAA 4YDKL 2BSCA 2GBTA 2OW6A 5HI3C 3SE4A 1LO2H 1PD3A 3G6AA 3QIBB 4XBGB 4Y1AA 5IQOA 5EH1A 1VQOV 3ME0A 4WEBL 1WZLA 2HKOA 2X05A 3Q7JA 3HNSH 1WZ1H 4AI7A 1BQKA 2LAAA 5FYKL 2JI1A 3EOTL 5D96B 4O5LL 1FFPB 2XX0A 3O3BA 4YWGL 4BR6A 2GJ6D 2Y69C 3HG1E 3ULUL 3PDDA 5KEZA 1HZKA 5I16A 3V5KA 3EJSA 4LASL 4Y1TA 1LE9A 2Y4SA 4EDWH 4J3OC 4NN5B 1FGNL 5DJCB 4NQDB 5ADOH 4G71B 4ODBD 4PQXA 3BFOA 4XXCC 3D5OF 3Q9QA 4ZO9A 2Y4TA 1L7TL 1B3JA 4L05A 4NC1C 2P6JA 4CN6A 2BWQA 2AEQL 3TP4A 3NR7A 1JXKA 4WUKH 5ACLA 2DM2A 1YG9A 5DZLA 4XWOD 2ZZUT 4JI8O 4UTBH 1RZ7L 1NWOA 3B9KD 4PI0A 4ZFFA 4JM2A 5DSCB 3QUGA 5AD0B 1SQQH 4TV9A 1Q9KB 1KCBA 4IU3B 4NZJA 3RY5A 3BPOB 1YY9C 4LSPL 4HUNB 1I1YB 4WFBV 3THOA 5IY5B 4G3YL 4LSDA 4OAWB 4PCTA 3ULVD 1F11A 1OT2A 2OJ1A 4G2KA 3IGKA 4CW1B 5BUGA 3RN4A 3D36C 5JNYA 3OG6B 1S0VA 1AR1B 1HH6B 5BPPA 3D8MA 1HJBC 2H3NA 2IAAC 1OGTB 3KJ4B 2VMEA 3WO3B 3O9WB 1A1NB 4QF1B 3Q5OA 3C60A 4FG2A 2EDYA 5LGKA 3B77A 4GO8A 3B8SA 3M8OL 3PGDA 5CMAA 3RVXC 5TH2A 2FJGA 4R8WH 2G30A 1MVUB 3P2BA 3U7AA 6FABH 3CDYA 3UMTA 4B7EA 4Y4FA 1RURL 4L1HA 1CLVA 3P0VL 4IU2B 2YAPA 3E1ZA 4JFPA 4PDVA 2OXGB 2YD5A 1IURA 3WS3A 3ECBA 3US9A 3CQQA 1F8TL 2B15A 4W9FC 1SMAA 1G9MH 2CBOA 1F2QA 4G6KH 5C8JA 4N0FA 4YXHH 4FL4C 5D7LE 2OMWB 3ABMB 2QSQA 5JUEL 5DS8A 4WWNA 5JQGA 2AJVL 3ARWA 2UWEA 1A8JH 5KBDA 1MSPA 1SA0B 1INDL 3HFMH 3CGTA 5I1IL 1JRHI 1KJ2H 3ULUF 2MKLC 3LSOA 4U6XB 5CCKL 5DUPH 1Q7YW 3CFIC 3OGOE 1XFPA 4UIKH 4OU3A 1M6UA 4CUCA 5GZOD 2R9HC 3P3TA 1EO8L 4YHLL 2VRQA 4WNJA 4XH2A 3LPWA 1FNEB 2FO1A 4A2HA 1N36B 5IT2L 3WO4C 4GQRA 2DLHA 5E6UB 1A6UL 1OZUA 3SJBC 2R4RH 1KXVA 1YXBA 3PGFL 4MTOA 4D8OA 5C0AE 2FNWA 1WT5A 4BDVB 4JJ5A 3VTTA 3VYPA 3II3A 1IKFH 1A7QH 1HNWO 2DPKA 5KUKA 4QRTB 3FH7A 3TCUA 5IDJA 3QNXA 3C09C 2VM3A 3HN5A 4ECNA 2F15A 2UZIL 1N0XH 1I7UB 3ZDYE 5DECA 4TULH 5I1HL 5KAFZ 3EYSL 3ULSB 4W9LC 2V9UA 2VSCA 4X7SL 3BIKB 3S34H 1V7MH 1U41A 2VDLB 1BP3B 1J8SA 4P2RB 4FFBA 5E5MB 5DQ9B 4A6YL 4JHWL 5IFJA 3QFJB 1G9NC 3E80A 5MEQA 5C0FB 4NXNB 5LMUO 3O3AA 5EU6E 2JKLA 4PJBA 5I1JL 3US0A 3L1OH 5E94A 2WYZA 1JCHA 4DWHA 2NX5A 2DIJA 3DI3B 1FFXB 2JQMA 4AQAA 5KOMC 2GQHA 4DYLA 3ZTNH 1G7MB 1F0LA 3RBGA 3JWOL 4J42A 3PPEA 1BJ1H 1JPST 2EDMA 3LHPH 1J0KA 3ATDA 2R0KH 1BYPA 3O2WH 2LFGA 4OF7A 2BOCA 5BZZA 1U30A 2VZTA 2DBLL 4YNYB 4FZ8L 3BN9D 5B1OA 1I3RB 3ELAT 3RZCC 1E9OA 3MCLH 5K9QI 1PNKA 3KHOA 1BVNP 4HHWA 1LEKB 3UC0L 4HMEA 2VOTA 2N04A 1FG9C 2GIYA 3D30A 4BH8B 2A74C 3QUKB 4RQQB 3BO8A 4KL1A 3GMMA 1QSFE 5CJXC 1YPZA 1IAKA 1T1YB 1SGKA 4JEGB 1KN2H 1ENVA 1KGCE 4AQAB 3FOLA 4P9HC 4XPAH 5DU7A 5K9KB 3P73A 1ZGLB 4JR9L 4OI8A 4UDUB 2XBDA 3SGEI 4Z6AT 4I1PA 2BVPB 1DJZA 4PTUB 2KKQA 4MHHG 4PWIA 2O5YL 3GWJA 3H9YA 4AL8H 3SJAC 1FV1A 4X4XB 2ITEA 3ZSSA 1K72A 4QTHA 4I1NB 4L0PB 5ES4B 5C09A 3TF4A 1XIWD 1SQMA 1NM9A 1XHZA 4ZMYA 3NIFE 2VMDA 2XG5B 2R69H 4O2AB 4JFOA 5JHDE 3NQKA 5A2AA 2ZAHA 2K45A 4GRMA 1LUVA 1TJIL 4HD9A 5FYJU 5MEPB 1TSRA 4L4TB 5ESQB 3L71H 3DX4A 1I82A 4CGTA 3BO8B 2I07B 4CH5A 2VMJA 3PHQA 3SCMC 3OAAG 3CCRV 1LK2A 2ESVE 1C9SA 2X44D 4UQEA 4MYWB 2J20A 4AUYA 1K8DA 3FQRA 2Z1PA 1A7NL 4R7XA 4XNQA 2IVFC 2P47B 3HI1A 4K3JL 1JPFA 4CDGC 3ULUE 4I18C 4YXHL 4YSEA 5F3BA 1FFRA 1XBLA 4YIOA 2C9AA 3WTXA 4DP0X 3ULUH 3SE3C 3SD5A 1E43A 4LQ1A 3DO7A 1YY8B 2F8VA 5EOCH 4M93C 1MVFA 1KZYA 4TRPH 4KDVA 4U1SA 5I6LA 5MERB 2JLPA 3DVNB 5C7XH 4FNLL 4PJ9A 3QORD 3W38A 1C5CH 3QDJD 4OFPA 4XTRD 2D7QA 4P23A 3L4ZA 4R6UA 5AVZB 4KV5E 2XWRA 5I18H 4OIBA 5EU4A 2QQQA 4UOZA 3ILPB 2XPZA 1C12B 1FUNA 2J43A 2OR9L 1BD2A 3KPTA 4E4EA 1KC5H 2R51A 3CFJA 5GS0H 1MUJA 3LZQA 1JGUL 5IB5A 5KBLA 2P8PA 3OKMB 5J1SC 1N10A 3FRUA 3OSKA 5IOKA 4CC1A 2HB0A 3PWJA 1ZJBA 4QI3A 2VDMB 5LAXB 3UEZA 1MJJB 1BVKB 2QLVB 4QOKD 2D31B 3GF8A 4LHUA 1DQVA 2QPSA 4MDJB 3VX0A 5KBPA 2YUAA 1AIFB 1HNXB 1QBZA 3GKWL 1BEYL 1QI3A 2ZG1A 3ZUCA 1MWAA 3OW2U 2Q76B 1JNHA 3LNDA 3W39A 2E5LB 1SFDA 4C4UA 1D5BB 1RUAL 1MQKL 3ARRA 3CD4A 5BVJA 3NJVA 3FUFA 1F90H 1ADWA 4DK1A 2XN9E 4RGNB 1MFDH 1TGOA 3KPPA 4HMDA 3HUJA 4FLHA 1H15A 2OXHB 3Q43A 5EF0A 4JFFB 1U92B 2LAGB 4LCCC 4W6XB 2AQSA 2YEVB 2WXOA 3T4AB 5T33L 4NN6C 3LD8C 2X4SA 2LU7A 1U6AL 1IGFH 1UQSB 3QVNA 1JV5B 3MV8E 3T3MF 4CMHB 4HV8B 2BVYA 4JDVB 4XNYL 3ZDWA 5BQ7B 5JPNC 4UCRA 1Z5YD 1RUPH 4F9PA 2N59A 3OMNB 3LRGA 1PZ3A 4P46A 3DDGA 3GZOA 4JFEB 3SJVD 3TXAA 1XTLA 3G7TA 4GX1A 5DD1L 4RX4D 5IROC 5EUOB 1K4CA 1ET5A 1Z3GL 2F7IA 3TTYA 5JDSB 5CO1A 5KHJA 2WQWA 1WA0X 4CS4A 4NRYB 4FEMA 1PM9A 3N1FC 3BP5B 5C7ZA 4OJFH 3KYAA 3TBBA 5LWYL 4JPRA 2BDNL 3MHHC 3GSQA 1UQSA 1KJ2A 2AJZA 1P4IL 3OPZH 4HIXL 4MCZA 3CZUB 1YMMD 1GR7A 4LGSB 4JGUA 1SEQL 4XBEH 2B3IA 1EAJA 2BW4A 5JW3H 2P48B 1YDXA 1BZQK 2GTQA 3LVEA 4ZW3A 1FS0G 1XX9C 2ZKYA 5IIEB 1JZ4A 1YVLA 4XMPH 4KJQC 5AVRB 2RFXB 5KSVB 3H3PH 3SE6A 1IJ9A 1BMFG 2IWGA 2RJMA 3PAUA 1Q94B 1R3LB 1IM3D 3TO2B 2YS4A 2WXIA 4OX9B 3UXFA 2HJFC 2XASA 3UPAA 5HJDA 4PBVC 2ZUWA 4XNXL 4W6WB 2J88L 1W6WA 3GSNA 3MR9B 2OK0L 4P2QD 4KOCA 4ZOAA 3RTQB 3QEQA 4OCWL 5DMGD 4O4YL 3ATEA 4JPSA 4KHPB 4HKBB 1FG2A 5IVZA 4AIOA 1OE3A 4Y7OC 3QO0A 5D7SH 1E0OB 1HNWB 4QRPE 4R5XA 1NGPH 2JB6B 2UVEA 3TBTB 1SHWA 1L7IL 3LEYL 1JGDB 4FP8L 1V3MA 3O3EA 3ISYA 1EEYA 4OPAA 5LP6C 3DX0A 2V3EA 1LP9A 4XWGH 2R0WH 1NCCL 2FT6A 2A9CA 3IGFA 2EYRA 3JV5A 1SQPH 3O6LH 2XOTA 4PJGE 1KPRA 1OWWA 3ZDYB 2C1OB 2A1WL 3DX2A 4GS7B 3LPFA 4WHYG 1GOHA 1XH3B 2RCVA 2XWBA 4JYBA 5EO9B 4CVZA 1NJ9B 2ADGB 1EZLA 3KJ6H 5J11B 3L45A 1JD7A 5I73B 4ALAC 3VMOA 1KJMA 3FPXA 3M6DA 5EC2B 1AE6L 1RI8A 4GNKB 2RR3A 1FGNH 4U6VH 3WFEL 2X4PA 1RZKC 1IGCL 5ICYA 2AVFA 4JRWA 4DETA 3C5SA 5DEJA 1SQBH 3SE4C 4HUXB 2WLMA 4P8QA 2Q0OC 1T6WA 3L72H 4BK5A 3QUXC 4NGHL 2OYKA 3NZHL 1NGYA 3BMVA 2PW2B 1GIGH 4TSBH 3ZE1F 5I23A 1JNNH 1MCQA 4HWEH 3B9KC 4HOWA 4WO4A 1IZ3A 4LCYA 2QQLH 4FQXD 3SIKA 3RDTD 4P57B 4YO0A 1X5ZA 5F3HA 1BWWA 3EH3B 4HJ1A 3L3KA 3GRWA 2VUOA 3CXHF 1KTCA 1D5IL 3ARFC 4NP4L 4P23D 2ARWA 4FIPC 1Q8IA 2F23A 1A4BA 2GAZB 2QPUA 4KI5C 5IR1B 1IE4A 5FM5M 2GYSA 4Z7VB 4HFUH 4M02A 3ZMRA 3HBQA 2PCXA 4K3DL 5HGDB 2EUVA 1X4TA 1E3FA 4FQCH 1EXUB 3U7WL 3OMAB 4ZD3H 1AHKA 3ZQ9A 3KDPB 5HDBF 2VMCA 1Z9PA 3RTQA 4PJGF 1JPFB 2JKTM 2XWZA 1LQSR 2R39A 3BAIA 3HMXA 3ZZSA 4ZOLB 1EN6A 4OZGB 2OL3H 4YN3A 4U6TA 2AJXL 1W72A 2MNJB 2VR3A 3WFDH 3EUDA 4IIZA 1GTOA 3UYPB 5BO0D 2JJTA 2EVFA 2WN3A 5EO0B 1ASOA 2FL5B 4HWBL 2ENYA 4X7EC 5HXMA 1M2VB 1HWGB 2F53E 3IDNA 4PRDA 1WPCA 5D70L 3OGIB 5E6RB 3FT1A 5HI4C 5B3SC 2X0VA 5IB3A 2ZYHA 4JN2A 2YAHA 4KXCA 5K1VA 3TT1L 2E86A 3KLQA 5IW6A 4N3TA 5D7LD 4LAJH 4PRBA 1HH6A 3B2EE 2HVJC 4QGPA 1YITV 2B8OT 3GMNB 4NJAH 3VSTA 3US1A 5KHKA 1PKQA 2AAVA 5EU3A 2QPDB 2TAAA 3FOLB 3QCVL 4NZUH 1LMKA 1XZWA 4N6RA 3NA9H 1S7VA 2ATPB 3HI6L 2NLJC 4GAGH 4GMSL 1OT4A 2DTMH 3IJHB 2Z4QB 2AGJH 4KUMA 5E8NA 5IOPB 1EGJL 1HOCA 3PDOA 4HH8A 4DP7X 3ABKC 3DGCR 2AK1L 1ZUQA 1S7XB 3RAJL 1V3KA 1CURA 1R0AH 5I2IB 4L2LA 4PJ8B 2HLEB 4HAKA 3GXTA 5C08E 3NSJA 3GMQB 2B77A 2D3OW 1HSBA 2WWNA 3FUHA 2JELL 2PXYB 3E83A 3RWDB 1U96A 1S5HA 3HG1B 4ADIA 3UABA 4WEMB 3GZPA 3T8XB 1IGJA 2F8XC 3E8BA 4TV8A 3E7JA 1W72H 1F3JB 5CEYA 3BKCL 1M57B 4PJEE 3TBVA 4FK5C 1QBML 2CO4A 4P5TC 1I5YA 3DA0A 3DROB 5AOZA 5FK9B 2FT8A 3MBED 4I18A 3PQYB 4JKPH 1EBPA 1R34A 2I60H 4GKNB 5EMYA 1HR0B 1UXWB 2WWOA 4G6FD 2F8OA 4MXQD 3C6LC 4PJDE 4DGYH 5HFMA 2P49B 3OJDA 3VSQA 3EOBB 1A32A 4AVKA 5TGBB 3GVMA 3T09A 1PV0A 5GIRB 3CRRA 2DL9A 4H25B 4QRTA 2JKIS 4FLZA 1TTFA 4FXGA 3I3EA 1CGYA 3QC5X 4JFVA 1UXWA 3OKDA 4WHTB 1ZEAH 3CVBA 3CFJB 4NUGL 1AZUA 4MTGA 5LNGA 1QO3B 4OZHA 4J12A 1AR2A 3VXUD 3QDME 2KDGA 3DVIA 1XIWB 4OGZA 3EFOA 4JGJA 2Y0SA 1N5AB 4U1GC 1XMQB 2HHHB 5CEYB 1L1FA 1FAIH 3BEVB 3UZQA 2VDNB 4KGJA 4FX5A 2C3VA 4OGXH 4D8PB 2IPTH 3OLDA 4GLXA 3TZVB 2HPOA 3HVNA 4DR3O 3T08A 4ZNEA 4GSDL 4DR4B 3GXNA 4I2XA 3NFNA 4NCDA 3O41A 1KB9J 4HULB 3B6SB 4PGDA 1Q6HA 5BXFB 3CZEA 4GIOA 2KZ1B 4H1LG 2XTSA 1GW0A 4HKZB 3G5XA 1CL7L 1TU2B 2XACC 3SO3B 9CGTA 5LNDA 1LQBC 2CHZA 4JPIB 2ZYSA 1T5EA 5EBMB 4ORGB 2DEYX 3LS4L 1B4RA 1HVXA 4LPYA 5IGXH 3UBFA 1S9XA 3HC3L 4NWUL 3B56A 3O6FB 3HHSB 3EYVB 1JFQL 3QEQE 4PJ9C 3FMGH 5EIIB 3F85A 3V0EA 3EYFA 5EEWA 4X4YA 2F74B 5ISZB 3CB2A 4BZ2H 4CH3A 2MFNA 3LXBA 1L0YA 1AG6A 2K78A 1HNZO 2PWHA 2Q7GA 3DX8A 1DQJA 4K15A 4U2YA 2JMRA 3SKMB 4NNXB 5AG8A 4I87A 3GI9L 5DHXB 1I1CA 1UVQB 2EUZA 4PY7B 1UM6H 4UUJB 2CR0A 1VACA 2JVUA 3O6KH 5FKAA 3RIAK 3OD4A 5AZEH 1ND0B 3D12B 4DVRH 3CX5F 4JY5H 2BVPA 4KHTH 5GGVH 1ORQA 4B7IA 2Q6AA 5LXVA 1T3FB 2BIMA 4KJYB 4J4PC 3TETA 3VGFA 2VQ1A 3IFNL 3V10A 5J6GB 4K3JH 5K9KA 4M03A 4CN1A 3NCMA 4I5BA 5DEDA 1AXTH 1NDTA 2Z0UA 5JHLL 5IUSA 1F5WA 4YQXH 3L9DA 4TVPL 4YDJA 1F1AA 5IM7B 3PY9A 4PWGA 1KTJA 4Y9EA 3D34A 1HZHH 4W4LA 3JCZA 4F8NA 5HDQL 3VMPA 5BV7H 1IBLO 2XYCA 4HBCH 4ZUWA 3B8YA 1TTAA 1FA4A 1U8CA 3I9AA 2DIBA 1R3JA 1UZGA 3MCYA 4MAZA 4Z5RA 2X10A 3RT3C 3G6DH 2OMVA 2Z9TA 4BZ1H 2XQBH 4RFEB 4GYCB 1HT6A 1E4HA 1G7MA 3VDBA 3F7VC 4JI1B 3AXLA 3F6IA 4LSUH 1FFXA 5C0IA 2WP3O 1FYTA 1EXHA 2BHZA 3WFCH 1IM9B 1MRCH 4NN6B 1X7QA 4JO3H 1IQWL 3MLTB 5H35B 1E9QA 1UM4L 4HLZH 3WL9A 4DEUA 1CXLA 4G6FB 4F8PA 5HY9B 4Q4EA 1Z5LA 3VFTB 1PZ2A 5JIHA 2P4KA 3TWCH 3GHBH 4QY8B 2GIXA 5A2FA 2IC2A 1R3IL 5M94B 3VFSB 3EH5B 3N2GA 4UCTA 1YPZF 3SE8H 4XNDA 2VR5A 5IW1A 4DEPC 3P30H 1PQZA 2C8NA 1KEMH 3PGCB 4U1LB 3V7AG 5DUJA 5DMJB 1FJGO 1RK0A 4S0TD 3CMOH 3ZDZF 1ET7A 4LLDA 3S9DB 2IG2H 3S36H 4W9HC 5E1IA 4Z1PA 5ABDE 1MELA 4LL1A 1Q86W 3ATAA 3M8AA 4BDVA 2VZ1A 3T3PF 5IW1B 5DWUL 3B3IB 4AGOA 4MVOA 2Y6SC 5B1JC 2X4TB 5J9PB 2A7WA 4WNQB 1NMBH 1VPOH 1SETA 2YXFA 4NJAL 4TSAH 1NM4A 4F33B 1JUFA 2E5LO 1OO2A 1K5QA 1HL9A 3JD4A 3APQA 5EOCJ 3DURB 3D36A 2PI4A 3IJSA 1WZAA 3OEEG 3CIAA 3L3GB 3QULA 5H94B 3TCLA 2A9MH 2LW1A 3IAGC 1N0XL 4X66B 4LAQL 1PZSA 3FAXA 2AZAA 2PYEE 3NYKA 5JH7B 2D7TL 5DD0L 1V7NL 4JHUA 1AS8A 4OZFB 5BRZD 4CC4C 2F6AA 1CR9H 5E1AC 3CCHA 3BN3B 4GYBA 3KBEA 1H0DA 2QVMA 4RISL 5HYJA 3DTUB 4XX1G 1INQA 3GIVA 2Y24A 3A47A 3NK3A 3EFDL 4DAGH 2HZHA 3PN1A 3VD2A 3ZIMA 4P46C 1MJ8H 4KVNH 4QRSB 5DJ8B 4ABUA 5C09E 1K6QH 1QFUL 2WXKA 4YBHA 1AO7E 3H1ZA 1P5VA 3WS6C 1GSKA 1H8EG 1C16B 2FJHA 5I1KL 3EDKA 3ZE2F 3MAQA 4OI9A 4C55A 2OK0H 3T2NL 3S97C 3B2UC 4FC3E 3ARDA 3GTVA 5JHDA 1AKPA 3RWHA 3RB7A 3CVHL 5JJJB 2VW4A 2Y69B 5TISZ 1G4RA 5DMGC 2OCCB 1DK1A 3NTCH 2FMLA 4H0IA 4HPYH 3OM3B 1MCDA 3LZRA 4X5XA 4XPHL 3RX8A 1E5AA 2IH9A 4RMRA 5IHUH 2VXTL 4H8WH 2UY6B 4ZMLA 4P2RA 3FW6A 4K7PY 1FVEA 4LFCO 1KBPA 2W65B 2FWUA 1NAML 2P80A 2XXGA 3P0YL 4LDOB 4M7ZB 4WFGD 4WFFE 5CLZA 3OXSB 3T6ZA 3B2DC 4K23L 1TZIA 4HDIB 3CZJA 4IBSA 1C5DB 3ML8A 1QSFA 5F96H 2GJ6E 3EJYC 5EOTA 1RPUA 2R69A 3NZ8B 4LK4A 4MJ6A 1MI5A 1AD9A 2FEDC 1HZHL 3SE9L 1RK7A 1E4WL 4F7CB 3TO4B 4G1EA 5IJKA 3BPCA 2ICWB 4MA7H 1TG8A 2BLFA 5IJ0B 1VZIA 1YEKH 4S1SH 3QZMA 4G2AA 3SPJA 1LGVA 4IRSD 4CU7A 1K3IA 4I2XB 3ESOA 4X42A 4ZYKA 2APWA 2NX5E 5BO1H 2QFPA 5FYLE 3RWJA 2AV1A 2W0KA 3ZN0A 4QJ4B 4JY5L 5EU6A 1BPVA 3UKMA 4N8CL 4LF8O 4LLVA 1IGIL 3V8CA 4RZCA 3CC1A 2DQGL 4MJ6B 3QBTB 2BRRL 2PABA 1C5DA 2MRYA 4TYUA 2Z91A 2NCMA 2Q6WA 2R56L 2ATKC 1RMFH 5BUPA 4HJTA 3HPLA 3TNMB 3NACH 4ZSOE 2WWWA 3P02A 3VU1A 3BAAA 5E23A 3G67A 1SUHA 1JWMA 5I5RA 1TUPA 2UU9O 2ICEB 1KKCA 3TJTA 1KC5L 4K94H 5JOFB 1CFVH 1TUEB 3KLDA 2BNQB 5HBBA 5DJXB 4FABL 2CUHA 3IB4A 1KBHA 1F86A 2X3AA 5L7XL 2YRZA 4NN5C 3RHWF 1ZGLP 1I8IB 2EXTA 5EOQH 3S37X 1HCYA 2QSVA 3FNKA 2QM8A 3CXHK 5D93B 2WD0A 2WXFA 2XKNB 2ZQKA 2IBZY 4BIZA 3SDYH 5IJKC 2XY1A 2EXYD 5TQ2H 3V4PL 2WXLA 1BVNT 2EDRA 1P7BA 5LP6A 1S9WB 4PCYA 1SY6A 4K3AA 1KBWA 3BAXA 3JD0A 2C34A 1SQVH 4K3DH 3GB7B 2AJ3A 4XB3A 2F95B 3LQZB 3QUYC 4OLVH 1IGTA 1AH1A 4GB9A 5L6YH 1JGLL 4KTEL 2IAND 5KX5A 2EYSA 3GMRA 1FLRH 5DZNA 4HF5L 2GKIA 1E6OL 5DO2C 1ZX3A 3GBML 2JJWA 4RMTA 1PSKH 3ZO0A 3WE6A 4CS2A 1EDHA 4DERA 3CN0A 1S8DB 1OZTG 2OJEB 3GMOA 1D7FA 1DVUA 4KQ3L 3L1GA 5CIPH 4U1IA 3BRDA 2YDEA 2LE9A 3N27A 3ZO9A 3I3BA 1NVPB 3GSUB 2YPLD 5EEVA 4XZUA 3LXAA 1PEZA 1BZ9B 4FERA 1EAPA 3HKFA 3L5XL 4Z7QB 3SGKA 4MBOA 1K5SA 4XMXA 1VF5B 1I8MA 4U0QB 5CJQH 3D4CA 1GH7A 4XB8A 5FW7A 5E4EB 1NL0L 3X12A 1UENA 5FOBA 1JK8A 4DN4L 1ZS8B 5KYUA 3TVMD 3GLAA 4C59B 3SJVA 1X9LA 1S9KC 5CLXA 2VDKL 4P4KD 3CMEV 1CLYH 2UXDB 3O8XD 2W59A 4FTVE 2BNRB 3CN1A 2BSRB 1Z7JA 3N43F 3DX6B 4ZRGA 1ZHLB 4PW9A 4ENZA 5D1XB 1ASQA 5PCYA 3B9EA 1ZA3A 4KMTL 3F5WC 1CYXA 3L17A 2XWTA 3WIHA 2QFRA 2IADB 1U2YA 1JDDA 4UNVA 5FO8B 3F62A 5AUMB 3F12B 1P7HL 4HS8H 5DC4B 1ZTEA 1D9KC 1U8PB 2BZ7A 1FL3A 3GZQA 3L4CA 1XIWC 5J3HD 3IPEA 1VQ8V 3U25A 4O9HL 3T2PA 5BS0E 2DMCA 2VW6A 3GDCA 5GRZA 1PKOA 2DKUA 3EAKA 4H1LB 5HI3D 4O4YH 3NPSC 1RZFL 2NXZB 3BUYA 4IIQC 2BSTA 5EU4B 4R4BA 4NTWA 3MV8A 1J5OH 1L5GA 2H41A 2QPFA 4JM4H 4NWTH 2QHRL 3IMUA 1JRHH 2HVKC 4DZ8A 4EE2A 1ONQA 4WV1A 3KKYA 2FYVA 3P4MA 2APBA 1XB6A 3ZEDA 2A9NH 3ARED 3CV5A 4PJHF 2V5SA 4YHIA 3SO3C 5AUMA 3LRSA 5AL0A 2NY5H 1BVZA 1NGYB 4GAJH 4RIRA 3QSKB 2ZWZA 2W0XA 5HVGB 4HUXA 3PIQA 1MEXL 3IXAA 4V33A 4GMTH 3JV4A 5I0WA 5EU6B 3VI3B 3RWRD 3AC0A 4R50A 1LM8V 5D4HA 3L73H 4MDIA 1ZLEA 4OJFL 3Q3GA 1BQUA 1DUYA 2HFGH 3BVWA 5AW0B 3KPQB 4BFBD 3FC8A 1PKXA 2WIIB 2I07A 3VM7A 4OCXL 1LXMA 4E68A 4QO1A 4FG6C 1UVQA 1SN2A 3UC2A 4EMZA 5BMFH 3Q8BA 3X13B 5BMVA 3IC7A 4PJ9D 3ETGA 3M7MX 5IJ9B 3ZMNA 1XL4A 1HNFA 1KXTB 1OSYA 3GS4A 2H32B 3GSVA 4LSRH 1FH5H 5T1KD 4Q6IA 1EEYB 3IMWA 3ZT5A 3NIGF 3U6RB 1KB9K 2IH3B 4NO3B 3APDA 1N6VA 4DR4O 1T5XB 4QUOA 3P4NB 2IGLA 2QVFB 3UBXB 5J89A 4NRXB 4UAOC 1JNNL 4KZCA 3BXNA 4N2MA 4BSJA 2X38A 5G5DB 2Q2EB 2VIRB 5EBWC 2IQ9H 2WTRA 3FQWB 1LDPL 1XH0A 1WUNT 3H42H 2ZX9A 2WC7A 2GCYB 1A4KA 3VQWA 2YXWA 3VAEA 4M61A 2N05A 3MRPA 2RALA 4IDJH 4NOFA 2DWXA 5JW4R 3KYMB 4PR5B 4FQXB 5CCKH 2PPFA 2DYRC 3BLPX 3DX3A 1L9MA 4Z95H 1S5JA 2YD8A 4L1BA 3F7VB 2FHFA 2EJRA 5HJBA 5DF0A 1HI6A 1XGTA 4F15C 5I8CA 5I15L 2LQTA 1Q38A 2UWEF 4DK3A 4IMLB 1FORH 3U4EA 4ACTA 4UM9D 4NUQA 1CE1H 3D4YA 4N1HB 1AGCB 2BP0A 1BSIA 4DF9A 4LARH 4XCYA 5EU7C 4KKZA 4NO2A 3LKQB 2PPDA 3RVUC 3N40F 1VQ6V 2KQMA 4H25A 2R72A 2NY4C 1VQKV 4HQQL 1RUPL 1WS7A 3D69B 5CZVH 1G0YR 3MRIA 1GZQB 4P2OD 1KF9B 1MCPH 3HS0C 4ZX3A 1OP5K 3VGGA 4UV4L 5JLZA 4DP4X 4LF8B 1ETZB 1IEAB 3B3BA 4CMHC 1OOAA 2YARA 3WSQH 2TRHA 4G7YL 4HAMA 3K0YA 2APSA 3L3GA 3L54A 1GKFA 3ZHDA 1ZT1A 2IOOA 2CR3A 3PV6B 3PWUA 2XA8L 1EV2E 4P9MH 3WEXB 4HOMA 4TV8B 1IBLB 2CK0L 2DZEA 3TOPA 2F5AH 4UQ9A 4KUCF 2UU9B 3AWEA 1DEDA 2FLMA 3MLUH 3QUZD 1FYTD 1NGZB 5B7MA 5IJVB 1ZIBA 1QABA 1QKZH 3CG8A 4UINL 4B3SB 2RMNA 1QFWM 3AMLA 1XCTB 3OC5A 3LIUA 4YHOL 3WEXA 4X6DE 4JW3A 1H9DA 1J5HA 4KQ3H 5IB2A 1SEQH 3V5DB 1KXHA 3HR5B 4LP4A 3V9CA 3BT2H 1K4DB 4LCIH 3LV3A 3P3RA 1ZGLM 5E1AB 1C08A 2NT0A 2YQGA 1DO5A 4Y19B 1GGYA 2AEPL 3FQNB 4EI5B 5J56B 2VN4A 1TQUA 3FUDA 4YR6A 2FYUH 3B43A 4GKSA 3TCTA 4L8CA 4NQXA 5IMMA 1RP8A 2JIXA 4G7SB 5IF0B 3HFFA 3V9FA 2VDQL 3JV6A 2EIEA 4YHIB 4YDKH 4G5ZL 4LFHD 1AKJB 4XPAL 4AXWA 4UM8A 2DD8L 2LU5A 3IU4L 4J1UA 2XUMA 1IIIA 2WIMA 5DURB 4WTZA 3P0GB 1JHTA 3N0AA 4IK7A 4ZOCA 3T4AC 4PLJD 3TFKC 2FBRA 5EORL 3VFPB 2FJHB 1C16A 1OHHG 1GS8A 3VCLB 3DV4B 4LWSA 3ARYA 4EKJA 5C0RL 2X4UB 4TQDA 2VSKB 4EN3D 4KX7A 5LA6B 4R7VA 4OFVA 1ET8A 1QPPA