3ABLB

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ablB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ablB02
2VSKB 2XVBA 3ABMB 3MX0B 1KDIA 1SHXA 1GW0A 3FQ2A 4DP4X 2BP8B 2FT6A 2CUAA 3CG8A 2GC4C 1W8EA 2UXVA 1X9UA 2X87A 3DKHA 3IN2A 2XX1A 1JXDA 1PAZA 3SBPA 2WO2B 2IDSA 3X1FA 1M9WA 2GBAA 2BW5A 3OMAB 1L9OA 1WS8A 2DWSA 2YAPA 7PAZA 2EIKB 3V9EA 1JXFA 4A2DA 3TBBA 2J57A 3S3CB 4E9VA 3KW7A 3EH5B 2R7EB 4E9RA 3PPSA 5D4IA 4YSQA 1MG3C 2HLEB 4JKNA 2ZOOA 3WKPA 5B7MA 1J9RA 5B3SB 4YL4A 2PP7A 3S8GB 3TBCA 1AG0A 3T6VA 2XX0A 1GSKA 2XV2A 2YAOA 1AR1B 2I85A 2J55A 4UANA 2I7OA 1BXVA 1JZFA 4DP2X 1N68A 1QHQA 1AOZA 2GI0A 2BP8A 5IY5B 1M57B 2AZUA 2MRYA 3QJRB 1NIAA 2H5UA 2FQEA 1OCZB 3FS9A 1NDTA 3NJMA 5I5JA 1KBVA 2FQGA 2FT7A 2HX7A 2VM3A 4TXVB 3QJVB 2FT8A 3WNIA 3OD3A 1GYCA 1E5YA 2CAKA 3IE9A 1W6LA 2TSBA 1RZQA 3H56A 4BDVB 3HB3B 2R7EA 4YSDA 1RZPA 4E9YA 1BYPA 1E30A 1SDDB 3EH4B 2HX9A 3N2JA 3S3BB 3T6WA 1IUZA 1A4CA 1A3ZA 2PCYA 2YEVB 1JERA 2IWEA 2XU9A 4KO7A 3WG7B 4X4KA 1XB3A 1ZIAA 3BVDB 1RCYA 2BP0B 3QPKA 1GY2A 2H3XC 2GSMB 4E9WA 3NSFA 4HCGA 5B1JA 4ZK8A 1GS6X 4HCIA 3DIVA 3UABA 4N4YB 1PNCA 1MG2C 1SNRA 2JFCA 4F7KA 2DV6A 1OCOB 5I6MA 1WA2X 2IAAC 3OMNB 1JZIA 4QLWA 4DP8X 4DPAX 1YLBB 4CSPA 1NIEA 2PPCA 1JZGA 5F7AA 5EHFA 3OMIB 2VW7A 2I7SA 2BWDA 5AKRA 2MTAA 2QPEB 2PPAA 1SDDA 2QDVA 5FC9A 1BQ5A 1PMYA 1BEXA 4YSAA 2GIMA 1I53A 1PY0A 5B1BB 2AVFA 9PCYA 1AZNA 2BWIA 1VLXA 2BP0A 2YAHA 2FJSA 2YQBA 1E67A 3ZDWA 3NJNA 2GC7C 2XXGA 4GYBA 2GB2A 5I6LA 3AG4B 3WIAA 4HZ1A 3TU6A 3PAZA 3GDCA 3OQRA 3H4FA 1KDJA 3FU9A 4AKQA 4NB7A 1PLCA 2DY2A 3ERXA 4AI7A 1A65A 1L9TA 2IH8A 3EF4A 1CYWA 1NZRA 1NPNA 2Y1AA 5ANHA 1J9TA 3KW8A 2HX8A 4KO5A 1FA4A 1GS7A 2YAMA 1JZJA 5I6KA 1ILUA 1AZBA 2P80A 2HZHA 5I6OA 5I28A 1ZV2A 1FWXA 3NSDA 1XMEB 3NJGA 4DPBX 3HEIB 3L45A 4HIPA 5I6NA 1KV7A 5PAZA 5B7FA 5I5IA 1CUOA 4E9XA 2CJ3A 1ASPA 1IBYA 2BW4A 1DZ0A 2EILB 1J5CA 3OM3B 4ENZA 3BQVA 1NICA 3ASOB 3D12B 5A7EA 4AKOA 3PAUA 2AFNA 3MBWB 4M3HA 1ZDQA 1ZDSA 4F2FA 2EIJB 5I26A 4DPCX 2NRDA 1MDAA 1ADWA 1AG6A 1IKOP 1ASOA 1SHWA 2FTAA 1JZHA 3NJKA 3ZBMA 2PPEA 3G5WA 3UACA 4JHVA 3T6XA 4YSPA 1WA1X 1TKWA 2HRGA 3PCYA 3FQYA 2B3IA 1GR7A 5AZUA 1URIA 3FT0A 3ABLB 3T71A 3FSAA 1HAWA 4BXVA 7PCYA 1GS8A 2ZWNA 1V10A 4KO9A 4A68A 2A3TA 2AANA 1NIFA 4A2GA 3SBQA 1NINA 1J5DA 3FQ1A 3FSZA 4GXFA 2UX6A 2EINB 5B1JC 3AG2B 1ETJA 2N0MA 2QPDB 4N8UA 4KNTA 3GYRA 3V9CA 1JZEA 4BWWA 3EHBB 4CSZA 4BWTA 2XYBA 4DP6X 3WNJA 3X2QB 3NJFA 1ZPUA 1E65A 1CYXA 1WS7A 2XUWA 5I6PA 3ZX1A 1OE3A 3FU8A 3X1EA 5PCYA 2PP8A 1KYAA 4G7RB 1SJMA 2H47C 2QT6A 1IC0A 4PAZA 4GY4A 2Y69B 4UAHA 1L9SA 1WA0X 1BXAA 2PLTA 3FSWA 2LLNA 1SF3A 3AZUA 3GXUB 1UATA 4GP4B 2XWZA 3AG1B 4YSTA 4YVNA 3JT2A 3AW5A 1BYOA 1TU2A 2TSAA 1R1CA 2CBPA 3S3DB 2QDWA 4YSUA 3H4HA 1AANA 4G71B 1XB6A 3IBOA 2VSMB 3C75A 3ZIYA 1EHKB 3FPYA 3CZUB 2BZCA 1AACA 4P5SA 1KGYE 1T5KA 2PPDA 2JKWA 1PZCA 3DTUB 1HFUA 1JOIA 1CC3A 4BXSV 5I5MA 1KCBA 1A4AA 1PNDA 4YSCA 2OJ1A 4JHUA 1SFHA 1JXGA 3FPXA 4E9SA 2FWLB 2WSDA 1OE1A 3NJHA 2YAQA 4YSOA 3PXLA 3T6ZA 2PPFA 2XLLA 4HALA 4NAJA 3TA4D 1AS7A 4G72B 8PAZA 6PCYA 1J9QA 4KO6A 5B7EA 2YAFA 2PCFA 2ZXWB 3QJUB 4E9QA 4E9TA 3NSYA 1A4BA 4YSEA 3NYKA 2IDTA 3SBRA 2RACA 2XXFA 1PLBA 1NIDA 3NJJA 2VMJA 1OF0A 5F7BA 3AG3B 2X88A 1AIZA 2FNWA 4KNUA 1OV8A 1E5ZA 3UAAA 4BWUA 1X9RA 1QLEB 1ASQA 2DYRB 2JXMA 3FU7B 5B1KA 1B3IA 4A2FA 1AQ8A 4FA7B 3CDZA 4FAAB 4AZUA 3UAEA 4HHGA 3N55A 4YVUA 2YXVA 1JVOA 4BK5C 5LDUA 2OCCB 3S8FB 4KOCA 1N70A 2J56A 1GY1A 1ZIBA 1ET8A 2BZ7A 1W6WA 3QJSB 1AS8A 2YAEA 2XV0A 2UX7A 2VW4A 1BXUA 3JTBA 4HCFA 3UGEA 5AFAA 2IWKA 1OE2A 3IEAA 4L0PB 1IBZA 6PAZA 4EF3A 4A2EA 1TEFA 1CURA 5TK4A 3AY2A 2IH9A 1BQKA 1ID2A 1L9QA 2OV0A 3CVDA 3UADA 1NTDA 1J9SA 2IDUA 4GP8B 2FQDA 4NERA 4W9ZA 4F2EA 3U25A 2PP9A 1BAWA 4Q8BA 1A8ZA 1AZRA 4W1TA 2BO0A 1L9RA 4G7QB 3NP3A 3X1GA 2CCWA 4M4RB 3NSCA 1WAEA 1AZCA 3ABGA 1ET5A 1PLAA 3FU7A 2BHFA 1PZAA 4RH4A 2W88A 4YSSA 1OCRB 1NWPA 2AZAA 1KCWA 1OCCB 2Q5BA 2Q9OA 4K9JA 2VN3A 1BQRA 3PLYA 2DWTA 2IDFA 3SQRA 1MZZA 2VW6A 2IWFA 1M56B 2YARA 2UXFA 3TASA 1PCSA 4WTQA 2UXGA 2YXWA 3T9WA 4GP5B 2HXAA 4DP5X 1NPJA 4G70B 1PZBA 1HAUA 1AZUA 4KNSA 1QNIA 2DYSB 1AS6A 3QJQB 1NWOA 4DP0X 2HRHA 2P80D 3NJLA 1FFTB 5D4HA 1MZYA 2W8CA 1JVLA 1SF5A 1AAJA 3PAVA 3X1BA 1SFDA 1OOWA 4P5RA 4DP9X 2XV3A 2J5WA 1V55B 3WKQA 3WI9A 4A67A 4UF7C 4WKXA 3QJTB 3FSVA 4MFHA 4KOBA 4BDVA 5E9NA 3X1NA 1EZLA 3EH3B 3FYIB 4HAKA 1PF3A 2CALA 1F56A 2EIMB 3CVBA 4A66A 2GHZA 3ABKB 1ET7A 1V54B 3CVCA 2WO3B 1L9PA 2ZONA 2B08A 1RKRA 2FQFA 2IDQA 3CDZB 4QKTA 2E86A 3NP4A 4AKPA 3IN0A 1XB8A 3NJIA 1KBWA 3NT0A 4Q89A 2VM4A 4DP1X 5TK2A 3ASNB 1TEGA 3RYMA 4G7SB 3FYEB 4HHWA 1ILSA 2UXTA 1DYZA 5B1AB 4PCYA 4DP7X 4YSRA 4A2HA 4AX3A 5D4JA 3QQXA 1NIBA
chains in the Genus database with same CATH superfamily
2BTQB 1E40A 5EC2C 1P7HL 3D0AA 1BQHG 4ZMVA 1AE6H 1MWOA 3T0EC 4PW4A 2YI9A 3MGTA 1X9UA 2X87A 3TM6A 1I3RB 2XX1A 1JXDA 3CFEB 1MW2A 4TVPE 3KLAA 3N6YA 3DXAA 5INCB 4QRPD 2IAMD 1M9WA 4EB6B 2O5XL 3CIQA 3RZCC 4L8CA 3CRMA 1LR1A 3JYBA 3B2MA 1IAOB 1U4FA 1TNNA 1UFGA 3E8VA 4UUJC 3H7BB 1YUHB 2VN5A 1NM4A 2DWXA 1IX2A 2VRKA 3IDGB 4Y4KA 5AW0B 4GG8B 3ZDYF 2W07B 3FUNA 3RY4A 4TVPH 4AXWA 1I7UB 3BE1L 2IPKA 3IJ7A 4MQXC 5JHBA 4YLCA 4GKOA 1HILB 5EZLA 2XAHA 4JRXB 2DTSA 3AREA 5K9QI 3DXRB 2HG5B 2PW1B 3I56V 1A9EB 1HH6A 1HQ4A 3TPUB 3OR6C 5ID0A 4JRYA 5LMUB 4PA7A 3CHSA 3K04A 4UM9D 3LSQA 1F6AA 2E7BA 1NGQH 1X3DA 5CJ8A 4UQDA 1OZ0A 4TUJA 5E7BA 3MLVL 2H6UA 5DUPL 3G9VA 2ENQA 1QTPA 3IFOA 3ZHRA 3BABA 5FFOA 3VI3B 1AH1A 1Z2GA 1XDTT 2X41A 3GTNA 4RMVA 4XP6L 4EDXA 2X2HA 2Y4UA 4ODTL 1C08B 4DK3A 4G8FA 4Z7OF 3E0GA 3CRQA 5F9DC 3WSQL 4AEHH 4EN3D 5DSCB 5B3SC 5BR8B 4HF5L 2HEPA 2MWCA 4DR6B 2M1KA 4NCC2 4IKLA 3L70H 2LGWA 1JN6A 3UC0H 5HYIA 4PP2A 4KI5C 4YE4H 2OP4L 2EDLA 4NT6B 4PHXA 4A37A 3DX1A 2Q7YB 3FSOA 3RVXD 1R3JA 1A3ZA 1G6RA 2YEVB 2AEWA 3HE7C 1KTLB 3IMTA 1QYGH 4GCZA 4G6KH 1CLZH 1I9RL 2GJZA 4XN9A 4LLDB 1JNHA 3JAKA 1QSEB 2CHWA 4ODUB 4M93B 4ZMYA 5IMMA 3S4SA 3CJHB 1INDL 1NGXB 1S7UB 1QKZL 2H3XC 3A4FA 3MA7A 4M6OH 4EIZC 2WZPD 4WW2B 3U0PA 2YR3A 2NY3D 5AAPA 3PL6D 5CN2A 1TQSA 4QHNB 3QDHA 4JYYA 4UTBA 4TUYA 1CU4L 4ADIA 4KY1H 5HHNB 4DV4B 5IVZB 2A9AA 4IS6B 3ZYZA 1K8IB 4GO9A 3MLWL 5GS0D 4X4MA 5EBGA 4CSPA 5I1IH 5GISH 2Q87A 3VM5A 5CGMA 3ARFB 5HHPA 4MDJB 3MU3A 5LGTA 4H20H 2UU9O 4J9YB 1UYWH 5KYUB 3LD8B 4NM4L 4DEPB 3TCLB 3MJ8B 3B9KB 3GMMA 4WWKA 5FF6B 1TYEB 1SDDA 4DKEH 2C1OA 5BOJA 4RDQF 1ZLUH 4YSAA 2G9HB 4X6BA 4FQCL 3DOIA 3CLWA 4XDLA 2IM9A 2JI3A 3DRQA 4KH2A 3SE9H 4APQD 5ISZB 1EVTC 4G6AD 1WRFA 2JH2A 1LO5B 3OAZK 1MSPA 3VXSB 2FJSA 2K70A 3CCEV 3FH7A 3H1IH 1G84A 4JM0A 3MOBL 1VF5C 3S35L 2CHXA 4GXUM 5FA4A 2EYTA 4MNHB 3BXNA 3MRJA 4PJ9C 1AQDB 3MNVA 1E3ZA 3K1DA 4UYQA 1U42A 2P5WE 2HCZX 1Z32X 1KDJA 4WY7H 1ZGLP 2UXDB 1THAA 1QZ1A 3MJ9A 4ALAH 1UXSB 4AKQA 4NB7A 3QC5X 4PJFE 1MUJA 3P3PA 3QC6X 1HDJA 5G5DB 4DGUA 3VWKA 5SWSA 3OZLA 4I3GA 4KITB 5LGKA 4K94C 4LHUB 5CJXA 4H7VA 5LP6C 1E4XL 1A4JB 3G04A 3JWNC 4YHLH 2NY0D 1OANA 1WFNA 5AW3B 4D94A 5GZOD 3C5ZC 3VD5A 3ISWA 1T4KB 3JV0A 3V4UH 5BOPA 5D71L 5DJZA 4WVRA 4MSWC 1BGXL 1RMFL 2PWGA 2LP7A 3H2QA 1M71B 1QFWH 1R1BA 3CLEL 3VDBA 4F7MB 1RK7A 1SA0B 1PCXA 4TNVF 4WF9V 2Z4QA 5F7WC 4ORGB 4A63A 2YDEA 3MAQA 5EUKA 3IJSB 1J18A 3RPIB 4PS3A 5L3FA 2HP8A 1IBYA 2DIBA 1ESOA 3NMEA 3HC4H 1UJ3B 3HE6B 5TDPB 1J8HB 2NTFA 4G11A 3BAKA 2FR4B 5GRXG 2UXBB 3K4AA 2ZKWA 1N5YL 3KPMB 4GS7C 4MASA 3WDJA 1M7XA 2F1BA 5GGRB 4DR7B 3EO0A 3NCYS 3NSJA 1J5OL 4KK9C 1L5GA 4Z3IA 1SYSA 3B1TA 1F5WA 1NCGA 1UT9A 1NCNA 2WLLB 2VC2L 4GUNA 1PY4A 4L2LA 2OL3B 5FXCH 4ZI7B 4LCWE 4LOFA 1EZJA 2ITCB 4PFEA 1BCIA 2OT5A 1NDGA 1T0NB 2FTAA 2PXYA 5BMVB 4PJCE 2PPEA 2EIKC 4CSTA 3UACA 2JJ1G 2IF7A 2EEAA 3GRWH 2F74A 4PP1C 3BZFA 5F6IC 2NX5E 2P4AB 3KJ6L 3PCYA 3FQYA 5I1JL 1Z5LB 3FT0A 1EXGA 4P2QD 1D5MB 1O6SA 4QRUB 3F01A 3DVNA 5A2LH 3T8XA 3W7XA 4ZI8A 5JORA 2ETWA 2IOMA 4K3DL 2HFFB 2WLHA 4KO9A 2YWZA 3L6FB 1RFYA 5IB5A 2GBVA 5D7IE 1Z2KA 1HHKB 5CSBA 1Q6UA 3O6LH 4GOSA 1OCWL 3GPSA 4HHAA 2MKLC 4ABWA 2XXMB 1E28A 2PWEA 1NCAL 3UJTL 1PZ3A 1OARL 2X2JA 1NCBL 4QRPA 1UWGL 4YX2L 4F9PA 2IAMA 2K6ZA 2A77H 3KPOB 1HC1A 2PNDA 1DQJB 4OVUA 4Z1PA 1ZPUA 3ARPA 3AXLA 4OZHE 2EEDA 3S88L 3KPSE 3O0RL 3FU8A 4H88H 4QAMB 3K81A 4QT5B 2N04A 3MBED 2X10A 4MMYB 4JI0B 5E2VH 2XBZA 5E8OA 1TUBA 3SJCC 3F65A 1SPDA 3GM8A 2LLNA 5JXED 4G6MH 1T0MA 3VGHA 5ADPH 4TUKH 4J3BA 2E8ZA 1MW1A 3TYFA 4NN6B 2LLLA 2K1EA 4UVCA 4K23H 2UY6B 4NQUA 4FQXB 2W9DH 4UM9A 3AW5A 3EHBC 2JKRM 4NO0D 4MTMA 4JANA 4JRFA 3FF8A 1FG2B 5E2UH 4POYA 3IDYB 4ZX6A 2YIDA 3ZR6A 2CPUA 4JJHA 3FPYA 1QQCA 3CN4A 3VRIB 2PUSA 1JFFB 1JG9A 1R3KB 2ZCKL 4IIQA 4ODSH 4CVXB 4KVCL 1OCOC 3TJPA 4PVMA 1BAFL 3R4DA 4U1IA 1JGEA 4WHDA 4EN3A 4Z3JA 4Q9RL 1SXZA 1BDYA 2VXTL 3FRPB 3MLXH 3D25A 3S2AA 5J1AB 5KUMA 4HU8A 1I4FB 2YPLD 4OAWB 3V2AR 2W65B 2Z93A 4LVHC 4R4BB 3SJVB 3FUMA 5JHLL 2HJLB 4LC1A 2XWRA 4X65B 5J89A 3SDCB 2BIPA 1XUQA 3JWOC 2OK0H 5E8DL 4KX9A 4QOKB 4GUQA 3KLQA 3BC9A 4I7ZC 4R90L 1D5ZA 1HXYA 4MA7L 2F7PA 1RLWA 4LFHG 1L7TH 1VENA 5FK9A 4W9JC 2WZPA 5B38G 5I73B 5B7EA 1UPGA 1S9WA 4PS8A 1MHCA 4Y5XC 3LCYA 3U36B 1NEZA 3SE3C 1ZPLA 3KWWA 3ECBB 3JV4A 1A4BA 3HFML 3L4TA 5DHVB 4MMZC 5F0PB 4X5PA 4I85A 3BRFA 1A7PL 5IYDO 1T3FB 2V4DA 2D2OA 2K3TA 2VLRD 4OQTL 5H8DA 5KYXA 3F7VC 3EYFB 3VXMB 3WTYA 5FFGA 3RBZA 2F5BL 3MDSA 1EEUA 5TGBA 2QELA 4KKAD 4OCXL 3B83A 1GZQB 5BRZE 4HISA 1X9RA 4JI6O 1N33O 2XG5A 2Y1ZA 4OCRH 3VFRB 4QHUB 3OKOB 5M7QA 1KACB 2J71A 2IJHA 1WD9A 1A7BA 4HCRL 3BWUF 5FGRA 4QKXB 4N5ED 4APQA 1NR7A 3BDXA 1R24B 4XNMA 5F9WB 3T1FB 3K4ZA 4DKFH 1CDBA 1ZLUK 5JQ6H 2BVEA 3BFWA 1M53A 4G7VL 4GW4A 5K9KB 1LEKB 4DGYL 4XE0A 3UYRL 1FL5A 1QW8A 3SD5A 3BZEB 2UZYA 4JS7A 3BGFC 1VF7A 5EU4B 3U30B 1OL0A 1XIWC 2P9RA 3D85D 1U8HA 1YYLH 3AM8C 4UXNA 3ASOC 1CURA 1RIHL 1LP9B 1XF5B 4OGXL 5TK4A 2Q8AH 3WEOA 2IH9A 5IOPB 3K06A 3CHRA 2OV0A 4N26A 4RGMB 5B1NA 1NCUA 5LQBL 4F3FA 3PQYB 1U8LB 1YPZA 5FWRA 5GZOA 1R0AH 1QFWM 1BAWA 2DQUL 2DLHA 2EJ1A 1DN0B 4G59C 2YD0A 4NC1E 3JVGA 2YXLA 3NP3A 4B7KA 4WEUD 3BQUB 5JA9A 5HHOD 1YEHH 4PJ7B 4KJQC 3GSRA 3UO1L 4DZ8A 4OZGE 5JQHC 3QWNA 1YUKB 4DV1B 4Q6IA 5C0CE 1IGML 2BDNL 5DT1H 3EDEA 1AGBB 4PUBL 1BX2A 3TV8A 2BOBA 4JO1L 4ONOA 5A16A 4IU2A 4PLOB 3BKML 3PP4L 2YARA 4GFXA 4BELD 4X66B 3JD1A 2ZQKA 4P2OC 2YQ3A 2PI5A 4FNUA 4IDJH 1PZBA 4P3DA 1A22B 5IW6A 3FAXA 3EGDA 1TVKB 3QJQB 1UKQA 3RVWC 3PJSB 4BM7A 3RN4A 4O51B 1MRFH 4FULA 1HWGB 1GCFA 2IADB 1IEHA 3NJLA 4BFFA 5F7KC 1MWAH 5EORH 1P9MC 5EOCJ 1DVFB 3QI9C 5HGHB 4MW3A 1QI4A 4NSKB 1BVNP 2WNGA 4HKBB 3TGXA 3MV9D 4J4PD 4GZRB 2C4XA 3K5SA 4FQJL 1F97A 4MMXC 4QHPA 4L0ZA 4YGAB 1MRDL 3P4MB 3ZEDA 1MEXL 1FL6B 2CK0L 3BPLC 4YGVA 5C07B 1NFIB 2E74B 1EZVX 2WM0A 2Y0SA 4XVUD 3SBWC 3WI9A 3NQKA 5KBNC 3FT9A 4WKXA 4PYHA 5ABZA 1F3DJ 1S7XB 4ZS6C 5HYJB 5J12C 5C6PB 1W9XA 4XXWA 5AVSB 4Z1VA 2O5XH 5JH7B 2KHAA 4LNUB 1LWHA 1RZ7L 4XMXA 4CC0A 1AKPA 3O2VH 3QCTL 3TZVD 4QRRE 2HHHB 3CMGA 3X3FH 4WO4C 5GSVB 3IXAB 5FLVA 5C8JA 1DQIA 4U05A 3BE1H 3OWRA 5JZ7C 2HLAB 5A2JH 2VZ3A 1IKFH 3IN0A 4NGHL 1O9WA 4XNXL 3TESA 1KBWA 3MRLA 2CDEA 3ETDA 1RZJL 3MBEA 1XD0A 1TEGA 1IGCL 1S3JA 4OZ4B 4YQXH 2WP3T 2ZNIA 2O6EA 2WLMA 3AAZB 5DS8A 3JSNA 4D2NA 4PGJA 2UXNA 3U9UB 4AX3A 5HPOA 5JXEA 2EECA 1FJ1A 1N6QL 3RG1C 5CJBA 1UJTA 2YMTA 3TBTA 5DD5L 3T1WA 1NFDB 2CAZC 3F7PC 5DVPA 1V54C 4FTVD 2XPGB 1B4LA 2WMPA 1JHLH 1RP8A 4R7DA 5DZ9A 5GS2D 1GGTA 1X5FA 5LBSA 2A6IB 3CSPA 4NO0A 1H5BC 2UXVA 5H37H 5EIVA 1R6TA 1MCLA 1YN7A 1HW7A 4O2BB 3WEBA 1YJDC 4W9FC 3B4SA 1SQ2N 1W0KG 2WYIA 1FYTB 1L9OA 4WGVB 4BZ2H 1UADC 4O02H 3FOLB 4OFIA 5IKCA 2ZUUA 3CXCU 1NCCH 2PR9A 4ZG1A 4WI7A 4PY8J 2AK4D 4DEWA 1AQHA 3RWIA 5E56A 1GC1H 1QA9A 2AERT 3MLTA 2V33A 4AV5A 1I9RH 3E2HC 2JQMA 3MRHB 4KUZL 5FUCC 2BSBA 1E4WL 1INDH 3J7HA 1QKZH 5IB2B 3N41F 1GN3A 4LCUB 1F4WH 1MH5A 3B3IB 5KSBE 5C2UB 1ITCA 1DTUA 2J55A 3HPLC 1CU4H 4K8ZA 4U6TA 2CR0A 1DO6A 1XCTB 2XN9B 3EGXA 1EEYB 5J06A 2QQLL 2EUWA 2FEDD 1AC0A 1NDTA 4AK1A 5KS9A 1AHWC 2JELL 4TXVB 5E5LA 4KBPA 4OVVA 4H8PA 3CFCL 2ATKB 2NTSP 1E43A 3WNIA 1E5YA 2AJSL 2VLRA 2ZIMA 4R2GD 1KIQB 3IU4L 1EAQA 3VTAA 3QEQE 4AJVA 2CO3A 1JOYA 1S3KL 1ZLDA 3L3KB 4ZDHB 1IEBA 1A4CA 4JZOB 3HHSB 2D3JA 1TXKA 3TFKC 2ZF8A 1KJVB 4GKNB 4P5KB 4X9FA 2B2XL 2G3XA 2JJVA 3ASWA 4ZFGL 2ADFH 3CAFA 5EF1A 2G5UA 1TQBC 3N2GB 2GSMB 3DBSA 3M1CA 4WFFE 1UOKA 3TJTA 2HVKC 3BD5A 1JZDC 4GKJB 1CGTA 1JPSL 5D1XC 1GGCH 3DX9A 1SNRA 3U79A 4PJFF 2P4VA 3LRMA 2G2RB 4NTYA 1EZVY 4JAMA 1H15A 1KC8W 3CH1A 4U1SB 2UXBO 1YLBB 1E4XH 4DCQB 2CDYA 3HZMB 4HJUA 3I6KB 4MVMA 4JO5A 3K0DA 1UA3A 1IB5A 2XG4B 3D85A 3GIZH 3OKMA 4W4LA 4OGYL 5EZJB 4XGZA 1N7ML 5DEZA 5MENB 1N3NB 1RZKH 4PRHE 2L7JA 5D71H 4YDJB 4DO5A 4PU2A 1JWMB 2X4NA 4IRSB 3CLEH 5JCOA 1BFVH 2CO2A 5E9DE 4A6YH 3VQ2C 1DGSA 2VDNL 3GMLA 3U6RA 2E6QA 4U6XB 1B3QA 4XPBL 4AMKL 1X5ZA 1I53A 4MJ6B 4GPVA 3OEEG 3RWHA 5I1DB 1FL3A 5DCCA 3BW9A 5DQ9B 3DC6A 2BWIA 2FEEI 5F6HJ 1IKNA 2BP0A 3F7KA 2ZYHA 2MCPH 5HHOA 3NEOA 4DUWA 1FFOB 3FT4B 5DO8A 1N5YH 1IFHL 2MQ0A 4YE0A 1IC7L 4CRPA 3RI5F 4ZFQA 1LTXA 1ZXQA 3N50A 2DI7A 3OSKA 2V3DA 1EZSA 1QR9A 3LEYH 4NX0A 4EJ1C 2BWQA 4WK2B 2DQJL 1WGVA 4W9DC 1OK0A 2HVBA 3VRJB 4ODBD 2QLYA 4PJCF 5ANHA 3JUYA 3FHEA 3ABKC 5CP7B 4I4WB 4OI9A 2LOEA 4PJAB 5CZXD 1YNKL 4NFCA 3A5VA 1B2WL 4FXGC 4R8WH 1LUWA 4K55A 1KJMB 1Y66A 5I1JH 3P0YL 2OZNA 4J2QA 2WVVA 1ANUA 1A1OB 4X0KA 1OWWA 2NLJC 1UKTA 1ZSDB 2FO4B 3L3JB 3MV9A 3QEHA 4J4PA 4K3DH 5HVHC 5D7IF 4NTWA 3UKMA 1OGAE 4YDVA 1QP1A 2J3SA 3GSXA 2WTRA 2X40A 5H2FZ 1NC4D 2DD8L 1OCWH 2CJ3A 4KAQL 3U46A 2BW4A 3CFUA 1FXKA 1DEEA 3PABB 1N5AA 1NCAH 2GJPA 1HNZO 1MQ8A 3CQFA 4G2AA 3LRKA 4B3VA 4ENZA 3TWCH 3DYPA 1UWGH 1NVPD 4RWHA 2DJ4A 3MZGB 4HZAA 4OZHF 2CH7B 4F1SA 4OIFA 1IGYB 2IG2L 3DC0A 5EMYA 3O0RH 2R0ZL 1AB3A 5E8NA 1JK8A 2DWEA 4PGEA 3G7TA 4X80L 3S8WA 2PY5A 4NOFA 4OSUL 4C47A 1U58B 2FH8A 4XMWA 3MUZ1 5GIRA 1BVLB 4K35A 3TO2A 2F7QA 4FFBB 1XGTB 4NUJA 4IHBA 3RWEA 1Q9WB 3FUDA 3WE6B 3QG6B 4YHZL 4FLTA 2F18A 4DGIL 2EULA 2EC9T 4G2KA 3LNMB 1OP3H 1DUZB 3RKPA 1H3TA 1Q4NX 2H3NB 3GBEA 2WXGA 4X65O 5AZUA 3WELA 7PCYA 3WTTA 1HEJC 3N40F 2BVOA 3DV6B 3NABL 2H7WA 4U6YB 1TTCA 4J1UA 2J1ZA 2DB8A 2E7LA 1IXMA 1ORQB 1TU2B 3MRQA 5DZLA 4KFMA 3P4OA 3FSZA 4FTVA 3IDJB 1KBGL 4KP4A 5B1JC 3L81A 3BSHA 4FI6A 3RYHB 4CVWA 1BLNA 1KUMA 2FATL 4K8RL 4RAUB 1IMHC 2R69L 3EJTA 5FCSH 1IAIH 4KVCH 4P46B 1MQKH 1D5RA 1DVYA 1JPEA 1ZHNA 1XNQO 3QQ3A 4ICXA 1CG9A 5DLLA 3OAYH 1M57C 3O3AA 5LNDA 2IANB 2F7OA 3UBXG 1ZCRA 4Y1TA 1U2CA 2HSIA 5CWSB 5I6PA 1N2RA 3R06A 1PIFA 3VCLB 2G5BB 4ZS7L 3C9NB 4N85A 5GHWL 5L4MA 2AK4A 5IR1A 2R83A 3RYIA 2QQKL 4J7ZA 5AW4B 4G43B 1FZMB 3NH7H 4GBXB 5LWYL 3U7WL 4I8DA 5I5RA 2BRRH 4MA7H 4X7TA 2QHRH 3BY6A 5K59E 4ZUSB 2H2PC 4LEEA 3B2UC 1MZFA 1P1ZB 4ZYKB 2WQAA 3ZMTA 3D0LB 3MCLH 3RWRD 1INQB 1ZS8A 2YUAA 3L4ZA 4YVNA 1WF5A 3L95A 5BZBA 3FOMA 3BJ91 2BXZA 3QRLA 4POZD 3CN1A 2P5EB 4ZSOA 1AANA 1MY5A 4P57B 5FYLE 1I08A 1HHIA 3APNA 1BZ7B 1A7PH 2C4FU 4N2GA 2FLMA 3P0VL 4ALAC 4AGQA 3MJ6A 1AACA 1KGYE 2PPDA 2KUTA 1EEZA 2BS71 2J20A 2WKLA 1UCBL 5GZND 3H42L 1TQUA 1JOIA 4IDLA 3U6XS 1DQKA 4R7NB 1CFTA 3CVHA 4HU2A 1PNDA 4OW6A 3NZ8A 5J9PA 4W68A 3PDOB 2QV4A 4UU9B 3SDLA 3WS6A 4TT3G 1Q86W 3RA7L 4R9HA 1OAYH 2DH2A 2EXSA 1DJXA 2IQ9L 2YAQA 4M1DH 4NZTH 4QJ3B 3PY9A 4NDMB 4H5SB 1B04A 2O72A 2PPFA 4C8XA 1MF2L 1JRHH 1ORSB 2EDWA 3AVEA 1X7SA 3D09A 3TJEH 3UTSE 3ZZ1A 4BKSC 4DGYH 3UYRH 3QNYB 4MHHI 4NRXB 4LP8A 3QJUB 2Y7OA 1M1SA 1CXLA 2TAAA 4LCWD 5TPWL 1CLOL 3TURA 4UNIA 3L54A 1A25A 3QJZA 3GSVB 3BGMB 1RIHH 2IDTA 3E83A 1XREA 4MNQE 1S4IA 4OGXH 5KSVB 3DRTA 3QUZC 4HEMA 4U1MA 4EIUA 3ULSB 1T2XA 2DMKA 1FPOA 1P49A 3G80A 4PGDB 4XN4A 1ACZA 1IT9L 1V3MA 2Y72A 4ZMLA 4O4HB 2QM7A 2L3BA 1H0DA 1TZAA 2DQUH 2GT9B 1VCAA 3LMJL 2H0JA 3SOTA 1DQML 3F85A 1VFUA 1G7HB 1MLBB 3GIVA 3UAAA 3PV7A 4HPYL 4OZGF 3OAUH 3D39B 3UMTA 2NYZA 4AQYO 1RV6X 3RDTD 2H9GB 2OJZL 3VFVA 4WFAV 1IGMH 3MVSA 4FA7B 2UWEA 3QFDA 4APXB 2HMIC 4PUBH 4XC1H 4C54A 2CMRL 4IU3A 4JDTL 4JO1H 1LK3L 4QXTA 4QHMB 4RQFA 5CLXA 2LGNA 2F1EA 3BKMH 4LP4A 5HD8D 5FEBA 4HG4K 5LDUA 2CXKA 1MREL 1YQVL 3QJSB 2NNUA 4YDZA 5K9QG 3GHBH 2UX7A 4OPHA 2A06H 2PYEB 5EFIA 4HXAL 3ZT7A 1WLHA 1Y07A 3IAYA 5DO2C 2CLVA 4AYBA 2AMUA 3OKNB 3QH3B 4K71B 2Z31D 4L9LC 4Q56A 3IGFA 4FG6D 1HOCB 3HHMA 3BZ4A 5EZYA 2QGEA 1L9QA 5MP6L 2DOSA 2NW2B 4GP8B 3IJEA 4AJ0A 1U33A 1UM4L 3QPQD 1NTKH 2VL5A 3B56A 4G6FB 4FQJH 5HBBA 2RQ8A 3GDBA 4N0UA 5DVNA 5AVRB 4G80A 1MRDH 1YSOA 1GM8A 4CN6A 5HJ3B 1MEXH 2CK0H 2B1HH 2MHAA 2VIRB 4N8PA 1L9RA 4Q9QL 3TT3L 3UAJD 1WLEA 2D7PA 4XCEB 1RJLB 1WAEA 4E9LA 4TVUA 2W0FB 1BAGA 4H2AA 4KTYA 4DV0O 2UVFA 2NQDA 2AK1L 3O6FC 4FL4C 3MD0A 3X11A 1WEJH 2RJMA 5EBMA 4PJ8C 5LA6A 1MDTA 1NC4A 2AQ2A 3M07A 3SKMB 3MN8A 3WY2A 1RZ7H 2VC2B 5JMOC 3ZOAA 3X3GH 1CICC 2BNRB 3QCTH 3GI8H 2A99A 4K7PX 2IPUG 3TZVA 4EZJA 3CD6V 4DR2B 2LFSA 4CH3A 2XAQA 4LOVA 4P48A 2ZZUT 1W72A 1SZXA 1AD0A 1UACL 2EINC 3F7RA 2WBJD 2Y1VA 1TVHA 4NGHH 5HDRA 4BQ8A 3QFGA 3DX8B 1RZJH 2Y5TB 4NPYA 5E4EB 2YKLL 1E5BA 1FNLA 3CEIA 1JVLA 2NDGA 4MZIA 1S9YA 5HYQA 2BMKA 5KBLA 1SF5A 4I2XE 4NO3B 4ENED 3HN3A 4YFDB 3EOAA 2WXOA 4CH4A 1HL8A 3EYQC 2EDQA 2Z35A 5DD5H 1MCWW 3CDGA 2ADIB 1LDPL 4DV5B 1IBFA 4WEEA 4OD2A 3JV6A 1IZJA 1R3IL 1BJ1H 3FSVA 5GGVL 1VQ9V 1A1NA 3CCMV 5HGDA 4GAFB 4JO8A 5EIIB 4U3SB 5IJ9A 3B2XA 1XF4A 3D0VA 3QG7L 3X1NA 3O9WB 1IAIM 4JQIH 1PF3A 3DO7B 1F56A 5IMOB 5ACZB 1TTUA 1U92B 3QORB 2BH0A 5EBLA 1FI8C 5CCGE 2OMUA 4L8DA 3CDZB 3M1BA 3AB0B 2OCHA 4JPRA 1PG7X 2FECI 1S6NA 1OSPL 3BMVA 4WK0B 1YVWA 3WXWL 4M5TA 1XMQO 3ES6A 5A6LA 4O4YL 2IGFH 1MCPH 4KUZH 3V7MA 4A7QA 5JOPD 5B5EZ 3RYMA 3U7YL 1FFXA 2PGGA 1BOYA 3IDMB 4O4IA 2GITA 5KSBF 4JUSA 4TLTA 2XKUA 5GGUA 1JWSB 5ECJE 5B1AB 4DYLA 4DP7X 2ID5A 1VCBC 3T3ME 4DUVA 3TGUH 3GB7B 4FLZA 1GW0A 5AB9A 1I8IA 4EAEA 4L3EE 2EKSB 1FXVA 1WBYB 2QQLH 2XFXB 4ZMPA 3KYOA 1DDTA 1GKFA 1XBLA 2YIBD 4LCYA 1MHHA 2RR3A 2JELH 2WTPA 3THMH 3PHOB 3LDDA 5IQLA 2WO2B 2DQFA 3TFBA 2Q69A 4BQ6A 4FLOA 3GMNA 3L71H 5DJ6B 1QLRA 1SN5A 2FJFB 4GW1B 2H32B 3OMAB 1P69B 4NRYA 2HJKA 1U3HD 1WZ1L 1HE8A 1DQLL 4HX1B 4MNGB 5IFAH 4LARL 5L7XL 4EFBA 4NUGH 1S3KH 2J57A 3WNPA 5KG9A 5GZNA 2R2EA 1JGLL 4JFDD 2EUXA 3GBNL 2E8YA 5C0CD 4FKKA 1W0YT 2X0LA 3N0AA 2B2XH 2OCFD 2H1LM 2NUPA 1MHEB 2HN7A 3S34L 2EVIA 1RVFH 4AQ1C 3LDEA 3TBVB 4B3RB 2E4TA 1PX3A 1TLMA 3SGJA 4YHPB 3N43B 2E75C 1NOFA 2I85A 2JK5B 5DMYA 5DMGD 1CDUA 1PVHA 5D72L 2IPTL 4XMPL 4M02A 1CTOA 4TQHA 4MVBD 4Y1SA 5IY5B 2GTWB 3L1OL 4YJ3A 1ZWIB 4G9DB 3NUKA 5EO9A 3LRSB 4I18B 2EXWC 4KUCD 3H3KA 4ZODA 4X6CA 5I18L 1I1FB 5IYBO 1KBVA 1FXHA 1T1ZA 4RFEB 1GYAA 4PJCA 2X6MA 2EZ0D 1N7MH 3QULA 3FAVA 1OW0A 2FT8A 2NY6B 3DTXB 5FV2A 1MCFA 4JVPA 1GYCA 4PIBA 2D7NA 4EIGB 4K7PY 2ROXA 4UCRA 2TSBA 4FQ1L 5J6GA 3UJJH 1NFKA 3H56A 4FJ6A 3HB3B 4E2OA 4UQ2B 5JIQA 4X20B 4CJ0A 3O2DA 3BP6A 5E1AC 3FTGA 4NZUH 4XPBH 4O2CB 4XNBA 3HC0B 5ALBH 5C0AD 5C0DB 5FYJE 4BKTC 1AY1L 1V05A 2NNFA 4JHAH 3IFPA 2O93L 5TTRA 2WXLA 3IPEA 2XN2A 5ILTH 4PN6A 5EC1C 4P4KC 1CB4A 4XX1E 3QIBC 5AVXB 4BSWB 4BFKA 3RDTA 1GY2A 1BZ9A 1MIEH 5LGHL 2CJUL 1P0SE 4HCIA 3W56A 4DJMA 3BSZH 4M6NL 4PRDA 2PR4H 1IFHH 4U6VL 5TE7L 3ULUH 1P6FA 3CHPA 3VI3E 2ZOTA 5FYJH 1F8TL 2CBTA 5D1ZB 1NAKL 1PNCA 2ADJB 1OP5H 3TV3L 3TN0B 1CD1A 3DDGA 1W0WA 3ZKXB 2XHBA 3MACL 1KB5L 2V3EA 1RP9A 5I6XB 1OCCC 2IAAC 1JZIA 3BWAB 4DP8X 5FNVA 1Y4MA 3FB5B 4NYLB 3ZK0A 1SZTA 2A3QA 2FJGA 2VW7A 2I32A 1NAMA 1YNKH 1SOXA 2NY5H 1M56C 2NCMA 2FAUA 1DBAH 1P5UA 1PFOA 3EOBB 3FCBA 4FMFA 4BGLA 1KMIZ 5IE9A 2BJML 4JZNB 5SWQB 1S9XB 2Z4TA 1F7YA 2QPEB 4BFRA 3C2SA 4MDIA 3B8NA 1QSEE 2FH6A 1SEBA 2E9WA 2GIMA 2JB6A 3OBAA 2JKTM 1JMXA 2WQ8A 4GINA 2ZNWA 3BEWB 3R8BB 2YD7A 1X4ZA 3UAJA 4RMSA 4Z76A 1FBIH 4Y2DC 4NKQB 3GSUB 4IOIA 4WKZB 1UOVA 5LYJB 3BZ5A 4IBYA 1FGVL 4DV7O 4HUXB 4LQ1A 2IBZX 3MRGA 2RAMA 3ET9F 4UB6Z 3ZMVA 2CHZA 2IG2H 2DEWX 3VWJD 1GGUA 2R0ZH 4JMNA 4X5WB 4YXHL 3MMEA 4HAFA 5B4MD 3US9A 3ERXA 4X80H 1LO3L 3UXFA 1KTRL 1U8CB 1XGPA 1JPTL 1LEGB 5K1PA 3CPWU 4NRZB 1CXIA 5SX4I 2WBJA 1IE5A 3H0TB 1JX9A 2VDQL 4F57H 3UZQA 5BVPL 4G28B 5LOVB 4DGIH 2XNAA 1GS7A 2WUCL 5BXFA 1GC1C 2HVJC 5ISZE 1U8MA 1ID5I 4JE4B 4OZIE 2GUYA 3Q2NA 5I24A 1WTGT 3OHXA 1MLCB 4K5LA 1IM3B 3NJGA 4RWUA 1YEKL 1PZSA 3CSBA 4WFEE 3MCG1 2VUOA 4J7KA 2ZQMA 2W0LA 2QGCA 1ASPA 1AKJD 1RSYA 4BZYA 1WITA 1BOGB 2R69H 1JDCA 4X9GA 5E08L 1M1KW 1NGYA 3CUPB 3CLFL 1B6UA 1G43A 1A1MA 4PDRA 3JARA 4UV9A 4IHOB 2UXCO 3VVVA 3EJUA 1DJYA 2ZP9A 5DRZB 5HDBB 1WT5C 3QEGL 1ROCA 1OQXA 3ZTCC 3APCA 3RQ3A 1I7RB 5MERA 1A0QL 2QQKH 5EDXA 3W0WE 4Y19D 1ZA3B 2QTVA 3IF1A 3FB6B 3ATBA 4HJEA 5LWYH 3GNML 1PEZA 2BSKB 3G6DH 4JHVA 4PW3A 5K59F 1FC2D 5EO0A 3KEHA 5DURD 3CNKA 2A7BA 3V6ZB 2B3IA 2R2BA 1JFHA 5FDYA 5E2TL 2DH3A 2FSEA 2V5MA 5KSAC 1NM9A 4X62O 1J8HE 1F45A 2FZ3B 2G2NA 3H9HB 2AANA 5DZPA 1HR0O 2YSSA 3FT3B 4NN7C 1T6VN 4L4TB 1WG3A 5ABAA 4P9HH 2EJRA 5HJGA 2VQTA 3P0VH 3L1FA 4LRIC 1AGDA 5KJ4A 2YIBA 3ZRWA 4FFYA 2DOCA 4AJYV 3GYRA 1JZEA 2BNQB 4NNYA 2DQEL 5E9DD 2ZPKL 2UUBO 1UCBH 3MBWA 4N2BA 3H42H 3OKLB 4NKMA 5IREA 1XEDA 2XYBA 1DJGA 3L3OB 1E0OB 3CCJV 4U7SA 1X5IA 4X6FB 2KZBA 1U3HA 5CLWA 1KN4H 1GN6A 2WHVA 3CMOL 1RZKC 1FN4A 3CRAA 4G7RB 4JFDA 3IFNL 4QXUL 4CGUB 4OZGA 1IC0A 3FFCD 4ZPTB 3QCUH 4N5UA 4OXSA 5C0CA 2OFQA 5MEPB 1A4KB 4AQEA 3EH2A 1PG7W 3GXUB 3OKKB 4IHJA 2WKGA 3KH4A 4KC3B 4Q2ZA 2V3FA 5AOLA 5CUSL 3UMNA 2XAJA 2Q86B 2E47A 2Z3YA 4GXVL 1CWVA 1WZLA 3PGDB 1A3QA 1I5YA 2L7QA 5DJCA 3QZBA 3S37X 2CKBA 4FFZH 1NSNL 4G71B 2WIIB 1UUNA 3CXHK 5L4JA 3WIIL 1IM9D 3T09A 3IBOA 4YNYA 3OPZH 2R39A 5TD4A 1L7IH 3CZUB 1CBJA 2BZCA 3JSSA 4P5SA 2QFRA 1IT9H 1BQ0A 4FI8A 2IBZY 4WAFA 3LNIA 1BSIA 2BSTA 1M9NA 3LMJH 1OGAD 4JDEB 1CGXA 4BXSV 4ZXBA 1DQMH 1OSZA 2D7QA 2MOVA 4JY4A 4YSCA 2WGXA 3INOA 1NTMH 4HPYH 5D8JL 1FO0A 4DVBB 4LF5B 4W9CC 2HH0L 3QDMD 5D7HA 5DWUL 5C0AA 3PRZA 1OAXH 2OJZH 1Z5HA 4E4EA 5T5FA 2ZJSL 3V4VH 3LH2H 4H0HB 2ZXGA 4KHPO 3FN0H 4X1IA 2HTKD 3LDCA 1J05A 4H8HA 1YXBA 2YO3A 3CHQA 3HR5A 2CMRH 1HSAA 2GCYB 1LK3H 2WCGA 1R19A 3AQXA 4MD4A 4M7ZC 4N2EA 5CD3A 5JHMA 1YQVH 2Q2EB 3DURA 3B34A 2B9BA 1L0QA 4JFFB 4X5QA 1K5NA 4ISVB 1JF5A 5FLUA 4KQ3H 2P48B 2FWSA 3ALPA 3AUVA 4JDVB 3KGSA 2LGQA 1EJ6A 1AROP 3LRLA 3SKOA 5K5YA 4BFGA 3VMNA 4JKWA 1GGBH 3AG4C 1XSIA 3FQNB 1J7VR 1X4XA 5IQ7L 3DGGA 3MRIB 4KMTH 2LFRA 1UM4H 2I9TA 3KG2A 3S98A 1D9KB 1HL4A 2DE0X 2R8SL 4JI3O 3ARDD 3J8F7 3SJVE 1JHKL 3EYUL 2BINA 2YBGA 3BKYH 3FO1B 3AG3B 5F7BA 2HJFB 3W39A 1C16B 5EIBC 2KI6A 2XTLA 1VEOA 3VJ6B 4AHCA 1QLEB 1MFDL 2B14A 3PE9A 4PVNA 3WNKA 4AT6A 4ES9A 5I1AA 4AM0Q 3RHWF 3WUWB 4M7KH 4D7TA 1KXQA 4LLYA 3T0VA 1URLA 1PSKH 5H35B 1G7LB 5CBHA 1GZPA 3NN8B 3BUYA 3VQMA 4FAAB 2EDKA 4H0LB 1S5IL 5C0BD 5LG6A 3EXAA 4ATWA 4N8CL 4FG4A 4PBXA 3HKCB 3I75B 2H3OA 4ONGH 2CTQA 4L8SB 3LX9A 2ZSVB 3ECVA 3P0GB 5E4IA 3MJWA 4Z78B 1BXUA 3C60B 3WJLA 4WQOA 3VWJA 4LASL 2BC4B 4JYCA 1CJYA 2VQEB 2PYFB 3QXAB 3LY6A 4NNPL 3HRZA 3LH9A 1WFJA 4I55B 4K5PA 2ZUVA 3VG0L 3VXME 3MRNA 2Y4TA 1DUYA 5EU6B 3ZHVA 4PY7A 3II2A 1ACCA 3EOYG 1UCTA 1Y6KR 1QSFD 3HZKB 4NERA 4B3TO 1QI3A 1T5XB 4DR4O 3OKEB 3HC3L 4PTUB 4ZD3L 3UTQA 3LNNA 4IL6Z 4QYOA 1I8LA 5KUKA 2ESVB 1LDPH 2OI9B 3MCKA 5I8CA 5T1MB 5C0EA 3LN9A 3SDDD 3I6LE 1A6UL 3PGFL 4WU7B 2C5DC 5FYLD 1R3IH 3FONA 1S0VA 5DEFB 1VHPA 1B0RA 1F4XL 2ICWA 3LQZA 5T3XE 2ARJB 3QXWA 2LO1A 3NCFB 2RH0A 1YCIA 1AKJA 3PLYA 3SQRA 3MLYL 4PCSA 3UYPB 4LLWA 5JXAH 5KEZA 4OX9B 2E59A 5C7XL 3LPGA 5JLZB 4F9LC 2B59A 3GMPB 1LP9E 1I3GH 1K5WA 3IJ4A 2X7RB 1FF5A 5IB1B 2WNWA 1FV1A 1WYJA 1OSPH 4NNXB 2VJ8A 3AG2C 3R0MA 3TBWB 1NGZB 3PQYE 1T03L 1UGNA 3LKNA 4XCFL 3QNXB 1G4RA 3U7YH 2WLIB 5KBKA 3OUFA 3SE4A 1I1CA 2M2DA 4R4FH 4ELDA 1FFPA 4YN3A 3ZE0B 4Y19A 3STBA 4PJ7E 1QG3A 2O30A 3PAVA 5GGVY 3T3MF 3EYOB 5FKAA 1HHGA 2EYRA 2JTYA 3NIGB 3UBGA 2PCPA 1OD7A 3VGGA 4XNYH 3UBXB 3IC9A 4OM1H 1LE5A 1MFEH 3LSUA 3N44F 3PHQA 3CDYA 5JIIA 3QJTB 2XY2A 4BUHA 3MGTB 3BH9B 4TRPL 3PN1A 2OMBA 1JF1A 2FGWL 4UQ3A 1BQZA 3KLAB 2DYPA 1G6UA 2DYSC 3DXAB 3B2DC 4OCYL 2P28B 2AW9A 2LW1A 3GSWA 4L8CB 3CXHF 3E80A 1PY9A 4KFZC 5E9DA 1C7TA 1RKRA 4JREC 1JGLH 4Y4KB 5EUOB 1EBAA 4OLXH 4G8EB 2DTMH 4J3XA 4M29A 5CJQL 5D9SA 1F4NA 2IPKB 1RM1C 1ZJBA 2VRQA 2WYHA 2APBA 4UV7L 1JXKA 3S34H 2AJUL 1BQLH 1T5WA 3ZN0A 1OLLA 2SODB 3AREB 4JPQA 4I50A 1GZHC 1MFCL 2ZKXA 3FFCA 4J6RL 1NBCA 1HH6B 2G38A 1HQ4B 1NOAA 4JAAA 5DUBA 5ID0B 1TJHL 1KYOK 4JRYB 1EAPB 1MSDA 2EVJA 4BIKA 4LP5A 5D72H 2IPTH 4XMPH 5ESQA 5HYJE 3C3TA 1F6AB 2DPKA 2Q3AA 2XVBA 3U6XA 4TOIA 3EUDA 4BUQA 5IV2B 1R3LA 2UY7A 4EXPX 3T1HO 2QEJA 3GO1H 3IFOB 2F8XC 1DF4A 2DQCH 3KPQA 5CP3A 4L4VD 1IM9A 1F86A 4G8FB 5A6MA 1EQWA 3EJYD 5L3BA 4PLNC 4P9ML 4EQ2A 4CNIA 5D6DC 3P11L 7PAZA 4IBUA 3DX2A 1T83C 4A2DA 2APSA 1OGAA 4UT7L 1AY1H 1YY9C 1HNFA 1R3JB 3UG5A 3EJPA 4QPJA 1G6RB 4W4OC 4ZFZA 1S7RA 3QDMA 2GJZB 2FTKA 5GSRA 3TX4A 1JNHB 3JAKB 4GMTH 4HIEA 3FH5A 4FHJA 1F3RB 2CJUH 3CCSV 2PWFA 3T6VA 3VI3F 4U6VH 3OZ9H 4M6NH 3S4SB 5IMMB 1WBXA 3MA7B 1TR7A 5DD6A 2YAOA 1AR1B 1F8TH 3LIZH 3OB8A 3U0PB 4F58L 1KULA 1FGNH 4DP2X 1MHPL 2YQGA 1OTTC 3QNFA 1KB5H 2E76C 4TUYB 4YDLC 2WWOA 4LFBB 2VR4A 1FYTE 4LDEB 3E3QC 2O5ZL 2W9LA 3D8CA 3B40A 1KPUA 3AGWA 4J3OH 3EHBD 3PIQA 1Z3GL 5HHPB 3IRPX 5MEQA 5MI0B 4PYGA 3ULVE 3CFDA 1JJUA 4B7EA 4LF6B 4AYGA 4U1NA 3GMMB 5AVTB 1YMMD 4AM0A 1FJGO 2CH8A 3ARDA 4WW2F 1P2CA 1SDDB 5JNYA 2C1OB 1A3RL 3ZY7A 2FHBA 4FNTA 1S77D 1U3JA 1BM3L 5GONB 3OGCA 3E7JA 3DRQB 1FNSL 5CHNA 5JPNC 3IJHA 4B9KC 3BVDB 4K3JL 4JKKA 4OLWL 2XN9E 3N85H 4PLKC 4N90E 3NSFA 3FCUB 1GS6X 3UABA 4MB5A 5HP5A 5C0BA 2F15A 4PB0L 1KB9J 2EYTB 5FA4B 5AW6B 3BXNB 3MRJB 4YXHH 3MNVB 4KI1A 5KN5A 4LLAA 3A4AA 2R29L 2WQUA 1A9BB 1TVBA 5FR3A 4QLWA 1XH1A 2FJUB 2Y0IA 1MJ8H 1MUJB 3VWKB 1VKXA 3HI6L 5EHFA 5BVPH 4A04A 3KPLA 3NIDB 3G04B 2WUCH 2BWDA 4KK6C 4OZIF 3CJJA 4XRCA 1B4JL 4X4XA 1P53A 1DE4B 2BCKA 4OLVL 5T3ZD 2JIXD 1LHZA 1QSFA 3S3JA 5DJZB 3L3IA 5D7KD 1OGPA 4L3ED 3VSQA 3ATAA 3APFA 1XZWA 3EXJA 1YEKH 1O5DT 4G1MA 1F58H 2JJ2G 4X8JA 4HT1L 5EOCL 2Z4QB 3ZN1A 1J0KA 1GCYA 3B4NA 1E3FA 2LV4A 3CDCA 5EUKB 1I1YA 3SDDA 2D73A 2VE6A 5TE6H 5I16A 4X50A 4V1DD 4AVHA 5E08H 1YJNV 3M7MX 1V55C 2HT2C 2XWJA 5HYSA 2V1DA 1JD9A 2NTFB 3CSTA 1VEMA 3FTVA 3BLKA 3OJVC 4PMFA 4CS2A 1E4KC 4PLJD 4U3CA 3ZU8A 3QIWC 2IJ0C 1OJHA 3QWQB 3QEGH 3EO0B 4FM0A 4AI7A 2MQCA 1MNGA 2R1YA 15C8L 1FIEA 4ZQKA 1L5GB 5BV7B 1SYSB 4KROD 4BA0A 1A0QH 4RDBA 2XVGA 3QUYD 3AUWB 3CMEV 2L4OA 3F05A 5E03A 4IMLA 4ZAKC 3NAAL 5DUJA 1FA4A 4TWKA 1NDGB 2PXYB 4HZ3A 4HIIA 5I19L 3EJZD 4LKXA 4OGAD 1M93A 4LPTA 4Y16D 2F74B 2NY1D 3BZFB 1TIUA 5E2TH 4DEUA 2KBGA 3FQTA 3FU5A 1DEDA 4ZUUA 2JKSA 5K39B 1DBJH 1O6SB 4ZTEA 3AS3A 3DVNB 3T8XB 3KL3A 5JORB 2WXRA 2E5EA 5IB5B 4TTDD 4ES8A 5TE4L 5PAZA 5HYFA 1KYOF 3K5MA 1JPFA 2Q73A 2W94A 1HYSC 4M62H 2EILB 2BFVL 3OM3B 1OT4A 3ARWA 3HN5A 1AXSA 3NCXA 4HHAB 1F2XK 2YN5A 4N9OB 1E28B 3L5WA 1RH8A 5HSFA 1A64A 4PBVC 4YL9A 4QRPB 2IAMB 1HNWO 3AXLB 2OW6A 4DPCX 1E6JL 2NRDA 1P84K 3CX5K 3P3TA 4JV5B 3Q5YA 4JFQA 4NQDD 4A5UB 3VX0A 4QNHB 5E8OB 1TUBB 5AKTA 5J7CC 2ZWSA 1KCUH 3C3SA 2VQ4A 1BREA 5CUSH 1CGSH 1JZ5A 1HAWA 3T5WA 3ARUA 3TYFB 2ZWNA 4BK5A 3IWUA 4GXVH 2HG5C 1UEMA 4DOHB 4LDCA 4OF7A 4UM9B 1NSNH 3ULUC 4TQIA 5F3FA 2BIOA 2OZ4H 4JANB 5FM4A 3WIIH 3U11A 2A74C 5BY1A 4HZLA 1HU8A 4ODXA 2COVD 1FNGA 3EYVA 4BFJA 12E8H 4RGNB 1ZEAH 3PYCA 4G8IA 5GJTL 4IIQB 1DK1A 1MCKA 4NFDA 5AW1B 3WY1A 3F6LA 4L4VA 1EUUA 4PRAA 2F0CA 5AVYB 5BW7A 3X2QB 4EN3B 4U1IB 1JGEB 3IT8D 5KYYA 3KBPA 3MGOA 2NY5C 3CH8A 4XOEA 1RZFL 3P3YA 5ENWA 3VD9A 3VW3L 4G9FE 1CE1L 3D25B 1AJ7L 1UM6H 5AG2A 2ZJSH 3S5ZA 3H9SD 1BWMA 5ESVA 2Z93B 4G8GD 1I8KA 3T2PA 2FWUA 3J80N 1ZTEA 3QVNA 3A3YB 5EN2A 3W37A 5KVGL 5LVEA 2FBOJ 2YOAA 3CXFA 2WUBH 1PNLA 4QIWF 1D5ZB 3WAKA 5IF0A 1PS3A 2JGDB 1ECYA 3IPFA 3MV8E 4PG2A 4Y2NA 1J0YA 5MHSE 2AJYH 2ED7A 5FK9B 4JN2A 5KX5A 5HGBA 2NY3B 4UNTA 1S9WB 3QR0A 5FIEA 1Q82W 1NEZB 1PJWA 2H2SC 3PHSA 4JMXA 2D3NA 5JOEA 1YYML 2MIZA 3KWWB 4OCNC 4X7CC 3GI9L 1KIRA 4UM8A 2YUZA 4UQCA 2IANE 3JV4B 3RY6A 1KKCA 4MJ5A 1NKRA 3C75A 4TSCL 5CLZA 4R6UA 2R0LH 1MFAH 3AJ7A 2DM2A 2EDJA 3D3VE 5IBUB 5L0QB 4PV8A 2R8SH 1J95A 1I94O 2YA1A 3EYUH 4PWFA 5M95B 1R9FA 3TYGL 3MOAL 5KYXB 2DJVA 4DQOL 5E1QA 1DLHA 3ARFC 1JGUL 4KRPD 5TGBB 1P7GA 1KGXA 1YMMA 2FECL 5G4NA 2XG5B 2JKXA 3NRQA 3LD8C 1MCQA 4PSPA 8FABA 3B9KC 1EDYA 4ACTA 3EG9A 2DL9A 1S5IH 4LHUD 3GBML 4APQB 3VFMA 4N8CH 4XNMB 1UWFA 2VH5H 2C3GA 3B9EA 4LKCA 3TA4D 3ZZSA 2WWWA 3OTOO 4XVSL 3KYNA 3O8XC 5BJTA 3FHQA 4GW4B 3KWTA 4E9QA 1HS6A 4W4KA 1VQOV 3J2PA 2C9XA 2H6PA 2WB1A 2WKOF 1BHBA 2UZYB 3W0WD 2ENPA 4AK2A 4Z3HA 5DLML 1E8WA 3VG0H 3BYTA 1H3UA 1B2YA 3QG5A 2OW7A 2VDPH 4HUWA 1ULVA 2Z65C 4QTIL 2X0VA 4KKRA 4ZJ9A 2A6JA 1CP9A 1AZVA 1E1RG 3EZ8A 4JFHE 6TAAA 5CEZH 3CN3A 3UDWA 2VDML 4F3FB 4LF7B 2ZOUA 5GRUL 2NY0B 1J8HD 2NXYC 5FGBC 5JIKA 5ICYA 2GI7A 3SPJA 4R5VA 2JIXA 3PGFH 4J3TA 3LPPA 2DYRB 3QAQA 2J8OA 4HBNA 3K59A 1KELH 3CFQA 3VFGH 4K2UH 5JOFA 2O5YL 3GSRB 4DZ8B 4U3FH 3SQOL 3UROR 4Q6IB 1H2NA 1KPVA 4UOW1 4XAKD 5B39A 3ARVA 5ICZA 4YVUA 1PKOA 3MLYH 1Q8MA 2ZE6A 4V1DA 2Y48A 5IBTH 1LP9F 3S8FB 2J12B 4Q4IA 4GX1A 2BOBB 3ETBF 4P9HC 3QGVA 5A16B 4AGNA 4IU2B 3ETEA 1AS8A 3CIAA 4EUPH 2IVFC 2VQ1B 3EKCA 1WD8A 4AQ8C 1Q90D 4GKLA 1FQ9C 4NIKB 3JTBA 1VZHA 3I3EA 1UJ3C 1T04A 2Y2TA 1XEUA 2IWKA 2Z7ZA 3HE6C 5D1XD 5DK0A 4X98A 1N34O 3UTZA 2X4OA 1EZVH 3ZHDA 5I1HH 1K73W 4U0RB 4P3DB 5IWAB 5IW6B 3EGDB 1ED3A 4QXWA 3RE0A 1BQKA 4YJZL 3SJBC 1IGIH 1MSWD 4PTTA 4PJ7F 5E8PA 3QUYA 1EHNA 2IDUA 1PX4A 4ZMAT 3D39E 1P84F 3U25A 3CX5F 2LTQC 3CFBA 1E9QA 3JCZA 2AF2A 4RFOH 1TSHA 4MA8L 1LEIA 1JNLL 4DFHA 4DK5A 2XBDA 1Z9PA 4Y16A 3PREA 4GT0A 4ODWA 3X1GA 2AGJH 1QFHA 4YGVB 4B9CA 1ET5A 4X7SL 4Q7DA 4F8PA 1OCRB 2HP4A 2AZAA 1KCWA 3RX8A 2FGWH 3WGVB 2PYEE 5AOIA 2PI4A 3LUTB 4GX0A 1HHJA 4BYHA 3BT2H 2W80C 4RRPA 2AQNA 1SXBA 1PZ5A 3QQ9C 3KXFE 3DXRA 2WWKO 3LN4B 5IMKA 5A2QN 5I30H 1JYWA 2ZCHL 1H9VA 4UB0H 1A14H 1D7FA 4KTEH 4UV7H 1YTFD 1UWXH 2AJUH 3CVIL 3MRLB 2P80D 3PWPD 5IGXH 2CDEB 3NCCB 3D1MC 4NQDA 3RIFK 1MZYA 3MBEB 4J6RH 3WCYA 5IBLC 2QHLA 5C0NC 4TV8A 2ED6A 5FUZL 5DS8B 1AAJA 1CFQA 1TJHH 3DROA 3VI3A 1N9PA 2VITA 1IAKA 5D7LD 3QS3A 4UNVA 4B0MM 1FJ1B 1OB1A 1KWGA 1ICTA 1TTBA 3W7TA 2Q9LA 4UBDD 5JDJA 2BNRE 3K7UA 1C8QA 4R7DB 2WMPB 1QNZL 3Q1EA 2ZDIA 2KZ1B 4NO0B 5IT2L 4J23A 2LQRA 4FQXC 4PGCA 3SYAA 1N6UA 1EJ8A 3S5LG 2NYYD 3E22A 2Y22A 3FT2B 4LLDA 4DAGH 2ZONA 4RSVA 3OX8B 5IKCB 1CTNA 2HUHA 2QR0A 4NZRL 2E86A 3NP4A 2MSPA 4YZFE 1JTTA 2XQYK 4DR1O 1XB8A 4M1CC 3RWIB 3NT0A 3MLTB 3P30H 1F11A 4Z7QB 4TUUA 1I8MA 1NUNB 5LJYH 2HFEA 4HHWA 5IVZA 3IGKA 1ILSA 3H9SA 4G8GA 3UTPD 1ODAA 1I7TA 2IDCA 3FCSA 4YPGA 2EDTA 1MH5B 5D5MA 5D7JC 1MHPH 2WN2A 3B8YA 5A43C 3SKNA 2Y24A 3C6EA 3QUML 3SDCC 3VFPA 5KYUA 4BW5A 3EGXB 1VGEL 3O41A 4QHKJ 1LK2A 1LDSA 2WLYA 2Y6SC 4LSRH 2GC4C 5L3DA 4W70A 2OBGA 1GW6A 2EJ7A 1TPXC 5I73C 3ULVF 5KS9B 3BISA 2IFGA 2GBAA 5F7NC 1J0ZA 3AS0A 4OZIA 1BBDL 1H5BA 2Y7SA 1LO5A 5F1NA 3D50A 2VLRB 4Y5VA 4IKKA 4CSSA 1JXFA 3KVQA 3PHAA 4LEOA 5I8KH 3T77A 4X9IA 1BM3H 2H8PA 3WKPA 1FNSH 4H1LG 3BPNC 1KNOA 3T0AA 3HMXA 2LAGB 3GS7A 1TMCB 3ZO0A 4ZUVA 4B9GA 3WNOA 4DW2L 1BVOA 3T0XA 4GX5A 5FUOH 4PB0H 3WS3B 1J5EB 4OH2A 2KT6A 4UT9H 1BXVA 2VDOB 2JE8A 2R29H 2QQQA 2GI0A 1Y7VA 3DX9B 4MVOA 2H2PD 3F2LA 2OSLA 3HRPA 3ECQA 3HR6A 4LL1A 5F9WC 5KVDH 3RGVD 1EVUA 2MH4A 3D3QA 1H15B 3CH1B 2ADGB 2DJMA 4JAMB 2O4EA 4MNGE 1OM3H 3W0WA 3IMBA 2FQGA 4Z77A 2YEZA 1URZA 4LBEC 1SJHA 3C5XA 3K6DA 3OKMB 4AJWA 4ORGA 4OLVH 3I74A 3QHFH 3S2CA 1Q72L 4XGZB 2R2HA 4YBQD 5EF0A 3HFFA 1S5JA 2I26N 3U30C 3OC8A 3COOA 2X4NB 4IGBD 4V2CB 3CC2V 1EV2E 1IUZA 2PYLA 2W0KA 3GMLB 4FJZA 2HJDA 5EOCH 3U6RB 4RGMC 4QTHA 3HZYA 1D5IL 2VWEE 1NCWH 3RWHB 1RSOA 5KA5A 1FL3B 3BW9B 4QRSA 2E7DA 2BP0B 4N8VA 5HHOB 3SDAC 4B53A 2RJZA 1P4RA 2WLLA 5T1DL 4K07A 2WQXA 1KCVH 5JR1L 3BQUC 5BO0D 4IBVA 4CVZA 3LZRA 2ITCA 5A2FA 1NKOA 3E1F1 5L4FA 2DV6A 1RURL 3JZ7A 2JQZA 4JFYB 15C8H 2HVKA 2Z1PA 1Q90A 2CJTA 2VMEA 5F7AA 4FEMA 5D1XA 1Y67A 2EXTA 3HZVA 3ZMNA 5KW9L 4G6JH 1DQDH 4C83A 3QW9A 4F6RA 1KYFA 3QEUA 3L6FA 1OAKH 4F20A 1A3LL 4LSTL 2RQEA 4KXDA 5J5EA 3QZMA 5HFLA 4X7EC 3E9TA 2NY4D 5FC9A 2WVVB 1BEXA 1QD0A 1YEDA 2K9FB 5E2WH 5ELIA 5FGSA 3RIFF 4X0KB 3QEHB 2N4IA 3MV9B 4F8QA 2JJSA 1PYWA 2GSIA 4YDVB 1DVFC 3GXTA 3V52L 1Z9SA 2TRHA 3GSXB 2WTRB 2YD5A 3DK2A 2C4FT 3WEXA 5I0WA 3KPOA 2Y36L 3RVTD 4YHMH 2YQBA 1RULL 3RP1A 1E67A 1MG1A 4XHQA 1SYVA 1KJ2A 2BFVH 1PM9A 4O58L 3U46B 5CN3A 1FXKB 3KCXA 4NI3A 4AYID 1DEEB 1N5AB 4P2YA 4DUZO 3QZWG 4HZ1A 4IT5A 4Y4FD 4P23D 5F3BA 3H4FA 5EB9A 3OLDA 4AYMC 4MA1C 4HAGA 1U21A 2CBMA 4XPHL 5AKSA 1E6JH 1DBBH 3TVMC 5E8NB 3VBBA 1FFNA 3KJ4B 3VFTA 3ZRXA 1L9MA 1NGPH 3SPGA 3NIFB 3CK0L 4BRJA 5GIRB 2NN4A 3QNZA 1B88A 4NUJB 4P4RA 3TO2B 3DVIA 1NANH 3RWEB 4XNDA 4HWNA 3LNGA 2I07B 3QQ4B 1AZBA 2P80A 3PWPA 1WUZA 5BZZA 5E23A 1KIUA 5LCVL 1ZV2A 5JHAA 4MTFA 4WK4B 4X99B 1BM7A 2QADD 2BVOB 1MJ7H 4KXZI 4PRPD 5D7LA 1F2QA 1CLYL 4J1UB 3MFGB 3VXTA 4P0DA 1KV7A 1T89C 4Y5YC 5B7FA 2PYJA 1CUOA 4HC1L 3ZYJA 1P4BL 3MRQB 3P4OB 3ULVD 4FTVB 4QTFA 5TQ2H 3FMGL 1K9TA 1BLNB 1AI6A 1NICA 3RIAK 2N0KA 3FQWA 4JCMA 4J3OC 3LEVH 2BS9A 3WL9B 1PNKA 3SKUD 1ZHNB 3PAUA 3QQ3B 3IS0X 1CG9B 4S0TD 1RZFH 3RVUD 3V5HA 5J11B 3CDFA 1R5WA 4F7PA 5HI3C 1CE1H 3VW3H 1N2RB 2AAVA 1ROPA 3R06B 1JJOA 1E27A 3BD3A 4IBWA 5AD0A 4JG1L 2XN9D 3LKRA 4J10A 5J6SA 2AK4B 5IR1B 3ZBMA 3RYIB 1E79G 5KVGH 1CK0H 3RKDC 2JCCA 8CGTA 4M5YH 4YSPA 4GKKB 3I84A 1SLVA 5KA6A 3NCYP 2VZVA 4X7TB 4NQCE 5FO9A 5FB8A 1URIA 4NN5B 3Q2CA 3VXUE 2X4PA 3VB9A 1U8KA 1AQMA 1ZS8B 4FNRA 2EIZA 1FYHB 2IFFL 1YYMH 2BIHA 5T33H 4LCUC 3L95B 3SBQA 2OS7A 4J9ZB 2Y06L 1HZHH 3KLKA 3FOMB 1Z9LA 4ZSOB 2VZOA 1QFWI 3HKBA 1HHIB 4FQQA 4LF8B 4BIZA 3F6JA 3NVQA 5HDBE 5TF0A 2LLGA 4FFWC 4H4NA 1EEZB 4DP6X 5HHQA 3V7AG 3DX6B 4N2NA 1WS7A 2CE4A 4AIEA 4OJDH 1IQDA 5JQIB 1R24A 3C2AL 1CFTB 3CVHB 3F12A 4R2GB 3NZ8B 5J9PB 1KYAA 1AGEA 1XT5A 2ATKC 3WENA 3BP4A 5KVFE 5K9KA 4UINH 5C2BL 1M3JA 1IBMB 3VGDA 1IJ9A 5D5PA 1G9HA 4N2OA 3GMOA 4PBWD 4DR3B 2VCOA 4L4TE 1GIGH 4L0YA 4KJWD 1HP8A 1XDCA 3OR7C 5IMLA 3L9RA 4KQ4H 2WXMA 5A2IH 2XA8L 3KPPA 4XOBA 4NO5A 2DQ6A 2BNQE 1PNMA 2ICWJ 1AMXA 5DLMH 6CGTA 2HB0A 1QR1A 3H4HA 3L9DA 3K57A 2MCG1 4QTIH 3BUBA 4E68A 3RGVA 2H1XA 5CBGA 3DRTB 4MB1A 4U1MB 4YDNA 1DJHA 1DO5A 3GJFH 3OQ3B 4UILH 3UTOA 4DTGL 2IOIA 1J88A 3TT1L 2LU7A 5IWAO 1AHKA 3Q6GH 1QVGU 1H0DB 1WCBA 1XGYL 2VN6A 3SY6A 3LNFA 4IGBA 2QKAA 1CN4A 3ZMRA 3PGCA 3IXTA 5J0BA 5TFSH 4IRSC 4P59L 3QXVA 3VFVB 4FQPA 5DC2A 2F6AA 2QBWA 2UWEB 3KGTA 3QFDB 4HJ0C 3WNNA 4WFHD 3L4XA 5DQJA 4PA9A 5C92A 3L48A 4IU3B 1QTYT 4QXTB 3FNKA 3M6DA 2LU3A 4JB9L 2ZCLL 3FUIA 1IEAA 2GIYA 5EFIB 1X5MA 1RI8A 1EJFA 1FORL 5E2JA 4HG4J 2CLVB 2HRPH 4Z3TA 5CILL 3RAJH 5I1EL 1KY7A 3MREA 3P4MA 35C8L 2XJKA 2XXFA 3I9AA 3BZ4B 5EZYB 4U1JA 4J39A 5AVWB 2DDQL 1A6VL 3IJEB 1ZTXE 1GVIA 2VL5B 4XXCA 2L35A 4GFTB 2C2AA 4N0UB 4UQIM 2D0FA 5CB4A 4G80B 2E6JA 3VH8G 4EKXA 2KC0A 1BJ8A 3EFDL 2MHAB 3IE4A 3K6FA 5DA0B 2VRAA 3K2MC 3GSNA 4X7SH 2DLGA 2QSCL 3G5ZA 4JFFE 3BKJL 1XHHA 3IXAA 3F7YA 3X11B 3RZWA 2BOCC 4XNUL 5EBMB 2D9QB 3PJLA 1FSKC 3B7UX 4HHGA 5LA6B 1NC4B 3MNZA 4A7UA 4IRJD 4WI3A 1EK3A 3HG4A 2D8KA 5FYKL 1XGQA 1UGKA 4Y4FA 4G9FD 4P23A 4N2KA 3DA0A 2W1NA 2J43A 5C08D 1WPXA 1VFOA 1NVPB 1AD0B 2ZCHH 3A24A 2JSFA 4UI2A 2VDKL 4JJ5A 5C0RL 3RIAF 5J56B 1TVHB 4JAVA 3KL0A 3BP5A 4NPYB 1QNMA 2OSYA 1CXKA 5FV1L 3AFLA 5E6ID 3UADA 5FUZH 3IGAA 4WUUD 3MV8D 4HK0A 3AT8A 5MHSD 5HYSG 4XNZB 5HYQB 2BMKB 2H26A 3GRBA 4Z7IA 2JJTC 4JI4O 1G1YA 3LXUX 2HKAA 3EOAB 4I77H 2EX3A 2EXYC 2PTUA 1I8AA 2CCWA 4IGGA 2Z35B 4E42A 1XSKA 3CDGB 3HAEG 4F91B 3R19A 2SEBA 3KGUA 4OD2B 2BHFA 3JV6B 4JJOA 4ZO9A 4PRPA 4YSSA 3WB2A 5IT2H 1J5HA 1DLBA 1A1NB 4K94L 1BEYL 5HGDB 2WBKA 3D3VD 5IJ9B 1XF4B 3D0VB 3K3WA 2WXQA 1SJEB 3ALXA 1MZZA 1UD2A 3JD4A 5D6CA 3K46A 3R1GH 2IWFA 2Q3XA 4FP8L 1ORQC 4NHCL 4GBXD 5E4AA 2UUDH 5EU6E 1OKEA 4YZFF 2OMUB 4L8DB 5HDQL 1JVKA 1CR9L 3M1BB 3HPJA 5CINL 5GRJH 1YDPA 4M9PA 4NXKA 3MLZH 3C6LD 2LW3A 4P46C 4D9LH 1VESA 4DP0X 1T0PB 3ES6B 4YJ2B 1OAQL 1RUPH 2ESVE 4RMQA 1WPBA 2XN9A 1KXTA 1FFXB 4O4IB 3N40P 1FPTL 5GGUB 2CO7A 3AY4C 2XCMC 4ANVA 4DP9X 2XV3A 4U7NA 3BPOB 2J5WA 3QUMH 1COWG 2EDEA 4O4JA 1H8SA 4X83A 5GJSL 4KL1A 3ZMUA 1QR8A 3PWJA 1I8IB 1T1XB 2GBTA 5TDNA 3ZX6A 4KDVA 2W92A 3KYOB 4FG0A 1UVQA 2RCVA 5CF3A 5IEHB 2DQFB 1UUSA 3GMNB 3ARBD 1QLRB 2ARWA 4XBGA 3NA4A 1KJVA 4NRYB 3Q1SH 5JW4N 2HJKB 4H1LH 5DYFA 1L9NA 3MJ7A 1JS4A 3ZE0E 1PIGA 2R2EB 3GBDA 3GT6A 1CFSA 1KENL 1IURA 3NIGE 1J9CT 3IFLL 4LQFH 5J13B 2NUPB 2G2RA 2HN7B 4TSFG 4BZ1H 3GHEL 3QHZL 3DX4A 4ERSH 3HZMA 2ZCZA 5E4OA 3LXAA 2NR6C 1J48A 4FM2A 5JWPA 5L88L 4YJ3B 1ZANL 3MYZA 4UCUA 2XETA 4S1DD 5F89A 4UV4L 1SDYA 4X6CB 4ZNCD 3P4NA 4ZMQA 1FLRL 4OD3L 1BGYH 4KZEL 5EUOE 3VG9B 2ZD0A 1T1ZB 4U6XA 1CFBA 5IK3A 5I71B 5IQMA 4PJCB 4JFZH 2BW5A 2UYLA 5I1DA 2Z0UA 3FAVB 2DWSA 4M7LL 2I69A 3TA3D 2X7LA 1JBJA 4Y4HC 1INEL 4ODVL 5D96B 3ROOA 5J6GB 2VLME 4BCYA 4QGTA 2XRAH 3PPSA 3BP6B 1MOFA 3FTGB 3LKOA 3N43F 2GTAA 5FM5M 2GBUA 5L3CA 4UTAH 3RLSA 4JRYE 1K6QH 1FZKA 1XX9C 1RIUL 4KY2A 4AIZA 2VT0A 3ESMA 3IFPB 1TAEA 2X05A 3E89A 1A7OH 3RDTB 2QR4A 3KXFD 1HYRC 2ZKOA 1BZ9B 2VZUA 4X8AA 5G4OA 5F9JA 4G27B 2CLZA 4PRDB 3TIDA 3LH8A 2CNYA 2FO1A 2I7OA 1XGUA 4WFHA 5IJKA 1DL7H 1PPIA 1RURH 2CNZA 2BP8A 4KPHH 1CD1B 2V8MA 1W0WB 4HUUA 2IJKA 2MRYA 1JDDA 4KMLB 2VDMB 3BVNA 2ED8A 4H8QA 4FQ2H 4YDKH 3HS0C 4Z95L 1FNEB 2UZIL 1B0IA 5FNVB 1A1OA 5I15H 2VO5A 3ZKND 3QJVB 1NAMB 3JWOL 1P5UB 1A3LH 3LRGA 3N04A 4LSTH 1QUPA 2Y3NA 2XQYA 4K71C 2AXTZ 2IBZH 4BDVB 1HKFA 3HUJA 2H41A 1NBVL 1UOWA 2HX9A 3I9GL 4A55A 5ITZB 2DKSA 1MIML 5I1CL 1SEBB 4M6ML 2IWEA 2JB6B 2X44D 2XZCL 2CH7A 1G6RH 1Q1PA 4Z76B 3QQDA 3NXSA 3FL7A 2O1AA 1BQHA 5T3ZL 4IOIB 3VNZA 5KBDA 5DJ8A 1HHHB 3LNDA 1VACA 1CFVL 1H3VA 3QHTC 3LPOA 2W0FC 4RDQG 3NK4A 4X4ME 4DIXA 4IRJA 4XPHH 1U8OA 1ZLVH 3AGVA 2W60A 3G4SV 1FAFA 3BD4A 5LMNB 3MMEB 1WAZA 4UIKL 1WWAX 4G9FA 5C08A 1DUZA 4Q6GA 1XGPB 3CK0H 4FIPC 1OV9A 1IQWH 2WBJB 4FXTA 2HWZH 1ZT1A 2F61A 4FXKC 3TO4D 5AG8A 2XNAB 3WG7C 5BXFB 2ZX7A 4DV6B 3MA9H 5E6IA 5LCVH 2KLTA 3O9WD 2JLPA 3ARGD 3O45A 1U8MB 3MV8A 2ZD9A 4RESB 4WUUA 5GRWA 3S97C 3IAQA 1QRNE 2IXQA 2V9TA 1XMOO 5E4EC 4XT1C 3OHXB 2Z1KA 3WAJA 4N1EA 5I8OL 4JAUA 4CW1A 3H53A 1LNQA 1N8RW 4HC1H 5FOJA 2YAHA 3QSKB 3FMGH 2UXXA 4JPKL 3ELAT 4FLWA 2YRLA 1YEFL 3D3VA 1PU0A 1DQQB 5DI8A 2Q6AA 1NGYB 7CGTA 4FNLL 2GTZA 1QBZA 1ZGLM 5AAMA 1OB0A 4Y2DA 3C8HA 4E36A 4GBXA 3C6SA 4B9JA 3D2UD 3IKCA 4BE5A 3D4YA 3MJ9H 3MLSL 3W7SA 3HG5A 5BRQA 2F19H 3QORC 5F88A 5GTIZ 1TDQA 3EBIA 3C6LA 1SOKA 2KPWA 2YPVL 3IF1B 2F5AH 5G55A 1KMGA 3D69A 1PL3A 4H0IA 3AB0C 2VLLA 5EO0B 3Q06A 4WEBL 3QZOA 1D5NA 3ZRVA 1E4XI 2BX5A 5B21A 5CCJA 1NA8A 1X5GA 4QO1A 1NUFA 3EJCA 2R2BB 3A67L 3GEWB 3X12A 3W5NA 4KVPA 5F8QC 2D3VA 2XPZA 3WLBA 1HCVA 1R3HA 2AEOA 4LFHD 2YSSB 1P4IH 5B1AC 3T4DA 5EA0L 2C1PA 5HDBF 3SO3C 1FUNA 5ESAB 5ICUA 3QUHA 1AGDB 3SSGA 2CRIA 4OT1L 4CC4C 1W80A 1D5XA 3ZRWB 4LPYA 1UOLA 4CZZA 4MBOA 4P3WA 4Q4EA 1N59A 3THOA 1VF6C 1BMFG 3ZLQC 4NNYB 4NWUL 2AFNA 3MBWB 3NCJH 2CQVA 4NKMB 4QJ5B 3WV0A 3KKYA 1VQNV 3ARBA 4LCCB 4H5SA 3C2AH 5J57B 2EIJB 1ZHBA 1GK9A 3FTWA 1U3HB 5DN6G 2QPSA 4RBPH 1MDAA 2IH1C 1ORSA 4OF6A 3L5HA 2OA9A 4MQ7A 3FB7A 4JFDB 1NBMG 4OZGB 1Y6MR 2R4SL 5C0CB 4AQEB 4HOMA 3T0BA 5DEJA 5AWNH 3MYJA 3IDIA 4IHJB 3RBGA 5L3GA 3FSAA 4GIAA 5FPIA 5IFJA 1GS8A 4Q2ZB 2ZX9A 2XA8H 2EDOA 2R9IA 1V10A 5B8CC 4FTDA 1MAJA 4WV1B 1NIFA 1RPQA 1J5DA 3QR1A 3PS6A 5FGCB 1WC7A 3L3DA 1EPFA 2OXGA 2GTQA 2VWEC 2Y25A 2B1AH 4QRPE 4RVBA 1JMKC 5J6HA 1I85A 4YNYB 5AAWA 4B60A 1MLBA 4DTGH 5IY5C 1GAFL 2WXHA 4O5LH 1P4UA 2G60L 4KMQA 4QF1B 3TT1H 3IGUA 4I18C 1RU9L 4BWTA 1LNUA 1OVZA 4CVUA 1XGYH 5DVOA 2BSTB 2OR9H 4LRIA 4ZXBB 5CFHA 4EI5D 3TA3A 1JV2A 1OSZB 2OTWB 4PV1B 4JY4B 4PJDA 3SKJH 2QGNA 2NY6C 1FO0B 4L29A 1TQTA 4NBYB 3MOQA 4KDTA 3B8SA 2WTOA 5C0AB 4P59H 4NWTH 4A7SA 1BXAA 2V9RA 4DOHE 3HB3C 4X1IB 3QAZC 5E99H 3BLBA 1J05B 1VJSA 2R27A 1B4TA 3HR5B 4TQDA 1YJDL 4BE6A 1HSAB 5GRYA 5CJOH 3IYLW 4DVRL 2ZCLH 2C3WA 3KXFA 4MD4B 4BFIA 5CD3B 3DURB 2CRZA 4YY3B 2RN9A 1WZKA 3HMXL 1K5NB 4RGNE 1FORH 1UT1A 2WA4A 5CXPA 5T1LA 2GJ6B 5CILH 5I1EH 2ICES 2ZXAA 5A2AA 3SKOB 1U91A 35C8H 5D1ZC 1N10A 1T7YA 2AEPH 3IJ8A 4KVNH 3ZKXC 1T66D 1DQTA 3H6AA 4ABMA 3DGGB 2DDQH 1A6VH 5IB3A 4DKDC 2V9UA 2I9TB 1XEQA 5CA1A 1N19A 4JZJA 4LSVH 3T4ZA 3UT5A 2Q2LA 3DJSA 4JG0L 4ZFOL 1GAXA 3LNHA 4HIXH 3VX1A 2O26U 3WNMA 2N3JA 3W39B 3R8QA 3IS1X 1IZKA 2VO8A 1IAII 4OCWH 5I1AB 3L4YA 4AT6B 3CC4V 1E2VA 3BKJH 1P6WA 4I0PC 3U9PL 3C8DA 4LLYB 3APDA 3L4CA 1GZPB 3BUYB 3KL5A 2XPYA 3I6GA 2DW5A 5C0IA 4X5RA 2YAFA 3DIFA 2B5IC 3HBGA 3KBHE 4WHYG 2YOCA 5DZVA 1N0JA 3IGLA 1SLXA 3P9LA 2A0LC 4YO0A 5KHJA 2VDKH 1W8NA 5C0RH 5DFVC 4DUYO 3WB0A 3VWJB 2QMJA 3WGUB 4WGWB 3HRZB 4FM1A 1SS3A 1U3NA 3MRNB 4H44C 1IBKO 1DUYB 4NQCD 5FO8A 4PY7B 1TJGH 2EO7A 5GS0H 1ZLVK 1AJNA 1X6NA 3NJJA 3VXUD 3TO4A 2X88A 4LCIH 3A21A 3TC9A 1QX1A 3UTQB 4HWBL 4L3CA 4QYOB 3SE8L