3ABMB

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 66
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3abmB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3abmB02
4G70B 4A2DA 2IWFA 1E5ZA 1X9RA 1OF0A 1SJMA 4DP6X 4YVUA 4P5RA 3ZBMA 1TEGA 2PPCA 5F7AA 2PPFA 2UXVA 4HZ1A 2PP7A 2UX7A 4Q89A 1ZIAA 4YSPA 1AG6A 2IWKA 5I6PA 1ET7A 4BDVB 2AANA 4NB7A 1ZDSA 1GSKA 2CAKA 2FQGA 2YAOA 3WIAA 3ABKB 3TBCA 2YXVA 1F56A 2IH9A 3EHBB 1JZJA 4G71B 1KCWA 2BWDA 3QJRB 1QNIA 5AZUA 3OMIB 2Q5BA 2VW7A 2DV6A 3UABA 3JT2A 1ET5A 1JZEA 1JOIA 2JKWA 3N2JA 2IDUA 1PZCA 2CALA 3N55A 1SFDA 4KO6A 4KO7A 2PP9A 4GP8B 2HXAA 1CYWA 1BQ5A 2DYSB 4G7RB 2XYBA 5AKRA 4KNUA 1SHWA 1J9QA 5LDUA 5B3SB 2QPDB 1EHKB 1BQKA 1OE2A 2VMJA 4E9TA 2VW6A 1ILUA 4DP4X 1E65A 2PPAA 4GP4B 4YVNA 4HAKA 4DP0X 1A65A 2YEVB 4UANA 1SDDB 1VLXA 4HHWA 2IH8A 3QQXA 3TA4D 1MZYA 2OV0A 2Y69B 1NIDA 3KW8A 2MTAA 3FQ1A 4BK5C 2NRDA 3DIVA 1JZIA 2AFNA 3IN2A 1OV8A 3CDZA 1M56B 1ILSA 2Y1AA 1NICA 1X9UA 1GW0A 1NIAA 1V10A 2YAMA 4YSTA 4NAJA 1KV7A 4PAZA 3S3BB 2AZAA 1SF5A 5TK4A 4DP7X 3S3DB 1M9WA 1PLAA 3NYKA 3AZUA 4HCIA 2BP0B 3BQVA 1GY1A 2MRYA 4DP9X 2YAEA 2OCCB 3NP4A 1N68A 3SBQA 3X1FA 3HB3B 5I6OA 1R1CA 2YAQA 3ABMB 4KOCA 1ADWA 1AZCA 4AX3A 5D4JA 4E9WA 1GS7A 2PPDA 4JHUA 4E9YA 3FU7A 1ZV2A 3NSYA 1GR7A 4A66A 1XMEB 1NWPA 2UXGA 1CC3A 1E30A 1GYCA 1KDJA 1KDIA 1OCCB 4Q8BA 1AANA 3SQRA 4AZUA 4A2EA 2WSDA 3PAUA 2TSAA 1PAZA 2Q9OA 1V55B 2DWTA 2J57A 1AS7A 3S8FB 1DYZA 2CUAA 1DZ0A 2HRGA 1J9TA 1AG0A 4M3HA 3MX0B 3WNJA 2DYRB 2QT6A 3TU6A 1J9SA 2ZWNA 5B1BB 2X88A 4GYBA 5I5MA 1CYXA 1FA4A 1BQRA 2W8CA 2H5UA 1SFHA 4DPAX 1QLEB 2YARA 2EINB 4BDVA 3AG3B 3H4HA 3WNIA 2J5WA 4WKXA 5IY5B 3NJJA 4YSQA 3V9CA 1L9PA 3FYIB 2PP8A 2VSMB 2I85A 2XV0A 1BYOA 1PNDA 6PAZA 2BZ7A 2FQFA 1NWOA 2RACA 4YSUA 2EIMB 3AY2A 4DPCX 2XU9A 3TBBA 5PAZA 3NSCA 2XX1A 2ZOOA 1ZIBA 4RH4A 2PCYA 1BXUA 1OOWA 2DY2A 1IUZA 4HALA 4G72B 2GB2A 3SBPA 1PLBA 3QPKA 3FPYA 2HZHA 2YAPA 1A4BA 1W6LA 1M57B 1TU2A 2FNWA 2PLTA 4HCGA 1KGYE 3T6VA 1MDAA 4F2EA 1NZRA 3FSVA 4W9ZA 1WA2X 1PF3A 2XXFA 3V9EA 1ASQA 1NIFA 1AACA 1RZQA 2JFCA 2FT6A 3WI9A 4A2FA 2FT8A 3ZX1A 2GC7C 2YQBA 1IBZA 3OD3A 1BXVA 3TASA 1QHQA 2CJ3A 3ABGA 1ETJA 9PCYA 3UGEA 2H3XC 2XV3A 2YAFA 4DP1X 4YSEA 3L45A 3MBWB 2VW4A 3OQRA 3T6ZA 3KW7A 3CDZB 5AFAA 1V54B 3PAZA 2UX6A 3OMNB 1JXFA 4KNSA 3NSFA 2IDFA 5B1AB 1SF3A 2OJ1A 3IN0A 3OMAB 2PPEA 3T9WA 1A4CA 5F7BA 4A68A 2IAAC 1KCBA 1MG2C 2B3IA 3ABLB 1EZLA 4AKOA 2FT7A 2XWZA 2YAHA 1TKWA 4HHGA 1RKRA 1J5CA 2BW5A 3X1NA 3T6WA 4E9XA 2FJSA 2XX0A 1BEXA 1BAWA 2FQEA 2WO3B 3FSAA 2VN3A 1GY2A 2XXGA 3ERXA 4KO5A 1OE1A 4FA7B 3WKQA 3FU7B 2BP8B 2XLLA 3IBOA 7PAZA 2WO2B 3EH4B 4E9SA 2H47C 3FS9A 5I6MA 2PCFA 3NJLA 5TK2A 2R7EA 3C75A 2E86A 5D4IA 4JKNA 1SHXA 1AOZA 3UADA 1J9RA 3ASNB 1PZBA 2GI0A 1SNRA 1PCSA 4YSOA 3FSWA 5B7FA 1AS6A 2AZUA 5E9NA 3CVBA 1AZRA 1N70A 2AVFA 3EH3B 2IWEA 2I7SA 4E9VA 3S3CB 2UXTA 3JTBA 2GSMB 4GXFA 5B1JA 2GHZA 4PCYA 3ZIYA 1ET8A 1WS8A 4JHVA 3NJMA 1BXAA 1ZDQA 1GS8A 2YXWA 4KO9A 1JVLA 4TXVB 1AZUA 4ZK8A 6PCYA 3QJQB 3FU8A 3IE9A 4BWUA 4FAAB 4DP2X 1A4AA 1IBYA 2BP8A 2IDSA 3H4FA 1W6WA 3T71A 1A8ZA 3QJVB 3NJKA 1HAWA 4K9JA 1PMYA 4NERA 1PY0A 3NJGA 4QLWA 3PXLA 4YSAA 1IC0A 4BXSV 4DPBX 3QJUB 2X87A 1XB8A 4A2HA 4A67A 5I6NA 1T5KA 3CVDA 3BVDB 4KOBA 2IDQA 4BWTA 3PPSA 1MG3C 2EILB 3GYRA 1WAEA 3ASOB 3NJHA 5A7EA 2BO0A 2QDVA 1ASPA 4BWWA 1UATA 3NP3A 3S8GB 5B7EA 1AAJA 4KNTA 1AIZA 1L9OA 3DTUB 3UAAA 2VM4A 1XB3A 1JXDA 1TEFA 2JXMA 2P80A 4MFHA 1RCYA 1JXGA 2HX8A 1L9TA 1PZAA 3PLYA 4DP8X 5I28A 5I6KA 1YLBB 4BXVA 8PAZA 1OCOB 1JZGA 3G5WA 4A2GA 4CSPA 2LLNA 2BHFA 2FTAA 2XV2A 2W88A 3PCYA 1MZZA 1NPNA 4AI7A 1AR1B 3GDCA 3AG1B 1NIEA 3QJTB 4G7QB 3DKHA 3CG8A 2BW4A 3ZDWA 2J56A 4WTQA 2BWIA 4GP5B 3HEIB 1I53A 4CSZA 3CZUB 4X4KA 1E67A 3PAVA 2GC4C 2HX7A 5FC9A 1JERA 1KYAA 5B1JC 2I7OA 1NINA 3T6XA 3H56A 1E5YA 3WG7B 1AS8A 1FFTB 1XB6A 2ZXWB 2FQDA 1ASOA 4AKQA 3FU9A 4HCFA 5I5IA 1KBWA 2GIMA 1NDTA 1OE3A 4UF7C 1NTDA 2TSBA 3NJFA 5I26A 5I6LA 1PNCA 3X1GA 2R7EB 1OCRB 2FWLB 4DP5X 3OM3B 4UAHA 3EF4A 4YSRA 1A3ZA 3GXUB 1OCZB 3FYEB 2N0MA 4G7SB 2QDWA 1RZPA 4GY4A 4N4YB 4ENZA 3NJNA 1SDDA 1GS6X 2EIKB 4HIPA 3X2QB 3FQ2A 2XVBA 1FWXA 1JZHA 1L9QA 3NJIA 4W1TA 3WKPA 1HAUA 1J5DA 1WA0X 3D12B 1W8EA 3FSZA 1NPJA 1WA1X 5PCYA 1AZBA 5B1KA 3FT0A 4YSCA 2VSKB 2HRHA 4QKTA 3X1EA 2CCWA 1HFUA 1JVOA 3CVCA 3SBRA 4N8UA 5B7MA 2ZONA 2HLEB 1L9RA 2A3TA 2QPEB 2BP0A 5I5JA 1PLCA 7PCYA 1BYPA 2DWSA 4YL4A 2IDTA 4YSDA 4F2FA 1WS7A 1CURA 3RYMA 4E9RA 2VM3A 4F7KA 3EH5B 2HX9A 5EHFA 3UACA 5ANHA 2B08A 2UXFA 1B3IA 1URIA 1ID2A 1KBVA 3FPXA 3NT0A 4M4RB 3X1BA 3NSDA 1CUOA 4YSSA 2XUWA 2P80D 1ZPUA 3IEAA 1NIBA 3U25A 4L0PB 4E9QA 4AKPA 3AG4B 3QJSB 3UAEA 1JZFA 1L9SA 3AG2B 1AZNA 2EIJB 2CBPA 1AQ8A 2BZCA 4EF3A 1IKOP 2GBAA 2J55A 5D4HA 3AW5A 3FQYA 4P5SA
chains in the Genus database with same CATH superfamily
3TA3C 2BVEA 2IMNA 3CCEV 4XCEA 3K1KC 1USQA 5GGRB 1P53A 4ONFL 3KVPA 4XPBL 1UYWH 3LPWA 3RX5A 4GKNB 3DI2B 2EDXA 2ROXA 4LL4A 3DGDA 3DMMC 3TO2B 5GRXG 2PO6A 3K72B 4PJFB 3ZZQA 4M6OL 5B4MD 3VD5A 2V7HB 3HC3H 3VSQA 4CNIB 3V6BR 4EIZC 4XHJC 3IDGB 4WNQB 2EC8A 1MCSA 1BL8A 5D7IB 3L9DA 3CFDB 2DEXX 3BVNA 1E1RG 4NB7A 2XHBA 3KR3H 3T2LA 1K9MW 1WAAF 5E6YA 4JYCA 2P8PA 3ARGA 3P0YL 1Y6KR 4Q74A 1CCZA 2ICWA 5FYJE 5EYPB 2OZ4A 2WXHA 4HMCA 1JPTH 4OM1H 3LRSA 2UZYB 4XP9L 2X53A 1SJHB 2ZF9A 1KCWA 3BP5B 1QZNA 3T0BA 4HIEB 4UM8A 3ATDA 5BMFL 5I2IB 5JQIB 3P9MA 1FORH 3MRIB 4B7IA 3DHMA 1XAKA 1F4WL 1JRHH 1X5JA 1RLWA 5D6CB 1X5YA 2IDUA 3ZE0B 4KGJA 1H5BB 2B20A 5KAFZ 3QQ3A 1CICB 2P8LA 1FC1A 3TIDA 5HD8C 4GP8B 3V0AC 1VESA 3BAEH 2R2HA 2XYBA 3TEZA 4FABH 4M7ZC 5AEAA 1E7UA 1MCFA 4HJTA 4RFOL 3BH4A 4Y4FC 2AP2A 1S0VA 4K3HA 1PX4A 1AC0A 3A24A 2VAJA 4FD0A 2AI0L 1N32B 2AK4A 1SDDB 1MZEA 5C3IA 1V27A 1LE9B 1ECZA 4Z7UF 4OI8A 4LSQL 2FYVA 3L1FA 4LEXL 4NJAL 3EO9H 3IJYA 3OHMB 3G6DL 4JDEA 3GS4A 1OB1A 2Q69A 1PQZB 3BD5A 4XC3H 2ERJC 2FX9L 4XC1H 4A6YA 1JZIA 1K7DA 3SDDB 1PIGA 5ERWB 3DRTB 1FNEA 1BG1A 1SQBH 3E6FB 3FO2B 4JRYB 2PN5A 4GZRB 4O58H 3S34H 4NC0B 1DBKL 1MRFL 5JIIA 2JK5C 3VM5A 2R2CA 2GT9A 4JFOA 5IVXA 1J0ZA 4FZ8H 1KSRA 2MQ3A 4G59C 3V4UL 4XMKH 5AAWA 4H0HB 4JO4H 3OKNA 4TQDA 1P7KA 4RAHA 4X4ZA 3F5WA 1DUZB 1HOCA 1XFPA 4PRIA 1K97A 2BX5A 2QKAA 3CRQA 3UTPE 4UOW0 4JZOB 1VARA 3D4ZA 4J3OD 4DVRL 1U8JA 4KOCA 3MODH 2H1PH 2CA4A 4AX3A 1LILA 3MFGB 3QUMB 4OUOA 1JZ8A 5EEXA 2WUCH 3C08H 2CJSA 1OZTG 1OZ0A 3AAZA 2Y0PA 4NQDD 3ECQA 1E90A 2WXJA 2CNYA 2IPTL 1U3NA 4K0OA 1U8KB 4Q9RL 4KNQA 4U7OA 3IJEB 4N8VA 4PV8B 5KYWB 5A2FA 3G6JE 4BRVA 4LLUB 5BZDA 2ZXDA 3SGJC 1DLFL 1MCEA 1JMKC 1U97A 3QAZC 4WUUB 2NR6D 5FUOL 1LE5B 3GZQA 4MA7H 4XMXA 5E8NA 4IBVA 5B39B 2FL5B 5MEQA 1BZ9B 1SM3L 2EJRA 2X1QA 2CDYA 2GCYB 3BQUA 1HTYA 1I9JH 2EILC 3T0VA 1U8PB 2HRGA 2J8HA 1Q90D 4OCLC 2Q6WA 3ZS8C 4JQXC 4OCYH 2QDOA 2YQGA 3BGAA 2DYPA 3HG2A 3DMMA 4M43L 2X6VA 3R66A 4FJ6A 2PCPB 4ZO8A 1AGFB 1KELH 3RWIB 1YYMH 2CO7A 5JCOA 2P47B 4H5SB 2B14A 3QUMA 2P5WD 5HHNA 3VG0H 4EPSA 2D3NA 2E9GA 1C5BH 2YXLA 4NTYA 1FJGO 2IWGA 2ZUXA 3MCLH 3P0GB 4AM0B 1L9PA 5E23A 2VSMB 1XGQA 4ODTH 3EDEA 1FSKB 4QXWA 4OIIH 5I1KL 1OKEA 4PYGA 3HNVH 3NCYP 2EXYD 4PW9A 4CRPA 1MEXH 2E8ZA 4PU2A 1ZLVH 3T1YB 1K8IA 2NQ3A 3D4CA 4HBQA 3PV6B 5CJXC 4BW9A 1MCRA 4MQXD 1BXUA 1OOWA 2Q87A 3RGVD 3WLBA 4HQQH 1MLCB 2FH8A 3RVWC 3BA9A 3ZX6A 2GB2A 3DIFB 1VQ7V 3QPKA 5IT2L 1I1FB 5D7HA 4EBQL 3CX5K 2JJUA 5I1DB 4M29A 4YDMA 4GLRI 1KGYE 2GBTA 3ZN0A 3J27A 2PXYC 3DRQB 2EIBA 3FSVA 5TF1H 2JGUA 2J72A 1XIWB 4XI5D 3BKMH 1I7TB 3KH3A 4GT7A 4ZOLA 3QIUA 3DYOA 3RURA 4PVBA 2FSDA 1ZVSB 3SE8L 1G7HA 1J8KA 2O5XL 4FI7A 4E42A 4ZD3H 1QRNA 8FABB 4OZ4B 4O4JB 3FRPB 3MV9A 5F6HJ 3JD3A 4UB8Z 3NA9L 3S97C 1VP7A 5DHXB 4PRHE 4AHCA 4UCRA 2B9AA 4L18A 5BZBA 4NQCB 5GISH 4ZDHB 2EAEA 4WFHD 4YUEH 2FB4H 4U1SB 3DGEA 3V0VA 1UB5A 3LZPA 4F7TA 3SE3A 1KIUA 2HJKB 4F8LA 4PJCB 4U1NB 5IB3B 3MRCA 5HGGS 2VRKA 3D48R 1HW7A 1FCGA 4KKCC 3RTQA 1IEHA 1JNHA 2TRHA 3CMOH 1MCIA 3S96A 1J5CA 2YMTA 4ASUG 5AAWC 2JCWA 4Y1TA 5EC2B 5D1QB 1KYDA 2N7SA 3E35A 1VCAA 2OZ4L 1RUPL 3HKFA 5E8OB 3WKML 4GAYB 4L5FL 3QIUB 3B8SA 1GY2A 1E2WA 3CLEH 3CFEA 4WUKL 3IFOB 2WO2B 2XN9B 1VEOA 5BV7L 2VDMH 3MV9B 2GSIA 2W81C 2R0LL 5C0IB 4BUQA 3SY6A 4IT5A 2O57A 1X5IA 2A4CA 4P04A 3DETD 3V6OC 5KYXA 3S8WA 3K8LA 3ASNB 1GPOL 1SN0A 3OAZK 4PY8J 1T03H 3BKJL 2OR9L 2EUXA 1G6RB 1FL3A 2I60L 4YSOA 1HH9B 2JE8A 2KKWA 1UCBH 4AJYV 4M3KB 5BO1L 3RLSA 4KJWD 2AQNA 4TVPL 3MA9L 4JFSA 3VWJC 5KSBF 4E9VA 2FL4A 3UXFA 2UXTA 4LVNC 3KPLA 3F7YC 2BE3A 5IQLA 2P52A 3VGAB 1URZA 1KZYA 3CXDL 3QWNA 4I4TA 1WWAX 4HSAC 4XAKD 4HWEL 1ACYH 3Q6FB 5C09B 3FQUA 2J1YA 4BSWA 1QLEC 1EX0A 3APFA 4BEIA 4BWUA 1KB5A 4DP2X 1U41A 2YPLD 3JYBA 1ZLWK 1EMTH 1QFUL 5GRZA 2DKMA 2GFBA 2UWEF 2XT1B 4L1SA 3MAQA 3GXTA 4ODSL 1A7RL 3SOBH 4TQEH 1BJ1H 2X6BA 5L3DA 3IJSB 2WBWB 1XIWD 3QXDA 1UT9A 5LAPA 3D9AH 4PJXA 1D5RA 4JASA 1UOLA 2DRUA 2V9UA 3BZ4A 5JZ7D 1JDDA 2Q76A 3LEYL 5JORB 5KUKA 4PRNA 4LEOB 2P49B 1I7FA 3MDJA 3NPZB 4AQ1A 1B2YA 3BISA 3RL1B 1D5NA 2F1EA 3NZSA 4P3CH 5GHWH 3OGCB 2CHDA 5DMGD 4UQ9A 2WQRA 3ZRVA 1A4JB 1F3DH 3IK2A 4P4KA 5FHAH 4TSAL 5SWSA 4WI6A 3RB7A 3GSNH 3ASOB 4X8GA 1WWCA 4LSSH 1BGXL 3K4DA 2N59A 3U1SL 1AIZA 1Z3GH 2APBA 4ENEC 1TEFA 1SBSL 5JQGB 4AGNA 4M5ZL 4O2CB 1KMGA 1GM8A 1L9TA 2QLYA 4OF8A 2CBOA 2WWMD 5I66B 4NO5B 4LF7O 1RH8A 5JJEB 1D5AA 3E8UH 5CA3A 2PTVA 3N9GL 2RMKB 2ZUTA 3IDGA 2M2DA 1MWAA 2GSGB 1G1YA 4X98A 1TNNA 1AE6H 1B2WH 5DZOA 3UAJA 1EQWA 5AVRB 3A4AA 3JSSA 4ONOA 2ZCEA 4J8RA 1SVZA 2Y3AA 3BAKA 3ETTA 4R0LB 2BLFA 1ZLSL 2WZPA 1DVFB 3SD2A 3UG4A 3KYNA 1G7JA 3CZUB 2UZYA 3RGVA 3HA0A 2JIXD 1IKNA 1XH1A 3ZKND 3BP5A 4FFVD 3K0DA 4AXWA 3ZZLA 5I71C 3M8AA 3HZVB 5DD5L 3N1FC 1XB6A 4RWYH 3UYPA 4F1SA 1SGKA 5IHUH 4O02H 4EN3B 3K0YA 3VE0B 2JI3A 5CS7A 3VYPA 4K9EL 3I02A 4GG8A 2VSDA 3UGXA 4ZI8A 1ZEAH 5CZVL 5FM5M 5F7HA 1G7IA 2ZYSA 1CLYH 1FNFA 3VFUA 2IAMC 3V6FB 1GN4A 4F58H 3VFMA 4MASA 4QPKA 4ODUA 2GABA 1CK0L 4AC2A 1TR7A 4JO1L 4PM1A 1NCGA 3DETC 4MWFB 4ORGA 3IJ7A 3X2QB 3VAEA 3IMTA 2NY4B 4X98B 2XN9E 3I2CL 3R4RA 2AXFA 2FJHA 2DB8A 5BRPA 1HL8A 4PA7A 1F4XH 4PCSA 2ZM6B 3U0PB 4P2ZA 1J5DA 3RNKB 2HJFC 3FCTB 5T3ZL 1O75A 4JMXA 4PBXA 3EBGA 3QDJA 5H4ZA 1WA1X 1UXSB 1OSPH 4E2LA 3BH8A 1UWEH 5CR1A 1N3NB 4QTHB 3CSFA 4R7LA 2OT5A 1Z32X 4WHTA 1G9NC 5AW8B 3UYPB 1D9KC 2AF2A 4UIMA 5FYKE 4IU2A 4C56E 4GKNA 1CO1A 4EN3A 5J57B 3QG7L 5JHLH 5D1XB 3TO2A 5TF0A 1WE5A 3ZZSA 4G43B 4PJGB 4I48B 1YAIA 3L54A 1OO2A 4JNXA 4PRHB 2H2PD 2QPSA 5ANHA 2NY4C 3L5IA 1NUFA 3M1BA 3LRGA 3CFDA 3X1BA 1CUOA 3MUZ1 4P9HL 5HHXL 3VB8A 4OQTA 4OZHE 3F7PC 1ZL8A 5IB1A 2YD2A 3D39E 1VQMV 2UYLB 4YHOH 2LV4A 4K94C 4GAGL 1T0PB 4YHHB 1DQMH 4X65B 3QPQC 4R2GC 5T5FL 4DKFL 4F3FB 5C0NC 3AREB 4XBEL 5CXPA 3IAPA 3AMLA 4Y5XC 4WUUA 3QQ4A 1UVQA 2CKBA 5JW4N 4MX7A 4HIIB 4G8GB 4IS6B 5FLXN 3AW5A 1JD7A 3PDGA 2B5UA 3VXRE 3HW7A 2PZSA 4N24A 1O6TA 4JX0A 5KVMC 4YIQB 4JFFE 3TJEH 2Q2EB 3RX9A 4CN1A 1NANI 3LS5H 1SOKA 5FYKH 1TEGA 5JTWA 3OC8A 2PPCA 2WQWA 5BW7C 1GYAA 3F8UB 1I3RB 4WI3A 1NMCB 4HK0B 6TAAA 3QO0A 4Y1AE 5EU6A 2AK4B 2XBTA 4OFDA 4HUWB 2AJVH 2Y36L 4L0YA 3JWNE 3D8MA 1NAKH 2ZXAA 5IYBO 1MFNA 5CLWA 5B22A 1W2KT 1ZL8B 1JK9B 3KPPB 3ABKB 3R0NA 2QM7A 1UOWA 4XNMA 5F96L 2M8XA 3T8XB 3N0AA 4BZ1A 5BQ7A 4BIUA 1I0HA 1MREL 4X0KB 4XWGH 5EZLB 5DO2D 1EO7A 2ZQMA 1SDYA 5AVQB 3S5YA 3MJWA 1FDLL 2F58L 4MZ2A 4Q52A 5L2KA 2DYSC 4YC2C 4YHNB 3GSWB 5F0MB 1W0KG 4B9FA 3SE6A 4QT5A 4OJYA 3MROB 4MNHA 2CALA 4KO7A 4CVZB 2WXQA 3DXAE 2NX5B 2WYHA 2Q3ZA 2H2PC 1OPGL 1OQXA 2X2IA 4N28A 1N64H 3SZKC 1I3RA 5E6IC 4EFEA 1I7TA 1E27B 1R6NA 1Q0YL 3CBKB 4YVNA 4K15A 1W59A 5B3SC 1XF4A 4NO0A 1L7TL 4WWPA 2NNUA 1DSFH 1XSJA 2ZKXA 3ASWA 5KW9L 3V4VH 3G6AB 3VXME 2GI7A 4R7DB 5I1IH 3VFWA 1OHHG 3U9PL 5DQ9B 5IF0A 3GMNA 2DI9A 4BCXA 1TZIA 2NSQA 1LDPL 4U7KA 4BSJA 1N4CA 4EI6B 4Y8AA 5F89B 3O45A 4IJ3B 4MSWA 2EX3A 4FQQB 3CD6V 1WEJL 4KXCA 1EERB 4X62O 2MCMA 2WPGA 2AEPL 1T7XA 2E7DA 3ARDA 3DV6B 3DDFA 4NI3A 3W9DB 3RWRD 1RIHH 5JA8B 2H32H 2WLNA 1CG9B 1Z3RA 1SF5A 1TSHA 1WEJH 1IL1A 3FTUA 1S5JA 1KYFA 3SJVD 1WPBA 4DK5A 4DK6A 4GUPB 1QHPA 4I9WD 4X8CA 3OGCC 4ISVB 1ZLVK 2BOCC 2P22C 2XWTB 1U8CA 1IIKA 2OCCB 1YVLA 4FPPA 3ROLB 5GS2H 2QSAA 4BCZA 3UYRH 1FIGL 1CJYA 5KW9H 3TA3B 3ABMB 3AVEA 3OZLA 5D4JA 4L8SB 4Q9BA 2AJZA 2JV6A 2E74B 3BFWA 3FU7A 1OCOC 3Q8FA 3F2LA 3N43B 4ZXBC 1XGQB 5HVFB 1RHHA 2NR6C 4X20A 4Z8FL 3FO1A 3KWUA 5INDA 2P5EB 1LO5A 2NUTB 1WBYA 1SF9A 2LVEA 5FM5O 4B41A 3BPZA 4Q8BA 2R0KH 2R59A 4XNUL 1A6AA 3RJQB 3O45B 3RFRA 1YJDH 4LFHD 4GKSA 4AZUA 3D85B 5F1KC 2WQXA 3OKLB 4XXDB 1KV3A 2BVQB 4PY7A 4A6YH 2KH2B 2P8MB 3GTNA 2DWTA 4Z5RB 1AI1L 1CB4A 3T77B 3WHXB 1IM3A 3GSUB 3WFBH 4U1KA 4RA3A 5C8YA 3T2QA 1AVMA 5CD3B 3DRQA 2BIMA 4UTBH 3D25A 4WO4B 4UOZA 2M26A 5BMVB 5JQ6L 3Q8CA 3V5HA 3E9TA 1UA6H 2UVEA 3RWEB 3BVVA 1X4YA 2GAZA 1PL4A 1NLDL 3QZLA 1NAKL 4GYCB 2XI9A 3GPSA 1OAYL 2D7MA 3K5SA 2EINB 1IVSA 4DV1B 2W07B 4WRLA 4HF5H 4QGTA 4R26L 5IW3A 3V4PL 3H4HA 5TPWH 4I0XB 3DMMD 4L1BA 3X3GL 1JNLH 5IJ9B 1XMQO 4G7VL 1NC4A 1CL7I 4LKCA 3UZVA 3DBXA 5EOTB 3UFIA 1RPOA 2KYIA 3GKWH 3LS5L 3MLWH 1E1QG 3MNWA 1H3UA 2OAAA 2EXWC 4OLXL 4R6UA 4JM2B 3OTOB 5D1XC 4UB0H 1RP9A 1BLNA 2ZX6A 1BF8A 5I75B 3V0HA 1E5BA 2RJMA 1DBAL 5A16B 4LF5B 2B9ZA 2XQYA 5DEDA 4PHZA 4WFFA 1FPTL 4FADA 1DO6A 1YAZA 4ZXBA 1W6LA 3WFEH 2J4WL 1TU2A 3IFPA 2ZJSH 5I15H 1HZLA 1MCQA 1CFSA 3KZIZ 2X70B 4HCRA 1RJZA 4JFDA 3T1YO 5KMGB 2V4LA 2Y5TA 3QUYC 1MMMA 2C4XA 4P4KB 3OKDA 4F2EA 2XXFA 1AXTL 1VZIA 1TG8A 3C5XA 3V9EA 2N01B 4S1RH 3CU1A 2KC0A 2YLKA 5CUSL 4NWTH 3OJ2C 4M7JL 5DCCA 5JXED 2NY7L 4ABVA 3MXWL 3V6ZB 5J2TB 1IGFH 1ORQB 2AK4D 3N04A 4UDUA 4U6XA 5C0GA 4ELDA 5DMYA 3JATA 1UH2A 3KVDD 3L3GB 1NCBL 2GHWB 2YAFA 1U8LB 3L81A 1U3YA 4J7ZA 3D51A 4MB3A 1TVDA 2F54A 5JDJA 1I8AA 3CK0H 3CDZB 4S0TD 3VFTA 2J1KA 3G5ZB 4WTZA 4WFHE 1JL8A 4HH8A 5G2NA 1Q4NX 5IG7B 3PHOA 1XGRB 3RA7H 3WIFB 4BE6A 1GHFL 5DVPA 1LNUA 2NZ9C 4JPVL 3HR5A 4PGCA 4A68A 2NMSA 1OSPL 2BTQA 3LZNA 3RL2A 3VRLF 5LYJB 2P5ED 2XN0A 3VRIA 1AP2A 2XAHA 5LXTB 1MWAH 4BKLA 1L9MA 1T22B 2XX0A 5ITFA 3K81A 1BEXA 3EZ8A 4G7YL 1IO4C 3CHSA 4F8NA 2MKLC 2B39A 3FTXA 1BX2A 3W1ZA 4XTRC 3QG6B 4WJ5A 4U3JA 3FS9A 5TISZ 5GGVY 4LL1A 1WD8A 5I1GH 3R4DA 4OFYA 2XZAL 1JK8A 1EAPB 4JQXA 1INEH 3RGVC 1EUTA 3N41F 2D7PA 3PWPD 3EYQC 1HKFA 2O5ZH 3TVMD 4XGZB 5DTFA 1VQ4V 1EM1A 4O02L 2OI9C 1AGDB 2F19H 3MCYA 5IG7A 1H9VA 3PHOB 3SN6N 1VZGA 2VH5L 3HMWL 2WLIA 3IKCB 3PXJA 2IADB 3KCPA 3O0RL 4I8DA 2AZUA 2EDBA 4JFQB 2VL5A 5IB5B 1FIEA 2QSCH 5F3BA 3HS0A 4P23C 4DFHA 1FG9C 2IWEA 4XI5C 3RVUC 3WNLA 2JSFA 4PJ9C 3EJZC 3SDYH 3N2GA 4XDJA 3CZEA 2FIKA 3L5XL 1AP2B 3QUZC 2EE3A 2D3OW 3KYMA 3KEHA 3Q05A 4ZUWA 1ET8A 4JF3A 4PB0H 3BAIA 2YXWA 5H35B 2UUCO 1GZPB 1MI5E 4LASL 3GMQB 3NVQA 1CQYA 5DHYB 5JWPA 2ESVA 1RPUA 3EYFA 3IXTA 5CWSB 4MVRA 1Y6MR 4LOVA 1BOGA 1IBYA 2YPLE 4OCWL 2VR3A 3MLUL 4TSFG 1TVHB 2ZYHA 1A1MB 2C1OA 4I48A 4RSVA 5DZ9A 4BINA 3P3YA 4D8OA 5LG6A 1K5WA 3RX7A 1Z66A 1FAKT 1I9RL 2YPLA 2B1AH 1YECL 1PY0A 3BEWB 3QIBD 3GBEA 2AKRB 4R50A 4QLWA 2EYRB 3UP6A 4NN7C 4UAOB 2DPKA 5C71A 3O3UN 1W0JG 5I23A 2ETWA 4BXSV 4X9BA 4RGNB 2HLAA 3QWRA 2NNAB 3F62A 1JGEB 4GB9A 4NQSA 4FYQA 2MPAL 4ZNCD 1H9DA 4TUJA 4P99A 4DEUA 1G7JB 1TEYA 3ZQ9A 4PTTA 5I19L 1IGYB 1VFMA 1U42A 4LSRH 1BBDH 3H7LA 5KHGA 2VO5A 1XNQB 3GWKC 2ISDA 3KYMB 3WEMA 4TTDC 3KPRE 3GXIA 1VGEH 4ZO7A 5T5NF 1IFHL 1ITBB 1QSFA 1PD0A 1SYVA 3B2UC 3LEYH 4HV8A 2HKHL 4ZW6A 3ZMRA 3I5DA 4GAJH 2D31A 1IT9L 1XZ0B 4JYAB 3KJ6L 4MCYB 2XWRA 4AL8C 1ULVA 5F1SA 2A83A 4JGSA 2WY3B 5C70A 2CE4A 2CK0H 1FFXA 1F11A 1T04B 4XBFA 1U91B 2HX8A 2PXYD 1PZAA 3EYQD 3QEUB 5DLLA 3V6FA 1IC5H 4JY6B 3LKQA 2CNZA 1EAOA 4DQOH 1TOXA 2ICEB 4Q6IA 4OZHF 5JH7A 5KX5B 5K1XA 4ANKA 1F5WA 1JFHA 1JYNA 1FNAA 4MB5A 4U4BA 2VXQH 3MO1B 5IYZB 1E9OB 2CKNA 3T2NL 2XYCA 4IL6Z 2GIXA 4Y0GA 4H37A 2ZG2A 3SO3B 1FVEB 1PZDA 4PR5B 2VXQL 4KX8A 1UJ3C 1PJ9A 1FZJB 4ELMF 4BYHA 2E9BA 4F15B 4W9GC 3PAVA 4JS7A 5E2UL 3LB6C 5DLML 4TVPD 1XILA 2CDEA 4HFWA 4U1GB 3MKKA 5EOCJ 5F9OH 4U2ZA 3QNXB 4EZMA 4JI6O 1PG7X 1XCWA 2AEIT 3IGFA 2YXMA 3KJ6H 3KYKL 4PVLA 4UV7L 1GPOH 5JUEH 3MROA 2XRAL 4CC6A 4GO6B 4JVUA 3GK8H 1MXDA 1IFHH 2Y72A 1QFPA 4GLXA 3FFCE 3LQAC 5KSUA 3X1GA 5IB1B 3T0EC 4Q97A 3OM3B 4ZNEE 1RSYA 4OJDH 5C8JB 1FL6A 3FTYA 5GJTH 3D0LA 4AENB 1UM6H 4PJGE 3QUYA 2ZM6O 2QDWA 1MNUL 4HX1B 2F4VO 3L95B 4HZLA 5EU5B 2DWDC 2ITDC 3BX7C 5FS5A 1PSKH 4J23A 2WKOA 2WSSG 2OCCC 3GF8A 4PJDA 3BVTA 1HH6B 5DZPA 3BP7A 2FBOJ 3T6QC 4AMKH 1Y0LB 2LLGA 5LNEA 3UERA 4F3FA 5CINL 2YUWA 1R5IA 4KK8D 1A2YB 3KWWB 5FKPA 5DJ8B 1I9RH 4LCUC 5EC2C 3CX2A 2ZE0A 5E9DE 3FSZA 4Z7WB 3QZNA 4HIIA 3PFUA 4YSCA 3FT0A 3PN1A 4QKTA 3TF4A 3A4DA 1E43A 2VDLL 2BNQA 4I5BB 1JWMB 4XP4L 5B7MA 4I50B 1RIVH 2IJKA 2HLEB 2Q2LA 4LH7A 1P4BL 3UT5B 1G0YR 2LGWA 2BNQE 2K1EA 1FVCA 1ZVHA 3QUZD 3Q01A 1NUNB 3JVGC 3OPUA 1L0YA 4F2FA 2KQXA 2ZOLA 3G04A 4PJ7F 3A4EA 1BQUA 3C5ZC 5BY1A 3EH5B 4MW3A 4O4IB 5KVEH 2AQPA 4YXHL 1T3FB 3W9EA 2QSCL 3VG9C 1ZT7B 1SLWA 3AT0A 3FB8B 1NGXB 3HMWH 4IOIB 4JGJA 3IEAA 1P4BH 3JUZA 4W9HC 1TTBA 1AYRA 2VRZA 4XO4A 3IDJB 5HI3D 1BVLB 4HUKB 3K6SA 4Y1AD 5I8OH 3CGTA 2NXYD 5KAQF 3DWTA 1HNFA 5K9JL 1NOAA 5JZ7C 1ES0B 3O9WD 1TO5A 4J7KA 5IM7B 3ZR5A 4ZW3A 5CA1A 4JG1H 4EIUA 3KLLA 3UP1A 2DBLL 5T3XH 4I77H 4QT5B 4ZS6D 3MRLA 1SEBB 3ZQXA 5F1IB 4P5KA 1PX8A 1IM3B 2P4AB 4EB6A 1NCAH 3DNKA 1BSMA 1OTTD 1VFOA 4TQPA 2FYYA 3ULUE 1US6A 2WK2A 3QORC 2CIIA 3CFCH 4DV3O 2UXVA 4ODVL 2VZOA 5TDNB 4GS7C 1DTOA 2UX7A 1ZIAA 4DW2L 2MCPH 4YS4A 4G9FA 4FLHA 3CZLA 4MNQE 5DJ0A 5I6PA 2OTJV 5KVDE 1HJCA 4PLJD 4GKJO 1G1CA 4LEEA 3GI9H 3LZLA 5JPMC 1YRKA 3RRQA 5EZIH 4AYEC 2CCVA 3CUPA 4YBHA 4YHIA 3UTTD 1BMFG 2XAJA 5JPNA 1IFGA 3BPNB 1PD1A 4U6HB 1QYGL 4GUCA 4H2CA 3SYCA 1TA8A 1SQGA 1OCWL 4MSWB 4ZX4A 2QKIA 5F9OL 1JCKA 5HDQH 1WCQA 2E5LO 5HGAB 2RN9A 2DMCA 3TBSB 2DV6A 2VDOB 3NQKA 4EDWL 4P2QD 4LARL 4EKJA 4Y5XB 5FFOA 5KTEH 1Y07A 4DR2B 3UTTE 1T6VN 2KLTA 4QHMB 3MXWH 4H8UA 1T0MB 2HB0A 1T2QH 5C08D 2CBTA 4RRPG 3N85L 5G4OA 4EN2A 1A47A 3FFDB 3IS0X 3P69A 3O8XC 2VC2H 4ZFOA 4D8PA 4DV6B 4TUOB 4NUPA 1FYJA 4NZUL 2NW3A 4E41D 4HKZB 4X9HA 3VFNA 3TA4D 3C8KB 5ALCH 2PF4E 2Y69B 1HHJB 2C9PA 2W0LA 3TNMB 4G6MH 1TJIH 3NIGF 2EDMA 4JHWH 3HS9A 3VG9B 3L3JA 5FA3A 4Z7NB 1VADA 1XI1A 3LN9A 2Q7YB 4EMZA 3RUGB 5DQJB 1MHHB 4R97B 5DK0B 3KZ8A 1FC2D 3PJSA 5FYKD 1U9KA 3PWNA 2IU3A 3QO1A 2GJZB 1WJ3A 2C1PB 3EDJA 4PY7B 2X9XA 3O3BB 2I5YH 4DZ8B 4OLYL 1LVEA 2ZE5A 1U96A 1Z1WA 1WFOA 1PU0A 2AJXH 1O9HA 2BVUA 3G3LA 4KQ0A 2R9HC 3N3EA 4O58L 3S34L 2MPAH 1PLAA 3B7UX 4F7CB 3BP6A 3QEHA 3LDBC 2A9BA 2V5MA 4L3EA 4LHUD 1DJYA 3OT7A 3BZEB 3EIFA 5HYJA 3HMXL 3NP4A 3T0DA 3SBQA 1UPGA 5KEZA 5BUAA 4LDCA 2WKGA 5LGJB 3OUFA 1IBDA 3L48A 1BAFL 4LF4B 5HVHB 1JJUA 5LL6Y 2ZYIA 1JHLH 1XR9A 3H01A 2CMRL 2IFFL 4HPYH 3CN3A 3SGEH 3D0VA 2WB1A 25C8L 1GR7A 4Z78B 3FZUD 3FONA 1BHBA 3ILDA 5DC2A 4PCKA 2C8NA 4GSDL 3K58A 4XMTA 3WTXA 3PJSB 2Z35A 3E6FA 3FO2A 3QR2A 4ZQKB 2GJRA 4X4YB 3KGTA 4AITA 2EIJC 4LL9A 2J7LA 3MJGX 4NM4H 4MKTA 2KQMA 2FGWH 2GT9B 4G42A 5D7JB 3JD0A 1LD9B 5ACMA 4F91B 5I9QC 4ZMZA 3EZJB 5H94A 2IH3C 2VH5H 3NGBC 2DLGA 2ZNJA 2VM9A 3ULVF 4HD9A 3WMSA 3QRBA 1LL1A 4GMSL 1CXEA 1KG0A 2AJ3B 2AVGA 5DVMA 2YZ8A 3VYNA 5GGUB 1I8LC 2HRPL 3BUYB 3G6JF 4GRLA 3MGOA 4HUUB 1DE4B 1SFHA 3CYOA 3L4CA 4LSUL 4MAYA 4WTWA 1QLEB 1YQVL 1OP3K 4BDVA 3D2TA 2QMKA 1J48A 3AG3B 4I1NB 4N1CA 4JZNA 3GXDA 2OXGB 4IBZA 4M6OH 3FYIB 2EACA 3ARBB 5EEVA 3LXUX 2OCFD 1YQVH 1CE6B 4IKKA 1BJ8A 4LFHG 1PPJH 4UM9D 4MNQB 2BZ7A 4YFDB 4ONGL 4DPCX 1LDPH 2XU9A 1KNOB 4AV0A 2J1ZA 4TNVF 1HHIB 3NSCA 2HHHO 4H8PA 3ZDXB 1TJHH 2R4SL 1GAFH 2ED8A 2V9QA 3MRMA 4QXTB 4LNUA 1L7TH 3MRGB 4N2IA 1A4BA 2DQMA 1ND0A 5J6HA 5ID1B 1DJHA 1BPLB 1HHGB 3RA7L 1MJUH 1KY6A 1KCUH 2CPCA 2OSLA 3HBGA 5HXMA 2EVIA 1F0LA 3PWUB 4CA4A 4LCCA 1COWG 2WXRA 1ZGLB 1YEEH 3HUJE 1SN5A 5LQBL 3NCFB 3LZOA 5CGBA 3BAAA 4HUUA 5LP6B 3IGAA 3T08A 3ZX1A 3TIEB 4UCVA 2BDNL 2DMGA 4JDTH 4ZUSA 2F93B 4L2YA 5HTSA 2CJ3A 1PFCA 2VGLM 5D70L 5GSRB 3UGEA 5T1MA 5C7XH 1S7RA 4NN7B 1KTLA 2A9ML 3WYRA 2VW4A 1JK8B 3X13A 1FDLH 2JGDA 2F58H 4H13C 3T6ZA 4U6TA 4NXNB 1EHLL 3AS2A 5JH7B 2MK3A 1TCMA 5GTHZ 32C2A 3GMPB 4NUJA 4TQ8A 4XWGL 3UCRA 5CUSH 1FH5L 1Y74A 1H38A 2OMYA 1IEAA 2XWXA 3Q5TA 1QFWH 2WLIB 1MDTA 3IKCA 3MXVH 3UPCA 1W2BU 5LGTA 3WJLA 3F5WC 3ZYZA 4QE7A 1ZPLA 2XTJE 4LSTH 4QXTA 4Y4KA 5I18H 1NJ9B 3QF7A 1I1FA 5IEHB 3Q43A 2AJXL 3SKNB 1NBMG 3KGRA 3N2GB 3C60D 1NH2B 5EK0A 2W0XA 3O9WC 2Z8SA 2AV7A 4PW4A 1KFAH 2YC1A 3HPLC 2DH2A 3BDYL 3O6FD 1V55C 1FE8L 3P0VL 2VMEA 4ENED 1BAWA 1JGLL 1ZXKA 3QFJA 4JQIH 4ZOLB 4OGXL 2Y9RT 3RVVD 4JBSA 3IGAB 3FT3A 2QADB 3IMUA 2UWEA 3QXWA 4YNYB 1XH0A 4RGNC 2XXMB 2LGNA 3VXSA 3E2EA 1GIGL 3GSQB 1ECYA 5DO8A 2WXGA 3BZDA 4XMVA 3V4PH 3FRPA 1AXSA 3IDUA 3C87A 2X4SA 1KLGB 4W9JC 2R2BA 2VLJD 1B4JL 4XXWC 3L4TA 3BFQG 1GZHA 2WUBL 3AS1A 4G5ZL 4X6EB 2WLKA 2JDIG 4MZ3A 5B39A 5E8DL 1QBML 4UAOC 3GGWB 3GRGA 4ODHL 4OVUA 2GCYA 3CPLA 3CP1A 3G9VA 1ZLZA 5AENA 4FNLH 4AQYB 4DR4B 3KPQB 2ADFL 1M1SA 3L7EB 1UURA 3CVBA 2VLRD 2QHRH 3HRPA 5E00B 3V4VA 3CC1A 2COVD 3KWWA 4MQTB 2CU9A 1I7UB 1FFPB 2G38A 1OSZA 4GIPD 5DJ8A 5KVFL 4OLUH 2JCCB 4K3EL 4FLRA 4MNQD 4MQ7A 3DX9A 1WBZB 2YOAA 4MB1A 4LVOB 1HE8A 3TEUA 2R0KL 3TP4A 4OZGA 4APQB 1AGFA 2IGFL 4OGQB 1M3JA 1I8IB 1O6VA 1P1VA 2JELH 2Y7NA 4OQ1A 5DFWH 4MAYC 1JWMA 3SKJL 5JIDA 4MCYA 2APWA 2DM3A 4Z8FH 1SQQH 1CI3M 2QM8A 1IGIL 3E7JA 3H9ZA 4FQXB 1A4AA 3UT5A 3VXNA 3X11A 2WIMA 5TGBA 4G9DB 3QJVB 4OIFA 1ETA1 3NJKA 3B9VA 2OQJA 1JFFA 2DQTL 3HRZA 4DO4A 2W60A 3ARRA 1I7ZA 1GAFL 2MCPL 2PWGA 4OF3A 1Y76B 1PZ5B 1HDJA 1A3LH 4G8FA 1AVAA 4P59L 5E5MA 5HGDB 5J89A 2NQDA 4XNAA 4UZGA 4L4VA 4ZOBA 4ONGH 4MJ2A 5L4IA 3FB8A 4YSAA 2WJ5A 4CBZA 1JYXA 3MUGB 4JAMB 2Y48A 4TNGA 1ROWA 1UACH 1QSVA 3UMTA 1VERA 2MCAA 3O0LA 4FQJL 4HXAH 3L4UA 5LBSL 5LHIA 4NC1E 2BVOB 4UV4L 1RIHL 3GXFA 3KWTA 4D9QE 4F93B 4NM8H 4N8VG 4JG1L 4B7EA 1DDHA 2R0ZL 5A7EA 3DHPA 2IPUG 4JZJA 2HT3C 1AHMA 4LF9O 2Q7EA 5IW1B 5J56B 4PS4H 3EW3B 2H0FA 2XG5B 4G27B 1UATA 2OMWA 3HBQA 3CFUA 1KJMB 1OALA 3MLTA 2P5PA 4HXBL 4N8CH 1JPXA 2VM4A 1AI6A 4J3SA 4PGEB 5ESQB 1CICD 4P8QA 4J4PC 2VDNL 2H9GB 3LIZL 3E6HA 3EKCA 1QRNB 2FYYB 4O02A 5DD5H 2AXGA 5TE6H 4KZDH 2QADC 5AYQA 3D50A 3NFNB 3W81A 2P67A 4AIEA 4TKWA 1QEWA 3O6FB 4NQCA 1GMEA 1PM9A 1N64L 3LV3B 5CZKA 4LNRB 1ZLSH 3IGLA 1L0QA 1NPNA 1DVQA 4FQXC 4NPYA 4KRPB 5IJ0B 3AG1B 1NAMA 3M7OA 4WF9V 3QJTB 1QSEB 3GEWB 3CG8A 3R0MA 4XE0A 5DS8A 3CUPB 2J56A 3MRCB 3O8XB 1JFQL 4QJFB 2ZSVB 2UY6A 2XY2A 1SA0A 2XQYK 3WJLC 4IGGA 2MMXA 3P32A 1LGVA 3D2UB 2IC2A 3SE3C 2Z3YA 2P43B 2CMRH 2IFFH 3FU0A 4HPYL 4AIXA 1NFDA 1M05B 4TLKA 1KYAA 3VXPB 3BH9A 2Y0SA 3O41A 3H56A 2OSXA 3WG7B 3CIQA 4M5ZH 4NLAA 4MRBA 3EG9A 2OMWB 2Z4TA 2Z31A 4Y5XA 4MRCA 5KBMA 5L8LB 3D3VA 5D71L 3RJDA 1J11A 1BGXH 4PWIA 5F7FA 2WCGA 4Y2DD 3CSGA 4ZUTB 1BP3B 1JNNH 2ZSWB 2LU4A 3D39B 4FGMA 2RCSH 4QXUH 5IKCB 5K59F 4X5WB 1EZVX 1EGJH 4X4ME 2X44D 2QJ1A 2FWLB 5HDBF 3UZQA 3MV8D 2CGRH 4E5XG 3FYEB 2I5YL 1XF1A 4JJOA 4AQAB 5IJKC 2XZQH 2J12B 3MZTA 3IC7A 4HIPA 4PY8I 1QP1A 1NEZA 1YYCA 4NQVA 3P73B 4RFEB 4ALAH 5HPMB 4X66B 4F37F 4MXQC 4GOSA 3RIFF 3GK8L 2X2YA 1G6VK 3OXRA 4PSRA 5DJCB 4DEPC 2CWRA 5HY9B 1KEGL 1SA0B 5DFVD 5B39G 4OQTH 1R73A 3ZYJA 4PVMA 3P2BA 1N4XH 3K1DA 5L0QC 2E9JA 5E1AB 3FO0H 3GJFK 4PGZA 2RHEA 3Q4HB 3DVIA 3F85A 3HBPA 2LVCA 1N67A 3Q5OA 2BSSA 5DJ2A 5F1IA 2Y4UA 3NRFA 3FB7C 4U3FH 5GGSY 4CUCA 4ZFFA 1X9QA 3PIQA 4PSPA 1B3JA 1U2CA 2WIIB 3VXRA 1NMBH 2NY4D 2BFVL 3MRDB 3QEQA 3BDXA 4G9FB 3RY4A 1SMOA 4R4FL 1MN4A 1KTCA 2YD5A 5LGJA 1NGZB 1SXCA 2IBZY 5JPNC 2EP6A 4MXWL 1ACXA 4M4RB 4PJ7B 2Q8AH 3UTSE 5GZOD 4NNYB 4LCWD 1N4XL 4R2GD 5C0ND 3FT1A 5F72S 4J2QA 2ZXGA 4ZW8A 4B50A 4UV9A 1BIHA 1YMME 1FNHA 3U25A 4BJLA 3ABMC 2OLDA 4GAJL 1X4XA 4JV5O 5ELIA 3MNZB 1XX9C 3QRLA 3V8CA 4HLJA 3AG4B 1L9SA 3NK4A 4N2LA 1YJ9V 5DJDB 2XNAB 5EZIL 3OZKA 4DTGL 3IFNH 1AQ8A 3C9NA 1A9BB 4U7MA 5M7QA 5JVDB 4CMMB 5EEYA 4OFKA 1AJPA 5HHPB 1L6XA 4F8TA 3A0HZ 2HR3A 4G42B 3CFCL 3ZRSA 1F18A 2BHUA 2SEBB 4H8WC 2QFPA 4L5FH 5H94B 2EIZB 5FW6A 3KE0A 3WJJA 2VKWA 1PPIA 1IC1A 5BOJA 4NZ8A 5D72H 4AYDC 3NG5A 3WNNA 4KKRA 1YF2A 3PDOB 4XNYH 1TDQA 1DUYB 3OUSA 3ENEA 3NGBB 1GSKA 4CN4A 5K9JH 1CXZB 1ZGLP 1ZANH 3EYVB 5H4YA 1CD0A 1UD6A 4X83A 2YAOA 2XT9A 3RUGA 3B2MA 3KL0A 4JLRA 3HKEA 4KHXL 4Q2ZB 4I7ZB 1JFQH 4WFGE 4YPGA 2ZKMX 3EJUA 3KNBB 2W38A 5EU3B 5F6HI 3CH1A 5A2JH 1DVXA 2CKBB 5CIPB 4V2CB 3FO9B 1VF5B 5F7UA 4IIQA 3VFRA 3OJDB 4FFYL 4Z7VB 4DWHA 4DV3B 4F33B 4MA3B 3RFZA 1JTOA 4CU6A 1JV5B 3DXRB 4WW1B 3F7KA 3CFIC 3CXFA 1Y66A 2R4RH 4QAMB 2HXAA 1M1XA 1BQ5A 2DYSB 1HHGA 4MT8A 4LOEA 1NKRA 3O9OA 1TTRA 5ECJE 4DN3H 5BUGA 1F6LL 2AABH 4RZKA 4OQTL 2YI9A 5EO0B 4DP4X 3N9GH 1HQ4A 3BZ5A 3EUUA 2EIKC 4J3XA 4BCYA 2XZAH 1N34O 1XF2B 5ITZA 4S0SD 5EIQA 2VDQH 1XR9B 2QPFA 4XP5H 4I4WB 1DUYA 2P24B 2X05A 5CAYB 5JJNB 1EZVY 5T3XD 3M45A 2NY0D 3QQ9C 1CE1H 1ETZA 5DJAB 4NJ9H 3DVNA 3EOTL 2FECI 4FKKA 1HQRA 4P46D 5JOEA 2KZWA 3BD4A 1JD9A 3JUYA 2BWQA 1IQDB 3F5TA 1SJHA 1Q9KA 3BH8B 1Z6JT 2OTWA 2NY6B 5C07B 1UM6L 2Y7LA 2X4RA 4PRID 3TC9A 1TZGL 1UM5L 1ML0A 4PN6A 2GHYA 4AIOA 1TTFA 2R1XB 4WW2A 4XOCA 1JPGA 5BQDA 3TIDB 4PRBA 1QRNE 3ETBJ 2MRYA 2MWCA 1O5DT 3PAYA 2XUMA 3AUVA 3H3BC 3KLAA 1RL1A 4U1MB 3SKJH 5JUEL 3WGVB 1ORSB 2ADYA 4PH8A 3D9AL 1FLRL 4HWZA 4PRHA 4OD3L 3JWNC 2VJ8A 4LLVB 5IROC 2AQRA 4CVXB 4DZBA 4FM0A 4TQEL 1H2KA 1A7RH 1I3GL 3SOBL 15C8L 1OGTA 3OR7B 3G6JA 1JPSL 4XBMA 4IIJA 3HZYB 2OXGA 1I31A 1KCLA 1MCWW 3MACH 4OAWB 5E2UH 2BNRD 4DUYB 2FO1A 1YCSA 3DUHA 3GMNB 1QR8A 2IBZX 4S2SA 1M2VB 4KJWC 4R2GB 4DKTA 1OCCB 4F5CE 1TT6A 2BY3A 1SOXA 1WAAE 4N8PA 5F0JB 3AM8A 3KGUA 2CXGA 2TSAA 3PWLA 5LKNA 4U0QB 1CBJA 3C08L 5K1PA 1INQA 4L1HA 3VDCA 3FO0L 4BZ2L 2ZUUA 4F2ME 1ZT1B 2GPZA 2GKIA 2VERA 5I74C 5ID1A 4Z1VA 1LEKB 5LAXB 3LKOA 1U2HA 2QT6A 5MEND 1BOYA 1X7QA 4YDJA 3K79A 4UV4H 3LKPB 4G8EA 4R7XA 1G87A 2AITA 3BPNC 1VGEL 3PNWB 1AP5A 3BDYH 1DQKA 4WK4B 3VQMA 2A73A 4LKXA 5IK3A 4Z76B 1U58A 1IBBA 5BV7H 1PNMA 2Y2TA 3B7TA 3VXNB 3X11B 3NJJA 2V4DA 5FUZH 4FFZH 1HC1A 1RHHB 4ODBD 2RCSL 3IRCA 4HEMA 4PV8A 4Y19E 3FU6A 1LO5B 2NUTA 3MXVL 3VQ2C 4Z7UE 5J1AA 1UA6L 2VDQB 3QIWC 4Y4KC 3QO8A 2OZ4H 4XC3L 4QRQA 1HWYA 3LPPA 4RH4A 1YECH 4UTBL 4L9LC 2B1AL 5GW7A 2DY2A 4YHNA 4LEXH 2Y23A 5MEQB 1PP9H 3ILQD 1N34B 2F8XC 1RUAH 3P9WB 3UO8B 5JNYA 3R7QA 1MIEL 5C0BB 2HMID 2GITB 4Z0XB 4AILC 2PLTA 3UH8A 4EEEA 4X4XB 4J3OG 2QGDA 3NZ8B 3ZMVA 1MDAA 3KL3A 3RAJH 5C09E 5GGSB 2UZXB 4KQ4L 1X7QB 4JRFA 3IAGC 2X28A 4DV7O 1E27A 5GISL 3KGSA 1IM9A 3QJOA 1AZVA 4AQ1C 2CHZA 2GAZB 1X5HA 1SLXA 4ZMXA 3R65A 1KC8W 3TASA 2HP8A 2G5UA 4UOQA 4A7TA 2ZUSA 5GS0H 5AB0A 5BPPA 5J1TC 4A39A 3CZFA 1ZAUA 3MRQB 5BRZB 5AFAA 3D18A 2X2UA 4N1HB 4R4BB 3MNWB 1MQ8A 1J95A 1WUZA 3BKML 2PO6C 1UASA 3GO1L 4X6EA 1H6EA 2D4DA 2IDFA 5B1AB 2WMPA 4XN9A 3SKMA 1FG2A 3ML0A 1MVUA 4MHHI 3C60C 1A4CA 2P7TC 3KPNB 3L7EA 1UJ3B 2BOCA 4BK5A 4JW3A 4XNQA 1FE8H 1HESA 3TXAA 2DH3A 4P9OA 2GITA 4Z0XA 2I25N 1K73W 1NSNH 1TQCB 2X2JA 2Y4SA 3EJTA 4RGNE 1A22B 5KYUB 4MQ7B 1AHWB 2V2WA 3FU3A 4XN1A 4E9XA 4KRMB 4Y89A 4QHPA 5CMAA 4KMQA 4Z0BL 1AKJB 1NBYA 1WDAA 4BGDA 1XWVA 3US9A 1TPXC 4X5QA 2RQ8A 4KO5A 2AQSA 4L8SA 5EF2A 1EZVH 5CJOL 4PJGF 2LQTA 3IDIA 4ZFQA 1HOEA 5E56A 5FO9B 2O61A 4WFFD 3O9WB 3HNSL 1H6TA 2JIXB 3NAAL 3C75A 5D6DA 1BD2B 5E99L 4QO1B 4JPVH 4ICWA 4YL9A 1XZWA 2V2TA 2QWNB 5T1LD 1SHXA 2NUPB 3CQQA 3NCJL 1RZKH 4KGLA 3FQXA 4F7PA 3WNPA 1WGVA 3RN4A 1D9KD 1H0DA 5GTIZ 3APQA 4MS2A 3ZBHA 3MX0A 3JSLA 1IAIM 5CD3A 1AJNA 3M1CA 2HT2C 1XL6A 3BN9C 4XNXH 3GZKA 3VD0A 1FZOB 2GSMB 2XOTA 5D1QC 1CGXA 2NN4A 1IGFL 1T22A 5ITFB 2Z7WA 4JQVC 1N2RA 4ODXB 1NDGA 4Y4FD 5L4JA 5K59E 4M6MH 5E8DH 1KTKE 3QJQB 4PGEA 1J0HA 4Q9RH 1TJHL 4JI2O 4I0XA 3DJTA 5FGCB 2MCG1 4QHUB 3FB7B 1GOFA 4XX5A 1MI5B 5F21B 1J18A 4DVBA 2Z5UA 1JRHI 3TK1A 3LNDA 2Z6FA 4JI1O 4N2AA 3THOA 3O6FA 3BRGC 2X10A 3FDWA 3FK3A 4UNTA 3LIZA 4PJIB 4A7VA 3EGXA 5GONA 3DTXA 1AR2A 5I1HL 4NWUH 3E8FA 1DJSA 2Z8RA 2APSA 2H26A 4X80L 1LP9B 5BS0E 1JGLH 4DPBX 3EJJX 3QJUB 3GKWL 4JI5O 4DESA 4XVTH 2XBDA 1U8QA 1BVKA 4XN5A 5L6YH 1IX9A 3P11L 1USZA 5DJDA 2XNAA 1JF6A 2Q0ZX 3APNA 4RMVA 4WU5B 5DK2A 5L4MA 1ZUQA 1NLDH 4KDTC 3OW2U 3S98A 2P90A 2MNWA 4ZMTA 2CO6A 3EJQA 3NIFB 1Z5YD 3K2UL 2IBZH 1E28A 3L9EA 3ARGD 4XCEB 5DHYA 4ZRGA 4KK5D 2HWZH 1EDQA 3G6DH 3AXLA 2X0WA 5C0RH 3U36A 4JKMA 5IKCA 1RZFH 4KZ0A 3MRFB 1F97A 2EE6A 4L23A 4AH2B 1HDMA 1YLBB 3DLQR 3RWDA 3VO0A 3AT9A 1G6RL 3TV3H 1IURA 2BHFA 2FTAA 4KQ4H 4GIAA 1CD8A 3IJSA 4CMHC 2W88A 2WXLA 3ZVVA 25C8H 1K92A 3DO3A 1QR1A 3ZRWA 4WY7L 1BAGA 1LHZA 3EGXB 5GONB 2H1XA 1KENL 2A0LD 1F42A 4QXGH 5JIMA 1RUAL 5DC0A 3KPTA 2HT2D 2ODMA 1XR8A 3BN9D 3PJNA 5HVWA 1D5MB 5C0RL 1KCUL 2F54E 1JV2B 3CLFL 4W6YB 3FOMB 4ORZC 1OT2A 2D8KA 5IQNA 2DQGL 2YD4A 1DF5A 1OSYA 1J10A 3REVA 2EICA 3KNBA 3QG5A 3HNSH 2YGQA 3NAAH 4U05A 5EZOH 5SWSB 4CS2A 3Q2LA 2K9PA 5FOBB 2OMVB 3DX7B 1YDXA 4MDIA 1XBLA 5C6TH 3SPVA 3RWJA 4A7QA 3A6OA 1B9ZA 5FNVB 1KULA 5E24E 3CV5A 1HILA 4YOKA 1F86A 5EORH 3P4OB 4ZX6A 4QIWF 3IFXA 3NJFA 1NEZG 3WIAA 1CXFA 2H4EA 2XG4A 3AUWB 4Z7WE 4XN7A 1S9VB 3GVMA 2Y7MA 2NT1A 1NM4A 1UA3A 5KSVB 5I1HH 5KA5A 1L5GA 3BUTA 3BI9X 2HG5C 2IH1B 5A6IA 5ID0A 4G6ML 1TZOA 1CLYL 4XN2A 3N43F 2VQFB 1NFIA 4JRYD 3STZA 3ZTCC 4RGOH 4RWHA 5IMKA 1U3ZA 4BZ2H 4PA4A 3TCUA 1K3EA 4K9EH 3SQOL 1RD6A 1FVEA 1PBYA 1D3CA 3CXHK 1W8EA 5MI0C 3O2WL 1P1ZA 4KITB 1FNEB 3CTTA 4JVWA 3T1HO 4K8XA 3L3OC 4RFNC 4YO0B 5LA6A 1MXGA 1QKZH 5D1QD 5CEZE 5EEWA 2X4TB 3E3QE 2XA8H 3IXAB 3R06A 1PEWA 3MACL 3SBRA 4RMRA 2ZAGA 4WSKA 4A2MA 5BNXD 3VD2A 1RU9L 2DL2A 1F6FB 5E6ZA 1B2WL 2D7NA 1K5QA 3G5VA 1A7QH 4GG8B 4G8AC 2B4CC 4A63A 1RM1B 1DUZA 1HOCB 2C1OB 2IDTA 3ESUF 3RVTD 2CH7B 4CVUA 4FI8A 3WB2A 3QI9D 3HR6A 3ZE2F 1C8PA 4XHQA 4FFKA 2XIIA 3LJ3A 2VXQA 1RK0A 1JCHA 4NYKA 3LUTB 4FLYA 1OB0A 3FPXA 3BWZA 1RZIA 1MREH 1FGNL 1XD0A 5GPRA 2EZ0D 3OR7C 1C8QA 2K4AA 3STBA 5ES4B 3TJHD 3V7AE 4XOEA 5SWZA 4J10A 5CJOH 1BHAA 2RA1A 2BIOA 2AV1B 2EO1A 1BCIA 1TQTA 2XHNA 1M2VA 3OHXB 3QJSB 5LMUO 3S3SA 3WIHA 2VCOA 3GWJA 4NXMO 4GRWH 2HTLC 3T1CA 5GJTL 2QGBA 2X4TA 4CADA 4PDLA 2V3EA 3MZGB 5J9PC 1A14L 1ODUA 1JGUH 1WGOA 3KDMA 2HJDA 5E95B 3QRGL 1B0GA 4A37A 3VTTA 3A0RA 3ECWA 4DK3A 1UZ8B 2KB1A 4PPTA 3DX3A 1Y6XA 5KX5A 1S7WA 2DMKA 3HE6C 4TNWF 1RI8A 3F7YA 5J7CC 2VWEC 1FNGB 5D93B 1T3FA 3W9EB 1SY6A 5DN6G 1IMHC 4AM0A 4YXHH 1RM1C 4DKFH 3BGFB 5D1QE 3T2MA 3QISA 4MSWC 3N85H 4QRUA 4CJ0A 4I55B 3BIAX 3N44F 2DWYA 4YN3A 3WXVL 1EBAA 3E86A 3T1HB 3OMIB 1AXIB 3V0EA 1GA2A 1N8ZA 2YBRA 2H0JA 4MVOA 4DR7O 1CT8B 3LN5A 3WBDA 1FPOA 3WMPA 5B3NA 4JV5B 3L3OB 4M62L 1OK8A 15C8H 3HG1B 2VDLH 3H9SB 3OG4B 2CK0L 1XGYH 2XBZA 1A6UH 3WFHB 4K8RC 3MRBB 1U3HC 2YKKA 5B3SB 3QCUL 5EOCH 3ZHLA 2VDRL 2QZQA 4UI2A 4IK6A 3UBXG 4BZ2A 2LFGA 3RVXC 3BPCA 4DP0X 4WFEA 4N87A 3VU1A 3B9EA 3AITA 4HX1A 1SDAB 1RMFL 1UM5H 4XX1E 5EEUA 1NIDA 1BBDL 1OWWA 2DLEA 1A6VH 3MU3A 2CLVB 5I1EH 4LCIL 1Y0LA 4DETA 1H19A 3KM2A 5GS1B 2F53E 3MFFA 4E4EA 3SZ6A 2OX5A 4KKAC 2JMRA 3TPUA 4UTAH 5FKPB 5KOMC 3WHE0 1CGUA 4P5TC 1XXDC 3IU3B 1FP5A 2VR8A 4LVHC 3SOTA 3CNKA 1A8JH 3N1MC 2P26A 4NRZB 3BVXA 4DUXA 4U2YA 4GW4B 3HPLA 1BCCH 1FVDA 2VDQL 4MAZA 2AZAA 4NCC2 5TK4A 1YY9D 5DA0B 3E22B 1E9QA 1DQDL 3QWQB 3O4LD 1BVZA 2KMWA 2BP0B 2Y7SA 4CVZA 3OF6A 5E2TH 1A6ZB 2DJVA 3HB3D 1FNLA 2FB4L 4PJ8D 4ANXA 1J88A 2PCPA 2EEDA 5HPOA 2O6EA 2R4RL 5KN5A 4LCWA 1MHPH 1W0WA 2WBJD 4NKDA 1ADWA 1ZLEA 4NRXA 3HIZA 1G9ML 5AAPA 2L7QA 3NK3A 1HHJA 2EZ0C 2X6UA 3IDIB 4D9RD 3K6OA 4A66A 3L9YA 2ED9A 4HJEA 1ITCA 3M7FB 4Z1PA 1UEMA 2BERA 5EF3A 1JPSH 4P23D 2DIJA 1AE6L 2CM5A 4TLSA 1AANA 3LDEA 4KHXH 2IQ9H 4OD3H 4N25A 2ZOWA 1ZA6A 2BJMH 3BYTA 4HS8H 2O5ZL 2P5OA 1JDAA 2WP3T 3PAUA 1IT9H 3MUY1 3O3BA 4RCAA 1HNXO 2VR6A 2C2AA 5JNYB 2F08A 4RRPA 1AS7A 1KBBA 1SEQH 2DZEA 1YEDB 4BUGA 4E41A 1IL1B 3BRDA 4Y2OB 1AY1L 4JFZH 4RRPM 1A14H 3WNJA 4HKBA 1HXMB 1SBSH 3OD4A 4JN2A 4F8PA 2CGRL 2IOOA 4FQHB 1FL5A 1WT5C 2QJDA 4OUUA 4Z3EA 5I19H 4PJXF 3MV7B 4U3CA 3N41B 4LSSL 5I73C 4L4TE 1ED3A 1JNNL 5IE9A 2QV4A 4BSWB 2YARA 3H7BB 1SYSA 3KPMB 1MFMA 3PWVB 1N6VA 2ZKHL 4L29A 4X0NA 4HUVB 3EOTH 3W11C 1V3JA 3LOWA 1KOAA 2B5IC 3QI9A 4NJ9L 3OXSA 1D9KA 3D0VB 2E3VA 5I0DA 1HYSD 3B9DA 1NOFA 5E1QA 2TRYA 4J6RL 2R70A 3HUJF 3ELQA 1DLHB 4WWOA 4DR6B 2YS4A 3D3VD 1SJXA 2FO4A 3Q48A 1WAPA 3SR2C 3ESPA 3CSYA 1KGCD 1RULL 2EDQA 3AXHA 4Z7VF 4FQPA 5ESAB 2FECL 4GKSB 4BKSC 1JVKA 2GBVA 3VDBA 4AYFB 1IUZA 3R8QA 4AVIA 5AG2A 2XVKA 2I27N 2C4FT 2DQFA 3D0AA 1XOUA 1M6UA 1BFSA 2ESVE 2YN5A 4LVNB 3RTQB 3ARPA 3P02A 1ZT4A 2AGJH 3BO8A 1T0MA 4PB0L 1KCKA 3EJSA 1N0JA 2L7UA 1LYQA 2X7RB 2XTSA 1KYOJ 2C9RA 4YJZL 3JV6B 1P7QA 3MCG1 5AVWB 2X9YA 5DK2B 4D8PB 4X8JA 2A6KB 1DLFH 4ZSOA 3WI9A 4DH2A 5GGUA 4OZIB 5I5RA 4MDRA 4BRJA 2WNWA 2YQBA 3OD3A 1NU1H 1NL0L 4HUCA 3H2QA 1VQ8V 1GM9A 1E2ZA 3IFOA 4JFFA 2CHWA 2Y5EA 5ANME 1KLFB 2GDSA 3B3IA 5EBMB 5E8PB 5C0FA 3U36B 4LDLB 2J4WH 5EDSA 3O9WA 4WHCA 3FHQA 3OXSB 1D9KB 4Y9FA 4KJQD 3II2A 4RGOL 2QR0A 5C08A 4PGBA 3RI5F 3SBWC 5DDHB 4W6WB 1URFA 2YQ3A 3DA0A 1IV8A 3VI4A 1I7RB 3VCLB 4HGMA 2GSGA 2IF7A 5D72L 1V05A 4BA0A 1QR1B 3FQXB 4F7PB 1NANH 4FQJH 4HXAL 4YHKL 3SDXF 3BY6A 4C8XA 2KQNA 3N40P 3T9WA 1I82A 2A6DA 3PJSK 4UCOA 2CPUA 4B96A 3GWOA 1E5CA 4G7VH 2PXYB 5FA4A 4NI6A 1EZLA 1AOHA 5K9OA 2CR6A 3B37A 4EN3D 4YHHO 1OW0A 4W4OA 1KKDA 3CB2A 1MRFH 4LCIH 5HYSB 4FL4B 5FWQA 1QWUA 2HCZX 4PP1C 5HYJB 3AADB 4KI5F 2ITFA 1RMFH 3VFOB 4LCCB 4PS8A 5EZOL 5AVZB 3DURA 4M8RA 3JYCA 4LR3A 1Y6NR 4HAFA 4DTGH 4UQBA 1EN5A 2E9WA 2IV9A 4IBUA 2GUOA 4XBGA 5JHDE 3CLFH 4B3TB 1DQTA 2EEBA 2VDRH 2W95A 5T5NG 3CFKB 3F7QA 5DJ6B 2DQ3A 4E9SA 5F3HA 1KLFA 4XP1H 2F53D 1G9MC 1RZ8A 1BVNP 5EBMA 2H8PC 3T4AA 5C0FB 6CGTA 2CHNA 1XGYL 5E1IA 3KWXA 2BY1A 2JNZA 3QJHA 4NKOA 2JGDB 5K1JA 2P3YA 4K3EH 3FFCA 5CBAB 2HP4A 3HCVA 2XV6B 1LWJA 4KKPA 1G6RH 2LU3A 4R4FH 2CG9X 1U8NB 2NY2D 3ZE1B 2YRLA 4MJIA 5EBLB 1M7IA 3BJLA 1BYNA 2DE0X 1RZFL 5FYJD 4M03A 3TTSA 1IM9D 2DWEB 2P06A 4LPXA 4Y4KB 3PGFH 1A4JA 3Q06A 3QTCA 4OJCA 4J2XA 1AO7E 3K2UH 1HEHC 2NXZC 1B4JH 3PHSA 4D7BA 1JWUB 1CXIA 2Y0IA 1WS8A 2ZJSL 3TO4C 2VDNH 5IDJA 1CDUA 3OAAG 4DUYO 1Y4MA 1GMGA 1S5LZ 4GKOA 3SB3A 2V8LA 3CC7V 2VLJB 3BDBA 4ELME 3P0YH 4GKLA 2ZG3A 3GMMA 2RQ6A 1X9LA 2H41A 5IJKA 3K80A 3V0JA 3WTVA 4PDVA 1QU7A 3QRGH 3FN9A 4MLSA 4OD2A 4FNTA 2NYZA 3P0VH 3QJHB 4NKOB 1HN1A 5D7LB 1S78D 2X4SB 3NZUA 5HDLA 3L4WA 4KKBC 3T0ED 2YD9A 4HUMB 2A7WA 4FG4A 3FQWA 3X3GH 4PGDA 5DRZB 5K69A 2HJLB 1W72L 4OY9A 4TWKA 4DV0O 3DO7B 2VIRA 4UNIA 5FM8A 5I18L 1AQHA 1M4KA 5I1KH 4V33A 2FUQA 4QRTB 3PABB 3SDCD 3TFBA 2B0SL 4Y2LA 3FKSG 1QFWL 3U9PH 5D71H 1MWAL 5GS2D 1VB9A 4NENA 3IMWA 5EBGA 4KOBA 3U7AA 1P7BA 1FZMB 2DQTH 1MG3C 2DI8A 2EILB 2CO1A 3VRJB 2OMVA 2BNRE 1EHLH 2EDTA 1ASPA 1DN0B 4IS6A 3WAKA 2YUZA 1P84J 2PMZA 5CJ5A 1N0LA 3AK3A 2CUMA 3GINA 1YNTB 2IAMA 2EINC 2WNGA 3MLZH 4ZUUA 5C7XL 4ZUSB 4A6YL 4M43H 3IDXL 5HDRA 3T65A 1U8IA 2F9BT 4KV5F 1JYVA 4G1MB 3W0WD 2BDNH 4JDTL 3RYFB 2E5LB 2YO3A 3S4SB 4LGSB 5F97E 4JTCB 3UYOD 3NXSA 2WB7A 5AZ2L 5EF1A 5I28A 1MG1A 3ECBB 4OLUL 1V54C 1WITA 3WFEL 4YLBA 4GNKB 1LK3L 3GMPA 1SM3H 4AJVA 4GINA 5J11C 1WLEA 4QWWC 1YY8B 1FHNA 3F7YB 3AMKA 1FXKB 3RY6C 5D7IA 3CHOA 4L4VB 3N6YA 2AXFB 2FJHB 3TV8A 1I5YA 4O2BB 1IM3D 4MTOA 4P3DA 2QGNA 1EHXA 4EXPX 1FIGH 1T7WA 2C9QA 1U33A 2Z3FA 3TEWA 1AXTH 3LIZH 5EYPA 4Z3JA 3OX8A 3L4YA 1Y7VA 4ZKIA 4N8CL 3WKYA 1JERA 5ABDE 4F24A 4JO2L 5I2IA 5I76B 4M61A 1DDHB 1FPTH 2WWKO 4N90E 1AS8A 3V0IA 3V7AG 2F7QA 4XNDA 2J20A 3W3BA 3KLQA 1NSNL 2DLHA 4X6BA 3QS3A 4MNHB 3H9SA 2AEPH 2CKBL 3FN3A 4QCIB 3VUAA 1EJFA 4UF7C 3ARSA 4JO4L 4IHBA 3S9DB 4PJGA 1UACL 3QEUA 4ABMA 5TDPB 2F8VA 3TN0A 4M6NL 3WIIH 4Z7AA 3G5YB 4HEME 1NGWB 2HFFB 3L74H 4PTUA 3DJRA 2N7BA 3M7MX 1Z2KA 3GO1H 1BECA 4ENZA 1RZPA 3SDCC 3TWCL 1T66D 1OAYH 3HJEA 4ZNEA 3K0WA 2Z65C 5TH2A 3ULUF 5GGTL 4JZGA 4M7ZB 2PYFA 2V3DA 4LIQL 2AMUA 4N85A 3WKPA 2E5EA 1HAUA 2BSEA 2DQGH 2EEAA 3U46B 4NM4L 3ECUA 3WN5B 3EO9L 4AYSA 1A0QH 5CJXA 4ANUA 1UXLA 3HZ3A 4P9HH 4DKDC 1OPGH 1YMMA 5E79Z 1VJSA 1U3HA 1NFDB 2JELL 2YJLA 3DX9B 3QWRD 4WWNA 4WDIA 3WFBL 1QG3A 4Y2DB 3CCRV 4BQCA 4B9ZA 2HRHA 3FUEA 3QP3A 4PLOB 1EH9A 5EPMA 3ARDB 1FO0B 3CJHA 3QDGA 4UCFA 4ABUA 3K59A 2NY5H 5C9KA 3WIHL 5JPMA 4OZIE 3GSNB 3K4AA 3TS8A 1M6OA 2K1MA 3DYMA 4N8UA 1R4XA 5C0GB 1K72A 1VIWA 3QVAA 2HEPA 1RURL 4L37B 3DC5A 2ADFH 2AERT 1I1AA 3BEHA 1UUNA 2F68X 3GMLB 2ILMA 4FMKA 4PV1C 4E2OA 5JOPE 2QKIC 1QBMH 2VM3A 3O3EA 4IU3A 4FA8A 2VLKE 1PNLA 1LEIA 2XVLA 1W0WB 4O00A 1FORL 1AFVL 1S7TB 4IIZA 2OYMA 2IALA 3S5LG 1NC2D 3CXCU 2VE6A 1KWKA 3AG3C 4YSSA 2CGYA 4M5SA 1GIGH 3BP7B 3VD4A 1FS0G 4JANB 3DGGB 5C0JA 2VDKL 1M2OA 1J5HA 2ZR3A 1E4XL 2YBRB 5SX5K 2W9DL 1SOQA 1T1WB 4TSBH 3TJEL 1QW9A 2HUEA 2PWHA 4JAUA 2FSEB 4I1RA 1E4XI 5CBEA 4A2DA 2EVFA 2BVTA 1MUJA 4PJBA 5CZVH 4AVKA 2I24N 5CA0A 5BOPA 2Q67A 3FHEA 2AXGB 5CP3A 3ISWA 4HWUA 5I0VA 2YFOA 3KWVA 3MRDA 3QEQB 5BMVA 4XBEH 1KYOK 4MKMA 4IBSA 4C4UA 3ETBF 3QW9A 3V4VL 1D5XA 3CRAA 4DCQB 2ADPA 3RWIA 2MHAA 2YEQA 3BAYA 1PG7W 5AL8A 1SYSB 2Z9TA 4L29B 4WIQA 5CSZA 2Y69C 2FGWL 4NNYA 5KTEL 3RWHB 2G0KA 2Z0UA 2Y06H 4N2FA 3TBCA 5D2NB 3VVWA 2F23A 1IVLA 3NEOA 2BSRB 5JHBA 5D70H 1NKGA 3D08A 1DBBL 1SMAA 4QHNB 2YDEA 2BCCH 5AZ2H 2BWDA 3HKDA 3L2LA 3ZHNA 1NC4D 2ZICA 1H8EG 5LQBH 1L7IH 1J0YA 3V95A 1FLRH 3CZGA 3LDBB 1T1WA 1JYWA 4X50A 2JB6B 4L9DA 2XKNB 4KY1L 1LO3L 4TV9B 5DHDA 3I3EA 3IFPB 1SS3A 2EZPA 1A6ZA 5A2IH 1TCRB 4XWOC 2LW1A 3K57A 1D2OA 1SXSA 4KNUA 1TZGH 2Y5TB 2DICA 3QDJE 1B0RA 3T1WA 1KUQA 4LOFA 5AWNH 2C7UA 3VXSD 2ZKHH 4FZEH 4X8JB 3GRWL 3H3KA 5CJQL 1LUWA 1KMIZ 3IF1A 5J2TA 1ORQA 2JLLA 2OCHA 3CE2A 4W81A 4HMEA 4HW6A 5I74B 4JE0A 2JS5A 1SXAA 2G60L 4Z7VE 4P2RA 3K5MA 1U8LA 1WZ1H 2YUVA 5HY9A 4JTAB 4YHPB 1AY1H 5HGBA 4XP5L 2F54B 4JM2C 2O6FA 1UZGA 4N2HA 4DN4H 1JZ2A 2OKMA 2XICA 2NY3B 2NNCA 3OKLA 5L8KB 3A0OA 3QVNA 5I8OL 1EZSA 5GS3A 4ZTEA 2EDFA 2YAMA 2HJKA 4OW6A 1AKPA 2VN7A 5ALCL 4DN3L 3OEEG 2A6DB 3WDHA 1IAOB 1ZHNA 3PL6D 4NVPA 5FA4B 4O2FA 5AW6B 5T1KA 4HCIA 4PJEA 1JNHB 4CSTA 4EUPH 2YEZB 1CICA 2P8LB 4EFBA 4WO4A 2YN3A 3ILEA 1IAII 5IVOA 3PGFL 4HJUA 1OXYA 3W7TA 1GYVA 4X5PA 3O4LA 3RGHA 4HK3J 1C9SA 1NGZA 5D2NC 4ES8A 5JYLA 4P46B 3CXDH 2XCMC 2PPDA 2H0PA 3EO0B 3MMEB 4GSDH 4S11A 4Z7NE 5HYIA 1BF5A 1ZV2A 4G1EB 4TVPH 1G0XA 3QEGL 2OBGA 3Q3GA 2VR9A 2IMMA 1QBZA 1NGYB 2F7RA 3OGOE 4FULA 1UEYA 3MNZA 4MVZA 1CC3A 2ICES 2Q7YA 2QSQA 3VFSB 4D9QD 3BPOC 3PGCA 5C0DA 4RO2A 4FZ1A 1ZWIC 1IQDA 4XGZA 3BEVA 5CNHA 3BSHA 4EJ1C 2GTWA 4JGNA 4ZX3A 3SGDH 5JIKA 2WSDA 5CINH 5HP5A 3PWPA 5A16A 4P57B 2GTAA 5E8EB 2K45A 5FCUH 1OSEA 3TBWA 1S76D 4PJ5B 1U3HD 5I6XB 4IHJB 2XZZA 2BM3A 2DQIH 4JI8O 2CAZC 4MMXB 4YR6B 5E6ID 5FL7G 1CBVL 2DWEC 2YEZA 5EU6E 3N1QC 1W0YT 1XGPA 2EDYA 2ATKB 3K72A 2H8PA 3RGBA 2D3JA 4LQ1A 2H2SD 5F6IB 5AOIA 2D7QA 1NCHA 4L9LA 4BFJA 4CAGA 5FK9A 5EO1B 5JOFB 4WNQA 1UT2A 4B0MM 2X9WA 3KS0J 4I77L 4K73A 5E2WH 2JQAA 3W38A 1B9KA 3AAZB 4N0UA 4OAWA 3ARYA 2C9XA 3CU7A 4H8QA 3PGDB 2P6JA 3I6GA 4A7SA 4BFNA 5KYYA 4KDVA 4NZUH 4QI3A 1T66C 1TZHA 1KXVC 3NIGE 4DERA 2HJLA 5DURD 3WIFA 2PCYA 3CZJA 4APQC 4P4RB 3AG4C 1LWHA 5JORA 1NMBL 4KTEL 3FPYA 3JTTA 4OBRA 1RUKL 4L3CA 2VLJE 2LE9A 2QVKA 3OSKA 4X5LA 2ATPB 3RWFA 3QEQD 4XPTH 5C2UB 3MA9H 1HK6A 3KHQA 1I3GH 3F83A 3LKPA 4G8EB 1IC5L 4BH7A 1SQPH 5AALA 2AEWA 5HDQL 2FT8A 2JWYA 1DE4A 2GC7C 5D5PA 5ABAA 4B3EA 3IGAC 1T1ZA 2DLTA 1WBXB 2OR9H 4B53A 2H6PB 4FEMA 4PRPE 2X41A 4BZ1H 1KEGH 1R5WA 3OTFA 1RULH 4LCYA 3RYCA 2E6QA 5I24A 2ARJQ 2CLZA 4Z7OB 2FBJH 5KG9A 1THAA 1T7ZA 4RGMC 1D7BA 1T7YA 4LHUB 3U4EB 4ALAL 1F3JA 1A32A 2NQCA 4MXQD 3HCVB 1KB9F 1NCIA 4JFHE 4MNQA 5KYYB 2NOYA 3QORA 1XHXA 4YBQD 5L0QB 1TTCA 1KXQE 2DJ4A 1HHIA 2VL4A 2Z64C 1BJMA 4HUXA 4JKPL 1CDJA 4DO5A 3B9KA 5F7BA 2FLRT 4V11A 1K3ZA 3I50L 3W7WA 1KXQA 4ODTL 4CH3A 4L3CB 1S7XB 1D5ZB 4TSAH 1FJ1B 2FBRA 4JKPH 1JA8A 2Q5ZA 2YAHA 1C5BL 2LJ2A 2BW5A 1ND0B 1V9PA 2ATPA 4G6AC 1AMXA 3X1NA 3F5WB 4HFWB 3BFRA 4U1MA 4WEUD 2QEXV 3TETA 2MEJB 1MWOA 4Y9GA 5BS0D 3SKUD 3LCYA 4YJ3B 3D5OF 5D7LD 3RIAF 5CZXD 1A9EB 3LPOA 1OHZA 2HT3D 4TQFA 3QNEA 2XXGA 2Z31D 3KD4A 4BZ1L 1IU1A 1TQBB 4U31A 2AABL 1VFAA 3DBSA 5GSRA 3JTSB 2H47C 4YUEL 1SVBA 2Q6AA 5KJ4A 2APXA 5IV2B 3LVEA 1HNZB 1Y1UA 4S2SB 3VWJB 3HC0B 1JE6A 2UXXA 3D18B 1QASA 4PGDB 5I0YA 4X1KB 4Z7OF 3TBYB 3L95A 1Z2GA 4HZLB 2B59B 1TNMA 1ACYL 1HEZB 4U1LA 4FHBD 1RUKH 4HUXB 5TE6L 4TUJB 4UQCA 5B7FA 3CWBH 1WO2A 4NQXB 2BOCB 2F19L 4URKA 2AVFA 5C9JB 3B1TA 2JJSC 1U2YA 3SQOH 2VQ4A 4JFPB 5IMLB 1G5GA 2XA3A 3ZMSA 4DQOL 3QDJB 3W7SA 2L7JA 4OKVA 1UCBL 2H1PL 4WDIB 3S36X 2EH8H 1DQDH 2BY2A 3SDAA 4XNYL 2B15A 5JIQA 5LOVA 5ISZA 3MV9D 4JRXD 3J81N 1DZBA 1HX0A 3H0TA 3ROOB 1HSAA 3BZFA 3TZVA 2APFA 4G1MA 4LO9A 4YNYA 4P49A 1N33B 2X3BA 3NIDF 4XPGH 2BP8A 4NRYB 3GSQA 3T71A 3AGVA 1FKAO 4OF7A 4UOW1 5EORL 2YS8A 4DV2O 4H4NA 4ZZKA 4Q7DA 3WEOA 5LP6C 3LSUA 2DQDH 4WTXA 2PW1A 3MO1A 4HOXA 2DQIL 4X5RA 4OPAA 3SO5A 2O5NA 4IRJA 5FCUL 3JVFC 2D3LA 1H8SA 4L8CA 2ENPA 5C0BA 1ENVA 4CBPA 2CTQA 3ZTJH 3EXLA 4HKJB 2IH3B 4Z3FA 4ZO9A 2MOVA 3QCUH 5EOCL 2HRLA 4YIPA