3ABMB

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3abmB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3abmB02
4YSUA 1AS8A 2FQGA 1SDDA 1EHKB 3NP4A 3SBQA 1VLXA 4A2DA 1W6LA 1RKRA 3PAUA 2FT8A 8PAZA 1KCWA 4KOBA 3NSYA 3HEIB 4WKXA 6PAZA 1NIEA 1OOWA 1WA0X 3NJLA 3AG2B 1JZJA 1AIZA 2PCFA 2YXVA 3ASOB 3QJTB 3S3BB 4CSZA 3QJUB 1NIDA 1PLAA 4DPCX 4YSCA 2N0MA 2VW4A 3QPKA 3UADA 4A2GA 1V54B 5B3SB 3PPSA 3TBBA 4TXVB 4NERA 3IE9A 4YSSA 4YSPA 3NJJA 1AACA 3EF4A 3KW8A 4G7SB 4GXFA 2IDSA 3PXLA 4KNTA 1IKOP 2CAKA 2X87A 1X9UA 1OCCB 2AANA 1KCBA 2XVBA 2BP0B 2GB2A 4EF3A 1SFHA 4KO9A 2AZUA 2J56A 4QLWA 3S8FB 1JXFA 2OCCB 5B1AB 3OD3A 4A68A 3WKPA 2HX7A 2FNWA 2GC4C 3QJVB 2DWSA 2PPDA 5TK2A 4YSAA 3N55A 3FSVA 1E5YA 1NICA 1ZIAA 3SBPA 2QT6A 4DP8X 3AG3B 2YQBA 2BWDA 1M57B 1A4AA 2PP8A 2Q5BA 4Q8BA 3GDCA 4G7RB 1GS7A 4N8UA 1V55B 1IUZA 3NJNA 1WS7A 3FU7A 2IWEA 1CYXA 3UABA 1MG3C 3NSDA 4YSDA 2GC7C 2Y69B 1IC0A 2VM3A 3IEAA 2DYSB 3NJGA 4GP4B 2H3XC 1A8ZA 3BVDB 1BXVA 1BQRA 1E67A 3EH5B 2W88A 2XV3A 4A2HA 2YAEA 4DP1X 3NP3A 3AZUA 2HLEB 3S8GB 1SNRA 4A66A 3T9WA 1ZDQA 4NAJA 2HX9A 5I6PA 3V9CA 4F2FA 2UXFA 2EINB 1YLBB 1BQKA 1BXUA 3NJIA 4AKQA 5I6KA 4NB7A 1X9RA 1AG0A 1ILSA 3ABMB 5B1BB 1JZGA 3RYMA 4E9SA 1XB8A 1AR1B 1A4CA 2XXGA 2W8CA 9PCYA 1J9QA 3OMNB 1CUOA 4YSOA 1V10A 4KO5A 1AQ8A 1GS8A 1OF0A 5I5IA 1HAWA 1A3ZA 5B1JC 2CALA 1KDJA 3ABGA 5B7MA 3N2JA 2JXMA 4E9QA 1BYPA 2PPEA 4KNUA 3ZIYA 4AZUA 4YSQA 4W9ZA 5EHFA 1E5ZA 2UXVA 4AKPA 2PPCA 1DZ0A 4A67A 2A3TA 7PAZA 1AANA 2PPFA 3PCYA 1SDDB 2TSAA 5AZUA 2FT7A 1RZQA 1SHXA 2IDFA 1L9PA 1PNDA 3WNJA 2EIMB 4BDVB 1ID2A 3ZDWA 1ASOA 1GS6X 2IH8A 1WA2X 2GIMA 1CYWA 5B1JA 1AZUA 3EH3B 3X1GA 5I26A 4RH4A 4UAHA 3SBRA 3ASNB 4ZK8A 2VSMB 4HHWA 2QDWA 2AZAA 3X1FA 1L9OA 2PLTA 1JVLA 1URIA 3MX0B 5B1KA 4BXVA 2UXTA 2Q9OA 3FSAA 4BWWA 4FAAB 1JXGA 1SF5A 3QQXA 4UANA 3SQRA 3WKQA 1NWPA 1TKWA 2H47C 1QLEB 1L9RA 1HFUA 1JZHA 2BP8B 3TBCA 5LDUA 1UATA 1TEFA 2NRDA 4DP6X 2XXFA 1OV8A 4CSPA 5D4JA 1BXAA 1L9TA 3CZUB 3UAEA 2I7SA 2VW6A 3NT0A 3QJRB 2VM4A 3NJFA 3HB3B 4DP5X 4UF7C 1AAJA 1ETJA 4W1TA 5I5MA 2VW7A 3FYIB 1GSKA 3AG4B 4GYBA 1NWOA 3FPXA 4YSTA 2B3IA 1BAWA 3NYKA 6PCYA 3T6ZA 3OQRA 2BZCA 1OE1A 5B7EA 1W6WA 4X4KA 4DPBX 4DP4X 1TU2A 3UAAA 1ZV2A 1KBWA 1GW0A 2CBPA 1ET8A 2HRHA 3G5WA 2MRYA 4HCFA 2ZONA 2ZXWB 2IWKA 1AS7A 1OCRB 5ANHA 2XUWA 1J5CA 4DP9X 3DTUB 4P5RA 4AKOA 1XB6A 1XB3A 3T6WA 4BWUA 2FWLB 2CJ3A 4PAZA 3AW5A 1J5DA 1L9QA 1CC3A 2VN3A 2XU9A 3T6VA 2E86A 2PP9A 4YSEA 4JHUA 4E9VA 4AX3A 1KDIA 2IDUA 2BP0A 3PAZA 1ZDSA 1WAEA 3CVDA 3FU9A 3FYEB 1R1CA 4HIPA 3AY2A 1N68A 1NZRA 1E65A 3MBWB 2I85A 2WO2B 1NINA 4YSRA 2HXAA 4M3HA 1XMEB 1OE3A 1GR7A 3FS9A 2I7OA 3H4HA 4HALA 4JKNA 1AG6A 4DP2X 4BWTA 2FQEA 1NTDA 2PPAA 1T5KA 2IDTA 1N70A 5AFAA 3TA4D 1WS8A 1JZIA 1F56A 2YAFA 3FU8A 5I6MA 4FA7B 1J9SA 4YVUA 5I6LA 3X1BA 3NSFA 1ZPUA 1TEGA 2HX8A 1FA4A 2PCYA 4YL4A 5PAZA 4F2EA 2FT6A 1IBZA 2HZHA 1CURA 2DY2A 1NDTA 3X1EA 1SJMA 1NPJA 3GYRA 1PCSA 2IH9A 2J57A 4M4RB 3UACA 1SFDA 3FQYA 3DKHA 4HCIA 5I28A 3FQ1A 4DPAX 2B08A 3NSCA 1W8EA 4GP5B 3PAVA 2YARA 1ILUA 3BQVA 3D12B 1PNCA 4Q89A 2GBAA 5TK4A 2XYBA 3OM3B 1M9WA 4E9WA 1AZNA 2P80A 3JT2A 4BK5C 3FQ2A 4G71B 2OJ1A 3IN2A 1B3IA 1PMYA 2OV0A 1PAZA 2XLLA 3CDZA 2UX6A 4DP0X 1KBVA 4WTQA 2QDVA 2IAAC 3CG8A 3GXUB 3PLYA 1DYZA 1AOZA 1OCOB 1KGYE 2XX1A 1MDAA 2MTAA 1IBYA 2FQFA 2UXGA 2R7EA 2BWIA 5A7EA 2XWZA 4YVNA 2ZOOA 1MG2C 4BDVA 3ERXA 3TU6A 2XV2A 1AZRA 1BYOA 2TSBA 2GSMB 2YEVB 5IY5B 1ADWA 3V9EA 5I6OA 2AFNA 1ET5A 3NJKA 2YXWA 4L0PB 1AZCA 1SF3A 2VSKB 1BEXA 3T6XA 1BQ5A 3DIVA 1EZLA 3IBOA 3FU7B 4KOCA 3WIAA 4G7QB 2YAQA 3WNIA 3CVBA 2H5UA 2JFCA 1GYCA 2BP8A 4AI7A 1J9RA 3C75A 4A2FA 4E9YA 5PCYA 1A65A 1JZFA 2FJSA 2QPEB 1HAUA 1AZBA 3X1NA 1FFTB 2BZ7A 1A4BA 1E30A 1JOIA 2YAHA 3WG7B 2EILB 1PZCA 4QKTA 4P5SA 4ENZA 4HZ1A 4G72B 1OE2A 1GY1A 1WA1X 3QJQB 4KO7A 1PZBA 1PLCA 2UX7A 1RZPA 2HRGA 3QJSB 2GI0A 3U25A 2CCWA 1KV7A 2BO0A 4E9RA 1QNIA 1SHWA 4F7KA 1MZZA 1PF3A 1NIBA 3ABKB 2DV6A 3H4FA 2WSDA 1JZEA 5E9NA 3OMIB 2FQDA 2Y1AA 4KNSA 1PLBA 1RCYA 2XV0A 3UGEA 1JERA 1NIAA 2GHZA 3CVCA 2LLNA 4E9TA 4GP8B 2XX0A 3FSZA 3H56A 4MFHA 3FT0A 3NJHA 4K9JA 3ABLB 2VMJA 2YAOA 3EH4B 3ZBMA 2RACA 2BW5A 4PCYA 3AG1B 3TASA 1M56B 2IDQA 1FWXA 2BHFA 1I53A 5F7AA 1AS6A 5AKRA 4HHGA 3S3CB 3ZX1A 2X88A 4BXSV 4DP7X 1J9TA 2J55A 2J5WA 2JKWA 2DYRB 1JVOA 3X2QB 5D4HA 1ET7A 5D4IA 1ASPA 3KW7A 1QHQA 2IWFA 1NIFA 2ZWNA 2YAMA 3IN0A 2YAPA 3OMAB 1ASQA 3FSWA 5B7FA 3JTBA 1PY0A 2EIJB 2BW4A 1MZYA 5I6NA 3S3DB 1JXDA 2WO3B 3CDZB 3EHBB 3NJMA 2EIKB 2CUAA 4GY4A 4E9XA 1KYAA 1GY2A 2AVFA 4G70B 1L9SA 5I5JA 4HCGA 2P80D 4A2EA 3WI9A 2FTAA 1ZIBA 2DWTA 3FPYA 4KO6A 5F7BA 3T71A 5FC9A 1PZAA 2R7EB 1OCZB 4N4YB 7PCYA 3L45A 2PP7A 1NPNA 4HAKA 2QPDB 4JHVA
chains in the Genus database with same CATH superfamily
2WBWB 2FQGA 1LO5B 3QUXD 4YY3O 1KT2A 4JZJC 4WI5A 3FD9A 4XCEB 4YDMA 3VFOB 1YMMB 2GJ6E 4QXUL 5K39B 2EH7L 1AI5A 4TVPL 4XVUD 1RU9H 4POYA 4IU2A 1AFVH 4M6OH 4JANA 4R8WL 1NTZH 4EDWL 2BY2A 4MT8A 2JF1A 3OJVC 4GI6A 3ARTA 3NRFA 5IMOA 3HRZC 3DXAD 3QYCA 2G60L 4ELKA 4DR2O 3FQWA 1NAMA 2F0CA 3EJCA 5DD3H 1Y07A 3G5VA 3OB8A 1ECYA 1YN7B 2CM6A 4JX0A 4JTCB 2P06A 3FBKA 3I9IA 4TQDA 2J1WA 4LFCB 1KBPA 4Q58C 3RBGA 5EWIH 4GLXA 4LF8B 1N8OE 2GKIA 2X1XR 3HN8A 4JPWH 4K2UH 1L0YA 4QF1A 5C08D 1ADQL 1L7IH 4PMEA 1H3TA 2P5EA 2IJHA 1Y18A 4NP4H 3T1YB 1SESA 4HGWA 4F7CA 4EUPB 1UZ6E 1YDPB 4JI5B 2R69A 1QO3B 2NXZD 2NR6A 4DR4B 4DW2L 1AP6A 1X5GA 1QFHA 2AQ1A 1OCRC 3HKDA 5A9GA 4FLZA 1YAZA 2BINA 4DAGH 4YDVB 2IGLA 4P2OD 5C0FB 5L2KE 5KYUB 4DZBA 1O6VA 5AB9A 4ICGA 1ZVHA 2WWKO 3HMXA 2FNWA 3MRMB 3S88H 1GPOH 1BM7A 4UTAH 4Q2ZA 2NZ9D 2QFPA 4E41B 2C5DC 1XUQA 4LH6A 1YJWV 5EZPA 2G5UA 3C2AH 3JV4B 2DIEA 2PYFB 2I69A 4U1GC 3HS9A 4ZI7A 4JG9A 3U4AA 2JLPA 2LAGB 4WEBL 5TDPA 5I0YA 4HKZB 4KHTL 3U7YL 4Y2DA 1KLFB 4UUJA 5IEKB 3H9ZA 1I8MB 1E7UA 1WS7A 1MFCL 3QUMB 2X3AA 1D9KA 3MKGA 2QM8A 3DJRA 2NW2A 3NIGF 3MRIA 1Z1WA 4F7TA 2BNQD 1DQIA 2EDRA 1BQRA 1QRNE 2NY3B 4FFBB 1XV8A 1YMHA 4A2HA 3MJ8A 4N8VA 4JPSA 1FVCB 4FQ1L 2CLVB 2ZX7A 2A6JB 5LXTA 4P4KC 1QKZL 3CMAV 1M05B 4PJ8D 2QL1A 4NAJA 4U1JA 3BPCB 1XH3B 2X9WA 4C59B 5KSBB 1R3HA 3QI9B 2YA1A 1BQKA 4I9WA 4NC1C 2B0SH 4D9RD 4XP9L 1YEIL 3L2NA 4R4NC 1AI4A 3WAKA 4LWSB 5ABAA 3CFKA 1EJ6A 1KLUB 4F7PB 2XOTA 3LDBC 4PIBA 2EEDA 1J9QA 1I9RL 2LLLA 3IMUA 3S96A 1J5OL 3LKOB 3OB0H 1BD2E 4N1HB 4PS3A 3QS2A 3F58H 2ZD0A 2F74B 3P0YH 2X2IA 5HHPA 5KVFH 4RQQB 1MCPH 3BDYH 1UD5A 2XZAL 4NN5C 2CALA 5IESL 4GG6E 3H3BC 4WLCA 3TO4B 3ZMRA 2A6KB 4JDTH 4M6AA 1UEYA 1DBJH 4O00A 5ENWA 1NC4D 5JQGA 2D4FA 5AWNL 4MTFA 3IS1X 2A3TA 5GGSA 1LD9B 4HEMA 3L8QA 4ENEC 4F9LC 4QRUA 1PFOA 2PPFA 3VFPB 2GT9A 1F7YA 1XZ0A 1A3RL 1RUAL 2H6UA 4PJCF 2DTMH 3Q13A 4GMSL 4MDJA 4K5NA 5TE4L 3DK2A 1FV1A 3V55A 4WZ9A 1GM9A 3GMRA 1SHXA 5ADPL 5DEZA 5JQIB 5L0QB 1RP3B 3D69B 4Y4HB 3HR0A 1UWYA 2WXGA 3L3KB 5IVZA 5J1SC 35C8H 4FNQA 4UBDC 1T6WA 1T66C 3K6OA 3SKMB 3DX6B 4QAWA 2LW1A 2XWXA 3AAZB 3S36L 3TP4A 4ODVH 1CICB 2XN9B 3MGOA 5LCVL 1UM4L 3DV4A 3HPLC 4XO9A 4ZK8A 5J6HA 1FH5L 1CF8H 1OAKL 3K80A 4D3CL 4H1LH 1IMHC 2X7RB 2APVA 2P24B 1VRSA 5DZPA 1JVLA 1R5IB 4LPTA 4GAJL 3IDUA 2NSMA 3B9EA 3F2LA 1Q90A 2DQUH 3U9PL 3ZMVA 3WUZA 1DCEA 1JRHH 3NPSC 1BAGA 1SOXA 5CEZD 3NZUA 3QRBA 4FK5C 1MCRA 2YZ1A 4NZTL 4JO2H 3OAAG 5IBUG 3B7YA 4Y4KB 5DQDH 2G60H 2Z7UA 4HK0B 4NBZB 5BQ7B 4HS6A 2B16A 2B9BA 1EHLH 3RVZA 2X4TB 3FMGH 1TEFA 1O7VA 4KI5C 4N0FB 1F90L 1JI1A 4X6CF 4ZAKA 3I55V 4QCIB 1J05A 3FF8A 4TVPE 4YS4A 1VCBC 2M83A 4L3CA 1FFRA 4X4YB 4Z7WF 4IRZA 4YDLC 4NGHL 4JFQA 3EO9L 1G9MH 2C9PA 2RBLA 3NIDF 5A16B 2I7SA 4AE0A 3D7PA 4IKJA 1J88A 2NR6D 2B1HH 3PHSA 4DP5X 1CDIA 2J21A 3IDYC 4GAGL 4KV5E 3S35H 2F8IA 3PDOA 4YHZH 3W0WE 3T6ZA 2Q7NA 3MOBH 4XXCA 4KRNA 1TSRA 3FH7A 5B7EA 1OALA 3LHPL 1FD9A 4M7KL 2BVOB 3S6CA 5JW3H 2FJFB 1NZ6A 5EZOL 3D0VA 1QFWH 2WYZA 1S78D 4I0CC 5GGQL 1TLKA 5IMLB 1UCTA 4KRPC 4K8RL 3LZOA 4FQ2L 4NQEA 3TNMA 2ZSWA 5DRWB 2JRIA 1OV9A 5BNXD 3QWQB 4OFYA 4Y2DD 3DTUB 3V52H 1LYQA 3WEXA 3L3HA 3Q2CA 1UD4A 3GPSA 4BWAA 4CNIB 1NJ9A 3T1HB 3G9AB 1D9KD 3KBEA 4LF7B 1JCHA 3TVMB 1VMGA 1J7VR 3M8OL 4J41A 4UOW1 3ZE0F 1NBZA 4EAEA 2PP9A 3NESA 2GFBB 5FUCC 4FM2A 1TZOA 2IDUA 1P4LB 3CB2A 4CW1B 4EO5A 2UUDH 3UBGA 1HNZB 5GONB 2ODMA 4XC1L 3D1MC 4YUEL 3VTMA 4Y16C 2HTKD 2F68X 1ZA3A 4OD2B 2LJ2A 3C6LD 1E4XH 3RBZA 1COWG 4I9WD 4OLWL 4P5TA 4FIPC 5DVNA 5HHXH 5D9SB 4YK4B 1HQRA 1RULL 5HPMB 4I3RH 3RGVB 1GR7A 2VITA 3FS9A 1TUEB 1N3NA 4NDMB 5CNHA 2XTAA 3WGUB 2DWDC 1D2DA 1NTDA 1P7QB 2YD0A 4GUPA 1T03L 5I9QB 2AK1L 3ABMC 2F53A 4O58H 2D7TH 3K1DA 2JK5B 1IC7H 2E76B 5IV2B 5A6MA 2E6QA 1AJ7H 3P30A 2I9LB 4U7MA 3EXAA 4ZMYA 2MCPL 2EDHA 3FTGB 3NTCH 4B3EA 2O61B 3V4PB 4ELDA 3HNSL 1BM3L 1A7BA 3X12B 1KGCE 4N1CA 5GGUA 1S5HA 4BZ2H 3ULUC 5DGRA 3SDLA 1JD9A 1PCSA 2LW7A 2EKSA 3HI1B 1MLBB 1QFWM 2IH9A 2RMKB 1U8QA 1GH6A 2NNAB 5IJVA 1DBML 2DQTL 2ARJQ 2DB8A 1W8EA 2C3WA 3PAVA 4W9JC 3QUXC 4FYRA 1AHWC 3ARVA 3O9WA 4F58H 3FT3B 5E1QA 1I8LC 1M4UA 2NY6D 3MLVL 5LDSA 1Z5WA 1LE9B 1DTUA 1F6AB 3GF8A 3FUJA 4PHZA 2CUIA 3UMTA 4N2NA 5EBWC 3ML9A 2WVVA 4AK1A 3GS4A 5I16B 2FB5A 1HHGB 2CKNA 4NQVB 2C9UA 1Q90D 4G6ML 4NWTL 1KU9A 4P07A 4X20A 4QNHB 4OGYL 3DPBA 4Z7QE 1Y74B 4GXUN 3MV8E 4GAJH 4Q97A 4I2XE 1SYSA 2O6EA 1YEFH 4H13C 3WB1A 3WL9A 4MNQA 2H0FA 4J3BA 2LGNA 3B7TA 3FQUB 2UYLB 4ZAKD 5ILTH 1JFHA 4OZIF 2VIRB 1NCNA 2WQRA 4XMZA 3BAEL 4JPKH 3GZPA 4CDGC 3WNOA 1KB3A 1KXHA 5DS8A 4IBZA 3UTTA 4YJ2B 3O11A 1Q94A 1NFDA 4R84A 2CPUA 3JALB 4LGPB 2WLKA 3DJ9A 4QXWA 3RURA 4X62B 5LYJB 2XV2A 3FN0L 3L5JA 4DKTA 4PP2A 2EUVA 1I08A 1OAQL 3U1QA 2A77H 2ZUTA 1HHIA 1YEEL 1LO5A 4D9QE 5H8DA 4XCEA 2VL4A 3Q8BA 3VFOA 4B08A 1ADWA 3ZY7A 1IBFA 3HBPA 2D03H 4GXVH 1R5VB 1YPZA 2DWEB 4FFYH 4RWYL 3K71A 3BW9B 1Y6MR 1QW9A 1SF3A 4LSTH 3CXHJ 1TVKB 3VWKB 1U3ZA 2NDFA 2FYYB 5FCUH 3KWXA 3UAFA 3D09A 5G5DB 3DIVA 5EF1A 1WZ1L 3RT3C 2D3JA 4JKLA 5C6TH 2ZIOA 1ETZA 4NQED 1NLDH 2WIIB 3HR5B 1SHSA 3B2UC 5GGQH 1MHPL 5AW9B 1YN7A 2WTOA 5MP6L 5J2TB 1QWUA 4MJ4A 5HGDB 2DMXA 3NSXA 3T2NL 3VH8B 4A2FA 4J5VA 1JHTA 1HZKA 4HWEL 2WN2A 1PJWA 2WXJA 2G3XA 2YIBD 2OMYB 5IR1B 2YAHA 2EILB 4LGSB 1CT8A 5AL0A 4EUPA 4DR5B 1JWUB 1YDPA 4IEFB 4GIPD 4H0LC 2YSSB 2OJZH 1OAXL 3OR6B 2H26B 1EDHA 1I1RA 2IJ0C 3FJTA 3FO2B 4YDVA 3RTQB 5C0FA 1UA7A 1UXSA 4ZMAT 4X50A 1WZAA 1PZ3A 4HSQA 2QR4A 1PPJH 3GWJA 3UT5B 1A9BB 1EFRG 3H4FA 1XSKA 2WSDA 4E41A 4GKKB 1HJBC 2BNQE 1GKEA 3II1A 1A6AB 3KLAB 5D93C 2PYFA 4JFDE 3GJFA 4Q9BA 1BVZA 1IFGA 3GLAA 1Z7JA 3GHPA 5IQMA 4G6JL 1EJ8A 4GP8B 4PHXA 2F53D 5IEKA 3BWAB 4CVZB 3CSTA 3MRLB 3QUMA 4IOFC 4OD3H 3EH4B 1I7UB 1NGZB 1ZUQA 2VDNL 2AK1H 3PNWA 4B9GA 1T03H 4NQCE 3CRMA 4ZODA 5CGTA 4XB8A 4QE9A 5CSGA 3BEVB 1CZ8L 4JPIA 4JFVA 1NH2B 2CO2A 3J7HA 5AVUB 5IFHH 2VDKL 4MCMA 1SM3L 1J12A 1FVCA 2CLVA 5DK2A 2A6JA 5C0JB 1M05A 4X88A 5DLMH 4WGVB 3TH2T 2W9DL 1XH3A 4P06A 5KSBA 3QI9A 2JB5L 3SPCA 5K1PA 4WHYH 5HXMA 3V79C 4YXLL 2CK3G 2DQDH 3FB6B 5DUBA 1FO0H 2YAMA 5L2JB 1AKJA 4AGQA 2J1ZA 1MJ8H 5CBFA 1MCCA 5D1XB 5IG7B 1KLUA 1U8KA 1S7QA 3O9WD 1BFTA 3BGFB 3ZKSD 4F7PA 1DBMH 3LIZA 4HS8L 3MUJA 2WYTA 3LKOA 4AYMC 3UEZA 4GO6B 4UTBH 5KYNA 3KHOA 2OA9A 2A4CA 2F74A 2OSLB 2WXRA 3EO0A 4XPAH 4GY4A 1TUBA 1BZ7B 1KB5H 3FUEA 3MLUL 4FQCL 1ZX3A 2CKBL 3UJJL 4RQQA 1GHFH 5AW4B 3TO4A 5HFMA 5I18H 2A6KA 5FC9A 4X1IB 4FQXB 5IB2B 3L5XH 2J5LB 5C0AB 3TO2B 4AY0A 4LBEB 5EORL 1JHKH 4FNUA 3P77B 1LD9A 2XPGB 4ZMWA 4MXWL 3S5LB 5DT1L 4MNQD 4GX2A 3FCUB 3QA3B 4JHWL 5KSVB 3ELAT 3N50A 3VFPA 4RZKA 1F4HA 1MCEA 2V3DA 3CHXA 3MFFB 2FO4B 3PYCA 4HFUL 4BH7B 1RK7A 3MXWL 3UTTD 1QU7A 4X5QA 4Y4HA 3L3KA 3NABH 2VN4A 2NR6C 4GKNA 3BAEH 4NO3B 4RFEB 5AB2A 2DLIA 3SD2A 5CEZE 3SKMA 4ANKA 3DX6A 2AEIT 4ETYA 5ITBL 1EVUA 4LO9A 1I0HA 4K3JL 4ANUA 4U3JB 1YMMD 3EDFA 1CICA 2XN9A 2HVJB 3UCQA 3U2SB 5DWUH 1MRDH 3PP4L 4Q0XL 3V8CA 1MXGA 4AGNA 2P24A 3CH8A 4PUBH 1S7WA 1CGVA 2IIJA 1DF5A 2AGJL 5LNDA 2NTFB 4DQOL 5E1AC 4FHKA 2QWQB 1CN4A 1OB0A 3V6OA 4LF4B 3D18B 4XXDB 3L2LA 1JZ6A 1MW2A 4H8WC 4Y2DC 5D7EA 3H9SE 2V3EA 3DROB 1OARH 3PXLA 5IK3B 3CVHH 1JMKC 4HK0A 3UROR 1B3JA 3QFDB 1C8PA 2X4TA 1IBGH 3EG9B 3QWOB 1D9KC 4N0FA 3KWTA 4KBPA 4HQQH 4QCIA 4LR3A 1RFDL 4X4YA 5A2JH 5LA6A 1NTKH 5K1XA 1RZ7H 1MCJA 3TGXA 1MJ7L 5A16A 5TDOB 5A2AA 1BQLL 2VERN 5JR1H 4AW4A 3O3BA 1BOYA 5GHWH 2PO6B 1GTNA 1R3JB 4PVNA 2MOQA 1YNTA 4PJDF 1P4RA 2QT6A 3MRFB 4HUUB 5E8NB 4TULH 2B2XH 2VH5H 3QCUL 2YUAA 5DK0B 3OXRA 2HWZL 1FNLA 2MFNA 1CU4L 1GM8A 2FJFA 2VXTL 4FTVE 4Z7VB 1WWAX 5C7ZA 1IKFL 3RILA 4E41D 4WGKA 3WSQL 3ZVVA 4D9LH 1ZVYA 5DR5L 4CDHA 4H1LG 5DRWA 5IJKA 4GP4B 2P1YA 1QZ1A 1D5AA 1O7DC 4N0CD 4C56E 2EADA 3B7UX 2W88A 1MN4A 2LW3A 5EU7C 4WTXA 2XWTB 4FRWA 4MD0B 3MAQA 1F2XK 3NP3A 3AZUA 3DO3A 4QHMB 1UOWA 3O8XC 2Q67A 4OFQA 3UBFA 4PWJA 4JO4H 3TVMA 4ZZKA 1OHZA 3HG3A 3V9CA 4AEIH 1K3ZA 4U49A 1S3JA 2ODIA 2GFBA 2NY3D 3HPJB 2VDNH 3IB4A 2VQ1B 5A3IC 1FBIH 1MEXL 3L1OH 1ILSA 3KNBB 5GONA 1QEXA 3VW3L 2ATKA 4P3CL 3ESVF 4ZSOA 1BBDL 5JQ6L 2OMVA 2XZQH 1VKXB 3H6JA 3QI9D 1ZK5A 5FM5M 3A8TA 2SODB 4JF3A 4OCYL 1VEOA 1A6PA 2YA0A 5D9SA 5I0XA 1I4FB 5HPMA 1AKJD 5HDBF 3RGVA 4F15C 2OQJA 2ZR3A 4HIQA 1CFNB 2MPVA 4WCEV 3VI3E 2F8XC 5IQ7H 4NVPA 2FEEL 4KNUA 3APNA 1P49A 4AZUA 1P7QA 2ERJB 4KZ0A 3WXWH 2DBLL 2VLJA 4LPWA 5TPWL 4WF7A 3IDIB 2Q6AA 1YAIA 3DSNB 3KL5A 1HILB 4HF5H 2FB4H 4MXVE 5IV2A 3TO4D 3VD1A 4XTRD 2I25N 1EHNA 3PGCB 2HEPA 2NNRA 1KYUA 4MBRA 2O61A 3V4PA 1FGVH 4L1TA 2ZXEB 3WY4A 2OZ4L 1NKOA 3VXSB 4FNLH 3QDJE 1FC2D 1U8PA 4OIBA 2BS8A 1HNFA 2JVUA 3HI1A 4DR6B 1MLBA 3DX9B 5IB3B 1CGSH 4BBWA 1HNXO 2NNAA 3GBNL 4Y4HD 3I9GH 1L9OA 4HFUH 1XZWA 1UZ8A 4ZYKB 3K5OA 4JW3A 2V5SA 5BMFL 3FT3A 1SS3A 5ICZB 3GBML 1OQOA 1CICD 2XN9D 3K5RA 1LE9A 1F6AA 3SQRA 1NWPA 4D7TA 4MCNA 4RDQF 4R5TA 1PG7X 3UTSB 3FB8C 3VBBA 1IT9H 3ZBHA 1L9RA 1XAKA 3BRGC 5I16A 4EN2A 1SC5B 2PWGA 1HHGA 4BFGA 1QR1B 2VXVL 1E4JA 3KGRA 4Q0XH 5D7KD 1J1OL 4K3EH 3TPUB 5JHDE 1Y74A 3JYCA 5C0DB 3JSSA 5BW7A 4K7FA 5BZZA 4HHAB 5I73B 4Y4KD 2XKUA 1E5UI 4LLDB 4KUCD 3VXUE 1U6AL 4B95C 1JK8A 2C3XA 1S6NA 3FQUA 1QASA 2UYLA 4FXKB 5KBNC 2YC0A 2VIRA 3CN0A 5I1HL 3FYIB 1GSKA 3AG4B 1XVSA 3QZMA 3RYHB 1NWOA 2CO3A 3DX8A 4YJ2A 1KZYA 2B3IA 4M93B 1VGEH 5I76A 1MH5B 5D7IE 2XAHA 4HLZH 1OHQA 4F1ZA 4U33A 1E7VA 1FL6B 4W6YB 4N3TA 2AK4B 4X6DE 1QSVA 2V6HA 1YNLL 3O3UN 4P5TC 3CSYB 3A4DA 1IZKA 1D5MB 4FABH 1RURH 3ESNA 2P5OA 3KJ4B 1TVKA 1IC5H 4LZKA 3VWKA 3TONA 3AJ7A 4OBSA 4OZFG 1BF5A 2FYYA 1ZT1A 3ZRFC 2PXYB 5G5DA 2YD2A 5KVGL 2WXKA 5HYEA 1SOSA 4GLRI 1M57C 1E1RG 1BOGB 1WUZA 2F5AH 2P8PB 2VXTH 3AB0C 4TLTA 3S35X 3HR5A 2J8UA 3OLIA 1QHPA 4J3SA 2VLME 3VQ2C 3CWBH 1ANUA 3OAZH 4E9VA 1EEUA 1Y6XA 2XHNA 5HGDA 5LGHL 3A2FA 3BWZA 3PV7A 2BP0A 4KJQC 5H37G 3VH8A 1NMBL 3NXSA 2YEQA 4WWKC 1GAFL 4XAWH 1KP2A 3TVMD 5F7HA 1R3LB 3HG4A 2OMYA 5FFOA 5IR1A 5E08H 3BP6B 2LVEA 3L3OB 5DD5H 1JWUA 3MBWB 3K0GA 2VDLL 1FIEA 4WK0B 4IEFA 1S5HC 2QVTA 5GSVB 2YSSA 4UAOC 2V0AA 4TQEL 3LNNA 3LQMA 2H26A 1IAIM 4HX1B 3FO2A 1IQWH 4MSWB 3RAJL 3RTQA 1KCRH 3VXSE 2BP5M 4ZO8A 4PGJA 5I0VA 1OF2B 4AHCA 3LZPA 1R5WB 3UT5A 5JORB 1T5KA 3IC7A 3HG5A 1N70A 3N44F 3RGVD 3NIFB 2OP4H 3X2QC 1H3WM 3U0TB 1A6AA 1OKEA 2R51A 3KLAA 4L3EE 4LDEB 4LKXB 1SMOA 5GRVL 1KY6A 4YVUA 3I75B 1P7QD 5CA0A 1YUHA 4NENB 5J0BA 4HWNA 1A32A 3BWAA 4U31A 5IF0B 2ICCA 2CCLA 4JRWA 4RMUA 3HTLX 1YXBA 1G6RB 1I7UA 1NGZA 4S1SL 3B4SA 1E6OL 4ZD3L 3NCYP 2MPAH 3MMEA 4FHJA 2F4VB 2EEXA 1D5XB 3BEVA 4HCIA 5GS3A 5B66Z 3TTSA 3B43A 1N0JA 2V3FA 3VSUA 5BS0B 2C9QA 3ZN6A 3QQ9C 3RWDB 4P48A 3BFOA 4RGND 3PQYA 1K73W 4QAMB 1CPUA 1KZQA 1W8NA 1ZY9A 2WTRB 5BVJA 3EFFB 3LEXB 4UQ9A 2GTWB 3KPRE 5TK4A 3VSVA 4EZJA 3FB6A 1U4EA 4BZ1L 1XFPA 5D1XA 2L7JA 2VN7A 4WI3A 1ZLSL 4NUQA 3HHMA 4MAUL 3W9DB 4G71B 1IX9A 4NZDA 2X05A 2HN7B 3V0VB 3N40F 4J3VA 4JG1H 3GK8L 2MCMA 5E99L 1BE3H 1PTZA 1BZ7A 2DLGA 3GBMH 3PHOB 3MACL 3P9MB 3K0DA 4LVEA 4FYTA 5CZXD 1IC4L 2DKMA 2MTAA 5BR8O 2QQKH 3IPBA 5B39A 4RMRA 3MRGA 3TEZA 1BEYL 5CIPB 2QKCA 4FQXA 3ESMA 5IB2A 3IFLL 5C0AA 3TO2A 3D8MA 4LBEA 4G5AA 2ICWA 3IU3B 3P77A 4MA8L 4LFAB 4BDVA 4ZUSB 2XPGA 2JCCF 2ZOTA 2Y7NA 3LH2H 3QA3A 4XP1L 4BZYA 5KSVA 4FZEL 2GSMB 4TV8A 2WUBH 2BY1A 1QR8A 5GISL 5IJCC 3KPNB 2BK8A 3MFFA 2FO4A 5E5UB 4YEFA 4N2OA 2CH7B 1ET5A 3DX7B 2B1IA 4G5ZL 5CJOH 5L8JB 2OSXA 4LHUG 1LO4L 3C6SB 4LSUH 2HKOA 2R4SH 1N34B 1T0OA 4NO3A 4RFEA 4QHNA 1V7NL 4XVOA 4F1SA 2WYIA 4WHYG 4U3JA 3GMQA 5D1QB 2XV6B 4NJAH 3AU0A 4QPKA 3CVBA 4P23B 3BZ4B 2JFCA 1GYCA 2A9CA 4M3KB 3VWKD 2VDOH 1JTPA 3CSFA 1OCWL 4PJ9A 5ECJE 1BQZA 2NTFA 2CTRA 1U2CA 2ZXWC 1N8ZB 4KXRA 4GO8A 4N90E 2RA1A 1JR9A 4WO4B 1CR9L 3D18A 4JAAA 3D05A 4OCSL 1KYDA 4XXDA 3IETB 5FYJU 3DROA 5IK3A 4Z8FL 2BWQA 4J7JA 4YJ3A 3GKWL 3CC4V 2X4PB 1A7RH 3EFOB 3EG9A 3BGMB 2WCSA 2GJJA 4HPOH 1I8UA 1DR9A 4N2MA 5EZYA 3M99B 2OAAA 4FQLH 2JKRM 2IPTH 4ORGB 2A4EA 4RMQA 2NY3C 4G6KL 4P4RA 5DD6B 4QKXB 2AJ3B 4J11A 5GS0D 43C9A 1QVGU 1T1ZB 5AZ2H 5I8KL 1W72B 1RHHB 1Y1UA 1DUYA 1RSOB 1HNYA 2WXMA 4FC3E 1LO3L 2PO6A 3RQ3A 1R3JA 4R7NB 1BCIA 5IFAL 1NGWB 3CSGA 3HI5L 3MA7B 3QI9C 5E8NA 3MRFA 5AVTB 3RTQD 5HHQA 2CO6B 2JDIG 3KVDD 3EW3B 4WFGA 1BJ1J 2DEWX 3DX3A 4JFEA 5EU3B 3EYUL 3BOVA 2IQ9H 3A23A 5IROD 4Z7VA 4K9JA 4OSUL 2FO8A 3H7BA 1J0IA 3CX5F 1QATA 1WZLA 3LNFA 3VDBA 2BX5A 5AB1A 1G0XA 4ELMF 2JEUA 1RV6X 1PBYA 4M1DH 4PCYA 1RUQH 3OUSA 1HINL 3QTCA 1I53A 3GFUA 5DUPL 4PJEB 3K6SA 4WFFA 4P9HH 1JK9B 3QIBB 5IHUL 2XWTA 4MD0A 4ONHB 4I87A 3VGFA 3K9AA 4QHMA 4YQXH 1Y67A 3TO4C 4XTRC 1CBVL 3D0LB 2PYJA 3ET9F 2MW2B 5LHDA 4G9FE 3N40P 5D4IA 1UZGA 3G9VA 5FV2A 2FATL 3ZIAG 3REVB 3HPJA 4AQ1B 1E6OH 2VQ1A 4ODSL 2N7SA 1RJYB 3QRGH 4MZIA 4HAFA 1UH4A 2WZPA 2W65B 2JKNA 5EC1C 1WK0A 3HC2A 2CDEB 5LNGA 4LEOB 1LEIB 3SOTA 1VKXA 1HC1A 3DUSB 5EA0H 5L0QC 4Y4HC 2JCWA 4H8HA 4Q74A 4OLXL 4F7MB 3CN2A 1I4FA 5ETUB 3ZYZA 2PUSA 2FYVA 5D1XD 3ZJAA 1L9SA 4K71B 1CFNA 5I5JA 3WJJC 2EDKA 1JJOA 2UWEA 4B3VA 3CX5K 3T08A 4OY9A 3MLSH 1QQCA 4RDQG 1NPNA 4NM8H 4OCNC 3B40A 4LCWE 3S37H 1QI5A 4HAKA 4O4JB 3JAWA 3DSNA 2EYSB 4EKJA 3DO7B 1KIQB 5E5RB 4Z77A 1SMDA 3LS4H 4LF9O 3PGCA 4FQXD 4MMXC 5C0AD 2YBRB 3LQAL 5ERWB 1KJMB 3S36X 3IMSA 3PAUA 2IPKB 1QA9B 5AQ0A 4ZUVB 3FAVB 2X09A 2MNJB 4KOBA 3JASB 4FM1A 4F2MB 3MJ9L 4L9LA 3RHWK 1OOWA 1WA0X 1SQ2N 3LCYA 4HBCH 5A7BA 2ZXQA 4LAJH 3DX9A 4HP5A 4QRBA 5HJ3B 3RJQB 1X7SA 2F93B 4NHCH 4Z7UB 5AYUH 1AMYA 3L4VA 5SWQB 1QLRB 3WAJA 3IE9A 1HE7A 4F7EB 1WPCA 4B3SB 3DX1A 3MR9B 4XMUA 1RPKA 3EF4A 4RQFA 3NA9L 1ZGLM 4UCFA 2AQNA 5D1ZB 4GXFA 3FONB 1A7NL 4I13B 2E7MA 2G4GA 1ZVSB 2IPUK 3UTSA 1XMQB 3UMNA 3T8XB 2UY7B 2Y25A 2XN0A 2AQRA 5BO1H 1MRCL 2AW9A 4CBCA 3ETBF 3VYNA 2JWYA 5C0DA 4C4KT 2WINB 3IAYA 2AZUA 1MSWD 5LJYH 5B1NA 5KSUB 1TO4A 2JKTM 2XFGB 4LLDA 1IE5A 2BVUA 1CLZL 1MQ8A 4JPVL 4R96B 1KC8W 1SJXA 3BD5A 4JB9L 4GAAA 4FXKA 3GKWH 4JFOB 3TVMC 1NJIW 3WIFB 2Z1PA 3ZMEA 5DQJA 3GRGA 2WPGA 3AG3B 2G0LA 2YQBA 1W0YT 3SEPA 4YEEA 3ZT7A 1MH5A 3ZKND 4Q8BA 4ZNEE 1MCWW 3VQ1C 2ZE0A 2XUMA 3OV6A 4L8SB 4X8JB 3RPKA 2L0DA 1D5IH 2ATKC 1TSHA 3BYTA 4QO1B 2A0LA 1FL6A 2PO6D 2OWOA 3WTWA 3UTQB 5I8KH 5ICXB 5TF1L 2H3XC 3CSYA 3WE1A 2CTPA 1D5MA 3IDNB 4WFGD 4ZPTB 1O75A 3VDAA 3DRTB 5KBDA 2UU9B 2DMBA 4PLJD 1D5RA 2YAEA 3VX0A 3RGVC 1ZOXA 2WWWA 1LLAA 2PXYA 1OPGL 3FO0H 4ABVA 4ZW3A 1DTOA 4XMWA 5I0WA 1BOGA 2P8PA 3VM5A 1CXHA 1ZDQA 4N2HA 1LO2H 4PBVC 2GABA 5I9QC 5CLWA 5BXFB 5LGTA 3A4AA 4WFFD 4B9ZA 2VN6A 4O4LB 5GRVK 4K5MA 4IIQA 5FX3A 2E76C 4ADJA 5BPPA 5HDRA 2GY7B 4X0NA 1OVZA 4HK3N 3KH3A 5AYQA 1UPGA 1R3LA 4OT1L 2HCZX 3IAGC 2P46B 1HDJA 3BP6A 4WI4A 5C6WH 2WA3A 3KLHD 2IBZH 1BSIA 4I48B 4Q56A 4KY1L 5GSVA 5IVNA 3SE9L 1R6TA 1KC5H 1ZHNB 2VR5A 2ZCZA 3QR2A 4RGNC 4HX1A 3V0AC 3ZUCA 4MSWA 3OR7B 2ZM6B 3QYMA 1OF2A 3BFWA 5F0LB 3T3PE 3DETD 4WTZG 7CGTA 5CN0A 3PP3H 3ECBB 4M9PA 5JORA 2UXBO 1KTDB 1FJ1B 4MX7B 3U0TA 4LKXA 4AYFA 3I75A 5C0ND 4NENA 2X0VA 4OCLC 4BFJA 1IXMA 2WXFA 5ISZE 2FLRT 1LDSA 1TQUA 5IF0A 5CZXC 1H8EG 4PW3A 4Z3IA 2FGWL 3RZWA 1G6RA 1DE4B 1BZQK 3LNHA 3L4WA 4HCRL 3CBJB 5AW2B 3FQNB 3IJEB 1G9HA 3T0VA 3T77B 4B50A 4UAHA 3IMRA 2YJLA 2HG5B 3TT1L 4GH7B 4JREB 2RCVA 1YEJH 5JUEH 4RA3A 3H42H 1UWGH 5BS0A 1A25A 4MD5B 3RWDA 1TF4A 2UZIL 4G7VH 4L05A 2ETNA 4LESA 5F7EL 2B4CC 1UENA 2WTRA 1ZGLP 4XHJC 2X9XA 3EFFA 3JUZA 3LEXA 2GTWA 3K3WA 1H9VA 1KIRA 1Y0LB 1S5JA 1MFMA 4U1NA 1QLEB 1G7IB 3BWUF 4DFHA 1GJWA 4LDCA 3V95A 3TBCA 1DQLL 3QNXB 2NRDA 3W9DA 4DP6X 3H0TB 5JHLA 4EB6B 1OWRM 1ZS2A 2EE2A 3BZ5A 4N0YH 5TQ0L 2MWCA 2HN7A 4JY4A 3V0VA 1O6SB 1SXAA 5D4JA 5F0JB 5B3SC 3UTSD 3VWKC 4O2EB 4X4ME 3P9MA 2OBGA 3P9LA 3EAKA 3NT0A 1I1CA 4MJ5A 2R0KL 1FL5B 4B41A 1OW0C 1HYSC 1J11A 4BCZA 5CCKH 3Q8FA 2Y06H 3WN6A 5CIPA 1UH3A 4FMVA 4XMLL 4OVUA 1VQ5V 3SKJL 3IU3A 4LARH 2V5TA 2ZNWA 1BAFH 4ZUSA 3O6MH 4Z6AT 2X6AA 3VQXA 2L8AA 2X41A 3ARQA 4E0RB 2CBPA 3KPNA 3FT1A 1JDDA 3QG6B 2EILC 2W0XA 4G82A 1OLZA 2ADFH 3EJZC 4QRSB 3FZUC 3UBXG 4EE2A 3ECQA 4MJ2A 3K58A 3AMLA 4LF6O 4TPRL 2KBGA 1UWFA 5DJDB 3U79A 3RTQC 1HSAB 3O2DL 2AK4D 1I5YA 2WANA 3HZKA 5D1QA 5EN3A 4JNXA 2KZ1B 3ZDXF 1M5IA 2OX5A 3V5DB 1ACYL 2MKLC 2VLLB 4P23A 3BZ4A 4LSDA 3WD5L 2F7QA 4HJ1A 3MCKB 3RY6A 3T2PA 1K5NA 5MEQB 1ZLEA 2ZYSA 2PXYD 5CKAA 1X5XA 3T0DA 1N8ZA 3RYCB 2TRHA 1MHHB 2WHVA 3OWRA 4GUCA 4ONFH 4WO4A 2GEQA 4GAYB 3AG7A 3SYAA 4FQQB 4CBZA 2QSCL 1NKGA 4MGXA 4W9GC 4JFHE 4JGMA 5MHSD 1MAKA 1NM4A 3EFOA 4KITB 2J8HA 2ZF9A 3IJYB 4A6YA 3BGMA 2P47B 5L4MA 5IHHA 4ORGA 5EFIB 3TH4T 4A04A 5DD6A 3SDAB 2AKRA 2AJ3A 1DBBL 5EU4B 1SOQA 1E5BA 4OT1H 4ZTPL 2AJZB 1AR1C 1W72A 1RHHA 1RSOA 1X3DA 3O2WH 5TDNB 4KXAA 4XXWA 4G8AC 4FKKA 1NGWA 3MA7A 5FWRA 3UG4A 2MIZA 4X5LA 4AL8C 5EU3A 2QA4V 3SKNA 2QWOB 5IYBO 2FSDA 3KDMB 1HXKA 3WKYA 4ZG1A 3P11H 1Q1PA 1SJMA 2C7FA 2G75B 3RKPA 2BY3A 2A7BA 4PJEA 1X4ZA 1FN4B 3DKHA 4ONHA 3GSUB 2ROYA 4JE0A 5DC9B 3NSCA 5DHDA 3WDHA 3SPIA 4FLUA 3OHXC 3D0LA 4PDLA 2J5LC 4OGXH 1U2HA 4LBEC 2FGWH 2ZD9A 2BP3A 5HI4D 3REVA 4AQ1A 3FT2A 2C1OB 1Q81W 4GMTL 2MK3A 3DI2B 5BS0D 3AQXA 4KK8C 2ZAHA 1INDH 2W65A 4RO2A 2EEFA 4QNPF 4AJYV 2FJGB 3FU6A 3TFBA 4N0UB 4CKQA 1LEIA 3SIKA 3DUSA 3IN2A 4L1SA 1NGXB 3GRWH 4P04A 1PAZA 3NAAH 4BRVA 5D70L 1XNQO 2NQDA 3TIDB 2YGQA 5ETUA 2WZAA 2IAAC 3GXUB 3MV9E 4HWBA 3W11C 1PZUB 3I6KB 2ENYA 1KEML 4UQIM 1DGSA 3RWIB 2WZ5A 1VACB 2P90A 2XBDA 4LQ1A 4EBQH 4PJ9C 2G4EA 4AMKL 4GAFB 5DJ6B 3HG1E 2EYSA 3DO7A 1KIQA 1CWVA 3MDJA 1N4XH 2D0FA 4EKXA 5ERWA 4MVBC 3GB7B 1KJMA 3LAFA 1U8MB 1UOKA 2IPKA 1AZCA 5DFWH 2XVGA 2YIDA 3FAVA 4YZFF 4ZUVA 3VU2A 4C55A 3JASA 4F2MA 3WUWB 1QTPA 4XMLH 1KXQE 1OAYL 5K5YA 1VEPA 1B88A 1RZJC 3AROA 2HTLD 5EIQA 1BGXH 5JW4R 2FR4B 1F4WL 3HKZA 5GRYA 5HJ3A 3DBSA 4X89A 4NZRH 4Z7UA 2F19L 5AVYB 5KMGA 3LEVH 2BP8A 1KB9F 2DM2A 2XBZA 1EFQA 5SWQA 5HD8C 5BOJA 1UKSA 1O5PA 1Z3RA 1WNSA 3WB0A 4F7EA 4XBGB 2FJSA 2VLKB 4XPTH 3MR9A 2AI0H 5D1QD 2VNCA 1FFTB 2VO8A 2Q8VA 3FONA 4WK2B 4P23D 1ZVSA 4YXHL 5LAXB 3BVWA 3O2DH 4HZ1A 1LWJA 2UY7A 1VFBB 3ZE2E 3TZVB 5D2NB 4KK9C 1JGVL 2X4QB 4WO4D 1WAAF 5JA9A 4ZPVB 2IGFH 2WINA 2IANE 5J11B 4BK8A 1VFUA 2PWHA 4I77L 4OB5L 5BRPA 4XVTH 4LP8A 1H3XA 3HNTH 1U8NB 2H8PB 4JFOA 1FAKT 2KH2B 3BAKA 3CCLV 2WLLB 3WKNA 3PIQB 2YD7A 3EYQD 2NUTB 2GHZA 5I1AB 2H6OA 2L7QA 4F37F 5IFJA 4IYIA 4L0YA 3EFDH 1QYGL 4AIZB 1H8NA 4UWQB 4L8SA 1IGJA 4QO1A 3PXHA 3ESPA 4MDRA 3EO1B 1ZV9A 2J6WA 1KB9K 3BEWB 3COOA 2ZE8A 3QIUB 3UTQA 3DETC 4U7SA 3VFNB 2LT9A 2CIIB 2EXSA 3D50A 5LBSH 2JJVA 3L9RB 3DRTA 4HULB 1H2LA 2IBBA 4F6EA 4K3AA 3SHSA 4FFZH 5KANI 7FABH 4Q4IA 4JKWA 5E8EA 1NEPA 5C9KA 5KHGA 1RUKL 1B3QA 5C0NC 1LUWA 1JYVA 1D3CA 1IBMB 4S10A 3CXDH 3QIBD 2ZWNA 4O4LA 4TNVF 2R29L 4DV3O 2Q8BL 3NH7L 1WB7A 4JQVA 4ZMQA 5E56A 4KJWD 4U4IA 3SKOB 3SJVB 1ZSHA 2WO3B 1K34A 3ULVC 4PP1D 3EHBB 4OJCA 1ITCA 3CLFL 4I48A 4L9LC 3B7SA 1ZHNA 4PR5B 3L9BA 1AH1A 3GSXB 4NPJA 1TPXB 1RZ8B 1KPVB 1XTMA 2F54B 4HFWB 1OM3H 4PJAB 4KZDL 5C92A 2OLDA 4NUGL 1NEZG 4JQIL 4GSDH 2K1EA 4EOWH 3ECBA 1SPDA 5E2VL 2PP7A 3IFXA 1FJ1A 2CBMA 4MX7A 2XPZA 1J5EB 2H1PH 3MBEA 3SBQA 3UG5A 4JCWA 4EI5A 1H6UA 1JZ5A 4NPKA 2HRPH 4ILDA 3EYVB 3MNZB 3JV0A 1K3IA 4B0MM 1AQKH 4FD0A 5CM1A 4UV9A 5LGKA 1TJGL 1DE4A 1T2JA 5DFAA 3VXMB 1EXUB 1Z9MA 3CD4A 3J27A 2DQEH 1JZJA 2Z91B 3FQNA 2C2AA 3IJEA 5I19L 5JDJA 3T77A 1YG9A 3S3SA 3S3BB 4GUOA 4AM0B 2HG5A 1VEWA 2LFRA 1PLAA 4N22A 2X2UA 2O26U 4Z7NE 4YE4L 4ETQB 2DH3A 2WOBA 3AU1B 4MD5A 2JKSA 4X6EB 4ZQKB 1PW3A 4FXKC 3IJ9A 3HAEH 4KI5E 1BWMA 3JSNA 4MA7L 5DD1H 1WO2A 5T3XD 1CG9A 1HN1A 3G6JE 5F2FA 1UC6A 3ULAB 4Y5VB 5FYKD 2Z3YA 1DSFH 5CF3A 3PGFL 5L6YL 1Y0LA 4IJ3B 5KWYC 1Y76B 1KIUB 2J71A 3MTRA 1G7IA 1L9NA 5D7SL 2EE3A 1FQ9C 4A7GA 1YY8B 2EYRB 4PRIA 1BECA 3QNXA 5GZOA 2A0LC 3IFNH 5DO2D 2XAGA 3H0TA 4EB6A 3H1ZA 2AJUH 1LO0L 3SB3A 3UP1A 4OPHA 3S8FB 5D1ZD 3JV6B 1IGMH 3BFRA 3KVPA 4A68A 4O2EA 4YHHB 4M6ML 5BV7H 1GC1H 1WBZB 2E75B 3P4NB 3RUGE 4LSVL 4OH2A 5JPMA 1YIJV 2KZKA 2DWXA 3PUCA 1BX2A 1THAA 3ARBB 2WP3O 1KULA 3OC5A 3WIHL 2WWOA 4ANVA 1BZDA 1F4XH 4N24A 5IQOA 1HWWA 3D4YA 1SQXH 4XNXH 3FQ4A 3S4SB 4AQEB 3OT7A 2K9FB 4BV1A 4YNYB 3TH3T 4BM7A 4IIQC 3FT9A 3GDCA 5I74B 4XODA 5KHJA 2HFFB 3MD0A 5J56B 4MTGA 1IUZA 1AD9B 4E0RA 1OGSA 1GVIA 2H7WA 1R3LC 2XXCB 4CSTA 5IOPB 4U3XA 1KJ2H 4KZEL 3NZSA 2VM3A 3QORA 3IEAA 1ACCA 4XX1G 5IW6B 5DLLA 3PU7A 2QMJA 1FCGA 4QRSA 3L72H 1BXVA 4L87A 4YXKL 3T1WA 3QDME 4UT6A 3HZVB 5BZDB 4FYQA 5CMAB 5GRJH 4H8PA 1BQ0A 4DP1X 2FX9H 2VZUA 4WW2A 5DJDA 4BHUI 4MSWC 2HLEB 5HHMB 1HSAA 1FF5A 1MI5E 4XWGH 5E8DH 4IJTA 2WSPA 3V5DA 5T1MB 4IMLB 2VLLA 5E1IA 4KDWA 4PJGA 4M48H 3OZ9H 2FO1A 4N2DA 1VP7A 1KYOK 5ANME 2WAQA 5MEQA 1J8KA 2ZWKA 4JI7O 1LVEA 1MCOH 1NGPH 3E3QC 3MJWA 3OLGA 4GAYA 3ZL4H 4UTAA 3D9AH 5CAYB 1QSEE 1AQ8A 2BVPB 4CU6A 4U3SB 2WNXA 1AY1L 1NDMA 3ULUH 5FUZL 4XWOD 2ZX9A 4UM9A 1S7XB 4P2QB 1A3ZA 4M5SA 2OK0L 1MY7A 4DK6A 4LVNB 4LNVA 4MA1B 2A2QT 1Q3EA 4NXMO 4GSRA 3CUPB 1LNQA 1IIIA 1T2XA 4Z95L 5EU4A 2AQQA 3G5YA 4G7YL 5TDNA 1FE8H 3HBZA 4OQTA 4JDVB 4Z7WA 1KENH 3DRQB 2MEJB 4PRPA 3FHQA 2OMXA 2G3NA 4H25B 1NAML 2Z0AA 3CH1B 4ASUG 3K5SA 3N85H 1OB1B 3NEXA 3CWGA 3HFMH 3KDMA 3KXFE 2D7QA 2Y5TA 4AXWB 2E59A 1P4UA 2VC2B 4AGPA 1T04B 4U1HB 5E2VH 3DI3B 2O30A 3M46A 3DTXA 1YCSA 2ED6A 3P3YA 4FG2A 4IGBA 1UG9A 4UZUA 4X98B 2NSXA 3K04A 2XCMC 3SDXE 3SBRA 2IJIA 2CZNA 3EJUA 5FECB 5D5MF 3GSUA 1CE6B 3FUIA 3CFTA 5DMJB 1UCBL 3JZ7A 2AV7B 4ALAH 1SETA 3EJYD 5F72S 3JCUZ 3GKZA 2JVDA 4KROC 1JXGA 1VF5C 3OC8A 3KPSB 3WKQA 3L3GB 3X3GH 2WQ8A 3S37X 3HMXL 3N1QC 1SXSA 4WUUE 2DZEA 1R3KB 4K7PH 2DD8L 4F8OA 5KVDH 2HTLC 1KBKA 4UIKL 2VWKA 2FEDC 4N0UA 5GZND 1FDLL 1CFTB 1GGTA 1MFEH 4UVCA 5EIIG 5FYLE 4X4XA 4H4NA 4HUVB 5H4ZA 4OZ4B 2WXHA 3FUMA 1NCTA 4H8WL 1EO5A 1YUKB 5LAPA 4L4TB 1HDMB 3I6KA 4OR1A 1ROPA 3CK0H 3QUKA 5D1QC 2ENSA 2NY2B 4XCYB 4GYBA 4XH2B 4Z9KB 4P23C 3RWIA 2WM0A 3T0EA 1BAWA 4ODUB 4R0LB 3RY6C 1VACA 1OE1A 2NZ1A 3RWRD 2X4NB 5DJ6A 5IT2H 4WO4C 2A79B 3K6NA 4UIMB 1ET8A 3GZQA 3RX8A 1OOAA 1W91A 3ULUF 3Q3GB 5EMYA 1U8MA 2XUWA 3HUJA 4M3JA 4RSVA 1ORQC 4P5RA 3II3A 5AUMB 3DHJA 4XBEH 3WUWA 4QE7A 4WFHA 1QUNA 3H2WA 3M1CA 1NAKH 5CP3H 2FR4A 1TT6A 1OO2A 3KBFA 4LCCB 3BIAX 4AIOA 3ZU8A 4J6RL 3G04B 1XGYH 3CCUV 2YEZB 3BZEB 2FIKB 4LP4A 4AX3A 4H0GA 2R2BB 3CSBA 4YIOA 4OTXL 4ZRGA 4XXWC 2Y7QB 4XBGA 2DYPB 2VLKA 3T0XA 5E94B 2X1QA 1P6AB 5FK9B 1RZFH 1QUPA 4MS6A 2AMUA 4IW4C 1K5SA 3MREA 3FB5B 5LAXA 4X9YA 1MWAH 1VFBA 2EH8L 1KELH 3ZX6A 5D2NA 3DURB 3TZVA 3HKBB 2X4QA 3CFDB 5HI5D 5TTRA 5HY9B 4ZPVA 3GXPA 1B6DA 5KYYA 3ARDA 4JKNA 3H2PA 3GMLB 3O6LL 4BWTA 2PR9A 3RI5K 2Y07L 1WD9A 1XX9C 4TSBL 1XGTB 4NTWA 4ZQTA 1SVBA 3K2UL 1RAMA 1ZTMA 4UM9D 4HUMB 4HOXA 2H8PA 1MFDL 5B8CA 2EVJA 4J2XA 4OFDA 4B5ZA 1AGBA 1IBLO 1NKRA 1KXVA 2ALAA 3V4LA 3PIQA 3KVQA 5TGBB 4AQ1C 2NUTA 4NI3A 4TVSa 5I1AA 4PP1C 2HPTA 3SDAD 3TJEL 3X1BA 4XE5B 4ZTEA 2UUAB 1OD7A 1FA4A 3BH9B 4YZWA 3K72B 4JY5H 3GSRB 4OZIA 1VQ8V 4NQSB 4AOFA 3OL2A 1EZUA 2DICA 2VERA 3EO1A 3BEWA 3QIUA 3MOAH 3WS3A 3TBWB 4HZLB 4UQ2B 3VFNA 4L3AA 4X6FA 2CIIA 5I8EB 2EC8A 1YNKH 3L9RA 4ACPA 2DJVA 1P4BH 4MNGE 5HHOE 3OPZL 1HNWB 4PTUB 5CEZH 4I3SL 1G7HA 1KTCA 2ADIB 2N01B 2YPKB 3CC2V 2V5YA 1I7ZB 4FZ8L 1T20B 1J1PH 4XMPH 4J10A 2XYBA 1A7PH 3OM3B 1RUML 2R4RH 2YPLB 3I6LD 1Q82W 3ZYIA 1XSJA 2DQHL 3B09A 2G3MA 1EVTC 4Q6IB 3GMOA 4MS2A 4W4OC 3JT2A 4HC1L 2D3VA 5JXAL 3KGUA 2R69H 3OKMB 4KXBA 4OD1L 3SKOA 1ZTEA 1XAUA 4WEEA 3SJVA 5BRZB 5KSAA 5C09B 1M7UA 1M71B 4ZXBB 5C0CE 4OX9B 3RVXC 4IBYA 4XZUB 4PR5A 3V8OA 5JIQA 3GSXA 3UTPD 2AJXH 2GUOB 2F54A 1RZ8A 1KPVA 1V7MH 4LFHD 2FQFA 1LEGA 3GSNB 4HFWA 2N04A 4N9GA 2AJYL 4PJAA 4N8CH 4PJIF 3G08A 1KCLA 5TQ2L 3T04D 2HYMA 4BZ2A 1PIFA 2VDPL 4PRNB 2J44A 5HHVL 3CCRV 4P59H 4TL4A 3ZCCA 1OGAA 2Y36L 5FGSA 1SXBA 3VFSB 4EI6B 1L5GA 4IKKA 1R0AL 3DSFL 4BUQA 1HZLA 1U3HB 3WFBH 3B2DC 1DQKA 3ETEA 2YRPA 3T0ED 4WV1B 4TNWF 3A4FA 3TWCL 2X4OB 3MNZA 3HC4H 2ENQA 3ZN1A 4PJ7B 1TEYA 1J0ZA 3VXMA 1EXUA 3B2VL 2Z91A 1ACXA 1M53A 1UJ3B 2GPZA 2Z92B 5GJTL 4K9EL 5EOCJ 4AM0A 2OR9H 1IDSA 3F6LA 4RGMB 4ETQA 4GKOA 1INEH 3AU1A 4G8GB 3T1FB 4ZQKA 4X6EA 4JRYE 4WFHD 5C71A 1FLRL 3QZBA 4KQ3L 1PD1A 4B9IA 1DUZB 3WYRA 4HNAB 1E30A 2XG5B 3HS0C 1KN2L 1OP3H 4OFVA 4ZIBA 4GRWE 1T22B 1VQ6V 1UGNA 1KXTB 1YY8A 2GIYA 1CD9B 2V7QG 1KBHA 3M7FB 4BQCA 2VLKD 5I75B 4K23H 1PL3A 1JNJA 1SEBB 4L48A 1OXYA 2LGQA 4X8AA 1P84K 2Z3FA 1ZA6B 2PTVA 2ZAGA 2BTQB 1P7BA 1WBZA 3KBPA 3P4NA 4PJHF 4JM2B 3TZVD 5FYJE 3VD2A 4FFYA 3KYKH 4TNWK 1UB6A 3VG9C 4Y1SA 2YSUB 3ARBA 3N6YA 4NWUH 1O7DE 2OTUA 2QTEA 4YFDB 5T1KB 3DOSA 5IQNA 5CBGA 4YNYA 2B1AH 1NBYB 4AQEA 1BG9A 5AW8B 2HP4A 4XWOC 5A2BA 2HFFA 2HMID 1J0YA 1AD9A 3U7WL 2AQSA 4JQVC 1P7GA 2IH1C 3OX8B 2RACA 5FM8A 4MW3A 5IOPA 4LVOB 5J1AA 3SJBC 1W2BU 3ABTA 3O65A 2R0LL 3HG2A 4GW5A 4JI4O 3LKQB 5F7AA 1EIBA 1T21B 4TOIA 2DQJL 3HAEG 3HZVA 4B7EA 5CMAA 1IVLA 3O0RH 5AYTA 4R97B 4DP7X 1OGTB 4MTXA 4CC1A 2HLAB 4NKGB 3ETSA 2BY0A 2DYRB 2F58H 3Q9PA 3QIUD 4XC3L 1DJSA 1UT2A 3BXNB 3EDKA 5T1MA 5KOVC 5IJDC 2WNGA 4BIOA 1YEKL 1ZHBB 1EERB 3BKYL 3I6GB 4FJ6A 3US1A 3LB6D 3ZDZF 1S72V 3FSWA 4KHXH 4UINL 2FAUA 5DTFB 5AVVB 3L75H 3JTBA 3MBEC 3VTTA 4EI5C 1MSDA 4XNYL 5T1DL 2ZWZA 3LRLA 4QI3A 1OM3L 5D2LE 2BVPA 1JXDA 3O3DB 4I3SH 1LILA 4LSSL 4QY8B 1DJZA 1E9OB 1WB8A 1PU0A 4OFIA 2OSWA 3L7FA 3DC6A 1KYAA 3POCA 4IRZH 3EJYC 4P2QA 5JIIA 5J8OA 4P9PA 1ZIBA 1A6UH 2R72A 1AZVA 2HG5C 2KI6A 4ODXA 3SJVD 3KLKA 3RX9A 3EHBD 1S76D 3CUPA 1NL0H 3SDCA 5JXAH 4GG8B 1IBHA 3VXQB 2X0LA 5LP6A 1A66A 1MXDA 5F9WB 4JDVA 1M9SA 1AS8A 4UZGA 2F54D 2ZTBA 3LHAA 32C2B 4XMKH 4HK3J 1QVFU 4H25A 4HKXB 3U4EA 1Q43A 3CH1A 4GKZA 4O5LL 1OB1A 4AYSA 3QDGE 1V05A 3L5HA 2V2TB 5GZOC 3MCYA 4AXWA 4U6VH 2KG7B 4DVBB 6PAZA 1OGAD 4U1HA 1DQJB 2X53A 1CE1L 3VJ6B 1FO0A 3I6SA 4WBNB 4NO2A 2Q0ZX 3Q43A 3S9DB 5GRUH 1OZ0A 5FECA 3SDDC 2DQGL 3M17B 3BVNB 3BEHA 1ZTXL 3CZGA 1FNEB 3P3UA 5IY5C 1CE6A 3QPKA 3IU4H 4DCQB 4UTBA 5JPMC 1BF2A 2WXNA 4PJFB 2EZ0C 3HI6L 3VXMD 2AV7A 4Q9RH 4YSSA 3WJLA 5DF0A 2XVKA 3PWVB 1AVAA 3F7VA 1HH9A 3HKFA 1BW8A 3KPSA 1KYFA 4G7SB 4WUKL 2FSEB 3L3GA 4LQFH 3MRKB 5E4AA 1E79G 1R3KA 2FHFA 4P2RE 1BQUA 4JJOA 5FPOA 2E5LB 2WY3B 2XIBA 4N2AA 2DE0X 1GZHC 1XR9B 1P0SE 1U8IB 3QORC 3C8HA 3HS8A 3A67H 2J25A 4HUVA 1Q0YL 1XMOB 3NQKA 1IFHL 2UXDO 2LLGA 3DMMC 1JPST 1N19A 1Z3GH 4LOUD 4L4TA 3P9WB 1HDMA 4WW2C 4HT1L 3CGTA 4O02L 2YEVA 2L4OA 2EDBA 3EGXA 2YMXH 3MLXL 3QUML 4YSAA 1E5YA 3EZJB 4MA3B 3OUFA 4JFYB 4XH2A 1UWXH 3WBDA 2Y4UA 1B4LA 4HGKC 4ODUA 2DKUA 3CFJB 4J8RA 4PGZA 4R0LA 3APCA 3FQRB 1AXTL 5EU6B 5K9OB 3SD5A 5E4OA 1A0QL 1T5XB 4N8UA 5HI5C 3P30H 2QGDA 3QE5A 5J3HC 4S0SD 2IWEA 5CS7A 3ARBD 3BUDA 2ICWI 2VDOB 3V4VH 5KTEH 3Q3GA 1K92A 2DYSB 1JNNL 3RP1A 3TYGH 3HHSB 1EAOA 1U58B 4X65B 3ROLB 1X5IA 4TT3G 2ZG3A 3BISA 3EJSA 5KOMC 3N42B 2WK2A 3ARGB 1IGIH 3N9GL 2CSPA 1MPAH 3CVHA 4XNUH 4AG4L 3CFCL 4LCCA 4ZFZB 1DDTA 5CXPA 2A06H 1EN6A 3G04A 1VQ7V 1F4MA 2YEZA 3BZEA 2FIKA 2OTJV 4U3CA 3HVDA 5D7LB 4PTTB 5IBTH 3REWB 3BE1H 2ZINA 5IB1B 4ZHQB 2KLSA 3SZKC 3ZO0A 2DYPA 5HHMD 1NTMH 5BQDA 1RZGB 2VDML 5E94A 5KYXB 2VQEB 5DMIH 3FB5A 1XH2A 1T7YA 4ZOBA 2UUBB 4UQ3B 1IEAA 2EO9A 1KY7A 1V8HA 4PYHA 3CFDA 3PJSK 5HY9A 4F57H 4P05A 4IGBC 4XCFH 4QRRB 3CIQA 4UV4L 3DBXA 3GMLA 1BYPA 4OLYL 1YA5A 2Q7GA 1XGTA 1ZXQA 2B1GA 3ZDYE 1HKLL 4N2GA 1KWGA 1NM9A 3Q7JA 3CHOA 3PWUB 2VUYA 2B5IC 4PD4J 1AR2A 1FLTX 3EOYG 2FJHA 4P2QD 4RISL 5FHAH 1HCZA 1SDDB 3P02A 4G27B 2IDFA 5DHMC 1LE5B 2A9BA 4MVUA 1BV8A 1SEQL 3HW7A 5E95B 3BH9A 2PCPA 5FDWB 3K2KA 4WNQB 3K72A 2QELA 1F51A 3GSRA 4LL9A 4GCZA 1TJIH 4V1DA 3ZTNH 3TBWA 4UQ2A 4OW6A 4NZJA 5I8EA 3H9YA 2AW2A 4TQIA 1KQSU 1P4IH 1H0DB 1M4KA 3DC0A 5D7JB 4ZX3A 3Q4HB 5CGBA 1DQQA 4PTUA 4JI3B 3QXDA 4JO3L 3BGAA 3BHBA 3GHBL 4LLMB 3L6FB 3P32A 2EAEA 2VDRL 1I7ZA 1YPZE 4IKIA 1T20A 3T0EC 4W9FC 3VI4B 4LLQA 1M7IB 3B9VA 4IGGA 2ZOUA 3ZTEA 4QRPE 2P5WE 2YPLA 2DEYX 3MRHA 4GI9A 4LGRB 1KCVL 5FGCE 1IL1B 1NPUA 2M6YA 4OCMC 3OKMA 5GIRB 4UMSA 3KPSD 4XP4L 5C09A 4ABQA 5EV7A 4OCXL 3RVUD 2WA4A 4KVPA 3LX9A 3UAEA 3SPVB 3WFEL 1O0VA 3JZYA 3KAAA 4J3WA 3HB3B 2GUOA 1BBJB 3C8DA 3QJFB 2E56A 3GSNA 4MKTA 2XETA 2WYHA 3NR7A 3ETTA 3BQUC 1ZTXE 1IE4A 1G87A 2YD8A 2YGNA 3CZNA 4PRNA 3SBWC 4DV4B 4L4TD 3FUHA 4PCSA 4U1IB 1G9MC 4RAIA 1PX8A 3AFLA 3BWSA 5FO7B 1BCCH 2O5NA 3KPMB 4EI6A 1JWMB 2NY2D 4FMFA 3ZSSA 2E3CA 3HMWH 5EEXA 2K8MA 4FJCC 1U3HA 2R1YB 4HCFA 4HT1H 5FAAA 1UYWH 1N36O 4HJJH 2G5RA 4IRJC 4NJ9H 4QIWF 3QUMH 4LAQL 4WV1A 1ZKAA 4QHLB 2ADPA 1GGCL 3TZVC 5D2NC 1VEMA 3GD1C 2DM7A 5EIVA 3VYPA 1XB6A 1IJNA 4PJ7A 4PAZA 3M88A 3UO1L 4PS8A 4FPPA 5F71A 1NLBL 3ARDC 2WLIB 1A6VH 1XNRB 1E43A 2Z92A 1W0WB 3HA0A 4X66B 3QUYB 4NKMA 1RL1A 4ZFOA 4KK5D 2Z93B 1NFDF 4G8GA 3T1FA 4KXZH 3STLC 2H8PC 5B8CC 1IGYB 5GSRA 2Y69C 1AYOA 1JHLL 3ZE1B 1DUZA 4KUZL 5CEYB 4RMVA 4HNAA 1EDQA 4LIQL 3BO8B 1T22A 5H5NA 3PFQA 4OAWB 4QWWD 1KXTA 3CFCH 1NINA 4RFOL 1U8HB 2YS8A 1DJYA 3LIZH 3QSKB 1T1XA 4CVXB 2HVKB 2DYPD 3GLDA 3QIUC 3PL6B 4YHMH 5F6HI 4DV0B 4AVKA 5HVHB 1SEBA 2OMBA 3AGWA 1C12B 5KA5A 1N33O 1ZA6A 3LKNB 2E7LA 4QTIH 3LB6C 2BTQA 1A3QA 2DIBA 5DMKB 4JM2A 4RWUA 1U8CB 1KCUH 5KS9E 2PUQT 4LP5A 3OKKA 1BQHG 2IC2A 2YAFA 3ENEA 1VPOL 1J9SA 3TLRA 1WZMA 5T1KA 1CDGA 1S3KH 1NBYA 1ZPUA 1S9WB 5F89B 4IM8A 3V4UH 3WFCH 3WNKA 3VD4A 2GYSA 3OX8A 4YLCA 4RAUB 4OJAA 4CZZA 4NCC2 1AYRA 2NY5H 4QJFB 2XRAL 4QMEA 1IBKO 4UB0L 5HDQH 4EIUA 3EHBC 5KSAC 2EEBA 4UTCA 4URTB 2WBJB 3FHAA 1T21A 1T6VN 3UACA 2GK0B 1AZZC 1WRFA 2Y5EA 2XZZA 2GBOA 2NT1A 5KJRH 1OGTA 3R1GH 4ADGA 1TPXC 4PW4A 2ZKOA 3OJMB 3KD4A 4CA4A 3FFCE 1EN5A 3P54A 3BXNA 4K94H 4NN7B 3SCMC 5KN5B 5DI8B 3SE8L 3I6GA 3GXDA 2UXNA 1O9ZA 1QP1A 4WFED 5DTFA 5FO8B 2LAAA 5EUKB 2BSKB 4F8TA 2G2RB 1MCWM 3RL2B 2BSCA 3NCCB 4FXLA 4JO3H 2R8SH 3S3WA 4QY8A 4ZFGH 2BMKB 3QWRA 4DUZB 2FL5B 2YPLD 5E9DB 5F1NB 4AQYO 4K73A 1EX0A 3ZTDC 4Z7IA 9CGTA 1KGYE 4OCRL 3I2CL 3C5SB 1AXIB 5IVXA 4OU3A 3LKPB 2D2CB 4TUJA 2WD0A 1B4RA 1K9MW 1VJSA 3CMOL 5KSBF 5C09D 4ZXBD 3KR3L 4JDEB 1BMWA 4U1SB 3ERXA 4GG8A 3MOQA 4JI8O 3VXQA 3N5AA 5DJ0B 3RA7L 3IC9A 3EOTH 2Q76B 1T7XA 2NY1C 3K0YA 32C2A 3FQXB 4HKXA 3MUUA 3UBXA 1W0KG 3KLLA 4I4WB 1QQDB 3GI8H 3B9KB 3CVIL 2EZPA 2CWRA 3OKDB 2V2TA 1EXGA 3RNQA 5DVMA 2KG7A 4PRHB 4DVBA 6FABH 3GJFK 1DQJA 1BQ5A 3VJ6A 4LF5O 4WBNA 2K8QA 2YWYA 2CK0H 1QFUH 3GSQB 1U3HD 2Z34A 4MMZA 3BVNA 3QQ4B 2WGNB 1YQ2A 3SGDH 3WKML 2LHAA 4ZO6A 2Q10A 4PJXA 4DCQA 3FO1B 4EFEA 4PJFA 3UBHA 1BVNT 5AOMA 3VQVA 4R3SB 1YI2V 3DIFB 5KBLA 1HL4A 1GGCH 2EBOA 3PWVA 4JBSA 4ODTH 1RMFH 4NCDA 4YX2L 2V4LA 4NN6B 2FSEA 4WHDA 2YUXA 2Q8AL 5E1HB 1N67A 3MRKA 4JDZB 5I74C 2YD5A 4DO6A 3UPRB 3PDGA 4G8GD 4TNEA 2WNKA 4YBHA 1ZSPA 1DFBL 1PQZA 4YDIH 1E8YA 3SY0B 1U8IA 3JCZA 2ZCHH 4M1GL 3VSQA 5J2UA 2ZSVB 1NCGA 4UILH 1BZ9B 4CN6A 4HXAL 1CVSC 4B3TO 2CCWA 4U0RB 3L3IA 3FKUS 4JRXE 3T6QC 4H88H 1YVWA 3ZHVA 1SRDA 1P7KB 4M7LL 1TA8A 4ZSOE 2ORBL 2FQDA 2NOYA 3DGCR 3BAYA 4JFYA 3T0BA 3GS0A 2HJDA 1TAEA 1FJGB 4GQ9H 3CFJA 2JXMB 1CQYA 4GBXC 4HEPG 3FQRA 2XN1A 4KDVA 1CL7H 5EU6A 1ID5I 1KJVB 3FSZA 1AE6L 2XNDG 1KBBA 3B9AA 3IBEA 4JM2D 3GSWA 4KUCF 4J28A 1LUVA 1E90A 3S3JA 5C6PB 1PLGH 2Z35B 3V4PH 4WK4B 4X9HA 4R4FL 1FXKB 2J73A 2IJKA 4LIQE 2GJZB 3WO4B 2ARWA 3QZWG 5T1KD 4ZBJA 4ZI8A 5ID0B 3HHSA 5CMUA 1U58A 4AL8L 5BO0D 1Z6JT 2NX5B 3GTVA 3GMPB 4WI0B 4B3MO 2Z64C 4Y2NA 5DD1L 3ARGA 1MCSA 5F88B 4JZ2A 2B14A 4PREB 3BCCH 5L88H 3Q2WA 1YY9D 2MMXA 4ZFZA 4B27A 5D4HA 3H1LH 1SBSL 1YNTF 3KW7A 1QHQA 4YH6A 3SDCC 4DGWC 3GDBA 4AMWA 4XHQA 5D7LA 5AKTA 5LP6C 2J6EH 5IB1A 4R5XA 4UB0H 1ASQA 4OZGE 12E8L 5CFAA 1KJ3L 2DEXX 2IOIA 2VLRB 1RZGA 5KYXA 1Z5LA 2L7UA 4UM8B 5DRNA 5E4EB 2CJSA 1ZS8B 3DGGB 3SN6N 3IPFA 2ZOLB 3TJHD 4UQ3A 4DR1B 3K03A 5SWZE 3R8QA 1TJHL 1YEHL 4CVWA 5LMNB 1GY2A 1RIVL 5FA4A 1A5FH 1PS3A 1XCWA 3BT0A 4KU1A 4M7JL 2CPCA 4YAQB 2UZPA 3NIGB 4LDLB 4F91B 3ULSB 2QGNA 1VZIA 4DSYA 1RJZB 1PZSA 5TJWK 3JTSB 3ZO9A 3QWRD 1MREH 2GJ6B 2W9EL 4PLKD 5F3BA 5D5QA 3NCYS 4YPGB 2ESVA 5FUOH 5KYWB 2B4CH 3H7LA 4YSUA 3MRNB 4DKDC 4YFLI 5CBHA 3F7VC 4U6YB 4D6TH 1FGNH 1EHKB 1SDDA 3TV8A 1BT8A 5DDHB 5T33H 2XI9A 2NMSA 3FAWA 2G9HA 3RVUC 1LE5A 2AJSL 1TETL 4B9CA 2CCVA 3MV01 4WNQA 4P8QA 4UFZA 2NQCA 4PJBA 1TTRA 1N6QL 5JJJB 4WO0A 3QEQE 4YIPA 2QV2A 4OI8A 1FYTA 4J7RA 4KAQL 1RZIB 1QTYT 4ODBD 5AVSB 2VUOA 3D36A 5B38G 4R7CA 3QNYB 4BIKA 15C8H 4CC4C 4NERA 1WCBB 3NCJH 1NCCL 4XPFH 2WUCL 1RZJL 2VZTA 5GGRY 2FLMA 3VI4A 1M7IA 3TCTA 1GAXA 3I50L 5T3ZL 3K4ZA 4D0BB 3GSOB 4QT5B 4JI1B 2NXYC 5L2KB 4BINA 1OCCB 5AKSA 4UCUA 3CC5A 2YKKA 2ENJA 3MJ7B 2J8UE 5GIRA 4Z2WA 1KG0B 4GI8A 3RWGB 4EF3A 4LVHB 5EO9A 3QHFL 3QPXH 2F43G 5GS0H 3RFZB 2XOKG 3MUY1 1G1KA 2AAVA 3KYMB 3DGDA 3PWJB 5CB4B 1Q1JL 3WKPA 4HJTA 4FLWA 4A7QA 3W5NA 3SPVA 4JFZH 4B3RO 5DFTA 2PPDA 4OPAA 4KVNH 3C5ZC 1BBJA 3QJFA 2JI2A 4LCCC 4MQXD 1WIPA 3VRJB 4BFFA 3RY5A 1DFBH 1J9CT 3CPLB 1HWHB 5HYIA 3QPQD 3V0GA 2CHZA 2EDOA 4PBDA 4U1IA 4Y2OB 4MD4A 1QRNB 3GHEL 2VDQH 3FU7A 5I1IL 1JWMA 3PV6B 3N3EA 2GC7C 2OR8A 1IC0A 3FB5C 1BREA 5DUMH 2ZCEA 4HU8A 4QHLA 2HJKA 2F9BT 2QMKA 5EU6D 1OQXA 2VABB 2HT2C 1M3IA 2RNBA 2VWEC 3LXUX 5CD5D 4TUKH 3TEWA 2NCEA 5C0EA 1RK0B 4JPRA 2WLIA 1I9IH 1SNRA 2H3NB 3O3AB 1N9PA 4YSEA 4ESKA 1Q38A 3QUYA 2UXFA 2ZCLL 2EJ1A 3MLWL 5JHMA 2EINB 4AQ8C 3NEEA 2E8ZA 2FBRA 1M2VB 3N41B 1G9NC 4EUPG 1EXHA 4AKQA 1L0NH 4JG0L 2M8XA 2EABA 1BD2B 1MY5A 3ARGD 4LLVB 1VQ4V 4I9QA 2F5BL 3V0DA 3CXHF 4AL8H 5CEYA 4I0XB 3V7MA 2HVBA 3BPNC 1ZT7A 1V10A 4KO5A 4DN4L 3BX7C 4OAWA 4GG6B 1AQDB 3LD8B 4Q52A 1U8HA 1Z9NA 2OXHA 5D7LD 5JIDA 3ALWA 4B0MB 2NW3B 4B97A 5CLZA 5I1CH 4CVXA 2HVKA 3GIZH 4OLZH 1MA1A 2NT0A 3UYRH 3PQYE 2XWCA 2F7PA 5GGTL 3STZC 1C12A 1NEZA 2DPKA 4DV7O 2CHXA 3PAYA 2NCMA 4JI0O 3BLKA 3A6CL 1XGQB 3L3DB 4OCWL 3ULVL 1JVMA 3NZ8B 1AQMA 2AQ2A 4NLHA 2EULA 3QCVH 5DMKA 1U8CA 2WN3A 5I82A 4A2LA 4KX9A 7PAZA 4ZTOH 1JYNA 3VG0L 2X3BA 3PCYA 2RIKA 2CR0A 3FOMA 4QRRD 1RHFA 4ZX4A 1YEHH 1H3UA 5C2BL 3IGKA 3MGAA 1MF2L 4ZNCD 5F89A 5FDYA 2CNZA 2ESVD 1L0QA 3QAZC 3V10A 2V9UA 4PV1B 5E6RB 2JQMA 4RAUA 1VZHA 1IGFH 1OCZC 2X4SB 1IAMA 2J88L 1DVUA 3EH3B 4W9IC 4WFEE 5ADOL 1H2KA 1I75A 2WBJA 3WTTA 3Q2VA 2GK0A 4XN2A 2YOCA 3DTDA 2E27L 2O6FA 1DVTA 5LWYL 4NKQB 5JA8B 3QEGL 3W1ZA 1RUPL 2YMOA 3VXTB 1MNNA 4OJFH 5LGYA 2QQQA 4BWWA 1DDHB 1FYTD 5KN5A 3CFIC 4YC2B 1K8IB 3WU1A 4X83A 3BVTA 4RMSA 3WJMA 4ONGL 1JS4A 3CPWU 2ARJB 5CSZA 3CN1A 1HFUA 2EE9A 1XHZA 3H54A 5EUKA 2BSKA 1URFA 3FUKA 4X7FC 2EO1A 3DECA 5BRZE 1A6TB 3OAYK 1Q9WB 2G2RA 3RL2A 1RJLB 1U3HC 4N2IA 3KPTA 4WV1C 2BMKA 3QO1B 2ZUUA 4D7BA 1QPPA 3DJTA 5TFSL 2FL5A 5E9DA 1LP9A 2H2SC 3BSZA 5INDB 1FPTL 2VM4A 2OYPA 3W0WB 3C5SA 2DW4A 4JI2B 4IBUA 3I50H 4U6TA 3LKPA 1QNZL 2O5YH 4LU5L 2B59B 4RGMC 3GLZA 3MO1B 4JDEA 4U1SA 5HGAB 3CD6V 2D3NA 2JH2A 2V8LA 2Z8WC 3QHFH 5DJ0A 1BLNB 3O6KL 2Q76A 1OSPH 1A14L 3Q8AA 2GG1A 2CK2A 3ISWA 1EN4A 5DN6G 2XAQA 4OLVH 3FQXA 5CR1A 5EUOA 2AXGB 1AS7A 3O41A 2H9GA 2BFVL 4I4WA 5T3ZE 1QQDA 4Q9QH 3B9KA 4LRNL 1GTOA 4KZCA 5CGYD 4PRHA 2BS71 1YYML 2BSTB 3GI9H 4M5ZL 1B2YA 3ATEA 3AW5A 1C16B 1L9QA 5A6IA 3GSQA 2Q3ZA 2QGBA 4LL1A 3WMPA 4JFEE 1VFOA 5JCOA 1AR5A 4U3FH 3AWGA 2IH3B 4XP6L 3T6VA 3QQ4A 2E7LC 1RPOA 1DQDH 3WTUA 1TQSA 4A5UB 5I1IH 2BOCC 4OM0L 4YWGL 3FO1A 4O4YH 4KHPO 2GK2A 3HNVL 4EVNA 1BZOA 4R3SA 3CVDA 3DIFA 4X7CC 5FR3A 4IYHA 3PPEA 1R1CA 2KDYA 3G6AA 4HIPA 4NKDB 3QUYD 2AEWA 4XI5C 2N7AA 4PY8J 4JDZA 1N68A 4ZMOA 3UPRA 3DXRB 2OCJA 3GXIA 4YO0A 2WPDG 1Q0XL 3GXNA 4LPVA 5DSCB 4BKTC 2EX3A 4Z5RB 4G80B 1J18A 1G7QB 1YY9C 4LVOC 4NCC1 2ZSVA 4UQEA 1AMXA 3LNMB 4JG0H 3WDIA 1BZ9A 1NGYB 2WNWA 1C08B 1MCFA 3D30A 1WEJH 2DDQH 1KJ2B 1ZLZA 2J20A 2NYZA 1R3IH 4NOBA 1WPXA 1P7KA 5GPRA 2FHCA 3PL6D 4HJIA 4HWUA 3OTOO 3F5WB 1O9GA 4DEWA 4FA7B 2AQ3A 2XTSA 1KCSH 2MQ0A 4EMZA 3G80A 2ZOKA 3GBLA 1O7SA 5E2JA 3EXJA 2VZ1A 3C08H 5DZ9A 3ZL2A 2Z35A 2VZ3A 2DY2A 5JMOC 4IIZA 3CDFA 3LZFL 1FXKA 2GJZA 4AYDC 5C3IA 4ZOCA 5ID0A 1DO6A 2CLRB 4W70A 2WKOA 4OZHE 2Y2TA 4PLKC 1SFDA 3GMPA 4KK6C 1UH2A 4WI0A 1I9JL 4N2CA 5I28A 2OZNA 5JPNB 5F88A 1U8OB 4PREA 1PKOA 5I1JH 1Q9KB 1ZLDA 2ZJSL 2QBWA 4LLAA 1JPSH 1LR1A 2ZT9B 2ZXDA 3KPPB 4HJGB 1N59B 3ULVE 5LHIA 2VTFA 1EFXA 3FTWA 1NBCA 2WBJD 3IDXH 2XWRA 2QSQA 1KGIA 4Z7QB 4C56D 3SOBH 4BKSC 5F9WC 3EYSL 4MVZA 1IKNA 2J88H 1CGTA