3ABMB

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3abmB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3abmB02
3NP3A 2N0MA 3AG2B 2MRYA 3ASNB 1JXDA 5I5IA 3H4FA 3CDZB 2IWEA 2DYRB 2W88A 3TASA 1T5KA 4KNUA 3U25A 3EH5B 2HX9A 4A2GA 4BXSV 3CVBA 3UAAA 4DP5X 1ILUA 1NZRA 4YSSA 2FQDA 6PCYA 3T6ZA 4KNTA 1XMEB 4DP2X 4YSCA 5I26A 3OQRA 3ZBMA 5IY5B 2VSMB 4M4RB 2GSMB 1A4BA 3JT2A 2GB2A 3OMIB 4A2FA 3HEIB 5PCYA 3QJRB 1J9QA 2BO0A 2FJSA 1NIEA 3AZUA 1AG6A 1OOWA 2YAOA 3NJIA 1GR7A 2DWSA 2OV0A 1OV8A 1AZRA 4UANA 4AZUA 1SNRA 4BDVB 2PP9A 2JXMA 2AANA 2VN3A 4N4YB 1AR1B 2DYSB 3PAUA 4AKQA 2BZCA 3NJHA 4F2FA 3H4HA 3IE9A 3X1GA 1BQKA 3ABKB 2AZUA 1SDDA 1W6LA 4KNSA 4PAZA 3TBBA 2UX6A 4NB7A 1AS6A 1NIFA 4YVUA 3NJNA 3ZX1A 2Y69B 2FWLB 4NAJA 4BDVA 3UAEA 1ASQA 3UADA 2BZ7A 3AG1B 3QJQB 4UAHA 1URIA 5D4IA 1XB3A 3NSDA 1JZFA 2MTAA 2IDTA 2R7EB 1IUZA 4GP5B 4GP8B 1BXUA 1QHQA 3H56A 2QDWA 1F56A 1PMYA 3WI9A 2XV3A 1AZBA 2BWDA 4DPAX 1BQ5A 2B3IA 1A3ZA 1RZQA 1N68A 4PCYA 1CURA 2PCFA 2CJ3A 2R7EA 3AY2A 2J5WA 3ABLB 2BP8B 4ENZA 1WA2X 2CAKA 2HRGA 2BW5A 1NDTA 2IWFA 4KO5A 1NWOA 2GBAA 3BQVA 5B7EA 4AX3A 5B1AB 1SJMA 2CBPA 1FFTB 4FAAB 4YSUA 4W1TA 5B1JC 4YSOA 1SHWA 2YXWA 4DPCX 1PCSA 4E9VA 1AAJA 1OF0A 1SFHA 2IWKA 2JFCA 4W9ZA 4AKPA 4DP7X 4DP6X 4YSRA 4BK5C 1OCOB 1BAWA 1BQRA 3FPYA 3WNJA 4X4KA 2FT7A 1SF5A 3NJKA 4E9SA 4L0PB 1NIDA 1XB6A 1ETJA 1MG2C 1PZAA 3OD3A 1PAZA 4YSEA 1E65A 3FYIB 1PNDA 3NJMA 1DZ0A 1EZLA 1W6WA 3QJUB 4HALA 3NT0A 3CVDA 5TK4A 3ERXA 1EHKB 1KCBA 4TXVB 3FSWA 3SQRA 1L9PA 1JVLA 4GP4B 3TU6A 2I7OA 2EILB 3X2QB 1GSKA 2BHFA 2IDFA 4HIPA 4JKNA 2AFNA 2UX7A 2VM3A 1RZPA 2IH8A 1IBZA 1PY0A 4E9WA 4NERA 3D12B 2YQBA 3X1NA 1GYCA 2IAAC 1WA0X 2HZHA 2VW7A 2E86A 3QQXA 2JKWA 1BEXA 2J56A 2H5UA 4HHWA 2X87A 5B7FA 3FS9A 2HXAA 2PCYA 1BYOA 1RKRA 4ZK8A 4HAKA 2TSBA 1IBYA 1KBWA 2YAPA 2XXFA 3KW7A 3HB3B 2DWTA 1SDDB 3SBQA 4AI7A 1KCWA 3ABGA 1NWPA 1KDJA 5FC9A 2CALA 1TEGA 2DY2A 1NPJA 3ABMB 4DP9X 4KOBA 3IN0A 3NSFA 2GIMA 2J55A 4P5SA 5I6PA 2H47C 3FQ1A 2GC4C 2GI0A 3FQYA 3T6WA 4Q89A 4E9QA 1J5CA 2EIKB 2XX1A 3GYRA 5B3SB 1GS8A 4YSQA 1AZUA 5D4JA 2XX0A 4QLWA 3SBPA 7PAZA 1A4AA 1L9OA 1J5DA 1E67A 1MZZA 1ILSA 3FT0A 2P80A 2WO3B 1MG3C 3T6XA 1CUOA 4A67A 2YAFA 3S3BB 4G7SB 5D4HA 3UACA 3RYMA 4WKXA 1JXGA 1ET5A 1JZIA 2UXTA 1JVOA 2XLLA 1OCCB 3KW8A 4BWUA 5PAZA 3EHBB 2YAQA 3BVDB 6PAZA 3NSYA 3T6VA 3WG7B 1PLAA 3G5WA 4K9JA 1WS7A 1MDAA 2NRDA 1KBVA 5I6NA 1ZPUA 4G72B 1KGYE 2QPDB 2UXGA 3S3CB 3IBOA 5B1JA 1OCRB 1PZCA 2OCCB 1TU2A 2W8CA 3FPXA 2AZAA 1OE3A 3CG8A 3ASOB 2OJ1A 1V55B 3FU7A 1AZNA 3X1FA 4HCIA 1ADWA 3QJTB 3IN2A 1WS8A 3S8GB 2VW6A 1L9TA 2I7SA 4UF7C 2YEVB 2Q5BA 4N8UA 1KYAA 4RH4A 2VSKB 3X1BA 2J57A 5AKRA 3JTBA 5AFAA 2ZWNA 1TKWA 5F7BA 3FQ2A 3X1EA 1X9UA 2PPEA 2AVFA 2PPCA 3NJLA 1CYXA 2UXFA 1J9RA 1ET8A 5E9NA 2PLTA 4MFHA 3ZIYA 1PF3A 1NINA 2PP7A 4YSTA 2QDVA 1PZBA 3FU8A 5I5JA 3DKHA 4Q8BA 4GYBA 2GHZA 1L9SA 5B1KA 4CSPA 1HFUA 2BP0B 5AZUA 3FSVA 4A66A 1W8EA 2XXGA 2XUWA 1N70A 3T71A 4E9TA 1GS7A 2FQFA 2UXVA 1ZDQA 2IDQA 1GY1A 2PPFA 5I5MA 3FSZA 4HCGA 2CCWA 1WA1X 1QLEB 2FQGA 4HCFA 4YVNA 2YAMA 1L9QA 4EF3A 1X9RA 2IDUA 2WSDA 5TK2A 4GY4A 2BP0A 1JZJA 2BWIA 2H3XC 3EF4A 3FU9A 2IDSA 4A68A 3FYEB 4CSZA 2FNWA 1I53A 3C75A 1BYPA 1ZIAA 1HAWA 3UGEA 5I6OA 4G71B 2VMJA 3CZUB 5B1BB 1GW0A 3OMNB 1V54B 3NSCA 1E5YA 4DP4X 2QT6A 3DTUB 4G7QB 2DV6A 4A2EA 4P5RA 4F7KA 1OCZB 2A3TA 3NP4A 1NTDA 1JOIA 3OM3B 1ZV2A 2P80D 2WO2B 1J9TA 1J9SA 1ZDSA 1JZEA 2XU9A 2XV0A 1M9WA 1CYWA 4M3HA 3DIVA 4HHGA 2BW4A 1OE1A 3IEAA 3CVCA 1AS8A 3OMAB 1DYZA 4DP8X 5A7EA 1UATA 1A4CA 2ZOOA 3PPSA 8PAZA 1B3IA 4BWWA 1WAEA 2YAEA 2RACA 1MZYA 1V10A 2HX8A 1PLCA 1SF3A 4KO6A 3TA4D 1A65A 1RCYA 2FT8A 1AZCA 2QPEB 2HLEB 1NICA 3CDZA 1JERA 2YAHA 4F2EA 1AACA 3GXUB 2YXVA 4A2HA 9PCYA 3N55A 5ANHA 3WKQA 3V9EA 2PPDA 1A8ZA 4JHVA 1BXAA 2X88A 2HX7A 5LDUA 1M56B 3FSAA 2FQEA 1NPNA 2TSAA 4YSPA 1JZHA 2B08A 3WKPA 1FWXA 4KO7A 4QKTA 3FU7B 5I6LA 3NJGA 3ZDWA 3AG3B 2VM4A 2CUAA 4WTQA 1KV7A 1ASOA 3MX0B 1HAUA 3S8FB 5I28A 1M57B 4DP1X 4HZ1A 5EHFA 2XWZA 1QNIA 3AG4B 1L9RA 2XYBA 2YARA 4DP0X 5I6KA 3NJFA 1ZIBA 4G70B 3PLYA 2XV2A 2FT6A 1BXVA 1PLBA 2Y1AA 1KDIA 3AW5A 2HRHA 4A2DA 2ZXWB 2EIJB 3L45A 3SBRA 3NJJA 2PP8A 3S3DB 1IKOP 1AG0A 1NIBA 3UABA 1SHXA 1NIAA 1AOZA 3PXLA 7PCYA 2XVBA 4JHUA 1ID2A 1R1CA 1IC0A 3WIAA 1AIZA 4FA7B 5F7AA 1ASPA 2VW4A 2LLNA 4DPBX 1AANA 2BP8A 3MBWB 5B7MA 3T9WA 1ET7A 2IH9A 3PAVA 1FA4A 1JZGA 2GC7C 3QPKA 4KO9A 1JXFA 3PAZA 4E9YA 4KOCA 1E30A 3EH3B 4GXFA 4E9RA 3WNIA 3NYKA 1XB8A 5I6MA 4YSAA 2EIMB 2Q9OA 2I85A 4BWTA 4G7RB 4BXVA 2PPAA 3EH4B 3N2JA 1AQ8A 1TEFA 1VLXA 2EINB 1SFDA 3QJSB 1CC3A 1OE2A 4YL4A 3TBCA 4AKOA 3V9CA 1YLBB 1AS7A 4YSDA 1PNCA 3GDCA 1E5ZA 2ZONA 1GS6X 1GY2A 3PCYA 3QJVB 4E9XA 2FTAA
chains in the Genus database with same CATH superfamily
1ZJAA 1ZSPA 1S78C 3X14A 3VDCA 1COBA 3DXAA 4LH7A 4U0QB 4XWGL 1Q6HA 1AP2A 1O6SB 3NFNB 3QEUA 2GJPA 1Q43A 5D96C 1FF5A 5J2TA 1PKXA 4PH8A 4BWAA 3RX7A 2JMRA 3FAVA 5JMOC 5D72H 4YSCA 2WQWA 1UT9A 3OKOB 1AH1A 1HTYA 4S2SB 3QNZB 1CFQA 3VM7A 1YEDA 4HK3J 2VZ3A 1U8KB 3HUJE 3EJJX 4P4RB 3FO1B 4URTB 3CZLA 3K4AA 2RNBA 1VERA 2COQA 5CR8A 3WJMA 2XN9B 4OZFA 3T4DA 4AIZA 5IB1A 1TTUA 3D39E 4OF5A 3F2LA 2QR0B 1JS4A 1O6TA 4KHXH 2AC0A 4GQQA 1RK0A 1VZHA 1P49A 2QPFA 3LRSB 3BWAB 5AYQA 3J7AU 5DD3L 3CRQA 4Q9RH 5E9DE 2PR4H 3B7SA 1DQML 3FAXA 1OSPH 4H88H 5DUJA 2R1YB 3L3KB 5GS1C 2VN4A 1Z9LA 3D08A 4LCUB 2P44B 1SLUA 1QBML 2V9UA 3H7BB 1FAIL 1VQKV 3UBGA 1FXHA 3LNFA 1W6LA 1G6UA 3DHJA 4UQBA 1CLOL 5C7ZA 2B1AH 4XOEA 4WV1C 3SKJL 1HNXB 4MJHA 5I8EB 1QW8A 3TP4A 3BAEL 3NG5A 4WCEV 3FMGL 2EUZA 1D5XA 1A0QH 2IDTA 1ZLDA 4LLMB 3QJHA 3GWJA 1V3MA 3IRPX 4RQFA 3BGAA 4AXWB 1R3HA 4S1SH 5IVOA 3BIKA 3LB6D 3SCMB 1ZHNA 3UP1A 4WI3A 3ARFC 2OTPA 2DQMA 1KIUA 1D2PA 2OZNA 3AEIA 1P7QA 1SLXA 1KJ2L 3OR7C 3STBA 1XMQB 4AEHL 5BS0B 3BVNA 1HHIA 2NQCA 1NC2A 4NXSA 3OZ9L 4HKXB 1UWEL 3G6BA 1NCWL 3KVQA 4ANUA 4MVMA 2DW5A 4G59C 2WXJA 2VTFA 4YBLC 2WLKA 3ALXA 3LQAH 1ZE3H 2OULB 1RERA 4N87A 2WIMA 2F66C 1RJYB 5LA6A 2XTJB 5D7JA 1SLVA 2NY2D 3BQVA 3C09B 1NCGA 4AX3A 1B4RA 4U1HB 4FNTA 4U1NB 2Q86B 3TGUH 1MH5B 2V8LA 1IXBA 2C9QA 3ZGHA 5J5EA 5MEQA 3S88H 4TNFA 3EYOA 5DJXB 3F05A 3UTSA 5DGQA 2YHGA 2AQRA 4DPCX 3I84A 4E9VA 1YMHB 1AAJA 4X8AA 3RJDA 1Z66A 2DM7A 4RMSA 2GK0B 3VFRA 5HHQB 5D6CB 1NH2B 3S3JA 2H45A 3L4VA 1WA8A 2F1MA 3PWPB 4NKGB 2VDPH 3UTPD 3BQUA 4YSRA 1UC6A 5GGQH 4UNVA 1QQDB 1Z7JA 5FKPB 5KVMC 1BQSA 2I9TA 1C16B 4UQCA 1P1VA 2WKOF 1H3WM 5JIQA 2ITDB 4WFFA 2E7BA 3FB8B 4W9CC 2XOKG 5CD5D 1YI2V 4PB9H 1CDBA 1NUDA 2WN3A 3MRIA 1I8UA 3NIGF 3DXAD 4MAZA 4TV9A 5ITZB 4M43H 4XP6H 3WXVH 3GFUA 2WZPD 2AMGA 4M7LL 3T3PB 4Y19A 3QUKA 2F4VB 4HALA 3V4UL 4F8QA 1RAMA 3D8MA 1QNZH 4ZYKB 1B2WL 1NDMA 3D9AL 5FHAH 1ZEAL 3P02A 3P2TA 4NQEA 4X4YA 4OPHA 2I7OA 4PJBF 2IDFA 3PFQA 4YJ2A 4AYGA 1O9WA 4F33A 1PYWA 1VZGA 2FJFB 3NA9L 3CMEV 3ILQD 2ZOLA 4E9WA 4U1JB 1I1CA 1MF2H 1VADA 2XZAL 5LGNA 2AK4B 4WSJA 5BRQA 1KB3A 1UKTA 2FIKB 4LCVA 2ARJB 1CXEA 2NY7L 4RGMC 3MMEA 4ZUUA 4X6DA 3HB3D 4GRWH 3AK2A 2WWOA 1I7FA 1RKRA 3QUZA 3VCLA 5L7XL 2CNZA 3UEZA 1QEWB 1E6OL 1N8RW 2ADIB 5LCVL 5DECA 2UY7B 4L3CB 3Q2CA 5ANMA 1VESA 5CEYA 4APQA 4R7DB 2OX5B 5IROC 1HHHA 4HLZG 4U1GC 3TJHD 3OL2A 1H3UA 2KG7B 3ABMB 3TBTB 3CXHJ 3RW0A 1R19A 2LLGA 5I1IL 5KEZA 4PLJD 1Q81W 2Q9LA 3IJEA 5F1IB 3ZDZE 4LF7B 4ZOLB 1AXIB 3N06B 1X5YA 2LU7A 3LZRA 1XD1A 3QC6X 3QNYB 1T4KA 4PJEE 3LN9A 5J6HA 4NBZB 2BC4B 5C0CB 1NAKH 1P7QD 2QPUA 4GMSL 5EU6E 1GS8A 4E5XA 4UINL 2BY0A 2XA8H 5HHOA 2WYHA 1MFAL 5E2WL 3FONB 4KROC 2CBTA 3C2SA 5EORL 4DFHA 5M7QA 4LCWD 2W91A 3AG2C 4O51B 4MMXC 3SOBH 3TBWA 3FZUD 2ROXA 3RYHB 3K91A 3MBEB 5T1KA 5J6GB 2BCKB 1G6RL 4H25A 4JY4A 1ZHKA 3PIQA 5DURD 3N6YA 4BM7A 4QHLA 5JA8B 3WTTA 2VXUH 1DQIA 1Q7YW 4HXBL 1KIRB 1BVLA 1NFDF 5CGYD 4A7QA 3VD2A 1R3IC 1DQQA 3DA0A 4PJ7E 3JAWB 2AGJH 5C0BB 3RDTB 1J88A 3MRJB 2EH7L 4GKZB 3UTSD 4KZ0A 1N0JA 2LJ2A 1UD8A 4KZEH 3UTTA 4B5EA 3A4EA 1R5WB 2J1KA 2Q7YA 3KW8A 4BWUA 4X8CA 3CFIC 1R3KC 5PAZA 4MVOA 3TH4T 4DR3O 4AC4A 4Z7WE 4URKA 1FUNA 3D05A 3C6LA 2UZYB 5IYZA 2HKFL 3U2SA 3S9DB 3G5WA 3LDCA 4FLYA 1FZKA 2ZWLT 5D1XC 4GIPD 3KMDA 2DQTL 5LQBH 3CZFB 4J9YB 1FRGL 3BQUD 5CJBA 1AI5A 1KGYE 4B9KC 2DYSC 5GZOA 1CGSL 3G6JB 3HIZA 3LKSA 4LSVH 4NC1C 5LBSH 2VUYA 5CMAB 3RDJA 2WXNA 3F58H 4WFFD 2XN1A 3CG8A 3ABKC 4KP4A 1KCSL 1WT5C 2IPKA 4JI0B 2ZUXA 3RIFF 4EPSA 2IBZH 2X3AA 3NIDB 5ADOH 2VW6A 5EOCH 4CU8A 1UOLA 3GS4A 1IC1A 2OYKA 4Y19D 1LMIA 1P1ZA 3RYIA 4N1CA 2A7WA 1SXSA 4HU8A 3DUHA 5TJWK 4TVSa 1CLZL 5AUMB 3L6FA 1T5XB 1HKFA 3AWFA 3R06B 4JDZB 4NQED 5D5ME 3VVVA 3QW9A 3WL9A 4Z1VA 5DD6A 3KXFD 4LVNB 3U7YL 4Y9BA 3IFNH 3NVQA 4P46C 5E9NA 4FKHA 5GIRB 1WFNA 5ADPH 2NCEA 2CGOA 2BIOA 1DUZA 4UNUA 4AL8H 3P9LA 4H8VA 2P24B 5E79Z 2CLRA 3CHQA 4RO2A 2IC2A 4Q8BA 1VQ4V 1UM6H 4TNEA 4IDJL 5CFHA 4C7UA 4F15C 2WK2A 4AQ8A 1D9KB 4EUPG 2BP0B 1JPXA 2BZDA 3GM0A 4FI7A 4RAVB 5H2BA 3O11A 2NW2B 3OF6A 5J1AA 1CGYA 1QNMA 2E5EA 3O3AB 1UFGA 2JKXA 1DBKH 2IPTH 4APQD 4EUPA 3U7AA 2KPNA 1IGIL 1K85A 3RGVA 3ASOC 1RSYA 1G6VK 1ZLSL 1Q72L 1S5LZ 2MH4A 3FSZA 5TQ2H 1D7DA 1IC4L 1WBZB 1OWWA 1QLEB 1ZVHA 2CCWA 1XF2A 4NO3B 1JDCA 3APCA 1Z3GH 3VW3H 2A0LC 1L9QA 2IH1A 2WSDA 1UD2A 3I2CL 5I1KL 3UPRA 3QEGH 3KWVA 2BFGA 3OZKA 4NQDD 1MHCA 1TXKA 1INDL 1IEAB 4B9IA 3FYEB 4UCFA 2V3FA 1OCOC 3CHPA 4AI8A 1F4YL 1U96A 5HHOD 1J7VR 2E47A 3ILEA 1CD9B 3ENEA 2XWEA 4P2RE 5JQHC 5C8YA 3CZUB 5LMUB 4QXVA 4EN3A 1GW0A 3NXSA 2JLPA 1V54B 5LWYL 4H7VA 6TAAA 4A04A 5JHBA 5IOPB 4LL1A 2QT6A 3QWRD 5L2KE 4QGYA 1N5YL 4FC3E 4R7NB 4JFDB 3TBVA 5AWNH 3STLA 2OMXA 1IAKA 4E42B 4NBXB 4LNRB 3IPBA 3CLEH 4X5PA 1MCSA 3FRPG 4M3HA 4MQTB 2ATPA 4EKJA 2W81C 3GMQB 1YY9D 3QUXB 5FYKU 3FT3A 4XC1L 3ZSSA 4PTTB 2CO7B 3UJJL 3V0WL 3MYZA 4LAQH 1KB9J 4YBQD 3R18A 4LNVA 4S1RL 4BWWA 2XVKA 3LKOA 1EAQA 1S9YA 2UZIH 3FRPA 3IU4H 5DEJA 3UTTD 4HCRL 4LLUB 5HDQH 3LRKA 1GH6A 1YUKB 3P4OA 4ELMB 1AZCA 3VI4A 4U6XA 3OWRA 1I8MA 1FPOA 4HF5L 3BA8A 1YQ2A 3QDGE 5I18L 1KIQA 2HJKA 2X6BA 3Q1EA 1N33B 1OALA 1UWGL 3N55A 1WJ3A 1T83A 2NZIA 5GZOD 1NCJA 3AGVA 1JK8B 4UXNA 2PTVA 4DO6A 1OAUL 4FRWA 1BXAA 4GXUN 2D0GA 5DRWB 1BF2A 2DAVA 2XWBB 3EJPA 3FSAA 1PDKA 3NTCH 1D5AA 2QQLH 1XCWA 2YPLA 3Q9QA 2GTZA 3CMAV 1H3XA 4NCC2 4UB0H 4XB7A 4Y4KA 3RB5A 3EJTA 1JNHB 3OX8B 2HFFA 3VFGL 2YIDA 1IGMH 4EDXA 1RUPL 1OF2A 3UDWC 3P4NB 4NZRH 3VFOB 4ZKIA 4DV3O 3A24A 1TQCC 5H94A 1KJMA 5EZIL 5C09E 1BBJA 5DJDA 4YN3A 5EOTB 2A99A 4DIXA 3VH8G 1I08A 2AJZB 3O6FA 5ITBL 4GQZA 4YHLL 2VMEA 4UAOC 4PJFF 3OSKA 5LCVA 1E5AA 4H37A 4NYLA 4WLCA 4DK1A 1W72L 4HUVA 2A6IB 3VH8A 5KBDA 2QFRA 4F9LC 4B3MO 1K6QH 3GIZL 5IW6A 1XBLA 1ZGLM 2JJSA 3ZTNL 5G4NA 5BMVB 3ARZA 3LXCA 1MCDA 2WQXA 3F5WB 3GBNH 2F5AL 1J1XL 1JP5A 4ZTOH 3N0PB 2EIJB 5HHPB 4NN6B 1FS0G 3SBRA 3WFEH 4FDWA 4HVBA 1MJ8L 2MWCA 3DROB 2CSPA 1EXGA 4XGZB 5GGRB 1GKOA 1UWYA 1VMGA 1JFFA 2IAMB 1XVSA 3RVWD 2UY6A 3MUY1 3FQRB 3RGVD 3ZL1A 4AK1A 2VDQH 1CI3M 1CK0L 2R2EA 4YE4L 4FA7B 5I73C 1ZLEA 3H9HA 1RSOA 4LU5H 4NSKA 5GSVB 4L1SA 3LXUX 1MSWD 3PV6B 3OLIA 3GMOB 4U3HA 4KJPD 2YSSA 3C5ZD 3ZO0A 3MACL 2VXQH 3SKNB 4ONOA 4MVSA 1OY3B 3VRJB 3N44B 4A1RA 1IFRA 2I27N 1ZT7B 2EIEA 4EN3D 3ZRFC 3LHAA 3OGCA 5E2VL 4YHHB 2OR7A 2Q9OA 1NBYB 3TZVB 4LPUA 3P9MB 3RILA 3S34L 3MRKA 2VDNL 2YOAA 4N0CD 5DO2C 4LSSL 1E4WL 3QJSB 1MSDA 3OAUH 1HILA 2EE6A 4BQ6A 1LD9A 3BAKA 5EMYA 4HJ1A 5IYDO 3KBHE 3IAQA 4AM0B 2VZSA 3H53A 3AWGA 2MEJB 3VXSB 2DLIA 4QD2E 3N1MC 4UCTA 1FJ1B 5B4MC 2K45A 2WB1A 4DR1B 1YNTA 3MOBL 3QR1A 1GL4B 4KVCL 4OGAD 3UO8B 4J5VA 2GUZA 1UWXK 2CLVB 1FNEB 1SY6A 2YUVA 5BZZA 1I7TA 5LXTA 3GKZA 3VNYA 3LNMB 1SF9A 2VLJD 4FZ8H 1RVFH 4OLYH 4YFDB 3CVBA 5T3XH 4EN2A 2AJXL 1LILA 2Z0UA 1TR7A 1WFTA 5CIPA 2D7QA 2R69H 2IIJA 2W80C 1OTSC 5FYKL 5FGSA 2YPLD 4U6VH 4M4RB 4Y4KD 1BW8A 1BPLB 1W91A 5I0XA 3HEIB 2G3ZA 4M5YL 1U8MA 1YJDL 1B4LA 1I3GL 4PVBA 1O5DT 5K9OB 2H6UA 4ZHQA 2LGNA 2YXHA 5I9QB 4WI6A 3RVYA 2Q3AA 4F8TA 5F0LB 3UYRH 3KVPA 2AANA 1HWGB 1HZHL 5J9PA 3WTXA 2AEIT 3CH8A 3C5XA 5E7BA 1BQUA 4WJG3 4KKNA 7CGTA 3O6FD 3JWOH 3KL5A 3S6CA 1BCIA 3IKCB 4F2FA 1KECA 4B7IA 1RP3B 3V7AE 1N6QL 5EF2A 4O4HB 4GKOA 3BO8A 3FCBA 1A7RH 3G6AA 4JV5O 4DHLA 4FLUA 3VQYA 1RK1A 3Q01A 1GCFA 3NJNA 1IAOB 5H37H 1ASQA 3W11D 4FL4C 2ZYSA 1QPXA 2RMKB 2XWTA 4LSQL 3THOA 2KPWA 3CHOA 3DRTA 1AXSA 4G6MH 3TNMB 5HSFA 3HS0B 2JGDB 2UYLB 1Q9WA 4HS6A 1LDPH 2D0HA 4XNQA 3UXFA 3GSNB 5BV7H 5GJTH 4LHQB 3R19A 1JF6A 1HXKA 5DI8A 4PBWD 3LMJH 4JKKA 5CINL 3HKEA 2CHDA 4Z0BL 1J87A 4CDHA 3NZ8B 4OV5A 2WV3A 4J6IA 4MDJB 4MD0B 2C34A 2QEJA 3US1A 3BRCA 4LBEB 2W6IG 3RB7A 3VFUA 3GSWB 2NY5L 4X7SH 2IH3A 2DL9A 4PS8A 1P5UA 1U3ZA 2WQSA 3RWRD 1DVYA 3QBTB 3GS7A 3BOVA 3MJ9H 2HRGA 3LSUA 4DJMA 4X20A 1U8NA 3DI3B 3L7EA 1L5GB 5C0NC 2UWEA 2NYZA 1WC7A 4MVRA 3DLQR 1IMHC 1N0XH 3D4CA 4WTZG 3UX9B 4NRXA 1KKDA 4HIHB 1GN2A 3QK0A 5T1MB 3B4NA 3WB1A 1XL6A 1WTLA 2NY2B 4YSOA 1AI1H 4PJXE 2Y69C 3KCPB 1N8ZB 1Q5OA 2WKLA 3HPJB 2H8PB 4GO9A 3SDCA 1BXXA 4Z76B 4LH6A 2YRZA 4WTZA 4WDIB 5GJSH 4S1QL 2PTMA 5LXGL 3IDJB 1I8LC 1LNUB 3E3QE 3N1GC 3HMXH 5EO1B 4DP6X 1FGNH 4D94A 5F7UA 4QR7A 1F4XL 1QACA 3SSGA 2J43A 2B1IA 3KPMB 1HNYA 2AXWA 3NJKA 5DJAA 5ECJE 3AG4C 3G5XA 4JFED 3KPRE 5E99H 3CCLV 5CO1A 5DLLA 2GBTA 1XH3A 4F92B 1XGRA 3FYIB 2AITA 4P2ZA 3BKJL 4FI8A 3NJMA 4JHWH 3DXAB 2OK0H 3W2DL 1AP2B 1P84F 1KU9A 3KPOA 3PHOB 3GKWH 1SN0A 5FUOL 2NY1D 3V6ZB 1BGXL 3JVGC 3WUWG 3K57A 2EIDA 4MMYA 2AFNA 2UX7A 1MG1A 4OCWH 1X5IA 4P3DA 1YITV 3H3PL 3KH4A 1IBZA 1NC4A 1Y7VA 5KLVH 1CFQB 1PY0A 4DKEH 4Z7OF 3B7RL 1WE5A 3CH1A 2CUMA 5JDSA 3WUWA 1PD0A 4IHJA 2AP2A 3LKNA 3QCTH 2Y7QB 1ROWA 3WJMB 4WF9V 3ETSA 3FUMA 4GRMA 4RQQA 4O02A 1QSVA 2NYYC 1F97A 2QKIC 3TBYB 1HZKA 5A2AA 4PRHE 1NUNB 2VXVH 5EFIA 4P3CH 4YDLB 2Y25A 2OI9C 2DWXA 4LCYB 5SX5H 1CICA 2ILMA 4OGZA 2QZQA 4TOYH 3KW7A 3HB3B 4LPCA 1IM9B 2A74B 4J3BA 2F61A 4XC3H 4IRSC 3SJBC 1BZ8A 3PGCA 1DBAH 4DW2H 2DY2A 4GG6E 1NLBH 4U3CA 5HDBE 3IN0A 3MCKA 1XOUA 1HH9A 3KVDD 2I26N 1MFVA 1Y6KR 4JE4B 4JPVL 5E1IA 2P49B 3BEHA 3SKUD 1JG9A 2ALWA 1D5XB 2NQDA 3ZPDA 2X4PA 3GI8L 1RZIA 1WZ1L 4E9QA 1IBGL 1ND0B 3GYRA 1R3HB 2JB5H 4PBDA 1AFVL 4GSDH 2WCSA 3BIKB 4HJ0C 4C56A 3T0AA 4PIBA 1I9EA 4OD1L 5FS5A 3RFZA 3TL5A 3CQPA 5EBMC 5I8CA 4Y16C 3IWUA 4HKBB 2G60L 1HHIB 1DN0A 2NTSP 3HN5A 5ICXA 3DOIA 4QJ5B 2JCCA 1XSJA 1OANA 1G7QA 3ZKND 3FH5A 4LCWB 2NT0A 3M1CA 4BKSC 1G9NL 1PEWA 3RWGB 4PG9A 1B4TA 4R7XA 5DS1A 3S3BB 1J5HA 2ATKC 3LS5L 1BZDA 4OPAA 1KLFA 2A9ML 2HVBA 5DURB 4DKDC 3TCTA 1WFIA 3MPCA 5DT1L 4R4FH 3QF7A 3IK2A 1F8TL 3ARUA 3L54A 4XPFL 1MW2A 2I25N 3OB0K 1GM8A 3CN1A 3HE7C 3M7FB 3SDCD 4CJ1A 3HR0A 3EOAB 1M9SA 3P0GB 1WLHA 3GRWL 1IGYA 3UTSB 3WG7B 4K9JA 4BIKA 3WO4B 4UOQA 1S7QA 4RFEA 4AYBA 1U92A 2V7NB 5JZ7C 4KH2A 4PRPE 5K39A 1ZGLP 3S3DB 3BVVA 3VFRB 2YS4A 4BUGA 2V8MA 3QH3A 1XAKA 2JKSA 2YK1H 4MS8C 5EZOL 2P4AB 4LZKA 4B53A 1NR7A 1QWUA 4JPKL 4ENEC 1UEYA 2E0PA 2C7UA 5DMJB 5IVNA 4DR6O 4HCIA 4ZFOL 1O7SA 2O6DA 4DQAA 3IN2A 1E9QB 2GG1A 3IPEA 4Q6KA 3K2KA 5IVXF 5JW4R 1L9TA 4UF7C 2R4RL 1YF2A 4LLDB 4Q2ZA 3RZCC 1KBKA 3ECUA 1SLWA 5BZWA 4H26A 1FLRL 4CVZB 1DANT 1F1GA 4DAGL 1WBXA 4Y19B 3X1EA 3RWDA 3GJFH 5DUML 1DLFH 3NPSC 4K3JL 1JJ2U 3OLGA 4GQRA 1PNKA 4ZS7L 3H42H 3UTZB 4IK6A 1RJCA 1NDMB 3ZKMD 4B9PA 5IV2B 3OHXA 1SJHA 2UUCB 4WI7A 3RAJH 4OR1A 2VB5A 3KXFB 3VB9A 2FGWL 4X9FA 1PYWB 3MNVB 3L7FB 4XMUA 2HP8A 4EZLA 3L5WA 5L4JA 4K4KA 5JQGA 3U82B 4I9WA 2R56H 1R3LC 1SDAB 5KSAD 3QDMB 3ESUF 2WY3B 3SE4C 1M71B 3ETEA 1N70A 4ZUUB 2OYLA 3VI3E 3ZE1E 3CC2V 4OIBA 1VHPA 3H1JH 1RZJL 5K69A 4NIYE 1V7NH 3NEOA 3D0AA 2P6JA 4XNYL 2H2PD 2BPBA 2C9RA 1RUAL 2Z6FA 4APQB 5ANMB 5AOKA 1E3XA 1AYRA 4AYMC 4IYKA 4I3RL 3QIUA 3VG0H 3CVIH 2LFRA 2R9HC 4PJGB 3T4AA 3TIEA 2H3NA 1QVFU 1K8AW 4BIUA 3HHMA 2P9RA 4MXWH 2FJHA 5EYPB 5CB4A 2V2XB 4L05A 4NQDB 4Q9QH 2DQ3A 3CSFA 3QCVL 4NWUH 4N8PA 3GGWB 3HUJF 2X9ZA 1A6ZA 3ISWA 3ZE0E 1VQLV 4GMTL 1QFHA 4KXBA 4ORGA 2D7OA 1U8LB 4DUZB 4HW6A 3NP4A 4HZLA 5DJYA 3LEVL 2G75B 3R7QA 3SPIA 3Q2VA 2FKXA 1CDHA 2BW4A 2VC2L 1U8HB 1LJMA 4H25B 1QG3A 2Z4QA 5A7EA 2F58L 1UATA 1ZHKB 4JY4B 8PAZA 2W9DL 5JXEA 3PIQB 5IQ9A 4JPWH 5DO8A 4W4OC 3O45B 1SM3H 1OXYA 3NAAL 3VJ6A 1ZV9A 5DHDA 4N8VG 4R4ND 3UTTB 3WY2A 3CCQV 2PO6A 1R46A 3E9TA 3OJ2C 4N1EA 4PJ8C 2A9CA 1E2WA 5D2LF 5D7IE 5B3JE 3FTUA 1OP3K 1A6WL 1SA0A 5FYKD 5IYZB 3U83A 4AGQA 1AZVA 2CHZA 1RP8A 3WD5H 1SZTA 3U2SB 2PPDA 1L6PA 5F0PB 1FZKB 2IGFH 1Q38A 2OW6A 3VSVA 2FIRT 5MENA 2H26A 4N8VA 2JELL 4FQQB 5EWIL 4JFWA 1NFDB 3GWOA 3LKRA 3GO1H 2H1PL 4DK3A 2WIIA 3JV4A 1Z3RA 3RVUD 1QFWM 2BOBC 3QG6A 1GTOA 3MAWA 3PWJA 2IPKB 4IK7A 2NN4A 4H5SA 1HR0O 2ENPA 1A8JH 4BQCA 4ZPTB 1DEEB 5I8KL 2H6OA 3MHSC 1DJSA 2A9HA 1OARL 1XEDA 1SVCP 1P1ZB 2E7HA 3VXPB 2DICA 1JHLL 3OTOB 4MWFB 4ZMPA 4QYOA 2CUIA 1VQOV 1MXGA 2OXHB 4IJ3C 2QSCH 3HHSB 1B4JL 3QUML 5KJRH 4GKSA 1GTNA 3ZMUA 2NLJC 3W56A 3ISYA 5I6KA 1ZIBA 2P48B 5H2FZ 1WAAA 4NT6A 5HHXH 1E6JL 2DJVA 2JNZA 5AW5B 3E8UH 1PLBA 4CN1A 2ZKXA 4JZOA 1D5RA 2J1ZA 2ZNXA 1YYLL 3Q8FA 2P5WA 4I9WD 3EIFA 3ZKQD 5IIEB 2CLRB 1ZT4A 3NJJA 3RWHB 1OAZH 3POCA 4G6KL 4AG4L 5CBEA 3POHA 1CT8A 4XXCC 2GSIB 4L8SA 4IIQA 3E8FA 4MTGA 3LQZA 4K71B 5DQJB 4KXRA 5H2BB 2YEQA 1MWOA 3UZVA 4I9QA 2AJUH 2ZE0A 5CXPA 4PJAE 3T2LA 1R1CA 1ZS8B 4HXAH 5I75B 3ETDA 4Y5VB 4EUPB 3LXAA 1KJ2B 2Z8VC 4DPBX 3HPLA 3RGVB 3MV8A 4X66O 4JUSA 1ZGLA 3BWSA 5C0GA 3TXSA 1S6NA 3QIUD 4G6FD 4X6CA 5IT2H 5ALCL 3ZT6A 4HPOL 1U8JA 1G7MA 4KK5C 4BFEA 1OM9A 2DQFB 3CCHB 3E3QC 4OM0L 4CH5A 2OBGA 1M6OA 3PAVA 3RWIB 1MHCB 1CFVH 1FHGA 2DQDH 5EZYA 1Q9KA 3OKMB 2ZCHH 3C5ZB 1NGQL 5GHWH 3NYKA 2Y4SA 5D2NE 4DV6O 1G84A 1Q0EA 4TV3A 4FQ1H 3UMNA 5BZBA 2O5XL 3P73A 1MFDH 2A6KB 4CC0A 4J39A 3PWLB 4UCUA 4LFAB 3CPWU 1TOXA 4NCC1 1GZQB 3F04A 4U1SA 1UZ8B 4JY5L 4FLRA 2EC8A 3TBVB 4EI5D 2QPSA 4R0LC 2BIHA 4Y5YB 1PKQE 1P0SE 4AKOA 1AS7A 5JXED 5HGBB 2VLRB 4L4TD 1E5ZA 4NQCA 4YIQA 3CU7A 4XCFL 3FT3B 1HL8A 1XF1A 4GT7A 1U30A 4TUJB 3V95A 2XJLA 5DWUH 4E9XA 3IGLA 1S9YB 3KLAA 4JM4L 2H3OA 2PO6D 5J0BA 1O9HA 3LRHA 3K8LA 3P4OB 3H1ZA 5EN2B 2FYYA 3CCRV 1I8MB 4XTRC 3FH7A 4RX4A 5MEND 5L3DA 25C8H 3STZB 4TNWF 4PD4F 2FQDA 3ME0B 4HMDA 4JM2A 4HSCX 2VLJB 1CFTB 4FFZH 4NJAL 1AP5A 1MVUA 2A1WH 4LO9A 2IM9A 1PKOA 4WFGE 5PCYA 4UZSA 5FUZL 3EOBA 4U1IB 2YPLB 3C5JB 3CBRA 1AKPA 2YAOA 4Y4KB 4JGNA 1MLCA 3LIUA 4YIPA 1HNZO 1UG9A 2HFFB 4KXCA 4TLSA 4BDVB 3T3MF 4EDXB 1H3PH 2PP9A 1WFJA 5C9JA 4U7OA 3SB3A 2DRUA 3RTLA 4DXWA 4ZNEE 5DSCB 5H94B 1S46A 4U05A 5LB1A 4HYOA 1GSMA 2X1OA 4PJ7F 4Q4IA 1BBJB 3OD4A 2DEYX 2DYPA 5F9JB 5E95B 3MV7E 2X3BA 3GINA 3KD4A 4XBEL 1ULVA 1N64L 5F1KC 1JN6A 2AEPL 4H4NA 2B9AA 1I9RH 5JVDA 2B3RA 1T21A 3MODL 2NSMA 1DO6A 4Z7WF 1J11A 4JDVA 3UAEA 3S36L 5KVGE 3HG0A 5KSBE 4HUVB 5AW9B 4DR2B 4P5TA 5IW6B 2J88H 4MZ2A 4HUMB 1RI8A 3IFOA 1DJWA 5DZPA 2K8QA 1IJNA 2XY2A 1F6LL 4R3SA 4JFHD 4HLEA 1ZVNA 4LSPH 5GGVH 1QHQA 3TN0C 2GABA 3SE9H 1WSST 2BIMA 5DZNA 1Q3EA 1Z0MA 3U9UA 3ZKXC 2UY6B 1ORQA 1OCWL 1ZA3A 3MV8D 3IYLW 5EZJA 1EMTH 2DEXX 3ESOA 3LSQA 4PCYA 1ZVSA 3U36B 1WIOA 3QARA 1RSOB 4KJQD 4NSKB 2ICWI 1Z9OA 3BUIA 3AY2A 1A7NH 4EEEA 3P40A 2D7MA 3T77A 3UJTH 3BIBX 4DRXB 4X4XA 1J5OH 1G6RB 2VDLL 2YSSB 3F6JA 3ZR6A 2R9IA 3DC5A 3UCQA 4FFWD 1JYWA 4KQ4H 2FX8H 1OLLA 2WLIB 1BMZA 3QCUL 1A3RL 4FQJL 1BOGA 1VENA 3PGFH 4P9HL 3HKDA 3LS4L 2OR8A 2DIEA 5CN2A 3Q05A 4JR9L 1W0YT 4GKJO 2C4FT 3OGOE 3JV5A 4OM1L 5K9QG 1S7SA 4RBPK 3LPOA 1CPYA 4ZSOA 4MBOA 4B27A 5FUCE 1DLHA 4TYUA 1FYTE 1LK2A 1SMDA 3T1YB 1IAMA 2TRHA 3D30A 3UG5A 4YPJA 4XO3A 5EB9A 1AMXA 4GFXA 4AIXA 4DP7X 3AMLA 1IC5L 2FYVA 2Q20A 4TULH 5GSRA 4HBNA 3MROA 3FPYA 3SPVA 3WKNA 2F74A 1I75A 2QE7G 4YBHA 2EEXA 1A6TA 1TQTA 3D18A 2JJUA 4CC4C 1A9BA 1YNTB 3HFFA 4FG2A 1KJ3H 4JFEB 3Q44A 4QKXB 5LGYA 2GUZB 2FL4A 1NDGB 3ILDA 1I7TB 5GS0L 2ZXQA 3HKCA 5DD1L 3TO2A 3BKCL 4IKKA 2Z7ZA 3ZO9A 5CCGE 3S36X 1JTPA 1MIML 3QUMA 3BRFA 2A5UA 1R0AH 1GSKA 3NCEB 4O9HH 4JKNA 5CIPB 1S7UB 2Q76B 2MCAA 4DN4L 1KUQA 2IH8A 5ICUA 1K8IA 4AW4A 1MREL 4NRYB 4ATWA 1HSBB 2NY1B 3PL6A 1WP7A 4LIQL 5EPMA 4I8DA 1WIUA 4LRNH 1C8PA 3BPOC 2HZHA 4ZHQB 4GKLA 2EXTA 3TJTA 1YO4A 5J1SC 3BFRA 2OXGA 4F58L 5DEFA 3HZVB 2DYPD 4YE0A 1CZ8L 5FPOA 1KMIZ 3UBFA 5CAYB 5I1AA 4QHNA 3FB7A 3OPZH 1RLBA 4YC2B 4GW4B 2F54D 2Y7NA 1HX0A 3HCVA 4L3FA 5KA6A 2NDGA 4RMTA 1E1RG 4P5TD 3HNSL 3LCYA 3P77A 3F12A 2F93B 4KK9D 5KYUA 4NO2B 4WENB 2K3HA 1MFEL 3WNOA 2XWTB 1MWAA 3DRTB 1AXSB 3HG3A 1SDYA 2DQUH 2OMTB 2LGQA 2DMCA 4XNQB 1QSED 2X70A 1JWMA 1KXTB 2LT9A 5FWRA 1GC1H 5DVLA 2P67A 1S72V 2EIKB 5HP5A 1D5IL 4J27A 5DI8B 2WSSG 1BQHG 1O9GA 3T0DA 4CU7A 1JE6A 2A6JB 4OX9B 2FD6H 4JHZA 4EOWL 3W9DB 5JJJB 1RHFA 3C60C 3PJSK 2YPVA 4X80L 3DX1A 4XRCA 2R0ZH 1BQHA 2EYSA 1OP4A 2E27H 5K1PA 3L9YA 4G7VL 1MXDA 3PF2A 2ZM6B 3CZSA 2XZQH 3MGTA 2IH3B 2V9QA 4UILH 4NJ9L 1P5UB 1KCUL 4R7CA 5D4HA 3EHBD 1INQA 1P4LA 3ZT5A 5IY5C 5FB8A 4X20B 3L7EB 2GTSA 3KGRA 2UWEB 3WAKA 1WC7B 4AGMA 1KIPA 4NM8H 4NRXB 3ZMEA 1C12B 3EYVB 1BQ0A 1CD0A 4GYCB 4TL5A 1ZHBB 2APSA 4N86A 3IJYA 5ESAB 2AQSA 2YKLL 4X62O 4IU2B 1AR1C 3WFDL 1PL4A 5AAWA 4LQFH 3W9EA 4PRID 5C08E 2QWQB 5IGXL 4R97B 4AVIA 1TU2A 5HGDB 1JPTH 4OLZH 4AE0A 2ITFA 4MRBA 4Z95H 1DVTA 3EUDA 1MNUL 1BVOA 3NABL 4DO2A 4WIQA 1SYVA 3G5XB 3MXVH 3FQNB 3EDDA 3GUFA 4HH9A 5DTFA 3TO4C 1ETZB 4PG2A 1F4AA 2ADYA 4AW7A 1R1BA 3GBML 1LVEA 1S3RA 4ODUA 4ZTEA 1QYGH 2VE6A 3CFDB 1TAEA 2OJEA 2E9BA 4JZNB 1XGRB 1Z5HA 1TKWA 4OD3L 5F72S 1MCPL 3TGXA 1VAHA 4JYCA 1C5BL 4R96A 4ZOBA 5LMNB 4QXUH 1BFTA 3IDUA 4OFYA 3ZYJA 1D7CA 1EH9A 1CL7L 1S9WA 1MJJA 3SBWA 3PL6D 1BZEA 1COWG 2E75C 1GZPA 3L5IA 4MMYB 4MXQC 4JG1L 1OTTD 4QRFA 1W72B 4HLJA 4XE5B 4BA8A 2ZT9C 2IG2L 3FU8A 4WK4B 4Y5XC 5F71A 4DVBB 1UURA 3HNVL 3NRQA 2UXDO 1YUHB 4OSUL 3VWKC 4GYBA 4X98B 3WUWB 4DSYA 3IKKA 4PR5B 5DJZB 2RQ6A 1E4XH 4UT7H 3DOSB 1KLUB 3F64A 3PUUA 1T4WA 2OL3L 4JFYB 3V52H 1FL5B 1YHQV 3KS0J 3Q1SL 4GRMB 3H01A 4YDZA 5JW5A 2CG9X 1G4YB 3P4LA 8FABB 5D2NC 4J10A 3EGDB 3L72H 5KSAB 2VQFO 3TFKD 3MA9H 3GM8A 5DYOA 5EFIB 4G7YL 4IRZH 4MMZC 2YUWA 4Z7OB 4MTOA 4DV1B 1OZ0A 15C8H 1VGEL 1IBHA 3MRLB 3AADB 2BOLA 3HRPA 1WWAX 3WFCH 5CU9A 2MIZA 4C58B 1TSRA 1K5QA 5KG9A 2BWIA 3FB6B 3PGCB 5KHGA 5LL6Y 1VQ6V 2QADC 3CC1A 4JKMA 4P04A 4RIRB 3OVUB 3VQVA 5DVOA 5B8CC 1CLYL 3UT5A 1HOCA 4NZFA 4M3JA 1YNLH 4J41A 4QGPA 5I66A 1ZIAA 4Z1PA 4UV4H 5E24E 2X89D 2KSDA 2DBLH 4I0PC 4O2EA 4G71B 4I85A 4AUYA 4QTIH 2BJMH 1RZIB 3O6MH 4YDMA 5DQ9B 1E4KA 3UC2A 1JHKL 4LVHB 3IETA 3DX6A 5LBGA 2ZAGA 4GUPA 4YFLI 4JASA 1DUYA 1XD0A 2VDNB 3DWTA 3V6OA 1IX2A 3WIHL 5I8CB 3GPEA 3NACL 5EU4B 1DN0B 5CNHA 4G8FA 4UQ3A 4XNMA 5CGTA 2QEXV 4YIOA 4UB8Z 3Q13A 2G2PA 4BKLA 1M90W 2ZSWB 1PLCA 5BO1H 3RP1A 1KLFB 2QPEB 3QWOA 1EWHA 4FHKA 2O5YL 2YAHA 3K6NA 4UM9A 4CUCA 4XB3A 3MRCA 4P5MB 3GXUB 2A9BA 1FBIL 5IQ7L 4U3SA 3CP1A 1RJLA 2QGBA 4BZ1H 2CO6B 4KXZI 1NCDL 5E6IB 2B39A 1FNLA 2H0FA 1DVUA 2WPGA 3MDJA 1OTUC 1S7QB 2VKWA 1U92B 5KVEL 2X2HA 5IFAL 1AKJB 5K39B 2Y36H 1LEGB 5AG9A 3DJ9A 5ACZA 4GAFB 2R0LH 5H6RA 4WY7L 3E6FB 1ED3B 3QH3B 1JZHA 3S2AA 2OTUB 4U31A 1N8OE 2AQ2A 1KPRB 2IQAA 2EP6A 3K3QA 2L7JA 2Q6WA 4M03A 3N43F 1M93A 4IGBA 1DANU 4BSJA 1E1QG 4QRSB 4LRIA 3ZRWA 1KV7A 4JQXC 2DOSA 5JOPD 1E3FA 5FLUA 4Q2ZB 4OFYD 5DZVA 1B6QA 2X4NA 3B5HA 4H26B 5F6IC 4DP1X 3CZEA 2VUKA 1FXKA 1S3KL 1L9RA 4KVNL 5F7MC 3TA3C 2CRMA 5GISH 2CO2A 4DGIH 3QULB 5CLYA 3IVKA 2F18A 2EJ7A 3IXAA 4FXGB 1SJHB 4BK4A 5IR1A 1FNGA 2NT1A 1ECZA 5DS8A 5EEZA 1AP6A 1QMUA 1PZ5B 1UWFA 2G5RA 2ZXWB 4M1CC 4LKXA 4OGXL 1VA9A 5HGAB 4B9JA 4DN3H 1KBHA 5FM8A 3DGGA 3Q6GH 1IKOP 1DZBA 2QTEA 1TVHA 3LZQA 4JFZL 5A2FA 1NCIA 3KNBB 4Y4FC 3QG5A 1EQWA 3PU7A 2ICES 4G1MB 4J6RL 2YMOA 5IB4B 1BYNA 1AIZA 3L71H 1V3JA 5DRXB 3ZT7A 1IIKA 4GZRB 3WFBL 5KS9A 1BD2E 3V4PL 5FUCC 4X5QA 3MN8A 2ZUUA 4YXHH 2RH0A 4IHBA 3WBDA 1SQFA 3HC0B 4R4BA 3K5MA 2X6MA 4X4MA 4WZ9A 4MB1A 4G6FB 1BS3A 3T4AB 3UYOD 2H3NB 1CXFA 4WU7A 5FO9A 2FJHB 3HW7A 3MRRA 5CB4B 4RCAA 3AY4A 1I3VA 2EECA 1XIWD 1XGQA 4UU9B 4G6AC 1YEEL 4X7TA 1A6ZB 5AENA 5LP6A 1JK9A 2Q2LA 4X6EA 2Y3NA 3WSQL 3D7PA 5EUOF 1J5EO 3O4LD 3G7TA 4HZLB 4L2YA 5E8PA 5E6YA 1YLBB 3V9CA 4PJBA 4L37A 4JQIH 4ONFL 4ZXBA 4XXWA 1I8IA 4UBDD 4EI5B 1SQ2N 2Z4QB 1BLNA 4M5ZL 3LQAC 1ZE3C 3T65A 4L4TB 4JAUA 3KYMA 5T5NF 1U97A 4NLHA 4MA7H 3VFVA 1XHXA 1JXDA 4L3EA 5I5IA 4DEPB 2H94A 5GS0D 4LOUC 1ZD6A 3TASA 3L81A 3BP6B 1L9MA 2HX9A 2PO6B 3PNWB 2ARWA 3MLZL 2EKJA 4XAKE 1DJIA 5JO5B 5LBVA 5T33H 4AILC 4LGSB 3ETQA 3MLTB 2H0EA 2C3GA 3SYAA 4N25A 3PAYA 5MENB 2H26B 4FQCH 3JT2A 4N8VB 5E5MA 1P84J 3MLVH 4JAMB 4AV0A 3ESMA 1F4WH 3HI6H 2Y23A 1E8WA 1C5CH 3TF4A 3L1OH 1B0GA 1EAJA 2WXRA 3BE1H 2A9AA 3GRGA 4PV8A 4YNYB 5DFVD 1QD0A 2E9WA 3SDDA 4IGBD 3QG6B 4UANA 3T5WA 5KTEL 3GJEA 3PWJB 3GMNB 4Y1AA 1XGZA 4UIKL 1Z5VA 4H5SB 2HG5C 1PP9H 1NCUA 1DCEA 4ZW6A 1YN6B 1RU9L 4YY3O 1IILE 2BSRA 3ECBA 2JE8A 1LGVA 3IE9A 4KI5D 4RRPM 3BUPA 2BX5A 3SJAC 2H2SD 2AZUA 4MTMA 4QE9A 1QFWH 3F7VC 2JWYA 2O5NA 2V2WB 3B9DA 3SJVE 4AYSA 3WLBB 4XHJD 4J3OG 1AY1H 3D36A 1IKFL 2N4IA 5GRYA 4K3EH 3NESA 3QIBC 4QWWC 5D4IA 3EO9H 3FFDB 4QNPE 1FVDA 1RZFH 4PEEA 1OGAE 3NSDA 1YEHL 1MFCL 2CDGB 4MDIB 4JZOB 1T20A 4B50A 5CSBA 4UDTB 5D1ZC 4GP8B 1JFQH 2JK5A 1ZT4B 1MAML 1HSAB 1O9VA 3X13A 1ORSA 4DEWA 5CBEB 1OGSA 1U0QA 3P3YA 3THMH 2ZOTA 4WWKC 1U8IA 5T3XE 1YEJH 4PGZA 3UZVB 2BWDA 1MQKL 2O61B 5HVHC 4IKLA 4KRPC 1U8CB 1UA6H 4LPXA 1MHPL 2L4OA 2EVIA 5AEAA 3NRFA 4PPTA 3V5HB 4P9MH 5F8QC 4KKBC 3EBIA 3K6IA 3VDAA 1U8JB 5ES4B 3ZRXA 4M93C 2BFVH 1WNSA 1M6OB 4LE8A 2RIKA 3GSUA 2UXNA 3F7QA 3H2WA 4I18A 4FAAB 5LKNA 2ID5A 2KL6A 1A14H 3HZKA 2IJKA 3WHE0 3GSRA 1J0ZA 3E83A 2HKHH 4G9FE 3P73B 4K5LA 4D9LH 4YPGB 1Q9LA 5E8DH 5G55A 3FFCA 4L8DA 1J12A 1X5MA 2GAZB 1RZ7H 4PW9A 3PN1A 4I3SH 4ZMAT 1UOVA 4U1SB 4ZXBD 4F8LA 5CGMA 4G3YL 4PJIF 2CGZA 4WO4A 1EFRG 3D6GA 3VI3F 3GEWB 2EDYA 5IBLD 1M57C 2KLRA 1S7VA 1IBMB 4Y2OB 5LGJB 5A9GA 1KV3A 2JJVA 2UUAO 2I60H 1Y6XA 2FGZA 5H35A 2A9DA 1PAZA 4ZFOB 2LE9A 3QXUA 2KYIA 4RDBA 4N2GA 4N20A 1P4BL 5CEZL 4AT6B 1P9MA 5BXFA 1AGCA 4ODSL 3OXSA 2ADGB 4J7JA 3NT0A 2NR6C 5MEPA 4QE7A 3PABA 4Z7VA 3CN3A 5LGHL 4JO1H 4GW1B 2B8OT 3CC5B 4GP4B 1O0VA 3X2QB 3ZE0F 5B1AC 4OLUH 3SDDD 1OSEA 4KMQA 3X12A 4UV7H 3RL2B 1I85C 2ZKHL 2LABA 3RUGE 3CFUA 1SXAA 1FH5H 2ISDA 4FM2A 4Y1AD 3ZTJH 3EOBB 3M1OA 2DQIH 1N7ML 5DU7A 3UO2A 5J7CC 1MLCB 3MOQA 1KP2A 1MW0A 3GMMA 2L6LA 5DDHB 2JIZG 4FGMA 5HHMD 3PP4H 5IG7A 4A38A 2NCMA 5D1ZI 2OQJA 2VR5A 3SDLA 1KUMA 4N8CL 1BVZA 3JUZA 1QLFA 2JTDA 4OJEH 2DYPB 3NZHL 4JRXA 1R5VB 1LP9A 5A2CA 1KCVH 5BXZA 3M7OA 2VZTA 1VCBC 2YXLA 4FG0A 3V4PA 3JV6A 5L8JB 1KCWA 1T21B 4HIIB 4L2LA 2B0SH 4PUBL 5D7IF 5B3JF 3IJ4A 1CBJA 5EU3B 3T3MB 2F54B 2XXMB 4J3OD 2XUMA 3KWXA 5LAXB 3IXTB 3LX9A 4TLKA 1CDJA 3OR6A 3OQ3B 4P5TB 1YAZA 3QXTA 5CZVL 3FQTB 4AL8C 2BS71 2FLBT 1S7TB 1W15A 1HXMB 2NNCA 4Y9CA 4OI7A 4R3SB 4A37A 5C0AE 2DWEC 2XX1A 3U79A 5BZXA 1AZUA 5IJ9B 3F5TA 1QSEB 3IDIB 3T4YA 4D2NA 3ASWA 3FU5A 2DWDC 4QF1A 1MRDH 1QPKA 4FNLH 5D7LE 1ORQB 4HIQA 3C2AL 4FLSA 3H8NA 4TPRL 2Q4PA 5EZLB 2ZOUA 4ZAKC 1NGXA 5AVXB 2EEDA 3DV6B 4I55A 5IJBC 4FLZA 1FAIH 1M7IB 2VC2B 3V4VL 3LZLA 2BH0A 3R8QA 4NP9A 2C4FU 1ET5A 3LRMA 3SDYL 4AJVA 3D3VE 1LWJA 3SKJH 4CKVX 1IM3A 2N56A 3UG4A 3I02B 3UDWA 3HKDB 3QO1A 3EHBB 4YX2L 5C0DB 1HYSD 3ARDC 2ZUQC 4BKTC 3FFCD 2CPCA 5CA3A 5CLXA 4NQDA 2K9PA 1JZ6A 2I07A 1DLHB 3WLWC 3RKDC 3CV5A 4MCNA 3V6FA 4LF8B 1WPBA 4WO4D 3LH2H 5B1JA 2WNWA 4JO5A 4PJFA 2Y1YA 2NNAB 1UTDA 2Z35A 2OCCB 3L73H 1KJ2H 4AEHH 2LW3A 4QIWF 1A47A 5FO7B 3RNKB 2CDYA 2IANE 3AMKA 4R9HA 4PRIB 2B4CH 1UWEH 2GUYA 1PNLA 1NCWH 4JI4B 2N7AA 4KPHL 3O3DA 4WSKA 1MFMA 5C7XL 2VR3A 4AQ1C 3FTWA 4R6ZA 1Q4NX 4X5XB 5G4MA 1NU1H 1JL8A 2FEEL 4POZC 2HVJB 4ONGH 4J4PA 3B09A 1FZMA 4D9RD 2AVFA 2KH2B 3HKCB 1G7JB 2F7OA 3CE1A 5ISZA 5FYLH 2Y06L 3QUMB 2F15A 2VMCA 4WQOA 1T6VN 1IXMA 4KZDL 3LDDA 4ODVL 4NUMA 1WG3A 4PFEA 1CD1B 2B9ZA 1K8IB 3NN8B 3RA7H 2R29H 4EZMA 4FCHA 3PL6B 4KRLB 2NXYD 2R39A 5BUAA 2F19H 1W2KT 5E8EB 4MJ4A 4D0BA 2GVYA 2R70A 4CSPA 2ZKWA 4NQUA 1ZLUH 1AI6A 5CJOH 5L4FA 3A0OA 5DEFB 4I4TA 4JRXD 1LO0L 1IVTA 2L35A 4LF5B 2VWEE 4DWHA 4XPGH 1G7HA 2OMWB 1NFIA 1CLCA 1S7RA 2SEBB 3AUWB 4BZ2A 2UXVA 2XG5A 4YL9A 4WHTA 1K8DB 5I71B 2P7TC 4QY8A 3FB7B 3KM2A 4JUTA 3TPUA 1ZX3A 2G3XA 3HCVB 5IEKA 4XVTL 4DR4B 5AL0A 1VGKA 4M7JL 3P77B 2H3XC 1B2WH 3F12B 3PXJA 4H8UA 1G7LA 1ZEAH 4IOIA 5KYUB 2Z3FA 4LF9B 2P5EB 4HC1L 4GW5A 4K9EL 1BYPA 4KUZH 2W92A 4Z9KB 3IB4A 5D70L 3SJCC 3D4YA 4E0RB 3NA9H 3VXME 4LSTL 1RP9A 5IW1A 4Z8FL 2V33A 3LZOA 4FX5A 4ASUG 4QRTA 1YEIH 3VQ2C 1SZXA 5CZXC 1SOQA 3FO9A 3MGOA 1QPPA 3HLAA 4QHKJ 1VF5C 2HHHO 2NY7H 3TNNB 5GS1A 4FP8L 4BFNA 2YD7A 4FHJA 1HK6A 2HH0H 1TTRA 3SO3B 5BQ7A 1A32A 2JV6A 2R0WH 4FNPA 4OH2A 5L7XH 1FFPA 4JFFA 2NZ9D 1KENL 3RVTC 4X1YB 2LTQC 3B2MA 3MGTB 1T66C 4WV1A 4F8PA 5C0IA 5C07D 1SF3A 2EADA 3D1MC 5E1HB 5E6ZA 4LWSA 3S35L 5KSBF 2NTFB 5I1IH 3KPLB 4LB8A 2E6JA 3EYSL 1QRNA 4OCRL 1KIPB 1MELA 3GUTA 3EJRA 1G8MA 4P4KB 4QRRD 1E8YA 2YUAA 1QVGU 1IL1A 2YIAA 3ARFA 3FN3A 4IS6B 4JANA 4PY7B 4JZGA 5E8OA 3ZW3A 1BM3H 3UM7A 1N4XL 2APWA 3FBKA 3OR7A 4UINH 4YJZL 1Q6IA 1P6AB 2FQEA 4YHKH 3W9EB 1MFAH 3H9VA 1E5BA 2WAQA 3L9DA 3KS0H 2FR4A 3BPNC 4NPYB 1R17A 4X7CC 4F3FB 5FM4A 3LNEA 2IVFC 4M4PA 1G6RH 2JCWA 2XN9E 3LNNA 3MXWL 4DV0O 4OCLC 4CVWA 1IGJA 4KY1L 4LVEA 2ZKMX 3B5TA 4J4PD 4HXBH 2AMUA 1JRHL 2CUAA 3MJWA 1EJ6A 1XNRO 1Q0YH 1MAKA 5KVFL 5ISZD 1JV5B 4RMWA 4KQ3H 1UXLA 1Q0XL 2FBOJ 4S0SD 2V17H 5T1DH 2GV9A 4O2BA 2KC0A 3I6LD 1I9IL 4UT6H 4O5LH 1MJJB 4PU2A 4J3TA 4M7KH 1FIGL 4JCLA 3VFSB 1H6EA 2PF4E 2DQTH 4DERA 3B77A 3UCSC 2GUOA 3BT0A 3QORD 4XMPL 3HMWL 4OLXL 5DEZA 1F58L 5A2BA 2ZD9A 2K70A 1CGSH 1N36B 3NCXA 3L45A 1S5HC 4X2UA 5B3NA 3BEWB 1H3GA 2YI9A 5JUEL 5DFWH 3OKDA 1DFBH 3V8CA 3ARGC 4ZODA 4DK0A 1J1OH 1S78D 3MJ6A 1KCSH 4NN5B 4PJ9D 3SPJA 5KVDE 5CBHA 4I4WB 3O3UN 5E1AC 4L8CA 1PZSA 3IMUA 1AGEB 5JW5B 5E8NA 1KACB 3IJSA 4JHUA 4IOSA 2YZ8A 5DWPA 4EO5A 2HJFC 1TJHL 4L1BA 5DYOB 5BS0E 2ZXGA 1HQ4A 3O2DL 3P30H 3EFDH 1EZUA 2DMHA 4JPSA 1CLZH 1D6VL 3IDNB 5C0FB 1MCEA 2WZAA 3T9WA 4YK4C 2UU9O 3U7YH 3S35X 5CP3H 1UXWA 1S8DA 2VDLB 4KOCA 3C5SA 3N2GA 2XTJE 3T0WA 1LEKA 3FQ4A 1MCWM 4JE0A 5BV7C 4XH2B 4IDLA 3U4EB 2J6EL 3SKMB 1E9OB 4PHZA 4OB5H 2R2BB 2OTJV 3HG4A 1JWSB 3HKBA 4G7RB 2ZDIC 3B3IA 1BEYL 1MI5D 3MBWA 2XQYA 4KDVA 1C5DA 5BJTA 5K9JH 1IZJA 1EXUA 1XIWB 1BIIB 3IETB 5M94B 3VGAC 2EQDA 1CBVL 5I1JL 3VXRA 2QV4A 3CVHH 4JFFD 2LHAA 3GDCA 3FTGB 1MPAH 3PWPE 1GS6X 4TQEH 2IJ0C 4CZZA 3BP4A 1ZCRA 3O4LB 3T2NL 3P3PA 4G8FB 5J12C 3R4DA 4UQ3B 1ZLSH 1QI3A 4OZIF 5E2JA 3PCYA 3ARWA 2X3CA 4FLOA 4WI9A 2BK8A 4BKLB 4XDKA 1QRND 4NQXA 3I2CH 5CEZD 4ZMVA 1I8AA 4K23L 4V33A 1EEZA 2JVUA 3DX8B 1INDH 4JPQA 4KMLB 3U25A 4JG9A 3EH5B 5EBLC 2YGQA 3T3PE 1EDQA 1RJLB 3J2PA 2E7LC 4FZ1A 3DJTA 1UH3A 4DGYL 2ORBL 4U6YA 1JGLL 4GAJH 1E42A 2EJ1A 3INUL 2F08A 3DK0A 4MMXA 4WJ5A 2XKUA 1J9QA 3KPQB 1G87A 3NSJA 4NIKB 1AG6A 2J5LB 3FOMA 4BV1A 2DWSA 2PYEA 4BH8A 2ZNIA 1HQRA 3B8NA 1SNRA 5BY1A 4M29A 3OSVA 3MNMA 1XGYL 4KJYA 2VN3A 1FNSH 4N4YB 4PBXA 2AK4E 4J9ZB 3GIVB 3V0WH 2WPDG 2AJ3A 3CFEB 3IPFA 2BIIA 2FB4H 3HZYA 3QFJA 1F00I 3ZRWB 1DVFC 3NR7A 3ES6A 4FQ2L 4HCRH 1R24A 1TUEB 2J44A 1R3KA 4XVUD 2X4NB 1U8OA 3SQOH 3UJIH 4P05A 2B2XH 4MTFA 5F3HA 2JQMA 5B21A 4LNUA 4NHUA 5EEWA 2OP4L 4HOZA 5D1XA 3ZOAA 5B1BC 1UWGH 3MLSL 4FXKC 3GT6A 2DJ4A 3QJQB 5DLML 4QRAA 1KJVA 1IQWH 5IR1B 2MOVA 3PP3H 2CKBH 1J8KA 2PCFB 1C8QA 4MNGB 1SUJA 2HUHA 4HC1A 4HWNA 1WT5A 1XGPA 3OUSA 3FUNA 1AR2A 2X4UB 4RRPA 4PMFA 4X1KB 3VFGH 4IOSD 3ATBA 3WFZA 4XI5C 5CBAA 3DUSA 3EYUL 1KTDB 3DIDA 4ODXA 5C0CE 5B38G 4NZTL 4XPHL 5FOBB 5LYJA 1F7YA 2LR4A 4NGHL 1N68A 5ILTL 3ML0A 3TJPA 2QBWA 3J07A 3QI9C 2VH5H 2JKIS 1P53A 3DPBA 2ZX6A 4FFYH 4PJCF 5EZIH 4BK8A 4FFVD 5B38A 2PZSA 4IRJB 2IV9A 5L2JA 1NCOA 3EGSA 3FU0A 1S3JA 1RULH 1WYJA 4YHLH 3PDDA 1L6XA 3BZDA 4P46A 4PJDA 4R7LA 2W95A 2O5ZL 1SJMA 1W72H 5AB1A 2WXOA 1AJ7L 3IGAB 5AB9A 4JI6B 4JYAO 1LO2L 2TAAA 5C0BE 4CU6A 3KG2A 5IVXA 2ZUYA 1CU4L 5J2UA 3ARQA 1ZWIB 1J1XH 3E8BA 1XGQB 3MNZA 2R4SH 3LYRA 2WHVA 1EZVX 5KYYA 2IWKA 4NZUL 5LP6B 3VXRD 1IE5A 4W9ZA 4XZUB 1U2YA 2A6DA 3ZN6A 4OCYL 4F57H 1OHZA 2EDJA 3WEOA 5I1GL 1R75A 4JW3A 4BK5C 5ID0B 2J2ZA 5E8PB 3G6JE 3LUTB 2KKWA 2XQ0A 3P3UA 1YQVL 1I3RB 4ZXBB 3VFMA 1BZKA 2P3YA 3KJ6L 2A0LA 1EEQA 1HXYB 2X0UA 4NKIL 2WB7A 4MA8L 4KTGA 1IFGA 2Y7SA 2D2OA 4HWEH 4G8GA 5AZ2L 3HZMA 3NIDE 2HB0A 3CPUA 1GGYA 4LPYA 3S37X 1I0HA 5EUOB 4JFOA 1EO8L 1EZLA 1KXQE 3QIWC 5CSZB 3MUUA 3B2XA 3CFJA 4HKJA 1I7ZA 4HUWA 4L4VA 1A7OL 5K1NA 2AHIA 3QRGH 5A6LA 2EILB 3KL3A 4M48L 2VWEC 5IM7A 1JPGA 3OKEA 2J1XA 1G1OA 3CFBA 1NMCB 3GTNA 5KMGA 4H1LG 4GBXD 2KQXA 2PYED 1RM1C 5E0FA 3F7PC 1CIDA 4LSSH 3TV3H 1UJTA 2JIXA 4FABL 5DYFA 4YLCA 2O57A 1D2OA 5GXBB 3WNKA 2K78A 2ZSVA 3SDDB 4MXVE 3LDEA 4ZI7A 1A6AA 1W16A 3GZPA 2VW7A 2B1HH 4ADJA 3VQ1C 1WUZA 1CO1A 4H1LA 3QFJD 1BEXA 1CFMA 2IDCA 3GJEB 4Y1AB 2XNDG 5DQDL 1EHLH 1KC5H 2YQ3A 3SGEH 3RLSA 2F53B 3KDPB 4R90L 3HUJA 3RVXC 3SQBB 5SX4I 2GFBA 3MYJB 2OL3B 1EV2E 1KNOB 4KVCH 3NDYE 4XOBA 3WFHA 1EBAA 1NFAA 5HHMB 1KN4H 5D1XD 1HEZA 1KBWA 4OQTA 5IB5A 3D39A 3JSNA 2GSGA 3CRCA 2NX5E 3SBQA 3AROA 1FJGO 1XCTA 3O2DA 2XG4A 3BVUA 4HBCL 5IK3A 5L9DL 2Q5ZA 4NTXA 1PAMA 2R2HB 3QP3A 4JGMA 5E9DA 3T8VA 3HVNA 4X9GA 4ZFGH 2AJXH 5CHNB 1XQ4A 5KAIZ 5FYKH 4OZHB 3ZVVA 1JGEB 3T1CA 1ERNA 4F5CE 1T20B 4N6RB 3TEWA 1YJDH 2D3JA 3ZN1A 5DVNA 4WKZB 5F1NA 2R1WA 3HN8A 4LSUH 2B77A 5B3SB 3X13B 4LSRH 1J05A 2WO4A 1IFHL 1TTGA 3MGAA 3P0VL 2D3VA 2WMPA 3PXHA 1U8IB 1A4AA 2BERA 1H2KA 3WIIH 4HGWA 1HZHH 1ES0A 1QBBA 3MRBA 4EQ3A 4LDCA 4JFDE 4ECNA 2GJJA 2FBJH 4UIMA 2DL2A 2CR0A 4PWIA 4ES9A 3RYCB 2WO3B 4BFJA 5D7KE 4KTEH 5DCCA 4R26L 1N6QH 2MK3A 5FK9A 1CFSB 2COVD 1UEMA 3W3BA 1HHGB 4OGYH 2YZ1A 4F9LA 1JXGA 4HEPG 4L5FL 4XR8C 4NPKA 1MRFL 2R15A 3REVA 1UASA 2X4TA 4Y2DD 5IJ0B 2FWOA 3RYFB 3MVSA 5F1OB 1KCRL 4ELME 5SWSA 3D09A 5FOJA 4P23D 1USZA 5CGBA 2WUCL 5FFOA 1NGPH 3T0XA 4ZOAA 2BVQA 1TVBA 2CJTA 4PJ5D 2L04A 1G4RA 1FLTX 4B6ZA 4L8DB 1CVSC 4XCNA 3VFNA 3BKML 4Z0BH 5AALA 5IE9A 1FQ9C 4PLKC 2GJ6A 4QXWA 4YQXH 2XSKA 5FCSH 2Q6AA 4LCUC 4WO4B 4MJ6A 5ACMA 2ADJA 1G7IB 1L3NA 3P11H 1BGYH 4G8GD 3SD2A 4X0KA 3APDA 4QRUB 1AO7D 3BUDA 1N3NB 3S8GB 2AAAA 4QHUB 4KFMA 4ZW3A 1SHMA 2IEPA 1H2MA 2I7SA 2V3EA 4W9DC 2EH8L 5C0RL 2PYLA 3OXRB 5FF6A 1TETH 3U0TB 2WXFA 2CWRA 3RJOA 4FLQA 1N19A 3FQ2A 2QVFB 2PKDA 3LZFH 4A39A 2PPCA 1A1MA 1AGCB 3H9SB 3OXSB 3ZK0A 2XFGB 3CDGA 1A5FL 5CUSL 5MEPB 2X41A 3PABB 4Z7VB 2FDBP 4DV2B 2JI2A 3MREB 3SCMC 4N5EC 3SE3C 1X9QA 1NS1A 2PI5A 2JIXD 2PYJA 3B6SA 2PP7A 5SV3A 1JZ4A 1NEPA 1QKZL 3TIDA 5LXGH 1QSFE 5C0EA 3OLEA 3I9IA 2BE3A 3QGVA 4O58H 4XNAA 1KLGB 1NMBH 4B9YA 3PHQB 3QO8A 2ZUVA 1YC8A 5AZUA 2A9NL 2GJZB 2NXYB 4N90E 4BRJA 5DVPA 1C08A 3KWWA 1IBFA 2XTJC 5IG7B 1YJNV 3C09C 1FFXB 3ULSB 3O0RH 2OQJB 5E70A 3LD8C 4PHXA 4U3JA 2E56A 1R6KA 2P45B 4YVNA 2FQGA 4JRXB 4MCYA 2F6AA 3BKJH 3DVIA 1LP9B 3MV9B 3E1ZA 2W0XA 3W2DH 4FZEL 3BZEA 4GY4A 2CLZB 3HAEH 3V4PB 2UVEA 1NBQA 1NOAA 1XGTA 4MRCA 4ZW7A 1E5CA 1SYSB 2ZX5A 5FUOH 4RWYL 5IJVA 1BGXH 4QTHA 4NKMA 4AGPA 1A6UL 1V7MH 3DNKA 4Z1MG 2SODB 3OR6B 3UGEA 5TQ0L 2X0VA 3WGVB 1RY7B 3SY0A 1RUQL 1G9EA 4JJ5A 2ITDC 5IESL 3FB8C 3GHBL 5DMGD 1OAJA 2NOYA 4N3TA 1OCZB 2AW2A 4PJEA 1ZV2A 4Y7OC 3ZCCA 1JZEA 5J8OA 3RPIA 3W0WD 5EU6A 2P22C 1S9XA 1JUFA 1NGXB 1A4CA 3AU1A 1IEBA 35C8H 1IGTB 3LN4B 4D3CL 3HG5A 4I55B 4AEFA 3VXSE 1XX9C 1A65A 2QQNL 2Q8AL 5SWSD 2EDBA 5TISZ 3FQWA 4OFQA 1EN4A 1Z9MA 2VR8A 2FEDC 2BVOA 3GI9L 3GHEL 1NUGA 5DK2A 5C07B 1XF3A 3MLPA 2IWGA 9PCYA 3D69A 2HFEB 4GSRA 3IF1B 3CRMA 3L5XL 1WB8A 1D6EB 4EB6A 4LF4O 2GJ6D 2J1WA 1JGVL 3GI8H 3K74B 4UT9L 2X88A 2ZJSH 4QRRB 1M56B 2JS5A 3E22A 2K7PA 1MJUH 3HI1A 5C0JB 1AFVH 4TMPA 1QWNA 5CLTA 2W9EL 4X64B 4FULA 4DTGL 5TH2B 1SQGA 1RZGB 4FJCC 4KZCA 5I18H 1MCOL 4TUYB 3IFLH 1DEDA 1NGZA 2CGYA 3K6DA 5LO7A 2NSQA 3BY6A 4RUFA 3ILPA 3ULUF 4PS4L 2FO8A 1UVQB 3O3DB 3QUYC 4Z78A 3ABMC 1N26A 5TDNA 1XF4B 1VKXA 1Z1WA 3E86A 5BMFH 1ASOA 1P6FA 3RX8A 3DMMA 5A2QN 3LTVA 2QQKL 3P2BA 1TZ8A 4KXAA 2KZKA 1AR5A 5DO2D 4G6JH 2FL5A 4XPFH 5HJBA 2GT9A 2OMUA 4ZOCA 2B59B 5C6TL 4LLVA 5ISZB 1RIHL 3GRWH 4DT2A 4RQEA 3NEEA 1KYDA 3BUQA 1I8LA 3JALB 5D5MA 3MX0A 1R3JC 5FGBC 2CK0L 3DVFA 1F3DH 1W0JG 3H9ZA 5H5NA 4JFPB 2XVGA 3BPZA 5SV4A 2GHYA 4UVAA 1V3KA 4NXNB 2YD6A 1HWYA 1UXMA 4R8CA 2HT2D 4HK0B 3MFFA 1K3EA 3E1F1 3QORB 4HU2A 3CXDH 3MLRL 2KUTA 1MFBL 4LEOA 4JPKH 43C9B 5E94A 4F37K 4BCXA 1LO3H 1CE1L 4PV9A 3B9KD 2EYRB 1J0HA 1HNGA 1PX3A 4I4TB 1AXTL 3ARSA 2FSDA 4WHYH 3FT2A 3V5DA 4PJ9B 3F6LA 1G7HB 1GN4A 3F65A 5CSGA 5IHLB 2ZXEB 3QG7L 5E1GA 4PRDA 2BP8A 3BLPX 3U30C 4YGVA 1ACCA 5D7SL 1FLRH 5D96B 4DO5A 3L3IB 3WO3B 3JVGA 5GS3A 1ZLWH 1I1FA 1Q94A 3BAIA 3CLWA 3K2UL 1OGTA 5HD8D 3LKQA 3IE4A 4GW5B 8CGTA 4JMNA 5CS7A 6FABH 3MRMA 5IUCA 3RUGF 2J4WL 2EIMB 2CIKA 4OKVA 3U0WH 1U6AH 2BNRB 3KR3H 2EYTB 3BW9B 4DGUA 1U2CA 1S77D 3M1BA 2XAJA 5CZRA 4DCQB 2EINB 1VEWA 3Q3GA 4GI6A 3OG4B 3G08A 1OAYH 4ALAH 4GAGL 3MGOB 5EU6D 1CGXA 2P52A 3HLAB 1FGVL 3SGJC 4G8EB 1MI5B 3MLXL 4Q9CA 4ABWA 3KL0A 4U7NA 4P2RA 3T1FA 1RZJH 2J72A 1IT9L 1E43A 3W39B 1ECYA 5L2KA 4E41B 4LVNC 1FFPB 4JFFB 1AHWC 3JCUZ 2LQTA 4XP5L 1IQDB 2Q7NA 3IMWA 4WFAV 2E5LO 3ASNB 2X7LB 2WBJD 5LGTA 1ZS2A 4LWSB 4F27A 3H4FA 4GO8A 3NRPA 4ISVB 2GPZA 2AJYL 5LHGA 5EBGA 3E2HB 4KNUA 1LR1A 1QRNB 4QOKD 2E4TA 1PTZA 2P8MA 1QZNA 4YSSA 1D9KC 3DXAE 1QTPA 4XBPA 3QCVH 4H8HA 3JSSA 2P4KA 5ENWA 4WNQB 5EF0A 4QT5A 2P42B 2DTML 1PFCA 3ZBMA 2WC7A 3HTLX 5E8OB 3QDGA 3OR7B 5EBMA 4RAIA 5K59F 2CMRL 4GAYA 4LMQE 4WFEE 4Y16A 4F1SA 3N41F 2HFGL 3HBPA 2W5PA 1GR7A 5DK3A 1KQSU 3K80A 4NNYA 3EFOA 5C0ND 4YBLB 1VFAA 1H8HG 5LLIC 2ATKA 3DMMD 4XAWL 2F58H 4WGWB 5FIEA 5JR1L 1CG9A 1IGJB 2W9DH 4UTBL 3UC0L 4KDTC 4PYGA 1JV2B 2Y07L 4N22A 2LU3A 4UYPA 1JZ5A 5T3ZL 3K6SB 4O4IA 4W9GC 3HE7A 3B2VL 3NAAH 3EH1A 3BZFB 3TBBA 1XR8B 4G5ZL 2D73A 5KYXA 1AS6A 1S9VB 1F6FB 1XWVA 3C6EA 1N6UA 4DR6B 5C09A 4O2BB 1GYVA 3I6GA 1A6WH 3F00A 1XB3A 5D1QC 2JRIA 5DHEA 4D8PA 3CAFA 4M61A 4OT1L 2ZKYA 5TFSL 2NQ3A 3D33A 1FYHB 1Q9OB 2GUOB 3D85A 5EWIH 3UBHA 3AK1A 5DR5H 3C08H 5GGTL 3QUXC 1UACH 5CMUA 3DGCR 4J23A 1MZEA 5FKAB 5EEXA 1MLBB 3D2UA 3K7UA 1G5AA 4C83B 1KEGL 2N3JA 3EXLA 4U1KB 2YA0A 5E8NB 2OSWA 1BQ5A 3RZCA 1A3ZA 5IMKA 2BP3A 1RPKA 4NHCL 5CN3A 2YPKA 2Z8RA 3BHBA 3HKFA 3CJHB 1TZHA 4RFOL 2K4WA 2CHNA 4AGLA 1JHLH 5LG6A 5EC1B 4OIIL 1M6UA 3FN9A 2FBRA 3ZR5A 1B4JH 1GXEA 3AQDA 4LCWE 2IWFA 3CPLB 3LSOB 1S9KC 4JI7B 1FFTB 3MRGA 4P59L 1UXWB 2WQAA 3V4VB 4JYBA 1S8DB 3MUGA 5DJ6B 2YFOA 5TPWH 3BGFB 1E6JH 3A5VA 3C5SB 4UB6Z 2HYMA 5I1CH 1YYLH 3BN9C 2NYYD 3GZKA 4OJAA 1O9ZA 4UI2A 3SOTA 1GC1C 1PCSA 1R3LA 2X4RB 1ZK5A 2EE0A 1JNNL 5I9QC 4HDIA 3HKBB 2C1PB 4ADIA 3MLUL 3NCFB 3R7RA 1I1YA 4U1LB 4G6KH 1IAIL 3UTSE 5BJTB 1WZAA 3DO3A 5HYSG 3SE4A 4P2RD 4RDQG 2XAGA 4UT9A 3KEHA 4KKAC 3MRNB 5MEOB 2YKKA 3P4MB 1K4DC 1ZLVH 5HXMA 3VXRB 4P30A 4I77L 2BOCC 4NQVA 3B5GA 4UM8B 1XREA 1T2QH 3MJ8B 1JTTA 1OSZA 4I48B 4OZGA 4OW6A 4A6YA 4HIEB 4UV9A 1K5WA 3HC4H 1MA1A 1U93B 1TZAA 1QR1B 4K3GA 4ZPVA 2OSLA 5F7WC 4RGOH 5ALCH 4MYPA 4DR7B 4HPOH 4WFFE 4PRNA 1WP8A 4F7TA 1GYAA 3QE5A 4TKWA 1EEZB 3F5WC 4WNJA 3CEIA 1UKSA 2GIYA 3EDKA 4MVZA 4QRQA 1DBMH 2GI7A 4NN6C 5CWSA 5TK4A 4B0MB 4HAMA 1NGQH 1GGCL 4NUPA 1XMOB 1X5LA 2J8OA 1J1PL 2R23B 4PREA 2IAMC 4OZIB 3N1PC 1GJWA 2XFXA 3W7WA 1A22B 2MNJB 1P5VA 3CXHF 1B0RA 3JTTA 1BFVH 1JF5A 2X1WL 3QHFL 4MMXB 3NIGE 1KGWA 1I8KA 4JY5H 2ZUTA 3KXFE 2YD8A 3G5ZA 4UOZA 3ARBA 4X5WA 1R33A 2YD3A 4GBXB 2PYEB 3V2AR 3LPWA 4M6NL 3QQXA 4XNDA 1HQRB 5HYQA 1RD6A 4KJYB 1BZQK 4W4OA 1PX8A 3WEAA 3HE7D 3QDME 4B96A 2XNAA 4PJHB 1MAJA 5FGRA 5TF1L 4JM4H 3DX7A 3GDBA 4TUKH 4EVNA 1R24B 2XXFA 3BZ5A 1LE9B 2RCSL 3DBXA 5F3HB 3TZVC 2EXWD 1W0WB 1YEKL 4LNUB 1EZSA 2VAAA 5JW4N 1FVEB 4EKWA 1HE8A 2WQ8A 3UTOA 3F6IA 5ANME 1QVOA 2AKRA 4K55A 4BE5A 4ZX4A 5HI3D 1GYUA 3ZMTA 2H47C 3EO0A 1FORL 2OMZA 3OKNA 5JTWA 3UAJD 4PJGE 2V37A 3EG9A 2VQEO 1H6UA 2ZR2A 2HCZX 2BOBA 3LVTA 3D2UD 1S5IH 5CA0B 3I3BA 4NQDE 2JI3A 1SQVH 4FMFA 3TH3T 3RZCD 5EC2C 2K6WA 4FQLL 5CBAB 4DGVL 1U3HD 5L4IA 5T5FL 4CDGC 3KJ4C 4GIOA 2BRRH 3MA7A 1SVBA 4N5UA 3K1KC 1ILSA 1NTMH 4M56A 4KX9A 4XPAL 4MCZB 5F89B 3V5KB 3UTQA 5B38B 5KSVA 4LF3B 1QUNB 4GUCA 2WZ0A 2NLJA 2YAFA 3EGSB 5L2JB 2UUDK 3D2TA 4JGUA 5C2BH 5J1TC 4TSCL 1OPGH 4G2KA 5EDSA 3MODH 4PJDB 1JR9A 2VR6A 2E3CA 1MNNA 1T80A 2XVLA 1JWUA 4YR6B 4ELKA 2CQVA 4N2IA 4HIJA 4MJ2A 2CH8A 3QYNA 3NIFF 4U4IA 3SKOB 1NZ6A 3F62A 4JFXB 4MNQE 4DR5B 4PJCB 5J2UB 4X66B 3UTTE 3VUAA 1NT2B 3PJSA 4XXCA 4Y2DB 4O4JA 3B2DC 3MNZB 1VQPV 2XCMC 1UJ3A 1T5WB 2LVEA 3BA9A 2K7QA 4P23B 5AZEL 2KKQA 3VFWB 1K34A 3W38A 1RUKL 2A6DB 4XNUH 5HY9A 1NFDE 1MABG 3GB7B 4PJXA 4PJ5B 2IJJA 3LNHA 1LEIA 3ASOB 4CNIA 5EN3A 2R59A 5BOJA 3B9VA 2KB1A 5I8OL 1WFMA 3OW2U 1Y0LB 2R9HD 5IHUL 3VFMB 5LHDA 4JI2B 5DMKA 2AW9A 1K3ZA 3EYFA 4GXUM 1F41A 2Q5BA 1KB5L 4H2CA 1EEYB 1TJIL 2A73B 1YSCA 1AO7B 2VDLH 3HS0C 5IJDC 1EUUA 1MJ7L 2OFQA 1BA9A 2VL5A 4P2OB 2VDKH 3QCUH 4NXMB 1A3RH 4FQJH 2G4EA 1LO4L 1X9UA 2PPEA 2YEZA 4HJEA 4PWJA 4QI3A 4YDIL 3T1HB 1AI4A