3ABQB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and 2-amino-1-propanol
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 78
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3abqB03
3ABOB 3AO0B 3ABRB 3ANYB 3ABQB 3ABSB
chains in the Genus database with same CATH superfamily
2NUBA 3DE5X 4DADA 4M86A 1NQWA 4UBLA 1ZUWA 2FYTA 1SCIA 2BKEA 2OB1A 3PNYA 4L8GA 1L5KA 2VF8A 1UANA 1JLKA 1V96A 3L0YA 3U3KA 2BEWA 3OZAA 5FUXA 5EQDA 1WU7A 2HCBA 4G1MB 2OVBA 4WCVA 3ZI7A 1XXHE 2ZI5A 2OORA 3B36A 3EVAA 2HWWA 4IINA 1Z62A 1R74A 2YMPA 3NATA 4YMTA 4DUYB 4A03A 4EHAA 5K8UA 1MEOA 1J0DA 1R8JA 3FZEA 1A4IA 1UOOA 1RPAA 4MGIR 4Q7MB 5MN4A 1ETUA 1R0CA 1GFZA 1V1RB 3WFIA 1II0A 2AIRA 2BHNA 4IIHA 2IW3A 1KIAA 2X2PA 2R1VA 3IULA 3EPJA 1HDZA 5K9ZA 2C3YA 3G02A 3OZBA 3H17A 4OHVA 4C03A 3U7JA 2SHKA 3HEAA 1FU4A 3K1JA 2JLUA 3A11A 3L7OA 1G66A 2EU8A 1EPUA 3FDIA 1Y9ZA 1E8NA 4EVIA 3L7LA 3RS2A 2HSEA 5IC6A 3C16C 4WVLA 3NVAA 5LZ5A 3FF4A 4A5OA 3UUGA 2ZYHA 1E7WA 5ALWA 3STTA 2J9XB 1L7EA 4IMRA 4CM4B 4KR7A 3V6MA 4MROA 2PX5A 3RUCA 3CHYA 4GX1A 1GDDA 5E6UB 4RPHA 2YJNA 3W5AA 1S6YA 1OBVA 1WKCA 1Y6QA 3TGPA 1I3MA 1ZD5A 2XWBF 1YK0A 4DEVA 2Z2IA 2DPYA 3MN1A 1CJSA 4W1SA 1W76A 3S1LA 2D4AA 3JQGA 3K0CC 4G4SO 3V2IA 5JU6A 1L1EA 2YXDA 1LY1A 4L08A 5B58T 1OILA 3TN7A 1AXRA 4G5XA 3IH5A 2DOKA 3BQMB 1XEXA 4Q12A 2HJ9A 5KQRA 4ESVA 3EPRA 3DKKA 1O0SA 3CLRC 3TUJC 3BTUA 1Z6TA 1YDWA 2HA6A 4G24A 5FWYB 3VO1A 4BUZA 4E3WA 3CSSA 3FNQA 4L28A 1DWQA 1PLJA 1JQBA 1TD9A 1FNBA 1T43A 2EX4A 1RJFA 4DY4A 4BVGA 2XT6A 3IAM6 1JIJA 4K1LA 2NT3A 3ADKA 2C8KA 1OR8A 3AI7A 3X1MA 2XCIA 5IK2D 3RLFA 2CL6X 4C7JA 1SHLA 3A04A 2QL6A 1DUIA 2PYIA 4GPZA 4NK5A 4QXQA 4R7GA 5H16A 1JFTA 2AVDA 4UXHA 2AFIA 1N0VC 2CYAA 1JHXA 4W5HA 2I2WA 1Y9EA 1WSWA 2G1UA 2POCA 3OPYB 1EZ4A 3K2IA 5BNIA 1CUJA 1MMFB 3PQDA 4V24A 2YXEA 4G5GA 1SBQA 1IHOA 2ZUVA 3H13A 1I7LA 1HYQA 4UHKA 1RHKA 3I6YA 1U7WA 4PWZA 1ACLA 2G9QA 4G2TA 4KWEA 3PDWA 3W78A 4DPKA 1XRPA 1R6AA 2C07A 1V95A 4BNZA 3EXEB 2PUBA 4K9DA 2HYIC 1SD1A 4FR5A 4UEKA 1XVAA 5FHQA 3GGGA 5FTWA 5IBQA 4MYSA 5JZBA 2OCGA 4J0CA 4RORA 3J80A 4QOHA 3FUUA 2AX4A 3CIFA 3D3KA 1SXPA 4V1CA 3V1UA 3THYA 3CG0A 2X13A 2YNMA 4QQFA 3RFFA 4XEHA 4M8LA 2VSFA 3NBFA 2CUKA 2LTAA 2WHXA 3K0AB 3OF5A 3ZNQA 3RARA 3VR0A 2OE2A 1QR2A 3E35A 3MNFA 2QUBA 4G1EB 1G21A 5DM60 4EP1A 3IHWA 1JQ5A 4CT4B 3B6KA 3ZZ0A 5LNK1 2FEOA 5EP2A 1NZDA 2PSHA 1YF3A 2E89A 4MYTA 4Q6WA 3F5QA 4GR5A 3L8YA 5H59A 1JYEA 1L5LA 5LKAA 2Z8ZA 4H1WA 3P2YA 1EEHA 2NOAA 4ZYTA 4U0JA 1QZ3A 3T61A 4QYSA 1O6CA 4JIGA 2AZDA 2I4MA 2PKRA 4CM9A 1KERA 3C7AA 4X7RA 4UTZA 1YZGA 3E9ZA 3KOUA 3TZ6A 1D7AA 2Q6KA 3AV0B 1OFUX 4U1RA 3U0BA 5LQAA 2CK3D 2IOQA 2NXNA 2GVDC 4EJFA 2XOKA 3JATA 4JN6B 4L78A 5JO0A 2UZ1B 2REBA 1TECE 2FPIA 2AMLA 3NHBA 2G80A 4MRRA 1PJ3A 1EGAA 2X19A 3P9XA 3NP9A 4BAGA 1Y8QA 2FFQA 3AWIA 3FCAA 2FHPA 2IYOA 4UVDA 1X7ZA 2RGAA 1II9A 2V7UA 4UTRA 1WXFA 1LRLA 5EZYA 1I4TD 4MQEA 1C9MA 3D7RA 4EKDA 5E7QA 2Z43A 2QVYX 5BMOA 3EZ9A 4NCNA 4GR9A 1TC2A 4LTDA 1QOPB 3VQTA 1A5TA 1D4AA 1KMHA 3KELA 4GLBA 4BVBA 1N9GB 3PEUA 3DMTC 1CUFA 2Q7OE 3PF9A 5CFMA 2X8WA 4R2JA 1AA9A 1IMOA 2GYYA 4I55A 3FWZA 1K7SN 1PX2A 2C03A 4NESA 3K53A 4WK4B 4P2BA 3WGMA 5TXGA 1FBTA 1GTMA 2GAFA 2XA9A 4TVKA 1ESEA 3HDHA 4XFDA 3W9YA 1OA0A 2AC7A 3KZNA 1CXZA 1PZEA 1UK8A 3PR2B 1VGQA 2OWEA 4PYJA 3D0KA 5FJJA 3VJLA 3EDOA 1F6BA 5L7YA 3SJ7A 2N47A 2WJGA 5KSYA 3EWIA 3QPVA 4P3YA 4LF4B 4IIJF 1YKFA 4F3YA 4ME6A 1TU3A 3DOJA 5KHLB 3LFHA 2C78A 2ZT6A 4JZYA 5EESA 2RARA 1G17A 2OQ2A 3QFHA 1QG0A 1NUAA 5AK4A 4L76A 3S2UA 1NJ6A 2WWIA 1XF1A 4JB8A 4BO8A 1TRHA 4MVJI 1MGPA 3BYZA 3E9YA 1PVVA 3Q3IA 3MT9A 4S1OA 2OXCA 4MOWA 1IG3A 1NUUA 2W2TA 3P27A 3I3OA 4BMXA 4RZ2A 5K8LA 2AKEA 1I4LD 3SIWA 1ONBA 2QL7A 1YB6A 4WESA 3H9JA 4UKDA 5TC4A 4YCDA 5FRDA 5IRCD 3B3JA 2PY6A 1SXGA 2I6FA 4RMHA 1BS9A 4RK0A 4TKZA 5EHZA 1A9PA 2R2AA 2MYTA 3WRYA 5G0SA 2GUWA 3BGSA 4QELA 3TXXA 2E4VA 7AT1A 3G1WA 1WUKS 3AP2A 2A0FA 4K9RA 3AI2A 3TMAA 4HQLA 4CKWB 3HDJA 1QP0A 5KS2A 1UKAA 1FP1D 2H7YA 3RREA 2YFQA 4UMFA 1HT0A 4KFSA 5AM3A 2JFHA 3CZCA 1NP3A 1X77A 3BXOA 3KT6A 4IX1A 5DNWA 3KJIA 5BWMA 1PYGA 4YRQA 4V0SA 4TYQA 4EK9A 2B2CA 5IHPA 2P4HX 1SCUB 2X8JB 5I9BA 3K5IA 1FVFA 2I8LA 5L3ZA 1JDTA 5IM4A 2AE2A 1S8FA 2P6OA 1OXMA 3O9MA 5HR5A 2NN3C 2JLWA 3ZV7A 2IS4A 2C4WA 2DCMA 1B3BA 2VK2A 3GYBA 5JWRA 4WFKA 3DTNA 3DHVA 1NXPA 2OVFA 4Q16A 2C9OA 3OX4A 3KOOA 1GPJA 2VSYA 2X3FA 3IYLW 4WLEA 3WP1B 4W1PA 4TXMA 3DMPA 4DDMA 2HRZA 3IPYA 3A6KA 4MO9A 1H05A 4ATNA 3V7NA 2EJTA 4LECA 4HFMA 4LUCA 2KBFA 2VHWA 3EVFA 3E7WA 1OFGA 3ROTA 4MIOA 2UVPA 4LJ4A 3Q7EA 1JFRA 1XA3A 3BSYA 4IIVA 2HHJA 4M9CA 4QUHA 5IT5A 3MS7A 4JEHA 1U2DC 3O0DA 4CFSA 4B85A 3RVRA 4QQNA 2ZCJA 1KEKA 1DTWB 2I6XA 3KBBA 4IQ0A 4B2IA 1H0SA 1GFIA 2F8SA 4R83A 2E4UA 1SD5A 3LX5A 1IN7A 2J5XA 4HDKB 2IV2X 2QYHA 1PK7A 2R48A 3JQ7B 1Q7CA 4N65A 1RYYA 5CBPA 3CM0A 5ALYA 3RIMA 4QGHA 4KYUA 2C0QA 3COSA 1YJCA 1NOIA 4WINA 2RC6A 3MWEA 1JAXA 2IHTA 3PHJA 1LI7A 2JBHA 2ZIAA 1NW4A 2XIQA 5JQGA 2I9KA 1N6PA 3GAAA 3TINA 2PBLA 2Q46A 3ZWOA 3KHTA 1XZFA 4B46A 5KHOC 1DOAA 2TYSB 3TRIA 4DHWA 5JISA 2DUWA 1M0SA 2JJ1A 2X0JA 3D8SA 1C3OA 3TLGB 3FHTA 4KB5A 1P29A 1M9NA 1PF7E 3W5DA 1YVRA 2JIZD 3E3NA 3RWMB 2IBMA 2TSYB 4Q18A 4DF3A 2VDVE 2AN3A 1JIXA 3WWYA 2OY0A 1IN6A 1R6XA 1KFKB 3LC1O 4IWXA 1AE1A 5I3ZA 3U44A 4MAFA 2Z08A 5ERYA 1H4QA 3HWX1 3A2LA 2QGFA 4BVLA 3BHMA 4NSNA 3R6GA 4Q9IA 4IJWA 2RB5A 3F4BA 2JVJA 3B6JA 1GA4A 3M4YA 4AP6A 6LDHA 1JR2A 2OSBA 1YJBA 4DV6B 4WH0A 1LSSA 3FMOB 3SKVA 4HATA 1UXGA 4A8TA 2CBZA 2R9VA 5ALNA 1FF9A 5IAGA 3QXGA 1HTTA 3EGXB 4NV0A 1PQYA 1QIIA 2HBQA 3QUSA 4X6YA 3L8GA 4X8LA 5TIIA 2EZ9A 1IATA 4KMOA 5C8ZA 5ICFA 3ABOB 4B4UA 4XSHA 4L0MA 3W04A 3NYIA 4XUDA 3HJUA 4IWNA 4CMEA 5B55A 4ETMA 2PEYA 2PRKA 2DWOA 5TQ0B 1CHNA 4QEDA 4KLCA 3D1JA 4O2AB 1ZJ4A 3N8GA 1QFMA 3JR3A 1K9SA 1M76A 3Q9NA 4OOEA 4BEJA 1QFYA 1FW8A 1PJ4A 5LQRA 1TKBA 3R9KA 5IFLA 2PZ8A 2VUIB 4C06A 1KI4A 1XTUA 4YIHA 5M2QA 2PS3A 2YV3A 3NT4A 2MTBA 2GK7A 1F7UA 4NTZA 5EUMA 1JFFB 5FOUA 1I9GA 3S3TA 3BSFA 2Y1CA 2CLLB 1U0SY 5T7BA 1KHTA 5DI9A 1TGYA 2VKQA 1DL5A 1T3GA 4I1UA 5TR9A 5ITSA 1YR6A 4EM6A 1W85A 3GA5A 2ZRCA 2VZ8A 2CHGA 3GJYA 4AYXA 1QAOA 2OO5A 3BGIA 5B7GA 1LC0A 1NXXA 1Z2NX 3WGHA 2XMCA 1DKQA 3C70A 1DIHA 4XFKA 2XKKA 2ZS8A 4HCJA 3SJAA 2QT0A 4C0BA 5KTPA 4UHBA 1NPTO 4K05A 2XMDA 3LA8A 2Y1DA 1UPCA 2FLKA 4OGFA 5DTQA 1Z2PX 3OZSA 1YZHA 5J4HA 4OBBA 2QX9A 2BH9A 1T8TA 3CLSD 1XLTC 3JVDA 3RSLA 3X2SA 3WZLA 4O8CA 5FNVF 1MNQA 5HBRA 4P6VF 3GLHE 4BZZA 1SCNE 4BO6A 4BPBA 4YJFB 4MQFA 4DLYA 3RBVA 4CTNA 1T2NA 1E9AA 3GJSA 1U1DA 3N2GA 2R96A 3P2KA 2JI9A 4DDVA 3DLTA 3ZDQA 4AN0A 1DUVG 2WILA 1XU9A 3Q15C 5DXJA 1UDWA 5SV2A 4A23A 1LJ8A 4K2AA 2OZLA 1Y8RA 4MSUA 1FSZA 2O2GA 5TB5A 1XV5A 3UKDA 4HGQA 4ACBA 1WD5A 3PJFA 4Y0NA 2Q5IA 1T9BA 2YYYA 1KE1A 4KNVA 1Z0FA 2EL7A 2Z95A 4H1TA 2A9FA 3TZBA 2WQ6A 4AJEA 2YX1A 3CBGA 4MWTA 1I1OA 4WXPA 4P84A 2AYXA 3LUHA 2NIPA 3P9NA 1CFZA 1G1AA 2PR7A 2Q29A 4IKEA 1OPXA 1YI1A 2GAJA 3I6BA 4JBNA 3DYIA 3GGCA 2XW6A 4FXPA 1GLNA 1OT5A 2R8EA 4YV0A 1TYEB 2UZ4A 2BMWA 1XMSA 1I0IA 5E7IA 4P58A 2H1OA 1RP7A 3CH5A 1Z47A 2QRLA 3DKVA 4U63A 5J4YA 4U02A 2P67A 2CMKA 3GFTA 4DNPA 2J6IA 3UMJA 1KOGA 5EAIA 2EHDA 3KTDA 3KP1A 4S0XA 1PFWA 5KPJA 3C85A 1GADO 4DLUA 2FMFA 4D6YA 4LISA 4DUZB 4JJZA 4TUYF 13PKA 3K0KA 1VRWA 5FFFA 3TRHA 4QUJA 3RK4A 4G5HA 2DQSA 1YMUA 1PGPA 2VDJA 4OB6A 4J0QA 5AFSA 2V7VA 3UV3A 1JWAB 3W7BA 1V7PC 2JIOA 4RD3A 1PFYA 3H65A 1RRFA 4E4TA 2ATIA 5IVPA 3LL7A 2D5AA 1SQFA 3IT2A 1OYOA 1GNRA 4K6CA 2WTXA 2VH2A 3Q12A 3GZNB 4US1R 1W35A 4E33A 4ECEA 4XVCA 1PZHA 4U9IS 1RC0A 3U7GA 3M1IA 2K2WA 3QOXA 2GN0A 5B57C 1UP7A 1Q57A 2HJSA 1K89A 4KAXA 2HADA 1KSHA 5IJZA 4BX3A 2WAAA 4GL4A 2W93A 1IE3A 2QJWA 5CA0A 1NXOA 3KQLA 2XMPA 3A9WA 4LHSA 4N82A 4LY6A 2WHRA 3ZV6A 3MTIA 3W6NA 3UB4A 2X4GA 3DBLA 2DETA 2C9BA 2PBRA 5EJIA 1VE3A 4DCGA 3EDCA 4FR0A 3DZIA 5BSHA 2Q2VA 3NGLA 4Q9LA 4I50B 4GQBA 5KREA 4E51A 1X7HA 5CEFA 1EBUA 2J6HA 1X13A 1UODA 3I4CA 3BB4A 3RHZA 5HDQA 5I5GA 2BRUC 2RGNC 4DNOA 4DQXA 4Z7JA 5TLSA 2J46A 1DDOA 1N25A 2AB0A 2QK4A 3HB5X 1AGXA 5EEHA 5K0FA 3TE7A 4PPGA 1Z08A 2QZ9A 3TTWA 2ZWAA 4TV8B 4F2GA 1QQAA 3BUSA 2BAGA 2PZEA 3JPYA 2C2KA 3NETA 3UC9A 4YI5A 5K8JB 3LBFA 3DHNA 1LDYA 1IZZA 4X3CA 3KNZA 5K7SA 2HF8A 2C1EA 3LJKA 4XX1A 1JG2A 4AD8A 1UOQA 4PM4A 3LGXA 5G2OA 1W52X 2PA0A 2I7XA 2FGJA 3NFYA 4X20B 4WCFC 5B1SA 4RCZA 4I6JA 4UCWA 2XHEA 3FWNA 4X8HA 4RIEA 1EM6A 1U7OA 4PBRA 4B4DA 2E5WA 4R1TA 5B4UA 1HYGA 2XMGA 4KQEA 1BZYA 1BQEA 1TYBE 1PVDA 1SQ0A 5I9MA 3TVDA 5HCUA 4I5GA 1T4BA 1HI9A 3KALA 3VU9B 3CF2A 3EA0A 3ICWA 4FXOA 2IHUA 4URWR 3ZE8A 4MWGA 2O5VA 2DSNA 2DFVA 4KQ1A 4N5MA 5JDIC 5CIWA 2RCYA 3Q1LA 5CYOA 4ZOAA 5KNDA 2DLCX 1I7PA 1KI3A 4YN3A 1B8OA 3ZE2B 4A16A 4FYXA 2EGGA 1FMCA 4W7IA 1BC5A 2UZAA 2YNMD 5CG2A 2DQ4A 4TS4A 3PFHA 4W99A 1URPA 1M1NB 3KD3A 1ID1A 4LK3A 4XPZA 4BV2A 2NZVG 2WWVD 4LGMA 2V7GA 2ZG6A 4RFSB 4XFJA 3CINA 2NP6A 2GBIA 2VJOA 2QD1A 4JKIA 4RV9A 3CR3C 2QW1A 2QRMA 3TD6A 4OMFG 5CH8A 4RHCA 4ENSA 3HCRA 5GWXA 4XRGA 4BJHB 7REQA 3U4MA 1A9TA 2XITA 4F1KA 1GT91 2JA1A 4OBXA 4RPGA 3UXMA 4BO5A 3LUJA 2QTLA 1Y5RA 4ISCA 5A7HA 2BLLA 1Z4LA 2EERA 4QXMA 3KDAA 1N2CA 3FWPA 3BK1A 1QH1B 2B21A 3DFZA 3MINB 3UJNA 2OUIA 4CM9D 3N39C 4HWRA 5I7HA 3L1UA 2B5OA 3U4AA 1TEZA 4D82A 1I2DA 4LAFA 2JAWA 1BOFA 1K75A 3NYWA 1DJQA 4Q7EA 3REOA 1KY3A 5E8JA 3V6LA 4IJKA 3ZOZA 2VYND 4BQSA 3VR3A 1W19A 2ZYSA 1XD9A 2W2QA 3E6AA 3FAKA 4QDXA 5LMNB 2GPBA 2IXAA 3L6EA 2GPJA 2XRYA 1QVVA 4ILKA 2V1UA 4OATA 5JWHA 2DY1A 1Y3IA 1G16A 3RS3A 1L9XA 1MAVA 2HLHA 4Z7OB 3QLVA 1FLDA 2WF9A 4M1YA 3VAAA 4NJMB 1EA5A 4ZQGA 3S40A 3UW3A 4PPQA 4DBLE 3JAWB 3Q3GE 1HDGO 4PFKA 5ERXA 3EVDA 1P61B 1A9SA 3P5BA 3RHSA 4QTZA 3RBAA 4NMXB 4WKPA 4HXYA 3MW8A 1U0HC 4JD5A 2CUTA 3A3PA 4X3OA 2EP7A 3C6KA 5IABA 4TT8A 1U7PA 5AVYA 1U9JA 2GJ4A 4JGGA 5FOVA 5DX8A 4Z53A 1IY8A 3HN6A 1M1ZA 2PA3A 4LX8A 2WTMA 2PLFA 2YWCA 4YAOA 2B6NA 3S28A 1RI2A 1GPUA 1NMZA 3H2BA 1SCKA 3BWMA 4DIEA 4CIXA 7ABPA 1C0KA 4K28A 1XA4A 5DNYB 3HABA 3OBIA 4KPGA 1M73E 4OP1A 1SJ9A 4P1ZA 4C7KA 1PL8A 2NW6A 3ZQJA 1RXCA 3T5AA 4TMFA 1XSEA 3DM9B 5TGDA 3TEMA 2I22A 3KLMX 4M6WA 5KTKA 5LNK6 1NURA 2Q4TA 4P4SA 3OEEA 1D4OA 2PBFA 2NU9A 1WJGA 4JJAA 4I1VA 4KP7A 4ON9A 5EJMA 2AN9A 4AZTA 4DQDA 1NQVA 4ZI5A 1N2SA 3PJGA 4AY2A 1ESNA 2IZZA 2H54A 1TKAA 3CEJA 4C0AC 4P5EA 2FA9A 3RS5A 3U60B 1POWA 3WJAA 1B8UA 4QHTA 3T4XA 4C7OB 1K6XA 2ZR0A 4JI2B 1GGEA 1HDRA 1Z13A 3G2OA 2OMKA 4K3UA 1BYUA 4C4SA 3KK0A 2E4XA 3INGA 5H02A 4ZI7F 1RW4A 1CUIA 2IBTA 3U6BA 4G5FA 3BGWA 2VQ6A 5B1HA 3A70A 3ANYB 1SHTX 5BW6B 2BMDA 3AHJA 3U1BA 4PXSA 1CY6A 1QB7A 1VPTA 2OHFA 2M6KA 5JS7A 4DR6B 2ZCVA 3CYFA 4JBXA 4Z99A 1LK7A 3TJMA 4EH1A 3MFQA 5AUQA 3ANLA 2QAGA 1D0VA 3DOOA 1VG0B 4WPGA 4ZXPA 3COZA 4M7PA 2ID8A 3ZW9A 3TXAA 4L8VA 6REQB 3LZ6A 5INTA 5TE9A 1EX9A 3A6JA 5A6VA 2HBRA 4F6LA 5JZOA 3C4JA 4B74A 1ZSYA 3FPLA 3PENA 4YRRA 4FGSA 3B51X 1U0GA 5CXXA 1LNQA 2WTBA 3GVPA 2D1SA 4KVFA 5FBKA 3SGLA 4C4AA 5FWXB 2OBNA 4A26A 2XNSA 3TZEA 1E5TA 4FSDA 4OAQA 2C82A 3AFIA 2O8VA 3L79A 5T3YA 1IAQA 2XF2A 5E4TA 4V2UA 4D8XA 4DLSA 1GAWA 3KR2A 1P7CA 2HJGA 3T1YB 5HP4A 3QPWA 3GJ0A 1NJ5A 2V6FA 3E3LA 3R20A 4BCDA 1E9BA 5EVJA 3E9MA 3O2QB 4MLCA 4HAYA 1UJCA 5NLLA 3VZPA 5A0FA 3DSRA 4EKNB 4D8TA 3P2MA 3LHSA 3T5MA 1YI0A 5IUNC 4ARCA 2Q7DA 2R5WA 3UMYA 5JAZA 1DV1A 2RI1A 1JR4A 1VJ0A 3FTNA 2A6PA 3KZXA 4LFBB 1T2CA 2FZ5A 4CFZA 1ZUNB 2O2XA 3NJRA 3ZHVA 4EB6B 3AZOA 5A7FA 5LXTB 1H5NA 5ENVA 4CR6A 5F78A 3QSYA 2D06A 4HQRA 4XDGA 2WNIA 4QU8A 2NTYC 1RWNA 3BXEA 3UB2A 2F3UA 3DB2A 2VRCD 4WLVA 1VA5A 3T9AA 3WS7A 4B80A 4ZDIA 4JMLA 2IC5A 3MAGA 3DDUA 4KDCA 4MQUA 5FNVA 1GVHA 4U7DA 2JJ1D 4PC3A 4X8MA 1SR8A 4BNYA 3EUAA 1IFXA 4W5TA 2P3OA 6CHYA 4K0RA 3KPWA 3H86A 4JVLA 4UBIA 3S99A 1XCLA 2HMSA 4LG1A 1FFHA 1JEOA 4WKGA 3D6TB 2QHXA 4KFTA 4FJ2A 1KBOA 2RJOA 3BH0A 4MINA 2ZUFA 2FSHA 4QYWA 3L8CA 3PQ6A 1L5GB 1N7GA 2GM3A 4XJXA 3RYIB 1M2VA 3U49A 5C8DA 3G0CA 2ONJA 4L85A 2WWXA 2B3TA 3M1LA 4UASA 2E49A 2Z5LA 3R8XA 3LT4A 3NM4A 3EX7C 4F9TA 4CIAA 4DR5B 2ONKA 4MW5A 1W36B 2HSGA 3HLTA 5EP4A 2ZTHA 4HD8A 2ZEJA 2HL6A 3ROMA 2EQ5A 4BKPA 1TM2A 5ALFA 5EIAA 1T4MA 1CERA 1NYLA 1Y1SA 3JD1A 3QWAA 4EX6A 1MAAA 4QTUB 1EFHA 3LUBA 4HOYA 4P86A 2VAMA 4LCBA 4PC1A 5AI0A 2PSJA 1X80A 2R751 1RE1A 3DAPA 3H2IA 3VJRA 1JSRA 2P78A 2YW9A 2YYAA 3BCSA 3OTHA 4DMMA 1C1XA 5JUWA 2I3BA 1BTOA 1AKYA 1WM1A 4AQYB 1JEAA 3EY9A 1FRQA 1MOZA 4JASB 2JHPA 3B7WA 4Q1DA 1MJ5A 5HE8A 1VHWA 2WU0A 4EDFA 3TG2A 1LW6E 4TUYA 5IJ9A 3K0BA 3AVXA 4KXYA 5F98A 3DOEA 4O1HA 5D87A 2CXOA 1LCIA 1JH9A 1OPRA 4GSKA 2ZIWB 5K2OA 5U4XA 3BTOA 1GAJA 1R2QA 2E4WA 2CJFA 2P9CA 1N32B 1QSGA 2FNAA 3G2MA 5G1NA 1DAGA 1PJ2A 3BMQB 3BS4A 3LF2A 5CK5A 5E0KB 2HSDA 5FAXA 1FDVA 2JFXA 4DDKA 4NZYA 4BV9A 1G9TA 3K9BA 3ZDCA 4GXNA 2NU6B 3HV0A 2OGSA 3EZLA 2XHZA 4BX9A 2PRSA 2Q8PA 4BQNA 1T2EA 4Q37A 3WGTA 4CW7A 5CGQB 1RAHA 3TL6A 2J4FA 1DMRA 3VR2A 1NLZA 3K0FA 3CRMA 4AY4A 4CTKA 2OM2A 3GLIB 4NBLA 3K8QA 3OT5A 1QLWA 1KRXA 2W6QA 2JAHA 1S7GA 4EPXA 3WGVA 1WSBA 1OIVA 3V4RA 1V9SA 2O2HA 2C5BA 4J94A 1L1FA 5HJEA 4G84A 4JY7A 1QYXA 1SU6A 1ODJA 2N1MA 1KJ9A 3DYBA 4K9KA 5EN4A 3OZGA 2XYGA 2VBFA 3IAUA 5IUKC 5ALOA 3WHPA 2C98A 4WVFA 1IHDA 2FZVA 3M6LA 5BR8B 4PW0A 3ACCA 2V6JA 2OV6A 5AESA 2J9RA 5ADWA 1RI4A 1OW3B 3AIIA 3EVCA 3NG1A 3PGVA 4QXRA 5CVDA 4GM1A 1J09A 3E7DA 2H2IA 5CDYA 2JGEA 4KFRA 3ZKWA 1OZ0A 4KVZA 1FMLA 5L4SA 3JQAB 4X94A 3S44A 2BKVA 1KXJA 2ZIZA 1JALA 1I3NA 1U2RA 4LGYA 2OC9A 1Z74A 3KQUA 1HTBA 1QHHB 2ZUWA 4RF4A 1G41A 3RANA 1LZKA 2XE4A 4DWVA 5BMVF 1V47A 2CT8A 2W2NA 2FW1A 3PDIA 2W7TA 2Z8XA 3GN2A 1FYFA 4GGPA 2QTVA 3U19A 2GYVA 4X8OA 2IZ7A 3QI2A 1KOFA 3HA3A 3TSCA 2DT8A 5B7NA 2YW2A 3NX4A 4FJ1A 2L18A 1I7NA 1U7XA 1UXKA 4H3HB 4FONA 4HNAA 5T4FA 1PJQA 2ECOA 3WQQA 1A2OA 1U31A 4L73A 1DCTA 1G0NA 2PT7A 2WFMA 1GQSA 3PHGA 1ECCA 4HQ6A 1CUZA 4NU5A 4UW9A 5CVUA 3GGSA 2HMUA 3GEDA 1DHTA 3TI9A 1E5VA 2IGBA 5F21A 1B00A 1BG6A 3WWZA 1L1QA 2R3SA 3MYRA 2ZR8A 3WIEA 1GV1A 3R0XA 4MARA 5ALLA 3ESCA 3QXJA 3ZNPA 1Z35A 2YIDA 3W6PA 1UFRA 2XZPA 2WIJA 1L5YA 2Z1DA 5EWLA 1G6OA 1PJSA 16PKA 5JD3A 3R9IA 2GCOA 3A7EA 3QXHA 3F9CA 4M46A 4FDAA 2QVCA 3D0RA 3HEMA 1SU7A 2CSXA 3IOCA 5DGCA 2BSXA 4EA9A 4KDRA 1Z2AA 1IEVA 3SXPA 4NAVA 4L8YA 1ST2A 4R69A 4UCFA 2ODEA 3EGOA 3SYLA 4E30A 2FR1A 4MWBA 4EG4A 1DBQA 2G1KA 3BWEA 5CNIA 5I9NA 1M34A 4JR0A 3IMKA 4J2OA 3PNKA 3PHBE 2ZATA 4CKEB 1M6EX 1CF2O 1T1IA 3CKLA 5JNWA 1J7KA 5E2IA 3KB6A 3P9CA 4J4BA 3RR2A 3HB7A 3ESBA 2G9NA 4L3OA 3G2LA 4OUDB 2ERXA 4P0TA 1ISGA 3PHHA 3KTOA 3BH6A 3WYNA 3FPGA 5WRFA 1GLVA 3GELA 3TTXA 1NVUQ 4MUIA 5DPMA 4YP0A 3T0GA 2EWMA 3HFRA 4JOQA 4BJ6A 1GPLA 2O05A 4OKNA 2OHXA 4DS3A 2VLIA 3MSXA 4LZWA 1SOUA 3O8QB 4TMWA 1NXSA 4BOYA 3IBYA 2HUPA 1ZXLA 3VDXA 1U28C 3S6JA 1UBNA 3KL2A 4PX2A 5KOHA 4WXMA 5TPZA 3ZX5A 4Z0NA 4PNPA 3V9AA 1U8CB 1KO8A 1IDN1 1XUOA 1J1IA 2G76A 3FTQA 2EYQA 5DM4A 4E0BA 1L3IA 3A0UA 3SZMA 1OVMA 3WADA 3X2EA 1X1BA 3ZWYA 2A5LA 5EWMB 4E2FA 4XYLA 2C9YA 2UVDA 4FDUA 3F6BX 5IW8A 4JI4B 2CJWA 2JGKA 3UJCA 3AQ4A 3SICE 4BRWA 4DXDA 4Y9DA 3GLGB 3EUWA 4MQMA 2TS1A 1ORTA 2EKPA 3QEMA 2IP2A 2FWRA 3LXRA 4G3XA 1NNSA 4G5SA 2RFLA 5A1JA 1RJWA 1SXHA 2I80A 2Y8EA 5IEJA 3M33A 3A6ZA 4XUEA 3WXMA 1P2BA 4XLTA 1Y3HA 2IITA 3R23A 5ALQA 4DLWA 2NV0A 1LDMA 1T3LA 2OQRA 1TX4B 2I66A 2YUIA 4DANA 3AUXA 2I3GA 4ZEXA 5JAQA 3UJPA 1D6JA 1XZAA 2FW8A 2OHIA 3F9IA 3LDHA 4OIMA 2Q4RA 4OJMX 4WZBA 4TLDA 5M7EA 4GEKA 1NFFA 3EZNA 1DG3A 4E70A 3FYDA 1EX6A 2VQDA 3G3EA 5K4AA 2XDWA 2BMEA 4YP5A 1GPWB 4YAWA 1KY4A 1Y37A 4QNNA 1A2BA 1O5OA 2VDOB 4YJDA 4PRKA 5JH7B 4ZYWA 2HNAA 4HNRA 5ED0A 2GFQA 1NF3A 4MW7A 2O8NA 4B3BA 3OE7A 5SYNA 1X19A 5HKOA 2FZGA 2J6BA 3NIFB 4ZI7A 3IVXA 3QXXA 4EA8A 2PZBA 2EFGA 3GRVA 3LPNA 2YHSA 3FM9A 3QVGA 2L19A 2QSUA 2IYRA 2QENA 1L7OA 2V9CA 1RWMA 2P1ZA 3K96A 1V4VA 3KHKA 4EJSC 3S0JA 2R1ZA 4LOHA 2UZ0A 3OUUA 4UUQA 4YUVA 3Q0IA 3TDMA 5JAMA 4WBSA 3STYA 2I54A 4PC2A 4BNKA 2J3DA 2G82A 2GPWA 3B3QA 3NV9A 1K9VF 1IQRA 1HE5A 2CVQA 3OCCA 4RIFA 5GOZA 5SZIA 2IUSA 4LJSA 1D9XA 3O3NB 1P75A 4BDTA 4BVHA 4XWKA 2XDQA 3PLNA 3GAZA 1KI1A 5A06A 1P62B 2GBLC 4KMMA 5IBCA 1K66A 4OLJA 4IQ8A 4B5LA 2Q1XA 3VNBA 2ARKA 4ZU1X 5KTTA 3AV3A 5HUHA 3DNFA 5DCYA 1E9EA 1T5DX 3EIUA 2G0NA 1PNRA 3LO8A 1YV9A 1OZHA 4FFWA 5FA5A 4D9HA 1U8UA 3HYCA 2RGDA 3RVMA 1Y81A 3RHTA 2GN8A 2B36A 3AEYA 5BWNA 1FFYA 1H6BA 2XVMA 5J2UB 4RD6A 3I5XA 5K3OA 1Z5PA 3W9UA 2P5TB 4EY8A 1OD6A 1DI0A 3OJCA 5AI4A 5LB2A 5BOSA 3QNWA 3WMWA 3PI6A 4EB0A 3RCBA 1M1YB 2ZREA 4FE4A 4HWSA 4HZIA 3U3RA 1VJ1A 4W1RA 3AJAA 1GZHB 3LNTA 4JI1B 2HJVA 5CX1A 2BBWA 3A6LA 1G6HA 2NZXA 4WSOA 3OEYA 4AZ3A 5JCPA 1VL1A 1WB6A 2CYCA 2UZ3A 3A26A 1ECBA 3BIWA 3JZAA 3M9LA 2BHRA 4BO4A 4NMHA 3OEED 1FE8A 1XCBA 2OXRA 3MHTA 1T5TA 1RRVA 2PGDA 3DBOB 4KHZA 2W48A 2W90A 3GEEA 4V0KA 4QOGA 1ZMTA 4EAQA 1Z2CA 1NN0A 3S1AA 2IY7A 1H69A 4DV1B 1X7YB 2FAXA 3KAKA 1D6MA 3IB6A 4CMAA 5AVTA 1WF6A 4TLLB 4Y2YA 3W8DA 4K3VA 1PT7A 1P5HA 1RSZA 2AOWA 5AKXA 4NYMQ 4HV4A 4YMUA 2ZJ8A 3A6HA 4REMA 3CNOA 1HG1A 3HVKA 4FBLA 4XPIA 4F3TA 3DHWC 2V7PA 4CR7A 3K35A 3RK1A 5JPIA 4YR7A 3TZQA 3ICEA 3KQPA 3KUXA 4GRAA 1FS5A 3T3DA 3EGEA 3WB9A 2YV2A 2H0RA 4G81A 2ZYWX 1C41A 1D1TA 1RWBA 2WJZB 1I1NA 4R98A 3BMNB 3AB3A 4Q9AA 2A88A 3H2JA 3A4YA 1LDEA 2V58A 3BGVA 1PNTA 1IZ8A 1QTIA 1WD7A 2RG7A 3HY6A 4H16A 4TYNA 2NO5A 2YIVX 2FW9A 1R6VA 4BKRA 3GBSA 4CFYA 5FBVB 5LMCA 3W6OA 4X7PA 3QBEA 1B73A 2CF5A 4PIMA 2O8DA 3U3OA 3GQBA 3T34A 1O2DA 3OFSA 1L7XA 1LVUA 2XMRA 1VJDA 3F5SA 2ZS9A 1PJCA 5DBIA 4RVHA 2HWKA 4LXHA 2XMBA 4AMGA 4BASA 3ZHOA 1PJZA 4DCNA 3B1YA 3WK5A 3TW8A 5I7RA 4LYYA 2AXPA 1G20A 1ATZA 2NPIA 3UH1A 4WX2B 2B4KA 3D64A 3VHXA 3OIDA 3O9VA 1FFGA 1YBHA 4V38A 2REQA 4AMUA 5EJ4A 1JMVA 3H0EA 2H29A 2FN3A 4X60A 2BFEA 4HMQA 4RCVA 4C5CA 2WJHA 3ANNA 2FP3A 2JGLA 2RHDA 3EXHB 3I3SR 2GD0A 1A1SA 2G9RA 3PGKA 4I2NA 4JQZA 1XC7A 3T7RA 3K9QO 3T3MB 4K88A 2C97A 5HKKA 3CV3A 1CUUA 2XX3A 2NU7B 3DBRA 1M1XB 5KDDA 1R6UA 3GT4A 4PY2A 3AQIA 3JAKA 3IMFA 4C1NA 3FLAA 3TKLA 4D0RA 5KAPA 4FZ3A 5DGHA 4A10A 3BG5A 2UUCB 4RD2A 1H4VB 3ZHCA 4M9RA 3U9SA 1G2PA 5C5CA 2AZMA 1YOBA 1RRMA 1XZKA 3PQ4A 5GZ1A 1H3FA 1YJXA 3EISA 1M3SA 2H3HA 4JC0A 1ZUHA 2O3QA 1JQJC 2FUEA 2WDZA 2A0XA 5EUQB 2BFAA 1T1EA 1TOAA 4L5YA 3H5RA 1NRJB 3AT1A 3JCZA 4JP3A 3TRDA 3W3ZB 3THOA 4BGEA 4LF7B 3NH6A 3I2IA 1D4ZA 2M2IA 5EUCA 2EGUA 1I13A 2B69A 4RHUA 4X9XA 1PZXA 3D59A 3B2EA 5FTLA 1UT6A 3D7SA 2R8YA 4CRWB 3OLXA 4WXRA 3RRYA 2IXEA 1E59A 3MGBA 4D79A 5KCZA 2EQBA 5ALPA 3ZGOA 1Z6QA 1FDOA 3F5FA 3SF8A 2RHOA 4Q1VA 3FFWA 1CJMA 1Z29A 2WAXA 4ROSA 3NUGA 3B1KA 4HI0E 4RHEA 4ZEMA 2VS1A 5JSFA 1CF4A 1OXXK 1AQJA 3DLAA 3B3GA 3GO4A 2E82A 1VL6A 1NKTA 4PHTA 1ZNQO 2Y92A 1PYDA 3KVVA 3NUZA 1TO6A 2EP8A 1Z9BA 3KDSE 2LZ0A 4PANA 1F14A 3DD5A 1YR7A 1AV7A 4O2BF 4LZZA 1MP0A 2H8GA 2QTGA 1GJRA 3AYXB 3GRUA 3QX8A 4PBSA 3WGLA 4D5GA 621PA 1SEVA 2OHGA 5BMVA 1EGVB 3DAFA 4R1OA 3CEPB 1AIPA 3BD7A 2JKVA 3DXZA 4CCWA 1XBTA 1M6NA 1D2GA 1ANKA 4GP6A 2GZRA 1F12A 5K8VA 1I7DA 3CF4A 4JP1A 1WEHA 1NVVQ 1ZCZA 2FP4B 3N8IA 1E62A 3OESA 1W48A 1CBUA 1GXSA 2BLNA 4RH3A 2Q3BA 5EPOA 4YCCA 3DFKA 2OA0A 5IVIA 3N3AC 5IJXA 3G0OA 4Y1RA 2QQGA 1W25A 3KTAA 3RVNA 1B42A 1FFAA 3RIGA 2XUQA 1T26A 2IOFA 1UQRA 4G6ZA 4A0FA 4MH0R 4RIGA 4LBYA 2DPLA 2O52A 3L1IA 4GHWA 3ZJVA 3M89A 3WFZA 3PUJA 2ACWA 2F90A 4CI0B 4CPDA 1P4SA 1Y63A 1QQ7A 1P45A 2TMGA 2YN2A 2BEVA 1BWSA 3MJDA 3UVEA 4EHDA 2NQ8A 2IIPA 2QNRA 4H6VA 1D2NA 2R6ZA 1PJAA 1VIYA 4RAQA 5T4HA 3RE1A 4RGBA 3VR2D 1Y8AA 1YNOA 3X1XA 4NR0A 3DV0B 2X2OA 3OLVA 1KU6A 1QG4A 1MNAA 2C20A 1AB6A 4CHGA 3CEMA 5IJ0A 1RPJA 1PR3A 1ZQ1A 1U7TA 3ZWQA 5ALEA 4II3A 1K7FB 3AR6A 1SBCA 1T3HA 1RJ9B 2PXHA 4YCMA 3BXFA 3A6GA 2CVOA 3MQ4A 3SC3A 3GIDA 2QRKA 2GEDA 5IM5A 5LP6F 1U0BB 4ZYYA 3G0IA 4D0SA 4Q7KA 3NT2A 4QVGA 1UBUS 3ORRA 3B1JA 5K0CA 5F4ZA 3C5EA 4WT7A 5KTRA 4R1NA 1VTKA 4X00A 4M8IA 1OXKB 2XUHA 2NSLA 3Q3VA 1RZVA 3ZK9A 5CFZA 3CONA 3O1JC 2B37A 4GC9A 5IYZF 1DVRA 3VDNB 4EYOA 3WK6A 3X2FA 3RFVA 2WJ3A 4B31A 4KX3A 2AX3A 5TMPA 1J0EA 2Y0EA 4RV5A 2F67A 1B8PA 4ZT7A 3TJRA 1LLQA 1DCFA 5GGYA 5ARBA 1SIUA 1RYBA 1ZCFA 3AOEC 4RVGA 1LI5A 3QNMA 5IDQA 1V5FA 2FEPA 4BLOA 3EEYA 3V32A 1JIUA 2V5UA 2ZIXA 3IUQA 3LY5A 3NWBA 5DRTA 4B71A 3GLSA 3TGWA 3URKA 4AJHA 2I99A 4RETA 4QTYA 3NEYA 2XAUA 5BV2P 3ASZA 2KW5A 3GCWA 3PQCA 4O0MA 2OFFA 4DWWA 3T1TA 2H4JA 1JU9A 3T1NA 2QDKA 3OC6A 2VJPA 3QJ5A 1R1DA 1EYZA 3ADBA 3QFFA 1K5HA 1SZDA 2WJIA 4GD3Q 5HJ7A 2J5BA 2BL4A 3MT8A 1NASA 3WLSA 3ICPA 5CM2Z 4HEA6 1GD1O 2D1YA 3BFVA 1E0JA 1MRZA 3DV2A 4I6GA 3AEZA 2XYPA 4L7QA 2HA3A 3DF9A 3HRHA 4EELA 4ZHSA 4G0VA 1II8B 2ZBDA 1T5IA 3F6YA 4G86A 5KHAA 3KJGA 3UKOA 3E03A 2AQHA 1Z5UA 1ZC3A 1UOPA 3SDBA 3VTZA 4DT1A 2VT3A 3L6DA 3DDCA 4BX2A 1JAZA 4QDJA 2FWBA 4OB8A 4RTPA 2AJLI 2QVLA 4UMEA 2W2LD 2ZXUA 1FJGB 3LCVB 2IS6A 2VFAA 3F7OA 4QDZA 3EQ6A 3D6NB 4EGQA 3D0OA 2ZJZA 1T3SA 1C8KA 2YV4A 3TB6A 2VXOA 2X58A 4BNVA 3R0QA 4LV6A 2GCGA 3U09A 2EL9A 2AG1A 3DBHA 3ORHA 2F1JA 2WU3A 3ONEA 1LA2A 2E55A 3BA6A 4WNYA 1EFDN 1P1KA 3V3TA 1DNPA 1XMJA 3BHNA 1X7GA 1NVDA 1BFUA 3DMHA 3ZK7A 1PQWA 2VYVD 5LM3A 4IZIA 2XBMA 4H3SA 4HQ0A 2C4HA 2X41A 1BU5A 4IUDS 3IXQA 4KSBA 5DLPA 5KKNB 1RCFA 1KJJA 3EH2A 1N6IA 1CIPA 1J7JA 1S89A 1T6YA 3PK0A 4J1NA 4ND6A 1DQNA 4HLNA 4RY0A 3LPDA 4DJAA 5HNKA 3PEWA 4WOCA 3PCTA 1S3SA 1KQPA 1OAOA 3N86A 2BH2A 3H2SA 1F3OA 3LC0A 1GQRA 3LX8A 2VTEA 5G53C 5H70A 4BFXA 4ZDJA 2G77B 1CUDA 2QM7A 4TYMA 4LDPA 4O63O 4IDAA 3VHQA 1DELA 1LZLA 4E5NA 1AZTA 3FPBA 3UF0A 1ZVKA 5EGSA 2FFAA 2BKAA 4KCGA 1JU4A 4KQMA 2J4CA 4Q4LA 3Q40A 2MT9A 2PQ0A 3O4IA 5F52A 3V1NA 3GLUA 3LNCA 3ZEIA 4C3VA 3GH1A 3FKSA 1JSXA 3W3AA 4KVAA 3GDWA 1M7BA 5KDLA 3GCZA 4F3CA 4LJRA 4G4JA 4CQMD 3BCUA 4R51A 4EA7A 3JRXA 1BVUA 1ADGA 1RJDA 4DJEC 1PFGA 1AO0A 2BKXA 4H7FA 4REOA 1ZD3A 3GLHB 1P0PA 1CR6A 1PW5A 2VJMA 5BO5A 3ZJ5A 4FIZA 1ZRSA 4LXXA 4MRVA 4GBED 4G0QA 4JLJA 5I9LA 1GZ3A 3U4QA 4RK5A 3QLTA 4BO3A 1I1HA 4DA4A 2LNDA 1DX6A 3FMGA 4A15A 4EATA 1EDEA 1MC4A 2EJUA 4Y6PA 4U7TB 5EMJA 5EJ7A 4AYTA 3I9V1 1QB8A 1TD1A 3IVAA 5HIJA 4DIKA 2G8NA 5PNTA 4DV5B 3EBLA 1RYHA 1OI2A 1EAYA 1T2VA 2JLCA 3FYUA 1RQNA 3M6MD 4LTNA 1QGUA 2ZBFA 4U7FA 4QO8A 4UVEA 5JCOC 1P33A 5HZMA 1MRSA 1JZQA 1BHSA 4BNWA 2FX2A 2ZCUA 3FCCA 3GRPA 4RHFA 1XJ0A 5L6MB 1RNLA 3CLTD 1O94C 3Q2KA 1E0SA 3RRNA 3WIUA 5HW0A 3DLHA 1KZ4A 1R5NA 1WUIS 1OT3A 2Q1YA 3N0TA 2GVZC 3PUKA 1SQSA 5IARA 3RUAA 1K86A 2PRYA 2QRUA 1IZ0A 5AJHA 4TLEA 4Z3KA 1KH1A 1C7EA 3QYJA 3B5EA 1N9KA 4E07A 1J8MF 4MPDA 4TLCA 5F7JA 4E46A 3ENKA 2B9VA 1H22A 1K2VN 4HH4A 1BE1A 4AZ0A 4MQBA 4J1TA 4K9NA 2AKYA 1WQ3A 3OE7D 4CE6A 3T3NA 1KDPA 3I32A 5LQJA 1U04A 4CWAA 1TJ5A 3L4BC 2QXTA 4CLOB 4IXDA 3TQHA 4F5ZA 5J47A 1KARA 2BFFB 4IJ6A 2IX9A 3E1KA 2G8LA 3HZRA 3BTVA 3CZRA 4KUHA 3OZEA 4Q4JA 3SEQA 4A4DA 3AX6A 3FTCA 3I53A 4KXUA 3EEIA 4FFRA 2B8WA 5REQB 3WGYA 1MVOA 3ZD7A 2F3SA 3GI1A 3GPDG 2CCJA 1TM4E 1P7WA 2EZUA 3MJSA 2IOYA 3ZTYA 4AKEA 1EXVA 5ICSA 5IT0A 1BFDA 1H0RA 1CVLA 4HS4A 3ZVMA 1GPYA 3B70A 2AZTA 2OO3A 3PFCA 5D01A 4FC7A 4DLPA 3PKJA 1NVVR 2LR0A 3NBUA 4DG8A 4B73A 3V8PA 4L9RA 1GR1A 4FGUA 2OZVA 5U9CA 4ZGGA 5CB4B 1GWNA 1GFWA 3I9V6 3GJ7A 1QIGA 1XHFA 5LMZA 5DI3B 3LVFO 3GEGA 1Z0KA 3PWTA 3G1TA 4IDOA 3OQJA 4F92B 4LYGA 1ZU4A 2IYLD 1T2DA 1AF4A 3NAGA 2A1TS 1M2GA 5JZMA 3LLSA 1N92A 1ADYA 4IGIA 1ZHFA 3B82A 3A4TA 1Z7YA 5BUCA 1PN3A 2CMFA 2R6CA 1CEXA 5HIMA 3A9UA 3ABIA 1KKMA 4IR7A 5BRJA 3AZQA 4J0GA 3TNJA 3EQ8A 1FQWA 3RDPA 1M7GA 2HLPA 1RQPA 2AN5A 1NJGA 3I6MA 1PS8A 3LQ1A 2VDWA 4YASA 1Q83A 2SCUA 2DAPA 3JYOA 4ZVTA 2IU0A 2XT0A 4E22A 4PTLA 2L2QA 2XUFA 1VMIA 2C4UA 1OB5A 1ODKA 1RZ3A 3BHJA 3I9FA 3BD9A 3A9VA 3BE4A 4LRUA 1K3UB 3ROGA 2M32A 4CLRA 2WYWA 3IHLA 3UA4A 5DHTA 5GM1A 5A0TA 1XKQA 5FB3A 4JYPA 3KEFA 2G0AA 1DS6A 1W47A 2DZDA 4XTRA 3TEJA 3WAKA 1QTRA 2XBUA 1U8AA 4RJKA 4BE4A 1JLLA 5CJJA 1TZMA 4B5KA 3QUAA 4LOKA 1RDFA 5TARA 4FSXA 1YZUA 3L0ZA 4HGRA 5F9MA 3EAQA 1J4AA 2ZKIA 4YCBA 4RLHA 3WIDA 2AR7A 5D2CA 5C1IA 4BQFA 5JHGB 2DBYA 3FWHA 4HFRA 1T9GS 1FMTA 3FB4A 2EYUA 2CNDA 4AJNA 4C1BA 2AXNA 3KE8A 1EUQA 1QXSA 2F4VB 1UM8A 3NYQA 2GCPA 1C81A 1C8LA 4KV7A 3WLOA 2EW2A 2WOOA 1OYVA 4ZZIA 2Z83A 3GDHA 4RM2A 2G5TA 3K05A 3D8HA 2YTZA 3K5PA 3NTUA 3DT9A 4EUHA 4CKYA 2FSPA 2AI3A 4O2BA 2OCLA 2JF0A 1IPEA 4YT2A 2W2OA 1MJFA 1OIXA 3ELWA 2YHBA 5DN6D 2HR1A 1ZIXA 4V0QA 4CDRA 3LWDA 1RAAA 1U7ZA 4POAA 1NP7A 2W2VA 4FHCA 3CKKA 3HACA 5F9HA 1SEPA 1W5EA 3ISVA 3IVMA 2JJ2A 1EHYA 2Y93A 4YACA 2Q1UA 4H0NA 2ORED 2JARA 1XDUA 4AMYA 3HUTA 1JXMA 5JNSA 3BQ9A 4NBUA 3SN6A 3UHOA 3VFDA 3M4NA 4IP0A 4YJGA 2M98A 1PT5A 3ZHYA 1H3EA 2IUTA 3WL6A 4ZVQA 3NDPA 4LXGA 4FKMA 1Q7BA 1E6WA 2ZLBA 5T57A 4E03A 5A9SA 3AM4A 4Y3UA 3D2AA 3T4PA 3EPLA 4PSAA 1PS9A 3R5SA 2X9QA 5F7XA 4V0OA 1MZPA 2A9JA 5HKKD 4RX1A 3HMKA 5DBHX 4HP8A 3DE4X 4P7BA 1M0TA 2FMTA 5JXHA 2IYSA 2C3UA 4L3VA 4NEHB 3AF6A 3NTLA 5A04A 4XB1A 4M1EA 2GLTA 3QA9A 4BNHA 5ALKA 1YCHA 1RKVA 3KFVA 2GZSA 1MENA 4DJFC 1ZMXA 3LF1A 4Y1EA 1DG9A 3E3AA 2QBYB 3ZWXA 4N8SA 3I34X 4RK1A 1ZIOA 4RQTA 5G4KA 5BORA 5CFOA 2JLBA 5KJCA 3EXG2 4NCIA 3TBFA 2JJYA 3KSBC 5BR7A 5KU7A 1BWQA 1IJEA 4ZZ0A 2VXBA 4IH4A 1UFVA 2J5RA 5AQ1A 2GNPA 1X8JA 2D1RA 4ARBA 3QWBA 3KS9A 3QVWA 2GVNA 3PNVA 1J2EA 1VC2A 5CIQA 5LP6A 1AQNA 2W42A 4BMYA 1I3KA 3LOPA 3O3OB 1TAHA 4RVFA 4ZO7A 1GG5A 4OHZA 2PNJA 5LQNA 3NV7A 3O8RA 1EUYA 3SZGA 3TD9A 2AMYA 1KDYA 4G1VA 3RU3A 1W59A 1NRWA 3VZQA 3DE3X 3WBJA 3AVYA 1QG2A 3K9FC 4J75A 1E7SA 3RGWS 3TRKA 2AKAB 5IYZA 1V16A 2ZE5A 4QG3A 1XRQA 4Y98A 2K7FA 5A6SA 1QCDA 1LTKA 1T0JB 2WU4A 3NOVA 3C98A 4A0GA 1WHSA 3BJZA 3DT8A 1TM7E 3H5NA 4X24A 4ZVOA 1VHDA 3FYCA 1NKVA 3AF1A 3M0EA 4HO1X 1BMTA 1BDMA 3H75A 4S35A 5KU1A 1K92A 3H5IA 3KJQA 4RU1A 5L8VA 1NVFA 3TQCA 1JQDA 1PCXA 1GYQA 2ZSEA 5C7LO 3KYDB 4XUCA 2PYZA 1VP9A 1Z34A 1MB4A 4P0QB 5K0GA 4NARA 2R79A 1W88B 3FOAA 1BJTA 4HNHA 3NHPA 4Q3DA 4JXZA 3G8DA 3KQWA 1EK6A 4FZRA 2PM8A 3HI4A 2CXUA 3BRCA 1G5QA 3EIXA 3JATB 3KQVA 1CS0A 3AETB 3MUFA 3PWKA 3LK7A 4HR7A 2JNWA 4XXHA 3V8QA 1KP3A 2FPIB 4UFPA 2ORYA 1L7MA 2PRJA 2H07A 1Z2OX 4P7KA 1N6LA 1I10A 2H1HA 2JGIA 2LD4A 3DZKA 3M34A 4KGXA 4XOUA 3MEQA 3N75A 3UG6A 3K70B 4N3CA 4TTIA 3M6AA 1T5SA 2QDXA 3UAGA 3EUFA 4C08A 3AUKA 2QYSA 3A1TA 3BEOA 5GQSA 5IJAA 4FX2A 4YQYA 4MR8A 2VP0A 2O0LA 3HYLA 4C20A 4TTSA 3GWGA 1BVHA 4DMFA 3UAWA 4ISBA 3DDZX 1TIPA 2FPPB 3NASA 5I9IA 1KMHB 1EFCA 1V3VA 4J16C 2QU7A 4NS1A 1KH3A 5JAUA 2D2VA 2JFGA 5E2AA 1UKZA 4PN3A 1G8MA 1CNFA 3SHOA 3O4FA 4I55B 5CT9A 3VPDA 4QFMA 1XMXA 3C3CA 3P9QA 2ZYAA 4LJ8A 4MB0A 2B4QA 4QPJC 5E9QA 5ABPA 4GX5A 1T8PA 2VPPA 1ZYUA 4NU6A 4FYKA 3SJZA 4A2WA 1XP5A 1GGHA 1Z82A 2V4ZA 4LGCA 4YUAA 3KL4A 4EYKA 4KUGA 6ADHA 4D74A 1JJVA 1QS0A 3CNNA 4MS1B 3F71A 4Q47A 4HB3A 1ONPA 4QXPA 3OPMA 4QGAA 3W5SA 4EIWA 1P1RA 1H42A 2NO1A 1YQDA 4C0LA 3FVQA 3IUEA 5AOAA 3DFFA 1ZRMA 3J81k 1Z26A 4AMZA 2TECE 3DO6A 4LY3A 5AW9A 1J0BA 2VPQA 4JU9A 5EINA 3MGGA 1JSLA 2QM0A 3GJRA 3EY4A 1I24A 2O9JA 2JLQA 4FTWA 4OHMA 3BB1A 4ZVNA 1TT5B 2X2FA 4H7EA 5DBOA 5JRJA 3VKUA 5GJVC 4EBBA 3PXBA 1ACMA 1I4DD 1YMQA 2IHKA 3V9PA 2CJXA 1Q1QA 2BE7A 1JU3A 1K6JA 4D1YA 1K08A 3ZU6A 4J3NA 1MO3A 2J33A 3BF8A 4GNRA 4IYJA 4V0ME 2X6RA 4ENPA 4DCTA 2JGRA 2Z6QA 2QIPA 4WY8A 1C0EA 2HFKA 2QVGA 3P94A 3JD3A 1G19A 4ZAGA 3WMEA 4IJ5A 4ZYXA 4MVCA 5FL7D 1U9IC 1VA4A 2XOXA 2J5KA 1KJYA 4TSFA 3KRTA 5DFAA 1JDSA 4LWOA 4TQAA 1U8TA 4X7MA 5B1EA 4MW9A 3PRJA 1ZK0A 2BJWA 3C2QA 2EIXA 1SUBA 2OT3B 1JH8A 2GM5A 2VHUA 2N1BA 3IIKA 2IK8A 3QF4A 3TIGA 4RJTA 1IWBB 4HDMB 3T9EA 1CQPA 3EBPA 4EFDA 1GY8A 1W0JA 3L0SA 3FSGA 3IJEB 1TCVA 1U3CA 2HI0A 3SJBA 3BZUA 1J2JA 3D8UA 1AA6A 4MGYR 2IBSA 3UMFA 1LF5A 1BVRA 1YMVA 4MLDA 4X1IA 3KM0A 5DTRA 1UJ5A 2O4CA 4XAQA 4GMGA 5IG2A 3N6XA 3TTVA 3LZDA 4GC5A 2WSBA 2D13A 4GLFA 3QVXA 1XZPA 2F6RA 3PXUA 1NMQA 3ZDRA 2CYBA 3B52X 4C6RA 1U1FA 4HXFB 3GX1A 4YGXB 3ILYA 1V3TA 4WJKB 4N01A 1TJ4A 3PE3A 1KDVA 3WKAA 4CMCA 4F5DA 2UVPB 3NO4A 1P81A 5EE0A 4BWFB 4ZALA 1R8YA 4JYBA 1T1JA 3DKPA 4NBVA 5EG5A 4WGGA 4MP3A 4LJ7A 1Y8CA 4EJMA 5CW2A 1IUNA 4FCTA 2PWBA 1UP4A 2G9UA 2VNKA 4O2AF 3WTBA 1V1RA 4DNQA 2A78A 1V8FA 4OGLA 2OXIA 1LGYA 1ISRA 3ETNA 2CXNA 3CRZA 2HNKA 2IYUA 3QFRA 3HBJA 5EZ6B 1SUPA 2C5EA 4ED9A 3R9XB 2Y76A 2IUUA 3PXDA 3G0GA 4Q01A 1W1WA 5D5PA 5IDWA 4O4HF 4TL6A 4XOIA 3HDQA 1NVBA 1RYEA 2IOHA 1K06A 1TQHA 2X2EA 3ABSB 3C41J 4HXEB 3REFA 5CBKA 2Q9UA 5KX5B 1B74A 4L9SA 5F7ZA 1XAGA 5JQGB 4RVUA 2JDIA 4BFWA 1B16A 2R6GA 3FKSD 4PX3A 4B0PA 3QNUA 3ZYCA 2VLBA 2B5WA 1HX7A 2X14A 3I9LA 1A0OA 4FSHA 4XCVA 4D4MA 5L95A 1WB9A 5J58A 1C3OB 5E6UA 4B4WA 3GJ8A 3GFFA 3A9SA 3QXSA 3DOFA 1RS0A 2BBSA 1IBRA 2HHLA 1RHQA 3NKFA 3EAGA 1P8AA 5IC5A 5A5GA 3U44B 2JIQA 4DIFA 3C5VA 3EUEA 4IL5A 3HVRA 2O2DA 2BGMA 2OB2A 3FMVA 4WCDA 1JA0A 4ZN6A 2IDJA 4QUKA 5DHAA 4REQB 4X71A 3E3MA 2FUCA 5EHGA 7GPBA 3X1YA 4Z4EA 1PNVA 2C58A 5LJIA 5CITA 3UYKA 5FWYA 4KSCA 2GZ2A 1E8DA 2WMDA 4G9GA 4KXLA 4MI6A 1T2AA 2ISSD 2QUKA 5ER9A 3AILA 3W2GA 4EG6A 4WKOA 4N5LA 4ETIA 2UUBB 3LW7A 2AD5A 4QULA 3JS5A 5DLEA 5EJ5A 3FUWA 3GFBA 4JKOA 3AR4A 4NNPA 3KXLA 2VHZA 1E96A 2ZETA 4ER5A 1GYRA 3ZE0B 2HF7A 4EI7A 4UOZA 4RZIA 3LSYA 1NSYA 3QU4A 4JGBA 3A0RB 3B1FA 3OPYA 1SKYE 2P2YA 5AW7A 4JSYA 2PGNA 5LQUA 1TKCA 3CKMA 1YZNA 5H81A 1KL7A 2VUTA 4P3XA 2VPXA 4DTIA 2XTJA 5D6OA 4C6TB 3NKLA 1OXSC 4JEIA 4LKRA 2ZU0C 2ISQA 1GKIA 3TIXB 3H19A 2PBZA 2NYRA 3V4SA 1C2TA 5F35A 4B33A 2CXQA 3JQEA 1GA1A 5T64A 1Y7LA 1DP4A 4YUYA 3W8EA 1O4VA 3EXEA 4CM7A 3AVWA 1B23P 1MT0A 3L1VA 1BQ4A 4EF5A 1Y4SA 5LOVF 1WSAA 3HR4A 5BSMA 1YI8A 1GUFA 3NVDA 3GPIA 3ZTTA 3EEOA 1PD1A 4PFQA 3WIVA 5F3WB 3WJ2A 1JAIA 4R2KA 1U5CA 5JSZB 3JQ8B 3R9WA 1NJSA 1POXA 2VT7A 4JL8A 5A4DA 1B93A 4G65A 1EDBA 1N9ZA 2VF7A 2ZDQA 4RK4A 1ZOPA 3S8YA 1NKSA 2V7BA 2W6JD 1L4UA 4JP2A 1YFZA 2WSLA 5EE5B 2Z6UA 5CB6A 4G5OA 2QNBA 2WUGA 4YJ3B 5HHTA 1C7QA 2V65A 3I42A 5HZHA 2OYSA 4D45A 3DC7A 4M8KA 3E3OA 5JARA 4JLMA 2QWXA 3GGOA 2Q8QA 1ICEA 4D4GA 5FF9A 1QF6A 3T3GA 2ZAMA 5AKJA 2O2YA 3C8DA 2GFHA 2YFKA 2BR3A 2FRDA 1Y8RB 5J40A 4BQEA 5JLJA 4NY1A 4ESHA 5GJBA 3SFVA 4N7BA 1FMJA 1C7IA 4KXWA 3HKCA 4YO7A 3S70A 4ZMBA 3OQOA 3PNPA 4I50F 1DT5A 4AF6A 1XDDA 4PLFA 1LBSA 1HLGA 1ZOLA 2UZ1A 3BCHA 4J91A 4EB3A 3KZKA 3RUIA 3WYCA 2R4QA 1UXHA 4E2XA 1LPPA 5I48A 1R00A 5JANA 1SG6A 3KLBA 4EG8A 2DXIA 1NNLA 1H9CA 3H1AA 1PJTA 4DSTA 5FDFA 4RVNA 3H9UA 4TV8F 5H0IA 4QRHA 4JI0B 1R64A 1KMCA 1U2EA 3VNQA 1FXSA 1NMSA 2FOXA 4QUAA 2IKQA 5GM2A 1PR0A 2AW5A 1U9CA 5HA5A 2D3WA 1QRTA 3Q41A 4Z2YA 1RPTA 4PX9A 4EMSA 1N9GA 5HZKA 3QUQA 1V4BA 5EA2A 4DYVA 4B1FA 4HH1A 4I5EA 4HB0A 5KQLA 3N0WA 1A9RA 2R8RA 5MFPA 1NR7A 3I2KA 1USUA 3AFNA 3L0OA 2Z58A 5JAPA 1O0BA 3V2UA 1HKUA 2P8JA 1F0NA 4BJ5A 2GFIA 1DXOA 1I32A 1C9JA 4O4IB 1NBMD 3JWHA 4N47A 1JZSA 1JYFA 3ENQA 4M55A 1XTBA 2XOEA 1EXWA 1A04A 1YHNA 2HDHA 1N78A 1FVHA 3DTTA 3MWKA 4EFLA 3DEYX 1M8PA 5DTIA 5EQTA 3VOSA 2P77A 1J5PA 2JB9A 3SIXA 1WW2A 3BZBA 2A9QA 5JY6A 3O91A 5MN6A 1T0PA 2AJBA 3H3JA 5CA0B 4QRIA 4JV5B 4IHJF 1P77A 3ED5A 2HU7A 5KTOA 2WSIA 2CHVA 1ZH2A 1CY2A 3UK6A 2Q21A 3DOIA 3ZS8A 1O58A 4CXMA 4RLSA 3ZD9A 1TQDA 4Y9TA 2EW8A 3EZ2A 1WCXA 1YC5A 3U17A 1GPH1 1E3WA 3S81A 2ZDHA 2JJ2D 5IT4A 4KTTE 3IEMA 4TQGA 4US2R 4LSMA 1RRPA 2BFPA 2WHPB 3QKUA 2XWQA 4MV5A 4F04A 3MT0A 4OXNA 3EJ6A 1A69A 1JI3A 2VG8A 3P2JA 4W82A 3UC5A 4GDMA 2YMMA 1EB8A 1OLOA 3KQMA 3MWFA 4FNOA 4OQZA 4ZPXA 4CKWA 4RVDA 3EYWA 4QECA 1QQ5A 2BCJQ 4IIYA 2C1ZA 4DQVA 3WL7A 2BGTA 2RH4A 4EKGA 2O6HA 1O9HA 4BV8A 5AVVA 3P2IA 4FFLA 2UAGA 3IVGA 5TY0A 1FYVA 3VNAA 4NCAA 4HAVA 2X0IA 1BSVA 3TAXA 2X8JA 3P9ZA 5JDCA 2WRZA 4OX9B 3HGQA 2I34A 4FCCA 5IVKA 3MCWA 2G3YA 3FNBA 2FF7A 5KJ1A 2VPIA 3AUJB 5CHEA 2FN9A 1UPFA 2WNHA 2Z9BA 1WTAA 3QY0A 3K5HA 3MUOA 3Q5GA 4ND8B 4OXYA 4EW1A 1IM5A 4X1OA 3ZN2A 1IQPA 1YZVA 1ODFA 2DTDA 3LSTA 4TKMA 4TVOA 1EVJA 3ER8A 5FPPA 4YJHA 3EGDB 4LSZA 3L7CA 3KB8A 3JQFA 2I6TA 3AHCA 3QA3E 2J0VA 2Q0QA 3GZTB 1L4LA 3BXHA 4YC7A 1CJVC 2IHBA 4MHTA 4YDRA 3KZOA 3UMSA 1PUJA 3HWSA 3KR9A 3WLRA 4YRNA 5IT9A 4ZGWA 3ZDBA 4ARUA 2FE4A 1WDMA 4Z0PA 4KRFA 4LE1A 3OIGA 4HVLA 4IH9A 5P21A 1QUFA 4EO4A 1QHEA 3RV3A 1F8UA 3WQSB 3BSWA 4W5WA 5E9WA 5I4CA 3KIPA 1DTWA 3ZI4A 1ILEA 2Z5FA 3AY6A 4LX0A 4M0DA 4QUGA 4RAOA 2C2GA 5CVJA 5D7NA 3TH5A 4AAYA 1GAXA 1DEOA 4HDKA 2ZJOA 3QW4B 3WAJA 3A4MA 1XKXA 3FD8A 3IBTA 1UM9A 1UOEA 3JQ7A 5I7FA 2QUHA 1I7QB 5ELXA 2WWTA 4DRYA 2BZGA 4Y6OA 2MMCA 3NOQA 1QV7A 1W2WB 3OM0A 1XZIA 4LWZA 3ZXXA 3GRRA 3N2KB 4F7WA 1XQ6A 1RWOA 4IUCS 4KRGA 1RWQA 1N2CB 2ADFA 2DTXA 5JJ5A 4NYIQ 1LRKA 4XD7A 2MYUA 3SFZA 4JB3A 3N53A 3WZMA 4G85A 5JALA 3UPUA 5IXJA 3L8DA 3GZ4A 1LPBB 2P3SA 3ESRA 3LGAA 1IDOA 5DB4A 1JIKA 3TLGA 2Z1MA 1XVVA 4EAAA 4NDAA 1YVUA 3U2QA 3LD9A 4XSGA 2CSUA 1HYBA 4BNMA 5BYKA 1A88A 3R5HA 3V4ZA 1PGQA 3A3YA 3HP4A 2PTHA 5JMPA 2HTEA 3Q87B 3MOSA 2D0PB 4IDPA 2P2ZA 1W30A 3KJZA 2RK6A 4FP9A 2YCBA 3DEIA 4TPKA 2GT1A 2WTAA 3CGWA 3TK1A 1C7ZA 3EG5A 3WOVA 4R1SA 1QHIA 1RWKA 4AG6A 4FHEA 3VJKA 1FK8A 2PFKA 3LKDA 4WIAA 3M4JA 1K5GA 4YECA 5E1MA 4ZD6A 3PJEA 4QTTB 4RGQA 4LI3X 3TGLA 3G79A 1QYIA 2Q9BA 4DCCA 2PQMA 3IPRA 2PL9A 2H5LA 1IC6A 3BMOB 3TPZA 1Z4IA 2LE0A 1IY0A 1SK9A 1PYOA 3OQIB 4O2AA 2RI0A 5F2EA 5TMBA 2QN9A 3CNHA 1TW3A 1BMFD 4K6KA 3BHIA 1L8XA 2C95A 3I6ZA 5I7WA 3GJ6A 3R41A 4G01B 2QP3A 2GR9A 3I92A 3M3DA 1WMDA 1JG4A 5EHXA 3BDAA 1GTL1 5D5HA 3V3KA 3IDOA 3P9PA 1JJFA 1ZC4A 4OJNA 5COAA 1P1BA 2EFDB 4O4HA 4A5SA 4BLRA 5KINB 1B6SA 1QIEA 3CNLA 4M6WB 3DXXA 3D7KA 3ZR4B 1ZM2A 4P4SB 4W8GA 1N1DA 4C14A 1X86B 1FB5A 4L0CA 3V48A 3FR7A 3ANXA 4MLPA 3SE7A 2RE8A 1I80A 4UNNA 3L04A 3KCNA 3O31A 1J07A 5LXTF 4DLTA 5CVTA 1Q1EA 1A1VA 2H2FA 1WBJB 4MPJA 4OF4A 4TXNA 3L18A 2LPMA 3MWLA 2QR2A 1A8HA 2QI9C 4MQ4A 5CDHA 1GG2A 1Q0LA 1S3FA 3AI1A 1YASA 2FR8A 1LFDB 2PZKA 1U7HA 1YULA 3MB5A 1ZX1A 1W4LA 1D2HA 5BNFA 1FCJA 3S2GA 3TLXA 5H3CA 2MDTA 3CNBA 1EP2B 2W4IA 3VVMA 2VDNB 4DIBA 1JG6A 1W87A 1Z5VA 3GXBA 4TSFD 4YAUA 3RRMA 1RRGA 4F4JA 5AIBA 2C1XA 4RIHA 3RFCA 3ITEA 1JVBA 5BNWA 1CQIA 1MO5A 5CIYA 3PWZA 2ZP1A 1DJPA 2PUWA 4BEBA 3B85A 4F3KA 3PQEA 1W0JD 4KXQA 3E1GA 2YZGA 4LCJA 2QAGB 2C4KA 1AN0A 3JTEA 3P9RA 2H5JA 4OU5A 3GUZA 2IPMA 1O6GA 2LKCA 3OKAA 4M1OA 4XGKA 2QTFA 5C46F 2G04A 5DWQA 4BKQA 1M33A 4FFOA 4B2PA 5EJ8A 3CWZA 4D46A 2G28A 2JIRA 3WWDA 3F7NA 4FHZA 2XH8A 4DM7A 3IP7A 3AI3A 3CO5A 4AXBA 3VOTA 2ZWOA 1GG9A 3NH9A 4FYHA 4R2WA 4Z1MA 3DMYA 3IAS6 4RL4A 4WXYB 4GX2A 5DK6A 4AJOA 3ERCA 1R4MA 4TRJA 2VWHA 1AS0A 1VL5A 1SG0A 2W37A 3U3XA 4GSYA 4KGVA 4R2HA 3WB2A 1XQ9A 3QX9A 1G8AA 3OX3A 2Y1LA 4G97A 2OHJA 4U7WA 4UU0A 2WICA 1QH8A 4EUEA 3IKLA 2OXTA 1HMPA 4LVUA 3CSDA 1E8MA 2R11A 3BAFA 5A05A 3TTUA 1IB0A 4LXIA 4ZKDA 1YGPA 5K01A 1U3VA 4P08A 4AKSA 4WN9B 4YRAA 2OGZA 4MWZA 3FVTA 2O3JA 4X7BA 4UUPA 4UXJA 2HA5A 3ZH2A 1QE5A 2VOEA 1JG1A 1SGWA 3HM2A 4QXOA 5DNEA 2GAAA 1RM4A 2FVYA 1Y48E 2NUTB 3OPXA 1CVIA 3OOWA 1PEYA 4NZPA 3LWNA 1NVMB 4YLEA 1X2BA 4JOSA 1TZCA 2J5QA 4B3CA 1GCGA 2CLFB 2RCNA 1RLIA 3N2EA 4L74A 3OHSX 2WE7A 1CFJA 1J42A 3C3JA 3I1FA 1JB9A 3Q7RA 1R6DA 2IVZA 2DU8A 4HSGA 4TN5A 5I9SA 5BW8A 1F6DA 3PDJA 4RF5A 2QXUA 4LYAA 2JDID 2PUDA 5HFJA 1BEUB 1CUWA 4ZVMA 2ZTVA 3EC7A 4EMUA 1K7CA 1RP1A 1V7QA 4HQOA 2A7XA 3H9GA 4EGCB 3PEYA 3ZCQA 5FNVB 1ZI9A 4Z4FA 3MF4A 4PYRA 4TRNA 4EUSA 2Z30A 1JF8A 4IDQA 2X9LA 4G4IA 3NR2A 3TLMA 3HU3A 5LLDA 1XQVA 5JCZA 1KAQA 1ZONA 1CV2A 1ZD2P 2IQIA 4A6PA 4HDQB 4Y18A 1AHIA 2O2ZA 1QORA 2BGUA 1QKIA 2DH5A 4JJIA 4IS3A 4U6SA 4CETA 3RYFB 4EHBA 1P17A 3QJYA 4Z51A 3B3AA 3MA0A 3F9RA 4FIDA 5CXSA 3G2JA 1YQEA 4DVJA 1M2VB 1EM8A 4JL5A 4LVCA 4Y2XA 3WO0A 1SUEA 2XIJA 3P1JA 4FDVA 2PZMA 5ALGA 3RJ5A 4I50A 2AH5A 3RS7A 3ST7A 4V2IA 4F8YA 1IIRA 3F98A 3LWBA 1YVEI 1QGAA 5G3ZA 4Q4HB 1C1DB 1L7NA 1XTJA 4R4JA 1YWGO 3G2HA 5C1DA 2FMXA 2AG5A 3D6JA 4R8VA 1HFWA 2J87A 3K9CA 3V97A 4F4UA 1WZCA 3PNMA 1Y3CE 1P2UA 3QP9A 4RHYA 3QKTA 4TTTS 3R76A 3UNXA 4M9SA 4YAGA 5KNCH 5CYFA 4TV8A 4OG2A 1X80B 1I5RA 3KYIB 4RA6A 2FEKA 4MVJP 5CDSA 1NUTA 1UFQA 2QOEA 4ZQCB 5A0VA 4D80A 1C1XB 3MM4A 4AWAA 2G36A 3VRHA 3AKYA 1KS2A 5IN5A 3NZEA 5SYMA 2A9PA 3ADPA 3DMTA 4O4JF 3MJRA 4XARA 1P1IA 3N0VA 3TW4A 1XK6A 1AS2A 3DAGA 4R71A 4GSLA 2LGJA 1RLJA 4ALLA 4FE7A 1WXEA 4AP5A 3UGTA 2N46A 4DCUA 1JILA 1SCDA 3FOCA 4HEHA 2HRRA 1U0FA 1JZTA 2D8MA 4Z4IA 3SBOA 3J7AC 1M66A 2VSNA 1BRMA 4ICIA 3VU9A 1RHRA 2ZZMA 3G9ZA 1OOEA 3AFHA 1EWTA 1QRAA 3I05A 3PSAA 4YROA 1EE1A 3ZV4A 1ZUIA 3E9QA 3VGPA 2GTIA 3AF0A 3CUWA 3QWFA 2QSJA 4PRYA 2WWYA 3N07A 1RAFA 1DX9A 2GI4A 4YWHA 3EVNA 4MIYA 4O1IA 1T4CB 3L4JA 1L5ZA 2IYQA 2QGZA 2WWRA 3EGVA 1L8AA 5CFQA 4NYIR 4H7JA 2FQWA 4RFSA 1EI9A 3K0FB 3O7WA 1H0HA 2OTCA 4LS3A 3MTQA 4MGKR 3IR6A 4J0FA 2PXCA 3OQMA 2CMDA 4L6CA 5CMLA 4ZXFA 2PGOA 3TKYA 2X9GA 2R00C 3HFSA 4IHJA 4BP9A 3RVDA 3AKCA 1E0KA 4CTMA 1PSDA 4OQEA 4U2BA 3KJFA 3INTA 5TF0A 3HBFA 3DTVB 3OLWA 5DEIA 1FTWA 4PC7A 3H83A 1EVQA 4MDFA 2F3TA 5FUMA 2EGHA 2XLBA 3LT2A 2P4EA 2YZ7A 1NBWB 1F20A 2I8AA 2ZWPA 3DZGA 3FNHA 4HY3A 5BVGB 3G85A 1M67A 1U0NA 4LNHA 1H1LB 4X61A 6YASA 3OTOB 4ZA2A 1K4YA 2XD4A 1RXVA 1QH1A 4GDFA 5KQPA 2JIDA 3P9KA 1F38A 4X85A 4PBTA 4ZODA 4LF5B 3QX3A 3UOAB 4A82A 3H2GA 2O50A 4GZ5A 4MUNA 5BR1A 3CUSA 1HE3A 1U0EA 2UUAB 4YMGA 1ZGHA 3Q2IA 4HUJA 5B30A 1FPQA 4QM6A 4UTOA 1MT3A 1QVAA 1ZJZA 4OXRA 4NOMA 4URYR 1SOMA 2C3PA 4FFSA 3P7MA 2VVTA 1TYCA 3IIEA 4HTFA 5I4IA 5C3UA 3MB8A 2WUVA 4J7UA 2BISA 4QJ5A 5PGMA 4F4HA 1CZRA 1XLUA 1C5KA 2GAOA 4KQCA 4UREA 2PCJA 5CA1B 2QTVB 4RUKA 4CNBA 3ZQKA 5LBTA 2OFXA 1MZVA 2Q27A 5LU9A 3BFPA 4IFTA 4QZVA 1CDZA 3TM4A 4CJXA 2P9JA 1UBHS 1HT2E 2Q62A 3RT1A 3AB8A 2OAGA 3JAWA 3O92A 2GZ1A 4HNAB 5C37A 5IDXA 3H3XA 1SCAA 4QU0A 2FCRA 4E94A 1VGRA 3N1UA 4FEGA 5D1NA 3RYHA 2ZJ5A 3PPXA 3GF4A 1Z88A 4F1WA 4Z4QA 4ZQBA 3FSJX 4I3GA 3GGJA 4BNIA 1R9GA 1Y4UA 3WYEA 4D96A 3B89A 3EVEA 3HQ4O 5C4GB 4WKCA 3PU6A 1C14A 3V4PB 1ZZGA 1GSIA 3I5AA 3O8BA 3GDGA 1F2UB 3KSZO 4JJEA 1KO5A 5EWLB 2GPNA 2VUSA 1ZW6A 1IVYA 3L06A 1DEHA 2APJA 2GCOB 1WCIB 4JS0A 4X54A 1MHTA 2IDKA 1OXVA 1R4AA 4PSCA 4OI1A 3ZWNA 5LD2B 1DKNA 5DYYA 4BYMA 1DPGA 2VBCA 3RJTA 1XCJA 4FYJA 3CLSC 5LMUB 1H8HA 4LI0A 4ZDKA 3IQXA 2P27A 1RAGA 3LUPA 5D00A 1A98A 4INJA 1CP2A 2WM2A 5AK0A 1IIBA 1JX6A 2HK9A 4MVJG 5JR3A 5HJ2A 2I4RA 1JDUA 2OD7A 2OOKA 1Z4QA 3DUFB 3EAFA 3H7AA 3I8XA 3FMIA 1HR0B 1U5BB 3NTXA 1MO4A 3AK4A 3PFBA 1FX0B 4NZ9A 3C97A 3IEKA 4NNOA 5JH7F 4AKTA 3VPHA 3UFBA 1CRWG 4OHRA 3AJEA 1JDJA 3WV5A 3I62A 1IUOA 3W8NA 5L3RA 1U80A 3JV7A 3LXUX 4XW2A 4AX4A 3ZIAD 1R4NA 4TWZA 3ZWPA 4B6EA 3W5BA 4YYEA 4RHTA 4DUGA 3L8MA 4LKOA 5B1DA 3Q7PA 1UBFA 2P9TA 1YH3A 1AH2A 1C2YA 3IFSA 5KVAA 2J85A 2GD2A 2I1WA 2OUKA 2XCOA 3MBKA 3FA2A 1SXJB 2QTTA 3DJFA 3FTDA 5KSWB 1GL6A 1JG3A 2OV3A 2OORC 4MW0A 5A5FA 5KOHB 4OGKA 5ITVA 2FX3A 3N5KA 4HMPA 3FNEA 4OSOA 1XIVA 1N3IA 3PDHA 3MMSA 4IPTA 4ALIA 8LDHA 2KE5A 6REQA 3IILA 1G9XA 1I2ZA 3L0CA 4PPFA 5CH3A 1M2JA 1TM3E 2FPLA 5JXJA 4DAEA 2QRNA 3SVTA 1E2HA 4PAOA 2IIBA 4H4EA 1PP4A 1VI2A 1H23A 3VU3A 1JLSA 2HDWA 3ZV3A 1ODCA 4C0KA 4MMYB 5FBHA 4KREA 4ENWA 1UZMA 4YRFA 1FUUA 4MQLA 1WOMA 3GFGA 5EZSA 2P4SA 2V3CC 2CLHB 1XU7A 4G4GA 5DOZA 2BGNA 4BX8A 4B8ZA 3ZE7A 1ZH0A 3NTRA 1ULBA 2OSVA 2JIPA 2Q1TA 3ACDA 4IS2A 4P8RA 5A4JA 1DOZA 4Y2GA 4S0ZA 3PTLA 4MO2A 1E64A 5J2UF 1I8TA 4G2NA 1LNZA 4A1OA 1M8GA 3MFYA 4ER3A 5CCBA 3ABQB 5IX8A 3DR5A 4OQNA 3DZCA 4N7JA 2ZRJA 3WLPA 1Z4NA 1X74A 4GRDA 3WRXA 1M5RA 1TCAA 3ESQA 5CRIA 3S55A 1NPYA 2AQ8A 3K09A 1YSCA 4WADA 4BV3A 1T1SA 4EB6A 2Z4TA 4LMPA 1UXJA 1LBHA 1NONA 2ZJAA 2XDYA 1T8UA 3ZBPA 3IPXA 2WSSA 4B83A 4BTVA 1UZLA 1WNTA 2AR0A 2Z0MA 3T9FA 5DSXA 2XB4A 4OM7A 3VAYA 2ZRQA 5BN3A 4QICA 5F33A 4MB2A 1H6DA 1MW9X 2GLUA 5K0TA 1KP9A 1UMCB 1WQ1R 3EVZA 1XAIA 4LNUB 4ZI7B 2XTMA 2Q6VA 3Q3JB 4XJVA 2WYUA 1LB1B 1CY8A 4Q19A 2R65A 1DDGA 1N2IA 4IDHA 1U2ZA 2J31A 3PDUA 1YZ3A 3JAMA 4IOKA 1F6WA 2GO7A 2QTRA 4LQCA 5SY9A 5C53B 5CEEA 4IDEA 4OQQA 3ZJYA 1AKVA 1VLVA 4Z9BA 4FB4A 1BXGB 1E2NA 4LZPA 2JLXA 2RKOA 1DQYA 3H97A 5TNXA 5CM8B 1H4TA 3FZQA 1H5UA 4AJJA 5B2FA 4IFEA 1XRMA 4QBTA 2DYKA 4BJ1A 4Q1CA 2EF0A 3QHQA 3CLKA 3I5UA 3LCUA 5BY2A 3TMKA 1OWOA 4QG7A 1X1CA 4GWKA 1LQTA 2ZJFA 4MKGA 1QU2A 2DH6A 4R8SA 3T5DA 1JXAA 3O0TA 1FP4B 1Z5WA 4YO8A 1DXYA 4ADSG 4PLYA 2Q3LA 1P19A 4G23A 3MT7A 4JLSA 2VK1A 2X86A 4DFDA 3AVQA 5ELLA 1UBLS 2AHRA 3CPHA 1OMOA 4ZT6A 3I1YA 1CIVA 4C9BA 1YBMA 5A2GA 4RGVA 2YNMC 3PXAA 1A71A 2FSVC 4KQFA 4BFUA 5KWVA 2D1FA 2F1OA 4IAOA 1NXVA 5TJ9A 1GUDA 4H31A 5E1BA 1ULTA 1PSZA 2AMVA 1CUSA 1HETA 5CX1B 1FSPA 1GITA 4FOPA 3QPBA 4N1AA 4A7PA 3UOGA 4NL4H 3N87A 3BXGA 1LS6A 4JHLA 3TVTA 5HS6A 3BMQA 4KPUB 4B6PA 1ZVQA 3NRCA 4CQNA 3PBKA 3PFNA 2QT9A 2G1PA 3ETJA 4J76A 1LKZA 1RD4A 2J7PA 2NU6A 2IIQA 1K1EA 2XTAA 3VR4A 4I1SA 1L5FA 2G09A 3S1AB 4UD2A 3LX4A 3JWIA 3IUPA 2B92A 1DARA 2PKQO 3AERB 4WK6A 4OUKX 2JFVA 1HZZA 4NYJR 4WLOA 2ZJBA 3O38A 2XNJA 2ZE6A 2IKSA 2OGUA 2P0EA 1AO3A 7MHTA 3WKBA 1OFHA 2I33A 3VI3B 3K6KA 1ISHA 2TRSB 4C5AA 2GPSA 1CDEA 3JQBA 3DCIA 1RKQA 4DN6A 5IVHA 3IQZA 5SZHB 4CDGA 4OI0A 4MZDA 1OJ7A 4UM9B 3K70C 1GTJ1 2C3MA 2R86A 1NYRA 2WWGA 5DHSA 3KE9A 1VLMA 4PWYA 2W9XA 2PMEA 5EJGA 2DLNA 4EHLA 1YJQA 2ZRMA 3R24A 3U3JA 3AEQB 1LQ2A 2AYYA 2IQ5A 1ZOOA 2D6FA 1QCYA 4B4OA 4ZVUA 4LBVA 5LR6A 3JRNA 3PR1A