3ABVB

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 62
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3abvB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3abvB01
4YSYB 1WRIA 3AEDB 2E3TA 1JQ4A 1XLPA 1TKYA 1WGKA 3P4QB 1CZPA 1FFVA 3HUIA 4ZOHC 1A70A 4A9AA 4ITKA 2DWQA 1YQ4B 4ZHPA 2ACZB 2WU2B 4US9A 3W5UB 1KFYB 3ETRA 3AMZA 3HRDD 1N60A 1F0ZA 3KWLA 4YTPB 2CJNA 3P4PB 4YXDB 1J7BA 3AEAB 1TYGB 2MJ3A 2Y5CA 4YTMB 3SFDB 1GAQB 1NVID 1NEKB 2W3RA 1L6UA 2WP9B 1PFDA 1SIJA 3LB8C 1UWMA 3B9JA 3CIRB 2K9XA 3AN1A 2WDQB 2JQRB 3AE1B 3AEBB 3AM9A 4LTUA 1H7WA 3AEGB 1JWBD 2W3SA 3FAHA 4P6VF 4US8A 2PKOA 3NVZA 4KX6B 1WWTA 5GXGB 2PIAA 3W9CB 2KMMA 1GTEA 4IDIA 3FC4A 3W5VB 3AE6B 2BS3B 3B2FA 2BS4B 3P63A 2WDVB 1NENB 4HRSA 1JRPA 3HVZA 1I7HA 3NRZA 4WWMA 3CWIA 1N5WA 1V97A 2CU3A 2WQYB 3AE8B 1VDVA 1N61A 3NVVA 3AE5B 1RWSA 1VLBA 1RYJA 5C3JB 1DOIA 3DWGC 1YJJA 1QF6A 1PDXA 3NS1A 3EUB2 3AEEB 1DOXA 5H92C 1EWYC 2MH7A 2QJLA 1JWAD 1B9RA 3P4SB 2W54A 1FXIA 1FRDA 1ZXIA 1J7AA 3LXFA 1ZOYB 1XO3A 1E7PB 2KAJA 3CF4A 1PUTA 3AECB 3AE4B 3NVYA 2L52A 2H89B 4C7ZA 1V8CA 2K22A 4WQMA 1JROA 4N59A 3VRBB 4JX1C 2W55A 3VRAB 2WS3B 5G5HA 1L5PA 2HTME 1IUEA 2OHFA 1YQ3B 3AE9B 2PVOD 3WCQA 5EE1A 5MPOA 1L0VB 3NVWA 2G1EA 3SR6A 5G5GA 1DGJA 1TKEA 3AE7B 1QOBA 1WXQA 3L4PA 1XLOA 2LEKA 4ZHOA 1XLQA 1XLNA 2H88B 2MJEA 3AE3B 3RPFC 1TJEA 4YSZB 1OQRA 1FO4A 3P1MA 2B76B 1N63A 1KRHA 3P4RB 4JWUC 1E10A 1DOYA 1E0ZA 4C80A 1GTHA 2WLBA 1GT8A 1E9MA 1RFKA 2PVGC 1CJEA 1N5XA 2BT6A 4YT0B 1SF0A 1AYFA 3DWMA 2K5PA 4C7YA 1FIQA 1R7SA 1FRRA 5EE9A 1QOFA 5EE3A 1SB3C 3AE2B 2N0SB 3PO0A 1QLBB 5C2TB 1NI3A 1FMAD 1NYRA 1ROEA 2WDRB 1ZP0B 1H7XA 1JW9D 1E6EB 5AUIA 5H8YE 3BIID 4HROA 1FFUA 2JX5A 4N6EB 2FBWB 2DBYA 1WYGA 1L6VA 1ZUD2 3AH7A 3ABVB 2EKIA 4YSXB 2AX5A 2L83A 2BS2B 1JALA 1J7CA 3AV8A 2M19A 2MJDA 3B2GA 2WU5B 1T3QA 5AUKA 4USAA 1GPXA 4YTNB 1FM0D 1OFFA 1KF6B 1QOAA 2CJOA 1YJIA 4N58A 5EE0A 2M56B 3SFEB 1TKGA 1VJKA 2QIEB 3VR8B 1NYQA 1FXAA 1QOGA 1N62A 2Q5WD 1AWDA 1QT9A 4JWSC 1RM6C 3AB5A 3VR9B 4FXCA 3AEFB 3ZYYX 1OQQA
chains in the Genus database with same CATH superfamily
3MJWA 2FIDA 3Q3OC 2MBEA 2MLBA 1P98A 2V1YA 4DHZB 4KDLB 4F8CB 1FCLA 1WGGA 2KHWB 1IBXA 4LK0M 1MFWA 4O1NA 3P4PB 1P3QU 3V62A 3M3JA 3LB8C 3JSVB 2A4ZA 3ML9A 2WDQB 3BVZA 4KX6B 4W9FA 1SE4A 1WX8A 4IWOA 2BKFA 4IOIE 4HRSA 3V05A 4OVUA 2JPHA 3AE5B 3NVVA 4II2B 1EWYC 1AN8A 1B1ZA 1RAXA 2KQ4X 1VRAB 2M0AA 1VR9A 1TTNA 3VRBB 4JX1C 3WANA 4YL8A 3UQBA 3ZTCA 3DHGC 3D32A 3PREA 3BWUD 3ZNZB 4ZHOA 2D3BA 3MC8A 1NBFC 1L4ZB 3DBHI 5J17A 1KM7A 1E10A 3W1SA 3QHTA 2NBVB 4MDKE 4MM3B 5T8IA 1KLGD 4RGNA 1V49A 4XZ4A 4YWGG 1YJ1A 3QCAA 1J8CA 4WURA 3KYCD 5IP4D 1E6EB 3OLMD 5BMHA 2AWTA 3ZVVA 3GS2A 1FXTB 2KWCA 4ZRQA 4FJYA 2KQ7A 3NZSA 1GPXA 1TS4A 3A1QB 2WXQA 1T0RC 2Q5WD 4J6IA 1RFAA 2KN5A 1ET6A 1IGCA 4FXCA 3A9JA 2Z8LA 5I4DA 2W9NA 3EGRA 4YSYB 2DNFA 1CQVA 2KFKB 1XLPA 3JYUA 4WAFA 2V4IB 2PE9A 2JZPA 4L1BA 4ASWC 4US9A 4FLHA 5D7GA 3NS8A 2PLPA 2WXRA 1L6UA 4I6PA 2O6VB 3UI3A 2GOWA 4MH0E 1WH3A 3AM9A 2KXJA 5KHQA 2KDMA 3CWIA 3IFWB 1N61A 1RWSA 2BYEA 2XK5A 4WWPA 4IUMB 2NBUA 1C3TA 4KGTA 3BVGA 2CU1A 1SE9A 1WRDB 2ZVNA 1LGRA 4MGKE 3BYTB 1L0XB 2K22A 3E9SA 3Q14C 2WDTB 2NPTA 1FD6A 2N1WA 3VH3B 1ZKHA 4NJCA 2NS5A 3HHMA 1TKEA 1N6ZA 1FEHA 1L7YA 3N30A 1WZ3A 3ECIA 2QILA 3AE3B 4K7UA 1FO4A 2ASQA 1N5XA 1BXTA 3EFCA 1FRRA 3V60A 3AE2B 4ARCA 2YLMA 2HTHA 5C2TB 3GP7A 5BO4B 1LXDA 3R7RA 2ONQA 2EELA 3L0WB 3AU4A 1FFUA 1EWCA 4N6EB 1MJDA 1ZUD2 1D5MC 4KIKB 3B2GA 3AV8A 2V4LA 1QOAA 2M56B 2K3UA 3WA0A 4OHJA 2VZKD 1OQQA 4PT5A 2KLCA 1VCBA 1MVKA 4OZBA 2KTRB 2DZIA 3HM6X 1AARA 4YXDB 1J7BA 2KDBA 3JSVA 4K3CA 4LDTB 3RNFC 1IP9A 3A4RA 4RFBA 1V6EA 3H6NA 2JQRB 3AEGB 2KMMA 2HJ1A 3RNEC 2INNE 4BZAA 1FNWA 4RMAA 2N9XA 1I4PA 1P7FA 3C19A 4HEA1 3DBRI 3RZFA 1R4NB 4IM3A 3PHWB 2R2OA 3TEWA 1XCTL 1YNTE 1F2RC 1B9RA 4KV2A 1FRDA 2D11A 5FR3A 2KDFB 2IY1B 2IGGA 3X23A 2GLSA 1KLUD 3DDCB 3LDZE 2W55A 2J52A 2G4DB 2KVZA 3ZO5B 3WCQA 5IKCM 2RPQA 2XNAC 1QOBA 1TJEA 4YSZB 3VXWA 3Q69A 1FCCC 1KRHA 2ZEQA 3UQAA 4MM3A 2XN9C 1X1MA 3R7QA 1WJ6A 4KGRA 3N9YC 4YT0B 2AL3A 4BFRA 3ZLZA 2KX0A 4K1RB 3I57A 2LXAA 2PW9A 2G45B 4A20A 2JYTA 2MQJA 4ZDVA 4KZ0A 2RDHA 3BIID 2DBYA 3FILB 1STEA 2BS2B 3N20C 3A1QA 4NY0A 3NOBA 1YJIA 5EE0A 1P0RA 3ZGZA 4MJSB 2QEJC 1QILA 4P1CC 1Y56A 4G50A 2KFKA 1P9DU 3DVNV 2C9WB 3H8HA 4N9F4 4ZHPA 1WIAA 1IPGA 4GU2A 5HKHA 3ZDTA 1SEBD 1V2YA 3TJPA 4GDLB 1QQRA 5AZFA 1NVID 2O6VA 3L54A 3CIRB 2KX3A 4JIOU 4R3DA 4GB9A 2I1JA 3B2FA 2QHOA 5JXVA 5G55A 3VUXA 3PV1A 2ZNVC 5JHBA 1AW7A 1PGXA 4HWIB 3V3XA 4BKSD 1WZ0A 4AUQC 3AE4B 3NVYA 1OEYA 1JROA 4MELA 2X8XX 5D3DA 1UD7A 2KMCA 2PVOD 2KO3A 1I42A 1LFDA 3DBLI 3RNAC 1C77A 1GUAB 1YOVB 1YN4A 4RH6A 2NCNA 4H2AA 2JF5A 2B76B 2J0JA 1Q10A 4C80A 1E9MA 3Q8AA 1WX7A 4JE3B 4C00A 2DLBA 2KJRA 2QSDA 3ZUNA 2LGXA 5J2RA 4BOZB 1E90A 4TKNA 2KD0A 1UUPA 3R3MA 3U30A 5JZEB 3ZDMC 1ENFA 4WJOA 3CF6E 1RLFA 4ZRPA 2CJOA 4FULA 2IBIB 3QQ8B 5DCNA 1QT9A 4LNFA 1VZ7A 4BKGA 4EZKA 1YN3A 4DXFA 2C7HA 5D3IB 1A70A 2KTRA 1V80A 4B0EA 2ACZB 2ZW1A 4WJNA 5FKAC 1Q0WB 4YTMB 1MPEA 2W3RA 2J4XA 2K6QA 3RULA 3BY4B 2WYQA 2KDEB 3DHHC 3K9OB 4P6VF 1JWBD 2RDGA 4DXAB 2JZZA 1WGYA 1EF1A 2BVCA 4WQOB 3URYA 1N5WA 2V3SA 4LCDE 2KC2A 2BKRB 4GGQA 3I63C 1E8ZA 2L76A 3P4SB 1TIFA 3VTUA 3EFUA 2ZJDA 4KSKC 1ZDVA 3MFGA 3KUDB 3A9KB 4PYZA 3MHSD 1IUEA 2FCSA 2OHFA 5MPOA 5EE1A 1NDDA 3L10B 3VUYA 4W9IA 2VZKB 5G2NA 2HD5B 2H88B 3RNBC 2AQ2B 4JWUC 1TGZB 3PPAA 2KJHB 3KQ4A 2ZVOA 1F9JA 5IOIA 1SB3C 2N1VA 1FMAD 2C60A 5CX3A 1BMLC 2ON8A 2FBWB 3FILA 4NJ7A 3ABVB 2FCNA 2JXTA 1J7CA 1ZDXA 4WIPA 4MJSA 1SE2A 4IWQA 3RZWC 1K51A 4ICVA 2FAZA 4ZYNA 1JQ4A 3IAS1 4GMVA 1CZPA 4FADA 3TIXA 1ISNA 2NR2A 4YTPB 4GDLA 4GIVA 2KMAA 3SFDB 4KZCA 2WP9B 4OVVA 2RMMA 4PYUA 1WJ4A 4DDGD 2WXPA 2NBWB 4D2KA 2KLGA 3NRZA 4WWMA 1GJZA 1TS2A 1NI2A 2KYWA 4MGZE 4LJPB 3A33B 3W1SC 2DAJA 5E6JA 4X57B 2FIFA 4J3OD 2OEDA 2LGSA 4IC7B 3H7PB 4K7WA 3Q6BA 4NNJB 3TMPB 3PVLA 4JL9A 1WY8A 3U7DA 4OZAA 4EEWA 4WWNA 4RGTA 3VRAB 3DPDA 1OGWA 3AE9B 3O13A 1V86A 4BVUC 1C79A 2BB5A 2MBQA 4MEMA 1KLVA 2DAFA 2LEKA 5J18A 2A5UA 2ICIA 1MHHE 3JW0X 4FA6A 4PS3A 1UNSA 1GTHA 1ZE3D 4BAXA 2BT6A 4M8MA 3RYTA 1PYWD 3IG3A 2PE6B 2JRHA 4GXBA 4ANVA 1WJNA 1QLBB 2GMIC 2V3PA 1ZW7A 3Q3NC 2D3AA 5H8YE 2I1KA 3AH7A 3DVGX 4YSXB 4HCNB 1EUVB 3GOEA 2GB1A 2C5LC 1E7UA 1KOTA 4B9KA 2LGDA 4KSLC 3TBLD 3MJ5A 3P4QB 4LNIA 2UU7A 1Z5SB 2WU2B 2FCQA 4JQWC 1XXGA 2XEWA 1SIJA 3GZNI 3AE1B 2IJ0A 1DOXA 5AZHA 3DHIC 2INPE 4E3CA 3BVMA 3PGEA 2WDVB 4K81A 4K3BA 4PS7A 1YJJA 2MP2B 5LXIB 5DPSA 4HKZE 4L2YA 1GB4A 3X0WA 3GB1A 2DZMA 3Q2AC 3ZNGC 3E56A 3P42A 2LHDA 2RR9A 4IM0A 2FUHB 4TV3A 2DHZA 5EDSA 2IGDA 2BYTA 3A9KA 3IXSA 3SU8X 2UYZB 4HJGE 1D4BA 4CHKA 2EKEC 4HPLB 2FE8A 2AQ3B 3A4SC 1XLQA 2CHWA 3RPFC 2DENB 2JYEA 4GOCA 3VUWA 4P1BC 1AYFA 2LMCA 4G0NB 1U4AA 1WGHA 4MT5A 2G3QB 2SAKA 1NI3A 2WXJA 4E71A 4G11A 2AX5A 4UDUC 3PHXB 3T3OA 1KF6B 3U2SC 2VRRB 3APCA 2CHXA 1WM2A 2O2VB 1AWDA 1TZ1A 4GDKB 3S2AA 3AU5A 4EFOA 5BMGA 1T5XD 1WRIA 3NHEB 3AEDB 4I6NB 1E8YA 2EMSA 2MW5A 4P16A 4W9DA 4NQLB 1C9FA 4A9AA 3DVNU 4KGSA 3W5UB 4XWTA 2M4NA 2BGFA 3PLVA 3KWLA 3ZRCA 5DPTA 4S0RA 4AS1A 2C7MB 3AI5A 1WR6E 3OJ4B 1CK1A 3MTNB 2GBMA 3FAHA 1MI0A 1WWTA 4NAWB 4M01A 2OJRA 3VH4B 1L2NA 4KKIA 2BS3B 2YEPF 5L95C 1YQBA 3HVZA 2CU3A 4EOYA 4TMAB 2M8SA 1MG8A 2LZ6A 1PDXA 1WJUA 1OQYA 1JWAD 2W54A 3B08A 3IVFA 1ZXIA 3R8BA 3T9LA 1D6EC 2L0FA 5CHFA 5D2MB 1ET9A 3V61A 3RD2A 2RD0A 4HLEA 2DYMA 4ZRJA 2L1AA 4TQ0A 3RI7C 4IKGA 2FCMA 2NTSA 5GMVA 4C4VB 1WXMA 4LNNA 3AXCA 2WX1A 3SR6A 4GSWA 5G5GA 1DGJA 4HDOA 4ZRKA 3ZJVA 3EC8A 2L00B 2BF8B 2L3ZA 5AZGA 2WLBA 2WX0A 3RFZB 4DHZE 2LI5A 5EE3A 1H8CA 3UF8A 3N1ZC 3RN9C 3PO0A 3L13A 1ZP0B 2KOXA 2DYBA 1JW9D 1D3ZA 2LHEA 2K8BA 4HXDA 4FHKA 3UIPB 1I4HA 3DVGY 2WXFA 1TKYA 4BKSA 3M95A 3Q8BA 1SJHD 2ZPYA 3PZDA 1IGDA 2IZVB 4REZA 3TL5A 4L23A 3AMZA 4LNOA 2NVUI 2BBCA 3C8YA 1PGBA 1P1AA 5BYSA 2FUG1 2KNBA 5BYQA 2JRIB 3ZIMA 3AN1A 4K7SA 2D07B 2I2YA 4US8A 3MHZA 5GXGB 5E6NA 3W5VB 1WYWB 2ZZPB 3IBEA 2GBKA 4M0WB 1VDVA 2MP2A 1HE8A 1UF0A 1QF6A 2N9EB 3AEEB 2MH7A 3O65B 2PJHA 1FXIA 3JVZX 4KDIC 2INCC 4LJOB 3NZUA 1XO3A 1RRBA 2KAJA 3CF4A 2N9PC 2L52A 4C7ZA 3T3NA 4AJWA 4HKQA 1VZ8A 4CYEA 2MX2A 2N9LA 3NVWA 2IDYA 3U8ZA 1YX5B 2WXOA 2ZPNA 5IA7A 4ZYSA 2JSVX 3QK0A 2KQSA 3DWMA 1FIQA 2QMTA 1ZPSA 2MSED 1ACCA 4QAYA 4B6WA 2JUOA 2KVRA 3V6CB 1V9JA 1EF5A 1TY2A 2J0KA 1SSNA 1MHXA 4RM8A 3VFKA 3DQVA 2M17A 4USAA 2FNJB 3KW5B 2O2VA 4GDKA 3LYYA 1M4VA 2Y5BB 4FJVB 2JU6X 3HIZA 2L8JA 1WF9A 3L17A 3ZW3A 5D94A 2BYFA 2KT7A 3ZQ4A 1YIWA 1Z2MA 2RGFA 1HQRD 1TZOA 4KIKA 1N60A 2Y3AA 4ICUA 1S1QB 1R4MB 3HK0A 1GB1A 1TYGB 2MBOA 1R4NI 1HEZE 1UWMA 3QA8A 4DXGA 3ZJUA 1VZ6A 3AEBB 5JHAA 2W3SA 4NAWA 3B1LX 1XQQA 4FJZA 3P63A 2BS4B 1CMXB 2G4SA 1A5RA 4B0MA 2WQYB 2X38A 1F52A 4A6QA 4NPNA 5H92C 4XGAB 4MACA 4NAMA 4F7ZA 2IYDB 3APFA 2HJ8A 2JWUA 3Q3FA 4HPMB 4C4VA 3BK1A 2GBJA 1YQ3B 1V81A 1L0VB 4AP4C 3ML8A 4DDID 1XLOA 2Z0EB 1TS5A 4HVBA 1N63A 2QDFA 2J53A 1T0QC 1GC6A 3VDZA 3N32A 2KFJA 2ZCBA 3KWVA 2LVPA 2MWSB 4HCPB 4KKJA 3DCGA 3RUIB 3HM3A 4IG7B 4IM2A 1JWSD 1WYGA 1V1PB 2MA9B 3HVDA 2EKIA 4S17A 2V0GA 3AB5A 3VR9B 5FK9C 3PSEB 1XCQL 1FFVA 4XDDA 1YQ4B 1TBEA 3ETRA 3PS6A 3TEXA 3UGBB 1F0ZA 3VVWB 4NZLB 4JGHB 2LJIA 1H7WA 4MSQB 3WAMA 4C7YA 4M0WA 1K8RB 1ZXHA 2BYVE 2WNMA 4A90A 2BB6A 2D10A 1VLBA 2WXLA 3L16A 4EE2A 3ZRFA 4DBGA 1UZXB 3LXFA 3AULA 4AOFA 1UELA 1EM7A 3MC9A 1J19A 1M94A 3SD5A 4N59A 2DZKA 1QZEA 3SHQA 1ZGUB 2J0MA 4DWFA 5DPWA 3TEYA 1UBQA 1MG4A 1JMLA 2W82A 2PEAA 2KWUB 1C4CA 5LXHA 1CJEA 1R4MI 1T0SC 5HHDG 1R7SA 4NJ6A 1WMHB 2MEKA 4EZLA 2NMQA 3NUHB 1WXSA 1I4XA 4FBJB 3PRMB 3QAQA 3IHPC 1SBBB 4RF1A 5D6JB 2M19A 2JZ3B 4OW0A 4YTNB 2BPSA 1TKGA 2SEBD 2GRIA 1JWUD 1WX9A 2L05A 1RM6C 2MHJA 1T6BX 1LO5D 5CHVC 1WGDA 4WWOA 4E74A 2XBBC 3HUIA 1I35A 2MCNB 2QC8A 1D5XC 4HJKA 4IWPA 4JPSA 3R2IA 1LQBA 2KTFA 2PTLA 1OEYJ 2AEHA 2CJNA 2G9HD 3HRDD 1NEKB 1PFDA 5DPRA 3OG5A 3KUZA 2K39A 5FR6A 4RGOS 3DOWA 2JY6A 3PLUA 3NVZA 4MGIE 3CSTA 2LJ5A 1QKZA 3Q3JA 1V97A 4IW0A 3GE8C 3N1YC 2BWFA 5AEKB 4LLGM 2IO0B 3ZKJC 2L0TA 3VTVA 1E7PB 2CS4A 3SDLC 1PQSA 2LUEA 1D5ZC 4WQMA 3DBRB 4II3B 1E7VA 4DHJD 5G5HA 1H4RA 3RNCC 3QX1A 3TUOA 1WXVA 2KWDA 1FNUA 1S3SG 2MBBB 4RF0A 4GLSC 1J0GA 1UH6A 2GBNA 4W9EA 3TCAA 2MRPA 3P4RB 3R2TA 1SE3A 3QC8B 1RFKA 2DYOA 2D3GA 1SF0A 3L08A 1Q1OA 2KK8A 5EE9A 2R61A 3UIOB 1C4AA 1YMHE 4MH8A 2LWPA 1UBIA 4GN1A 1ROEA 1FPYA 2I38A 5KHOA 3TSSA 2JWZA 1V1PA 3ZXRA 4BOSC 4W9KA 1FM0D 3PRZA 4ANXA 4C56C 1P7EA 3I3TB 1QOGA 1N62A 2WGSA 1KTKA 3ZYYX 4P7IA 1L0YB 2N9KA 4XYCA 3BK2A 4A55A 2WXIA 4A8XC 2J42A 2N7DA 2KACA 2PMVA 3J9CA 2V3NA 4DK5A 3ZNID 3AEAB 1GNUA 1GAQB 3U4EG 2E6XA 1K50A 3WAOA 2ZCCA 1F77A 3APDA 3NY5A 4WJPA 2INDC 5CTRC 3W9CB 2V9HA 1GTEA 3FC4A 3AE6B 3SEBA 1NENB 4TSSA 2IO3B 5C3JB 1SGHA 3NS1A 2REXA 3C0RB 3UINB 1WM3A 2RSUA 1JCKB 3GE3C 1J7AA 1ZOYB 4W9LA 1Q5WB 3AECB 2WXKA 3ALBA 2J7QB 2LUMA 4BKTA 3ONSA 4Q2JA 2WXNA 2G1EA 3BINA 1V5OA 1C1YB 3AE7B 3VQIA 3H7PA 1UGJA 2GBRA 2CKHB 3WIMA 3ZNHB 2ZNVB 3RMKC 1EU3A 4TUUA 1WMHA 3BYYB 3DBLB 3Q8EA 2KN4A 2D3CA 3IT4B 1WXAA 2WDRB 4MSMB 1SIFA 2MJDA 1C4PA 1L4DB 2KKCA 3VR8B 3VHTC 3U7ZA 4ANWA 2K0PA 4ZOHC 3V6EB 2JVCA 3RNGC 2KDIA 1KH0A 2R2QA 2RDBC 4XDCA 3H9DA 2MJ3A 4LTUA 2DZJA 3PZ8A 4M8NA 4A3PA 2PPHA 5IO9A 3P2BA 3B9JA 2K9XA 2TSSA 3H1UA 3Q8CA 3CMMB 4RGMA 2PIAA 1HTOA 2HE7A 5TSSA 1F2RI 4AJYB 1RYJA 1LM8B 3DWGC 3TEZA 2IO2B 2LGIA 4URKA 1TS3A 3LJ3A 2L32A 4I6LB 4JLCA 3M62B 2LFIA 2LRUA 3T8MA 1PGAA 4OZCA 1C76A 5HI1A 1KJTA 3Q8FA 3L4PA 3U52E 1E8XA 4W9HA 4ARIA 1BT0A 1YD8U 3IT6B 3PRPB 1F1HA 2PVGC 2IO1B 4RNAA 3DBSA 2CHZA 1QOFA 1I4QA 3Q3MC 3VAWA 3PZ7A 2AQ1B 3NJTA 1Y8RC 2D2QA 5AUIA 3I9V1 4ACFA 2BW2A 3EHVA 1L6VA 3N3KB 2K6DB 1OTRB 1WFYA 1OFFA 1K52A 3NG0A 4FN2A 1NYQA 1FXAA 1VD2A 2QCZA 5LLIA 3ZXVA 1GC7A 1WE7A 4ZRIA 1UWXA 5L83A 1EU4A 4W9GA 1WGKA 3MC0B 2C7NB 2DWQA 4ITKA 3WAPA 4RCOA 1E5WA 1KFYB 2N7EA 1V1OA 1IYFA 2IY0B 2M1MA 2D5GA 2EMTA 4HPPA 1IBXB 2Y5CA 4DHJB 3QWZB 4NQKE 1HTQA 2KANA 4G3XB 3ENEA 2BWES 3QARA 2BTEA 1XD3B 4DQOC 2PKOA 4XE0A 2JT4B 1BUIC 4M02A 3W1YA 2OJWA 4WH4A 2LGYA 1ESFA 2KC1A 2UWQA 5E6OA 3FKYA 3M63B 1GOZA 2Z59B 3RT3B 2QJLA 5IN7A 5HFYA 3BZDB 2M0XA 1C78A 3NZ3A 4RM9A 4XC2A 1PUTA 2H89B 3B0AA 3QJZA 4PK1A 5CHWA 3EECA 4CO7A 1SXTA 2HTME 1WGRA 2O6VD 2VH1A 4EKUA 1WXQA 1XLNA 1HZ6A 2MJEA 4M00A 5C1ZA 3KVFB 4WAAA 4EZJA 3EA6A 1E0ZA 1GT8A 3IAM1 2Y5PA 1WE6A 1UGMA 3WALA 3W2DA 4BBNC 4WJQA 2VH2A 1EO6A 4AWJA 5JH5C 1NYRA 1YX6B 5BYRA 2KZRA 1XEEA 2K1FA 2KWVB 2JX5A 5E6PA 2WU5B 1T3QA 4MGYE 5TR5A 4N58A 2N4FA 3KUCB 2QIEB 3SFEB 2LRWA 4CQNA 3CSFA 3OAWA 1I4RA 2AYOB 3AEFB 3A9JB 4ANUA 2K25A 5C23A 2E3TA 3OJ3A 2WWZA 4A3OA 1TY0A 3DBHB 1JWMD 2LASA 1HA5A 4FHJA 2Z0DB 2MBHA 2B3AA 4HDQA 2WHIA 3RCZA 4XWWA 1E8WA 1GG3A 2LXCA 2LVOA 2K8CA 4IDIA 5AUKA 1HXYD 3MP9A 1JRPA 1I7HA 2CR5A 2GI9A 3AE8B 1XT9B 3K9PB 2WXGA 1DOIA 5LNK1 2XK5B 4KVGB 3EUB2 3KLSX 3GZNB 1I4GA 2WXHA 1DYQA 1V5TA 1XF5L 2RPVA 5HG2A 3PT2B 1SJED 4PS8A 1V8CA 4W9CA 3QIJA 4BBNF 4F1SA 2WS3B 3OWEB 3R66C 1L5PA 1WR1A 4LDTD 2NPTB 3VTWA 2KJ6A 3KH0A 1G6JA 1TT5B 2LD9A 2N7JA 1WSPA 1FNVA 1OQRA 3P1MA 3PTFC 3ZJTA 1DOYA 3KYDD 2IPKD 2OOBB 2LVQA 3ZTDA 1WI0A 1YN5A 1HZ5A 2K5PA 2L7RA 2WXMA 2JXXA 1T0YA 4XX5A 2N0SB 4TQ1A 2NTTA 2AL6A 2IGHA 2BQQA 4B95A 3H7SA 1H7XA 2YVCA 2K8HA 1JRUA 4HROA 4W9JA 4AQ7A 3N1XC 2YEPB 5IAAC 4LNKA 1K53A 2HDEA 2L83A 3I5JC 1JALA 2ZW0A 1VJKA 4HK2A 2DX5B 4OVZA 4JWSC 5BMIA 4EUTA
chains in the Genus database with same CATH topology
1I4HA 2N9KA 2WXFA 3BK2A 4A55A 2WXIA 1TKYA 1YN3A 4DXFA 3Q8BA 5D3IB 4A8XC 1A70A 2J42A 1SJHD 2KACA 1IGDA 2ACZB 2PMVA 4REZA 4B0EA 4L23A 2ZW1A 3AMZA 3J9CA 2V3NA 5FKAC 1FCLA 2BBCA 1IBXA 4LK0M 4O1NA 3P4PB 3AEAB 3C8YA 4YTMB 1GAQB 1MPEA 2W3RA 1PGBA 2J4XA 5BYSA 3LB8C 2FUG1 5BYQA 3U4EG 2E6XA 1K50A 3AN1A 1F77A 2WDQB 4P6VF 3BVZA 1JWBD 2RDGA 2I2YA 4US8A 3MHZA 5GXGB 4KX6B 3W9CB 1SE4A 1GTEA 3FC4A 4IOIE 3AE6B 3W5VB 3SEBA 1NENB 4HRSA 3V05A 3URYA 1N5WA 4TSSA 1VDVA 3NVVA 3AE5B 5C3JB 1QF6A 3NS1A 3AEEB 1EWYC 2MH7A 1AN8A 3P4SB 1B1ZA 1FXIA 1JCKB 1J7AA 1ZOYB 1XO3A 2KAJA 2KQ4X 1VRAB 2M0AA 3CF4A 1VR9A 3AECB 1ZDVA 2L52A 2WXKA 4C7ZA 3MFGA 3T3NA 3VRBB 4JX1C 2LUMA 4HKQA 1VZ8A 1IUEA 2OHFA 4Q2JA 5MPOA 5EE1A 2N9LA 2WXNA 3NVWA 2IDYA 2G1EA 3AE7B 2VZKB 2WXOA 3BWUD 4ZHOA 2H88B 3VQIA 4ZYSA 1L4ZB 2AQ2B 2JSVX 1UGJA 4JWUC 1E10A 3W1SA 4MM3B 5T8IA 1KLGD 3KQ4A 3DWMA 4RGNA 1FIQA 1EU3A 2QMTA 1ZPSA 3BYYB 1ACCA 3Q8EA 2KN4A 1SB3C 4YWGG 3IT4B 1FMAD 2WDRB 4WURA 1E6EB 1BMLC 1TY2A 2ON8A 5BMHA 2FBWB 3FILA 1SSNA 3ABVB 1MHXA 3GS2A 2JXTA 1J7CA 2MJDA 1ZDXA 4ZRQA 4USAA 1GPXA 1TS4A 1C4PA 4WIPA 1L4DB 2WXQA 1SE2A 3VR8B 2Q5WD 3LYYA 1K51A 1M4VA 1IGCA 1ET6A 4FXCA 2Z8LA 5I4DA 3EGRA 4YSYB 2JU6X 1CQVA 1JQ4A 1XLPA 3IAS1 3U7ZA 4WAFA 2V4IB 2K0PA 4ZOHC 1CZPA 2JZPA 4L1BA 3ZQ4A 4US9A 1KH0A 5D7GA 1HQRD 1TZOA 2PLPA 1N60A 2WXRA 4XDCA 4YTPB 2Y3AA 1GB1A 1TYGB 2MJ3A 4LTUA 3SFDB 1L6UA 2WP9B 3PZ8A 2RMMA 1HEZE 1UWMA 3UI3A 4DXGA 3B9JA 3ZJUA 2K9XA 2TSSA 1VZ6A 3AM9A 3AEBB 2W3SA 2WXPA 3Q8CA 4RGMA 2PIAA 3P63A 4D2KA 2BS4B 3NRZA 4WWMA 2KDMA 4B0MA 3CWIA 5TSSA 1F2RI 1TS2A 2WQYB 1N61A 1RWSA 2X38A 1RYJA 3DWGC 4A6QA 3TEZA 5E6JA 4J3OD 5H92C 2OEDA 2LGIA 4KGTA 1TS3A 4MACA 3BVGA 4NAMA 2L32A 3BYTB 4OZAA 1L0XB 2LFIA 2K22A 2JWUA 3E9SA 4RGTA 3VRAB 3BK1A 1YQ3B 3AE9B 1FD6A 1PGAA 3O13A 4OZCA 1L0VB 1C76A 4NJCA 5HI1A 1C79A 2BB5A 1TKEA 3Q8FA 3L4PA 1XLOA 1FEHA 2LEKA 3U52E 1TS5A 2ICIA 3AE3B 2QILA 1MHHE 4ARIA 1FO4A 1N63A 1UNSA 2J53A 3IT6B 1GTHA 2PVGC 1ZE3D 1N5XA 2BT6A 1BXTA 1PYWD 4RNAA 3KWVA 1FRRA 1QOFA 3AE2B 1I4QA 4ARCA 3PZ7A 1QLBB 5C2TB 3GP7A 2AQ1B 2V3PA 4KKJA 2ONQA 5AUIA 3I9V1 2EELA 5H8YE 2BW2A 1FFUA 1EWCA 4N6EB 1JWSD 1WYGA 1L6VA 1ZUD2 3AH7A 1V1PB 1D5MC 3HVDA 2EKIA 4YSXB 3B2GA 3AV8A 1OFFA 1K52A 1QOAA 2GB1A 2M56B 2K3UA 1NYQA 1FXAA 2V0GA 3AB5A 3VR9B 4OHJA 2VZKD 1OQQA 4PT5A 1UWXA 1EU4A 5FK9C 3MJ5A 1XCQL 1WGKA 3P4QB 1FFVA 4XDDA 3MC0B 2DWQA 1YQ4B 1MVKA 4ITKA 2WU2B 4OZBA 4RCOA 1KFYB 3ETRA 1V1OA 3TEXA 1F0ZA 2D5GA 4YXDB 1J7BA 2Y5CA 1IBXB 1XXGA 4NZLB 1SIJA 2LJIA 4RFBA 2BTEA 2JQRB 3AE1B 2IJ0A 1H7WA 3AEGB 4DQOC 1DOXA 2INPE 2PKOA 4XE0A 3BVMA 2KMMA 1BUIC 2INNE 1FNWA 4C7YA 2WDVB 4M0WA 4WH4A 1I4PA 1ZXHA 1P7FA 1ESFA 2WNMA 4A90A 2BB6A 2WXLA 1VLBA 4HEA1 4EE2A 1YJJA 1GOZA 4HKZE 2QJLA 3TEWA 1XCTL 4L2YA 1YNTE 1GB4A 1F2RC 1B9RA 3GB1A 1FRDA 3BZDB 5HFYA 5FR3A 1C78A 3LXFA 3E56A 3NZ3A 3P42A 2IGGA 2LHDA 1PUTA 1EM7A 2H89B 1KLUD 2IGDA 4N59A 2BYTA 3IXSA 2W55A 4HJGE 1SXTA 2J52A 2HTME 1D4BA 3WCQA 2FE8A 2AQ3B 3TEYA 2XNAC 1QOBA 1WXQA 1JMLA 1XLQA 1XLNA 1HZ6A 2MJEA 2W82A 3RPFC 1TJEA 4YSZB 3Q69A 1FCCC 1KRHA 2JYEA 2XN9C 3EA6A 1E0ZA 1GT8A 1C4CA 2Y5PA 3IAM1 4KGRA 1CJEA 3N9YC 4YT0B 1AYFA 2LMCA 4MT5A 5HHDG 1R7SA 3W2DA 2SAKA 2MEKA 3I57A 2PW9A 1NI3A 2NMQA 1NYRA 2JYTA 2WXJA 5BYRA 3NUHB 1XEEA 2RDHA 3BIID 1I4XA 2JX5A 2DBYA 3FILB 1SBBB 2AX5A 4RF1A 1STEA 2BS2B 2M19A 4UDUC 2WU5B 1T3QA 4OW0A 3T3OA 4YTNB 1KF6B 4N58A 1YJIA 5EE0A 3U2SC 3SFEB 1TKGA 2QIEB 2GRIA 2SEBD 1JWUD 4CQNA 3ZGZA 1AWDA 1RM6C 2QEJC 4GDKB 1I4RA 1QILA 5BMGA 1T5XD 3AEFB 1T6BX 1LO5D 1Y56A 1WRIA 3AEDB 2E3TA 3H8HA 3HUIA 4P16A 1TY0A 1D5XC 1C9FA 4A9AA 4JPSA 4ZHPA 3R2IA 4KGSA 3W5UB 1JWMD 4XWTA 1HA5A 1SEBD 2PTLA 3KWLA 2CJNA 2G9HD 3HRDD 4GDLB 1QQRA 1NVID 1NEKB 4XWWA 1PFDA 4AS1A 1CK1A 3CIRB 4RGOS 4R3DA 3FAHA 3NVZA 1MI0A 1WWTA 4NAWB 4KKIA 4IDIA 3B2FA 2BS3B 2YEPF 5AUKA 1HXYD 3MP9A 1JRPA 3HVZA 1I7HA 1QKZA 2GI9A 5JXVA 1V97A 2CU3A 3AE8B 4TMAB 2WXGA 1DOIA 5LNK1 1PDXA 1AW7A 3EUB2 3KLSX 1PGXA 1JWAD 2W54A 4LLGM 1I4GA 1ZXIA 2WXHA 3R8BA 1DYQA 3V3XA 1D6EC 1XF5L 2RPVA 1ET9A 1E7PB 5HG2A 2DYMA 3AE4B 3NVYA 1SJED 2L1AA 1D5ZC 1V8CA 4WQMA 4TQ0A 1JROA 4IKGA 5D3DA 2WS3B 2NTSA 3OWEB 5G5HA 1L5PA 2PVOD 3TUOA 2KWDA 3SR6A 1FNUA 5G5GA 1DGJA 1C77A 1YN4A 3ZJVA 4RH6A 4RF0A 4GLSC 2N7JA 4H2AA 1WSPA 1FNVA 1OQRA 3P1MA 2B76B 3P4RB 1Q10A 3ZJTA 1DOYA 4C80A 2IPKD 2WLBA 3R2TA 1SE3A 1E9MA 1RFKA 2DYOA 1YN5A 1SF0A 3Q8AA 4JE3B 3RFZB 1HZ5A 2K5PA 2WXMA 2DLBA 5EE9A 2R61A 5EE3A 2N0SB 1C4AA 1YMHE 2QSDA 3PO0A 4MH8A 2NTTA 4TQ1A 1ROEA 2IGHA 2I38A 1ZP0B 1H7XA 1JW9D 1UUPA 2LHEA 3TSSA 4HROA 4AQ7A 1V1PA 2YEPB 1K53A 2HDEA 2L83A 1ENFA 1JALA 1FM0D 2ZW0A 4C56C 4ZRPA 2CJOA 1P7EA 1VJKA 1QOGA 4OVZA 1N62A 4JWSC 1QT9A 5BMIA 1VZ7A 1KTKA 3ZYYX 1L0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSY B;  1WRI A;  3AED B;  2E3T A;  1JQ4 A;  1XLP A;  1TKY A;  1WGK A;  3P4Q B;  1CZP A;  1FFV A;  3HUI A;  4ZOH C;  1A70 A;  4A9A A;  4ITK A;  2DWQ A;  1YQ4 B;  4ZHP A;  2ACZ B;  2WU2 B;  4US9 A;  3W5U B;  1KFY B;  3ETR A;  3AMZ A;  3HRD D;  1N60 A;  1F0Z A;  3KWL A;  4YTP B;  2CJN A;  3P4P B;  4YXD B;  1J7B A;  3AEA B;  1TYG B;  2MJ3 A;  2Y5C A;  4YTM B;  3SFD B;  1GAQ B;  1NVI D;  1NEK B;  2W3R A;  1L6U A;  2WP9 B;  1PFD A;  1SIJ A;  3LB8 C;  1UWM A;  3B9J A;  3CIR B;  2K9X A;  3AN1 A;  2WDQ B;  2JQR B;  3AE1 B;  3AEB B;  3AM9 A;  4LTU A;  1H7W A;  3AEG B;  1JWB D;  2W3S A;  3FAH A;  4P6V F;  4US8 A;  2PKO A;  3NVZ A;  4KX6 B;  1WWT A;  5GXG B;  2PIA A;  3W9C B;  2KMM A;  1GTE A;  4IDI A;  3FC4 A;  3W5V B;  3AE6 B;  2BS3 B;  3B2F A;  2BS4 B;  3P63 A;  2WDV B;  1NEN B;  4HRS A;  1JRP A;  3HVZ A;  1I7H A;  3NRZ A;  4WWM A;  3CWI A;  1N5W A;  1V97 A;  2CU3 A;  2WQY B;  3AE8 B;  1VDV A;  1N61 A;  3NVV A;  3AE5 B;  1RWS A;  1VLB A;  1RYJ A;  5C3J B;  1DOI A;  3DWG C;  1YJJ A;  1QF6 A;  1PDX A;  3NS1 A;  3EUB 2;  3AEE B;  1DOX A;  5H92 C;  1EWY C;  2MH7 A;  2QJL A;  1JWA D;  1B9R A;  3P4S B;  2W54 A;  1FXI A;  1FRD A;  1ZXI A;  1J7A A;  3LXF A;  1ZOY B;  1XO3 A;  1E7P B;  2KAJ A;  3CF4 A;  1PUT A;  3AEC B;  3AE4 B;  3NVY A;  2L52 A;  2H89 B;  4C7Z A;  1V8C A;  2K22 A;  4WQM A;  1JRO A;  4N59 A;  3VRB B;  4JX1 C;  2W55 A;  3VRA B;  2WS3 B;  5G5H A;  1L5P A;  2HTM E;  1IUE A;  2OHF A;  1YQ3 B;  3AE9 B;  2PVO D;  3WCQ A;  5EE1 A;  5MPO A;  1L0V B;  3NVW A;  2G1E A;  3SR6 A;  5G5G A;  1DGJ A;  1TKE A;  3AE7 B;  1QOB A;  1WXQ A;  3L4P A;  1XLO A;  2LEK A;  4ZHO A;  1XLQ A;  1XLN A;  2H88 B;  2MJE A;  3AE3 B;  3RPF C;  1TJE A;  4YSZ B;  1OQR A;  1FO4 A;  3P1M A;  2B76 B;  1N63 A;  1KRH A;  3P4R B;  4JWU C;  1E10 A;  1DOY A;  1E0Z A;  4C80 A;  1GTH A;  2WLB A;  1GT8 A;  1E9M A;  1RFK A;  2PVG C;  1CJE A;  1N5X A;  2BT6 A;  4YT0 B;  1SF0 A;  1AYF A;  3DWM A;  2K5P A;  4C7Y A;  1FIQ A;  1R7S A;  1FRR A;  5EE9 A;  1QOF A;  5EE3 A;  1SB3 C;  3AE2 B;  2N0S B;  3PO0 A;  1QLB B;  5C2T B;  1NI3 A;  1FMA D;  1NYR A;  1ROE A;  2WDR B;  1ZP0 B;  1H7X A;  1JW9 D;  1E6E B;  5AUI A;  5H8Y E;  3BII D;  4HRO A;  1FFU A;  2JX5 A;  4N6E B;  2FBW B;  2DBY A;  1WYG A;  1L6V A;  1ZUD 2;  3AH7 A;  3ABV B;  2EKI A;  4YSX B;  2AX5 A;  2L83 A;  2BS2 B;  1JAL A;  1J7C A;  3AV8 A;  2M19 A;  2MJD A;  3B2G A;  2WU5 B;  1T3Q A;  5AUK A;  4USA A;  1GPX A;  4YTN B;  1FM0 D;  1OFF A;  1KF6 B;  1QOA A;  2CJO A;  1YJI A;  4N58 A;  5EE0 A;  2M56 B;  3SFE B;  1TKG A;  1VJK A;  2QIE B;  3VR8 B;  1NYQ A;  1FXA A;  1QOG A;  1N62 A;  2Q5W D;  1AWD A;  1QT9 A;  4JWS C;  1RM6 C;  3AB5 A;  3VR9 B;  4FXC A;  3AEF B;  3ZYY X;  1OQQ A; 
#chains in the Genus database with same CATH topology
 3MJW A;  2FID A;  3Q3O C;  2MBE A;  2MLB A;  1P98 A;  2V1Y A;  4DHZ B;  4KDL B;  4F8C B;  1FCL A;  1WGG A;  2KHW B;  1IBX A;  4LK0 M;  1MFW A;  4O1N A;  3P4P B;  1P3Q U;  3V62 A;  3M3J A;  3LB8 C;  3JSV B;  2A4Z A;  3ML9 A;  2WDQ B;  3BVZ A;  4KX6 B;  4W9F A;  1SE4 A;  1WX8 A;  4IWO A;  2BKF A;  4IOI E;  4HRS A;  3V05 A;  4OVU A;  2JPH A;  3AE5 B;  3NVV A;  4II2 B;  1EWY C;  1AN8 A;  1B1Z A;  1RAX A;  2KQ4 X;  1VRA B;  2M0A A;  1VR9 A;  1TTN A;  3VRB B;  4JX1 C;  3WAN A;  4YL8 A;  3UQB A;  3ZTC A;  3DHG C;  3D32 A;  3PRE A;  3BWU D;  3ZNZ B;  4ZHO A;  2D3B A;  3MC8 A;  1NBF C;  1L4Z B;  3DBH I;  5J17 A;  1KM7 A;  1E10 A;  3W1S A;  3QHT A;  2NBV B;  4MDK E;  4MM3 B;  5T8I A;  1KLG D;  4RGN A;  1V49 A;  4XZ4 A;  4YWG G;  1YJ1 A;  3QCA A;  1J8C A;  4WUR A;  3KYC D;  5IP4 D;  1E6E B;  3OLM D;  5BMH A;  2AWT A;  3ZVV A;  3GS2 A;  1FXT B;  2KWC A;  4ZRQ A;  4FJY A;  2KQ7 A;  3NZS A;  1GPX A;  1TS4 A;  3A1Q B;  2WXQ A;  1T0R C;  2Q5W D;  4J6I A;  1RFA A;  2KN5 A;  1ET6 A;  1IGC A;  4FXC A;  3A9J A;  2Z8L A;  5I4D A;  2W9N A;  3EGR A;  4YSY B;  2DNF A;  1CQV A;  2KFK B;  1XLP A;  3JYU A;  4WAF A;  2V4I B;  2PE9 A;  2JZP A;  4L1B A;  4ASW C;  4US9 A;  4FLH A;  5D7G A;  3NS8 A;  2PLP A;  2WXR A;  1L6U A;  4I6P A;  2O6V B;  3UI3 A;  2GOW A;  4MH0 E;  1WH3 A;  3AM9 A;  2KXJ A;  5KHQ A;  2KDM A;  3CWI A;  3IFW B;  1N61 A;  1RWS A;  2BYE A;  2XK5 A;  4WWP A;  4IUM B;  2NBU A;  1C3T A;  4KGT A;  3BVG A;  2CU1 A;  1SE9 A;  1WRD B;  2ZVN A;  1LGR A;  4MGK E;  3BYT B;  1L0X B;  2K22 A;  3E9S A;  3Q14 C;  2WDT B;  2NPT A;  1FD6 A;  2N1W A;  3VH3 B;  1ZKH A;  4NJC A;  2NS5 A;  3HHM A;  1TKE A;  1N6Z A;  1FEH A;  1L7Y A;  3N30 A;  1WZ3 A;  3ECI A;  2QIL A;  3AE3 B;  4K7U A;  1FO4 A;  2ASQ A;  1N5X A;  1BXT A;  3EFC A;  1FRR A;  3V60 A;  3AE2 B;  4ARC A;  2YLM A;  2HTH A;  5C2T B;  3GP7 A;  5BO4 B;  1LXD A;  3R7R A;  2ONQ A;  2EEL A;  3L0W B;  3AU4 A;  1FFU A;  1EWC A;  4N6E B;  1MJD A;  1ZUD 2;  1D5M C;  4KIK B;  3B2G A;  3AV8 A;  2V4L A;  1QOA A;  2M56 B;  2K3U A;  3WA0 A;  4OHJ A;  2VZK D;  1OQQ A;  4PT5 A;  2KLC A;  1VCB A;  1MVK A;  4OZB A;  2KTR B;  2DZI A;  3HM6 X;  1AAR A;  4YXD B;  1J7B A;  2KDB A;  3JSV A;  4K3C A;  4LDT B;  3RNF C;  1IP9 A;  3A4R A;  4RFB A;  1V6E A;  3H6N A;  2JQR B;  3AEG B;  2KMM A;  2HJ1 A;  3RNE C;  2INN E;  4BZA A;  1FNW A;  4RMA A;  2N9X A;  1I4P A;  1P7F A;  3C19 A;  4HEA 1;  3DBR I;  3RZF A;  1R4N B;  4IM3 A;  3PHW B;  2R2O A;  3TEW A;  1XCT L;  1YNT E;  1F2R C;  1B9R A;  4KV2 A;  1FRD A;  2D11 A;  5FR3 A;  2KDF B;  2IY1 B;  2IGG A;  3X23 A;  2GLS A;  1KLU D;  3DDC B;  3LDZ E;  2W55 A;  2J52 A;  2G4D B;  2KVZ A;  3ZO5 B;  3WCQ A;  5IKC M;  2RPQ A;  2XNA C;  1QOB A;  1TJE A;  4YSZ B;  3VXW A;  3Q69 A;  1FCC C;  1KRH A;  2ZEQ A;  3UQA A;  4MM3 A;  2XN9 C;  1X1M A;  3R7Q A;  1WJ6 A;  4KGR A;  3N9Y C;  4YT0 B;  2AL3 A;  4BFR A;  3ZLZ A;  2KX0 A;  4K1R B;  3I57 A;  2LXA A;  2PW9 A;  2G45 B;  4A20 A;  2JYT A;  2MQJ A;  4ZDV A;  4KZ0 A;  2RDH A;  3BII D;  2DBY A;  3FIL B;  1STE A;  2BS2 B;  3N20 C;  3A1Q A;  4NY0 A;  3NOB A;  1YJI A;  5EE0 A;  1P0R A;  3ZGZ A;  4MJS B;  2QEJ C;  1QIL A;  4P1C C;  1Y56 A;  4G50 A;  2KFK A;  1P9D U;  3DVN V;  2C9W B;  3H8H A;  4N9F 4;  4ZHP A;  1WIA A;  1IPG A;  4GU2 A;  5HKH A;  3ZDT A;  1SEB D;  1V2Y A;  3TJP A;  4GDL B;  1QQR A;  5AZF A;  1NVI D;  2O6V A;  3L54 A;  3CIR B;  2KX3 A;  4JIO U;  4R3D A;  4GB9 A;  2I1J A;  3B2F A;  2QHO A;  5JXV A;  5G55 A;  3VUX A;  3PV1 A;  2ZNV C;  5JHB A;  1AW7 A;  1PGX A;  4HWI B;  3V3X A;  4BKS D;  1WZ0 A;  4AUQ C;  3AE4 B;  3NVY A;  1OEY A;  1JRO A;  4MEL A;  2X8X X;  5D3D A;  1UD7 A;  2KMC A;  2PVO D;  2KO3 A;  1I42 A;  1LFD A;  3DBL I;  3RNA C;  1C77 A;  1GUA B;  1YOV B;  1YN4 A;  4RH6 A;  2NCN A;  4H2A A;  2JF5 A;  2B76 B;  2J0J A;  1Q10 A;  4C80 A;  1E9M A;  3Q8A A;  1WX7 A;  4JE3 B;  4C00 A;  2DLB A;  2KJR A;  2QSD A;  3ZUN A;  2LGX A;  5J2R A;  4BOZ B;  1E90 A;  4TKN A;  2KD0 A;  1UUP A;  3R3M A;  3U30 A;  5JZE B;  3ZDM C;  1ENF A;  4WJO A;  3CF6 E;  1RLF A;  4ZRP A;  2CJO A;  4FUL A;  2IBI B;  3QQ8 B;  5DCN A;  1QT9 A;  4LNF A;  1VZ7 A;  4BKG A;  4EZK A;  1YN3 A;  4DXF A;  2C7H A;  5D3I B;  1A70 A;  2KTR A;  1V80 A;  4B0E A;  2ACZ B;  2ZW1 A;  4WJN A;  5FKA C;  1Q0W B;  4YTM B;  1MPE A;  2W3R A;  2J4X A;  2K6Q A;  3RUL A;  3BY4 B;  2WYQ A;  2KDE B;  3DHH C;  3K9O B;  4P6V F;  1JWB D;  2RDG A;  4DXA B;  2JZZ A;  1WGY A;  1EF1 A;  2BVC A;  4WQO B;  3URY A;  1N5W A;  2V3S A;  4LCD E;  2KC2 A;  2BKR B;  4GGQ A;  3I63 C;  1E8Z A;  2L76 A;  3P4S B;  1TIF A;  3VTU A;  3EFU A;  2ZJD A;  4KSK C;  1ZDV A;  3MFG A;  3KUD B;  3A9K B;  4PYZ A;  3MHS D;  1IUE A;  2FCS A;  2OHF A;  5MPO A;  5EE1 A;  1NDD A;  3L10 B;  3VUY A;  4W9I A;  2VZK B;  5G2N A;  2HD5 B;  2H88 B;  3RNB C;  2AQ2 B;  4JWU C;  1TGZ B;  3PPA A;  2KJH B;  3KQ4 A;  2ZVO A;  1F9J A;  5IOI A;  1SB3 C;  2N1V A;  1FMA D;  2C60 A;  5CX3 A;  1BML C;  2ON8 A;  2FBW B;  3FIL A;  4NJ7 A;  3ABV B;  2FCN A;  2JXT A;  1J7C A;  1ZDX A;  4WIP A;  4MJS A;  1SE2 A;  4IWQ A;  3RZW C;  1K51 A;  4ICV A;  2FAZ A;  4ZYN A;  1JQ4 A;  3IAS 1;  4GMV A;  1CZP A;  4FAD A;  3TIX A;  1ISN A;  2NR2 A;  4YTP B;  4GDL A;  4GIV A;  2KMA A;  3SFD B;  4KZC A;  2WP9 B;  4OVV A;  2RMM A;  4PYU A;  1WJ4 A;  4DDG D;  2WXP A;  2NBW B;  4D2K A;  2KLG A;  3NRZ A;  4WWM A;  1GJZ A;  1TS2 A;  1NI2 A;  2KYW A;  4MGZ E;  4LJP B;  3A33 B;  3W1S C;  2DAJ A;  5E6J A;  4X57 B;  2FIF A;  4J3O D;  2OED A;  2LGS A;  4IC7 B;  3H7P B;  4K7W A;  3Q6B A;  4NNJ B;  3TMP B;  3PVL A;  4JL9 A;  1WY8 A;  3U7D A;  4OZA A;  4EEW A;  4WWN A;  4RGT A;  3VRA B;  3DPD A;  1OGW A;  3AE9 B;  3O13 A;  1V86 A;  4BVU C;  1C79 A;  2BB5 A;  2MBQ A;  4MEM A;  1KLV A;  2DAF A;  2LEK A;  5J18 A;  2A5U A;  2ICI A;  1MHH E;  3JW0 X;  4FA6 A;  4PS3 A;  1UNS A;  1GTH A;  1ZE3 D;  4BAX A;  2BT6 A;  4M8M A;  3RYT A;  1PYW D;  3IG3 A;  2PE6 B;  2JRH A;  4GXB A;  4ANV A;  1WJN A;  1QLB B;  2GMI C;  2V3P A;  1ZW7 A;  3Q3N C;  2D3A A;  5H8Y E;  2I1K A;  3AH7 A;  3DVG X;  4YSX B;  4HCN B;  1EUV B;  3GOE A;  2GB1 A;  2C5L C;  1E7U A;  1KOT A;  4B9K A;  2LGD A;  4KSL C;  3TBL D;  3MJ5 A;  3P4Q B;  4LNI A;  2UU7 A;  1Z5S B;  2WU2 B;  2FCQ A;  4JQW C;  1XXG A;  2XEW A;  1SIJ A;  3GZN I;  3AE1 B;  2IJ0 A;  1DOX A;  5AZH A;  3DHI C;  2INP E;  4E3C A;  3BVM A;  3PGE A;  2WDV B;  4K81 A;  4K3B A;  4PS7 A;  1YJJ A;  2MP2 B;  5LXI B;  5DPS A;  4HKZ E;  4L2Y A;  1GB4 A;  3X0W A;  3GB1 A;  2DZM A;  3Q2A C;  3ZNG C;  3E56 A;  3P42 A;  2LHD A;  2RR9 A;  4IM0 A;  2FUH B;  4TV3 A;  2DHZ A;  5EDS A;  2IGD A;  2BYT A;  3A9K A;  3IXS A;  3SU8 X;  2UYZ B;  4HJG E;  1D4B A;  4CHK A;  2EKE C;  4HPL B;  2FE8 A;  2AQ3 B;  3A4S C;  1XLQ A;  2CHW A;  3RPF C;  2DEN B;  2JYE A;  4GOC A;  3VUW A;  4P1B C;  1AYF A;  2LMC A;  4G0N B;  1U4A A;  1WGH A;  4MT5 A;  2G3Q B;  2SAK A;  1NI3 A;  2WXJ A;  4E71 A;  4G11 A;  2AX5 A;  4UDU C;  3PHX B;  3T3O A;  1KF6 B;  3U2S C;  2VRR B;  3APC A;  2CHX A;  1WM2 A;  2O2V B;  1AWD A;  1TZ1 A;  4GDK B;  3S2A A;  3AU5 A;  4EFO A;  5BMG A;  1T5X D;  1WRI A;  3NHE B;  3AED B;  4I6N B;  1E8Y A;  2EMS A;  2MW5 A;  4P16 A;  4W9D A;  4NQL B;  1C9F A;  4A9A A;  3DVN U;  4KGS A;  3W5U B;  4XWT A;  2M4N A;  2BGF A;  3PLV A;  3KWL A;  3ZRC A;  5DPT A;  4S0R A;  4AS1 A;  2C7M B;  3AI5 A;  1WR6 E;  3OJ4 B;  1CK1 A;  3MTN B;  2GBM A;  3FAH A;  1MI0 A;  1WWT A;  4NAW B;  4M01 A;  2OJR A;  3VH4 B;  1L2N A;  4KKI A;  2BS3 B;  2YEP F;  5L95 C;  1YQB A;  3HVZ A;  2CU3 A;  4EOY A;  4TMA B;  2M8S A;  1MG8 A;  2LZ6 A;  1PDX A;  1WJU A;  1OQY A;  1JWA D;  2W54 A;  3B08 A;  3IVF A;  1ZXI A;  3R8B A;  3T9L A;  1D6E C;  2L0F A;  5CHF A;  5D2M B;  1ET9 A;  3V61 A;  3RD2 A;  2RD0 A;  4HLE A;  2DYM A;  4ZRJ A;  2L1A A;  4TQ0 A;  3RI7 C;  4IKG A;  2FCM A;  2NTS A;  5GMV A;  4C4V B;  1WXM A;  4LNN A;  3AXC A;  2WX1 A;  3SR6 A;  4GSW A;  5G5G A;  1DGJ A;  4HDO A;  4ZRK A;  3ZJV A;  3EC8 A;  2L00 B;  2BF8 B;  2L3Z A;  5AZG A;  2WLB A;  2WX0 A;  3RFZ B;  4DHZ E;  2LI5 A;  5EE3 A;  1H8C A;  3UF8 A;  3N1Z C;  3RN9 C;  3PO0 A;  3L13 A;  1ZP0 B;  2KOX A;  2DYB A;  1JW9 D;  1D3Z A;  2LHE A;  2K8B A;  4HXD A;  4FHK A;  3UIP B;  1I4H A;  3DVG Y;  2WXF A;  1TKY A;  4BKS A;  3M95 A;  3Q8B A;  1SJH D;  2ZPY A;  3PZD A;  1IGD A;  2IZV B;  4REZ A;  3TL5 A;  4L23 A;  3AMZ A;  4LNO A;  2NVU I;  2BBC A;  3C8Y A;  1PGB A;  1P1A A;  5BYS A;  2FUG 1;  2KNB A;  5BYQ A;  2JRI B;  3ZIM A;  3AN1 A;  4K7S A;  2D07 B;  2I2Y A;  4US8 A;  3MHZ A;  5GXG B;  5E6N A;  3W5V B;  1WYW B;  2ZZP B;  3IBE A;  2GBK A;  4M0W B;  1VDV A;  2MP2 A;  1HE8 A;  1UF0 A;  1QF6 A;  2N9E B;  3AEE B;  2MH7 A;  3O65 B;  2PJH A;  1FXI A;  3JVZ X;  4KDI C;  2INC C;  4LJO B;  3NZU A;  1XO3 A;  1RRB A;  2KAJ A;  3CF4 A;  2N9P C;  2L52 A;  4C7Z A;  3T3N A;  4AJW A;  4HKQ A;  1VZ8 A;  4CYE A;  2MX2 A;  2N9L A;  3NVW A;  2IDY A;  3U8Z A;  1YX5 B;  2WXO A;  2ZPN A;  5IA7 A;  4ZYS A;  2JSV X;  3QK0 A;  2KQS A;  3DWM A;  1FIQ A;  2QMT A;  1ZPS A;  2MSE D;  1ACC A;  4QAY A;  4B6W A;  2JUO A;  2KVR A;  3V6C B;  1V9J A;  1EF5 A;  1TY2 A;  2J0K A;  1SSN A;  1MHX A;  4RM8 A;  3VFK A;  3DQV A;  2M17 A;  4USA A;  2FNJ B;  3KW5 B;  2O2V A;  4GDK A;  3LYY A;  1M4V A;  2Y5B B;  4FJV B;  2JU6 X;  3HIZ A;  2L8J A;  1WF9 A;  3L17 A;  3ZW3 A;  5D94 A;  2BYF A;  2KT7 A;  3ZQ4 A;  1YIW A;  1Z2M A;  2RGF A;  1HQR D;  1TZO A;  4KIK A;  1N60 A;  2Y3A A;  4ICU A;  1S1Q B;  1R4M B;  3HK0 A;  1GB1 A;  1TYG B;  2MBO A;  1R4N I;  1HEZ E;  1UWM A;  3QA8 A;  4DXG A;  3ZJU A;  1VZ6 A;  3AEB B;  5JHA A;  2W3S A;  4NAW A;  3B1L X;  1XQQ A;  4FJZ A;  3P63 A;  2BS4 B;  1CMX B;  2G4S A;  1A5R A;  4B0M A;  2WQY B;  2X38 A;  1F52 A;  4A6Q A;  4NPN A;  5H92 C;  4XGA B;  4MAC A;  4NAM A;  4F7Z A;  2IYD B;  3APF A;  2HJ8 A;  2JWU A;  3Q3F A;  4HPM B;  4C4V A;  3BK1 A;  2GBJ A;  1YQ3 B;  1V81 A;  1L0V B;  4AP4 C;  3ML8 A;  4DDI D;  1XLO A;  2Z0E B;  1TS5 A;  4HVB A;  1N63 A;  2QDF A;  2J53 A;  1T0Q C;  1GC6 A;  3VDZ A;  3N32 A;  2KFJ A;  2ZCB A;  3KWV A;  2LVP A;  2MWS B;  4HCP B;  4KKJ A;  3DCG A;  3RUI B;  3HM3 A;  4IG7 B;  4IM2 A;  1JWS D;  1WYG A;  1V1P B;  2MA9 B;  3HVD A;  2EKI A;  4S17 A;  2V0G A;  3AB5 A;  3VR9 B;  5FK9 C;  3PSE B;  1XCQ L;  1FFV A;  4XDD A;  1YQ4 B;  1TBE A;  3ETR A;  3PS6 A;  3TEX A;  3UGB B;  1F0Z A;  3VVW B;  4NZL B;  4JGH B;  2LJI A;  1H7W A;  4MSQ B;  3WAM A;  4C7Y A;  4M0W A;  1K8R B;  1ZXH A;  2BYV E;  2WNM A;  4A90 A;  2BB6 A;  2D10 A;  1VLB A;  2WXL A;  3L16 A;  4EE2 A;  3ZRF A;  4DBG A;  1UZX B;  3LXF A;  3AUL A;  4AOF A;  1UEL A;  1EM7 A;  3MC9 A;  1J19 A;  1M94 A;  3SD5 A;  4N59 A;  2DZK A;  1QZE A;  3SHQ A;  1ZGU B;  2J0M A;  4DWF A;  5DPW A;  3TEY A;  1UBQ A;  1MG4 A;  1JML A;  2W82 A;  2PEA A;  2KWU B;  1C4C A;  5LXH A;  1CJE A;  1R4M I;  1T0S C;  5HHD G;  1R7S A;  4NJ6 A;  1WMH B;  2MEK A;  4EZL A;  2NMQ A;  3NUH B;  1WXS A;  1I4X A;  4FBJ B;  3PRM B;  3QAQ A;  3IHP C;  1SBB B;  4RF1 A;  5D6J B;  2M19 A;  2JZ3 B;  4OW0 A;  4YTN B;  2BPS A;  1TKG A;  2SEB D;  2GRI A;  1JWU D;  1WX9 A;  2L05 A;  1RM6 C;  2MHJ A;  1T6B X;  1LO5 D;  5CHV C;  1WGD A;  4WWO A;  4E74 A;  2XBB C;  3HUI A;  1I35 A;  2MCN B;  2QC8 A;  1D5X C;  4HJK A;  4IWP A;  4JPS A;  3R2I A;  1LQB A;  2KTF A;  2PTL A;  1OEY J;  2AEH A;  2CJN A;  2G9H D;  3HRD D;  1NEK B;  1PFD A;  5DPR A;  3OG5 A;  3KUZ A;  2K39 A;  5FR6 A;  4RGO S;  3DOW A;  2JY6 A;  3PLU A;  3NVZ A;  4MGI E;  3CST A;  2LJ5 A;  1QKZ A;  3Q3J A;  1V97 A;  4IW0 A;  3GE8 C;  3N1Y C;  2BWF A;  5AEK B;  4LLG M;  2IO0 B;  3ZKJ C;  2L0T A;  3VTV A;  1E7P B;  2CS4 A;  3SDL C;  1PQS A;  2LUE A;  1D5Z C;  4WQM A;  3DBR B;  4II3 B;  1E7V A;  4DHJ D;  5G5H A;  1H4R A;  3RNC C;  3QX1 A;  3TUO A;  1WXV A;  2KWD A;  1FNU A;  1S3S G;  2MBB B;  4RF0 A;  4GLS C;  1J0G A;  1UH6 A;  2GBN A;  4W9E A;  3TCA A;  2MRP A;  3P4R B;  3R2T A;  1SE3 A;  3QC8 B;  1RFK A;  2DYO A;  2D3G A;  1SF0 A;  3L08 A;  1Q1O A;  2KK8 A;  5EE9 A;  2R61 A;  3UIO B;  1C4A A;  1YMH E;  4MH8 A;  2LWP A;  1UBI A;  4GN1 A;  1ROE A;  1FPY A;  2I38 A;  5KHO A;  3TSS A;  2JWZ A;  1V1P A;  3ZXR A;  4BOS C;  4W9K A;  1FM0 D;  3PRZ A;  4ANX A;  4C56 C;  1P7E A;  3I3T B;  1QOG A;  1N62 A;  2WGS A;  1KTK A;  3ZYY X;  4P7I A;  1L0Y B;  2N9K A;  4XYC A;  3BK2 A;  4A55 A;  2WXI A;  4A8X C;  2J42 A;  2N7D A;  2KAC A;  2PMV A;  3J9C A;  2V3N A;  4DK5 A;  3ZNI D;  3AEA B;  1GNU A;  1GAQ B;  3U4E G;  2E6X A;  1K50 A;  3WAO A;  2ZCC A;  1F77 A;  3APD A;  3NY5 A;  4WJP A;  2IND C;  5CTR C;  3W9C B;  2V9H A;  1GTE A;  3FC4 A;  3AE6 B;  3SEB A;  1NEN B;  4TSS A;  2IO3 B;  5C3J B;  1SGH A;  3NS1 A;  2REX A;  3C0R B;  3UIN B;  1WM3 A;  2RSU A;  1JCK B;  3GE3 C;  1J7A A;  1ZOY B;  4W9L A;  1Q5W B;  3AEC B;  2WXK A;  3ALB A;  2J7Q B;  2LUM A;  4BKT A;  3ONS A;  4Q2J A;  2WXN A;  2G1E A;  3BIN A;  1V5O A;  1C1Y B;  3AE7 B;  3VQI A;  3H7P A;  1UGJ A;  2GBR A;  2CKH B;  3WIM A;  3ZNH B;  2ZNV B;  3RMK C;  1EU3 A;  4TUU A;  1WMH A;  3BYY B;  3DBL B;  3Q8E A;  2KN4 A;  2D3C A;  3IT4 B;  1WXA A;  2WDR B;  4MSM B;  1SIF A;  2MJD A;  1C4P A;  1L4D B;  2KKC A;  3VR8 B;  3VHT C;  3U7Z A;  4ANW A;  2K0P A;  4ZOH C;  3V6E B;  2JVC A;  3RNG C;  2KDI A;  1KH0 A;  2R2Q A;  2RDB C;  4XDC A;  3H9D A;  2MJ3 A;  4LTU A;  2DZJ A;  3PZ8 A;  4M8N A;  4A3P A;  2PPH A;  5IO9 A;  3P2B A;  3B9J A;  2K9X A;  2TSS A;  3H1U A;  3Q8C A;  3CMM B;  4RGM A;  2PIA A;  1HTO A;  2HE7 A;  5TSS A;  1F2R I;  4AJY B;  1RYJ A;  1LM8 B;  3DWG C;  3TEZ A;  2IO2 B;  2LGI A;  4URK A;  1TS3 A;  3LJ3 A;  2L32 A;  4I6L B;  4JLC A;  3M62 B;  2LFI A;  2LRU A;  3T8M A;  1PGA A;  4OZC A;  1C76 A;  5HI1 A;  1KJT A;  3Q8F A;  3L4P A;  3U52 E;  1E8X A;  4W9H A;  4ARI A;  1BT0 A;  1YD8 U;  3IT6 B;  3PRP B;  1F1H A;  2PVG C;  2IO1 B;  4RNA A;  3DBS A;  2CHZ A;  1QOF A;  1I4Q A;  3Q3M C;  3VAW A;  3PZ7 A;  2AQ1 B;  3NJT A;  1Y8R C;  2D2Q A;  5AUI A;  3I9V 1;  4ACF A;  2BW2 A;  3EHV A;  1L6V A;  3N3K B;  2K6D B;  1OTR B;  1WFY A;  1OFF A;  1K52 A;  3NG0 A;  4FN2 A;  1NYQ A;  1FXA A;  1VD2 A;  2QCZ A;  5LLI A;  3ZXV A;  1GC7 A;  1WE7 A;  4ZRI A;  1UWX A;  5L83 A;  1EU4 A;  4W9G A;  1WGK A;  3MC0 B;  2C7N B;  2DWQ A;  4ITK A;  3WAP A;  4RCO A;  1E5W A;  1KFY B;  2N7E A;  1V1O A;  1IYF A;  2IY0 B;  2M1M A;  2D5G A;  2EMT A;  4HPP A;  1IBX B;  2Y5C A;  4DHJ B;  3QWZ B;  4NQK E;  1HTQ A;  2KAN A;  4G3X B;  3ENE A;  2BWE S;  3QAR A;  2BTE A;  1XD3 B;  4DQO C;  2PKO A;  4XE0 A;  2JT4 B;  1BUI C;  4M02 A;  3W1Y A;  2OJW A;  4WH4 A;  2LGY A;  1ESF A;  2KC1 A;  2UWQ A;  5E6O A;  3FKY A;  3M63 B;  1GOZ A;  2Z59 B;  3RT3 B;  2QJL A;  5IN7 A;  5HFY A;  3BZD B;  2M0X A;  1C78 A;  3NZ3 A;  4RM9 A;  4XC2 A;  1PUT A;  2H89 B;  3B0A A;  3QJZ A;  4PK1 A;  5CHW A;  3EEC A;  4CO7 A;  1SXT A;  2HTM E;  1WGR A;  2O6V D;  2VH1 A;  4EKU A;  1WXQ A;  1XLN A;  1HZ6 A;  2MJE A;  4M00 A;  5C1Z A;  3KVF B;  4WAA A;  4EZJ A;  3EA6 A;  1E0Z A;  1GT8 A;  3IAM 1;  2Y5P A;  1WE6 A;  1UGM A;  3WAL A;  3W2D A;  4BBN C;  4WJQ A;  2VH2 A;  1EO6 A;  4AWJ A;  5JH5 C;  1NYR A;  1YX6 B;  5BYR A;  2KZR A;  1XEE A;  2K1F A;  2KWV B;  2JX5 A;  5E6P A;  2WU5 B;  1T3Q A;  4MGY E;  5TR5 A;  4N58 A;  2N4F A;  3KUC B;  2QIE B;  3SFE B;  2LRW A;  4CQN A;  3CSF A;  3OAW A;  1I4R A;  2AYO B;  3AEF B;  3A9J B;  4ANU A;  2K25 A;  5C23 A;  2E3T A;  3OJ3 A;  2WWZ A;  4A3O A;  1TY0 A;  3DBH B;  1JWM D;  2LAS A;  1HA5 A;  4FHJ A;  2Z0D B;  2MBH A;  2B3A A;  4HDQ A;  2WHI A;  3RCZ A;  4XWW A;  1E8W A;  1GG3 A;  2LXC A;  2LVO A;  2K8C A;  4IDI A;  5AUK A;  1HXY D;  3MP9 A;  1JRP A;  1I7H A;  2CR5 A;  2GI9 A;  3AE8 B;  1XT9 B;  3K9P B;  2WXG A;  1DOI A;  5LNK 1;  2XK5 B;  4KVG B;  3EUB 2;  3KLS X;  3GZN B;  1I4G A;  2WXH A;  1DYQ A;  1V5T A;  1XF5 L;  2RPV A;  5HG2 A;  3PT2 B;  1SJE D;  4PS8 A;  1V8C A;  4W9C A;  3QIJ A;  4BBN F;  4F1S A;  2WS3 B;  3OWE B;  3R66 C;  1L5P A;  1WR1 A;  4LDT D;  2NPT B;  3VTW A;  2KJ6 A;  3KH0 A;  1G6J A;  1TT5 B;  2LD9 A;  2N7J A;  1WSP A;  1FNV A;  1OQR A;  3P1M A;  3PTF C;  3ZJT A;  1DOY A;  3KYD D;  2IPK D;  2OOB B;  2LVQ A;  3ZTD A;  1WI0 A;  1YN5 A;  1HZ5 A;  2K5P A;  2L7R A;  2WXM A;  2JXX A;  1T0Y A;  4XX5 A;  2N0S B;  4TQ1 A;  2NTT A;  2AL6 A;  2IGH A;  2BQQ A;  4B95 A;  3H7S A;  1H7X A;  2YVC A;  2K8H A;  1JRU A;  4HRO A;  4W9J A;  4AQ7 A;  3N1X C;  2YEP B;  5IAA C;  4LNK A;  1K53 A;  2HDE A;  2L83 A;  3I5J C;  1JAL A;  2ZW0 A;  1VJK A;  4HK2 A;  2DX5 B;  4OVZ A;  4JWS C;  5BMI A;  4EUT A; 
#chains in the Genus database with same CATH homology
 1I4H A;  2N9K A;  2WXF A;  3BK2 A;  4A55 A;  2WXI A;  1TKY A;  1YN3 A;  4DXF A;  3Q8B A;  5D3I B;  4A8X C;  1A70 A;  2J42 A;  1SJH D;  2KAC A;  1IGD A;  2ACZ B;  2PMV A;  4REZ A;  4B0E A;  4L23 A;  2ZW1 A;  3AMZ A;  3J9C A;  2V3N A;  5FKA C;  1FCL A;  2BBC A;  1IBX A;  4LK0 M;  4O1N A;  3P4P B;  3AEA B;  3C8Y A;  4YTM B;  1GAQ B;  1MPE A;  2W3R A;  1PGB A;  2J4X A;  5BYS A;  3LB8 C;  2FUG 1;  5BYQ A;  3U4E G;  2E6X A;  1K50 A;  3AN1 A;  1F77 A;  2WDQ B;  4P6V F;  3BVZ A;  1JWB D;  2RDG A;  2I2Y A;  4US8 A;  3MHZ A;  5GXG B;  4KX6 B;  3W9C B;  1SE4 A;  1GTE A;  3FC4 A;  4IOI E;  3AE6 B;  3W5V B;  3SEB A;  1NEN B;  4HRS A;  3V05 A;  3URY A;  1N5W A;  4TSS A;  1VDV A;  3NVV A;  3AE5 B;  5C3J B;  1QF6 A;  3NS1 A;  3AEE B;  1EWY C;  2MH7 A;  1AN8 A;  3P4S B;  1B1Z A;  1FXI A;  1JCK B;  1J7A A;  1ZOY B;  1XO3 A;  2KAJ A;  2KQ4 X;  1VRA B;  2M0A A;  3CF4 A;  1VR9 A;  3AEC B;  1ZDV A;  2L52 A;  2WXK A;  4C7Z A;  3MFG A;  3T3N A;  3VRB B;  4JX1 C;  2LUM A;  4HKQ A;  1VZ8 A;  1IUE A;  2OHF A;  4Q2J A;  5MPO A;  5EE1 A;  2N9L A;  2WXN A;  3NVW A;  2IDY A;  2G1E A;  3AE7 B;  2VZK B;  2WXO A;  3BWU D;  4ZHO A;  2H88 B;  3VQI A;  4ZYS A;  1L4Z B;  2AQ2 B;  2JSV X;  1UGJ A;  4JWU C;  1E10 A;  3W1S A;  4MM3 B;  5T8I A;  1KLG D;  3KQ4 A;  3DWM A;  4RGN A;  1FIQ A;  1EU3 A;  2QMT A;  1ZPS A;  3BYY B;  1ACC A;  3Q8E A;  2KN4 A;  1SB3 C;  4YWG G;  3IT4 B;  1FMA D;  2WDR B;  4WUR A;  1E6E B;  1BML C;  1TY2 A;  2ON8 A;  5BMH A;  2FBW B;  3FIL A;  1SSN A;  3ABV B;  1MHX A;  3GS2 A;  2JXT A;  1J7C A;  2MJD A;  1ZDX A;  4ZRQ A;  4USA A;  1GPX A;  1TS4 A;  1C4P A;  4WIP A;  1L4D B;  2WXQ A;  1SE2 A;  3VR8 B;  2Q5W D;  3LYY A;  1K51 A;  1M4V A;  1IGC A;  1ET6 A;  4FXC A;  2Z8L A;  5I4D A;  3EGR A;  4YSY B;  2JU6 X;  1CQV A;  1JQ4 A;  1XLP A;  3IAS 1;  3U7Z A;  4WAF A;  2V4I B;  2K0P A;  4ZOH C;  1CZP A;  2JZP A;  4L1B A;  3ZQ4 A;  4US9 A;  1KH0 A;  5D7G A;  1HQR D;  1TZO A;  2PLP A;  1N60 A;  2WXR A;  4XDC A;  4YTP B;  2Y3A A;  1GB1 A;  1TYG B;  2MJ3 A;  4LTU A;  3SFD B;  1L6U A;  2WP9 B;  3PZ8 A;  2RMM A;  1HEZ E;  1UWM A;  3UI3 A;  4DXG A;  3B9J A;  3ZJU A;  2K9X A;  2TSS A;  1VZ6 A;  3AM9 A;  3AEB B;  2W3S A;  2WXP A;  3Q8C A;  4RGM A;  2PIA A;  3P63 A;  4D2K A;  2BS4 B;  3NRZ A;  4WWM A;  2KDM A;  4B0M A;  3CWI A;  5TSS A;  1F2R I;  1TS2 A;  2WQY B;  1N61 A;  1RWS A;  2X38 A;  1RYJ A;  3DWG C;  4A6Q A;  3TEZ A;  5E6J A;  4J3O D;  5H92 C;  2OED A;  2LGI A;  4KGT A;  1TS3 A;  4MAC A;  3BVG A;  4NAM A;  2L32 A;  3BYT B;  4OZA A;  1L0X B;  2LFI A;  2K22 A;  2JWU A;  3E9S A;  4RGT A;  3VRA B;  3BK1 A;  1YQ3 B;  3AE9 B;  1FD6 A;  1PGA A;  3O13 A;  4OZC A;  1L0V B;  1C76 A;  4NJC A;  5HI1 A;  1C79 A;  2BB5 A;  1TKE A;  3Q8F A;  3L4P A;  1XLO A;  1FEH A;  2LEK A;  3U52 E;  1TS5 A;  2ICI A;  3AE3 B;  2QIL A;  1MHH E;  4ARI A;  1FO4 A;  1N63 A;  1UNS A;  2J53 A;  3IT6 B;  1GTH A;  2PVG C;  1ZE3 D;  1N5X A;  2BT6 A;  1BXT A;  1PYW D;  4RNA A;  3KWV A;  1FRR A;  1QOF A;  3AE2 B;  1I4Q A;  4ARC A;  3PZ7 A;  1QLB B;  5C2T B;  3GP7 A;  2AQ1 B;  2V3P A;  4KKJ A;  2ONQ A;  5AUI A;  3I9V 1;  2EEL A;  5H8Y E;  2BW2 A;  1FFU A;  1EWC A;  4N6E B;  1JWS D;  1WYG A;  1L6V A;  1ZUD 2;  3AH7 A;  1V1P B;  1D5M C;  3HVD A;  2EKI A;  4YSX B;  3B2G A;  3AV8 A;  1OFF A;  1K52 A;  1QOA A;  2GB1 A;  2M56 B;  2K3U A;  1NYQ A;  1FXA A;  2V0G A;  3AB5 A;  3VR9 B;  4OHJ A;  2VZK D;  1OQQ A;  4PT5 A;  1UWX A;  1EU4 A;  5FK9 C;  3MJ5 A;  1XCQ L;  1WGK A;  3P4Q B;  1FFV A;  4XDD A;  3MC0 B;  2DWQ A;  1YQ4 B;  1MVK A;  4ITK A;  2WU2 B;  4OZB A;  4RCO A;  1KFY B;  3ETR A;  1V1O A;  3TEX A;  1F0Z A;  2D5G A;  4YXD B;  1J7B A;  2Y5C A;  1IBX B;  1XXG A;  4NZL B;  1SIJ A;  2LJI A;  4RFB A;  2BTE A;  2JQR B;  3AE1 B;  2IJ0 A;  1H7W A;  3AEG B;  4DQO C;  1DOX A;  2INP E;  2PKO A;  4XE0 A;  3BVM A;  2KMM A;  1BUI C;  2INN E;  1FNW A;  4C7Y A;  2WDV B;  4M0W A;  4WH4 A;  1I4P A;  1ZXH A;  1P7F A;  1ESF A;  2WNM A;  4A90 A;  2BB6 A;  2WXL A;  1VLB A;  4HEA 1;  4EE2 A;  1YJJ A;  1GOZ A;  4HKZ E;  2QJL A;  3TEW A;  1XCT L;  4L2Y A;  1YNT E;  1GB4 A;  1F2R C;  1B9R A;  3GB1 A;  1FRD A;  3BZD B;  5HFY A;  5FR3 A;  1C78 A;  3LXF A;  3E56 A;  3NZ3 A;  3P42 A;  2IGG A;  2LHD A;  1PUT A;  1EM7 A;  2H89 B;  1KLU D;  2IGD A;  4N59 A;  2BYT A;  3IXS A;  2W55 A;  4HJG E;  1SXT A;  2J52 A;  2HTM E;  1D4B A;  3WCQ A;  2FE8 A;  2AQ3 B;  3TEY A;  2XNA C;  1QOB A;  1WXQ A;  1JML A;  1XLQ A;  1XLN A;  1HZ6 A;  2MJE A;  2W82 A;  3RPF C;  1TJE A;  4YSZ B;  3Q69 A;  1FCC C;  1KRH A;  2JYE A;  2XN9 C;  3EA6 A;  1E0Z A;  1GT8 A;  1C4C A;  2Y5P A;  3IAM 1;  4KGR A;  1CJE A;  3N9Y C;  4YT0 B;  1AYF A;  2LMC A;  4MT5 A;  5HHD G;  1R7S A;  3W2D A;  2SAK A;  2MEK A;  3I57 A;  2PW9 A;  1NI3 A;  2NMQ A;  1NYR A;  2JYT A;  2WXJ A;  5BYR A;  3NUH B;  1XEE A;  2RDH A;  3BII D;  1I4X A;  2JX5 A;  2DBY A;  3FIL B;  1SBB B;  2AX5 A;  4RF1 A;  1STE A;  2BS2 B;  2M19 A;  4UDU C;  2WU5 B;  1T3Q A;  4OW0 A;  3T3O A;  4YTN B;  1KF6 B;  4N58 A;  1YJI A;  5EE0 A;  3U2S C;  3SFE B;  1TKG A;  2QIE B;  2GRI A;  2SEB D;  1JWU D;  4CQN A;  3ZGZ A;  1AWD A;  1RM6 C;  2QEJ C;  4GDK B;  1I4R A;  1QIL A;  5BMG A;  1T5X D;  3AEF B;  1T6B X;  1LO5 D;  1Y56 A;  1WRI A;  3AED B;  2E3T A;  3H8H A;  3HUI A;  4P16 A;  1TY0 A;  1D5X C;  1C9F A;  4A9A A;  4JPS A;  4ZHP A;  3R2I A;  4KGS A;  3W5U B;  1JWM D;  4XWT A;  1HA5 A;  1SEB D;  2PTL A;  3KWL A;  2CJN A;  2G9H D;  3HRD D;  4GDL B;  1QQR A;  1NVI D;  1NEK B;  4XWW A;  1PFD A;  4AS1 A;  1CK1 A;  3CIR B;  4RGO S;  4R3D A;  3FAH A;  3NVZ A;  1MI0 A;  1WWT A;  4NAW B;  4KKI A;  4IDI A;  3B2F A;  2BS3 B;  2YEP F;  5AUK A;  1HXY D;  3MP9 A;  1JRP A;  3HVZ A;  1I7H A;  1QKZ A;  2GI9 A;  5JXV A;  1V97 A;  2CU3 A;  3AE8 B;  4TMA B;  2WXG A;  1DOI A;  5LNK 1;  1PDX A;  1AW7 A;  3EUB 2;  3KLS X;  1PGX A;  1JWA D;  2W54 A;  4LLG M;  1I4G A;  1ZXI A;  2WXH A;  3R8B A;  1DYQ A;  3V3X A;  1D6E C;  1XF5 L;  2RPV A;  1ET9 A;  1E7P B;  5HG2 A;  2DYM A;  3AE4 B;  3NVY A;  1SJE D;  2L1A A;  1D5Z C;  1V8C A;  4WQM A;  4TQ0 A;  1JRO A;  4IKG A;  5D3D A;  2WS3 B;  2NTS A;  3OWE B;  5G5H A;  1L5P A;  2PVO D;  3TUO A;  2KWD A;  3SR6 A;  1FNU A;  5G5G A;  1DGJ A;  1C77 A;  1YN4 A;  3ZJV A;  4RH6 A;  4RF0 A;  4GLS C;  2N7J A;  4H2A A;  1WSP A;  1FNV A;  1OQR A;  3P1M A;  2B76 B;  3P4R B;  1Q10 A;  3ZJT A;  1DOY A;  4C80 A;  2IPK D;  2WLB A;  3R2T A;  1SE3 A;  1E9M A;  1RFK A;  2DYO A;  1YN5 A;  1SF0 A;  3Q8A A;  4JE3 B;  3RFZ B;  1HZ5 A;  2K5P A;  2WXM A;  2DLB A;  5EE9 A;  2R61 A;  5EE3 A;  2N0S B;  1C4A A;  1YMH E;  2QSD A;  3PO0 A;  4MH8 A;  2NTT A;  4TQ1 A;  1ROE A;  2IGH A;  2I38 A;  1ZP0 B;  1H7X A;  1JW9 D;  1UUP A;  2LHE A;  3TSS A;  4HRO A;  4AQ7 A;  1V1P A;  2YEP B;  1K53 A;  2HDE A;  2L83 A;  1ENF A;  1JAL A;  1FM0 D;  2ZW0 A;  4C56 C;  4ZRP A;  2CJO A;  1P7E A;  1VJK A;  1QOG A;  4OVZ A;  1N62 A;  4JWS C;  1QT9 A;  5BMI A;  1VZ7 A;  1KTK A;  3ZYY X;  1L0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...