3ABVB

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 62
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3abvB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3abvB01
1QT9A 5H8YE 3NVYA 3AE8B 3AE4B 2QJLA 1NYRA 3AE1B 3VRBB 1E7PB 1VJKA 2QIEB 4WWMA 5EE3A 1XLOA 4ITKA 1RYJA 1FM0D 4C7YA 3VR9B 4JWSC 4LTUA 4YTPB 1QOGA 3AEBB 1J7CA 1OQRA 2E3TA 2W3SA 3VRAB 1OFFA 3B2GA 2DBYA 1GPXA 2CJOA 2K5PA 2KMMA 2M19A 4FXCA 2B76B 2PVOD 2AX5A 3CWIA 2WU5B 1CJEA 5EE0A 4YTMB 2WU2B 1PFDA 1SIJA 2KAJA 3BIID 1JROA 2BS2B 1NI3A 1QOFA 1VDVA 3SR6A 2BT6A 2JQRB 1NVID 3FC4A 1DOXA 3SFDB 2WDRB 1YQ4B 1N61A 3AM9A 1ZOYB 4ZHPA 1DOIA 1H7WA 1A70A 3HUIA 4USAA 3B9JA 1EWYC 1FO4A 1FXIA 1UWMA 2W3RA 4US8A 1E10A 1FFUA 1KF6B 3AE3B 3AMZA 3W5UB 1QF6A 1IUEA 5AUIA 3P4QB 3AEGB 1ZP0B 2FBWB 2K9XA 3AE6B 1TKYA 2L52A 3NVVA 1JWBD 1GTEA 3AE2B 4YTNB 3ETRA 1DOYA 4US9A 1FMAD 1N5WA 5AUKA 5GXGB 2WS3B 1WGKA 3HVZA 5EE1A 1FRDA 1TYGB 1QOBA 2PVGC 1NEKB 2WDQB 1N5XA 2EKIA 2BS3B 2WDVB 1XLQA 3W5VB 3PO0A 2H88B 1KRHA 2ACZB 1E9MA 2OHFA 4YT0B 3P4SB 3FAHA 2JX5A 3LXFA 1GTHA 1TKGA 2LEKA 1CZPA 1SF0A 4YSXB 1RFKA 1WYGA 2N0SB 2MJEA 1B9RA 4KX6B 1JQ4A 3AEAB 3NS1A 4YSZB 1AYFA 1VLBA 1TKEA 1KFYB 2PIAA 3AN1A 1N62A 4HROA 3CF4A 1AWDA 1N63A 5MPOA 3AEFB 2WQYB 1OQQA 1QOAA 1ZUD2 4WQMA 3AECB 1H7XA 1R7SA 1WWTA 3AV8A 1F0ZA 3EUB2 2WLBA 4C80A 3AE5B 2CJNA 1L6UA 4ZOHC 1YJIA 2Q5WD 3NVZA 5G5HA 2PKOA 3NVWA 4C7ZA 3P4RB 1J7AA 3AB5A 3P63A 4N59A 3B2FA 4JX1C 1J7BA 2DWQA 2G1EA 3VR8B 3ZYYX 1E0ZA 3KWLA 4P6VF 1E6EB 3HRDD 3CIRB 2BS4B 1V97A 2L83A 1WRIA 2K22A 2MJ3A 1N60A 1T3QA 1FFVA 3P4PB 2H89B 1L0VB 1FIQA 3WCQA 1WXQA 2W54A 5G5GA 1ZXIA 5H92C 3AEEB 1JALA 2W55A 1XLNA 1XLPA 3LB8C 2WP9B 1TJEA 1GAQB 1ROEA 1NENB 1JW9D 1PDXA 3AH7A 1SB3C 3AEDB 5C2TB 1JWAD 3DWMA 5C3JB 1RWSA 3ABVB 1QLBB 4YSYB 3AE9B 2HTME 3RPFC 2Y5CA 1L5PA 3AE7B 1FXAA 3SFEB 1I7HA 2M56B 2MH7A 3NRZA 4HRSA 5EE9A 3W9CB 1XO3A 1DGJA 2CU3A 1RM6C 1JRPA 1V8CA 1L6VA 3DWGC 3L4PA 4JWUC 4N6EB 4N58A 4A9AA 1YQ3B 1GT8A 1PUTA 4IDIA 1YJJA 2MJDA 3P1MA 4YXDB 4ZHOA 1FRRA 1NYQA
chains in the Genus database with same CATH superfamily
5D6JB 1L2NA 4KKIA 1UNSA 4OZBA 2IZVB 2RPVA 1WR6E 4HPMB 2DENB 5FKAC 4BBNC 3N1XC 3T3NA 4EE2A 4MM3B 2KJ6A 4YTMB 1SIJA 2BS2B 1QOFA 1SIFA 2MQJA 4RFBA 1C76A 2ZZPB 2LGSA 3SHQA 1SXTA 4WH4A 2KDEB 2WX0A 1V6EA 3Q14C 2V3PA 4XWTA 1JWBD 1DOYA 1J0GA 4J6IA 4HCPB 2NMQA 2XK5B 4W9LA 1N5XA 5HG2A 3H7PA 3URYA 2N7EA 1E7VA 2KN5A 3IAM1 3IG3A 3TEXA 3AEAB 4JPSA 2JWUA 4IW0A 1R4MB 1TT5B 4PS3A 2KDIA 2KZRA 3AEFB 1E8ZA 1F2RC 3KH0A 1F52A 4WQMA 1R7SA 1WGRA 3HM3A 2JRHA 3PRMB 1XD3B 1J7AA 3H1UA 4JQWC 1GB1A 1T3QA 3P4PB 1AN8A 3VUWA 3N3KB 2LGIA 3GS2A 2VRRB 3PS6A 1ACCA 2W54A 4F8CB 5H92C 1D4BA 3BK2A 2WXOA 1XLNA 3LB8C 4MT5A 2D10A 1YJ1A 5C2TB 3NZSA 1EF5A 4MGZE 4YSYB 4BAXA 5DPRA 2DYBA 2JY6A 4IDIA 2BQQA 3MP9A 1FRRA 3VTVA 2W82A 3AE4B 2LMCA 4NQLB 2L1AA 1M94A 4C7YA 1JWUD 1UBQA 3SD5A 2ZW1A 3CMMB 3VRAB 2V3NA 3HIZA 2KMMA 4N9F4 3VDZA 4EUTA 1GNUA 4KSLC 1VR9A 3D32A 5IO9A 3AM9A 3BK1A 5BMIA 3P42A 3RN9C 2WNMA 5IAAC 3QIJA 3O13A 3AU4A 3NS8A 3MHSD 5GXGB 1WGKA 5EE1A 1WGHA 2K8CA 1WZ3A 2FUG1 2WDVB 5DPWA 1XCQL 2ZPYA 2OHFA 3U52E 1YN5A 1ZGUB 2BGFA 2BYEA 3WANA 2MP2B 2O6VD 1TS3A 5MPOA 3VTUA 1I4HA 3QQ8B 3W1SA 4MM3A 2LJ5A 1ISNA 2V9HA 1H7XA 3ENEA 2LWPA 1JCKB 1L6UA 1YJIA 4HDOA 4P1CC 3MC0B 2MHJA 2DYOA 4OVUA 3AB5A 4M8MA 2L05A 3APFA 4P6VF 3KWLA 1GC7A 2PE9A 2BS4B 4WWOA 3DOWA 1WRIA 5C23A 2MJ3A 1IBXB 2WWZA 1P9DU 2DHZA 2KQ4X 2VH2A 1SE2A 3O65B 1J8CA 1XF5L 4GXBA 2KD0A 5D94A 5JXVA 2HTME 2CU1A 1QZEA 2AEHA 4ANVA 2MBBB 3DDCB 3NRZA 3QC8B 1ZDVA 1V8CA 1L6VA 3RFZB 4ZRPA 2C9WB 3ZVVA 5H8YE 1WXSA 3A33B 1ZW7A 5GMVA 3VRBB 3PTFC 3E9SA 3Q3MC 2MEKA 3RNGC 1V1PB 3APCA 2IGDA 2UWQA 1KH0A 1YQBA 2CJOA 2K5PA 2E6XA 4RM8A 3ZTDA 2RPQA 3PZ8A 1NI3A 1D5ZC 2WDRB 1GOZA 2N7DA 3N20C 2KXJA 4MDKE 1T6BX 3W5UB 4E71A 2J42A 3P4QB 2JZPA 2FBWB 1PYWD 2L52A 3TEWA 3R3MA 4UDUC 1SJHD 2WDTB 1UD7A 2KN4A 3MJ5A 2PE6B 3PRPB 3AXCA 3W5VB 2GBKA 4GLSC 5D3DA 1FNWA 3LXFA 1GTHA 2J4XA 2HJ1A 3PZDA 1EU4A 4YSXB 2C7HA 3UQBA 3MC8A 2BYVE 3AECB 2WLBA 2ZNVB 4ZOHC 3AULA 4KSKC 1N6ZA 4C7ZA 1TGZB 4M0WA 2G1EA 4DWFA 3HRDD 4GDKB 4P16A 2EMTA 1R4NI 1V97A 2K22A 1G6JA 4TKNA 1Q10A 3QA8A 4NAWB 2N9KA 1L4DB 5L83A 3N1YC 1ZKHA 2YEPF 2QILA 2BPSA 3RZWC 3TUOA 5DPSA 2CHXA 1JWAD 2WXJA 2L8JA 2W9NA 5C3JB 2C60A 1MG8A 3RPFC 1OTRB 2MH7A 1V5OA 4W9HA 4N58A 4HWIB 3BZDB 2FIDA 5DPTA 4LDTD 3Q3NC 5EE3A 3B1LX 3EECA 3VR9B 1BT0A 2ZJDA 3IAS1 2JSVX 2KTFA 4MJSA 1WXVA 1I4QA 1A5RA 4DHJD 3APDA 2LRUA 3V60A 4GGQA 3ZDTA 2LHEA 2WX1A 4ZRQA 1L4ZB 2OOBB 4AS1A 3Q8CA 2L76A 1FXIA 4LDTB 1V5TA 2G3QB 5E6JA 2NBUA 3P2BA 5FR6A 3NG0A 2INNE 3EA6A 3ETRA 4XC2A 2LVOA 4US9A 3RULA 4B0MA 3HVZA 5CHWA 1FD6A 2PVGC 2EKIA 1HQRD 2J53A 2WXPA 2GRIA 4GOCA 1UF0A 4M02A 2YLMA 2KO3A 1AYFA 4HKZE 4LNOA 1WI0A 4HROA 3PVLA 2DZKA 2QEJC 2RR9A 3GB1A 4EEWA 3EUB2 4WURA 3B08A 4IWQA 4RH6A 3UIOB 1VD2A 4G0NB 4LNKA 3B2FA 1K8RB 2QSDA 3MFGA 4KZCA 4NJ6A 5I4DA 1WJ4A 2IY0B 1TY0A 3L13A 4EZLA 1WXQA 1YX5B 4RGNA 1C79A 4HDQA 1GG3A 1P1AA 1TTNA 3ZXVA 2C7MB 2QCZA 3I57A 2IO2B 3M62B 3RNBC 1OEYA 4HJGE 3SFEB 1E8XA 3DQVA 3Q6BA 4G3XB 3TJPA 1NYQA 2LJIA 1MVKA 1WGGA 1WSPA 4ICUA 2KDMA 4S0RA 2MX2A 1LO5D 2PMVA 1I4XA 4GDKA 2E3TA 3CSFA 5E6NA 3WALA 1EF1A 4I6LB 4GB9A 4WQOB 1V80A 2JXTA 2WYQA 3ZDMC 3R8BA 1DOXA 5HFYA 4HLEA 1ZOYB 4ZHPA 3R7QA 3GE8C 2D3BA 3IVFA 5AEKB 4FBJB 2G4SA 2BYTA 3C0RB 3R66C 2WS3B 4D2KA 1EU3A 4R3DA 3OLMD 4JL9A 3UINB 1KRHA 3DBHI 1Q5WB 1WIAA 1PGBA 4MSMB 3PRZA 1N63A 2SAKA 1IYFA 2FUHB 3NVWA 3DBLB 3K9OB 1VCBA 4IWOA 3ZYYX 3VR8B 3H6NA 4RM9A 1WF9A 3CIRB 1F2RI 4WJPA 1CMXB 4NAMA 2CHZA 2AL6A 3PPAA 3DVGX 1L0VB 4XX5A 3ZW3A 5G2NA 2O6VA 3H8HA 2XK5A 1V1OA 1E5WA 1FPYA 1GAQB 1ROEA 1WZ0A 3IBEA 2KFKA 4WWPA 1HTOA 1I7HA 1FXTB 2ICIA 5HHDG 1YQ3B 4NAWA 1PUTA 2M17A 3TSSA 4ANUA 2RDHA 3DVGY 2QIEB 2N1VA 5CHVC 3DPDA 1RYJA 4LTUA 1YN4A 2RGFA 2N9EB 2KLCA 4XZ4A 3JVZX 5TSSA 3UGBB 2KAJA 4KIKA 3V6EB 1YNTE 1GC6A 2CHWA 2SEBD 1RAXA 3Q8FA 1ZDXA 2M0AA 1H7WA 2BVCA 2PJHA 2LASA 3H9DA 3B9JA 3Q8AA 1EUVB 1E10A 4BOZB 1WM3A 3KWVA 2K9XA 3Q8EA 3W2DA 4BKGA 4MJSB 4YTNB 1E8WA 2FCNA 4IUMB 3A9KB 4EZKA 3PT2B 1CZPA 4TSSA 3DCGA 2WXGA 2N7JA 2MJEA 1IBXA 1JQ4A 1KFYB 2MBQA 1N62A 2EELA 3U2SC 1SGHA 4LK0M 3JW0X 4F7ZA 1I4GA 2KWCA 5G55A 3WA0A 1M4VA 2FIFA 2Z59B 1UGJA 1T5XD 2YEPB 3TL5A 3KUZA 4X57B 2K8BA 3WCQA 1LFDA 3DHHC 1P0RA 5AZHA 1JALA 4LNIA 2J0MA 4WJNA 5BYRA 3TMPB 4IM3A 3GE3C 2GLSA 4GIVA 4P1BC 3KVFB 1B1ZA 4MACA 3NZUA 3VQIA 1XEEA 3TCAA 4W9KA 2KC2A 4A20A 1SEBD 1P98A 4CYEA 3J9CA 3N1ZC 5DCNA 2EKEC 4YTPB 4DXFA 3AEBB 4B6WA 3B2GA 4K3BA 2FCMA 3QWZB 4FXCA 4DQOC 2ZEQA 3LYYA 4MELA 4AUQC 1UWXA 2LVQA 3DBHB 2KMCA 5AUIA 1LXDA 3AEGB 3AE6B 3ZQ4A 4ANXA 2D07B 2RMMA 2INDC 3DBRB 1QOBA 1H8CA 4BKTA 4A8XC 2JXXA 1WR1A 3IT6B 3ZLZA 3ZIMA 3FILB 4IOIE 2V4IB 4C4VA 2PIAA 1MG4A 2J0KA 1WE6A 2IBIB 4HPLB 3V05A 1OQQA 1ZUD2 2PTLA 1CK1A 2KFJA 2WXLA 2L3ZA 1QKZA 1QILA 1Q0WB 3WAPA 4GSWA 1HZ6A 3OJ4B 4DBGA 1KLVA 5J17A 2NVUI 3AEEB 1P7FA 2JVCA 2M0XA 1T0RC 2WP9B 1C4CA 1PDXA 2PW9A 4JLCA 1RWSA 1VZ8A 4WWNA 4HKQA 2DAJA 2I1JA 1L5PA 3WAMA 5D3IB 3R2TA 1DGJA 1TIFA 2KHWB 4URKA 3V6CB 1C77A 4DXGA 4XYCA 3KQ4A 3NVYA 3Q8BA 1C4PA 3M63B 1NYRA 3WIMA 3JYUA 5CX3A 2WHIA 2X8XX 2L0FA 1DYQA 2DZJA 1H4RA 4PYUA 4DXAB 2WXHA 3BY4B 3VAWA 2AWTA 4B0EA 2GBMA 1D5XC 1GB4A 1YQ4B 4KZ0A 3B0AA 1LQBA 2WXFA 3ZXRA 1HA5A 4JGHB 2GBNA 3KW5B 3EFCA 1V1PA 2B3AA 1TKYA 2K6DB 3TBLD 2KJRA 1VRAB 5AUKA 5D7GA 2LGDA 5JZEB 2JPHA 2AL3A 2WDQB 2AQ2B 3OAWA 2L0TA 4RGOS 4YT0B 3DHIC 3FAHA 4K81A 2N0SB 2I38A 2GBJA 4MH0E 5FK9C 2LGXA 4O1NA 4IWPA 3VTWA 3M3JA 3RCZA 2CKHB 3A9KA 2WXNA 3E56A 2Z8LA 3CSTA 4OZCA 3RUIB 3PLVA 2H89B 1XCTL 3HHMA 3ZNGC 4K3CA 4AJWA 1WX7A 5G5GA 1HXYD 3V62A 4W9CA 3H7PB 4NNJB 3AEDB 4OVVA 3PREA 2Y5CA 3FILA 5EE9A 2V1YA 1T0SC 2KVRA 2K0PA 2BKFA 5AZGA 1K51A 4WIPA 3A4SC 3P1MA 3I63C 5JHAA 4L23A 3T3OA 1C3TA 4HK2A 3Q2AC 1QT9A 1GUAB 2IO1B 4DHJB 3MHZA 4MH8A 2LI5A 3SU8X 1XLOA 1FM0D 2HTHA 3TEYA 3ML9A 2W3SA 2JZZA 1IP9A 3HVDA 3UF8A 1CJEA 4FA6A 2WU2B 2V0GA 1XT9B 3FKYA 4OZAA 3TEZA 3V61A 2IDYA 5E6PA 1FO4A 4W9EA 2W3RA 4NQKE 3AMZA 2L00B 2LD9A 3PGEA 1HE8A 2BB5A 3KYCD 5CHFA 3VVWB 2KDFB 3VH4B 2ACZB 2JWZA 4DK5A 5D2MB 3R7RA 1KJTA 5L95C 2ON8A 3AN1A 5LXHA 3RT3B 2VZKB 2WXKA 4CO7A 4MGKE 2WXRA 3AE5B 1TY2A 1SE9A 1WY8A 1I4RA 2MBOA 3AI5A 2BF8B 1ENFA 4BKSD 3Q3JA 3X23A 4HPPA 4HXDA 2NTSA 2BWFA 4W9GA 3ZRCA 4DHZB 3ZJTA 1NENB 1IPGA 4II3B 3BVMA 2WGSA 1I4PA 3L0WB 4ICVA 3EC8A 3AE7B 3LDZE 1XO3A 1RM6C 4N6EB 5EDSA 4GU2A 2ZW0A 4K7WA 1WH3A 1T0QC 2QDFA 4WAFA 3K9PB 4OVZA 2WXQA 1TBEA 4BBNF 5JHBA 1ESFA 1MHXA 4EKUA 1BUIC 1D5MC 4MEMA 1E7UA 1IGDA 2DBYA 2MRPA 2M19A 3KYDD 4M8NA 2NR2A 2WU5B 4NPNA 1EO6A 3SR6A 1YOVB 1VDVA 1NVID 3SFDB 2A4ZA 2QHOA 1N61A 2N4FA 2G9HD 4K7UA 1WXAA 2ZNVC 1KLUD 2FNJB 3L16A 2I2YA 2MCNB 4US8A 4KDLB 1FFUA 2OJRA 1J19A 4GDLB 3VHTC 2FCQA 4IC7B 4CHKA 1QF6A 3BINA 2NCNA 4G11A 2JZ3B 2KLGA 3ZO5B 2G45B 3ZNHB 4PS7A 3U30A 2N1WA 3LJ3A 4P7IA 2INCC 1AWDA 2ZPNA 2KANA 4KIKB 2BW2A 1JWMD 4Q2JA 4FJZA 1UUPA 4NY0A 1K50A 2Z0DB 2KC1A 3BVGA 2GMIC 2JUOA 2UYZB 4RNAA 2AQ3B 2GOWA 4BOSC 1XLPA 3ZJUA 3ML8A 4MGYE 4LJOB 2QC8A 2RDGA 4L1BA 1JW9D 4LNNA 4RF0A 4DHZE 2JU6X 2MA9B 1SE4A 3ABVB 1QLBB 2IPKD 3AU5A 3ZNZB 1P3QU 2KX0A 1RFAA 4W9IA 4HRSA 3W9CB 3A9JA 3KUCB 3MC9A 1WE7A 1WJNA 3M95A 1HTQA 2MBHA 2NBVB 1GJZA 1NDDA 3ONSA 1E7PB 1VJKA 4WWMA 4KVGB 4RGMA 2NPTA 4IG7B 1J7CA 2KFKB 4TQ1A 1ET9A 2KQSA 4XGAB 4CQNA 2D3CA 1D6EC 1Y56A 2RDBC 2ONQA 2J52A 2O6VB 2MW5A 4IM2A 4AWJA 3NJTA 4FJYA 2IO0B 2Y5PA 4M0WB 3SDLC 4USAA 1LM8B 5IOIA 2JRIB 1IUEA 1TS2A 2TSSA 3NVVA 1HZ5A 1WMHA 3AE2B 4FHJA 4B9KA 2FE8A 2VH1A 1UH6A 1C4AA 3VXWA 2QMTA 3T9LA 4K1RB 2LZ6A 1E9MA 1ZPSA 4J3OD 1WM2A 2R61A 1MI0A 4JE3B 4ZRKA 1TKEA 1V2YA 3C19A 2M8SA 1QOAA 3ZUNA 2CR5A 2XBBC 3UI3A 2Q5WD 1WJUA 1T0YA 2OJWA 1L7YA 4HVBA 3BYYB 4ZYSA 4EOYA 3NY5A 4MGIE 1FIQA 1TZ1A 3KLSX 1CQVA 2HD5B 4E74A 3VUYA 3BVZA 2K6QA 3T8MA 3ZTCA 5BMGA 3AH7A 2RSUA 3L17A 2FCSA 5T8IA 2K25A 1WJ6A 1GT8A 1MHHE 4ZHOA 1VZ7A 4XDCA 3RZFA 5J2RA 2BB6A 3N32A 3VFKA 4BZAA 4ITKA 3H7SA 1QOGA 1WGDA 2G4DB 3RNEC 4NJCA 4OHJA 4WJOA 1F9JA 1PFDA 2BT6A 1FCLA 1XXGA 2X38A 2CS4A 1KOTA 4FLHA 3L08A 1YN3A 3RNCC 3ZKJC 2DX5B 2Y5BB 2LFIA 4E3CA 4TV3A 5BO4B 1WFYA 4HEA1 3DBRI 1L0YB 2XNAC 3ECIA 3NZ3A 2IJ0A 1RRBA 1OEYJ 1TYGB 2D3GA 2BS3B 2KTRA 2J7QB 2KWUB 1YIWA 4FADA 1KLGD 2C5LC 4ANWA 1SF0A 4GDLA 2D5GA 2ZCCA 4PS8A 4YSZB 1V9JA 1WWTA 2HE7A 2PKOA 2BBCA 5IKCM 5J18A 3DBLI 4ARCA 1E0ZA 2LVPA 2V3SA 3PSEB 3HM6X 3DHGC 3GOEA 1FFVA 3WAOA 1WYWB 3HK0A 4PK1A 2C7NB 1UZXB 2A5UA 3QHTA 1UGMA 4II2B 1SE3A 2DNFA 1LGRA 2O2VA 2PEAA 3DVNU 2ZCBA 2VZKD 1OGWA 2GI9A 4C4VB 4BKSA 1I35A 2LHDA 3SEBA 2K8HA 3QJZA 2EMSA 3QK0A 4NJ7A 1SSNA 3DVNV 4M01A 2XN9C 1JROA 1V49A 4I6PA 3FC4A 4GN1A 2NS5A 1SJED 1QQRA 2I1KA 2L7RA 4RMAA 3AE3B 4AOFA 1C78A 3KUDB 3UIPB 1EM7A 2DZMA 4LCDE 1FMAD 1I42A 5HI1A 3U4EG 3U7ZA 1STEA 3PO0A 3P4SB 1YX6B 2LEKA 4KGSA 1B9RA 4KX6B 2JT4B 2KK8A 4ZYNA 3CF4A 3VUXA 4B95A 2ZVNA 4W9FA 2CJNA 3NVZA 2Z0EB 2YVCA 1AARA 1J7BA 2KQ7A 2LUEA 4G50A 3IXSA 2OEDA 4FN2A 4C56C 2KT7A 4YWGG 4FJVB 2LGYA 4I6NB 1VZ6A 3NUHB 2NTTA 4PT5A 1TJEA 2KDBA 4EZJA 2IYDB 1U4AA 2CU3A 3OG5A 4W9DA 3GP7A 4A9AA 4REZA 5BYSA 1YJJA 2MJDA 1V81A 3ZRFA 4C00A 2DZIA 4ACFA 2KTRB 1SBBB 1ET6A 1MJDA 1OQRA 4TUUA 1FNUA 1OFFA 1TS5A 3GZNI 1WXMA 4HJKA 3CWIA 3CF6E 3OJ3A 4DDGD 3RNAC 3L54A 2KWVB 1JRUA 1S3SG 3ZJVA 1DOIA 3HUIA 2WXMA 4A55A 1UWMA 4LJPB 1KM7A 5KHOA 3A1QA 2FAZA 2BWES 3ZNID 2O2VB 3PHWB 5JH5C 4ARIA 1F1HA 1GTEA 5IN7A 2INPE 1C9FA 3EHVA 1N5WA 1FRDA 4M00A 3BYTB 1NEKB 3IHPC 1BXTA 4XWWA 2KMAA 1HEZE 3N30A 2RD0A 4A3OA 4PYZA 5FR3A 1TKGA 2KYWA 3NOBA 3S2AA 4A90A 2ASQA 1VLBA 1NBFC 3I3TB 3AV8A 1F0ZA 4JIOU 4C80A 5LXIB 1BMLC 1WX8A 4N59A 4KGTA 3IFWB 4JX1C 2DWQA 2IO3B 2UU7A 3RMKC 1E6EB 2K1FA 4KDIC 4KKJA 2KX3A 5BMHA 2L83A 1AW7A 3UQAA 3A4RA 3N9YC 1S1QB 1ZXIA 3R2IA 2BYFA 3JSVB 1SB3C 3Q69A 4OW0A 3AE9B 3NHEB 1FXAA 2HJ8A 4QAYA 4YXDB 2MLBA 4AQ7A 1KTKA 3V3XA 2QJLA 4A3PA 4WJQA 1Q1OA 3A1QB 1UELA 3PLUA 4DDID 4ZRIA 1WMHB 2PVOD 5EE0A 3U8ZA 2DAFA 3BIID 2XEWA 5BYQA 4KGRA 3RD2A 2K39A 4AP4C 1YMHE 2DLBA 1EWYC 2D3AA 2REXA 4IM0A 4RF1A 4KV2A 1KF6B 3U7DA 3TIXA 2IY1B 2KACA 3A9JB 2BKRB 5E6OA 2LUMA 2D2QA 4K7SA 1XQQA 2H88B 2JX5A 1WYGA 2D11A 1X1MA 2V4LA 4JWSC 4W9JA 4BFRA 4XDDA 1E8YA 3BWUD 3QAQA 2GB1A 5G5HA 3C8YA 2AYOB 2PPHA 3P4RB 3VH3B 1L0XB 2LXCA 4F1SA 1TS4A 2NPTB 1FCCC 1TZOA 2KVZA 4XE0A 3MTNB 2NBWB 4NZLB 5TR5A 2IGHA 3QCAA 1JMLA 2ZVOA 1Y8RC 4AJYB 3W1YA 4ASWC 1WRDB 3DWMA 1C1YB 1F77A 1D3ZA 5IP4D 2R2OA 3L4PA 2R2QA 3EFUA 2JYEA 1Z2MA 1YD8U 1MFWA 5AZFA 3AE8B 5LLIA 3AE1B 1RLFA 3JSVA 1WGYA 3QARA 2LXAA 3L10B 1ZXHA 2M4NA 2B76B 2LRWA 2AX5A 3I9V1 1PGAA 2KKCA 4BVUC 2JQRB 1UBIA 1P7EA 2L32A 1A70A 2N9PC 4H2AA 3ZGZA 4GMVA 4S17A 3Q3OC 2M1MA 4YL8A 1ZP0B 1R4MI 3OWEB 1ZE3D 2PLPA 3I5JC 3PHXB 1MPEA 5C1ZA 4MSQB 3EGRA 1PGXA 2Y3AA 1V86A 2MBEA 1FEHA 3ALBA 3MJWA 4A6QA 2BTEA 5IA7A 1XLQA 4TQ0A 2KNBA 2N9LA 5KHQA 2JYTA 5LNK1 1RFKA 2WXIA 3NS1A 1GPXA 4LNFA 2WQYB 4WAAA 3IT4B 4FULA 3X0WA 4RGTA 4LLGM 2IGGA 2K3UA 3P63A 4IKGA 2JF5A 3RYTA 3RNFC 4ZDVA 5HKHA 1JWSD 3QX1A 2KOXA 4RCOA 2AQ1B 1N60A 3RI7C 1EWCA 3W1SC 1PQSA 2DYMA 4FHKA 1OQYA 2GBRA 3PZ7A 2W55A 3DBSA 1WX9A 4EFOA 1FNVA 2J0JA 2MWSB 1NI2A 1Z5SB 3PV1A 1IGCA 1K53A 4ZRJA 2KJHB 2N9XA 1R4NB 2MP2A 2MSED 3Q3FA 2M56B 3DWGC 2HDEA 4HCNB 1JRPA 4JWUC 1E90A 2KWDA 4TMAB 3GZNB 4L2YA 1K52A 5CTRC
chains in the Genus database with same CATH topology
1QT9A 1WSPA 4KKIA 1UNSA 3MHZA 4MH8A 2KDMA 4OZBA 1XLOA 2RPVA 1FM0D 2PMVA 1LO5D 1I4XA 3TEYA 2E3TA 5FKAC 2W3SA 3T3NA 4EE2A 3HVDA 4MM3B 1CJEA 2JXTA 4YTMB 2WU2B 1SSNA 1SIJA 2V0GA 2XN9C 1JROA 2BS2B 1QOFA 3R8BA 1DOXA 3FC4A 4OZAA 3TEZA 5HFYA 4RFBA 4ZHPA 1ZOYB 2IDYA 1C76A 1SJED 1FO4A 2W3RA 1QQRA 3AE3B 1SXTA 3AMZA 4WH4A 1C78A 2V3PA 4XWTA 1EM7A 1JWBD 1DOYA 1FMAD 2BYTA 2WS3B 2BB5A 2NMQA 5HI1A 3U4EG 3U7ZA 1EU3A 4D2KA 4R3DA 1STEA 1N5XA 5HG2A 3URYA 3PO0A 1KRHA 2ACZB 3P4SB 2LEKA 1PGBA 3IAM1 4KGSA 3TEXA 1B9RA 4KX6B 2ON8A 3AEAB 4JPSA 2JWUA 3AN1A 3CF4A 1N63A 3AEFB 2VZKB 2WXKA 2SAKA 1F2RC 4WQMA 1R7SA 2WXRA 3AE5B 2CJNA 1TY2A 3NVZA 3NVWA 1I4RA 1J7AA 1J7BA 3ZYYX 3VR8B 1ENFA 3CIRB 3IXSA 1F2RI 2OEDA 4C56C 4NAMA 1GB1A 4YWGG 1T3QA 3P4PB 1L0VB 2NTSA 1AN8A 2LGIA 3GS2A 1VZ6A 1ACCA 2W54A 3H8HA 5H92C 1D4BA 3NUHB 3BK2A 2WXOA 1XLNA 3LB8C 1V1OA 2NTTA 3ZJTA 4PT5A 1TJEA 4MT5A 1GAQB 1ROEA 1NENB 5C2TB 3BVMA 4YSYB 1I4PA 3AE7B 1I7HA 2ICIA 1XO3A 2CU3A 1RM6C 4N6EB 5HHDG 2ZW0A 3GP7A 4A9AA 4REZA 1YQ3B 1PUTA 4IDIA 3TSSA 1YJJA 2MJDA 5BYSA 4WAFA 3MP9A 1FRRA 2RDHA 4OVZA 2WXQA 2W82A 3AE4B 2LMCA 2L1AA 1ESFA 2QIEB 1MHXA 1SBBB 1ET6A 1RYJA 4C7YA 1JWUD 1YN4A 4LTUA 1OQRA 2ZW1A 1BUIC 1D5MC 3VRAB 1FNUA 1OFFA 2V3NA 1IGDA 2DBYA 1TS5A 2KMMA 2M19A 3CWIA 2WU5B 5TSSA 2KAJA 3SR6A 1VDVA 1YNTE 1NVID 1VR9A 3SFDB 2SEBD 1N61A 1ZDXA 3BK1A 2M0AA 1DOIA 1H7WA 2G9HD 3AM9A 3Q8FA 5BMIA 3ZJVA 3HUIA 3P42A 1KLUD 2WXMA 3B9JA 3Q8AA 4A55A 2I2YA 1UWMA 4US8A 1E10A 1FFUA 4GDLB 1QF6A 3KWVA 2WNMA 2K9XA 4ARIA 3Q8EA 3W2DA 1GTEA 4YTNB 2INPE 3O13A 1C9FA 1N5WA 5GXGB 1WGKA 5EE1A 1FRDA 3BYTB 1NEKB 2FUG1 2WDVB 1BXTA 4XWWA 1XCQL 1HEZE 2OHFA 3U52E 1YN5A 5FR3A 1TKGA 1CZPA 4TSSA 2WXGA 2N7JA 2MJEA 4A90A 1IBXA 1JQ4A 1VLBA 1KFYB 1N62A 1TS3A 1AWDA 2EELA 3W1SA 1I4HA 5MPOA 3U2SC 1H7XA 3AV8A 1F0ZA 4C80A 4LK0M 1JCKB 1L6UA 1YJIA 2BW2A 1JWMD 3MC0B 1BMLC 1I4GA 2DYOA 3AB5A 4N59A 4KGTA 4Q2JA 4JX1C 2DWQA 3KWLA 4P6VF 1E6EB 1UUPA 1M4VA 1K50A 4KKJA 2BS4B 1UGJA 1T5XD 5BMHA 2L83A 1WRIA 2MJ3A 2YEPB 3BVGA 1IBXB 1AW7A 4RNAA 2AQ3B 3N9YC 3WCQA 2KQ4X 1ZXIA 1SE2A 3R2IA 1JALA 1XLPA 3ZJUA 1XF5L 5BYRA 4L1BA 2RDGA 1JW9D 5JXVA 1SB3C 4RF0A 3Q69A 2JU6X 1SE4A 3ABVB 1QLBB 2IPKD 4OW0A 3AE9B 2HTME 1B1ZA 4MACA 1FXAA 3VQIA 3NRZA 3W9CB 4HRSA 1XEEA 1ZDVA 1V8CA 1L6VA 3RFZB 4ZRPA 4YXDB 4AQ7A 5H8YE 1SEBD 1KTKA 3V3XA 3J9CA 2QJLA 3VRBB 1E7PB 1VJKA 4WWMA 3E9SA 4RGMA 4YTPB 2MEKA 4DXFA 3AEBB 1J7CA 4TQ1A 1V1PB 2IGDA 1ET9A 1KH0A 3B2GA 4CQNA 2CJOA 2K5PA 2E6XA 4FXCA 1D6EC 2PVOD 1Y56A 5EE0A 4DQOC 2ONQA 2J52A 3BIID 3PZ8A 1NI3A 3LYYA 1D5ZC 5BYQA 4KGRA 2WDRB 1GOZA 2Y5PA 1YMHE 2DLBA 4USAA 1EWYC 4RF1A 1UWXA 1KF6B 3W5UB 1T6BX 1IUEA 5AUIA 2J42A 3P4QB 2JZPA 3AEGB 1TS2A 2FBWB 1PYWD 2TSSA 3AE6B 2L52A 3ZQ4A 3TEWA 2KACA 3NVVA 1HZ5A 1SJHD 4UDUC 3AE2B 2FE8A 2RMMA 1C4AA 2KN4A 2LUMA 3MJ5A 1QOBA 2QMTA 4A8XC 3W5VB 2H88B 3IT6B 1E9MA 4GLSC 5D3DA 1FNWA 2JX5A 1GTHA 2J4XA 3LXFA 1EU4A 1ZPSA 4J3OD 4YSXB 1WYGA 3FILB 2R61A 1MI0A 4JE3B 4IOIE 2V4IB 4JWSC 1TKEA 2PIAA 3V05A 1OQQA 1QOAA 1ZUD2 4XDDA 3AECB 2PTLA 1CK1A 2WLBA 2WXLA 3BWUD 4ZOHC 2Q5WD 2GB1A 3UI3A 5G5HA 4C7ZA 3C8YA 3P4RB 1QKZA 1QILA 3BYYB 1L0XB 4M0WA 4ZYSA 1TS4A 2G1EA 1HZ6A 3HRDD 4GDKB 3T3OA 4P16A 1V97A 1FCCC 1TZOA 2K22A 1Q10A 4NAWB 2N9KA 1L4DB 4XE0A 1FIQA 3KLSX 4NZLB 1CQVA 2IGHA 3AEEB 1P7FA 3BVZA 1JMLA 2WP9B 2YEPF 5BMGA 1C4CA 1PDXA 2PW9A 2QILA 3AH7A 3TUOA 1JWAD 2WXJA 3DWMA 5C3JB 1RWSA 1VZ8A 4HKQA 3RPFC 1F77A 1L5PA 2MH7A 5D3IB 5T8IA 3R2TA 1DGJA 3L4PA 4N58A 1GT8A 1MHHE 2JYEA 4ZHOA 1VZ7A 4XDCA 2BB6A 1C77A 3BZDB 4DXGA 3KQ4A 3NVYA 3AE8B 3Q8BA 1C4PA 1NYRA 3AE1B 5EE3A 4ITKA 3VR9B 1QOGA 3IAS1 2JSVX 1DYQA 2LJIA 1ZXHA 4NJCA 4OHJA 1I4QA 2WXHA 4B0EA 2B76B 2AX5A 3I9V1 1PFDA 1PGAA 1D5XC 2BT6A 2JQRB 1FCLA 1XXGA 1GB4A 2X38A 2LHEA 1YQ4B 1P7EA 2L32A 4ZRQA 1A70A 1L4ZB 4AS1A 3Q8CA 1YN3A 1FXIA 2WXFA 4H2AA 3ZGZA 1HA5A 5E6JA 2LFIA 1ZP0B 1V1PA 1TKYA 3OWEB 2INNE 1ZE3D 2PLPA 3EA6A 3ETRA 1L0YB 1MPEA 4HEA1 4US9A 1VRAB 2XNAC 3EGRA 1PGXA 2Y3AA 2IJ0A 3NZ3A 5D7GA 3HVZA 5AUKA 4B0MA 1TYGB 1FD6A 2PVGC 1FEHA 2BTEA 4A6QA 2WDQB 2EKIA 1HQRD 2J53A 2BS3B 2WXPA 1XLQA 2AQ2B 2GRIA 4RGOS 4TQ0A 2N9LA 4YT0B 3FAHA 1KLGD 2JYTA 5LNK1 1SF0A 1RFKA 2N0SB 2D5GA 2I38A 2WXIA 3NS1A 4YSZB 1AYFA 4HKZE 5FK9C 1GPXA 4HROA 2QEJC 2WQYB 3GB1A 3IT4B 4RGTA 1WWTA 4O1NA 3EUB2 4WURA 4RH6A 4LLGM 2IGGA 2PKOA 2K3UA 3P63A 4IKGA 2BBCA 3B2FA 4ARCA 2WXNA 3E56A 2QSDA 1E0ZA 2Z8LA 1JWSD 4OZCA 3MFGA 4RCOA 2AQ1B 5I4DA 1N60A 1EWCA 1FFVA 1TY0A 2H89B 1XCTL 2DYMA 1WXQA 5G5GA 1HXYD 4RGNA 3PZ7A 2W55A 1C79A 1FNVA 1IGCA 1K53A 3AEDB 3I57A 1SE3A 2Y5CA 3FILA 5EE9A 3SFEB 2VZKD 2M56B 4HJGE 2GI9A 2K0PA 3DWGC 2HDEA 1JRPA 4JWUC 1K51A 2KWDA 4WIPA 4TMAB 3P1MA 2LHDA 4L2YA 3SEBA 4L23A 1K52A 1NYQA 1MVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QT9 A;  5H8Y E;  3NVY A;  3AE8 B;  3AE4 B;  2QJL A;  1NYR A;  3AE1 B;  3VRB B;  1E7P B;  1VJK A;  2QIE B;  4WWM A;  5EE3 A;  1XLO A;  4ITK A;  1RYJ A;  1FM0 D;  4C7Y A;  3VR9 B;  4JWS C;  4LTU A;  4YTP B;  1QOG A;  3AEB B;  1J7C A;  1OQR A;  2E3T A;  2W3S A;  3VRA B;  1OFF A;  3B2G A;  2DBY A;  1GPX A;  2CJO A;  2K5P A;  2KMM A;  2M19 A;  4FXC A;  2B76 B;  2PVO D;  2AX5 A;  3CWI A;  2WU5 B;  1CJE A;  5EE0 A;  4YTM B;  2WU2 B;  1PFD A;  1SIJ A;  2KAJ A;  3BII D;  1JRO A;  2BS2 B;  1NI3 A;  1QOF A;  1VDV A;  3SR6 A;  2BT6 A;  2JQR B;  1NVI D;  3FC4 A;  1DOX A;  3SFD B;  2WDR B;  1YQ4 B;  1N61 A;  3AM9 A;  1ZOY B;  4ZHP A;  1DOI A;  1H7W A;  1A70 A;  3HUI A;  4USA A;  3B9J A;  1EWY C;  1FO4 A;  1FXI A;  1UWM A;  2W3R A;  4US8 A;  1E10 A;  1FFU A;  1KF6 B;  3AE3 B;  3AMZ A;  3W5U B;  1QF6 A;  1IUE A;  5AUI A;  3P4Q B;  3AEG B;  1ZP0 B;  2FBW B;  2K9X A;  3AE6 B;  1TKY A;  2L52 A;  3NVV A;  1JWB D;  1GTE A;  3AE2 B;  4YTN B;  3ETR A;  1DOY A;  4US9 A;  1FMA D;  1N5W A;  5AUK A;  5GXG B;  2WS3 B;  1WGK A;  3HVZ A;  5EE1 A;  1FRD A;  1TYG B;  1QOB A;  2PVG C;  1NEK B;  2WDQ B;  1N5X A;  2EKI A;  2BS3 B;  2WDV B;  1XLQ A;  3W5V B;  3PO0 A;  2H88 B;  1KRH A;  2ACZ B;  1E9M A;  2OHF A;  4YT0 B;  3P4S B;  3FAH A;  2JX5 A;  3LXF A;  1GTH A;  1TKG A;  2LEK A;  1CZP A;  1SF0 A;  4YSX B;  1RFK A;  1WYG A;  2N0S B;  2MJE A;  1B9R A;  4KX6 B;  1JQ4 A;  3AEA B;  3NS1 A;  4YSZ B;  1AYF A;  1VLB A;  1TKE A;  1KFY B;  2PIA A;  3AN1 A;  1N62 A;  4HRO A;  3CF4 A;  1AWD A;  1N63 A;  5MPO A;  3AEF B;  2WQY B;  1OQQ A;  1QOA A;  1ZUD 2;  4WQM A;  3AEC B;  1H7X A;  1R7S A;  1WWT A;  3AV8 A;  1F0Z A;  3EUB 2;  2WLB A;  4C80 A;  3AE5 B;  2CJN A;  1L6U A;  4ZOH C;  1YJI A;  2Q5W D;  3NVZ A;  5G5H A;  2PKO A;  3NVW A;  4C7Z A;  3P4R B;  1J7A A;  3AB5 A;  3P63 A;  4N59 A;  3B2F A;  4JX1 C;  1J7B A;  2DWQ A;  2G1E A;  3VR8 B;  3ZYY X;  1E0Z A;  3KWL A;  4P6V F;  1E6E B;  3HRD D;  3CIR B;  2BS4 B;  1V97 A;  2L83 A;  1WRI A;  2K22 A;  2MJ3 A;  1N60 A;  1T3Q A;  1FFV A;  3P4P B;  2H89 B;  1L0V B;  1FIQ A;  3WCQ A;  1WXQ A;  2W54 A;  5G5G A;  1ZXI A;  5H92 C;  3AEE B;  1JAL A;  2W55 A;  1XLN A;  1XLP A;  3LB8 C;  2WP9 B;  1TJE A;  1GAQ B;  1ROE A;  1NEN B;  1JW9 D;  1PDX A;  3AH7 A;  1SB3 C;  3AED B;  5C2T B;  1JWA D;  3DWM A;  5C3J B;  1RWS A;  3ABV B;  1QLB B;  4YSY B;  3AE9 B;  2HTM E;  3RPF C;  2Y5C A;  1L5P A;  3AE7 B;  1FXA A;  3SFE B;  1I7H A;  2M56 B;  2MH7 A;  3NRZ A;  4HRS A;  5EE9 A;  3W9C B;  1XO3 A;  1DGJ A;  2CU3 A;  1RM6 C;  1JRP A;  1V8C A;  1L6V A;  3DWG C;  3L4P A;  4JWU C;  4N6E B;  4N58 A;  4A9A A;  1YQ3 B;  1GT8 A;  1PUT A;  4IDI A;  1YJJ A;  2MJD A;  3P1M A;  4YXD B;  4ZHO A;  1FRR A;  1NYQ A; 
#chains in the Genus database with same CATH topology
 5D6J B;  1L2N A;  4KKI A;  1UNS A;  4OZB A;  2IZV B;  2RPV A;  1WR6 E;  4HPM B;  2DEN B;  5FKA C;  4BBN C;  3N1X C;  3T3N A;  4EE2 A;  4MM3 B;  2KJ6 A;  4YTM B;  1SIJ A;  2BS2 B;  1QOF A;  1SIF A;  2MQJ A;  4RFB A;  1C76 A;  2ZZP B;  2LGS A;  3SHQ A;  1SXT A;  4WH4 A;  2KDE B;  2WX0 A;  1V6E A;  3Q14 C;  2V3P A;  4XWT A;  1JWB D;  1DOY A;  1J0G A;  4J6I A;  4HCP B;  2NMQ A;  2XK5 B;  4W9L A;  1N5X A;  5HG2 A;  3H7P A;  3URY A;  2N7E A;  1E7V A;  2KN5 A;  3IAM 1;  3IG3 A;  3TEX A;  3AEA B;  4JPS A;  2JWU A;  4IW0 A;  1R4M B;  1TT5 B;  4PS3 A;  2KDI A;  2KZR A;  3AEF B;  1E8Z A;  1F2R C;  3KH0 A;  1F52 A;  4WQM A;  1R7S A;  1WGR A;  3HM3 A;  2JRH A;  3PRM B;  1XD3 B;  1J7A A;  3H1U A;  4JQW C;  1GB1 A;  1T3Q A;  3P4P B;  1AN8 A;  3VUW A;  3N3K B;  2LGI A;  3GS2 A;  2VRR B;  3PS6 A;  1ACC A;  2W54 A;  4F8C B;  5H92 C;  1D4B A;  3BK2 A;  2WXO A;  1XLN A;  3LB8 C;  4MT5 A;  2D10 A;  1YJ1 A;  5C2T B;  3NZS A;  1EF5 A;  4MGZ E;  4YSY B;  4BAX A;  5DPR A;  2DYB A;  2JY6 A;  4IDI A;  2BQQ A;  3MP9 A;  1FRR A;  3VTV A;  2W82 A;  3AE4 B;  2LMC A;  4NQL B;  2L1A A;  1M94 A;  4C7Y A;  1JWU D;  1UBQ A;  3SD5 A;  2ZW1 A;  3CMM B;  3VRA B;  2V3N A;  3HIZ A;  2KMM A;  4N9F 4;  3VDZ A;  4EUT A;  1GNU A;  4KSL C;  1VR9 A;  3D32 A;  5IO9 A;  3AM9 A;  3BK1 A;  5BMI A;  3P42 A;  3RN9 C;  2WNM A;  5IAA C;  3QIJ A;  3O13 A;  3AU4 A;  3NS8 A;  3MHS D;  5GXG B;  1WGK A;  5EE1 A;  1WGH A;  2K8C A;  1WZ3 A;  2FUG 1;  2WDV B;  5DPW A;  1XCQ L;  2ZPY A;  2OHF A;  3U52 E;  1YN5 A;  1ZGU B;  2BGF A;  2BYE A;  3WAN A;  2MP2 B;  2O6V D;  1TS3 A;  5MPO A;  3VTU A;  1I4H A;  3QQ8 B;  3W1S A;  4MM3 A;  2LJ5 A;  1ISN A;  2V9H A;  1H7X A;  3ENE A;  2LWP A;  1JCK B;  1L6U A;  1YJI A;  4HDO A;  4P1C C;  3MC0 B;  2MHJ A;  2DYO A;  4OVU A;  3AB5 A;  4M8M A;  2L05 A;  3APF A;  4P6V F;  3KWL A;  1GC7 A;  2PE9 A;  2BS4 B;  4WWO A;  3DOW A;  1WRI A;  5C23 A;  2MJ3 A;  1IBX B;  2WWZ A;  1P9D U;  2DHZ A;  2KQ4 X;  2VH2 A;  1SE2 A;  3O65 B;  1J8C A;  1XF5 L;  4GXB A;  2KD0 A;  5D94 A;  5JXV A;  2HTM E;  2CU1 A;  1QZE A;  2AEH A;  4ANV A;  2MBB B;  3DDC B;  3NRZ A;  3QC8 B;  1ZDV A;  1V8C A;  1L6V A;  3RFZ B;  4ZRP A;  2C9W B;  3ZVV A;  5H8Y E;  1WXS A;  3A33 B;  1ZW7 A;  5GMV A;  3VRB B;  3PTF C;  3E9S A;  3Q3M C;  2MEK A;  3RNG C;  1V1P B;  3APC A;  2IGD A;  2UWQ A;  1KH0 A;  1YQB A;  2CJO A;  2K5P A;  2E6X A;  4RM8 A;  3ZTD A;  2RPQ A;  3PZ8 A;  1NI3 A;  1D5Z C;  2WDR B;  1GOZ A;  2N7D A;  3N20 C;  2KXJ A;  4MDK E;  1T6B X;  3W5U B;  4E71 A;  2J42 A;  3P4Q B;  2JZP A;  2FBW B;  1PYW D;  2L52 A;  3TEW A;  3R3M A;  4UDU C;  1SJH D;  2WDT B;  1UD7 A;  2KN4 A;  3MJ5 A;  2PE6 B;  3PRP B;  3AXC A;  3W5V B;  2GBK A;  4GLS C;  5D3D A;  1FNW A;  3LXF A;  1GTH A;  2J4X A;  2HJ1 A;  3PZD A;  1EU4 A;  4YSX B;  2C7H A;  3UQB A;  3MC8 A;  2BYV E;  3AEC B;  2WLB A;  2ZNV B;  4ZOH C;  3AUL A;  4KSK C;  1N6Z A;  4C7Z A;  1TGZ B;  4M0W A;  2G1E A;  4DWF A;  3HRD D;  4GDK B;  4P16 A;  2EMT A;  1R4N I;  1V97 A;  2K22 A;  1G6J A;  4TKN A;  1Q10 A;  3QA8 A;  4NAW B;  2N9K A;  1L4D B;  5L83 A;  3N1Y C;  1ZKH A;  2YEP F;  2QIL A;  2BPS A;  3RZW C;  3TUO A;  5DPS A;  2CHX A;  1JWA D;  2WXJ A;  2L8J A;  2W9N A;  5C3J B;  2C60 A;  1MG8 A;  3RPF C;  1OTR B;  2MH7 A;  1V5O A;  4W9H A;  4N58 A;  4HWI B;  3BZD B;  2FID A;  5DPT A;  4LDT D;  3Q3N C;  5EE3 A;  3B1L X;  3EEC A;  3VR9 B;  1BT0 A;  2ZJD A;  3IAS 1;  2JSV X;  2KTF A;  4MJS A;  1WXV A;  1I4Q A;  1A5R A;  4DHJ D;  3APD A;  2LRU A;  3V60 A;  4GGQ A;  3ZDT A;  2LHE A;  2WX1 A;  4ZRQ A;  1L4Z B;  2OOB B;  4AS1 A;  3Q8C A;  2L76 A;  1FXI A;  4LDT B;  1V5T A;  2G3Q B;  5E6J A;  2NBU A;  3P2B A;  5FR6 A;  3NG0 A;  2INN E;  3EA6 A;  3ETR A;  4XC2 A;  2LVO A;  4US9 A;  3RUL A;  4B0M A;  3HVZ A;  5CHW A;  1FD6 A;  2PVG C;  2EKI A;  1HQR D;  2J53 A;  2WXP A;  2GRI A;  4GOC A;  1UF0 A;  4M02 A;  2YLM A;  2KO3 A;  1AYF A;  4HKZ E;  4LNO A;  1WI0 A;  4HRO A;  3PVL A;  2DZK A;  2QEJ C;  2RR9 A;  3GB1 A;  4EEW A;  3EUB 2;  4WUR A;  3B08 A;  4IWQ A;  4RH6 A;  3UIO B;  1VD2 A;  4G0N B;  4LNK A;  3B2F A;  1K8R B;  2QSD A;  3MFG A;  4KZC A;  4NJ6 A;  5I4D A;  1WJ4 A;  2IY0 B;  1TY0 A;  3L13 A;  4EZL A;  1WXQ A;  1YX5 B;  4RGN A;  1C79 A;  4HDQ A;  1GG3 A;  1P1A A;  1TTN A;  3ZXV A;  2C7M B;  2QCZ A;  3I57 A;  2IO2 B;  3M62 B;  3RNB C;  1OEY A;  4HJG E;  3SFE B;  1E8X A;  3DQV A;  3Q6B A;  4G3X B;  3TJP A;  1NYQ A;  2LJI A;  1MVK A;  1WGG A;  1WSP A;  4ICU A;  2KDM A;  4S0R A;  2MX2 A;  1LO5 D;  2PMV A;  1I4X A;  4GDK A;  2E3T A;  3CSF A;  5E6N A;  3WAL A;  1EF1 A;  4I6L B;  4GB9 A;  4WQO B;  1V80 A;  2JXT A;  2WYQ A;  3ZDM C;  3R8B A;  1DOX A;  5HFY A;  4HLE A;  1ZOY B;  4ZHP A;  3R7Q A;  3GE8 C;  2D3B A;  3IVF A;  5AEK B;  4FBJ B;  2G4S A;  2BYT A;  3C0R B;  3R66 C;  2WS3 B;  4D2K A;  1EU3 A;  4R3D A;  3OLM D;  4JL9 A;  3UIN B;  1KRH A;  3DBH I;  1Q5W B;  1WIA A;  1PGB A;  4MSM B;  3PRZ A;  1N63 A;  2SAK A;  1IYF A;  2FUH B;  3NVW A;  3DBL B;  3K9O B;  1VCB A;  4IWO A;  3ZYY X;  3VR8 B;  3H6N A;  4RM9 A;  1WF9 A;  3CIR B;  1F2R I;  4WJP A;  1CMX B;  4NAM A;  2CHZ A;  2AL6 A;  3PPA A;  3DVG X;  1L0V B;  4XX5 A;  3ZW3 A;  5G2N A;  2O6V A;  3H8H A;  2XK5 A;  1V1O A;  1E5W A;  1FPY A;  1GAQ B;  1ROE A;  1WZ0 A;  3IBE A;  2KFK A;  4WWP A;  1HTO A;  1I7H A;  1FXT B;  2ICI A;  5HHD G;  1YQ3 B;  4NAW A;  1PUT A;  2M17 A;  3TSS A;  4ANU A;  2RDH A;  3DVG Y;  2QIE B;  2N1V A;  5CHV C;  3DPD A;  1RYJ A;  4LTU A;  1YN4 A;  2RGF A;  2N9E B;  2KLC A;  4XZ4 A;  3JVZ X;  5TSS A;  3UGB B;  2KAJ A;  4KIK A;  3V6E B;  1YNT E;  1GC6 A;  2CHW A;  2SEB D;  1RAX A;  3Q8F A;  1ZDX A;  2M0A A;  1H7W A;  2BVC A;  2PJH A;  2LAS A;  3H9D A;  3B9J A;  3Q8A A;  1EUV B;  1E10 A;  4BOZ B;  1WM3 A;  3KWV A;  2K9X A;  3Q8E A;  3W2D A;  4BKG A;  4MJS B;  4YTN B;  1E8W A;  2FCN A;  4IUM B;  3A9K B;  4EZK A;  3PT2 B;  1CZP A;  4TSS A;  3DCG A;  2WXG A;  2N7J A;  2MJE A;  1IBX A;  1JQ4 A;  1KFY B;  2MBQ A;  1N62 A;  2EEL A;  3U2S C;  1SGH A;  4LK0 M;  3JW0 X;  4F7Z A;  1I4G A;  2KWC A;  5G55 A;  3WA0 A;  1M4V A;  2FIF A;  2Z59 B;  1UGJ A;  1T5X D;  2YEP B;  3TL5 A;  3KUZ A;  4X57 B;  2K8B A;  3WCQ A;  1LFD A;  3DHH C;  1P0R A;  5AZH A;  1JAL A;  4LNI A;  2J0M A;  4WJN A;  5BYR A;  3TMP B;  4IM3 A;  3GE3 C;  2GLS A;  4GIV A;  4P1B C;  3KVF B;  1B1Z A;  4MAC A;  3NZU A;  3VQI A;  1XEE A;  3TCA A;  4W9K A;  2KC2 A;  4A20 A;  1SEB D;  1P98 A;  4CYE A;  3J9C A;  3N1Z C;  5DCN A;  2EKE C;  4YTP B;  4DXF A;  3AEB B;  4B6W A;  3B2G A;  4K3B A;  2FCM A;  3QWZ B;  4FXC A;  4DQO C;  2ZEQ A;  3LYY A;  4MEL A;  4AUQ C;  1UWX A;  2LVQ A;  3DBH B;  2KMC A;  5AUI A;  1LXD A;  3AEG B;  3AE6 B;  3ZQ4 A;  4ANX A;  2D07 B;  2RMM A;  2IND C;  3DBR B;  1QOB A;  1H8C A;  4BKT A;  4A8X C;  2JXX A;  1WR1 A;  3IT6 B;  3ZLZ A;  3ZIM A;  3FIL B;  4IOI E;  2V4I B;  4C4V A;  2PIA A;  1MG4 A;  2J0K A;  1WE6 A;  2IBI B;  4HPL B;  3V05 A;  1OQQ A;  1ZUD 2;  2PTL A;  1CK1 A;  2KFJ A;  2WXL A;  2L3Z A;  1QKZ A;  1QIL A;  1Q0W B;  3WAP A;  4GSW A;  1HZ6 A;  3OJ4 B;  4DBG A;  1KLV A;  5J17 A;  2NVU I;  3AEE B;  1P7F A;  2JVC A;  2M0X A;  1T0R C;  2WP9 B;  1C4C A;  1PDX A;  2PW9 A;  4JLC A;  1RWS A;  1VZ8 A;  4WWN A;  4HKQ A;  2DAJ A;  2I1J A;  1L5P A;  3WAM A;  5D3I B;  3R2T A;  1DGJ A;  1TIF A;  2KHW B;  4URK A;  3V6C B;  1C77 A;  4DXG A;  4XYC A;  3KQ4 A;  3NVY A;  3Q8B A;  1C4P A;  3M63 B;  1NYR A;  3WIM A;  3JYU A;  5CX3 A;  2WHI A;  2X8X X;  2L0F A;  1DYQ A;  2DZJ A;  1H4R A;  4PYU A;  4DXA B;  2WXH A;  3BY4 B;  3VAW A;  2AWT A;  4B0E A;  2GBM A;  1D5X C;  1GB4 A;  1YQ4 B;  4KZ0 A;  3B0A A;  1LQB A;  2WXF A;  3ZXR A;  1HA5 A;  4JGH B;  2GBN A;  3KW5 B;  3EFC A;  1V1P A;  2B3A A;  1TKY A;  2K6D B;  3TBL D;  2KJR A;  1VRA B;  5AUK A;  5D7G A;  2LGD A;  5JZE B;  2JPH A;  2AL3 A;  2WDQ B;  2AQ2 B;  3OAW A;  2L0T A;  4RGO S;  4YT0 B;  3DHI C;  3FAH A;  4K81 A;  2N0S B;  2I38 A;  2GBJ A;  4MH0 E;  5FK9 C;  2LGX A;  4O1N A;  4IWP A;  3VTW A;  3M3J A;  3RCZ A;  2CKH B;  3A9K A;  2WXN A;  3E56 A;  2Z8L A;  3CST A;  4OZC A;  3RUI B;  3PLV A;  2H89 B;  1XCT L;  3HHM A;  3ZNG C;  4K3C A;  4AJW A;  1WX7 A;  5G5G A;  1HXY D;  3V62 A;  4W9C A;  3H7P B;  4NNJ B;  3AED B;  4OVV A;  3PRE A;  2Y5C A;  3FIL A;  5EE9 A;  2V1Y A;  1T0S C;  2KVR A;  2K0P A;  2BKF A;  5AZG A;  1K51 A;  4WIP A;  3A4S C;  3P1M A;  3I63 C;  5JHA A;  4L23 A;  3T3O A;  1C3T A;  4HK2 A;  3Q2A C;  1QT9 A;  1GUA B;  2IO1 B;  4DHJ B;  3MHZ A;  4MH8 A;  2LI5 A;  3SU8 X;  1XLO A;  1FM0 D;  2HTH A;  3TEY A;  3ML9 A;  2W3S A;  2JZZ A;  1IP9 A;  3HVD A;  3UF8 A;  1CJE A;  4FA6 A;  2WU2 B;  2V0G A;  1XT9 B;  3FKY A;  4OZA A;  3TEZ A;  3V61 A;  2IDY A;  5E6P A;  1FO4 A;  4W9E A;  2W3R A;  4NQK E;  3AMZ A;  2L00 B;  2LD9 A;  3PGE A;  1HE8 A;  2BB5 A;  3KYC D;  5CHF A;  3VVW B;  2KDF B;  3VH4 B;  2ACZ B;  2JWZ A;  4DK5 A;  5D2M B;  3R7R A;  1KJT A;  5L95 C;  2ON8 A;  3AN1 A;  5LXH A;  3RT3 B;  2VZK B;  2WXK A;  4CO7 A;  4MGK E;  2WXR A;  3AE5 B;  1TY2 A;  1SE9 A;  1WY8 A;  1I4R A;  2MBO A;  3AI5 A;  2BF8 B;  1ENF A;  4BKS D;  3Q3J A;  3X23 A;  4HPP A;  4HXD A;  2NTS A;  2BWF A;  4W9G A;  3ZRC A;  4DHZ B;  3ZJT A;  1NEN B;  1IPG A;  4II3 B;  3BVM A;  2WGS A;  1I4P A;  3L0W B;  4ICV A;  3EC8 A;  3AE7 B;  3LDZ E;  1XO3 A;  1RM6 C;  4N6E B;  5EDS A;  4GU2 A;  2ZW0 A;  4K7W A;  1WH3 A;  1T0Q C;  2QDF A;  4WAF A;  3K9P B;  4OVZ A;  2WXQ A;  1TBE A;  4BBN F;  5JHB A;  1ESF A;  1MHX A;  4EKU A;  1BUI C;  1D5M C;  4MEM A;  1E7U A;  1IGD A;  2DBY A;  2MRP A;  2M19 A;  3KYD D;  4M8N A;  2NR2 A;  2WU5 B;  4NPN A;  1EO6 A;  3SR6 A;  1YOV B;  1VDV A;  1NVI D;  3SFD B;  2A4Z A;  2QHO A;  1N61 A;  2N4F A;  2G9H D;  4K7U A;  1WXA A;  2ZNV C;  1KLU D;  2FNJ B;  3L16 A;  2I2Y A;  2MCN B;  4US8 A;  4KDL B;  1FFU A;  2OJR A;  1J19 A;  4GDL B;  3VHT C;  2FCQ A;  4IC7 B;  4CHK A;  1QF6 A;  3BIN A;  2NCN A;  4G11 A;  2JZ3 B;  2KLG A;  3ZO5 B;  2G45 B;  3ZNH B;  4PS7 A;  3U30 A;  2N1W A;  3LJ3 A;  4P7I A;  2INC C;  1AWD A;  2ZPN A;  2KAN A;  4KIK B;  2BW2 A;  1JWM D;  4Q2J A;  4FJZ A;  1UUP A;  4NY0 A;  1K50 A;  2Z0D B;  2KC1 A;  3BVG A;  2GMI C;  2JUO A;  2UYZ B;  4RNA A;  2AQ3 B;  2GOW A;  4BOS C;  1XLP A;  3ZJU A;  3ML8 A;  4MGY E;  4LJO B;  2QC8 A;  2RDG A;  4L1B A;  1JW9 D;  4LNN A;  4RF0 A;  4DHZ E;  2JU6 X;  2MA9 B;  1SE4 A;  3ABV B;  1QLB B;  2IPK D;  3AU5 A;  3ZNZ B;  1P3Q U;  2KX0 A;  1RFA A;  4W9I A;  4HRS A;  3W9C B;  3A9J A;  3KUC B;  3MC9 A;  1WE7 A;  1WJN A;  3M95 A;  1HTQ A;  2MBH A;  2NBV B;  1GJZ A;  1NDD A;  3ONS A;  1E7P B;  1VJK A;  4WWM A;  4KVG B;  4RGM A;  2NPT A;  4IG7 B;  1J7C A;  2KFK B;  4TQ1 A;  1ET9 A;  2KQS A;  4XGA B;  4CQN A;  2D3C A;  1D6E C;  1Y56 A;  2RDB C;  2ONQ A;  2J52 A;  2O6V B;  2MW5 A;  4IM2 A;  4AWJ A;  3NJT A;  4FJY A;  2IO0 B;  2Y5P A;  4M0W B;  3SDL C;  4USA A;  1LM8 B;  5IOI A;  2JRI B;  1IUE A;  1TS2 A;  2TSS A;  3NVV A;  1HZ5 A;  1WMH A;  3AE2 B;  4FHJ A;  4B9K A;  2FE8 A;  2VH1 A;  1UH6 A;  1C4A A;  3VXW A;  2QMT A;  3T9L A;  4K1R B;  2LZ6 A;  1E9M A;  1ZPS A;  4J3O D;  1WM2 A;  2R61 A;  1MI0 A;  4JE3 B;  4ZRK A;  1TKE A;  1V2Y A;  3C19 A;  2M8S A;  1QOA A;  3ZUN A;  2CR5 A;  2XBB C;  3UI3 A;  2Q5W D;  1WJU A;  1T0Y A;  2OJW A;  1L7Y A;  4HVB A;  3BYY B;  4ZYS A;  4EOY A;  3NY5 A;  4MGI E;  1FIQ A;  1TZ1 A;  3KLS X;  1CQV A;  2HD5 B;  4E74 A;  3VUY A;  3BVZ A;  2K6Q A;  3T8M A;  3ZTC A;  5BMG A;  3AH7 A;  2RSU A;  3L17 A;  2FCS A;  5T8I A;  2K25 A;  1WJ6 A;  1GT8 A;  1MHH E;  4ZHO A;  1VZ7 A;  4XDC A;  3RZF A;  5J2R A;  2BB6 A;  3N32 A;  3VFK A;  4BZA A;  4ITK A;  3H7S A;  1QOG A;  1WGD A;  2G4D B;  3RNE C;  4NJC A;  4OHJ A;  4WJO A;  1F9J A;  1PFD A;  2BT6 A;  1FCL A;  1XXG A;  2X38 A;  2CS4 A;  1KOT A;  4FLH A;  3L08 A;  1YN3 A;  3RNC C;  3ZKJ C;  2DX5 B;  2Y5B B;  2LFI A;  4E3C A;  4TV3 A;  5BO4 B;  1WFY A;  4HEA 1;  3DBR I;  1L0Y B;  2XNA C;  3ECI A;  3NZ3 A;  2IJ0 A;  1RRB A;  1OEY J;  1TYG B;  2D3G A;  2BS3 B;  2KTR A;  2J7Q B;  2KWU B;  1YIW A;  4FAD A;  1KLG D;  2C5L C;  4ANW A;  1SF0 A;  4GDL A;  2D5G A;  2ZCC A;  4PS8 A;  4YSZ B;  1V9J A;  1WWT A;  2HE7 A;  2PKO A;  2BBC A;  5IKC M;  5J18 A;  3DBL I;  4ARC A;  1E0Z A;  2LVP A;  2V3S A;  3PSE B;  3HM6 X;  3DHG C;  3GOE A;  1FFV A;  3WAO A;  1WYW B;  3HK0 A;  4PK1 A;  2C7N B;  1UZX B;  2A5U A;  3QHT A;  1UGM A;  4II2 B;  1SE3 A;  2DNF A;  1LGR A;  2O2V A;  2PEA A;  3DVN U;  2ZCB A;  2VZK D;  1OGW A;  2GI9 A;  4C4V B;  4BKS A;  1I35 A;  2LHD A;  3SEB A;  2K8H A;  3QJZ A;  2EMS A;  3QK0 A;  4NJ7 A;  1SSN A;  3DVN V;  4M01 A;  2XN9 C;  1JRO A;  1V49 A;  4I6P A;  3FC4 A;  4GN1 A;  2NS5 A;  1SJE D;  1QQR A;  2I1K A;  2L7R A;  4RMA A;  3AE3 B;  4AOF A;  1C78 A;  3KUD B;  3UIP B;  1EM7 A;  2DZM A;  4LCD E;  1FMA D;  1I42 A;  5HI1 A;  3U4E G;  3U7Z A;  1STE A;  3PO0 A;  3P4S B;  1YX6 B;  2LEK A;  4KGS A;  1B9R A;  4KX6 B;  2JT4 B;  2KK8 A;  4ZYN A;  3CF4 A;  3VUX A;  4B95 A;  2ZVN A;  4W9F A;  2CJN A;  3NVZ A;  2Z0E B;  2YVC A;  1AAR A;  1J7B A;  2KQ7 A;  2LUE A;  4G50 A;  3IXS A;  2OED A;  4FN2 A;  4C56 C;  2KT7 A;  4YWG G;  4FJV B;  2LGY A;  4I6N B;  1VZ6 A;  3NUH B;  2NTT A;  4PT5 A;  1TJE A;  2KDB A;  4EZJ A;  2IYD B;  1U4A A;  2CU3 A;  3OG5 A;  4W9D A;  3GP7 A;  4A9A A;  4REZ A;  5BYS A;  1YJJ A;  2MJD A;  1V81 A;  3ZRF A;  4C00 A;  2DZI A;  4ACF A;  2KTR B;  1SBB B;  1ET6 A;  1MJD A;  1OQR A;  4TUU A;  1FNU A;  1OFF A;  1TS5 A;  3GZN I;  1WXM A;  4HJK A;  3CWI A;  3CF6 E;  3OJ3 A;  4DDG D;  3RNA C;  3L54 A;  2KWV B;  1JRU A;  1S3S G;  3ZJV A;  1DOI A;  3HUI A;  2WXM A;  4A55 A;  1UWM A;  4LJP B;  1KM7 A;  5KHO A;  3A1Q A;  2FAZ A;  2BWE S;  3ZNI D;  2O2V B;  3PHW B;  5JH5 C;  4ARI A;  1F1H A;  1GTE A;  5IN7 A;  2INP E;  1C9F A;  3EHV A;  1N5W A;  1FRD A;  4M00 A;  3BYT B;  1NEK B;  3IHP C;  1BXT A;  4XWW A;  2KMA A;  1HEZ E;  3N30 A;  2RD0 A;  4A3O A;  4PYZ A;  5FR3 A;  1TKG A;  2KYW A;  3NOB A;  3S2A A;  4A90 A;  2ASQ A;  1VLB A;  1NBF C;  3I3T B;  3AV8 A;  1F0Z A;  4JIO U;  4C80 A;  5LXI B;  1BML C;  1WX8 A;  4N59 A;  4KGT A;  3IFW B;  4JX1 C;  2DWQ A;  2IO3 B;  2UU7 A;  3RMK C;  1E6E B;  2K1F A;  4KDI C;  4KKJ A;  2KX3 A;  5BMH A;  2L83 A;  1AW7 A;  3UQA A;  3A4R A;  3N9Y C;  1S1Q B;  1ZXI A;  3R2I A;  2BYF A;  3JSV B;  1SB3 C;  3Q69 A;  4OW0 A;  3AE9 B;  3NHE B;  1FXA A;  2HJ8 A;  4QAY A;  4YXD B;  2MLB A;  4AQ7 A;  1KTK A;  3V3X A;  2QJL A;  4A3P A;  4WJQ A;  1Q1O A;  3A1Q B;  1UEL A;  3PLU A;  4DDI D;  4ZRI A;  1WMH B;  2PVO D;  5EE0 A;  3U8Z A;  2DAF A;  3BII D;  2XEW A;  5BYQ A;  4KGR A;  3RD2 A;  2K39 A;  4AP4 C;  1YMH E;  2DLB A;  1EWY C;  2D3A A;  2REX A;  4IM0 A;  4RF1 A;  4KV2 A;  1KF6 B;  3U7D A;  3TIX A;  2IY1 B;  2KAC A;  3A9J B;  2BKR B;  5E6O A;  2LUM A;  2D2Q A;  4K7S A;  1XQQ A;  2H88 B;  2JX5 A;  1WYG A;  2D11 A;  1X1M A;  2V4L A;  4JWS C;  4W9J A;  4BFR A;  4XDD A;  1E8Y A;  3BWU D;  3QAQ A;  2GB1 A;  5G5H A;  3C8Y A;  2AYO B;  2PPH A;  3P4R B;  3VH3 B;  1L0X B;  2LXC A;  4F1S A;  1TS4 A;  2NPT B;  1FCC C;  1TZO A;  2KVZ A;  4XE0 A;  3MTN B;  2NBW B;  4NZL B;  5TR5 A;  2IGH A;  3QCA A;  1JML A;  2ZVO A;  1Y8R C;  4AJY B;  3W1Y A;  4ASW C;  1WRD B;  3DWM A;  1C1Y B;  1F77 A;  1D3Z A;  5IP4 D;  2R2O A;  3L4P A;  2R2Q A;  3EFU A;  2JYE A;  1Z2M A;  1YD8 U;  1MFW A;  5AZF A;  3AE8 B;  5LLI A;  3AE1 B;  1RLF A;  3JSV A;  1WGY A;  3QAR A;  2LXA A;  3L10 B;  1ZXH A;  2M4N A;  2B76 B;  2LRW A;  2AX5 A;  3I9V 1;  1PGA A;  2KKC A;  4BVU C;  2JQR B;  1UBI A;  1P7E A;  2L32 A;  1A70 A;  2N9P C;  4H2A A;  3ZGZ A;  4GMV A;  4S17 A;  3Q3O C;  2M1M A;  4YL8 A;  1ZP0 B;  1R4M I;  3OWE B;  1ZE3 D;  2PLP A;  3I5J C;  3PHX B;  1MPE A;  5C1Z A;  4MSQ B;  3EGR A;  1PGX A;  2Y3A A;  1V86 A;  2MBE A;  1FEH A;  3ALB A;  3MJW A;  4A6Q A;  2BTE A;  5IA7 A;  1XLQ A;  4TQ0 A;  2KNB A;  2N9L A;  5KHQ A;  2JYT A;  5LNK 1;  1RFK A;  2WXI A;  3NS1 A;  1GPX A;  4LNF A;  2WQY B;  4WAA A;  3IT4 B;  4FUL A;  3X0W A;  4RGT A;  4LLG M;  2IGG A;  2K3U A;  3P63 A;  4IKG A;  2JF5 A;  3RYT A;  3RNF C;  4ZDV A;  5HKH A;  1JWS D;  3QX1 A;  2KOX A;  4RCO A;  2AQ1 B;  1N60 A;  3RI7 C;  1EWC A;  3W1S C;  1PQS A;  2DYM A;  4FHK A;  1OQY A;  2GBR A;  3PZ7 A;  2W55 A;  3DBS A;  1WX9 A;  4EFO A;  1FNV A;  2J0J A;  2MWS B;  1NI2 A;  1Z5S B;  3PV1 A;  1IGC A;  1K53 A;  4ZRJ A;  2KJH B;  2N9X A;  1R4N B;  2MP2 A;  2MSE D;  3Q3F A;  2M56 B;  3DWG C;  2HDE A;  4HCN B;  1JRP A;  4JWU C;  1E90 A;  2KWD A;  4TMA B;  3GZN B;  4L2Y A;  1K52 A;  5CTR C; 
#chains in the Genus database with same CATH homology
 1QT9 A;  1WSP A;  4KKI A;  1UNS A;  3MHZ A;  4MH8 A;  2KDM A;  4OZB A;  1XLO A;  2RPV A;  1FM0 D;  2PMV A;  1LO5 D;  1I4X A;  3TEY A;  2E3T A;  5FKA C;  2W3S A;  3T3N A;  4EE2 A;  3HVD A;  4MM3 B;  1CJE A;  2JXT A;  4YTM B;  2WU2 B;  1SSN A;  1SIJ A;  2V0G A;  2XN9 C;  1JRO A;  2BS2 B;  1QOF A;  3R8B A;  1DOX A;  3FC4 A;  4OZA A;  3TEZ A;  5HFY A;  4RFB A;  4ZHP A;  1ZOY B;  2IDY A;  1C76 A;  1SJE D;  1FO4 A;  2W3R A;  1QQR A;  3AE3 B;  1SXT A;  3AMZ A;  4WH4 A;  1C78 A;  2V3P A;  4XWT A;  1EM7 A;  1JWB D;  1DOY A;  1FMA D;  2BYT A;  2WS3 B;  2BB5 A;  2NMQ A;  5HI1 A;  3U4E G;  3U7Z A;  1EU3 A;  4D2K A;  4R3D A;  1STE A;  1N5X A;  5HG2 A;  3URY A;  3PO0 A;  1KRH A;  2ACZ B;  3P4S B;  2LEK A;  1PGB A;  3IAM 1;  4KGS A;  3TEX A;  1B9R A;  4KX6 B;  2ON8 A;  3AEA B;  4JPS A;  2JWU A;  3AN1 A;  3CF4 A;  1N63 A;  3AEF B;  2VZK B;  2WXK A;  2SAK A;  1F2R C;  4WQM A;  1R7S A;  2WXR A;  3AE5 B;  2CJN A;  1TY2 A;  3NVZ A;  3NVW A;  1I4R A;  1J7A A;  1J7B A;  3ZYY X;  3VR8 B;  1ENF A;  3CIR B;  3IXS A;  1F2R I;  2OED A;  4C56 C;  4NAM A;  1GB1 A;  4YWG G;  1T3Q A;  3P4P B;  1L0V B;  2NTS A;  1AN8 A;  2LGI A;  3GS2 A;  1VZ6 A;  1ACC A;  2W54 A;  3H8H A;  5H92 C;  1D4B A;  3NUH B;  3BK2 A;  2WXO A;  1XLN A;  3LB8 C;  1V1O A;  2NTT A;  3ZJT A;  4PT5 A;  1TJE A;  4MT5 A;  1GAQ B;  1ROE A;  1NEN B;  5C2T B;  3BVM A;  4YSY B;  1I4P A;  3AE7 B;  1I7H A;  2ICI A;  1XO3 A;  2CU3 A;  1RM6 C;  4N6E B;  5HHD G;  2ZW0 A;  3GP7 A;  4A9A A;  4REZ A;  1YQ3 B;  1PUT A;  4IDI A;  3TSS A;  1YJJ A;  2MJD A;  5BYS A;  4WAF A;  3MP9 A;  1FRR A;  2RDH A;  4OVZ A;  2WXQ A;  2W82 A;  3AE4 B;  2LMC A;  2L1A A;  1ESF A;  2QIE B;  1MHX A;  1SBB B;  1ET6 A;  1RYJ A;  4C7Y A;  1JWU D;  1YN4 A;  4LTU A;  1OQR A;  2ZW1 A;  1BUI C;  1D5M C;  3VRA B;  1FNU A;  1OFF A;  2V3N A;  1IGD A;  2DBY A;  1TS5 A;  2KMM A;  2M19 A;  3CWI A;  2WU5 B;  5TSS A;  2KAJ A;  3SR6 A;  1VDV A;  1YNT E;  1NVI D;  1VR9 A;  3SFD B;  2SEB D;  1N61 A;  1ZDX A;  3BK1 A;  2M0A A;  1DOI A;  1H7W A;  2G9H D;  3AM9 A;  3Q8F A;  5BMI A;  3ZJV A;  3HUI A;  3P42 A;  1KLU D;  2WXM A;  3B9J A;  3Q8A A;  4A55 A;  2I2Y A;  1UWM A;  4US8 A;  1E10 A;  1FFU A;  4GDL B;  1QF6 A;  3KWV A;  2WNM A;  2K9X A;  4ARI A;  3Q8E A;  3W2D A;  1GTE A;  4YTN B;  2INP E;  3O13 A;  1C9F A;  1N5W A;  5GXG B;  1WGK A;  5EE1 A;  1FRD A;  3BYT B;  1NEK B;  2FUG 1;  2WDV B;  1BXT A;  4XWW A;  1XCQ L;  1HEZ E;  2OHF A;  3U52 E;  1YN5 A;  5FR3 A;  1TKG A;  1CZP A;  4TSS A;  2WXG A;  2N7J A;  2MJE A;  4A90 A;  1IBX A;  1JQ4 A;  1VLB A;  1KFY B;  1N62 A;  1TS3 A;  1AWD A;  2EEL A;  3W1S A;  1I4H A;  5MPO A;  3U2S C;  1H7X A;  3AV8 A;  1F0Z A;  4C80 A;  4LK0 M;  1JCK B;  1L6U A;  1YJI A;  2BW2 A;  1JWM D;  3MC0 B;  1BML C;  1I4G A;  2DYO A;  3AB5 A;  4N59 A;  4KGT A;  4Q2J A;  4JX1 C;  2DWQ A;  3KWL A;  4P6V F;  1E6E B;  1UUP A;  1M4V A;  1K50 A;  4KKJ A;  2BS4 B;  1UGJ A;  1T5X D;  5BMH A;  2L83 A;  1WRI A;  2MJ3 A;  2YEP B;  3BVG A;  1IBX B;  1AW7 A;  4RNA A;  2AQ3 B;  3N9Y C;  3WCQ A;  2KQ4 X;  1ZXI A;  1SE2 A;  3R2I A;  1JAL A;  1XLP A;  3ZJU A;  1XF5 L;  5BYR A;  4L1B A;  2RDG A;  1JW9 D;  5JXV A;  1SB3 C;  4RF0 A;  3Q69 A;  2JU6 X;  1SE4 A;  3ABV B;  1QLB B;  2IPK D;  4OW0 A;  3AE9 B;  2HTM E;  1B1Z A;  4MAC A;  1FXA A;  3VQI A;  3NRZ A;  3W9C B;  4HRS A;  1XEE A;  1ZDV A;  1V8C A;  1L6V A;  3RFZ B;  4ZRP A;  4YXD B;  4AQ7 A;  5H8Y E;  1SEB D;  1KTK A;  3V3X A;  3J9C A;  2QJL A;  3VRB B;  1E7P B;  1VJK A;  4WWM A;  3E9S A;  4RGM A;  4YTP B;  2MEK A;  4DXF A;  3AEB B;  1J7C A;  4TQ1 A;  1V1P B;  2IGD A;  1ET9 A;  1KH0 A;  3B2G A;  4CQN A;  2CJO A;  2K5P A;  2E6X A;  4FXC A;  1D6E C;  2PVO D;  1Y56 A;  5EE0 A;  4DQO C;  2ONQ A;  2J52 A;  3BII D;  3PZ8 A;  1NI3 A;  3LYY A;  1D5Z C;  5BYQ A;  4KGR A;  2WDR B;  1GOZ A;  2Y5P A;  1YMH E;  2DLB A;  4USA A;  1EWY C;  4RF1 A;  1UWX A;  1KF6 B;  3W5U B;  1T6B X;  1IUE A;  5AUI A;  2J42 A;  3P4Q B;  2JZP A;  3AEG B;  1TS2 A;  2FBW B;  1PYW D;  2TSS A;  3AE6 B;  2L52 A;  3ZQ4 A;  3TEW A;  2KAC A;  3NVV A;  1HZ5 A;  1SJH D;  4UDU C;  3AE2 B;  2FE8 A;  2RMM A;  1C4A A;  2KN4 A;  2LUM A;  3MJ5 A;  1QOB A;  2QMT A;  4A8X C;  3W5V B;  2H88 B;  3IT6 B;  1E9M A;  4GLS C;  5D3D A;  1FNW A;  2JX5 A;  1GTH A;  2J4X A;  3LXF A;  1EU4 A;  1ZPS A;  4J3O D;  4YSX B;  1WYG A;  3FIL B;  2R61 A;  1MI0 A;  4JE3 B;  4IOI E;  2V4I B;  4JWS C;  1TKE A;  2PIA A;  3V05 A;  1OQQ A;  1QOA A;  1ZUD 2;  4XDD A;  3AEC B;  2PTL A;  1CK1 A;  2WLB A;  2WXL A;  3BWU D;  4ZOH C;  2Q5W D;  2GB1 A;  3UI3 A;  5G5H A;  4C7Z A;  3C8Y A;  3P4R B;  1QKZ A;  1QIL A;  3BYY B;  1L0X B;  4M0W A;  4ZYS A;  1TS4 A;  2G1E A;  1HZ6 A;  3HRD D;  4GDK B;  3T3O A;  4P16 A;  1V97 A;  1FCC C;  1TZO A;  2K22 A;  1Q10 A;  4NAW B;  2N9K A;  1L4D B;  4XE0 A;  1FIQ A;  3KLS X;  4NZL B;  1CQV A;  2IGH A;  3AEE B;  1P7F A;  3BVZ A;  1JML A;  2WP9 B;  2YEP F;  5BMG A;  1C4C A;  1PDX A;  2PW9 A;  2QIL A;  3AH7 A;  3TUO A;  1JWA D;  2WXJ A;  3DWM A;  5C3J B;  1RWS A;  1VZ8 A;  4HKQ A;  3RPF C;  1F77 A;  1L5P A;  2MH7 A;  5D3I B;  5T8I A;  3R2T A;  1DGJ A;  3L4P A;  4N58 A;  1GT8 A;  1MHH E;  2JYE A;  4ZHO A;  1VZ7 A;  4XDC A;  2BB6 A;  1C77 A;  3BZD B;  4DXG A;  3KQ4 A;  3NVY A;  3AE8 B;  3Q8B A;  1C4P A;  1NYR A;  3AE1 B;  5EE3 A;  4ITK A;  3VR9 B;  1QOG A;  3IAS 1;  2JSV X;  1DYQ A;  2LJI A;  1ZXH A;  4NJC A;  4OHJ A;  1I4Q A;  2WXH A;  4B0E A;  2B76 B;  2AX5 A;  3I9V 1;  1PFD A;  1PGA A;  1D5X C;  2BT6 A;  2JQR B;  1FCL A;  1XXG A;  1GB4 A;  2X38 A;  2LHE A;  1YQ4 B;  1P7E A;  2L32 A;  4ZRQ A;  1A70 A;  1L4Z B;  4AS1 A;  3Q8C A;  1YN3 A;  1FXI A;  2WXF A;  4H2A A;  3ZGZ A;  1HA5 A;  5E6J A;  2LFI A;  1ZP0 B;  1V1P A;  1TKY A;  3OWE B;  2INN E;  1ZE3 D;  2PLP A;  3EA6 A;  3ETR A;  1L0Y B;  1MPE A;  4HEA 1;  4US9 A;  1VRA B;  2XNA C;  3EGR A;  1PGX A;  2Y3A A;  2IJ0 A;  3NZ3 A;  5D7G A;  3HVZ A;  5AUK A;  4B0M A;  1TYG B;  1FD6 A;  2PVG C;  1FEH A;  2BTE A;  4A6Q A;  2WDQ B;  2EKI A;  1HQR D;  2J53 A;  2BS3 B;  2WXP A;  1XLQ A;  2AQ2 B;  2GRI A;  4RGO S;  4TQ0 A;  2N9L A;  4YT0 B;  3FAH A;  1KLG D;  2JYT A;  5LNK 1;  1SF0 A;  1RFK A;  2N0S B;  2D5G A;  2I38 A;  2WXI A;  3NS1 A;  4YSZ B;  1AYF A;  4HKZ E;  5FK9 C;  1GPX A;  4HRO A;  2QEJ C;  2WQY B;  3GB1 A;  3IT4 B;  4RGT A;  1WWT A;  4O1N A;  3EUB 2;  4WUR A;  4RH6 A;  4LLG M;  2IGG A;  2PKO A;  2K3U A;  3P63 A;  4IKG A;  2BBC A;  3B2F A;  4ARC A;  2WXN A;  3E56 A;  2QSD A;  1E0Z A;  2Z8L A;  1JWS D;  4OZC A;  3MFG A;  4RCO A;  2AQ1 B;  5I4D A;  1N60 A;  1EWC A;  1FFV A;  1TY0 A;  2H89 B;  1XCT L;  2DYM A;  1WXQ A;  5G5G A;  1HXY D;  4RGN A;  3PZ7 A;  2W55 A;  1C79 A;  1FNV A;  1IGC A;  1K53 A;  3AED B;  3I57 A;  1SE3 A;  2Y5C A;  3FIL A;  5EE9 A;  3SFE B;  2VZK D;  2M56 B;  4HJG E;  2GI9 A;  2K0P A;  3DWG C;  2HDE A;  1JRP A;  4JWU C;  1K51 A;  2KWD A;  4WIP A;  4TMA B;  3P1M A;  2LHD A;  4L2Y A;  3SEB A;  4L23 A;  1K52 A;  1NYQ A;  1MVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...