3AD8C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with pyrrole 2-carboxylate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad8C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad8C01
3GIRA 1WSRA 3AD7C 3GSIA 1XZQB 1XZPB 1XZQA 1XZPA 3AD9C 3TFJA 3A8IA 3GEEA 4P9SA 3AD8C 3A8KA 3GEHA 3TFHA 4PABA 1V5VA 1WORA 1WOPA 1PJ6A 1VLOA 3A8JA 5L46A 1X31C 2GAHC 3TFIA 1YX2A 2GAGC 1WOOA 4PAAA 3TTGA 1VRQC 1PJ5A 1WOSA 3GEIA 1WSVA 1PJ7A 3ADAC
chains in the Genus database with same CATH superfamily
1TR0A 1NSKL 1S9EA 2IBKA 1FK9A 4FBUA 3DDKA 4IFYB 1IBLJ 2NPIA 3LGHA 4YDXA 2IRXA 3W8PA 5B0CA 1FX2A 4JP8A 5FDLA 1EFWA 4LF2A 3VZIA 3OL9A 2AU0A 1TL4A 2IMOA 4C2MC 3HT3A 2MKJA 3G87A 2UUWA 2RVJA 5CZXA 2BOAA 4LF4J 2IYIA 2E2IK 5BR8J 1REVB 2L9DA 4YHHF 2QFIA 4ILMA 3BPDA 2CQGA 4AQYJ 2YWFA 3BSCA 2GZOA 3VVUA 2G1DA 2E29A 4HHJA 4OLPA 1YRUA 1R3NA 3TZZA 1FDAA 4IG0A 5D4PA 3KLGB 3OFEA 2EFNA 3VAFA 4IFYA 2HHTA 2HGLA 5KFXA 4X4OA 4ZHRA 3M32A 2C2RA 3ET6B 4DUTA 1UZHA 2Q3PA 1EHWA 2VFTA 2QLJB 5J2QA 3MWBA 1WHYA 3GR1A 4KMUA 1R8AA 1KEKA 4CLUA 3NAIA 3LW5C 3OUYB 5C44C 2DNYA 4PG5A 4G0UA 2JFDA 3Q22A 4LF1A 1RT6B 2O5DA 2VC0A 2FYXA 1XXAA 4ENOA 1CVJA 1S4EA 2AJ0A 2DNOA 4PXDA 2KT5A 1WSVA 3FFIA 2BABA 4DR1J 2RKIB 2V6SA 2J7WA 3POTA 1MSWD 1FJGJ 3AQPA 3N0VA 1LV5A 1WHVA 1AROP 1U45A 3KNGA 2RU9A 3SCLE 1HNZF 4B3MJ 3FSXA 1T9VA 2E2HK 1QD1A 1U1PA 1O29A 1N33F 2B0GA 6FDRA 4GKKF 2WSFC 3MR2A 1U1MA 3IP0A 1N34J 4F4WA 5K14B 3ETMA 1BS2A 4OINA 2GVZB 2UUCF 3EVWA 5DM6Q 5C2CA 5AJ3J 3OBIA 4X65J 3KLEA 4YS2A 3PV8A 4N41A 4ETXA 1K0TA 4WJ4A 2Z2YB 4L74A 3MM9A 1SL1A 1HQ2A 4MH8A 4RUAA 4YFXA 1U1OA 5ETLA 4WU3A 3M32B 4ES2A 2NSBA 5CYQA 4DSKA 3BQ0A 5KFJA 2P6TA 2C3PA 5J1PA 1WCMK 2B63C 4EBDA 4RW4A 1AB4A 2HNDA 2X1FA 3TX0A 2W9BA 3CQZC 2E7VA 2OPQB 2QMUB 1VIXA 4JOUA 5HJYA 1QAJA 5ETMA 2DR7A 3PZPA 5CJ9A 3J80U 3QFHA 3GCXP 1RKIA 4A3MK 4KMDA 5CH7B 5DDRC 1U6ZA 2VFUA 4XDCA 3JQMA 1IKVB 1DCHA 5EGHA 2RS2A 5B0EA 3OR2A 2SXLA 1ACMB 1LNQA 2NVQK 1UMJA 1R7IA 1RAAB 3QSIA 4CH1A 2FZGB 2W2NP 3UN2A 3MEGB 1RGVA 3OT9A 2C2KB 2ZFHA 3BPSP 3W64A 1VRUB 3QGGA 4FPRA 3W5ZA 2ADBA 3B8HA 3CC2S 1C0UA 2EFVA 1KBRA 3UD3P 2IA0A 1Y3JA 1J27A 2MKHA 3KFWX 1DBDA 1KONA 3DHXA 2DBBA 3GYNA 2R8HA 2F8EX 4WE1A 3RZAA 1JX4A 4CLFA 4KB2A 1NH8A 4LRDA 3I5CA 4GTLA 2VPWB 3NGKA 3SXLA 2WONA 2B9EA 5LXYA 1H72C 3GPAA 1S1VB 2DNNA 2NZ4A 1K83C 3JTNA 5EGYA 4NI2B 2M0GB 2DD8S 1MMDA 3I96A 1QE1B 2W25A 3J81j 2VJUA 1U2RA 2JA6A 2XCAA 4U95A 1VCTA 4FKXA 3WQPA 2AIRB 1NJIT 2RSQA 2WONB 3PRDA 3DXJA 2V4QA 3PJXA 1X4DA 2NUUG 5D0HA 4DDFA 2CQBA 1CPZA 3MMAB 3S15C 4KQZA 2D41A 4ZP7A 1FRHA 1IS1A 4DR6F 3LAMA 2I8EA 4GO5X 5I42A 4B9VA 3DRSB 3H98A 2R2RA 2HQDA 4F0HA 5L1IA 3FSYA 4JI8J 2V67A 1T8EA 3LQVA 3OL6A 2HQGA 1NKBA 4DR4F 2RIJA 2O66A 1RAEB 4QCLA 5IYDK 3AFGA 1WDTA 2LLZA 3J7Z5 4ZVTB 2RH3A 1S6QA 1HHTP 2YWHA 1FWLA 2AYBA 1HQUB 4FF1A 3DOKA 2HFOA 1ZM4A 3EPGA 3E01A 4AD6A 5IT9Y 3VGTA 5T41A 3TA1A 3HOXC 3KK3B 2ZHOA 3E8OA 3UFCX 2DHXA 3GQCA 2DVIA 1RTHA 3TI0A 1S6PB 3HOYC 1IWGA 1UEVA 4CDIA 3OXLA 3OHBA 3GTJC 2U2FA 1NSPA 1BC6A 1RB0A 1HNVB 3FKIC 1RAOA 4Y34A 2ZE2B 5IS2A 1DTQA 4P52A 3BP3A 2XMMA 3Q0AA 4DR6J 3R5BA 3GFHA 3G4SS 1B0PA 3JSTA 3KLIB 2PFFB 4DQQA 4C3KA 5C4XK 4I6WA 3HVWA 1BQNB 4RMFA 4IRDA 4OJGA 3BV8A 5IQQA 1FEEA 1BGWA 2I5JA 5HQ8A 3CJ4A 5KFGA 2V34A 4X66J 1HQUA 3HOZK 5ETPA 3MMBB 2DGTA 4J9UE 1VBYA 3G71S 4HHUA 1RQ0A 2K8GA 1FRMA 4YEAA 2A6OA 5KG2A 5LMNF 2RT3A 4A8XA 2V6UA 2W7PA 1BWEA 4KMHA 1ZAWA 2MZRA 1DTTB 1S1UA 5MLCV 3VAMA 2P8IA 1TL3B 5K8NA 3JSRA 3J7A1 3CO0P 3DDIA 1RT4B 4DPWA 1M0SA 5C4XC 2DB1A 2ZE2A 3N9UC 3TZWA 2QTWA 5L1LA 1TWFC 5GAHI 2ZKUA 2KHDA 2X3GA 3PR5B 3CD5A 5CHCB 3IM8A 5KFQA 4KJIA 4KM9A 3V6JA 4KGZB 1QSYA 1S1WA 3R5JB 1QDUB 1KC8T 1QSLA 2Z30B 2DO4A 1YJUA 1QY7A 4FKYA 5HROB 3MXHP 2X1AA 3PJWA 2ZKTA 3UDLA 2M8HA 3A1YG 2F3JA 2N7CA 3HOXK 2DHSA 1HNXJ 5DJBA 3G8SA 4BY1K 3SQGB 1XMOF 1IWAA 4TLQA 4KSEB 4LF9J 3GG0A 3C15B 1VS3A 1CULB 4DV0F 4I4BA 4USMA 4OHWA 3S8SA 3GTPC 3EQLA 4MIWA 2K1RA 3BQ2A 2M7SA 4A3IK 1H2TZ 5IT4A 4HKQA 4PQUA 1PG5B 3IA0A 2J6UA 1G7CB 4G0VA 2E2HC 2V8PA 1A6LA 1IKVA 3KNAA 1M5KC 3S2DK 4GT9A 1NDCA 4LR7A 2ZH2A 2R7QA 3OTOJ 1KR4A 3SV4A 3H2VE 4ZCLA 4DV5F 3OXFA 1S77D 2UZAA 4Y3CA 4NLOA 1ZOTA 2GS8A 3IG1B 2E5LF 3QAUA 4WWSA 1NDLA 1WC1A 1RI7A 2QMXA 4QYRA 2BE9B 3VAJA 2YKOA 4W92B 4YQWA 2WB1D 3AB2B 1S79A 5KG7A 4C6AA 5BXIA 4DR5J 4DWIA 3U02A 3AODA 2AMCB 2B63A 1FVQA 3BSAA 2QO3A 3DN9A 3M30A 1B64A 1PJ5A 1WKJA 1R43A 2Y0SL 1M5HA 2FVSA 1TTHB 2HEKA 1RADB 3GSIA 3IFEA 2NVYA 5CYQB 2I9SA 1RTJA 3MMCB 4FP9A 3NS5A 4DX8H 3I32A 2ACMA 2M8DB 1UVMA 1O27A 1VMBA 3H5YA 4KC5A 3OV7A 5CD4A 3W61A 5JVOA 3W1YC 3S1NK 3CCSS 4KB4A 2J9DE 4LRFA 1OSCA 2PGCA 3QT8A 1T03A 1N36F 1N56A 2QX0A 1U24A 3T5JA 1N54B 1P9QC 3CT9A 4DV3F 1DY3A 3QO9B 3M6XA 5DETA 2DNQA 4KO0A 1JLEA 3RB3A 1U8WA 2GMLA 4DSFA 4ANEA 3KJQB 4RW6A 3AH5A 3IN5A 1KLNA 4HTJA 1WEZA 4WTOB 5KT6A 2FLOA 2KXHA 4ED5A 4WFNQ 4UOCA 1UAWA 3MR7A 4WCEQ 1TFYA 2O01C 2ZM6J 4DFMA 2Q66A 1XXBA 2YX1A 3ZFVA 3CC7S 1O51A 5KFLA 4NYOA 3CD0A 4C97A 2XCQA 2C2NA 1NXIA 4W98A 4DN0A 2PC6A 2BJEA 1NB7A 1ZS6A 3P96A 2NVTK 3P6YC 3T1HF 4Y7NC 4DN9A 4RUBA 4K59A 4ZITA 4YP3A 2XO7A 2GVZA 3BUEA 3DOMA 3D0IE 3LPEA 2EFPA 4UF4A 1X9SA 3WX4A 1SUQB 3M8WA 4IH6A 2LEBA 1V3ZA 1NK4A 2CPHA 1Y1WC 4NLSA 3SZ2A 3GJRB 5DRKA 1UWBA 4LF9F 3S1QK 1FXDA 2KZMA 2R7OA 2MLZA 2FJEB 1SQGA 2V2ZA 2HHPA 5FIIA 2IM2A 3M8PB 3DDNA 2W7AA 3C14B 3Q8YA 3MM5A 3QPIA 4GTAA 4OI3A 2NYHA 2RB7A 2YX4A 5H9EK 2R8KA 1DFDA 4OX7A 2P2CB 3D2WA 4IFVA 1TVRB 3TA0A 3GTPK 4EYIB 5D3GB 3M3YC 3JTOA 3D68A 1RWPB 5F8NA 4DXLA 2I6WA 4FYWB 3OFFA 3MURP 1U1RA 3GV7B 1KQSR 3D28A 3GJTB 3GTJA 1RU1A 1S97A 3KMSA 1VJQA 1FDBA 1WQFA 3FUYA 3K0JA 4ZHRB 1PC5A 4RBVA 2XULA 2BYCA 3PKYA 4JV5F 1HNZJ 1T11A 5J2NA 1Q78A 2ERRA 3DLEB 5KFAA 2LP4A 1TWCC 4P7VA 5H9FK 4NEZA 3CD7A 1J98A 3CPWR 2ZDOA 4ZPBA 1HYSA 5J2MA 3MGJA 3HKZL 2KRBA 4NI2A 4U9RA 4IDKB 1E6VA 5DGAA 2MQMA 4LFAJ 4M95A 2D3OR 4PWDB 1S9FA 4DV0J 3N0CA 1EQ0A 2JX2A 1X0FA 2GO9A 2ACYA 3MAAB 2J6SA 4F3QA 1EK8A 4A3JK 2QSFA 4OZ1A 2VF3A 3ENAA 4B02A 1HA1A 5KFKA 1RSCA 4EBEA 3GTQC 3AQOA 4C8YA 4UQTA 1G51A 4PAAA 4UOGA 4TNOA 4DCPB 4XSXA 1LWFA 3H0GC 1YBAA 2GC8A 1U7LA 4C3JC 1UVIA 3PO3K 1IM4A 4USJC 3CTRA 3DFEA 4RX6A 1JXVA 4F0KA 5KFNA 1FFSB 1YSJA 3ERED 3MMBA 4K4YA 4O0IA 4CLKA 3HOZC 1TUWA 4LFBF 3A8KA 1S6OA 4FF4A 2HZAA 2MKKA 3S17K 4N76A 2R7TA 3OL8A 4ELTA 3GG1A 1CQMA 5J2QB 4A93C 2HLTA 3BB5A 3BQ1A 5E3QA 4K2JA 3T1YJ 4X62F 1PBAA 1E6YB 3KHHA 3CIZA 2WVBA 2CQPA 4DX5A 3T19A 2R2SA 2BOPA 2XI2A 3MI7X 1NKCA 4B3RJ 1CS4A 1U1QA 4P6QA 2DNGA 4KGXB 5ETSA 5IP9C 3AJDA 1MN9A 2CNKB 4DF4A 3MHYA 1QAYA 1VRQC 4NWBA 2FVCA 3KUGA 3W63A 2H5IB 1I50K 4HLBA 4NLYA 3ZZTA 3HOVC 1WG5A 4CLTA 4RW6B 1LKZA 3OVSA 2JLEA 3C6TB 3S2DC 1S59A 2W2MP 1TKTA 1WC4A 1WC6A 4J9QA 3CJ2A 4EZ6A 3BJYA 2UXCJ 2XWYA 1XMBA 4A3IC 3HFVA 4ECWA 2XYGB 2Z2LA 1SH0A 5E7OB 2VDIA 3HJVA 3DM2A 3UN3A 1F3VA 4H54A 1VBKA 7FD1A 1X4AA 1UV7A 2BKOA 3IAS9 2HS3A 3M8ZA 4BY1C 3OTEA 4CO0A 2XY5A 1QM9A 3HT0A 2WK4A 4RBUA 3KLFA 5I3QA 4YUDA 4TU9A 2PT0A 2VDHA 2UP1A 4KASA 4EMDA 4DZDA 3GTMC 3AXMA 2DYAA 3MZIA 4HDGA 2E2IA 2B5JB 1TQLA 3QATA 3R2DJ 2BVZA 3J81U 3DLGB 3RU0A 2ZDPA 4Q5VA 3LPYA 4LQYA 1T0TV 2VD3A 4TY8A 4IO1A 2AEFA 3ZZPA 4LJMA 3M8RA 4C3MA 3TWZA 1Y5IB 4CNYA 4DUYF 4F3OA 3KYLA 2XGPA 4A3CC 5E0OA 2J0WA 4HACA 2GSUA 1KFDA 3ZZUA 4FS2A 3AXKA 2QLWA 2GIRA 2CDRB 4NEYA 3QAEA 1VHFA 2Y8YA 2JLFA 2UU9F 3KUHA 2CJQA 1S6QB 2YQ0A 2G4BA 2W8KA 1U6BA 4AYBD 2E2HA 2I38A 4M5LA 2EKYA 3KG4A 1PILA 3DOKB 3OLAA 2ZJPQ 2FJDB 2UVRA 2ABYA 1FXLA 4EYHB 1KTQA 3PEHA 3ADAC 3CAGA 3GFZA 2FVRA 2RRBA 3RYLA 1KHWA 2UUBF 2MYFA 2YKNA 3D6HB 3NBPA 4BBRC 1Y5NB 1ZQ1C 5KFBA 1BD6A 1XN9A 1L3KA 1U0SA 3AD7C 2DK2A 5B0BA 3NOCA 2OEMA 5FJ4A 2BRKA 2VQFJ 3TARA 3I4NK 2H9ZA 2QA1A 2WVDA 3T9ZA 3GEIA 1TUVA 2Y1LB 4UUXA 3SDEB 3O6QA 3ULHA 4NOHA 4QW9A 1Y0HA 3S01A 1RT5A 4ZKAA 1F7VA 1VQPS 2XNQA 2N3OA 2JA6K 4MK8A 1EH1A 1MMNA 1HI0P 2C2ZB 2M88A 5C25B 2ZUAA 3F41A 1M5PC 4ILDA 3US5A 2ASLA 2DPIA 6AT1B 4I7FA 2RUGA 2JLGA 2HNZB 5E41A 2ZZNA 1HBMA 3FRYA 2ZH3A 4K4VA 2N4CA 3QJJA 2ZH5A 2VFVA 2W9CA 4B9TA 4R0JA 4EFAC 4DL0C 4G1QB 2MPUA 4ZCMA 1R8BA 1XBWA 4ATNA 4O3NA 1Q79A 2NZCA 1UTAA 1FWPA 1CJKA 1DCOA 2D69A 1YJ9S 1HI1A 5HQMA 1F6TA 1NK5A 2YWWA 1TWAK 1NB2A 4ED0A 3G96A 2D7SA 1Z1ZA 5CAAA 3QJPA 1V3RA 1L5UA 2LU1A 1F2GA 4XCHA 5IYCK 2ZBIA 1P6TA 3NLCA 1U2CA 2H51B 3M2VB 4RO0A 2JA7K 3PEJA 3D67A 3HD1A 3OXGA 4XPCA 1K47A 2M3DA 1XR5A 2JA6C 4V19J 2W4CA 2WSEC 4DR4J 2PSZA 5A8WA 2MMYA 4UW2A 4C45A 3OUYA 2JL9A 1SV5B 3LTOA 3G82B 2V4RA 2OAUA 2BQ3A 3N79A 4KKOB 5M3MK 3Q8VA 4K5RA 4WFZA 1S48A 4I1TA 4AXIA 5EWEA 4L76A 2J0SD 1OYDA 1IXKA 2POKA 3LUYA 2Z2ZA 4OIQA 1QTNB 1ZBTA 4ZPCA 2ZC3A 1ZPWX 2LDIA 3ZTOA 3HX9A 2MLYA 3SSSA 2YX7A 1GXLA 2NSCA 3GONA 4ZP8A 2MHNA 5KFDA 2EPIA 3PY8A 4JI4J 1C0UB 4E2FB 3UNGC 3ILOA 4QYZJ 1UA1A 2VV5A 4OX6A 4PG4A 2MKSA 3V4IB 1Q0NA 3ZNUA 5CYMB 2W8LA 3MAAA 1DZ5A 3P5TL 1VLOA 4QIWD 3MM6A 2KFZA 2B4OA 4CM0A 5KFCA 4N7TA 4F50A 1HWUA 3CDUA 3MTKA 1W2BR 2WRMA 5AXKA 5GMKa 4CT8A 4QPXA 1TL7B 1UJ4A 4PWDA 4PWWA 4ZN1A 2XMAA 1N34F 3FMWA 4A3FC 2P8TA 3I5AA 1A0OB 2XY7A 2P9CA 1FE4A 1YNJA 1AZSA 1LWCB 2BE2A 1H7WA 4DMZA 4PKDB 1YJWS 1HR0F 1NJYA 2LVWA 2HG4A 1TWCK 2XMTA 4O23A 3N01A 4TQSA 1IJFB 1XIQA 1NK8A 3KG1A 4RLEA 1B99A 3H5XA 2UXCF 1TMJA 3DLGA 8ATCB 3H2UB 4EK2A 5KG5A 2VH7A 5J2NB 4DSLA 2ZD1A 4DQPA 1CG2A 2O1PA 2R3VA 3IS9B 1RT3B 3DLKA 4WFAQ 1TFWA 2FGOA 2WOMB 2DR8A 4K50A 3AD9C 1NHKL 3MEGA 3EXCX 1YI2S 2V2VA 3PRVA 2W9CB 1IKXB 3TRGA 4IG3B 2FIUA 1IKWB 4NYZA 4WKYA 1R27B 3TAQA 3C14A 1KNZA 4UOFA 3TJ8A 3RAMA 1VQ9S 1UWBB 1UVKA 4Y2AA 3THVA 2NXEA 1FI4A 1URNA 1FK9B 4DFJA 1RHKB 4A3DC 4QJVB 1HLWA 1FTRA 2MZSA 4QWAA 1PAEX 2OPSA 1Y5LB 2IVFB 2BJ9A 3O8WA 2ZBRA 1UVNA 2EK6A 4J5OA 2B3TB 3PX0A 4JI7F 2GW8A 2A6HA 3NWGA 2G2OA 5C44K 3ILJA 4K4UA 4DV5J 1LFPA 1X5TA 4LF4F 3NG8A 1T3NA 4P9SA 4IQXA 1NBEB 4WJBA 2DIVA 1JLBB 2E1RA 1S57A 4A48A 5HLFA 1K73T 4M8LA 2BDPA 4DPTA 4JI4F 2YWGA 2YQ3A 3ILIA 2ILYA 4NL5A 3L7PA 1UP1A 3FNNA 4QIFA 5AXLA 1X5OA 2VG5A 1MWZA 2YY3A 3SFGA 3OREA 3H3VL 4C0BA 4C3JK 3PO3C 3QIPA 1PGZA 1YHQS 3DRSA 3S16C 2MZJA 5D15A 2LQ9A 1F60B 2MQQA 1N4LA 1IKWA 1S10A 2K7KA 1ITPA 5C42A 4QWCA 4FVCA 1QVFR 3IR6B 2ZHBA 3QLHB 4RNOA 4KR0B 2ZVIA 5IV3A 1V5IB 5THWA 2ROEA 2HSEB 4EO8A 1U48A 3KK1B 4FYXB 4ECRA 2HQIA 4YR2A 4G1PA 1E6YA 3KHGA 1AFIA 5AE1A 3IS9A 1RT6A 3T41A 1TL1A 2YKAA 4RNMA 3TP2A 5E3RA 5JVHQ 2HWTA 4PQAA 4BLGA 2H48B 2FZKB 5B0FA 5DQHA 3FMBA 3L3CA 4QR2A 3K89A 3GMGA 3H2LA 2EC2A 1S9GA 4WE1B 1FJGF 3SCKE 4X4RA 3VAGA 2YXLA 4UTGA 3UPFA 4Q8EA 4NX9A 1YG0A 2BANA 5DLGA 4B3OA 2OD4A 4B3SJ 3C6UB 4A3DK 4ED8A 1Q4RA 4ZH4A 3W9HA 1YZ7A 1PC4A 3L09A 3EVMA 5AE2A 2PO4A 4LF7J 4G3IA 1FWKA 5KFWA 2ATCB 4ICLB 4DL4A 5TMFA 4KE5A 1U1LA 4LR8A 3F73A 4OJHA 3U1MA 4ZP6A 1JK9B 1K44A 2B4UA 3UCGA 4NASA 2ZUEA 4TVAB 3LANA 2HMIB 2VBXA 2FJBB 4IDKA 5HQLA 4BWJA 3AHPA 3J7YU 4PG6A 1ZZNA 3IRWP 1KN6A 2VUGA 3HOUK 1WI8A 2LQJA 4G65A 5ETOA 2CKWA 2RE1A 2ZWPA 3I55S 3B82A 3OLBA 3ISZA 3QWPA 3Q8SB 2ZH9A 4CLPA 1IBCB 3MPVA 3BO2A 1C0AA 3NNAA 4CP5A 2YU9C 1Y9OA 4AXJA 2GVDA 2R92A 3IGNA 4I64A 2FD2A 1N5TA 5BYSA 1Y7PA 1O2BA 4TY8B 4A8QA 4GTEA 3HO1A 4N8NA 1EKSA 2ROGA 2VKRA 4DCOB 2YVSA 1TWHA 1WDDA 3RW7A 4Q4ZA 2WAQL 2W7VA 1OPIA 4ED6A 2E9RX 2CG4A 4DL5A 3N0BA 1AW0A 3AY0A 4ZPTR 1S5ZA 1YLXA 1N32F 2UV8A 3E3XA 1QAIA 2NQPA 1USMA 5ETNA 2WW8A 1HBUB 2KT3A 1SH2A 2GHWA 1XR7A 3UR3C 3MEEB 4DSIA 3HKWA 2DIUA 4IRKA 2NXNA 1FFGB 2WOMA 4OJ1A 3M1VA 4O3QA 1TWFA 3PR4A 1MW7A 2D74B 5BYQA 1FHTA 4QBUA 1W7WA 3VAIA 3M8SA 2UXBJ 3FEZA 5L46A 3OTOF 4PWUA 2JNJA 3P5BP 4BDPA 1Q82T 5AXNA 3NGSA 1U0HA 3HZEA 1C4CA 2GSNA 4HT5A 4FDFA 2K3IA 3K57A 2HZCA 2DNZA 2H54B 3NKYA 1R31A 4QW8A 4GC6A 4UZBA 2RMLA 2AZ1A 3PFOA 5H9EJ 1L3UA 3TA2A 1O26A 3WDOA 4USTA 1JLFA 4PYAA 4C8LA 3DRXA 2VUMK 4L3NA 5LJ3Y 1B4BA 4YOEA 3QFWA 4H4OB 3GTJK 1WHWA 1OYEA 3H40A 1WEXA 2AF6A 1HNVA 1FRLA 2JA7C 4J9MA 2LEPA 2CNLB 2DY9A 1C0TB 1HHSA 2HK2A 1TL7A 3PCOB 5HMZA 3ZZYA 4OZJA 4YDDB 2GJ2A 1SJ1A 2NVYC 2GO8A 3MF5A 3M4OK 3FVYA 4JI7J 3K5LA 3J7ZT 2HVZA 3FKIA 2YKNB 4NZ6A 2V5HG 4EO6A 1NK0A 5IYDC 3V6KA 3ENWA 1UFKA 3AOAA 3TW0A 1CBKA 2VG7B 2Y1IA 4ZCIA 1VQKS 1PYOB 3K5NA 4RR5A 4X4NA 2ZUFA 3LAPA 2D3O1 3GFYA 4JUZA 2DISA 1N0UA 1RLDA 4ZPAA 2B7CB 2P9EA 2JEIA 2P6SA 1F9EB 3D66A 2PA3A 3TQEA 4B3TJ 2AT1B 3N28A 1MU2A 4URSA 4BCAA 2GGPB 4ECYA 3GTYX 2CNNB 1KD1T 1KRPA 3D7SB 2VBYA 4GTFA 1QAXA 1TWGA 3G82A 5A6WA 3DKDA 1SFOA 2HBYB 3D1OA 4MFBA 4A3FK 1O2AA 2QEXS 1K83K 2NCKL 1KP6A 2OMOA 4WJ3M 3PFEA 4DR2F 1HNWJ 2NYIA 3VGUA 1WUUA 1MN7A 2R8JA 1Q95G 4WBFA 3KJFB 3VGSA 3QNWB 4WFYA 4QPTA 3W62A 4PCQA 3UVJB 1TL3A 4AFFA 2L08A 1SKUB 2VG7A 2WW4A 1TL1B 5LMUJ 4Q43A 3E2EA 3V4MA 3PW2A 1HMVB 4P75A 1SB6A 5A0YB 1HARA 2D1CA 4F3MA 2VHGA 3MFIA 5FLXU 1WC5A 3HXMA 2P9GA 1U26A 3M6UA 1RCOB 3DYAB 5EDWA 4A4JA 2CFAB 4L73A 3S2HC 4DQSA 1JOEA 2E5IA 5E3PA 4DUZJ 1PBUA 3C3LA 4ZPVR 3GEEA 2A10A 4ICLA 2AGPA 5IWAF 4B3TF 3W3SA 2FDNA 1CJTA 4DFKA 1CC8A 2IA6A 4RBTA 3FZ2A 3S0XA 1RHUB 3TQ1A 1B70B 3W2VA 2IRYA 1TZ0A 3BSOA 5CCLA 4DV7J 1F3FA 3H8YA 2L41A 2MKIA 4BXXC 4JV1A 2YKMA 3HVAA 3NWRA 2CQ1A 2CWKA 2V2QA 4CYUB 2HFNA 1DTQB 3P4UB 3P8BB 3VAKA 1UL3A 2B63K 5IOLA 4LF6J 5JXSA 2BMBA 2WB4A 2YU9K 2R7VA 3EZ5A 4BY7C 2YWKA 2RDJA 3BGRB 1XPPA 2EXUA 3I9ZA 1YIJS 3CNQP 4A3LC 3HULA 2AKWB 1QJHA 1RAJA 2B8PA 4ES1A 3H5UA 4C0HA 2FB0A 1BMQB 3SSQA 2C2EA 2CVEA 4KC6A 2RGRA 3OFGA 1TAUA 1PAUB 4LR9A 2VBZA 1EZZB 2XLKA 1RUSA 1DRZA 4ZK7M 5A0YA 1ZAVA 2JZ5A 4KY3A 2PPBA 3IMQJ 3M4XA 1U2FA 2E5JA 3MCOA 2KRRA 3I87A 1R0BG 3K17A 3ELHA 2XSFA 5KFZA 1REVA 5CABA 4KGMA 3GTQA 2IY5B 4RW9A 5F41A 4RWWA 3M8QA 3G6XA 3ZZRA 3ZZZA 1T05A 5I42B 2UXBF 3PHEA 3DXBA 1EB0A 1Y1VK 2RRAA 4RW7B 3FFIB 1V5VA 3RZDK 1CSJA 3VV2B 3O44A 3RUBL 3AT1B 4WXOA 3C19A 2BQUA 2RQMA 1YRXA 4DBQA 2OPRB 2XZTB 5IP9K 3LP2B 1S1VA 4IOCQ 4GVBB 3OVAA 3MPDA 4PG8A 4PR6A 4OI4A 1L3TA 1KS2A 3D0HE 4YHHJ 1QE1A 1YX2A 2CPFA 3BR9A 3FBCA 1RTJB 3MMCA 3M2RA 4LR2A 1HW8A 2Z2MA 2HW3A 3TNVA 4NLVA 4B17A 2AJ1A 2JVRA 1Y1VA 1N52B 3QIDA 2Y0BB 2CFXA 2R92K 3AOBA 1R9TK 1RT1B 2VASA 3D4JA 5IOSA 3ZTQA 3WIUA 3G8QA 3PYFA 3BF4A 1WACA 1DQAA 1K9MT 1Q8BA 1HNIB 2APOA 2ASJA 3G4AA 4USWA 3AA9A 3CCWA 3MUTP 2AX1A 1B0VA 2X1BA 3MECB 3PW0A 3V6DB 2MSSA 2A2DA 2VONA 3E51A 1VQ8S 3UW1A 4XIUA 3I82A 1KQKA 1O6XA 3RB4A 2G9OA 4TU8A 3IM9A 4WP3A 2W2OP 4R0EA 4A3MC 5C7PA 2B9WA 1HKAA 4ECZA 2IBOA 3MR5A 3OPKA 3ZTRA 2ZH4A 4ITSA 4WFBQ 4KGVB 4DR5F 1LFWA 2O3DA 1N8RT 2HHUA 2GX8A 2BKNA 1LXJA 2D9OA 3Q8RB 1JLCB 1H3DA 2B6AB 5L39A 3EGZA 1JMTA 1U0HB 2E1CA 4MEYA 4M5IA 4ID5A 3QT6A 2Z4PA 2N4DA 2BV3A 1FKPA 4C3HK 4M5JA 3CF5Q 4ZOSA 3QT7A 4EZ9A 1RK8A 3CIMA 4U7CA 4WF9Q 4NZ7A 1RTDA 3T02A 3BGOP 5A8RB 2HQFA 4O3PA 2E5GA 4DDQA 4ZVFA 3WX8A 2DR5A 1Q1KA 2XMJA 5GAEU 4PEOA 1ZBSA 3MDFA 2CJKA 2JC1A 1WOSA 4LQ9A 1RU2A 3N5FA 4LVNP 1S12A 2DITA 3RW6A 1RTIB 1UEUA 2JA5C 2NVYK 3N4WA 2ZOGA 2GJFA 4LSZB 1VQ7S 2W01A 3QIPB 5EN1A 5HP1B 4LREA 5AJ3F 1BJTA 3PXGa 2EG1A 2MTLA 4K0KJ 3WBZA 3GTOA 4OZ2A 1N48A 3FJ2A 5HL8A 1GT8A 1TKXB 4OYOA 2OHDA 1U02A 4ED3A 1ZM9A 1D8YA 1DD5A 1IKYA 4ETZA 1JLAA 1EARA 2WHOA 3MD3A 4EBCA 1X9WA 3M9MB 3ZZ0A 4LSLA 4K4SA 3GU0A 1XR6A 4LF5F 1KDNA 4FXDA 2MQ8A 1LK7A 1NPKA 1MROA 5HBMA 2FPHX 3CDAA 1XWLA 2CNOB 1X9MA 2V6AA 3I4HX 3I4MC 1TK0A 1YJ7A 3KTQA 1VQ6S 2AD9A 2AQ4A 3SMZA 1O24A 1T9XA 3BGLA 2E2IC 2RILA 2Z58B 3OW2R 5D0RA 2F63A 1ZVUA 1UVLA 1HNXF 2JA8K 3NGUA 1Q7YT 3OR2B 3W66A 4DV4F 2JRSA 3NP5A 2RRNA 2XYPB 1XZPA 4XTTA 1IKXA 4A3GC 3L9ZA 2XC9A 3MEDB 3FOFA 3V6DA 2CJXB 4M5HA 2IAJA 5A2QY 4QU6A 2B56A 1WC3A 2HHSA 3R6LB 4DEZA 8RUCA 1WNEA 4AUKA 4F7VA 1X8DA 1KVJA 2UVVA 1A7GE 4IR9A 4W4MA 2RJZA 1JNRB 2A68A 3MAHA 3HSJA 3LAJA 3R3TA 2CG8A 3GTKC 2V8HA 3HDSA 3CC4S 3S7RA 5KT3A 3OTCA 2E1PA 1SJ4P 4HT7A 5GAGI 3LP0A 3EYZA 1F7UA 2IM1A 4UZCA 2HQ3A 1ROFA 4UQGA 4AH6A 1GX6A 2KI2A 4FNHA 2QLXA 4P2SA 3N6MA 3RZOK 1MG7A 3PVXA 4A46A 1VLYA 2YNIB 3SBMA 1X4HA 2IFXA 4RW7A 3HLUA 1VRTB 3S1RC 3CCZA 3PO5A 4A47A 1RKJA 3RZDC 4Y52K 3DLLQ 5D4OA 3ENQA 3OEPA 5A76A 3V4IA 1RAHB 2J0XA 5IYCC 2JHEA 4RU2A 2KZZA 3CJKA 4OYMA 4JI0F 4NLTA 5CZVA 1S1UB 4M1KA 5B09A 1AUSL 5L1JA 4FXWA 3HOWC 2I1RA 4U7UD 4G7ZA 2XNRA 3Q8PB 2X51A 5KG4A 1FD2A 3I6PA 4J9KA 2WB1L 1PIEA 4WP9A 1OQ6A 1QTMA 3MPWA 3GTOK 4J37A 1TK5A 1TKDA 1T03B 1FKAF 3QRRA 1UEKA 5HMYA 4Y2IA 4C3HC 4TLRA 5C3EK 5F9NA 4Y7NK 4L75A 2ASYA 3FRZA 2DNMA 1ICEB 2K3KA 1VQYA 1IBMJ 4M5DA 1JLBA 3MMJA 4CYUA 1TKXA 2Q1LA 2C3OA 2ZH1A 3CUNA 2OPRA 1YJNS 1QUVA 3IBWA 3K5PA 4B3SF 1FF2A 4JI6J 1GMVA 5A8KB 5HMXA 3QQCD 4I67A 3HZGA 4P2FA 2B8QA 2YNGA 4NMXA 3ENVA 4ZIWA 4LK0A 1SC1B 3I4NC 1UJ6A 3U1LA 3UWTA 4RW9B 4M5DB 3VZHA 1JXEA 3D3CJ 2ZUGA 2KO1A 2HHXA 4C11B 1R6YA 4BBSC 4DL3A 4URQU 4USKA 2A69A 3NUHA 3GTLC 4LF8F 2XWXA 3PACA 1XK8A 4ED2A 2G2YA 2HGMA 2YH1A 4OI2A 4GTBA 4LF6F 1XNRJ 2KTQA 1N5YB 2E7WA 3CCJS 3DYAA 1H2UX 3Q8QB 3H7HB 4FN5A 4OMFG 1J5OB 3DLBA 1S76D 2XG8A 1ELOA 4A3EK 1WI6A 3JYTA 1V9OA 4TQRA 1R9TC 3LAKA 3V81A 1AXQA 3QGHA 5IM0B 4MAKA 1RT1A 5JUMA 2J8SA 4EU0A 2IVMA 2XS5A 3R1LA 1U47A 5C25A 2Y3PA 3TFJA 2KT2A 2YKMB 4TY9A 5L8RC 4CO1A 5D77A 4DR3J 3W2VB 2CQHA 3J7YI 2QC3A 1YZ6A 2XLIA 3K5OA 2D9PA 4R25A 4GKKJ 3CCVS 7AT1B 1XNRF 1JQWA 1JLGA 5F8IA 5ETQA 1IBKJ 2GMJA 3HD2A 2KJVA 3DRYA 2OPPA 3R2CJ 1WOOA 1EP4B 4PXCA 4MYUA 3QWUA 1Z2LA 4DR2J 3FKBA 1DLOB 2QL7B 4RKUC 3KHRA 1VOMA 1OQ3A 4Z37A 1L3SA 1WELA 4OYIA 1F5AA 4IH7A 3W5YA 4NCGB 2HRYA 5FLXY 3D1QA 1KVKA 1RAFB 3FEXB 4ZVEA 2DXDA 4ANCA 3BYPA 4DR3F 5KFHA 3H42A 3S1TA 1UWAA 2NR0A 2E2JC 3F44A 3UD5A 4B9MA 1RWWB 3H3VD 4MKBA 1YNNA 3EDRB 4M63A 1IBMF 3S15K 4NYPA 4F0MA 4A3LK 1H38A 3G2XA 3I56S 5GADI 2HS0A 2KM8B 3T01A 2LDYA 3CCTA 5C4JC 1OMSA 2XMWA 4Y28C 2XTJP 1SI9A 5F8LA 1DURA 3RGIA 3PM9A 2UUCJ 2OFGX 4PPZA 4AE5A 1LW2B 4X4UA 3CCES 5K8OA 1I50A 4P2XA 4DV1J 3M2VA 2LKZA 3NY0A 4ZA1A 3TAMB 4K4ZA 1I6VA 5L9NA 3CB4A 1TWCA 1YJRA 1YJVA 4USIA 3FZBA 4I68A 1NK7A 2HGNA 1WTBA 2FLLA 5E68A 2YWEA 4F26A 4LF7F 5K20B 5CHPA 4J9PA 1FA0A 3H20A 2JEFA 2DO0A 5D6GA 5DG8A 2UVUA 4MJKA 2CPIA 3TZYA 1EETA 4YB6A 2JVOA 1U49A 4XO0A 1GMWD 5K14A 1FKOB 2RHSB 4DPXA 4UOHA 1VBXA 4ERDA 3H0GK 3EX7B 1I6JA 1CLFA 2F4VJ 3CEDA 1D1UA 3ZXWA 1HMVA 2XEXA 2GAHC 5LOQA 4KGKA 3VQSA 5A6PA 4M5MA 1AA1B 4Z2XA 2K06A 4WIIA 1YCLA 3IXQA 4A3CK 4GTDA 2IDEA 2V94A 5HMWA 2NLWA 2A3JA 3G6VA 2UUBJ 2IJRA 2DH7A 5IOQA 2UXDJ 2J76E 3RR8A 3TJAA 2R9LA 2HRTA 4JBCA 4ZVSB 4KIAA 5DZ6A 3VCDA 4G7OA 2VG6B 1N33J 4OYAA 4X66F 3ETOA 4LRBA 2XO6A 3CWJA 1Q8KA 3R6GB 4ZJLA 5DG9A 3MM7B 1HHQA 5DGBA 1IBKF 2CFAA 1IW7A 1VYAA 3F56A 2H4YB 2G1HA 3UCUP 5HN0A 3BH6B 1WJ9A 3MOJB 2JA7A 2ZOFA 1RHRB 4NA1A 4WU2A 1SJQA 4RUCA 2GHPA 2DH8A 4ZPWR 1N6QB 4DUYJ 1WF2A 3HOUC 4UT4A 3HK2A 3SFUA 5KOWA 3KHLA 2Y1JA 1YQHA 3BN4A 5ADZA 1SFOK 3BDPA 4Z7YA 1Q8IA 1SQFA 3QSYB 2EFQA 3A4TA 3KJNB 3GTGC 4IQMA 4CH0S 2HHHF 4ZVRB 4OFZA 3GWCA 2DGXA 1NDPA 2A6EA 4KO0B 1T02A 2CJAA 4UY85 4ELVA 1S1XA 3JAMU 1FRKA 3PO2K 2J9DA 4PUOB 1C1BA 1RZMA 1Q16B 2YNIA 1VGXA 1MWQA 4I2PA 3CCQS 2N7YA 4F4YA 2QLFB 2C42A 3S14C 4X65F 2O5IA 4OZ5A 3U7JA 1G4CA 1G2EA 2YNHB 2VUMC 2DGVA 2BZ2A 2KU7A 3GLJA 1LXNA 2CZ4A 3R27A 2FC9A 1UW9A 2F9DA 4S0MA 1CJVA 4AT1B 4IH5A 1SKSA 4JI0J 1RWNB 2ILZA 2UUTA 3DNCA 1JJ4A 1NMEB 1X5PA 3GIIA 5G4DA 1WG4A 3RBDA 3PG9A 4KN7A 2QA2A 5KT4A 2XHCA 1RHMB 2FLPA 4KN4A 2XGQA 2X3DA 5T7LB 5DZ7A 2F9JA 4AL6A 4A8KA 2XY6A 2LFVA 3G6ES 1CJKB 4NXNF 1NPPA 4MEXA 2JH3A 1Y3KA 1GMWA 1J6VA 4U7UK 1USOA 4NLGA 3BM7A 4OI0A 1S72S 2XS2A 1HD1A 3MM8A 2HLUA 4C4WA 1XMOJ 1RLCL 2GSOA 5E3AA 1YITS 2CZ9A 2HWHA 4EI2A 3CJQA 4WK1A 3IAM9 2VQFF 2OIHA 5HVHA 1CJUA 4ED7A 4DQIA 2CJYB 4TXSA 4F4AA 3CJTA 3TR5A 4DCJB 2ZWOA 2FLNA 4C2MK 4O0NA 2JA8C 1RA7A 1F5CA 5AE3A 5GVQA 1OY9A 2WBMA 4EEYA 2V4JA 4ELUA 4AQYF 2QRRA 2CJBA 3X1LB 4FXVA 5IC6B 1TWGK 2DTJA 4LFCJ 1CULA 2MGZB 2HNDB 2YNFB 2BM1A 3VALA 5KFYA 3POTB 1U25A 2J8AA 1VFJA 1WCMC 2E66A 2CQ4A 1NHVA 3ILLA 4QYZK 4Y00A 1QSSA 1FXRA 1OWXA 4K4TA 4FM9A 3GTMK 4QWBA 1FKPB 4CNZA 4DLGA 1S1WB 1RABB 1R8PA 2QYCA 3M1VB 3VQTA 1Q86T 2VG6A 3KLHA 2ZH6A 2CQCA 2K7JA 4HH1A 4GC7A 5E2QA 1S6UA 4GVLA 1HWKA 4OZLA 1GX5A 4DV2F 1EAYC 4LF5J 4R8UB 3HVTA 3UDVA 3ZTPA 1B4SA 1TKZA 3QJLA 3ITHA 2R7SA 2W7OA 3MEDA 2DHGA 3Q2TC 1F0XA 4QIEA 1FCAA 4RW8A 1YKWA 5F8HA 3TYTA 1KQ4A 1M5VC 2GAGC 3PHTA 1X5SA 3MUVP 1T9TA 1LW0B 4QU7A 1JQGA 2BW2A 4F8RA 4Y52C 2DH9A 4CO3A 4IG3A 3GILA 1IE0A 3CDWA 3GJSB 2KXFA 2R7UA 3DRRA 3V5RA 1RTDB 3HHLC 5GMDA 3TUZC 2IHR1 4DZ6A 4J3NA 3CJSA 2CPXA 5CA5A 2YPZA 2IC3A 1RCXB 3JQKA 1ZPVA 2CQ3A 4CO4A 3SQGA 5LXRA 4N77A 3PIPQ 1NH7A 2AW0A 4J90A 2HNZA 3EWGA 4ZLNA 4LRAA 2L48A 5M5WK 2NVTC 3CVKA 3TANA 1RWKB 1PSDA 2EVZA 4IG0B 3KLGA 2OD6A 2M9KA 2PI4A 2E5HA 2OTLS 3JSMA 3BBBA 4RZRA 4DR1F 2YKPA 1LOUA 1I51B 1PJ6A 4X4VA 5D4DA 3KXDA 2BEFA 1TVRA 3PRBA 3BREA 4RL1A 2F40A 3SI8A 1U1NA 2R8GA 1TWGC 4HI2A 4G1IA 2BJ7A 3I31A 3FBEA 4NXNJ 1RWUA 1WHXA 2DNLA 4WZQA 4PABA 3RBXA 3T6JA 2J9CA 4ES3A 1TKTB 3KK3A 3W2WA 4KH0B 3TUPA 5M3FK 3L4KA 1VK8A 3BKFA 2V9WA 4Q0BB 5ETTA 1Y4ZB 3MOZA 1M5OC 1OY6A 2IM3A 4ZIVA 5F3ZA 2CPYA 3KK2A 1S9EB 3GIJA 2RDIA 3WODA 3S1NC 4DG1A 2FQOA 3HVTB 5KT2A 2GFFA 3BKUA 1AT1B 2F8HA 5KFUA 3ISND 3PYGA 2DGQA 2XZWA 5TMCA 1VGYA 4DV4J 5JJBA 2FUG9 2X7IA 3R5CA 4LT6A 2B4PA 3NCPA 5IWAJ 3MM9B 4NLXA 4GMKA 2NXJA 2AX0A 3F0NA 1SIWB 4USVA 1WD6A 2Z56B 3TUJC 3G86A 3CQZA 5C24A 4OZNA 2MGZA 4PPDA 2G0JA 3SQOP 1X4EA 5D0EA 4KAIA 2DGOA 3S1MK 5A8WB 2W4PA 2KL8A 1UA0A 1F93A 4ER8A 1F1BB 2GNKA 3CCMS 2OEJA 1ISEA 1F2HA 1K83A 4CTAB 2IMWP 1R0AA 4B08A 4BC7A 2MJUA 1O5JA 5K9FA 1VDHA 3KDNA 1I3QA 4I6YA 3BZQA 2O5JA 2DR6A 5SZTA 5CCMA 2GQCA 1NK6A 1H98A 1T7PA 1RXOB 5IFMA 4FYYB 3KMQA 2YPYA 2ZC4A 3TVKA 3HSGA 1RWXB 4I2QB 4DV1F 1EETB 4G1QA 3PW7A 3S1QC 5HAOA 4CCHA 2N82B 4YMEA 3IO1A 2DGUA 3MM8B 3THTA 1YBTA 4F2RA 5IYBK 2NVXK 3QGIA 2GIFA 3Q83A 4J9LA 1FRJA 1WWHA 4URGA 5IT0A 4YFUA 4KT0C 4PXEA 3GYXB 3P3DA 4DL6A 2BA9A 4GTCA 2V9KA 5GAGU 4KPYA 1RISA 3MUMP 5I3UA 4A3BC 3U27A 1I3QC 1IR0A 1S49A 4OHZA 3R8YA 3CJ8A 1REGX 2XMVA 2HURA 1PYSB 3RBZA 4DX7A 1IUJA 1WQHA 4YG2A 1YBUA 3A3NB 1JLQA 5F8GA 3SCIE 3MMLB 3HFZB 1GXTA 1RT5B 3D6FB 2GV1A 2CIMA 1LW2A 2OMLA 4HDHA 5DLFA 4F4KA 4WIQA 1AZSB 1FX4A 2CPDA 2M52A 3SYZA 1SL0A 3BBFA 2QGFB 2AJ2A 5F0WA 2E9TA 1U1KA 4OHYA 3DOLB 1I6HC 3OSPA 2ZNZA 2JA5A 4Q0BA 1DQ8A 3CCUS 1HWJA 3GTMA 3GV8B 3ZTSA 2KH9A 4FZVA 2I0XA 3RRGA 4C8OA 4ZJQA 1ZM2A 4JYAF 2GJIA 2DEJA 2CZVC 3WZ0A 2P5MA 5IT9U 1HI8A 2K1RB 5F9LA 4MQ9A 2MKCA 1N88A 3EGNA 1BWVA 3VF0B 2UVWA 4OYWA 1FESA 2XI3A 3NXZA 2E5LJ 5LSOA 1BQMA 1S0OA 3I0SB 1S0NA 3O2IA 1PKUA 3D9BA 4ZPDA 2WZ1A 3FSIA 2G2ZA 2V8DA 2MZQA 2QV6A 2R42A 1N5SA 4NLWA 1HQEB 4DS5A 4DU7A 1OPZA 4NCGA 1NM2A 4HTIA 5KAKA 3J80Y 2DHHA 5KTQA 3G6YA 3CMES 3UVJA 4C2MA 1RT2A 2MDAA 1OY8A 5U47A 9ATCB 2AV5A 1IKYB 3BO4A 4JV0A 3GR0A 1NJZA 1G1XA 2RKIA 4FPIA 2FVPA 4HACB 5TJ3A 3BN7A 3HJFA 3LWMA 3A8EA 1MWYA 2AGOA 1VI7A 1EQMA 2RNEA 3B54A 2LEAA 2IDLA 5F8MA 3SZYA 4H4MB 3HOYK 1I3QK 2B5JA 4MK9A 2XMUA 5KFFA 2LXIA 1XTZA 1NU4A 4O2DA 1SJFA 1JJ2R 4M94A 5J1EA 5LMUF 4V19X 3K5MA 2Q6CA 1Y00A 2GQ2A 3MCMA 4Z7CA 5M2UA 2C1EB 5KFSA 2RF2B 1LWXA 3VGVA 1ZETA 4FZBA 4O4RA 2CAJA 1RA6A 2F4FA 2FY1A 1N6QA 5H9FJ 2VG5B 1BDFA 4R8UA 5MAOA 4DL7A 2IPOB 1OIAA 4BS2A 2NVXA 3IC1A 1VRUA 2ZITA 1AUDA 3OPFA 1SXLA 4DV7F 1M1HA 2FGCA 3M2UA 3PO4A 2AWZA 2C2DA 4KAWX 1BE4A 4ZMMA 5EHHA 1X4GA 3KLHB 2ZHAA 1BQNA 1D3WA 1SL2A 1TWAA 2MSTA 4JB8B 2R93C 4M5GA 1ZYQA 1F9HA 2V50A 3DHWC 1QUPA 3IWLA 3X3UA 2KG1A 1WORA 2WVFA 1HBMB 1JB0C 1TKZB 4CTAA 4RWXA 4LRCA 4OI6A 1YK9A 3FCVA 2DXFA 5KFOA 2QA4G 1FO1A 5EWFA 1IVZA 4X4PA 2YNGB 1ZM3A 3HHLB 4W90B 2V68A 1BHNA 1N5VA 4M1XA 3ZO7A 2OSRA 4FS1A 3JSYA 1F9FA 3A3PB 4EGLA 1RHQB 1QVGR 2HAIA 2R7ZC 1JLAB 1X7VA 2ATLA 4HI1A 3TUIC 2HPUA 2ZJQQ 2MB0B 3S2HK 3GIRA 4YB1P 1S1TB 3ZNJ1 1TL5A 2ZJRQ 2HHVA 3M2UB 5ETKA 2GMHA 3D6MB 1UKUA 2PIIA 2AJQA 3LH2S 3I9V9 1DJ0A 4KMAA 4X64F 3NBPB 4RNHA 4O3RA 3C16B 3NGDA 1XZQB 4EWTA 4X84A 5D4NA 4LOWA 5KG1A 4Q2MA 3B4DA 2ROPA 3TAMA 1KQFB 1KLMA 2VZ9A 4DSEA 2FQQB 2LECA 1O25A 2HBRB 1SIZA 2J6TA 2YTCA 4MFBB 3DI6B 3OL7A 3CW2C 5CXTA 2A0FB 1UJ5A 3IBFB 3W65A 4ANDA 2PN6A 2EBGA 3VWSA 2MJNA 5EWGA 3EZOA 4YR3A 2XSJA 4RPFA 3H5SA 1ZYRA 5C4JK 4FNIA 1WTFA 2LQ8A 3BGUA 4GKJF 3GTLA 1ZAXA 5M5YK 4TKTA 4OX9F 2H65B 3CJRA 2JJ4D 4Q7AA 1NDKA 4DG1B 1S99A 3BBCA 5KFIA 4WXWA 3OHAA 3AH6A 5DDPC 4C9DA 3LP1A 4LFAF 3OTDA 2GA7A 4ZVGA 2VQEF 1XC9A 2YNHA 2KG0A 1L3VA 2KN4A 4K2XA 4DV2J 3UNYA 3K58A 4BWMA 1VQLS 2MQLA 3KJVB 2BR0A 4J9SA 1M5SA 2HNYB 2IAJB 3T1YF 3IWXA 1LW0A 2M5YA 1Q81T 1J5OA 3MM6B 3CJ0A 1JKHB 2WAQD 1B7YB 3DC2A 1I94J 3DU6A 2F65A 4U8VA 2KWAA 2DGSA 4QR1A 4PXBA 2ZH8A 4OIPA 1NKEA 2PA8L 3AAWB 4DR7J 2QIFA 3HHDA 1KSPA 5FD1A 1YGYA 1HR0J 3W60A 4PZVA 2R2TA 3GTGA 1ZTTA 3C6UA 3M05A 3IRXA 2JWNA 3S1MC 2NREA 2CADA 1EIYB 1FJEB 2FJWA 4LSLB 1I1GA 3QMQA 3QX3A 5DG7A 2FHKA 1GTEA 1V6HA 2CJ9A 3OQ2A 5KG3A 3EE3A 1IN0A 1UZDA 1GXUA 2JSXA 3C66A 4X4TA 1I94F 1J6WA 2PMZD 2XCRB 3AB4B 2DXEA 2EBEA 2PFDA 4LLGA 3G9CA 3D3BJ 4WFXA 4C7QA 1YVFA 2L9NA 2Y0SD 4J9OA 3QLHA 1MMLA 5ITHA 4I2QA 3RTVA 2HFUA 3K7RA 1NSQA 1LWEB 5HJXA 4KV8B 5KFEA 4JI1J 3V2UC 3ISNC 2BX6A 3TO8A 3BO3A 3JS9A 4KHMA 3AA8A 1HW9A 3NNCA 4BBSK 2G13A 3LO3A 3AOCA 3RG6A 3LF0A 1H0HB 4OIOA 3AJ2A 1Z2ZA 4XDDA 1WQGA 1VQOS 4O3OA 1GQEA 4Q45A 3C16A 4KV8A 1HWIA 5A8KA 1CS4B 2OH2A 2V69A 2DGWA 4YFKA 1B0TA 4P5BA 4HHHA 3CQZK 4V1Ak 3T00A 3HSZA 3MCNA 5JMNA 1S7IA 2OLWA 4OIXA 1NO8A 5KFPA 1RAGB 1H6KX 4P5AA 5IP7K 4J9RA 1OSDA 2CQDA 2XMKA 2CW0A 3NEKA 4OZ3A 3NOGA 4P71A 4D3HA 4NOIA 1KTVA 2Z0GA 2GVDB 4OHVA 3KLIA 2A6MA 3DLEA 3H4DA 2J9EA 3FHZA 3M30B 3TVYA 3UE2A 3ONQA 1LQ9A 1RBAA 1RJJA 1JIHA 5F8JA 3H59A 3RB0A 1CC7A 4N5SA 3M3YK 1R8CA 2FHOB 2IIHA 3I5BA 1KWMA 1Y1VC 5LSLA 3PO2C 4I2PB 4X6AK 4LUBA 4FVMA 4YB7A 4QQBA 2ZFZA 2H1YA 2W2PP 2HMIA 4GZYA 2RDDA 1FTCA 2A2CA 3K7AK 2DNRA 4DX6A 3T1HJ 3JXOA 3HVRA 2B4VA 5KFRA 4ILLA 5J1NA 2MKYA 1C0TA 4FYDA 1UETA 2FJAB 3WHIA 4CLZA 2HVIA 1O0PA 4CO5A 1J2VA 4B9LA 3DLKB 3CCRS 2CA9A 1CQNA 4K0KF 1FNMA 3MECA 2KFYA 1VK3A 3MTJA 4LIRA 4NLDA 5K8PA 4JV2A 1U4BA 1O28A 2KVIA 4CO2A 4LVOP 3IR5B 1M1KT 4LF8J 1DAXA 3V6HA 5L9XA 3MR3A 3HKZD 1VQSA 4G6VB 3MMAA 1MLAA 3HHNB 4ZVQB 3QYYA 2M4MA 3SEOA 2ASDA 3DGPB 1CJVB 4NZ0A 4OYZA 2KVQE 2VOOA 5D3GA 2CQ2A 2XSJB 2E44A 2LXUA 5J2PB 1URRA 4FYVB 3N5BA 2RS8A 2HBQB 2BBEA 2NXUA 4L6V3 5KFMA 2VQEJ 4L72B 5CYMA 3KOAA 3R97A 3NGTA 4P2MA 1ZA1B 3W5XA 2R4FA 2V4JB 4HL9A 4Y2KA 4PQUB 5HP1A 3ITHB 3CO9A 3DLHA 1SVDA 4M5NA 3S16K 5EX0A 4MT1A 3JYTB 4XAKA 5ETRA 1T9UA 2W24A 4WZMA 4KRWA 4U96A 3QO9A 2V0NA 4LFCF 4JI2J 3TEHB 3SZZA 4YR0A 2MXYA 3DU5A 2VICA 1B4AA 1LWEA 2JOQA 3H0PA 4H4KC 4AL7A 1NEEA 4YY3F 3JQJA 4P73A 1J5EJ 5HVFA 3QBCA 1K1QA 5DDQC 2Z8QA 1R8HA 3FEYB 3MPUB 3Q3QA 4L3KA 4G7HA 2QYGA 3W7BA 2Y3YA 5K8MA 4DUZF 4DU8A 4CIOA 2YKQA 3R5AA 4H4MA 4PG7A 3IRXB 3UQSA 3VR1A 2W9BB 2J5AA 1IBLF 3KLVA 5LMNJ 3NRBA 4U6PA 1UCNA 3IBCB 4O44B 3S14K 2VA3A 1KOOA 4K4XA 3PTWA 3BDEA 3GYGA 5IC4B 3DGVA 1XEZA 3EGVA 1VIOA 2UUAJ 3H0GA 4GO7X 4NRUA 3EPIA 3HP6A 5JFEA 4PUOA 4PRFA 2MLXA 3LWLA 1XMQJ 4KYZA 2RH6A 3VVTA 3KLEB 2PA8D 2KFNA 3EM1A 1ZXOA 1TU0B 1V3SA 4ECVA 4XPEA 4H4KA 1F5BA 1BXNA 1B7FA 2N3LA 4OYBA 2PI5A 2BANB 4A3KK 3EVOA 2ZH7A 4YN3B 2CYYA 1SC3B 2D3UA 1FT8A 1RBLA 1TUGB 5KT7A 3CJ3A 3GIMA 3L95X 3BR8A 5IZHA 1S4FA 4X62J 2F4VF 5DM7Q 2ZNYA 2OPPB 5L1KA 2K2PA 4I0WA 2ZBPA 1DLOA 2RUSA 4A8YA 1NJXA 4U8YA 4Q44A 1LK5A 4P74A 3FCWA 3MM7A 4QIGA 1PJ7A 4F02A 3QRPA 1LWCA 2BE2B 7FDRA 2R7RA 2E1AA 1O2FB 1SC6A 1BY9A 3EICA 1JXLA 5J2MB 2VKZG 1P1TA 3IG1A 4KFBA 3M6WA 3MR6A 2BJDA 4BXXK 4C48A 5E3CA 4OX8A 1WKKA 1NAQA 1R0CB 3DGPA 5CD4H 3D0GE 3EMTA 5D78A 1JJHA 1FEHA 5CQGA 1C1BB 2AHOB 3GZ7A 1T05B 4FF2A 1H7XA 3PKMA 2XCOA 3TZXA 1APSA 3MPYA 1KOHA 4NRTA 3WIVA 1RT4A 2H3EB 1X60A 1VR6A 2G0CA 3IR7B 4MIAA 3GCWP 4CRJA 1XZQA 1VISA 4A3EC 3VHQA 5IOTA 3L7UA 4KTQA 3C8YA 5B0GA 2L9WA 3TVZA 5BJRA 3DMJA 1BQMB 3CMAS 2JDJA 5D8HB 1S7HA 2VA2A 1S1TA 3SSRA 1VQMS 5JVGQ 4K7QA 4OI1A 3HXAA 2HWIA 2E7XA 1NNDA 2COLA 2DNKA 2CRLA 2DT9A 2BRLA 4QWEA 1I6HK 5BYRA 2R7ZA 3UR0A 3C6TA 4NE9C 3R9LA 1HWLA 5A2QU 1R0AB 2VFRA 3NMAA 1Y1WA 1NLKL 4LBIA 4Y6IA 2ZEJA 1UFLA 2HYIB 2DPJA 2PE8A 5DO2A 2R7WA 2YNFA 5G0RA 1IBAA 3HHLA 2QZ8A 1RAIB 3O3LA 5DDOC 4Y2CA 4OQJA 1XMQF 5I3UB 1ZZFA 3P49B 2G0IA 3M7VA 1H73A 5IM0A 3N6LA 2A18A 4OX9J 2AJFE 1KKHA 5LJ5Y 1OS5A 5C3EC 2BUNA 1SJRA 3MD1A 2OUGA 1K0VA 3R5DA 3RR7A 4JK1A 1TWAC 4NCAA 5HK4A 4ZVOB 2OSQA 4ECUA 2UUAF 2WSCC 3P45B 4OYXA 4MK7A 4NXMF 1TELA 3THPA 1Q5VA 2LXFA 3VA7A 5HANA 4QIWL 4JI3J 2FHMA 2PEHA 5AT1B 2PD1A 5HATA 3DMJB 4KHRA 3PYDA 5F0UA 4C8NA 1WF0A 5T14A 4UY8T 2VJVA 2XB2D 1X0PA 2CPJA 4QZVB 1AB8A 4IO9Q 3D6TB 3KG0A 2C28A 1Q8LA 4TU7A 2D3ZA 3PYEA 4D3GA 3WC2A 1LWFB 1Z4UA 4MKAA 1HBNB 2JFKA 2MY7A 3MEKA 4QIVA 1J5EF 3HCXA 2V8VA 1IL2A 3O1LA 4JI5F 2F7VA 4USHA 4ZCKA 3TFHA 1VRTA 4RNNA 3H25A 3Q24A 1UW4A 2JEGA 2OI2A 1WIHA 5D0GA 2QMWA 1D8ZA 5KFVA 1TMMA 4I6AA 1TV6A 3RJMB 4HVZA 2X1GA 1C4AA 1C1CA 1FDNA 2PMHA 2AYGA 5HI7A 5FJ8K 3Q2SC 4DHVA 4JYAJ 1FRIA 4C8KA 2H5JB 1T9YA 1S1XB 2PMWA 1EJ7L 4N47A 2MY8A 1RBOB 1RT2B 1P9YA 3HHKA 3GFXA 1R9TA 1HPZA 1GMUA 1FJCA 2C2OB 3T3FA 2IC3B 4ID8A 4B3RF 5DQIA 1P8GA 1BUXA 5GADU 2AP6A 4A3GK 1IQ0A 3HF5A 1N5QA 1RTZA 2EK1A 3JTPA 3J7AN 1FRXA 2VB6A 2A1BA 1EKRA 3OD2A 5E33A 4R5PB 4B9SA 2OP5A 3UO0A 2FJXA 5C2GA 3G8TA 2CPEA 1XZPB 4CLSA 5HO4A 4WK3A 4KKOA 3K8WA 4XK8C 4BLBA 4A3JC 4OLOA 2L3MA 3LA0A 3GIKA 1KFSA 3OVBA 3KJVA 1TWHC 2DRAA 1JLQB 4LBHA 1K1SA 1A9NB 4NMLA 4F2SA 3NL0A 3KWMA 5D4LA 3SIPB 2LCWA 1P27B 3GV5B 3FK4A 3JSMB 1ULRA 3TOQA 4MIBA 1D9DA 4BHQA 2YQ1A 2OPQA 2IRUA 2XHWA 2FC8A 1YDLA 1SUQA 2CPZA 4EUVA 4FBTA 1JWWA 4O3SA 2VFSA 3LP0B 1M1GA 2BXJA 1J6XA 1RWMB 2GHVC 3GJQB 4DI6A 2C2MB 1RYSA 1XERA 2RHQB 3BKTA 5CYJA 3J81Y 4KHPJ 4HR2A 1SQEA 4C8ZA 4N56A 4DV3J 2XQCA 3BS9A 2KXNB 1I3OB 1RWVB 1XQIA 1Q7LB 3JB9k 2VIHA 4IKAA 5LT5A 4A3KC 2B51A 2QLBB 2F1FA 4CLYA 3DI6A 1P1LA 4G0WA 1GH8A 4IFVB 5F3TA 3GB0A 1QLNA 1IR2A 2MZTA 2HAFA 1N5YA 1X4BA 4CT9A 1NSAA 2LYVA 3M4OC 3BP8C 2UV8G 5KG0A 1XNQF 2MQPA 4E8UA 2OO4A 1HFEL 1W25A 1W26A 3LGNA 2Y9HA 1B3TA 3MFHA 4J9VA 2CQIA 2WVEA 4O44A 4KM8A 2DNPA 1FD8A 3M9NB 2M2BA 4DFPA 5E5NA 1LEOA 5B0DA 1L0WA 5K5MA 3M8YA 5GAEI 1S0MA 4IYQA 4USUA 3TX8A 1UPMB 3JAMY 2ZVSA 4JI5J 3RZOC 1HIYA 2MQOA 4KBIA 3NCRA 1JNZB 2E9ZA 1MNEA 2O67A 1RYRA 3UDCA 3T5LA 4B3MF 2XBPA 4WP8A 3CMQA 4LSNB 2LMIA 2R2UA 3Q86A 4ZVHA 2EFOA 3FQLA 4A93K 3L7OA 2OGUA 3N3YA 3A12A 2NXCA 2KDOA 5IP7C 5M2RA 3NS6A 2FJVA 2KM8C 2B9YA 5GMEA 4K4WA 1RP5A 4QJVA 2FHJD 3R7BB 1ZH5A 4ZVUB 2DY1A 2IM0A 4DQRA 3CGIA 4TYBA 2QJ3A 4LQ3A 3C46A 2ZZTA 3QZ7A 3OR1A 2QL5B 4OYPA 1TWHK 4I56A 4PYDA 2VBWA 4WYWA 1XJWB 3CJKB 4KARA 2MZ1A 1Y10A 4MKVA 1CJTB 4F04B 3JSBA 1EP4A 1KHVA 3NNHA 4A8FA 4DPUA 5EX3A 4N8OA 3QGPA 3NS7B 2BE5A 3RB6A 5IV4A 4B3OB 2HNYA 1K8AT 2CXEA 1U6FA 1NK9A 1BGXT 4ZLPA 5KOXA 3KDOA 3G4CA 3GDZA 1SPBP 3OJSA 1TP7A 2ZD1B 4A8SA 4NA2A 3LP1B 5HBMB 1SCJB 2NUHA 3T6BA 4CI0B 3HPOA 3A8JA 4JI1F 3QZ8A 1YTYA 1YRTA 3R1HA 3FDSA 3W9JA 3M2RB 3MCSA 1FE0A 2QG9B 1C1CB 4ZDNA 2J7UA 4Q8FA 1WC0A 3EGWB 1TV6B 4K8RA 3B78A 4LMZA 4ZP9A 4OHXA 3Q8UA 3SDEA 3BH7B 1H74A 1OO0B 1RHJB 2ZOMA 3LP2A 4NLRA 2GGPA 4YB5A 3UI3A 4NLQA 2KJWA 2V2KA 4KATA 2W9AA 1GAOA 4BC9A 4F4XA 2JA5K 4RW8B 3CD6S 2KYXA 1NCLA 3VAHA 5B0AA 4C11A 5RUBA 3A13A 3A3OB 2HFSA 2DR9A 1YJTA 2IJNA 1DTTA 2GIQA 5HVGA 4LBPA 3FOEA 4J9NA 2VOPA 3LGMA 4MMOA 2OFHX 4H4OA 1VQ5S 4DR7F 4OIRA 2UXDF 2Y1RI 2BJ3A 1HPZB 2H4WB 2Q43A 3M6VA 2XLJA 2C3MA 1XNQJ 4C3LA 4F36A 4KPCA 4NLPA 2M70A 3PJ9A 1IR1A 2HHHJ 4DOZA 3BGRA 2WCXA 2J7KA 4P72A 3CXCR 2PEBA 4ECSA 1N36J 3U1NA 3I0RA 3DRRB 2R8IA 1WCMA 3UDEA 1JLFB 4RW4B 2QE5A 4IOAQ 3FQKA 4C0OC 3NMRA 3TTGA 3FCHA 2VPXB 2OJ3A 3EJMA 1NUEA 3BYRA 1HBNA 2XCPA 4IRCA 2RQKA 3T5HA 2HS4A 2FZCB 2UU9J 4KHPF 1S6PA 1VJEA 2BJ1A 4OV1A 3DRPA 3OJUA 2LA4A 1IQZA 2V6TA 1AFJA 1R6VA 4BBRK 1D9AA 2C22A 5A8RA 2VPZB 1HD0A 1TAQA 2OKQA 3GP9A 2VUMA 2I5JB 4OZ0A 2ZBQA 3W9IA 2VC1A 4C3IC 3T1AA 2DNHA 2FQTA 1N0VC 1XXCA 2R92C 4ID5B 2DEIA 2QN6B 3Q23A 4DPOA 2YU9A 4J7CA 3LOUA 2PHCB 5KG6A 4HH0A 5IORA 4DLEA 5G0RB 3D1HA 4OJ3A 4CH7A 4ECQA 1EI6A 2VL1A 2BACA 2B9XA 3VTIA 5C24B 4CWBA 1IQTA 2C3UA 2AJ4A 2LQ5A 2EFGA 3EDQB 3CULA 5DQGA 2D6FC 1SKWA 1DHMA 3R7NB 2DRDA 2BM0A 2QL9B 4RNFA 3ZZOA 2R93A 1KLMB 3EZUA 4E98A 1CJUB 3BEGB 4WTYA 1RDRA 2XZDB 3WC0A 3M8PA 4ED4A 5FLMC 2DHAA 5EUHA 4DF8A 2V63A 3C2PA 4MTPA 3HSDA 3UN5A 1KQGB 2ZZMA 2NPFA 3GTGK 3I0SA 2JEJA 2E2JK 5HL7Q 4R5PA 3C15A 2ZM6F 2CQ0A 1SFOC 1FERA 4LK1A 4YFNA 4WILA 9RUBA 5IQ6A 1RT3A 2XM3A 4DJBA 3KK2B 1S0VA 1FJ7A 2YBVA 2AYMA 1F9NA 1SMYA 1X31C 1HL6A 2HHQA 3DOMB 3HHLD 3M9OB 3R7SB 3HFKA 2HVEA 4Q5SA 2GCFA 4RUHA 2HK3A 3NAHA 1NRKA 3H90A 3OSNA 2RQCA 2BQRA 4GRSA 3PDNA 1D09B 3HOVK 5L38A 3TFIA 4KH1B 4DSJA 3CCLS 4XLPA 4BY7K 4QOTA 4LJZA 5HROA 2AEMA 4X64J 4GVBA 2LA6A 1T9WA 3MAQA 3A8IA 4X4QA 2HIQA 1U09A 1WEYA 1CEZA 1E6VB 4KFBB 1D0EA 4NXMJ 5LM7E 4A8OA 1MU2B 2B43A 2KYZA 4JI2F 2VU5A 2AYEA 4JI3F 3L4BC 4Q2LA 1TWFK 2IJFA 3LALA 2V8GA 1NZAA 1R89A 5SUHA 1RACB 4DV6F 3RAQA 4JI8F 1GK8A 4ZLLA 5LSRA 3TEGA 1DARA 3DXSX 3M8QB 2XS7A 1N32J 2DRBA 5AXMA 4B9UA 3AJ1A 1X4FA 4U67Q 3KLFB 1GTHA 4DV6J 3S17C 3DLJA 1WSRA 3DCAA 2FTRA 3GTKA 4K5SA 3KUEA 2AEJA 4C3IK 4IUFA 3GEHA 3RRKA 4DPYA 3NCQA 2QA4S 2XYHB 3E01B 3ZC4A 4DS4A 2EI5A 1RT7A 1NZ8A 3DRPB 5DS7A 3PX6A 4M5KA 4QR0A 1EX8A 1WF1A 3FGVA 5IXUA 2H5EA 3MM5B 4UUWA 2NVQC 3LPXA 4WKRA 3D5MA 2E1MC 3K59A 3GTQK 2IYGA 1VC5A 1VC6A 2R7ZK 3IWNC 2J0QD 3SCJE 8AT1B 4I69A 2HZVA 4E0DA 3FBBA 1GE9A 2HFVA 1AYEA 3IPJA 3UCZP 1UFWA 3OR1B 5KFTA 1VH2A 4P7TA 1T94A 3FKIK 3OTBA 5HSPA 2QSWA 2BW7A 4NPOA 1C2PA 2EW9A 2C3YA 2EBBA 4FF3A 1RTHB 2HKEA 1HBOB 3HMJG 3RBEA 4OL8A 5M5XK 1BLUA 1OJ4A 3QRQA 2U1AA 2MQNA 3I0RB 4BKWA 2Q6BA 1EQRA 6FD1A 1Q5YA 4A3BK 1GNKA 4LSNA 2OTJS 3TJ9A 4GKJJ 4ZLJA 5M2PA 2R93K 1U8SA 2YH0A 1WOPA 4O4GA 2LU2A 4A8WA 4IR1A 4ED1A 4CQ1A 2CVIA 1YWXA 3T5KA 1DCPA 2NS1B 1RT7B 4Y0FA 2FY8A 3RAXA 5B7WA 2KHCA 2VODA 1HBUA 1SBRA 1ZTWA 1VJWA 3MEEA 2RF2A 5H1SV 1RE1B 4JI6F 3PW5A 4Y65A 3HOWK 2CUYA 5J1EB 5FLMK 1X4CA 1G6BA 4C8MA 4HEA9 4AL5A 3W2WB 1RTIA 1VHIA 4J91A 1VQNS 3Q89A 2FHJA 1TK8A 1SV5A 3S6EA 1WKLA 4A8MP 2P5VA 4YY3J 4C98A 1JLGB 2R7XA 4BBYA 2WTFA 2F8MA 3PX4A 1M90T 3K2YA 3DOLA 1VC0A 1INNA 3KKFA 1VBZA 2GQQA 4TN2A 2QFJA 2WVCA 3HM9A 2HVDA 5GAHU 1UVJA 2DCLA 5I3PA 4RU9A 1NPRA 2MEWA 2HHWA 4NLUA 2AZ3A 1Y11A 2PDAA 4ZJOA 3BGFA 1IJEB 4XLNA 3EXYA 1Q53A 3GTKK 3CDBA 3CSKA 3UD4P 3V81B 1GFWB 3FC9A 3TAPA 4KDDA 3AD8C 4HYKA 1HQEA 1HNWF 3BSNA 2QT7A 3R5GA 1PO6A 1FKOA 1ZA2B 3I4PA 3OFHA 4CZCA 1HI9A 2AGQA 4NA3A 1UPPA 3GTPA 3IGVA 5ETVA 3DM2B 2HFZA 2DCUB 3KK1A 3RRHA 1WG1A 4X4SA 4XSZA 3HI9A 1SKRA 2Q79A 2EC0A 1O8BA 3GTLK 4X2BA 2JC0A 2OEKA 2MHEA 1RU0A 5I4MA 3V4GA 1PCAA 3H4BA 2I2YA 4LFBJ 2DKOB 1FDDA 3T9NA 1JVIA 5KT5A 3CJ5A 5FDLB 5LL6d 4ILRA 4F4ZA 2ALYB 2RD5C 3I4MK 1G3OA 2IVYA 4Y2MA 3FBFA 1HNIA 3EUNA 2Z57B 1S9GB 2F5GA 3B6BA 1KVIA 2BJ8A 2ADCA 1HQMA 2HBZB 1MROB 4MYTA 2KKHA 2EKNA 2W2QP 4O4GB 5EGEA 4F25A 4TYAA 1DQ9A 4ALZA 3K8VA 2VPYB 3ICLA 1FNOA 1NHUA 1FVSA 2HQCA 4OV6A 2RAQA 1NJWA 1JJCB 2DJWA 2WBRA 3NGRA 1HBOA 4ZS6A 3ET6A 1W2IA 2ZBCA 3N6NA 4CLLA 2ALZA 4RJVA 2Y8WA 5IYBC 2NVXC 4MKYA 1GEHA 2LQBA 3GTOC 4NCBA 1RWOB 1H2VZ 1I5OB 2OPSB 4KB7A 4P10A 5C42B 2KB2A 3L4JA 3QT5A 3O5TB 2PMZL 1IM6A 4ZVPB 3GE9A 1SC4B 2RQ4A 4JV5J 2FVQA 4BLAA 2HRUA 5B08A 5C5JA 1FFWB 3K7AC 2CWXA 4I7FB 4LIWA 3SV3A 4X6AC 1T95A 1T3OA 2BKPA 1I50C 1JLEB 4AYBL 1JKHA 3D54A 2HIYA 5J2PA 2W1BA 3W8GA 4GFQA 1Y1WK 3S1RK 1SJ3P 1SH3A 2EG2A 1VQ4S 3CDEA 3B4MA 2OELA 4CM2A 4DL2A 2HVHA 4IOBA 3PNIA 5HLFB 2BE7D 1HYSB 2RU3A 3HHEA 3PW4A 2CDQA 4ZN3A 1BQXA 5T7LA 5BR8F 4B9NA 2EEYA 1PYTA 4WYLA 4CLWA 3GSDA 4QWDA 3CE8A 2EWHA 4ECXA 4WPAA 1D9FA 4F67A 4ECTA 3PIOQ 1FNXH 1JLCA 2B6AA 2B7BB 2W4DA
chains in the Genus database with same CATH topology
3GIRA 1WSRA 3AD7C 3GSIA 1XZQB 1XZPB 1XZQA 1XZPA 3AD9C 3TFJA 3A8IA 3GEEA 4P9SA 3AD8C 3A8KA 3GEHA 3TFHA 4PABA 1V5VA 1WORA 1WOPA 1PJ6A 1VLOA 3A8JA 5L46A 1X31C 2GAHC 3TFIA 1YX2A 2GAGC 1WOOA 4PAAA 3TTGA 1VRQC 1PJ5A 1WOSA 3GEIA 1WSVA 1PJ7A 3ADAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIR A;  1WSR A;  3AD7 C;  3GSI A;  1XZQ B;  1XZP B;  1XZQ A;  1XZP A;  3AD9 C;  3TFJ A;  3A8I A;  3GEE A;  4P9S A;  3AD8 C;  3A8K A;  3GEH A;  3TFH A;  4PAB A;  1V5V A;  1WOR A;  1WOP A;  1PJ6 A;  1VLO A;  3A8J A;  5L46 A;  1X31 C;  2GAH C;  3TFI A;  1YX2 A;  2GAG C;  1WOO A;  4PAA A;  3TTG A;  1VRQ C;  1PJ5 A;  1WOS A;  3GEI A;  1WSV A;  1PJ7 A;  3ADA C; 
#chains in the Genus database with same CATH topology
 1TR0 A;  1NSK L;  1S9E A;  2IBK A;  1FK9 A;  4FBU A;  3DDK A;  4IFY B;  1IBL J;  2NPI A;  3LGH A;  4YDX A;  2IRX A;  3W8P A;  5B0C A;  1FX2 A;  4JP8 A;  5FDL A;  1EFW A;  4LF2 A;  3VZI A;  3OL9 A;  2AU0 A;  1TL4 A;  2IMO A;  4C2M C;  3HT3 A;  2MKJ A;  3G87 A;  2UUW A;  2RVJ A;  5CZX A;  2BOA A;  4LF4 J;  2IYI A;  2E2I K;  5BR8 J;  1REV B;  2L9D A;  4YHH F;  2QFI A;  4ILM A;  3BPD A;  2CQG A;  4AQY J;  2YWF A;  3BSC A;  2GZO A;  3VVU A;  2G1D A;  2E29 A;  4HHJ A;  4OLP A;  1YRU A;  1R3N A;  3TZZ A;  1FDA A;  4IG0 A;  5D4P A;  3KLG B;  3OFE A;  2EFN A;  3VAF A;  4IFY A;  2HHT A;  2HGL A;  5KFX A;  4X4O A;  4ZHR A;  3M32 A;  2C2R A;  3ET6 B;  4DUT A;  1UZH A;  2Q3P A;  1EHW A;  2VFT A;  2QLJ B;  5J2Q A;  3MWB A;  1WHY A;  3GR1 A;  4KMU A;  1R8A A;  1KEK A;  4CLU A;  3NAI A;  3LW5 C;  3OUY B;  5C44 C;  2DNY A;  4PG5 A;  4G0U A;  2JFD A;  3Q22 A;  4LF1 A;  1RT6 B;  2O5D A;  2VC0 A;  2FYX A;  1XXA A;  4ENO A;  1CVJ A;  1S4E A;  2AJ0 A;  2DNO A;  4PXD A;  2KT5 A;  1WSV A;  3FFI A;  2BAB A;  4DR1 J;  2RKI B;  2V6S A;  2J7W A;  3POT A;  1MSW D;  1FJG J;  3AQP A;  3N0V A;  1LV5 A;  1WHV A;  1ARO P;  1U45 A;  3KNG A;  2RU9 A;  3SCL E;  1HNZ F;  4B3M J;  3FSX A;  1T9V A;  2E2H K;  1QD1 A;  1U1P A;  1O29 A;  1N33 F;  2B0G A;  6FDR A;  4GKK F;  2WSF C;  3MR2 A;  1U1M A;  3IP0 A;  1N34 J;  4F4W A;  5K14 B;  3ETM A;  1BS2 A;  4OIN A;  2GVZ B;  2UUC F;  3EVW A;  5DM6 Q;  5C2C A;  5AJ3 J;  3OBI A;  4X65 J;  3KLE A;  4YS2 A;  3PV8 A;  4N41 A;  4ETX A;  1K0T A;  4WJ4 A;  2Z2Y B;  4L74 A;  3MM9 A;  1SL1 A;  1HQ2 A;  4MH8 A;  4RUA A;  4YFX A;  1U1O A;  5ETL A;  4WU3 A;  3M32 B;  4ES2 A;  2NSB A;  5CYQ A;  4DSK A;  3BQ0 A;  5KFJ A;  2P6T A;  2C3P A;  5J1P A;  1WCM K;  2B63 C;  4EBD A;  4RW4 A;  1AB4 A;  2HND A;  2X1F A;  3TX0 A;  2W9B A;  3CQZ C;  2E7V A;  2OPQ B;  2QMU B;  1VIX A;  4JOU A;  5HJY A;  1QAJ A;  5ETM A;  2DR7 A;  3PZP A;  5CJ9 A;  3J80 U;  3QFH A;  3GCX P;  1RKI A;  4A3M K;  4KMD A;  5CH7 B;  5DDR C;  1U6Z A;  2VFU A;  4XDC A;  3JQM A;  1IKV B;  1DCH A;  5EGH A;  2RS2 A;  5B0E A;  3OR2 A;  2SXL A;  1ACM B;  1LNQ A;  2NVQ K;  1UMJ A;  1R7I A;  1RAA B;  3QSI A;  4CH1 A;  2FZG B;  2W2N P;  3UN2 A;  3MEG B;  1RGV A;  3OT9 A;  2C2K B;  2ZFH A;  3BPS P;  3W64 A;  1VRU B;  3QGG A;  4FPR A;  3W5Z A;  2ADB A;  3B8H A;  3CC2 S;  1C0U A;  2EFV A;  1KBR A;  3UD3 P;  2IA0 A;  1Y3J A;  1J27 A;  2MKH A;  3KFW X;  1DBD A;  1KON A;  3DHX A;  2DBB A;  3GYN A;  2R8H A;  2F8E X;  4WE1 A;  3RZA A;  1JX4 A;  4CLF A;  4KB2 A;  1NH8 A;  4LRD A;  3I5C A;  4GTL A;  2VPW B;  3NGK A;  3SXL A;  2WON A;  2B9E A;  5LXY A;  1H72 C;  3GPA A;  1S1V B;  2DNN A;  2NZ4 A;  1K83 C;  3JTN A;  5EGY A;  4NI2 B;  2M0G B;  2DD8 S;  1MMD A;  3I96 A;  1QE1 B;  2W25 A;  3J81 j;  2VJU A;  1U2R A;  2JA6 A;  2XCA A;  4U95 A;  1VCT A;  4FKX A;  3WQP A;  2AIR B;  1NJI T;  2RSQ A;  2WON B;  3PRD A;  3DXJ A;  2V4Q A;  3PJX A;  1X4D A;  2NUU G;  5D0H A;  4DDF A;  2CQB A;  1CPZ A;  3MMA B;  3S15 C;  4KQZ A;  2D41 A;  4ZP7 A;  1FRH A;  1IS1 A;  4DR6 F;  3LAM A;  2I8E A;  4GO5 X;  5I42 A;  4B9V A;  3DRS B;  3H98 A;  2R2R A;  2HQD A;  4F0H A;  5L1I A;  3FSY A;  4JI8 J;  2V67 A;  1T8E A;  3LQV A;  3OL6 A;  2HQG A;  1NKB A;  4DR4 F;  2RIJ A;  2O66 A;  1RAE B;  4QCL A;  5IYD K;  3AFG A;  1WDT A;  2LLZ A;  3J7Z 5;  4ZVT B;  2RH3 A;  1S6Q A;  1HHT P;  2YWH A;  1FWL A;  2AYB A;  1HQU B;  4FF1 A;  3DOK A;  2HFO A;  1ZM4 A;  3EPG A;  3E01 A;  4AD6 A;  5IT9 Y;  3VGT A;  5T41 A;  3TA1 A;  3HOX C;  3KK3 B;  2ZHO A;  3E8O A;  3UFC X;  2DHX A;  3GQC A;  2DVI A;  1RTH A;  3TI0 A;  1S6P B;  3HOY C;  1IWG A;  1UEV A;  4CDI A;  3OXL A;  3OHB A;  3GTJ C;  2U2F A;  1NSP A;  1BC6 A;  1RB0 A;  1HNV B;  3FKI C;  1RAO A;  4Y34 A;  2ZE2 B;  5IS2 A;  1DTQ A;  4P52 A;  3BP3 A;  2XMM A;  3Q0A A;  4DR6 J;  3R5B A;  3GFH A;  3G4S S;  1B0P A;  3JST A;  3KLI B;  2PFF B;  4DQQ A;  4C3K A;  5C4X K;  4I6W A;  3HVW A;  1BQN B;  4RMF A;  4IRD A;  4OJG A;  3BV8 A;  5IQQ A;  1FEE A;  1BGW A;  2I5J A;  5HQ8 A;  3CJ4 A;  5KFG A;  2V34 A;  4X66 J;  1HQU A;  3HOZ K;  5ETP A;  3MMB B;  2DGT A;  4J9U E;  1VBY A;  3G71 S;  4HHU A;  1RQ0 A;  2K8G A;  1FRM A;  4YEA A;  2A6O A;  5KG2 A;  5LMN F;  2RT3 A;  4A8X A;  2V6U A;  2W7P A;  1BWE A;  4KMH A;  1ZAW A;  2MZR A;  1DTT B;  1S1U A;  5MLC V;  3VAM A;  2P8I A;  1TL3 B;  5K8N A;  3JSR A;  3J7A 1;  3CO0 P;  3DDI A;  1RT4 B;  4DPW A;  1M0S A;  5C4X C;  2DB1 A;  2ZE2 A;  3N9U C;  3TZW A;  2QTW A;  5L1L A;  1TWF C;  5GAH I;  2ZKU A;  2KHD A;  2X3G A;  3PR5 B;  3CD5 A;  5CHC B;  3IM8 A;  5KFQ A;  4KJI A;  4KM9 A;  3V6J A;  4KGZ B;  1QSY A;  1S1W A;  3R5J B;  1QDU B;  1KC8 T;  1QSL A;  2Z30 B;  2DO4 A;  1YJU A;  1QY7 A;  4FKY A;  5HRO B;  3MXH P;  2X1A A;  3PJW A;  2ZKT A;  3UDL A;  2M8H A;  3A1Y G;  2F3J A;  2N7C A;  3HOX K;  2DHS A;  1HNX J;  5DJB A;  3G8S A;  4BY1 K;  3SQG B;  1XMO F;  1IWA A;  4TLQ A;  4KSE B;  4LF9 J;  3GG0 A;  3C15 B;  1VS3 A;  1CUL B;  4DV0 F;  4I4B A;  4USM A;  4OHW A;  3S8S A;  3GTP C;  3EQL A;  4MIW A;  2K1R A;  3BQ2 A;  2M7S A;  4A3I K;  1H2T Z;  5IT4 A;  4HKQ A;  4PQU A;  1PG5 B;  3IA0 A;  2J6U A;  1G7C B;  4G0V A;  2E2H C;  2V8P A;  1A6L A;  1IKV A;  3KNA A;  1M5K C;  3S2D K;  4GT9 A;  1NDC A;  4LR7 A;  2ZH2 A;  2R7Q A;  3OTO J;  1KR4 A;  3SV4 A;  3H2V E;  4ZCL A;  4DV5 F;  3OXF A;  1S77 D;  2UZA A;  4Y3C A;  4NLO A;  1ZOT A;  2GS8 A;  3IG1 B;  2E5L F;  3QAU A;  4WWS A;  1NDL A;  1WC1 A;  1RI7 A;  2QMX A;  4QYR A;  2BE9 B;  3VAJ A;  2YKO A;  4W92 B;  4YQW A;  2WB1 D;  3AB2 B;  1S79 A;  5KG7 A;  4C6A A;  5BXI A;  4DR5 J;  4DWI A;  3U02 A;  3AOD A;  2AMC B;  2B63 A;  1FVQ A;  3BSA A;  2QO3 A;  3DN9 A;  3M30 A;  1B64 A;  1PJ5 A;  1WKJ A;  1R43 A;  2Y0S L;  1M5H A;  2FVS A;  1TTH B;  2HEK A;  1RAD B;  3GSI A;  3IFE A;  2NVY A;  5CYQ B;  2I9S A;  1RTJ A;  3MMC B;  4FP9 A;  3NS5 A;  4DX8 H;  3I32 A;  2ACM A;  2M8D B;  1UVM A;  1O27 A;  1VMB A;  3H5Y A;  4KC5 A;  3OV7 A;  5CD4 A;  3W61 A;  5JVO A;  3W1Y C;  3S1N K;  3CCS S;  4KB4 A;  2J9D E;  4LRF A;  1OSC A;  2PGC A;  3QT8 A;  1T03 A;  1N36 F;  1N56 A;  2QX0 A;  1U24 A;  3T5J A;  1N54 B;  1P9Q C;  3CT9 A;  4DV3 F;  1DY3 A;  3QO9 B;  3M6X A;  5DET A;  2DNQ A;  4KO0 A;  1JLE A;  3RB3 A;  1U8W A;  2GML A;  4DSF A;  4ANE A;  3KJQ B;  4RW6 A;  3AH5 A;  3IN5 A;  1KLN A;  4HTJ A;  1WEZ A;  4WTO B;  5KT6 A;  2FLO A;  2KXH A;  4ED5 A;  4WFN Q;  4UOC A;  1UAW A;  3MR7 A;  4WCE Q;  1TFY A;  2O01 C;  2ZM6 J;  4DFM A;  2Q66 A;  1XXB A;  2YX1 A;  3ZFV A;  3CC7 S;  1O51 A;  5KFL A;  4NYO A;  3CD0 A;  4C97 A;  2XCQ A;  2C2N A;  1NXI A;  4W98 A;  4DN0 A;  2PC6 A;  2BJE A;  1NB7 A;  1ZS6 A;  3P96 A;  2NVT K;  3P6Y C;  3T1H F;  4Y7N C;  4DN9 A;  4RUB A;  4K59 A;  4ZIT A;  4YP3 A;  2XO7 A;  2GVZ A;  3BUE A;  3DOM A;  3D0I E;  3LPE A;  2EFP A;  4UF4 A;  1X9S A;  3WX4 A;  1SUQ B;  3M8W A;  4IH6 A;  2LEB A;  1V3Z A;  1NK4 A;  2CPH A;  1Y1W C;  4NLS A;  3SZ2 A;  3GJR B;  5DRK A;  1UWB A;  4LF9 F;  3S1Q K;  1FXD A;  2KZM A;  2R7O A;  2MLZ A;  2FJE B;  1SQG A;  2V2Z A;  2HHP A;  5FII A;  2IM2 A;  3M8P B;  3DDN A;  2W7A A;  3C14 B;  3Q8Y A;  3MM5 A;  3QPI A;  4GTA A;  4OI3 A;  2NYH A;  2RB7 A;  2YX4 A;  5H9E K;  2R8K A;  1DFD A;  4OX7 A;  2P2C B;  3D2W A;  4IFV A;  1TVR B;  3TA0 A;  3GTP K;  4EYI B;  5D3G B;  3M3Y C;  3JTO A;  3D68 A;  1RWP B;  5F8N A;  4DXL A;  2I6W A;  4FYW B;  3OFF A;  3MUR P;  1U1R A;  3GV7 B;  1KQS R;  3D28 A;  3GJT B;  3GTJ A;  1RU1 A;  1S97 A;  3KMS A;  1VJQ A;  1FDB A;  1WQF A;  3FUY A;  3K0J A;  4ZHR B;  1PC5 A;  4RBV A;  2XUL A;  2BYC A;  3PKY A;  4JV5 F;  1HNZ J;  1T11 A;  5J2N A;  1Q78 A;  2ERR A;  3DLE B;  5KFA A;  2LP4 A;  1TWC C;  4P7V A;  5H9F K;  4NEZ A;  3CD7 A;  1J98 A;  3CPW R;  2ZDO A;  4ZPB A;  1HYS A;  5J2M A;  3MGJ A;  3HKZ L;  2KRB A;  4NI2 A;  4U9R A;  4IDK B;  1E6V A;  5DGA A;  2MQM A;  4LFA J;  4M95 A;  2D3O R;  4PWD B;  1S9F A;  4DV0 J;  3N0C A;  1EQ0 A;  2JX2 A;  1X0F A;  2GO9 A;  2ACY A;  3MAA B;  2J6S A;  4F3Q A;  1EK8 A;  4A3J K;  2QSF A;  4OZ1 A;  2VF3 A;  3ENA A;  4B02 A;  1HA1 A;  5KFK A;  1RSC A;  4EBE A;  3GTQ C;  3AQO A;  4C8Y A;  4UQT A;  1G51 A;  4PAA A;  4UOG A;  4TNO A;  4DCP B;  4XSX A;  1LWF A;  3H0G C;  1YBA A;  2GC8 A;  1U7L A;  4C3J C;  1UVI A;  3PO3 K;  1IM4 A;  4USJ C;  3CTR A;  3DFE A;  4RX6 A;  1JXV A;  4F0K A;  5KFN A;  1FFS B;  1YSJ A;  3ERE D;  3MMB A;  4K4Y A;  4O0I A;  4CLK A;  3HOZ C;  1TUW A;  4LFB F;  3A8K A;  1S6O A;  4FF4 A;  2HZA A;  2MKK A;  3S17 K;  4N76 A;  2R7T A;  3OL8 A;  4ELT A;  3GG1 A;  1CQM A;  5J2Q B;  4A93 C;  2HLT A;  3BB5 A;  3BQ1 A;  5E3Q A;  4K2J A;  3T1Y J;  4X62 F;  1PBA A;  1E6Y B;  3KHH A;  3CIZ A;  2WVB A;  2CQP A;  4DX5 A;  3T19 A;  2R2S A;  2BOP A;  2XI2 A;  3MI7 X;  1NKC A;  4B3R J;  1CS4 A;  1U1Q A;  4P6Q A;  2DNG A;  4KGX B;  5ETS A;  5IP9 C;  3AJD A;  1MN9 A;  2CNK B;  4DF4 A;  3MHY A;  1QAY A;  1VRQ C;  4NWB A;  2FVC A;  3KUG A;  3W63 A;  2H5I B;  1I50 K;  4HLB A;  4NLY A;  3ZZT A;  3HOV C;  1WG5 A;  4CLT A;  4RW6 B;  1LKZ A;  3OVS A;  2JLE A;  3C6T B;  3S2D C;  1S59 A;  2W2M P;  1TKT A;  1WC4 A;  1WC6 A;  4J9Q A;  3CJ2 A;  4EZ6 A;  3BJY A;  2UXC J;  2XWY A;  1XMB A;  4A3I C;  3HFV A;  4ECW A;  2XYG B;  2Z2L A;  1SH0 A;  5E7O B;  2VDI A;  3HJV A;  3DM2 A;  3UN3 A;  1F3V A;  4H54 A;  1VBK A;  7FD1 A;  1X4A A;  1UV7 A;  2BKO A;  3IAS 9;  2HS3 A;  3M8Z A;  4BY1 C;  3OTE A;  4CO0 A;  2XY5 A;  1QM9 A;  3HT0 A;  2WK4 A;  4RBU A;  3KLF A;  5I3Q A;  4YUD A;  4TU9 A;  2PT0 A;  2VDH A;  2UP1 A;  4KAS A;  4EMD A;  4DZD A;  3GTM C;  3AXM A;  2DYA A;  3MZI A;  4HDG A;  2E2I A;  2B5J B;  1TQL A;  3QAT A;  3R2D J;  2BVZ A;  3J81 U;  3DLG B;  3RU0 A;  2ZDP A;  4Q5V A;  3LPY A;  4LQY A;  1T0T V;  2VD3 A;  4TY8 A;  4IO1 A;  2AEF A;  3ZZP A;  4LJM A;  3M8R A;  4C3M A;  3TWZ A;  1Y5I B;  4CNY A;  4DUY F;  4F3O A;  3KYL A;  2XGP A;  4A3C C;  5E0O A;  2J0W A;  4HAC A;  2GSU A;  1KFD A;  3ZZU A;  4FS2 A;  3AXK A;  2QLW A;  2GIR A;  2CDR B;  4NEY A;  3QAE A;  1VHF A;  2Y8Y A;  2JLF A;  2UU9 F;  3KUH A;  2CJQ A;  1S6Q B;  2YQ0 A;  2G4B A;  2W8K A;  1U6B A;  4AYB D;  2E2H A;  2I38 A;  4M5L A;  2EKY A;  3KG4 A;  1PIL A;  3DOK B;  3OLA A;  2ZJP Q;  2FJD B;  2UVR A;  2ABY A;  1FXL A;  4EYH B;  1KTQ A;  3PEH A;  3ADA C;  3CAG A;  3GFZ A;  2FVR A;  2RRB A;  3RYL A;  1KHW A;  2UUB F;  2MYF A;  2YKN A;  3D6H B;  3NBP A;  4BBR C;  1Y5N B;  1ZQ1 C;  5KFB A;  1BD6 A;  1XN9 A;  1L3K A;  1U0S A;  3AD7 C;  2DK2 A;  5B0B A;  3NOC A;  2OEM A;  5FJ4 A;  2BRK A;  2VQF J;  3TAR A;  3I4N K;  2H9Z A;  2QA1 A;  2WVD A;  3T9Z A;  3GEI A;  1TUV A;  2Y1L B;  4UUX A;  3SDE B;  3O6Q A;  3ULH A;  4NOH A;  4QW9 A;  1Y0H A;  3S01 A;  1RT5 A;  4ZKA A;  1F7V A;  1VQP S;  2XNQ A;  2N3O A;  2JA6 K;  4MK8 A;  1EH1 A;  1MMN A;  1HI0 P;  2C2Z B;  2M88 A;  5C25 B;  2ZUA A;  3F41 A;  1M5P C;  4ILD A;  3US5 A;  2ASL A;  2DPI A;  6AT1 B;  4I7F A;  2RUG A;  2JLG A;  2HNZ B;  5E41 A;  2ZZN A;  1HBM A;  3FRY A;  2ZH3 A;  4K4V A;  2N4C A;  3QJJ A;  2ZH5 A;  2VFV A;  2W9C A;  4B9T A;  4R0J A;  4EFA C;  4DL0 C;  4G1Q B;  2MPU A;  4ZCM A;  1R8B A;  1XBW A;  4ATN A;  4O3N A;  1Q79 A;  2NZC A;  1UTA A;  1FWP A;  1CJK A;  1DCO A;  2D69 A;  1YJ9 S;  1HI1 A;  5HQM A;  1F6T A;  1NK5 A;  2YWW A;  1TWA K;  1NB2 A;  4ED0 A;  3G96 A;  2D7S A;  1Z1Z A;  5CAA A;  3QJP A;  1V3R A;  1L5U A;  2LU1 A;  1F2G A;  4XCH A;  5IYC K;  2ZBI A;  1P6T A;  3NLC A;  1U2C A;  2H51 B;  3M2V B;  4RO0 A;  2JA7 K;  3PEJ A;  3D67 A;  3HD1 A;  3OXG A;  4XPC A;  1K47 A;  2M3D A;  1XR5 A;  2JA6 C;  4V19 J;  2W4C A;  2WSE C;  4DR4 J;  2PSZ A;  5A8W A;  2MMY A;  4UW2 A;  4C45 A;  3OUY A;  2JL9 A;  1SV5 B;  3LTO A;  3G82 B;  2V4R A;  2OAU A;  2BQ3 A;  3N79 A;  4KKO B;  5M3M K;  3Q8V A;  4K5R A;  4WFZ A;  1S48 A;  4I1T A;  4AXI A;  5EWE A;  4L76 A;  2J0S D;  1OYD A;  1IXK A;  2POK A;  3LUY A;  2Z2Z A;  4OIQ A;  1QTN B;  1ZBT A;  4ZPC A;  2ZC3 A;  1ZPW X;  2LDI A;  3ZTO A;  3HX9 A;  2MLY A;  3SSS A;  2YX7 A;  1GXL A;  2NSC A;  3GON A;  4ZP8 A;  2MHN A;  5KFD A;  2EPI A;  3PY8 A;  4JI4 J;  1C0U B;  4E2F B;  3UNG C;  3ILO A;  4QYZ J;  1UA1 A;  2VV5 A;  4OX6 A;  4PG4 A;  2MKS A;  3V4I B;  1Q0N A;  3ZNU A;  5CYM B;  2W8L A;  3MAA A;  1DZ5 A;  3P5T L;  1VLO A;  4QIW D;  3MM6 A;  2KFZ A;  2B4O A;  4CM0 A;  5KFC A;  4N7T A;  4F50 A;  1HWU A;  3CDU A;  3MTK A;  1W2B R;  2WRM A;  5AXK A;  5GMK a;  4CT8 A;  4QPX A;  1TL7 B;  1UJ4 A;  4PWD A;  4PWW A;  4ZN1 A;  2XMA A;  1N34 F;  3FMW A;  4A3F C;  2P8T A;  3I5A A;  1A0O B;  2XY7 A;  2P9C A;  1FE4 A;  1YNJ A;  1AZS A;  1LWC B;  2BE2 A;  1H7W A;  4DMZ A;  4PKD B;  1YJW S;  1HR0 F;  1NJY A;  2LVW A;  2HG4 A;  1TWC K;  2XMT A;  4O23 A;  3N01 A;  4TQS A;  1IJF B;  1XIQ A;  1NK8 A;  3KG1 A;  4RLE A;  1B99 A;  3H5X A;  2UXC F;  1TMJ A;  3DLG A;  8ATC B;  3H2U B;  4EK2 A;  5KG5 A;  2VH7 A;  5J2N B;  4DSL A;  2ZD1 A;  4DQP A;  1CG2 A;  2O1P A;  2R3V A;  3IS9 B;  1RT3 B;  3DLK A;  4WFA Q;  1TFW A;  2FGO A;  2WOM B;  2DR8 A;  4K50 A;  3AD9 C;  1NHK L;  3MEG A;  3EXC X;  1YI2 S;  2V2V A;  3PRV A;  2W9C B;  1IKX B;  3TRG A;  4IG3 B;  2FIU A;  1IKW B;  4NYZ A;  4WKY A;  1R27 B;  3TAQ A;  3C14 A;  1KNZ A;  4UOF A;  3TJ8 A;  3RAM A;  1VQ9 S;  1UWB B;  1UVK A;  4Y2A A;  3THV A;  2NXE A;  1FI4 A;  1URN A;  1FK9 B;  4DFJ A;  1RHK B;  4A3D C;  4QJV B;  1HLW A;  1FTR A;  2MZS A;  4QWA A;  1PAE X;  2OPS A;  1Y5L B;  2IVF B;  2BJ9 A;  3O8W A;  2ZBR A;  1UVN A;  2EK6 A;  4J5O A;  2B3T B;  3PX0 A;  4JI7 F;  2GW8 A;  2A6H A;  3NWG A;  2G2O A;  5C44 K;  3ILJ A;  4K4U A;  4DV5 J;  1LFP A;  1X5T A;  4LF4 F;  3NG8 A;  1T3N A;  4P9S A;  4IQX A;  1NBE B;  4WJB A;  2DIV A;  1JLB B;  2E1R A;  1S57 A;  4A48 A;  5HLF A;  1K73 T;  4M8L A;  2BDP A;  4DPT A;  4JI4 F;  2YWG A;  2YQ3 A;  3ILI A;  2ILY A;  4NL5 A;  3L7P A;  1UP1 A;  3FNN A;  4QIF A;  5AXL A;  1X5O A;  2VG5 A;  1MWZ A;  2YY3 A;  3SFG A;  3ORE A;  3H3V L;  4C0B A;  4C3J K;  3PO3 C;  3QIP A;  1PGZ A;  1YHQ S;  3DRS A;  3S16 C;  2MZJ A;  5D15 A;  2LQ9 A;  1F60 B;  2MQQ A;  1N4L A;  1IKW A;  1S10 A;  2K7K A;  1ITP A;  5C42 A;  4QWC A;  4FVC A;  1QVF R;  3IR6 B;  2ZHB A;  3QLH B;  4RNO A;  4KR0 B;  2ZVI A;  5IV3 A;  1V5I B;  5THW A;  2ROE A;  2HSE B;  4EO8 A;  1U48 A;  3KK1 B;  4FYX B;  4ECR A;  2HQI A;  4YR2 A;  4G1P A;  1E6Y A;  3KHG A;  1AFI A;  5AE1 A;  3IS9 A;  1RT6 A;  3T41 A;  1TL1 A;  2YKA A;  4RNM A;  3TP2 A;  5E3R A;  5JVH Q;  2HWT A;  4PQA A;  4BLG A;  2H48 B;  2FZK B;  5B0F A;  5DQH A;  3FMB A;  3L3C A;  4QR2 A;  3K89 A;  3GMG A;  3H2L A;  2EC2 A;  1S9G A;  4WE1 B;  1FJG F;  3SCK E;  4X4R A;  3VAG A;  2YXL A;  4UTG A;  3UPF A;  4Q8E A;  4NX9 A;  1YG0 A;  2BAN A;  5DLG A;  4B3O A;  2OD4 A;  4B3S J;  3C6U B;  4A3D K;  4ED8 A;  1Q4R A;  4ZH4 A;  3W9H A;  1YZ7 A;  1PC4 A;  3L09 A;  3EVM A;  5AE2 A;  2PO4 A;  4LF7 J;  4G3I A;  1FWK A;  5KFW A;  2ATC B;  4ICL B;  4DL4 A;  5TMF A;  4KE5 A;  1U1L A;  4LR8 A;  3F73 A;  4OJH A;  3U1M A;  4ZP6 A;  1JK9 B;  1K44 A;  2B4U A;  3UCG A;  4NAS A;  2ZUE A;  4TVA B;  3LAN A;  2HMI B;  2VBX A;  2FJB B;  4IDK A;  5HQL A;  4BWJ A;  3AHP A;  3J7Y U;  4PG6 A;  1ZZN A;  3IRW P;  1KN6 A;  2VUG A;  3HOU K;  1WI8 A;  2LQJ A;  4G65 A;  5ETO A;  2CKW A;  2RE1 A;  2ZWP A;  3I55 S;  3B82 A;  3OLB A;  3ISZ A;  3QWP A;  3Q8S B;  2ZH9 A;  4CLP A;  1IBC B;  3MPV A;  3BO2 A;  1C0A A;  3NNA A;  4CP5 A;  2YU9 C;  1Y9O A;  4AXJ A;  2GVD A;  2R92 A;  3IGN A;  4I64 A;  2FD2 A;  1N5T A;  5BYS A;  1Y7P A;  1O2B A;  4TY8 B;  4A8Q A;  4GTE A;  3HO1 A;  4N8N A;  1EKS A;  2ROG A;  2VKR A;  4DCO B;  2YVS A;  1TWH A;  1WDD A;  3RW7 A;  4Q4Z A;  2WAQ L;  2W7V A;  1OPI A;  4ED6 A;  2E9R X;  2CG4 A;  4DL5 A;  3N0B A;  1AW0 A;  3AY0 A;  4ZPT R;  1S5Z A;  1YLX A;  1N32 F;  2UV8 A;  3E3X A;  1QAI A;  2NQP A;  1USM A;  5ETN A;  2WW8 A;  1HBU B;  2KT3 A;  1SH2 A;  2GHW A;  1XR7 A;  3UR3 C;  3MEE B;  4DSI A;  3HKW A;  2DIU A;  4IRK A;  2NXN A;  1FFG B;  2WOM A;  4OJ1 A;  3M1V A;  4O3Q A;  1TWF A;  3PR4 A;  1MW7 A;  2D74 B;  5BYQ A;  1FHT A;  4QBU A;  1W7W A;  3VAI A;  3M8S A;  2UXB J;  3FEZ A;  5L46 A;  3OTO F;  4PWU A;  2JNJ A;  3P5B P;  4BDP A;  1Q82 T;  5AXN A;  3NGS A;  1U0H A;  3HZE A;  1C4C A;  2GSN A;  4HT5 A;  4FDF A;  2K3I A;  3K57 A;  2HZC A;  2DNZ A;  2H54 B;  3NKY A;  1R31 A;  4QW8 A;  4GC6 A;  4UZB A;  2RML A;  2AZ1 A;  3PFO A;  5H9E J;  1L3U A;  3TA2 A;  1O26 A;  3WDO A;  4UST A;  1JLF A;  4PYA A;  4C8L A;  3DRX A;  2VUM K;  4L3N A;  5LJ3 Y;  1B4B A;  4YOE A;  3QFW A;  4H4O B;  3GTJ K;  1WHW A;  1OYE A;  3H40 A;  1WEX A;  2AF6 A;  1HNV A;  1FRL A;  2JA7 C;  4J9M A;  2LEP A;  2CNL B;  2DY9 A;  1C0T B;  1HHS A;  2HK2 A;  1TL7 A;  3PCO B;  5HMZ A;  3ZZY A;  4OZJ A;  4YDD B;  2GJ2 A;  1SJ1 A;  2NVY C;  2GO8 A;  3MF5 A;  3M4O K;  3FVY A;  4JI7 J;  3K5L A;  3J7Z T;  2HVZ A;  3FKI A;  2YKN B;  4NZ6 A;  2V5H G;  4EO6 A;  1NK0 A;  5IYD C;  3V6K A;  3ENW A;  1UFK A;  3AOA A;  3TW0 A;  1CBK A;  2VG7 B;  2Y1I A;  4ZCI A;  1VQK S;  1PYO B;  3K5N A;  4RR5 A;  4X4N A;  2ZUF A;  3LAP A;  2D3O 1;  3GFY A;  4JUZ A;  2DIS A;  1N0U A;  1RLD A;  4ZPA A;  2B7C B;  2P9E A;  2JEI A;  2P6S A;  1F9E B;  3D66 A;  2PA3 A;  3TQE A;  4B3T J;  2AT1 B;  3N28 A;  1MU2 A;  4URS A;  4BCA A;  2GGP B;  4ECY A;  3GTY X;  2CNN B;  1KD1 T;  1KRP A;  3D7S B;  2VBY A;  4GTF A;  1QAX A;  1TWG A;  3G82 A;  5A6W A;  3DKD A;  1SFO A;  2HBY B;  3D1O A;  4MFB A;  4A3F K;  1O2A A;  2QEX S;  1K83 K;  2NCK L;  1KP6 A;  2OMO A;  4WJ3 M;  3PFE A;  4DR2 F;  1HNW J;  2NYI A;  3VGU A;  1WUU A;  1MN7 A;  2R8J A;  1Q95 G;  4WBF A;  3KJF B;  3VGS A;  3QNW B;  4WFY A;  4QPT A;  3W62 A;  4PCQ A;  3UVJ B;  1TL3 A;  4AFF A;  2L08 A;  1SKU B;  2VG7 A;  2WW4 A;  1TL1 B;  5LMU J;  4Q43 A;  3E2E A;  3V4M A;  3PW2 A;  1HMV B;  4P75 A;  1SB6 A;  5A0Y B;  1HAR A;  2D1C A;  4F3M A;  2VHG A;  3MFI A;  5FLX U;  1WC5 A;  3HXM A;  2P9G A;  1U26 A;  3M6U A;  1RCO B;  3DYA B;  5EDW A;  4A4J A;  2CFA B;  4L73 A;  3S2H C;  4DQS A;  1JOE A;  2E5I A;  5E3P A;  4DUZ J;  1PBU A;  3C3L A;  4ZPV R;  3GEE A;  2A10 A;  4ICL A;  2AGP A;  5IWA F;  4B3T F;  3W3S A;  2FDN A;  1CJT A;  4DFK A;  1CC8 A;  2IA6 A;  4RBT A;  3FZ2 A;  3S0X A;  1RHU B;  3TQ1 A;  1B70 B;  3W2V A;  2IRY A;  1TZ0 A;  3BSO A;  5CCL A;  4DV7 J;  1F3F A;  3H8Y A;  2L41 A;  2MKI A;  4BXX C;  4JV1 A;  2YKM A;  3HVA A;  3NWR A;  2CQ1 A;  2CWK A;  2V2Q A;  4CYU B;  2HFN A;  1DTQ B;  3P4U B;  3P8B B;  3VAK A;  1UL3 A;  2B63 K;  5IOL A;  4LF6 J;  5JXS A;  2BMB A;  2WB4 A;  2YU9 K;  2R7V A;  3EZ5 A;  4BY7 C;  2YWK A;  2RDJ A;  3BGR B;  1XPP A;  2EXU A;  3I9Z A;  1YIJ S;  3CNQ P;  4A3L C;  3HUL A;  2AKW B;  1QJH A;  1RAJ A;  2B8P A;  4ES1 A;  3H5U A;  4C0H A;  2FB0 A;  1BMQ B;  3SSQ A;  2C2E A;  2CVE A;  4KC6 A;  2RGR A;  3OFG A;  1TAU A;  1PAU B;  4LR9 A;  2VBZ A;  1EZZ B;  2XLK A;  1RUS A;  1DRZ A;  4ZK7 M;  5A0Y A;  1ZAV A;  2JZ5 A;  4KY3 A;  2PPB A;  3IMQ J;  3M4X A;  1U2F A;  2E5J A;  3MCO A;  2KRR A;  3I87 A;  1R0B G;  3K17 A;  3ELH A;  2XSF A;  5KFZ A;  1REV A;  5CAB A;  4KGM A;  3GTQ A;  2IY5 B;  4RW9 A;  5F41 A;  4RWW A;  3M8Q A;  3G6X A;  3ZZR A;  3ZZZ A;  1T05 A;  5I42 B;  2UXB F;  3PHE A;  3DXB A;  1EB0 A;  1Y1V K;  2RRA A;  4RW7 B;  3FFI B;  1V5V A;  3RZD K;  1CSJ A;  3VV2 B;  3O44 A;  3RUB L;  3AT1 B;  4WXO A;  3C19 A;  2BQU A;  2RQM A;  1YRX A;  4DBQ A;  2OPR B;  2XZT B;  5IP9 K;  3LP2 B;  1S1V A;  4IOC Q;  4GVB B;  3OVA A;  3MPD A;  4PG8 A;  4PR6 A;  4OI4 A;  1L3T A;  1KS2 A;  3D0H E;  4YHH J;  1QE1 A;  1YX2 A;  2CPF A;  3BR9 A;  3FBC A;  1RTJ B;  3MMC A;  3M2R A;  4LR2 A;  1HW8 A;  2Z2M A;  2HW3 A;  3TNV A;  4NLV A;  4B17 A;  2AJ1 A;  2JVR A;  1Y1V A;  1N52 B;  3QID A;  2Y0B B;  2CFX A;  2R92 K;  3AOB A;  1R9T K;  1RT1 B;  2VAS A;  3D4J A;  5IOS A;  3ZTQ A;  3WIU A;  3G8Q A;  3PYF A;  3BF4 A;  1WAC A;  1DQA A;  1K9M T;  1Q8B A;  1HNI B;  2APO A;  2ASJ A;  3G4A A;  4USW A;  3AA9 A;  3CCW A;  3MUT P;  2AX1 A;  1B0V A;  2X1B A;  3MEC B;  3PW0 A;  3V6D B;  2MSS A;  2A2D A;  2VON A;  3E51 A;  1VQ8 S;  3UW1 A;  4XIU A;  3I82 A;  1KQK A;  1O6X A;  3RB4 A;  2G9O A;  4TU8 A;  3IM9 A;  4WP3 A;  2W2O P;  4R0E A;  4A3M C;  5C7P A;  2B9W A;  1HKA A;  4ECZ A;  2IBO A;  3MR5 A;  3OPK A;  3ZTR A;  2ZH4 A;  4ITS A;  4WFB Q;  4KGV B;  4DR5 F;  1LFW A;  2O3D A;  1N8R T;  2HHU A;  2GX8 A;  2BKN A;  1LXJ A;  2D9O A;  3Q8R B;  1JLC B;  1H3D A;  2B6A B;  5L39 A;  3EGZ A;  1JMT A;  1U0H B;  2E1C A;  4MEY A;  4M5I A;  4ID5 A;  3QT6 A;  2Z4P A;  2N4D A;  2BV3 A;  1FKP A;  4C3H K;  4M5J A;  3CF5 Q;  4ZOS A;  3QT7 A;  4EZ9 A;  1RK8 A;  3CIM A;  4U7C A;  4WF9 Q;  4NZ7 A;  1RTD A;  3T02 A;  3BGO P;  5A8R B;  2HQF A;  4O3P A;  2E5G A;  4DDQ A;  4ZVF A;  3WX8 A;  2DR5 A;  1Q1K A;  2XMJ A;  5GAE U;  4PEO A;  1ZBS A;  3MDF A;  2CJK A;  2JC1 A;  1WOS A;  4LQ9 A;  1RU2 A;  3N5F A;  4LVN P;  1S12 A;  2DIT A;  3RW6 A;  1RTI B;  1UEU A;  2JA5 C;  2NVY K;  3N4W A;  2ZOG A;  2GJF A;  4LSZ B;  1VQ7 S;  2W01 A;  3QIP B;  5EN1 A;  5HP1 B;  4LRE A;  5AJ3 F;  1BJT A;  3PXG a;  2EG1 A;  2MTL A;  4K0K J;  3WBZ A;  3GTO A;  4OZ2 A;  1N48 A;  3FJ2 A;  5HL8 A;  1GT8 A;  1TKX B;  4OYO A;  2OHD A;  1U02 A;  4ED3 A;  1ZM9 A;  1D8Y A;  1DD5 A;  1IKY A;  4ETZ A;  1JLA A;  1EAR A;  2WHO A;  3MD3 A;  4EBC A;  1X9W A;  3M9M B;  3ZZ0 A;  4LSL A;  4K4S A;  3GU0 A;  1XR6 A;  4LF5 F;  1KDN A;  4FXD A;  2MQ8 A;  1LK7 A;  1NPK A;  1MRO A;  5HBM A;  2FPH X;  3CDA A;  1XWL A;  2CNO B;  1X9M A;  2V6A A;  3I4H X;  3I4M C;  1TK0 A;  1YJ7 A;  3KTQ A;  1VQ6 S;  2AD9 A;  2AQ4 A;  3SMZ A;  1O24 A;  1T9X A;  3BGL A;  2E2I C;  2RIL A;  2Z58 B;  3OW2 R;  5D0R A;  2F63 A;  1ZVU A;  1UVL A;  1HNX F;  2JA8 K;  3NGU A;  1Q7Y T;  3OR2 B;  3W66 A;  4DV4 F;  2JRS A;  3NP5 A;  2RRN A;  2XYP B;  1XZP A;  4XTT A;  1IKX A;  4A3G C;  3L9Z A;  2XC9 A;  3MED B;  3FOF A;  3V6D A;  2CJX B;  4M5H A;  2IAJ A;  5A2Q Y;  4QU6 A;  2B56 A;  1WC3 A;  2HHS A;  3R6L B;  4DEZ A;  8RUC A;  1WNE A;  4AUK A;  4F7V A;  1X8D A;  1KVJ A;  2UVV A;  1A7G E;  4IR9 A;  4W4M A;  2RJZ A;  1JNR B;  2A68 A;  3MAH A;  3HSJ A;  3LAJ A;  3R3T A;  2CG8 A;  3GTK C;  2V8H A;  3HDS A;  3CC4 S;  3S7R A;  5KT3 A;  3OTC A;  2E1P A;  1SJ4 P;  4HT7 A;  5GAG I;  3LP0 A;  3EYZ A;  1F7U A;  2IM1 A;  4UZC A;  2HQ3 A;  1ROF A;  4UQG A;  4AH6 A;  1GX6 A;  2KI2 A;  4FNH A;  2QLX A;  4P2S A;  3N6M A;  3RZO K;  1MG7 A;  3PVX A;  4A46 A;  1VLY A;  2YNI B;  3SBM A;  1X4H A;  2IFX A;  4RW7 A;  3HLU A;  1VRT B;  3S1R C;  3CCZ A;  3PO5 A;  4A47 A;  1RKJ A;  3RZD C;  4Y52 K;  3DLL Q;  5D4O A;  3ENQ A;  3OEP A;  5A76 A;  3V4I A;  1RAH B;  2J0X A;  5IYC C;  2JHE A;  4RU2 A;  2KZZ A;  3CJK A;  4OYM A;  4JI0 F;  4NLT A;  5CZV A;  1S1U B;  4M1K A;  5B09 A;  1AUS L;  5L1J A;  4FXW A;  3HOW C;  2I1R A;  4U7U D;  4G7Z A;  2XNR A;  3Q8P B;  2X51 A;  5KG4 A;  1FD2 A;  3I6P A;  4J9K A;  2WB1 L;  1PIE A;  4WP9 A;  1OQ6 A;  1QTM A;  3MPW A;  3GTO K;  4J37 A;  1TK5 A;  1TKD A;  1T03 B;  1FKA F;  3QRR A;  1UEK A;  5HMY A;  4Y2I A;  4C3H C;  4TLR A;  5C3E K;  5F9N A;  4Y7N K;  4L75 A;  2ASY A;  3FRZ A;  2DNM A;  1ICE B;  2K3K A;  1VQY A;  1IBM J;  4M5D A;  1JLB A;  3MMJ A;  4CYU A;  1TKX A;  2Q1L A;  2C3O A;  2ZH1 A;  3CUN A;  2OPR A;  1YJN S;  1QUV A;  3IBW A;  3K5P A;  4B3S F;  1FF2 A;  4JI6 J;  1GMV A;  5A8K B;  5HMX A;  3QQC D;  4I67 A;  3HZG A;  4P2F A;  2B8Q A;  2YNG A;  4NMX A;  3ENV A;  4ZIW A;  4LK0 A;  1SC1 B;  3I4N C;  1UJ6 A;  3U1L A;  3UWT A;  4RW9 B;  4M5D B;  3VZH A;  1JXE A;  3D3C J;  2ZUG A;  2KO1 A;  2HHX A;  4C11 B;  1R6Y A;  4BBS C;  4DL3 A;  4URQ U;  4USK A;  2A69 A;  3NUH A;  3GTL C;  4LF8 F;  2XWX A;  3PAC A;  1XK8 A;  4ED2 A;  2G2Y A;  2HGM A;  2YH1 A;  4OI2 A;  4GTB A;  4LF6 F;  1XNR J;  2KTQ A;  1N5Y B;  2E7W A;  3CCJ S;  3DYA A;  1H2U X;  3Q8Q B;  3H7H B;  4FN5 A;  4OMF G;  1J5O B;  3DLB A;  1S76 D;  2XG8 A;  1ELO A;  4A3E K;  1WI6 A;  3JYT A;  1V9O A;  4TQR A;  1R9T C;  3LAK A;  3V81 A;  1AXQ A;  3QGH A;  5IM0 B;  4MAK A;  1RT1 A;  5JUM A;  2J8S A;  4EU0 A;  2IVM A;  2XS5 A;  3R1L A;  1U47 A;  5C25 A;  2Y3P A;  3TFJ A;  2KT2 A;  2YKM B;  4TY9 A;  5L8R C;  4CO1 A;  5D77 A;  4DR3 J;  3W2V B;  2CQH A;  3J7Y I;  2QC3 A;  1YZ6 A;  2XLI A;  3K5O A;  2D9P A;  4R25 A;  4GKK J;  3CCV S;  7AT1 B;  1XNR F;  1JQW A;  1JLG A;  5F8I A;  5ETQ A;  1IBK J;  2GMJ A;  3HD2 A;  2KJV A;  3DRY A;  2OPP A;  3R2C J;  1WOO A;  1EP4 B;  4PXC A;  4MYU A;  3QWU A;  1Z2L A;  4DR2 J;  3FKB A;  1DLO B;  2QL7 B;  4RKU C;  3KHR A;  1VOM A;  1OQ3 A;  4Z37 A;  1L3S A;  1WEL A;  4OYI A;  1F5A A;  4IH7 A;  3W5Y A;  4NCG B;  2HRY A;  5FLX Y;  3D1Q A;  1KVK A;  1RAF B;  3FEX B;  4ZVE A;  2DXD A;  4ANC A;  3BYP A;  4DR3 F;  5KFH A;  3H42 A;  3S1T A;  1UWA A;  2NR0 A;  2E2J C;  3F44 A;  3UD5 A;  4B9M A;  1RWW B;  3H3V D;  4MKB A;  1YNN A;  3EDR B;  4M63 A;  1IBM F;  3S15 K;  4NYP A;  4F0M A;  4A3L K;  1H38 A;  3G2X A;  3I56 S;  5GAD I;  2HS0 A;  2KM8 B;  3T01 A;  2LDY A;  3CCT A;  5C4J C;  1OMS A;  2XMW A;  4Y28 C;  2XTJ P;  1SI9 A;  5F8L A;  1DUR A;  3RGI A;  3PM9 A;  2UUC J;  2OFG X;  4PPZ A;  4AE5 A;  1LW2 B;  4X4U A;  3CCE S;  5K8O A;  1I50 A;  4P2X A;  4DV1 J;  3M2V A;  2LKZ A;  3NY0 A;  4ZA1 A;  3TAM B;  4K4Z A;  1I6V A;  5L9N A;  3CB4 A;  1TWC A;  1YJR A;  1YJV A;  4USI A;  3FZB A;  4I68 A;  1NK7 A;  2HGN A;  1WTB A;  2FLL A;  5E68 A;  2YWE A;  4F26 A;  4LF7 F;  5K20 B;  5CHP A;  4J9P A;  1FA0 A;  3H20 A;  2JEF A;  2DO0 A;  5D6G A;  5DG8 A;  2UVU A;  4MJK A;  2CPI A;  3TZY A;  1EET A;  4YB6 A;  2JVO A;  1U49 A;  4XO0 A;  1GMW D;  5K14 A;  1FKO B;  2RHS B;  4DPX A;  4UOH A;  1VBX A;  4ERD A;  3H0G K;  3EX7 B;  1I6J A;  1CLF A;  2F4V J;  3CED A;  1D1U A;  3ZXW A;  1HMV A;  2XEX A;  2GAH C;  5LOQ A;  4KGK A;  3VQS A;  5A6P A;  4M5M A;  1AA1 B;  4Z2X A;  2K06 A;  4WII A;  1YCL A;  3IXQ A;  4A3C K;  4GTD A;  2IDE A;  2V94 A;  5HMW A;  2NLW A;  2A3J A;  3G6V A;  2UUB J;  2IJR A;  2DH7 A;  5IOQ A;  2UXD J;  2J76 E;  3RR8 A;  3TJA A;  2R9L A;  2HRT A;  4JBC A;  4ZVS B;  4KIA A;  5DZ6 A;  3VCD A;  4G7O A;  2VG6 B;  1N33 J;  4OYA A;  4X66 F;  3ETO A;  4LRB A;  2XO6 A;  3CWJ A;  1Q8K A;  3R6G B;  4ZJL A;  5DG9 A;  3MM7 B;  1HHQ A;  5DGB A;  1IBK F;  2CFA A;  1IW7 A;  1VYA A;  3F56 A;  2H4Y B;  2G1H A;  3UCU P;  5HN0 A;  3BH6 B;  1WJ9 A;  3MOJ B;  2JA7 A;  2ZOF A;  1RHR B;  4NA1 A;  4WU2 A;  1SJQ A;  4RUC A;  2GHP A;  2DH8 A;  4ZPW R;  1N6Q B;  4DUY J;  1WF2 A;  3HOU C;  4UT4 A;  3HK2 A;  3SFU A;  5KOW A;  3KHL A;  2Y1J A;  1YQH A;  3BN4 A;  5ADZ A;  1SFO K;  3BDP A;  4Z7Y A;  1Q8I A;  1SQF A;  3QSY B;  2EFQ A;  3A4T A;  3KJN B;  3GTG C;  4IQM A;  4CH0 S;  2HHH F;  4ZVR B;  4OFZ A;  3GWC A;  2DGX A;  1NDP A;  2A6E A;  4KO0 B;  1T02 A;  2CJA A;  4UY8 5;  4ELV A;  1S1X A;  3JAM U;  1FRK A;  3PO2 K;  2J9D A;  4PUO B;  1C1B A;  1RZM A;  1Q16 B;  2YNI A;  1VGX A;  1MWQ A;  4I2P A;  3CCQ S;  2N7Y A;  4F4Y A;  2QLF B;  2C42 A;  3S14 C;  4X65 F;  2O5I A;  4OZ5 A;  3U7J A;  1G4C A;  1G2E A;  2YNH B;  2VUM C;  2DGV A;  2BZ2 A;  2KU7 A;  3GLJ A;  1LXN A;  2CZ4 A;  3R27 A;  2FC9 A;  1UW9 A;  2F9D A;  4S0M A;  1CJV A;  4AT1 B;  4IH5 A;  1SKS A;  4JI0 J;  1RWN B;  2ILZ A;  2UUT A;  3DNC A;  1JJ4 A;  1NME B;  1X5P A;  3GII A;  5G4D A;  1WG4 A;  3RBD A;  3PG9 A;  4KN7 A;  2QA2 A;  5KT4 A;  2XHC A;  1RHM B;  2FLP A;  4KN4 A;  2XGQ A;  2X3D A;  5T7L B;  5DZ7 A;  2F9J A;  4AL6 A;  4A8K A;  2XY6 A;  2LFV A;  3G6E S;  1CJK B;  4NXN F;  1NPP A;  4MEX A;  2JH3 A;  1Y3K A;  1GMW A;  1J6V A;  4U7U K;  1USO A;  4NLG A;  3BM7 A;  4OI0 A;  1S72 S;  2XS2 A;  1HD1 A;  3MM8 A;  2HLU A;  4C4W A;  1XMO J;  1RLC L;  2GSO A;  5E3A A;  1YIT S;  2CZ9 A;  2HWH A;  4EI2 A;  3CJQ A;  4WK1 A;  3IAM 9;  2VQF F;  2OIH A;  5HVH A;  1CJU A;  4ED7 A;  4DQI A;  2CJY B;  4TXS A;  4F4A A;  3CJT A;  3TR5 A;  4DCJ B;  2ZWO A;  2FLN A;  4C2M K;  4O0N A;  2JA8 C;  1RA7 A;  1F5C A;  5AE3 A;  5GVQ A;  1OY9 A;  2WBM A;  4EEY A;  2V4J A;  4ELU A;  4AQY F;  2QRR A;  2CJB A;  3X1L B;  4FXV A;  5IC6 B;  1TWG K;  2DTJ A;  4LFC J;  1CUL A;  2MGZ B;  2HND B;  2YNF B;  2BM1 A;  3VAL A;  5KFY A;  3POT B;  1U25 A;  2J8A A;  1VFJ A;  1WCM C;  2E66 A;  2CQ4 A;  1NHV A;  3ILL A;  4QYZ K;  4Y00 A;  1QSS A;  1FXR A;  1OWX A;  4K4T A;  4FM9 A;  3GTM K;  4QWB A;  1FKP B;  4CNZ A;  4DLG A;  1S1W B;  1RAB B;  1R8P A;  2QYC A;  3M1V B;  3VQT A;  1Q86 T;  2VG6 A;  3KLH A;  2ZH6 A;  2CQC A;  2K7J A;  4HH1 A;  4GC7 A;  5E2Q A;  1S6U A;  4GVL A;  1HWK A;  4OZL A;  1GX5 A;  4DV2 F;  1EAY C;  4LF5 J;  4R8U B;  3HVT A;  3UDV A;  3ZTP A;  1B4S A;  1TKZ A;  3QJL A;  3ITH A;  2R7S A;  2W7O A;  3MED A;  2DHG A;  3Q2T C;  1F0X A;  4QIE A;  1FCA A;  4RW8 A;  1YKW A;  5F8H A;  3TYT A;  1KQ4 A;  1M5V C;  2GAG C;  3PHT A;  1X5S A;  3MUV P;  1T9T A;  1LW0 B;  4QU7 A;  1JQG A;  2BW2 A;  4F8R A;  4Y52 C;  2DH9 A;  4CO3 A;  4IG3 A;  3GIL A;  1IE0 A;  3CDW A;  3GJS B;  2KXF A;  2R7U A;  3DRR A;  3V5R A;  1RTD B;  3HHL C;  5GMD A;  3TUZ C;  2IHR 1;  4DZ6 A;  4J3N A;  3CJS A;  2CPX A;  5CA5 A;  2YPZ A;  2IC3 A;  1RCX B;  3JQK A;  1ZPV A;  2CQ3 A;  4CO4 A;  3SQG A;  5LXR A;  4N77 A;  3PIP Q;  1NH7 A;  2AW0 A;  4J90 A;  2HNZ A;  3EWG A;  4ZLN A;  4LRA A;  2L48 A;  5M5W K;  2NVT C;  3CVK A;  3TAN A;  1RWK B;  1PSD A;  2EVZ A;  4IG0 B;  3KLG A;  2OD6 A;  2M9K A;  2PI4 A;  2E5H A;  2OTL S;  3JSM A;  3BBB A;  4RZR A;  4DR1 F;  2YKP A;  1LOU A;  1I51 B;  1PJ6 A;  4X4V A;  5D4D A;  3KXD A;  2BEF A;  1TVR A;  3PRB A;  3BRE A;  4RL1 A;  2F40 A;  3SI8 A;  1U1N A;  2R8G A;  1TWG C;  4HI2 A;  4G1I A;  2BJ7 A;  3I31 A;  3FBE A;  4NXN J;  1RWU A;  1WHX A;  2DNL A;  4WZQ A;  4PAB A;  3RBX A;  3T6J A;  2J9C A;  4ES3 A;  1TKT B;  3KK3 A;  3W2W A;  4KH0 B;  3TUP A;  5M3F K;  3L4K A;  1VK8 A;  3BKF A;  2V9W A;  4Q0B B;  5ETT A;  1Y4Z B;  3MOZ A;  1M5O C;  1OY6 A;  2IM3 A;  4ZIV A;  5F3Z A;  2CPY A;  3KK2 A;  1S9E B;  3GIJ A;  2RDI A;  3WOD A;  3S1N C;  4DG1 A;  2FQO A;  3HVT B;  5KT2 A;  2GFF A;  3BKU A;  1AT1 B;  2F8H A;  5KFU A;  3ISN D;  3PYG A;  2DGQ A;  2XZW A;  5TMC A;  1VGY A;  4DV4 J;  5JJB A;  2FUG 9;  2X7I A;  3R5C A;  4LT6 A;  2B4P A;  3NCP A;  5IWA J;  3MM9 B;  4NLX A;  4GMK A;  2NXJ A;  2AX0 A;  3F0N A;  1SIW B;  4USV A;  1WD6 A;  2Z56 B;  3TUJ C;  3G86 A;  3CQZ A;  5C24 A;  4OZN A;  2MGZ A;  4PPD A;  2G0J A;  3SQO P;  1X4E A;  5D0E A;  4KAI A;  2DGO A;  3S1M K;  5A8W B;  2W4P A;  2KL8 A;  1UA0 A;  1F93 A;  4ER8 A;  1F1B B;  2GNK A;  3CCM S;  2OEJ A;  1ISE A;  1F2H A;  1K83 A;  4CTA B;  2IMW P;  1R0A A;  4B08 A;  4BC7 A;  2MJU A;  1O5J A;  5K9F A;  1VDH A;  3KDN A;  1I3Q A;  4I6Y A;  3BZQ A;  2O5J A;  2DR6 A;  5SZT A;  5CCM A;  2GQC A;  1NK6 A;  1H98 A;  1T7P A;  1RXO B;  5IFM A;  4FYY B;  3KMQ A;  2YPY A;  2ZC4 A;  3TVK A;  3HSG A;  1RWX B;  4I2Q B;  4DV1 F;  1EET B;  4G1Q A;  3PW7 A;  3S1Q C;  5HAO A;  4CCH A;  2N82 B;  4YME A;  3IO1 A;  2DGU A;  3MM8 B;  3THT A;  1YBT A;  4F2R A;  5IYB K;  2NVX K;  3QGI A;  2GIF A;  3Q83 A;  4J9L A;  1FRJ A;  1WWH A;  4URG A;  5IT0 A;  4YFU A;  4KT0 C;  4PXE A;  3GYX B;  3P3D A;  4DL6 A;  2BA9 A;  4GTC A;  2V9K A;  5GAG U;  4KPY A;  1RIS A;  3MUM P;  5I3U A;  4A3B C;  3U27 A;  1I3Q C;  1IR0 A;  1S49 A;  4OHZ A;  3R8Y A;  3CJ8 A;  1REG X;  2XMV A;  2HUR A;  1PYS B;  3RBZ A;  4DX7 A;  1IUJ A;  1WQH A;  4YG2 A;  1YBU A;  3A3N B;  1JLQ A;  5F8G A;  3SCI E;  3MML B;  3HFZ B;  1GXT A;  1RT5 B;  3D6F B;  2GV1 A;  2CIM A;  1LW2 A;  2OML A;  4HDH A;  5DLF A;  4F4K A;  4WIQ A;  1AZS B;  1FX4 A;  2CPD A;  2M52 A;  3SYZ A;  1SL0 A;  3BBF A;  2QGF B;  2AJ2 A;  5F0W A;  2E9T A;  1U1K A;  4OHY A;  3DOL B;  1I6H C;  3OSP A;  2ZNZ A;  2JA5 A;  4Q0B A;  1DQ8 A;  3CCU S;  1HWJ A;  3GTM A;  3GV8 B;  3ZTS A;  2KH9 A;  4FZV A;  2I0X A;  3RRG A;  4C8O A;  4ZJQ A;  1ZM2 A;  4JYA F;  2GJI A;  2DEJ A;  2CZV C;  3WZ0 A;  2P5M A;  5IT9 U;  1HI8 A;  2K1R B;  5F9L A;  4MQ9 A;  2MKC A;  1N88 A;  3EGN A;  1BWV A;  3VF0 B;  2UVW A;  4OYW A;  1FES A;  2XI3 A;  3NXZ A;  2E5L J;  5LSO A;  1BQM A;  1S0O A;  3I0S B;  1S0N A;  3O2I A;  1PKU A;  3D9B A;  4ZPD A;  2WZ1 A;  3FSI A;  2G2Z A;  2V8D A;  2MZQ A;  2QV6 A;  2R42 A;  1N5S A;  4NLW A;  1HQE B;  4DS5 A;  4DU7 A;  1OPZ A;  4NCG A;  1NM2 A;  4HTI A;  5KAK A;  3J80 Y;  2DHH A;  5KTQ A;  3G6Y A;  3CME S;  3UVJ A;  4C2M A;  1RT2 A;  2MDA A;  1OY8 A;  5U47 A;  9ATC B;  2AV5 A;  1IKY B;  3BO4 A;  4JV0 A;  3GR0 A;  1NJZ A;  1G1X A;  2RKI A;  4FPI A;  2FVP A;  4HAC B;  5TJ3 A;  3BN7 A;  3HJF A;  3LWM A;  3A8E A;  1MWY A;  2AGO A;  1VI7 A;  1EQM A;  2RNE A;  3B54 A;  2LEA A;  2IDL A;  5F8M A;  3SZY A;  4H4M B;  3HOY K;  1I3Q K;  2B5J A;  4MK9 A;  2XMU A;  5KFF A;  2LXI A;  1XTZ A;  1NU4 A;  4O2D A;  1SJF A;  1JJ2 R;  4M94 A;  5J1E A;  5LMU F;  4V19 X;  3K5M A;  2Q6C A;  1Y00 A;  2GQ2 A;  3MCM A;  4Z7C A;  5M2U A;  2C1E B;  5KFS A;  2RF2 B;  1LWX A;  3VGV A;  1ZET A;  4FZB A;  4O4R A;  2CAJ A;  1RA6 A;  2F4F A;  2FY1 A;  1N6Q A;  5H9F J;  2VG5 B;  1BDF A;  4R8U A;  5MAO A;  4DL7 A;  2IPO B;  1OIA A;  4BS2 A;  2NVX A;  3IC1 A;  1VRU A;  2ZIT A;  1AUD A;  3OPF A;  1SXL A;  4DV7 F;  1M1H A;  2FGC A;  3M2U A;  3PO4 A;  2AWZ A;  2C2D A;  4KAW X;  1BE4 A;  4ZMM A;  5EHH A;  1X4G A;  3KLH B;  2ZHA A;  1BQN A;  1D3W A;  1SL2 A;  1TWA A;  2MST A;  4JB8 B;  2R93 C;  4M5G A;  1ZYQ A;  1F9H A;  2V50 A;  3DHW C;  1QUP A;  3IWL A;  3X3U A;  2KG1 A;  1WOR A;  2WVF A;  1HBM B;  1JB0 C;  1TKZ B;  4CTA A;  4RWX A;  4LRC A;  4OI6 A;  1YK9 A;  3FCV A;  2DXF A;  5KFO A;  2QA4 G;  1FO1 A;  5EWF A;  1IVZ A;  4X4P A;  2YNG B;  1ZM3 A;  3HHL B;  4W90 B;  2V68 A;  1BHN A;  1N5V A;  4M1X A;  3ZO7 A;  2OSR A;  4FS1 A;  3JSY A;  1F9F A;  3A3P B;  4EGL A;  1RHQ B;  1QVG R;  2HAI A;  2R7Z C;  1JLA B;  1X7V A;  2ATL A;  4HI1 A;  3TUI C;  2HPU A;  2ZJQ Q;  2MB0 B;  3S2H K;  3GIR A;  4YB1 P;  1S1T B;  3ZNJ 1;  1TL5 A;  2ZJR Q;  2HHV A;  3M2U B;  5ETK A;  2GMH A;  3D6M B;  1UKU A;  2PII A;  2AJQ A;  3LH2 S;  3I9V 9;  1DJ0 A;  4KMA A;  4X64 F;  3NBP B;  4RNH A;  4O3R A;  3C16 B;  3NGD A;  1XZQ B;  4EWT A;  4X84 A;  5D4N A;  4LOW A;  5KG1 A;  4Q2M A;  3B4D A;  2ROP A;  3TAM A;  1KQF B;  1KLM A;  2VZ9 A;  4DSE A;  2FQQ B;  2LEC A;  1O25 A;  2HBR B;  1SIZ A;  2J6T A;  2YTC A;  4MFB B;  3DI6 B;  3OL7 A;  3CW2 C;  5CXT A;  2A0F B;  1UJ5 A;  3IBF B;  3W65 A;  4AND A;  2PN6 A;  2EBG A;  3VWS A;  2MJN A;  5EWG A;  3EZO A;  4YR3 A;  2XSJ A;  4RPF A;  3H5S A;  1ZYR A;  5C4J K;  4FNI A;  1WTF A;  2LQ8 A;  3BGU A;  4GKJ F;  3GTL A;  1ZAX A;  5M5Y K;  4TKT A;  4OX9 F;  2H65 B;  3CJR A;  2JJ4 D;  4Q7A A;  1NDK A;  4DG1 B;  1S99 A;  3BBC A;  5KFI A;  4WXW A;  3OHA A;  3AH6 A;  5DDP C;  4C9D A;  3LP1 A;  4LFA F;  3OTD A;  2GA7 A;  4ZVG A;  2VQE F;  1XC9 A;  2YNH A;  2KG0 A;  1L3V A;  2KN4 A;  4K2X A;  4DV2 J;  3UNY A;  3K58 A;  4BWM A;  1VQL S;  2MQL A;  3KJV B;  2BR0 A;  4J9S A;  1M5S A;  2HNY B;  2IAJ B;  3T1Y F;  3IWX A;  1LW0 A;  2M5Y A;  1Q81 T;  1J5O A;  3MM6 B;  3CJ0 A;  1JKH B;  2WAQ D;  1B7Y B;  3DC2 A;  1I94 J;  3DU6 A;  2F65 A;  4U8V A;  2KWA A;  2DGS A;  4QR1 A;  4PXB A;  2ZH8 A;  4OIP A;  1NKE A;  2PA8 L;  3AAW B;  4DR7 J;  2QIF A;  3HHD A;  1KSP A;  5FD1 A;  1YGY A;  1HR0 J;  3W60 A;  4PZV A;  2R2T A;  3GTG A;  1ZTT A;  3C6U A;  3M05 A;  3IRX A;  2JWN A;  3S1M C;  2NRE A;  2CAD A;  1EIY B;  1FJE B;  2FJW A;  4LSL B;  1I1G A;  3QMQ A;  3QX3 A;  5DG7 A;  2FHK A;  1GTE A;  1V6H A;  2CJ9 A;  3OQ2 A;  5KG3 A;  3EE3 A;  1IN0 A;  1UZD A;  1GXU A;  2JSX A;  3C66 A;  4X4T A;  1I94 F;  1J6W A;  2PMZ D;  2XCR B;  3AB4 B;  2DXE A;  2EBE A;  2PFD A;  4LLG A;  3G9C A;  3D3B J;  4WFX A;  4C7Q A;  1YVF A;  2L9N A;  2Y0S D;  4J9O A;  3QLH A;  1MML A;  5ITH A;  4I2Q A;  3RTV A;  2HFU A;  3K7R A;  1NSQ A;  1LWE B;  5HJX A;  4KV8 B;  5KFE A;  4JI1 J;  3V2U C;  3ISN C;  2BX6 A;  3TO8 A;  3BO3 A;  3JS9 A;  4KHM A;  3AA8 A;  1HW9 A;  3NNC A;  4BBS K;  2G13 A;  3LO3 A;  3AOC A;  3RG6 A;  3LF0 A;  1H0H B;  4OIO A;  3AJ2 A;  1Z2Z A;  4XDD A;  1WQG A;  1VQO S;  4O3O A;  1GQE A;  4Q45 A;  3C16 A;  4KV8 A;  1HWI A;  5A8K A;  1CS4 B;  2OH2 A;  2V69 A;  2DGW A;  4YFK A;  1B0T A;  4P5B A;  4HHH A;  3CQZ K;  4V1A k;  3T00 A;  3HSZ A;  3MCN A;  5JMN A;  1S7I A;  2OLW A;  4OIX A;  1NO8 A;  5KFP A;  1RAG B;  1H6K X;  4P5A A;  5IP7 K;  4J9R A;  1OSD A;  2CQD A;  2XMK A;  2CW0 A;  3NEK A;  4OZ3 A;  3NOG A;  4P71 A;  4D3H A;  4NOI A;  1KTV A;  2Z0G A;  2GVD B;  4OHV A;  3KLI A;  2A6M A;  3DLE A;  3H4D A;  2J9E A;  3FHZ A;  3M30 B;  3TVY A;  3UE2 A;  3ONQ A;  1LQ9 A;  1RBA A;  1RJJ A;  1JIH A;  5F8J A;  3H59 A;  3RB0 A;  1CC7 A;  4N5S A;  3M3Y K;  1R8C A;  2FHO B;  2IIH A;  3I5B A;  1KWM A;  1Y1V C;  5LSL A;  3PO2 C;  4I2P B;  4X6A K;  4LUB A;  4FVM A;  4YB7 A;  4QQB A;  2ZFZ A;  2H1Y A;  2W2P P;  2HMI A;  4GZY A;  2RDD A;  1FTC A;  2A2C A;  3K7A K;  2DNR A;  4DX6 A;  3T1H J;  3JXO A;  3HVR A;  2B4V A;  5KFR A;  4ILL A;  5J1N A;  2MKY A;  1C0T A;  4FYD A;  1UET A;  2FJA B;  3WHI A;  4CLZ A;  2HVI A;  1O0P A;  4CO5 A;  1J2V A;  4B9L A;  3DLK B;  3CCR S;  2CA9 A;  1CQN A;  4K0K F;  1FNM A;  3MEC A;  2KFY A;  1VK3 A;  3MTJ A;  4LIR A;  4NLD A;  5K8P A;  4JV2 A;  1U4B A;  1O28 A;  2KVI A;  4CO2 A;  4LVO P;  3IR5 B;  1M1K T;  4LF8 J;  1DAX A;  3V6H A;  5L9X A;  3MR3 A;  3HKZ D;  1VQS A;  4G6V B;  3MMA A;  1MLA A;  3HHN B;  4ZVQ B;  3QYY A;  2M4M A;  3SEO A;  2ASD A;  3DGP B;  1CJV B;  4NZ0 A;  4OYZ A;  2KVQ E;  2VOO A;  5D3G A;  2CQ2 A;  2XSJ B;  2E44 A;  2LXU A;  5J2P B;  1URR A;  4FYV B;  3N5B A;  2RS8 A;  2HBQ B;  2BBE A;  2NXU A;  4L6V 3;  5KFM A;  2VQE J;  4L72 B;  5CYM A;  3KOA A;  3R97 A;  3NGT A;  4P2M A;  1ZA1 B;  3W5X A;  2R4F A;  2V4J B;  4HL9 A;  4Y2K A;  4PQU B;  5HP1 A;  3ITH B;  3CO9 A;  3DLH A;  1SVD A;  4M5N A;  3S16 K;  5EX0 A;  4MT1 A;  3JYT B;  4XAK A;  5ETR A;  1T9U A;  2W24 A;  4WZM A;  4KRW A;  4U96 A;  3QO9 A;  2V0N A;  4LFC F;  4JI2 J;  3TEH B;  3SZZ A;  4YR0 A;  2MXY A;  3DU5 A;  2VIC A;  1B4A A;  1LWE A;  2JOQ A;  3H0P A;  4H4K C;  4AL7 A;  1NEE A;  4YY3 F;  3JQJ A;  4P73 A;  1J5E J;  5HVF A;  3QBC A;  1K1Q A;  5DDQ C;  2Z8Q A;  1R8H A;  3FEY B;  3MPU B;  3Q3Q A;  4L3K A;  4G7H A;  2QYG A;  3W7B A;  2Y3Y A;  5K8M A;  4DUZ F;  4DU8 A;  4CIO A;  2YKQ A;  3R5A A;  4H4M A;  4PG7 A;  3IRX B;  3UQS A;  3VR1 A;  2W9B B;  2J5A A;  1IBL F;  3KLV A;  5LMN J;  3NRB A;  4U6P A;  1UCN A;  3IBC B;  4O44 B;  3S14 K;  2VA3 A;  1KOO A;  4K4X A;  3PTW A;  3BDE A;  3GYG A;  5IC4 B;  3DGV A;  1XEZ A;  3EGV A;  1VIO A;  2UUA J;  3H0G A;  4GO7 X;  4NRU A;  3EPI A;  3HP6 A;  5JFE A;  4PUO A;  4PRF A;  2MLX A;  3LWL A;  1XMQ J;  4KYZ A;  2RH6 A;  3VVT A;  3KLE B;  2PA8 D;  2KFN A;  3EM1 A;  1ZXO A;  1TU0 B;  1V3S A;  4ECV A;  4XPE A;  4H4K A;  1F5B A;  1BXN A;  1B7F A;  2N3L A;  4OYB A;  2PI5 A;  2BAN B;  4A3K K;  3EVO A;  2ZH7 A;  4YN3 B;  2CYY A;  1SC3 B;  2D3U A;  1FT8 A;  1RBL A;  1TUG B;  5KT7 A;  3CJ3 A;  3GIM A;  3L95 X;  3BR8 A;  5IZH A;  1S4F A;  4X62 J;  2F4V F;  5DM7 Q;  2ZNY A;  2OPP B;  5L1K A;  2K2P A;  4I0W A;  2ZBP A;  1DLO A;  2RUS A;  4A8Y A;  1NJX A;  4U8Y A;  4Q44 A;  1LK5 A;  4P74 A;  3FCW A;  3MM7 A;  4QIG A;  1PJ7 A;  4F02 A;  3QRP A;  1LWC A;  2BE2 B;  7FDR A;  2R7R A;  2E1A A;  1O2F B;  1SC6 A;  1BY9 A;  3EIC A;  1JXL A;  5J2M B;  2VKZ G;  1P1T A;  3IG1 A;  4KFB A;  3M6W A;  3MR6 A;  2BJD A;  4BXX K;  4C48 A;  5E3C A;  4OX8 A;  1WKK A;  1NAQ A;  1R0C B;  3DGP A;  5CD4 H;  3D0G E;  3EMT A;  5D78 A;  1JJH A;  1FEH A;  5CQG A;  1C1B B;  2AHO B;  3GZ7 A;  1T05 B;  4FF2 A;  1H7X A;  3PKM A;  2XCO A;  3TZX A;  1APS A;  3MPY A;  1KOH A;  4NRT A;  3WIV A;  1RT4 A;  2H3E B;  1X60 A;  1VR6 A;  2G0C A;  3IR7 B;  4MIA A;  3GCW P;  4CRJ A;  1XZQ A;  1VIS A;  4A3E C;  3VHQ A;  5IOT A;  3L7U A;  4KTQ A;  3C8Y A;  5B0G A;  2L9W A;  3TVZ A;  5BJR A;  3DMJ A;  1BQM B;  3CMA S;  2JDJ A;  5D8H B;  1S7H A;  2VA2 A;  1S1T A;  3SSR A;  1VQM S;  5JVG Q;  4K7Q A;  4OI1 A;  3HXA A;  2HWI A;  2E7X A;  1NND A;  2COL A;  2DNK A;  2CRL A;  2DT9 A;  2BRL A;  4QWE A;  1I6H K;  5BYR A;  2R7Z A;  3UR0 A;  3C6T A;  4NE9 C;  3R9L A;  1HWL A;  5A2Q U;  1R0A B;  2VFR A;  3NMA A;  1Y1W A;  1NLK L;  4LBI A;  4Y6I A;  2ZEJ A;  1UFL A;  2HYI B;  2DPJ A;  2PE8 A;  5DO2 A;  2R7W A;  2YNF A;  5G0R A;  1IBA A;  3HHL A;  2QZ8 A;  1RAI B;  3O3L A;  5DDO C;  4Y2C A;  4OQJ A;  1XMQ F;  5I3U B;  1ZZF A;  3P49 B;  2G0I A;  3M7V A;  1H73 A;  5IM0 A;  3N6L A;  2A18 A;  4OX9 J;  2AJF E;  1KKH A;  5LJ5 Y;  1OS5 A;  5C3E C;  2BUN A;  1SJR A;  3MD1 A;  2OUG A;  1K0V A;  3R5D A;  3RR7 A;  4JK1 A;  1TWA C;  4NCA A;  5HK4 A;  4ZVO B;  2OSQ A;  4ECU A;  2UUA F;  2WSC C;  3P45 B;  4OYX A;  4MK7 A;  4NXM F;  1TEL A;  3THP A;  1Q5V A;  2LXF A;  3VA7 A;  5HAN A;  4QIW L;  4JI3 J;  2FHM A;  2PEH A;  5AT1 B;  2PD1 A;  5HAT A;  3DMJ B;  4KHR A;  3PYD A;  5F0U A;  4C8N A;  1WF0 A;  5T14 A;  4UY8 T;  2VJV A;  2XB2 D;  1X0P A;  2CPJ A;  4QZV B;  1AB8 A;  4IO9 Q;  3D6T B;  3KG0 A;  2C28 A;  1Q8L A;  4TU7 A;  2D3Z A;  3PYE A;  4D3G A;  3WC2 A;  1LWF B;  1Z4U A;  4MKA A;  1HBN B;  2JFK A;  2MY7 A;  3MEK A;  4QIV A;  1J5E F;  3HCX A;  2V8V A;  1IL2 A;  3O1L A;  4JI5 F;  2F7V A;  4USH A;  4ZCK A;  3TFH A;  1VRT A;  4RNN A;  3H25 A;  3Q24 A;  1UW4 A;  2JEG A;  2OI2 A;  1WIH A;  5D0G A;  2QMW A;  1D8Z A;  5KFV A;  1TMM A;  4I6A A;  1TV6 A;  3RJM B;  4HVZ A;  2X1G A;  1C4A A;  1C1C A;  1FDN A;  2PMH A;  2AYG A;  5HI7 A;  5FJ8 K;  3Q2S C;  4DHV A;  4JYA J;  1FRI A;  4C8K A;  2H5J B;  1T9Y A;  1S1X B;  2PMW A;  1EJ7 L;  4N47 A;  2MY8 A;  1RBO B;  1RT2 B;  1P9Y A;  3HHK A;  3GFX A;  1R9T A;  1HPZ A;  1GMU A;  1FJC A;  2C2O B;  3T3F A;  2IC3 B;  4ID8 A;  4B3R F;  5DQI A;  1P8G A;  1BUX A;  5GAD U;  2AP6 A;  4A3G K;  1IQ0 A;  3HF5 A;  1N5Q A;  1RTZ A;  2EK1 A;  3JTP A;  3J7A N;  1FRX A;  2VB6 A;  2A1B A;  1EKR A;  3OD2 A;  5E33 A;  4R5P B;  4B9S A;  2OP5 A;  3UO0 A;  2FJX A;  5C2G A;  3G8T A;  2CPE A;  1XZP B;  4CLS A;  5HO4 A;  4WK3 A;  4KKO A;  3K8W A;  4XK8 C;  4BLB A;  4A3J C;  4OLO A;  2L3M A;  3LA0 A;  3GIK A;  1KFS A;  3OVB A;  3KJV A;  1TWH C;  2DRA A;  1JLQ B;  4LBH A;  1K1S A;  1A9N B;  4NML A;  4F2S A;  3NL0 A;  3KWM A;  5D4L A;  3SIP B;  2LCW A;  1P27 B;  3GV5 B;  3FK4 A;  3JSM B;  1ULR A;  3TOQ A;  4MIB A;  1D9D A;  4BHQ A;  2YQ1 A;  2OPQ A;  2IRU A;  2XHW A;  2FC8 A;  1YDL A;  1SUQ A;  2CPZ A;  4EUV A;  4FBT A;  1JWW A;  4O3S A;  2VFS A;  3LP0 B;  1M1G A;  2BXJ A;  1J6X A;  1RWM B;  2GHV C;  3GJQ B;  4DI6 A;  2C2M B;  1RYS A;  1XER A;  2RHQ B;  3BKT A;  5CYJ A;  3J81 Y;  4KHP J;  4HR2 A;  1SQE A;  4C8Z A;  4N56 A;  4DV3 J;  2XQC A;  3BS9 A;  2KXN B;  1I3O B;  1RWV B;  1XQI A;  1Q7L B;  3JB9 k;  2VIH A;  4IKA A;  5LT5 A;  4A3K C;  2B51 A;  2QLB B;  2F1F A;  4CLY A;  3DI6 A;  1P1L A;  4G0W A;  1GH8 A;  4IFV B;  5F3T A;  3GB0 A;  1QLN A;  1IR2 A;  2MZT A;  2HAF A;  1N5Y A;  1X4B A;  4CT9 A;  1NSA A;  2LYV A;  3M4O C;  3BP8 C;  2UV8 G;  5KG0 A;  1XNQ F;  2MQP A;  4E8U A;  2OO4 A;  1HFE L;  1W25 A;  1W26 A;  3LGN A;  2Y9H A;  1B3T A;  3MFH A;  4J9V A;  2CQI A;  2WVE A;  4O44 A;  4KM8 A;  2DNP A;  1FD8 A;  3M9N B;  2M2B A;  4DFP A;  5E5N A;  1LEO A;  5B0D A;  1L0W A;  5K5M A;  3M8Y A;  5GAE I;  1S0M A;  4IYQ A;  4USU A;  3TX8 A;  1UPM B;  3JAM Y;  2ZVS A;  4JI5 J;  3RZO C;  1HIY A;  2MQO A;  4KBI A;  3NCR A;  1JNZ B;  2E9Z A;  1MNE A;  2O67 A;  1RYR A;  3UDC A;  3T5L A;  4B3M F;  2XBP A;  4WP8 A;  3CMQ A;  4LSN B;  2LMI A;  2R2U A;  3Q86 A;  4ZVH A;  2EFO A;  3FQL A;  4A93 K;  3L7O A;  2OGU A;  3N3Y A;  3A12 A;  2NXC A;  2KDO A;  5IP7 C;  5M2R A;  3NS6 A;  2FJV A;  2KM8 C;  2B9Y A;  5GME A;  4K4W A;  1RP5 A;  4QJV A;  2FHJ D;  3R7B B;  1ZH5 A;  4ZVU B;  2DY1 A;  2IM0 A;  4DQR A;  3CGI A;  4TYB A;  2QJ3 A;  4LQ3 A;  3C46 A;  2ZZT A;  3QZ7 A;  3OR1 A;  2QL5 B;  4OYP A;  1TWH K;  4I56 A;  4PYD A;  2VBW A;  4WYW A;  1XJW B;  3CJK B;  4KAR A;  2MZ1 A;  1Y10 A;  4MKV A;  1CJT B;  4F04 B;  3JSB A;  1EP4 A;  1KHV A;  3NNH A;  4A8F A;  4DPU A;  5EX3 A;  4N8O A;  3QGP A;  3NS7 B;  2BE5 A;  3RB6 A;  5IV4 A;  4B3O B;  2HNY A;  1K8A T;  2CXE A;  1U6F A;  1NK9 A;  1BGX T;  4ZLP A;  5KOX A;  3KDO A;  3G4C A;  3GDZ A;  1SPB P;  3OJS A;  1TP7 A;  2ZD1 B;  4A8S A;  4NA2 A;  3LP1 B;  5HBM B;  1SCJ B;  2NUH A;  3T6B A;  4CI0 B;  3HPO A;  3A8J A;  4JI1 F;  3QZ8 A;  1YTY A;  1YRT A;  3R1H A;  3FDS A;  3W9J A;  3M2R B;  3MCS A;  1FE0 A;  2QG9 B;  1C1C B;  4ZDN A;  2J7U A;  4Q8F A;  1WC0 A;  3EGW B;  1TV6 B;  4K8R A;  3B78 A;  4LMZ A;  4ZP9 A;  4OHX A;  3Q8U A;  3SDE A;  3BH7 B;  1H74 A;  1OO0 B;  1RHJ B;  2ZOM A;  3LP2 A;  4NLR A;  2GGP A;  4YB5 A;  3UI3 A;  4NLQ A;  2KJW A;  2V2K A;  4KAT A;  2W9A A;  1GAO A;  4BC9 A;  4F4X A;  2JA5 K;  4RW8 B;  3CD6 S;  2KYX A;  1NCL A;  3VAH A;  5B0A A;  4C11 A;  5RUB A;  3A13 A;  3A3O B;  2HFS A;  2DR9 A;  1YJT A;  2IJN A;  1DTT A;  2GIQ A;  5HVG A;  4LBP A;  3FOE A;  4J9N A;  2VOP A;  3LGM A;  4MMO A;  2OFH X;  4H4O A;  1VQ5 S;  4DR7 F;  4OIR A;  2UXD F;  2Y1R I;  2BJ3 A;  1HPZ B;  2H4W B;  2Q43 A;  3M6V A;  2XLJ A;  2C3M A;  1XNQ J;  4C3L A;  4F36 A;  4KPC A;  4NLP A;  2M70 A;  3PJ9 A;  1IR1 A;  2HHH J;  4DOZ A;  3BGR A;  2WCX A;  2J7K A;  4P72 A;  3CXC R;  2PEB A;  4ECS A;  1N36 J;  3U1N A;  3I0R A;  3DRR B;  2R8I A;  1WCM A;  3UDE A;  1JLF B;  4RW4 B;  2QE5 A;  4IOA Q;  3FQK A;  4C0O C;  3NMR A;  3TTG A;  3FCH A;  2VPX B;  2OJ3 A;  3EJM A;  1NUE A;  3BYR A;  1HBN A;  2XCP A;  4IRC A;  2RQK A;  3T5H A;  2HS4 A;  2FZC B;  2UU9 J;  4KHP F;  1S6P A;  1VJE A;  2BJ1 A;  4OV1 A;  3DRP A;  3OJU A;  2LA4 A;  1IQZ A;  2V6T A;  1AFJ A;  1R6V A;  4BBR K;  1D9A A;  2C22 A;  5A8R A;  2VPZ B;  1HD0 A;  1TAQ A;  2OKQ A;  3GP9 A;  2VUM A;  2I5J B;  4OZ0 A;  2ZBQ A;  3W9I A;  2VC1 A;  4C3I C;  3T1A A;  2DNH A;  2FQT A;  1N0V C;  1XXC A;  2R92 C;  4ID5 B;  2DEI A;  2QN6 B;  3Q23 A;  4DPO A;  2YU9 A;  4J7C A;  3LOU A;  2PHC B;  5KG6 A;  4HH0 A;  5IOR A;  4DLE A;  5G0R B;  3D1H A;  4OJ3 A;  4CH7 A;  4ECQ A;  1EI6 A;  2VL1 A;  2BAC A;  2B9X A;  3VTI A;  5C24 B;  4CWB A;  1IQT A;  2C3U A;  2AJ4 A;  2LQ5 A;  2EFG A;  3EDQ B;  3CUL A;  5DQG A;  2D6F C;  1SKW A;  1DHM A;  3R7N B;  2DRD A;  2BM0 A;  2QL9 B;  4RNF A;  3ZZO A;  2R93 A;  1KLM B;  3EZU A;  4E98 A;  1CJU B;  3BEG B;  4WTY A;  1RDR A;  2XZD B;  3WC0 A;  3M8P A;  4ED4 A;  5FLM C;  2DHA A;  5EUH A;  4DF8 A;  2V63 A;  3C2P A;  4MTP A;  3HSD A;  3UN5 A;  1KQG B;  2ZZM A;  2NPF A;  3GTG K;  3I0S A;  2JEJ A;  2E2J K;  5HL7 Q;  4R5P A;  3C15 A;  2ZM6 F;  2CQ0 A;  1SFO C;  1FER A;  4LK1 A;  4YFN A;  4WIL A;  9RUB A;  5IQ6 A;  1RT3 A;  2XM3 A;  4DJB A;  3KK2 B;  1S0V A;  1FJ7 A;  2YBV A;  2AYM A;  1F9N A;  1SMY A;  1X31 C;  1HL6 A;  2HHQ A;  3DOM B;  3HHL D;  3M9O B;  3R7S B;  3HFK A;  2HVE A;  4Q5S A;  2GCF A;  4RUH A;  2HK3 A;  3NAH A;  1NRK A;  3H90 A;  3OSN A;  2RQC A;  2BQR A;  4GRS A;  3PDN A;  1D09 B;  3HOV K;  5L38 A;  3TFI A;  4KH1 B;  4DSJ A;  3CCL S;  4XLP A;  4BY7 K;  4QOT A;  4LJZ A;  5HRO A;  2AEM A;  4X64 J;  4GVB A;  2LA6 A;  1T9W A;  3MAQ A;  3A8I A;  4X4Q A;  2HIQ A;  1U09 A;  1WEY A;  1CEZ A;  1E6V B;  4KFB B;  1D0E A;  4NXM J;  5LM7 E;  4A8O A;  1MU2 B;  2B43 A;  2KYZ A;  4JI2 F;  2VU5 A;  2AYE A;  4JI3 F;  3L4B C;  4Q2L A;  1TWF K;  2IJF A;  3LAL A;  2V8G A;  1NZA A;  1R89 A;  5SUH A;  1RAC B;  4DV6 F;  3RAQ A;  4JI8 F;  1GK8 A;  4ZLL A;  5LSR A;  3TEG A;  1DAR A;  3DXS X;  3M8Q B;  2XS7 A;  1N32 J;  2DRB A;  5AXM A;  4B9U A;  3AJ1 A;  1X4F A;  4U67 Q;  3KLF B;  1GTH A;  4DV6 J;  3S17 C;  3DLJ A;  1WSR A;  3DCA A;  2FTR A;  3GTK A;  4K5S A;  3KUE A;  2AEJ A;  4C3I K;  4IUF A;  3GEH A;  3RRK A;  4DPY A;  3NCQ A;  2QA4 S;  2XYH B;  3E01 B;  3ZC4 A;  4DS4 A;  2EI5 A;  1RT7 A;  1NZ8 A;  3DRP B;  5DS7 A;  3PX6 A;  4M5K A;  4QR0 A;  1EX8 A;  1WF1 A;  3FGV A;  5IXU A;  2H5E A;  3MM5 B;  4UUW A;  2NVQ C;  3LPX A;  4WKR A;  3D5M A;  2E1M C;  3K59 A;  3GTQ K;  2IYG A;  1VC5 A;  1VC6 A;  2R7Z K;  3IWN C;  2J0Q D;  3SCJ E;  8AT1 B;  4I69 A;  2HZV A;  4E0D A;  3FBB A;  1GE9 A;  2HFV A;  1AYE A;  3IPJ A;  3UCZ P;  1UFW A;  3OR1 B;  5KFT A;  1VH2 A;  4P7T A;  1T94 A;  3FKI K;  3OTB A;  5HSP A;  2QSW A;  2BW7 A;  4NPO A;  1C2P A;  2EW9 A;  2C3Y A;  2EBB A;  4FF3 A;  1RTH B;  2HKE A;  1HBO B;  3HMJ G;  3RBE A;  4OL8 A;  5M5X K;  1BLU A;  1OJ4 A;  3QRQ A;  2U1A A;  2MQN A;  3I0R B;  4BKW A;  2Q6B A;  1EQR A;  6FD1 A;  1Q5Y A;  4A3B K;  1GNK A;  4LSN A;  2OTJ S;  3TJ9 A;  4GKJ J;  4ZLJ A;  5M2P A;  2R93 K;  1U8S A;  2YH0 A;  1WOP A;  4O4G A;  2LU2 A;  4A8W A;  4IR1 A;  4ED1 A;  4CQ1 A;  2CVI A;  1YWX A;  3T5K A;  1DCP A;  2NS1 B;  1RT7 B;  4Y0F A;  2FY8 A;  3RAX A;  5B7W A;  2KHC A;  2VOD A;  1HBU A;  1SBR A;  1ZTW A;  1VJW A;  3MEE A;  2RF2 A;  5H1S V;  1RE1 B;  4JI6 F;  3PW5 A;  4Y65 A;  3HOW K;  2CUY A;  5J1E B;  5FLM K;  1X4C A;  1G6B A;  4C8M A;  4HEA 9;  4AL5 A;  3W2W B;  1RTI A;  1VHI A;  4J91 A;  1VQN S;  3Q89 A;  2FHJ A;  1TK8 A;  1SV5 A;  3S6E A;  1WKL A;  4A8M P;  2P5V A;  4YY3 J;  4C98 A;  1JLG B;  2R7X A;  4BBY A;  2WTF A;  2F8M A;  3PX4 A;  1M90 T;  3K2Y A;  3DOL A;  1VC0 A;  1INN A;  3KKF A;  1VBZ A;  2GQQ A;  4TN2 A;  2QFJ A;  2WVC A;  3HM9 A;  2HVD A;  5GAH U;  1UVJ A;  2DCL A;  5I3P A;  4RU9 A;  1NPR A;  2MEW A;  2HHW A;  4NLU A;  2AZ3 A;  1Y11 A;  2PDA A;  4ZJO A;  3BGF A;  1IJE B;  4XLN A;  3EXY A;  1Q53 A;  3GTK K;  3CDB A;  3CSK A;  3UD4 P;  3V81 B;  1GFW B;  3FC9 A;  3TAP A;  4KDD A;  3AD8 C;  4HYK A;  1HQE A;  1HNW F;  3BSN A;  2QT7 A;  3R5G A;  1PO6 A;  1FKO A;  1ZA2 B;  3I4P A;  3OFH A;  4CZC A;  1HI9 A;  2AGQ A;  4NA3 A;  1UPP A;  3GTP A;  3IGV A;  5ETV A;  3DM2 B;  2HFZ A;  2DCU B;  3KK1 A;  3RRH A;  1WG1 A;  4X4S A;  4XSZ A;  3HI9 A;  1SKR A;  2Q79 A;  2EC0 A;  1O8B A;  3GTL K;  4X2B A;  2JC0 A;  2OEK A;  2MHE A;  1RU0 A;  5I4M A;  3V4G A;  1PCA A;  3H4B A;  2I2Y A;  4LFB J;  2DKO B;  1FDD A;  3T9N A;  1JVI A;  5KT5 A;  3CJ5 A;  5FDL B;  5LL6 d;  4ILR A;  4F4Z A;  2ALY B;  2RD5 C;  3I4M K;  1G3O A;  2IVY A;  4Y2M A;  3FBF A;  1HNI A;  3EUN A;  2Z57 B;  1S9G B;  2F5G A;  3B6B A;  1KVI A;  2BJ8 A;  2ADC A;  1HQM A;  2HBZ B;  1MRO B;  4MYT A;  2KKH A;  2EKN A;  2W2Q P;  4O4G B;  5EGE A;  4F25 A;  4TYA A;  1DQ9 A;  4ALZ A;  3K8V A;  2VPY B;  3ICL A;  1FNO A;  1NHU A;  1FVS A;  2HQC A;  4OV6 A;  2RAQ A;  1NJW A;  1JJC B;  2DJW A;  2WBR A;  3NGR A;  1HBO A;  4ZS6 A;  3ET6 A;  1W2I A;  2ZBC A;  3N6N A;  4CLL A;  2ALZ A;  4RJV A;  2Y8W A;  5IYB C;  2NVX C;  4MKY A;  1GEH A;  2LQB A;  3GTO C;  4NCB A;  1RWO B;  1H2V Z;  1I5O B;  2OPS B;  4KB7 A;  4P10 A;  5C42 B;  2KB2 A;  3L4J A;  3QT5 A;  3O5T B;  2PMZ L;  1IM6 A;  4ZVP B;  3GE9 A;  1SC4 B;  2RQ4 A;  4JV5 J;  2FVQ A;  4BLA A;  2HRU A;  5B08 A;  5C5J A;  1FFW B;  3K7A C;  2CWX A;  4I7F B;  4LIW A;  3SV3 A;  4X6A C;  1T95 A;  1T3O A;  2BKP A;  1I50 C;  1JLE B;  4AYB L;  1JKH A;  3D54 A;  2HIY A;  5J2P A;  2W1B A;  3W8G A;  4GFQ A;  1Y1W K;  3S1R K;  1SJ3 P;  1SH3 A;  2EG2 A;  1VQ4 S;  3CDE A;  3B4M A;  2OEL A;  4CM2 A;  4DL2 A;  2HVH A;  4IOB A;  3PNI A;  5HLF B;  2BE7 D;  1HYS B;  2RU3 A;  3HHE A;  3PW4 A;  2CDQ A;  4ZN3 A;  1BQX A;  5T7L A;  5BR8 F;  4B9N A;  2EEY A;  1PYT A;  4WYL A;  4CLW A;  3GSD A;  4QWD A;  3CE8 A;  2EWH A;  4ECX A;  4WPA A;  1D9F A;  4F67 A;  4ECT A;  3PIO Q;  1FNX H;  1JLC A;  2B6A A;  2B7B B;  2W4D A; 
#chains in the Genus database with same CATH homology
 3GIR A;  1WSR A;  3AD7 C;  3GSI A;  1XZQ B;  1XZP B;  1XZQ A;  1XZP A;  3AD9 C;  3TFJ A;  3A8I A;  3GEE A;  4P9S A;  3AD8 C;  3A8K A;  3GEH A;  3TFH A;  4PAB A;  1V5V A;  1WOR A;  1WOP A;  1PJ6 A;  1VLO A;  3A8J A;  5L46 A;  1X31 C;  2GAH C;  3TFI A;  1YX2 A;  2GAG C;  1WOO A;  4PAA A;  3TTG A;  1VRQ C;  1PJ5 A;  1WOS A;  3GEI A;  1WSV A;  1PJ7 A;  3ADA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...