3AD8C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with pyrrole 2-carboxylate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad8C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad8C01
3A8KA 1XZPB 1PJ6A 3GEIA 3ADAC 1WOSA 3TFIA 3AD8C 1V5VA 1WOOA 3AD7C 4P9SA 1XZQB 1PJ5A 3GIRA 5L46A 3A8IA 1X31C 3A8JA 4PAAA 1WOPA 1WSRA 1WSVA 1PJ7A 1XZPA 4PABA 1VRQC 1YX2A 3GEHA 2GAGC 1VLOA 3GEEA 3AD9C 3GSIA 3TFHA 3TFJA 1WORA 3TTGA 1XZQA 2GAHC
chains in the Genus database with same CATH superfamily
1NHUA 4RUAA 3NNHA 4I64A 3C66A 3IA0A 4DQSA 2X7IA 3LGHA 1WOPA 4GT9A 2DITA 1C0AA 1FRLA 3T6JA 2X3GA 1S9EA 3KUGA 5CCLA 3Q8QB 3ADAC 1INNA 4RW6A 2CADA 4ED2A 1UFLA 1VBYA 4BBRC 1SJ1A 3OUYA 2D3O1 3N5FA 4F04B 5L9NA 2N82B 2AMCB 3M8PA 4ZPDA 3H4BA 2P8TA 5KFYA 2ACMA 4H4OB 1FKPB 4A3BC 1DZ5A 2EC2A 2NLWA 2OH2A 1VLOA 3KUHA 3M4XA 5E3PA 3KYLA 5IZHA 4WFYA 2X3DA 3L3CA 1VRUB 5HQLA 4LK0A 1I51B 4PRFA 3ET6B 3PW7A 4Z2XA 4NLWA 2K06A 1IWAA 1Z4UA 5E68A 4AQYF 3FSXA 4KKOA 5KFXA 4CO3A 2IFXA 3GJRB 3M4OK 2EFGA 2IVFB 2HVIA 1Q0NA 4ZLPA 2DRBA 1S0VA 3Q22A 3T5HA 1L0WA 5A8KA 3KLHA 1CEZA 2M52A 5JVOA 3PO2K 4ZOSA 5K8MA 4DF8A 1XXAA 2VDHA 3VGSA 2WVEA 5K20B 1UFWA 3C2PA 1WG4A 1R0AA 4ECXA 1URNA 4YB6A 3O5TB 5K8NA 3CCRS 5F8JA 3MM9B 1YRXA 2AT1B 4X62F 1I50A 2NVQC 4K5RA 3MTKA 4OI4A 4X64J 1SH0A 1EKRA 3M8WA 1QLNA 5KFUA 3T5LA 3DRXA 2VF3A 3GTQC 2Z57B 2JA6K 3AD7C 4BCAA 3N6MA 3IR7B 4PQUA 2APOA 2OEMA 3CC2S 1HBOB 1RHMB 2HFZA 3UVJB 1HLWA 2YNIB 2DHHA 4HR2A 5D3GA 4WK3A 3S14C 2VUMC 2RS8A 2V6TA 5A2QY 4ED4A 1L3VA 3BS9A 1CSJA 1WC1A 1GMVA 4KE5A 2VPXB 3NUHA 1B4SA 1U4BA 1EI6A 2MYFA 1KDNA 3CQZC 1HBUB 2I5JA 2MQLA 1VBZA 4LSZB 5SUHA 3UN3A 2W4CA 3KOAA 4MKAA 2HNYA 3O1LA 4W4MA 3MMJA 3EVOA 4M5IA 1E6VB 1ZM3A 2HG4A 2HKEA 1MROA 4PYAA 2HVEA 1NHVA 2QGFB 4W98A 4XLPA 3H3VL 3S1QC 4LLGA 1NKBA 1JLGB 2KT5A 1EETA 3FFIA 2E5LJ 2A6EA 1M1HA 2CPFA 2M3DA 4QYRA 3FHZA 4FBUA 5KTQA 4JI8J 1G6BA 4OJHA 4DR6J 2AD9A 5ETLA 2GX8A 1KTQA 4DS4A 4DUZJ 1SQGA 2D6FC 1EP4B 1Q8IA 2G2ZA 1TVRA 4L3NA 1TKZB 3HMJG 1REGX 2OPQB 1IBMJ 4LSLA 4DUYJ 2QO3A 2VZ9A 4UZBA 3M32B 4M94A 3L95X 3A4TA 1GQEA 4QW8A 2P9GA 2BJ8A 1C1CA 2VIHA 3T3FA 2DNQA 3T01A 4LRAA 5IORA 4P2SA 3S8SA 4OYAA 1LK5A 4C8MA 1RWOB 2C42A 4NYOA 5E5NA 2V5HG 3L4BC 3D66A 3CW2C 1HMVA 1W2IA 4C3LA 5KAKA 2IAJA 2YKOA 4KV8A 3QIDA 1D9DA 2NVXC 1U6ZA 5ETPA 4BBSK 1KD1T 2LQ9A 3RZDC 2WVBA 1C0TA 5DQHA 3HOXK 1JNRB 3WIUA 4C3IK 3MOZA 5IC4B 2HHQA 3PXGa 2N7CA 3C46A 4LR8A 2GHPA 3H8YA 2HFVA 3LOUA 5T41A 3QAEA 4USJC 2YKMB 3J7ZT 2DGOA 2N4CA 2FVPA 3CCQS 4OZ1A 2FIUA 3GTPC 3MR2A 3Q0AA 3OSNA 1LKZA 2V8VA 2GAHC 3PJ9A 3DXJA 4AH6A 3M8ZA 5EX3A 2VG5A 5HL7Q 2DGUA 4ID8A 3H2LA 3OFGA 5EWGA 3LPEA 2YWHA 2BEFA 2EBEA 3DKDA 4OHVA 4TYAA 1EQMA 2O01C 3I55S 3BGRA 3DOLA 2V8HA 2XHCA 3DYAB 3FVYA 1UVJA 4Z37A 1VJQA 1HR0F 1NM2A 1PGZA 4YR0A 5LMNF 1RCXB 1TWFC 1Q16B 2BR0A 4DCJB 2RQKA 2BDPA 3PHEA 1O51A 2MQOA 1SB6A 1TKDA 3DMJB 2XCAA 5D78A 1S1UA 1KS2A 1RT3A 1D8YA 2JHEA 1KQSR 4CLLA 2QC3A 3CCZA 1VK3A 2PE8A 3BQ0A 4TNOA 4JV1A 2GJIA 3LP0B 1XMOF 1BY9A 1RA6A 5D15A 1NCLA 5TMFA 2CZ9A 3BREA 4LOWA 2C3YA 1FDAA 1X5SA 5D0GA 2B5JB 3V6DB 4LF6J 5T7LA 4C3JK 1X4GA 2R7OA 3OTEA 3M9OB 3JQMA 2E1MC 2HAIA 3DLHA 1RYSA 1S1WB 2PI5A 4ZP7A 4DSIA 3KJVA 1G1XA 2C2NA 4N47A 2ALYB 1TV6A 4QJVB 4BY7C 1NRKA 2V6AA 3GFHA 1HQ2A 3D5MA 3FCWA 3GQCA 2OJ3A 2HZAA 4LR2A 3DXSX 4ALZA 5KFWA 4MIAA 2DR9A 3VAHA 2BRLA 1VQ8S 4MJKA 4O4GA 2V68A 1FTRA 2OD6A 2V94A 2G1DA 1IW7A 1U48A 4ED6A 1S59A 5M2PA 2NXEA 2O67A 3HI9A 2BJDA 5B0GA 1U0HB 1EQ0A 2JC1A 2DHAA 2E9RX 1ROFA 3KUEA 4MKVA 1YBUA 1FA0A 4S0MA 3TYTA 2NVTC 2RD5C 4NRUA 1YI2S 2V6SA 3HOUC 5IT9U 5IYCK 1JVIA 4A3MK 3QATA 3UDEA 2G0CA 1NO8A 2HQCA 2RKIA 1KOOA 2DGTA 4ECZA 2EG1A 3UD4P 2JDJA 2IM0A 1QSSA 3O44A 1WQFA 4J37A 1I6HC 1B3TA 2VC0A 1CJUB 3QQCD 4LUBA 3Q23A 3FMWA 1FWKA 5MAOA 1NAQA 1T3NA 3E01A 1OYEA 3ISND 5M2UA 4P5BA 1S6PA 1QE1B 1CJTB 3H98A 2HQDA 2GVDA 2HK3A 1XIQA 2M88A 3GTLC 1O2FB 5KT2A 3CIMA 2YX1A 1FDDA 4NLGA 2NZ4A 2KVQE 3FKIK 4A3FC 5GAGU 1N0VC 3LWLA 4NCGA 2OELA 1OPZA 2XO6A 4UZCA 1F5AA 3CDWA 2GHWA 3IG1B 2VPWB 3UR0A 2HNZB 5D4NA 5HSPA 2OFGX 4OIQA 2HGMA 2E2HK 4RW8A 1RACB 1J5OB 4MYUA 4A8KA 1UJ5A 4B9UA 4OI0A 4I2PA 1N36J 1HARA 3PX4A 1DLOB 3PACA 3QFWA 4ILDA 1ZYQA 5C25B 2VFRA 1UCNA 1JLBB 1U8SA 2HHUA 1TAQA 1YTYA 4N56A 1F5BA 1UJ4A 1JKHB 2ZEJA 3BKFA 4YQWA 1NK7A 2MKSA 5K8OA 1IBAA 3G8TA 2YH1A 2VBYA 2ZBPA 1FDBA 3MCOA 3TFIA 4MFBA 3KLEB 1PAUB 2Y1RI 4Y7NC 2XLJA 3H0GA 1ZM4A 2XS2A 3U02A 2P9EA 1S79A 2O3DA 2KT3A 3M1VB 3C15A 2J0WA 4XLNA 2JEFA 2W7OA 3KG0A 3W2VA 4FYXB 5E3AA 5K5MA 1EARA 1EFWA 2NCKL 5HL8A 2JA7C 3U27A 4IO1A 3OXFA 2K3KA 4OZ2A 1UPMB 3RB3A 1YJVA 2H4YB 4CLZA 4BXXC 2QE5A 1QTMA 4M5KA 4TVAB 4OLOA 3I9V9 4X84A 2HFNA 3GTKA 3S15C 4O3OA 4OHYA 4XSZA 1ZYRA 3DRRA 4EGLA 1TL1B 3JTOA 2AZ1A 4ZMMA 3MCMA 3H5YA 2R7QA 4Y6IA 2DNYA 2VU5A 4KPCA 3W66A 4ZVQB 4ZKAA 2DD8S 3CT9A 2J7WA 4DR4F 1N33F 2VQEF 1VQ4S 3RR8A 1UVLA 2W24A 1S6QB 2FVQA 5I42A 1QDUB 2RAQA 3FRZA 4RW9A 3DM2A 2YU9A 2AYMA 3KK2B 5C4XC 2E66A 4IFVB 1NK0A 1YRUA 1QVGR 2BKPA 3RRGA 3M2RA 1YJNS 2AZ3A 1RTHA 4L72B 5A2QU 1ZAXA 4Q45A 2CVIA 3CC4S 3O2IA 2IBOA 3PRVA 1JQWA 5DDOC 1Q5YA 2GA7A 4EYIB 4ED5A 2AKWB 3DLEA 4A3CC 1ZZNA 3TARA 1NJXA 1FKAF 3TAQA 2E7VA 4AYBL 3KK3B 1HI0P 2DRDA 2KFNA 3CDAA 3HT0A 4J9MA 4C11B 2UUBJ 3IRWP 3RBEA 2ACYA 2FHJD 4EMDA 2WB1L 1SIZA 2HFOA 4EBCA 2BJ9A 5KFPA 4LRCA 4ECYA 1IKXB 4P10A 1S9FA 5D0HA 2CQPA 4ED7A 4DSLA 3KLVA 3VVTA 2M8HA 4ZP6A 5I3QA 2XMAA 2CIMA 1WQGA 2V8GA 2LU1A 2HHHF 1K47A 1WOOA 1IJFB 1DURA 1SJFA 2GO9A 1SFOC 2NXCA 1RAHB 1N5VA 1D09B 5DQGA 5KT3A 4ZJLA 4TU9A 4JBCA 1R8PA 1U8WA 1WC3A 2CJYB 4ILRA 2FQQB 3PYEA 4RU2A 1U1OA 5G0RA 1RISA 3MM8A 4A47A 5HP1B 4DR1J 1YKWA 2R92K 3HHLA 1FE4A 4ID5A 3FUYA 2LYVA 4JI3J 2DB1A 1RTJA 2QA4S 3ISNC 1JXLA 3T5KA 3BKUA 3JQJA 1PBUA 1QD1A 3IAS9 5AXMA 4NE9C 1V9OA 4DWIA 3Q8YA 1VRTB 4YB7A 3BYPA 1H72C 4NI2B 1RAAB 4XO0A 1NKCA 1RT5B 3BSAA 3FSIA 3GTOA 1RAEB 4KHPF 1WTBA 2A18A 4P6QA 4DL0C 3LTOA 4PWWA 4O3QA 3OSPA 1TL3B 4BC7A 2RU9A 1AFIA 4NEYA 4CM2A 2WTFA 4C9DA 4USUA 1FX2A 5JXSA 4ANCA 1F7VA 1BQMB 4I7FB 4K2XA 2DYAA 5FLMC 3QSIA 3QGIA 1YJ9S 1HIYA 1OQ3A 1AYEA 3TVKA 4H54A 4DV1F 4ZJOA 5F9LA 1ICEB 4OX7A 2A6OA 2YTCA 2YKNB 1DTTA 3I56S 2KZZA 4WCEQ 3S2HC 4DSJA 4ILMA 2HZVA 4ICLB 4XIUA 1FJGF 3QIPB 2YNHB 4A3DC 2KN4A 2PMHA 1FERA 1T03B 2B9EA 4KGXB 4DSEA 1VHIA 1VR6A 3GFYA 3MM7A 1XZPA 4DV7F 1KONA 2RDDA 3DLKB 3PZPA 2FVSA 3TUJC 5HVFA 4WJ4A 4K7QA 3TTGA 3I96A 3PYFA 2OUGA 4QCLA 3O8WA 2YX4A 2CQHA 3TI0A 1DQ9A 2LEBA 1XXCA 5DZ7A 4RNNA 4F0HA 3W5YA 2CJKA 4RW4B 3HHDA 1J5EF 3BM7A 2L48A 3GTYX 4QQBA 3X3UA 2J7KA 3B54A 2BE7D 5M3FK 2EXUA 3SSSA 4DU8A 1JJ4A 1KLMA 1XZQB 1ZXOA 3OHAA 2WVCA 4PABA 1HNXF 5T14A 1LFPA 1VQOS 4TY8B 3W9JA 5DM7Q 1IKWA 2CG8A 2B6AA 3D68A 3M30B 1IM6A 3AH6A 4G7HA 3MAHA 2PEHA 4CLUA 3PX0A 4PPZA 2U2FA 4RPFA 4B9MA 1S4EA 3QJLA 4RLEA 1XR5A 3NWRA 2IM3A 1RP5A 1GX5A 8AT1B 3KDOA 4X4OA 4GVBA 4G0UA 2HHVA 3R6LB 1PBAA 2M0GB 3ENQA 2B63A 2GAGC 1DJ0A 2A2CA 2V63A 1UVMA 3DOKA 4UOHA 2RGRA 4W92B 4QR0A 4XPEA 5FLMK 3LALA 2M2BA 1HNIA 1V5IB 2YWGA 3SDEB 3BR8A 3EGZA 2HQGA 4G7OA 1DTQB 2B3TB 2MQPA 4K4VA 1VGYA 3DDNA 3RB6A 3TWZA 1O2AA 1VQYA 3POTB 4D3HA 2LA4A 2OPRB 1S48A 1IQ0A 1XMQF 3WC2A 3NNCA 2B9WA 3BDPA 4Q5SA 1DRZA 1UETA 1HKAA 4WPAA 5HI7A 4J9SA 1U24A 2DEJA 2Y1LB 2BABA 2V6UA 1RTIB 4TXSA 4DR3J 4DFKA 1VFJA 2HVDA 2RB7A 1RJJA 4DUTA 2OLWA 2LQBA 5E3RA 4B3SJ 1PC4A 4ECVA 2ASDA 5CA5A 4J9OA 3CWJA 2E5HA 2VBZA 5KFJA 1TZ0A 1QAJA 2XWXA 1H2VZ 4Y65A 1UZHA 1VQKS 1F9NA 4M5DB 3AH5A 1PIEA 2VICA 2HZCA 3T00A 2V2VA 2Y1JA 2VDIA 3OR1B 4ZLNA 5M2RA 3FGVA 2H48B 4EEYA 2RRBA 3M8QA 4G1PA 3DGPA 2DPIA 4RWXA 3BO4A 4L6V3 1OS5A 2EFNA 4UOFA 1K0VA 1LWEA 2ZHAA 2YY3A 1ZTTA 5L9XA 1HW8A 4C0OC 1CS4B 2GGPB 2FDNA 4NLOA 2MSTA 3TZWA 3W63A 3MMCA 2B9YA 3SQGA 1SL0A 2ZH8A 5D0RA 2VQFF 3M9MB 4ELUA 1IKVB 3I0SB 1MG7A 1USMA 4A8QA 2W1BA 2RQCA 1U1RA 2XNQA 1J2VA 3SCIE 4PXDA 2DNGA 4GKJJ 3P49B 1SH3A 2CQDA 2VASA 2CNLB 2XCOA 2UVWA 5C2CA 3GTJA 3FOEA 2QZ8A 4R8UA 3DU6A 4Y52C 1J98A 3TX0A 5A0YB 2V50A 1S6OA 5CH7B 3NS6A 1NDKA 3SXLA 2ZC3A 2ZKTA 1S97A 4WF9Q 1F0XA 4QW9A 2FVCA 2QFJA 2BACA 3SZZA 1D9FA 2HK2A 3N4WA 4F2SA 4LF9F 3BPSP 3ZTPA 2R8KA 4Q2MA 2VJUA 2QEXS 1HWUA 2PA3A 3JSTA 4I68A 5HBMB 2R7RA 4Y3CA 2KXFA 3DC2A 2BMBA 3BBBA 3IMQJ 2BQUA 3IM8A 3MMBB 1N6QB 4X4PA 3HFZB 3OVAA 2PHCB 2HRUA 2GSUA 1FDNA 3W2WA 3S16K 1T9UA 4C3KA 4Q43A 3D54A 2RILA 3CCSS 3LAKA 2ZDPA 5KT5A 5J2QA 2PO4A 1TWGA 3CD7A 3P4UB 4AL5A 1N5YB 1ZBTA 1GMWA 2D7SA 1B70B 2BA9A 3CMAS 3PW4A 4OYWA 2W9AA 4A3KC 3MMAB 2EFQA 1HD0A 3JSRA 3RRKA 1N34F 3OJSA 2OPPA 1RT1A 3FBCA 4KB2A 2XCQA 3NS7B 1OWXA 2B4PA 2YPYA 2E2JK 3GV8B 4PUOA 3MCNA 3HJVA 3TJAA 3AFGA 4NCAA 4WZMA 4WILA 4KC6A 2B4UA 4A3JC 2ATCB 1PJ7A 2K8GA 2V2QA 3PKYA 4DFPA 4ZCLA 2LMIA 4RUHA 2UUTA 3MFHA 1I3QA 5F0UA 4MQ9A 4P2FA 4O3RA 2V4JB 1S9GA 1WDDA 3Q2SC 3NAHA 5CYJA 1AZSA 2ZE2A 5AXKA 3H5UA 1U49A 2CA9A 2VPZB 3ILOA 2CNOB 5DLFA 4QWCA 2N7YA 4ETZA 5F3TA 3MEGA 1S4FA 3JSMA 3HHLD 3EWGA 1K83A 1RT2B 4DX7A 2J9EA 1T7PA 2XMWA 2PEBA 2EFOA 3RAMA 3K17A 3S2DC 2L9DA 3K7RA 1NJWA 4JI7F 2C28A 4PG4A 5FD1A 4ECQA 3G82B 3P5TL 2CVEA 4FVCA 4LF5J 4QIVA 4JB8B 3L7PA 2MZRA 1HNZJ 1TWCC 4YB1P 3RAXA 1HHTP 3CJKA 4DV3F 1RT6A 1FCAA 1UWAA 4U6PA 5E33A 5KFNA 4N41A 3FEXB 3VGUA 3T1YF 4DR2J 2R7WA 1RAIB 3PO5A 2ZFZA 4LFBF 1UA1A 3NP5A 5CYQA 2JVRA 4RW6B 4C8OA 3AOBA 4YHHJ 2ZBIA 3OUYB 3MPVA 5HLFA 4DF4A 4YFNA 3M6XA 3DRPA 3PCOB 4OFZA 1YJRA 3M8PB 3OXGA 3QPIA 3CE8A 1U47A 2HLTA 2NXUA 2R93K 2M7SA 2G9OA 1HWIA 4CNYA 3W8GA 2R7ZC 2A69A 2JLFA 5DG7A 5B0FA 4O3PA 3CJ3A 1YGYA 3QFHA 1YNJA 3ITHA 3GPAA 2W8LA 3CD6S 1Z2LA 5FJ4A 5HATA 3BO2A 1V3RA 1F3FA 1R31A 2NXNA 4GMKA 3PYGA 4PZVA 3THVA 3MR5A 2UUCF 4V1Ak 3MDFA 2DGVA 1TUGB 5A8WA 4JI4J 3CCMS 4P2MA 3NGRA 1T95A 3WC0A 3AA9A 1NEEA 4J9QA 2DRAA 4RBVA 5BR8F 1I94F 3SSQA 5A8KB 3A3OB 3KLHB 5IP7C 1U26A 2IVYA 1M1KT 4UY8T 2B43A 4WJ3M 4ED0A 3VAGA 4BLAA 3G6ES 3HSDA 2UXDF 4KH0B 3C16A 4A93K 3HK2A 4FZVA 3SQOP 2F4VF 5KFVA 2HQIA 4RW7A 2CZ4A 2IM1A 1IE0A 2RT3A 3W62A 3PEHA 2I9SA 5ETTA 2CQGA 8RUCA 2JA6A 2VG6A 2QA1A 2PI4A 1HD1A 2AWZA 1WCMK 1TUVA 5HMXA 3FBEA 4KARA 3CJQA 4L73A 1W26A 2KJVA 3G6VA 4BS2A 2FJEB 3KMSA 4KFBA 2E5GA 1FRXA 3PO4A 3NXZA 3HDSA 2PFFB 3QNWB 5HQ8A 2JA8K 3VR1A 4CTAA 5D3GB 1AFJA 1OY6A 3PW2A 1OIAA 4N76A 1X5PA 4OI6A 4V19X 2CXEA 1KHVA 2GIFA 3EDQB 5KFIA 5HVHA 3J81U 3SCJE 1U2FA 4RL1A 1T02A 1S0MA 5LSRA 1HNXJ 3MR7A 2I5JB 4U67Q 5L38A 5EN1A 4OV6A 4CI0B 2IPOB 9ATCB 4P71A 2HBZB 2JFDA 3BB5A 3NS5A 2HNYB 4F4XA 1SXLA 4QU7A 1FRKA 1MROB 2GC8A 4DN9A 4KHMA 5IWAJ 2CJBA 3G4SS 2MKHA 3OBIA 3GU0A 3D1OA 5C4JC 3LQVA 1EETB 3DI6A 2RUSA 1T9YA 1R27B 3GIIA 4GC7A 1L5UA 3CO0P 3T1HF 4DR7F 5ETQA 2VD3A 3Q24A 4LF1A 5IQ6A 1IQTA 1UPPA 1K8AT 1TVRB 3C8YA 4ZVSB 3DU5A 2DNKA 5AJ3F 1IQZA 2YPZA 5B08A 4DR5J 2W2MP 4Y00A 2ZZNA 1RSCA 2RF2B 3CULA 2J7UA 2KL8A 3PJXA 3ERED 1U0SA 4G1QA 4JV5F 3SV4A 5ETOA 3MPYA 5EWFA 3ZTSA 1XMQJ 1URRA 4F2RA 1B7YB 1U7LA 3HFVA 1HMVB 1RAFB 1GEHA 1NHKL 2FGOA 4B3RF 4UW2A 1FD2A 3HHLC 3V2UC 1NK5A 4BDPA 4NA2A 4UTGA 1NH7A 4G0WA 2R2SA 2CKWA 1R43A 4C4WA 1Q8LA 3EMTA 1C0TB 3OR2A 5ETRA 4A8OA 1O0PA 1V5VA 4YB5A 2LDYA 4ZLLA 3KLFA 3GJQB 2VFVA 3UO0A 2GMHA 4Y2MA 1U6FA 1C1BA 3Q2TC 1N8RT 3LO3A 1OO0B 4FXVA 4DFJA 4B3MJ 2GCFA 1F93A 4M5NA 4L3KA 1SUQB 3JAMU 2EFPA 5KFMA 3HOVK 4JI0F 1XNQJ 4KPYA 2VH7A 5F8IA 2XSJA 1VC0A 5IP9K 1CULB 3HJFA 4DV5J 4UQTA 1SKWA 3BGRB 5KOXA 4K0KJ 4C48A 4A4JA 3EYZA 1AW0A 4YY3F 4G6VB 5J2MA 4LBHA 4DFMA 5CABA 5E2QA 2DGWA 2PFDA 4Q2LA 1S76D 1LW0A 1XMBA 3SSRA 3DRSA 1O27A 1JLCB 2FZGB 2ASLA 4CCHA 1GXUA 1RTDB 2CQ4A 2XNRA 3LAMA 1EKSA 1NB7A 2R3VA 1WI8A 4DQIA 4HH0A 1EAYC 1MMLA 1S1UB 2ASJA 1X5OA 1NDPA 1JLQB 2ZBQA 4LREA 2JOQA 3K58A 1M90T 1VQ7S 3OFFA 4M1KA 2BANA 2BYCA 1TK8A 2NS1B 4BY1C 1RA7A 2KM8B 3BN4A 3K5PA 5L1KA 2IRUA 3MURP 4JI2J 1VCTA 4JYAF 1HWLA 1W2BR 1HBNA 5AT1B 4RBTA 2XY7A 3ZTOA 3ETOA 3VQSA 2JA5K 5ADZA 6FDRA 2FJWA 5T7LB 1WWHA 3ZZ0A 1T05A 1X7VA 2LXFA 4DV6J 3TVZA 2YVSA 4X6AK 4Q8FA 1J6WA 5GAEU 2DO0A 4TKTA 3MPDA 1YDLA 1HW9A 5C24A 4LF9J 3CAGA 2YQ1A 4Q5VA 2EFVA 1FI4A 2BW7A 2DNPA 1JB0C 2J0QD 2NVXA 2E2IC 1BMQB 5C42A 4FXDA 4FF2A 1LWFA 3FK4A 1SV5A 4NZ7A 2LXIA 2NSBA 2GVZA 1RWNB 2NR0A 2K1RA 1S1VA 4EUVA 1Y3KA 1BE4A 2L3MA 3PHTA 3PR5B 4DPTA 1A9NB 1MLAA 3GTPA 3I4MC 2JC0A 2I1RA 3V5RA 2IJNA 5HK4A 3MM6B 4Y2AA 2D3UA 3IRXB 4UUWA 5G4DA 2QIFA 1IR1A 4PXCA 4CH7A 1H0HB 2HQ3A 3IM9A 5I3UA 2CWXA 3GDZA 5DLGA 3KMQA 3PRDA 9RUBA 4KMHA 1ZVUA 1TK0A 1Q95G 1FK9A 2HPUA 3S17K 1TWAC 4QPTA 1AROP 3ILIA 4TU8A 2RKIB 2LA6A 2PA8L 1MSWD 4TLRA 3AT1B 4K5SA 3N0VA 2UXCF 3C14B 4RBUA 5HANA 3W1YC 4ZVEA 2B8PA 3ZZOA 1WTFA 1RLCL 5CYMA 4P7TA 3T19A 4OMFG 3E01B 3LH2S 5LOQA 1FRHA 4I6WA 2MQNA 3NCPA 5BXIA 4KGVB 4FF1A 1O28A 5MLCV 4ZIWA 2GIRA 2AW0A 3HHNB 2CQ2A 3NAIA 1WHYA 3HHEA 1WQHA 3AD9C 4F4WA 3FKIA 1ZZFA 2Z56B 2DBBA 2IYIA 4DZDA 4DLGA 3RZOK 3M05A 4TLQA 2EPIA 1H73A 1R8CA 2KVIA 3IPJA 4O44B 2M4MA 2WRMA 2Z8QA 2M9KA 2LVWA 2UU9F 4I2PB 4H4OA 2OEKA 1QTNB 1RXOB 4QIWL 1H2TZ 2WAQL 2AP6A 4OYMA 4HT7A 4KB7A 2XHWA 3MECA 3HOZC 1VRUA 1A7GE 5D6GA 4C2MC 1Y1VC 3ENVA 3M6VA 5J1EA 1RABB 5KG3A 3CJSA 4UOGA 4G0VA 1JMTA 1YK9A 4GTEA 4YOEA 3O6QA 1RWPB 4EWTA 1VDHA 1DQAA 3DCAA 4C3HC 3P6YC 4G65A 3K59A 2MZJA 1KFDA 4LF7J 5LJ5Y 1PAEX 4Y28C 3UN5A 2ZOMA 5DO2A 5IS2A 3RRHA 3M2VA 3G4AA 1I5OB 4P7VA 2PD1A 1JWWA 2QYGA 1JLEB 1H98A 2NYHA 5M5XK 3CD0A 3W7BA 1T8EA 4ANDA 1V3SA 4XPCA 4XDDA 1HI9A 1BUXA 1TUWA 4GTLA 3TZYA 1S1XB 3NEKA 3W2VB 3MM9A 2BJ7A 1WC5A 3M6WA 3KHLA 1I50K 2Y3PA 2KXNB 5TMCA 1UW9A 5KFOA 1H7WA 1OY8A 5DS7A 3IWLA 1ZA2B 1U1QA 4JI1F 2V0NA 4ZPCA 1CVJA 4A3EK 2G13A 5HVGA 3NGDA 2QFIA 4OZJA 2D9OA 3RTVA 2UUAF 5FDLA 4JI5J 3HKZL 1RU2A 3DRRB 4F50A 1HBOA 1N32F 4RNFA 2X51A 3MFIA 3N01A 3CTRA 1R3NA 3JTPA 2JNJA 4FYYB 1OQ6A 1K1SA 2YNIA 3QGPA 3GTLA 4CLWA 2H54B 2ZVIA 2Y0SL 4DV2F 1GTEA 3LGMA 4QWDA 3BUEA 1VBXA 3QT7A 4W90B 4OZ0A 4ZPTR 5I42B 4LF4J 4UF4A 2VPYB 4CH0S 3FEZA 4RW9B 1UA0A 1HBUA 2DGSA 5IYBC 5A76A 3MUVP 2WB4A 5KFDA 7FDRA 1OPIA 4C8LA 3GWCA 2I8EA 2BOPA 4LF8F 2AJ0A 2KKHA 3NL0A 1R9TC 5LXYA 3M2RB 4HI1A 4LFAJ 3FDSA 2KWAA 1GMUA 4ZVHA 4OYBA 4CH1A 4TY9A 1MMNA 2FY8A 4NXNJ 3MEKA 1Q78A 4NOIA 3SCLE 4CDIA 1JLGA 4ZP9A 3HOZK 4F0KA 5EWEA 2X1GA 1ZS6A 5A8RA 4B3TF 2ALZA 3FCHA 4M5MA 2DH8A 5IOTA 1QJHA 1X4DA 3CJ4A 4URQU 1KSPA 2CQ1A 2FY1A 2O5JA 3OD2A 4RUBA 4OX9J 4DL4A 2KYXA 2QT7A 1IBLF 1TKZA 2IJRA 3H25A 2OPQA 3MPWA 3PDNA 2A6HA 4CYUA 3M32A 4USWA 4TN2A 1Y1WK 3RBDA 4GKKJ 2KM8C 2EBBA 4IUFA 1D9AA 5CJ9A 5DRKA 3IBWA 3KFWX 3I5CA 2F8HA 3IP0A 2V4QA 3R1HA 3CSKA 1N4LA 3UPFA 3TFJA 2LCWA 3M3YK 2JA7A 3FBFA 2R8GA 1QSYA 3U1LA 4DSKA 4WYLA 2DY1A 4ZCIA 2RH3A 4RNOA 4WFNQ 5GAHU 4GZYA 2WW8A 3GEEA 4R25A 1GT8A 4DX8H 3R8YA 2ZUFA 3MM8B 3H0PA 1ULRA 4USKA 2QMWA 4QIWD 1WHWA 3VCDA 1I6VA 2R92A 4LFCJ 2MQQA 3UW1A 1KNZA 1RTJB 4N8OA 4NA1A 3GLJA 2CPDA 4U8VA 2QLFB 2GW8A 4JV2A 4IO9Q 4ENOA 3QO9B 3OTOJ 3D7SB 2V2KA 3K5MA 1RKIA 2BE5A 4F67A 1FNMA 3CGIA 4TQSA 2W2OP 2KI2A 4FP9A 4GTBA 4CWBA 1UAWA 3QSYB 1TTHB 2HHXA 4WP9A 4A3GK 2ZH3A 2VHGA 5GADU 3DYAA 1VQLS 1B4BA 2LP4A 1YWXA 1U1PA 2FJVA 4HTIA 4N5SA 2HURA 3KTQA 2G2YA 3AXKA 1Y00A 1L3SA 3WQPA 1DTTB 4KGZB 4XAKA 2P8IA 3D0HE 3HVAA 3KHHA 4DQQA 4P5AA 1UZDA 3DMJA 1XR7A 1REVA 3M4OC 4AFFA 1L3UA 2OEJA 2MLXA 1RWUA 2DHGA 4I2QB 5SZTA 1B64A 1R6YA 2XWYA 4QR1A 4E98A 3LGNA 3PO2C 3BP3A 3MM7B 2W2PP 4ZVUB 2RDJA 3BBCA 3SMZA 1SL2A 3DN9A 4PQAA 4HT5A 5B0CA 4UUXA 1S7IA 2OFHX 3A3PB 2YNFB 5DG9A 2DH9A 1T9XA 5IOLA 2LEAA 1SFOA 4X66F 4NYPA 2EWHA 3FQKA 5K8PA 3HT3A 3MXHP 1S1WA 3QZ7A 2Q79A 1NSQA 4FS2A 3CPWR 4IG3A 4FBTA 2QLBB 4QJVA 3EZOA 2DR7A 2C3PA 5E3QA 3TZXA 5DDPC 3R5DA 4DMZA 1KLMB 4MMOA 3PRBA 2H9ZA 4BC9A 2WBRA 3T41A 2XLIA 3A8JA 3M8RA 3C6UA 3NWGA 3X1LB 3TAPA 2AJFE 3PW5A 2UXBJ 4C8ZA 1Y5NB 2B6AB 1XERA 2P6TA 3LAPA 3RZAA 4E8UA 3GSDA 3T1AA 1U0HA 1VOMA 3UNYA 4DV0J 1NH8A 4ELVA 1NJIT 5EGEA 3CJTA 2F3JA 4GVBB 2NVYK 1TMMA 3IS9B 3LP2B 2HS4A 4Y0FA 2O1PA 4DV4J 2AX1A 3B6BA 2OTLS 3IGNA 1HNIB 4WFAQ 4PPDA 1RHUB 2NPIA 2XZWA 3PV8A 5B0DA 3MUTP 1CJUA 3RR7A 4J91A 2K2PA 3GYNA 5JVHQ 3S1NK 3TEHB 4LQYA 4AL6A 5C7PA 1F7UA 4NLVA 1NSPA 2QRRA 3KLGA 1IUJA 1QE1A 4OJ3A 1CJTA 3PR4A 4JOUA 2R8IA 2CFAB 1LXJA 3U1NA 1YJWS 3PTWA 3I87A 2UVVA 3QJPA 3EPIA 4PWUA 3PW0A 2XMVA 2XLKA 1FFGB 3QGHA 4Z7CA 1OJ4A 2V9KA 3H5SA 4RNMA 4LJMA 2YKQA 2KG1A 1BGXT 3IG1A 4WFZA 1GXLA 3F41A 5AE3A 2QL5B 4QIGA 2VBWA 1D8ZA 4A3LK 4ZJQA 1LFWA 1UWBB 2J0SD 2RJZA 1QAIA 2QMXA 2ZM6J 3H42A 3AQOA 2MKJA 4BBSC 1XNRJ 5C25A 4NWBA 4ES3A 1IBKJ 3W5XA 3GTGK 1KLNA 3HOXC 1JLBA 5BYSA 3HPOA 3S1RK 1JX4A 4C3IC 3D6FB 1K9MT 2AX0A 3M8QB 3DGPB 1N54B 4BBYA 4ZPBA 2UVUA 3M2UA 1JJ2R 4WP3A 4DCOB 3H0GK 3GYXB 3KLEA 2ZJPQ 3TANA 1DFDA 3M1VA 3CMQA 1WKJA 4JI6F 2IBKA 3MMCB 1BLUA 1SJQA 1SC6A 5M5WK 4I4BA 1TWHK 2KXHA 3UR3C 5GAGI 1VGXA 1LW2B 4QR2A 3EX7B 1WC0A 3MAAB 3T9NA 2DGQA 3CMES 3UD3P 4B02A 1J6VA 2JSXA 3WX4A 3GTKK 1KKHA 1F9EB 2VG7B 3K5OA 2D3OR 2VFSA 2VOOA 2DNMA 2PMZD 2ZUEA 3R5CA 2HYIB 1TL1A 2DCLA 2XCPA 3VAFA 1FKOB 3TUPA 2ZWOA 4ECWA 4QWAA 4GTDA 2AJ2A 1U25A 4ECRA 4LQ9A 4YS2A 5LMUF 2RHSB 1RB0A 2FHJA 1HQUB 3FZ2A 4R5PB 1VK8A 2RRNA 1NLKL 1S6QA 1FJEB 4IQMA 2ABYA 1QY7A 3TW0A 4QBUA 4LRDA 4HHJA 2YU9K 2M8DB 4C3JC 4ETXA 3NGUA 3KK2A 1D0EA 2AYBA 4C6AA 2Z2LA 3S1TA 2QLXA 4LVNP 5KG4A 1HYSB 1LXNA 4NCBA 1CPZA 4NLDA 2W2NP 4USMA 2YNGA 1HNWJ 2EVZA 3UDLA 4IRKA 2BW2A 4M1XA 4O4RA 4C0BA 3ENAA 3UWTA 1FNXH 5J2QB 4E2FB 2R4FA 4NX9A 3BGFA 5D8HB 2A68A 4CP5A 2GIQA 3KK3A 3N3YA 1N5TA 5JMNA 2VOPA 1ZPVA 4Q44A 3I4NK 1O6XA 1MN9A 1VIOA 2ILYA 2HHTA 3W5ZA 1IKXA 4OX8A 5KFGA 1QUPA 4MYTA 4NXMF 1IM4A 2XY5A 1KQ4A 2CJXB 2D9PA 2KTQA 3TA0A 4RR5A 2IYGA 4QWEA 3E8OA 1T9VA 1KVKA 4KAIA 2QTWA 5HO4A 1N56A 3UE2A 1RWMB 2DR6A 5KFZA 5KOWA 3AY0A 1M5KC 2XTJP 4X4SA 2EG2A 1S9GB 1P8GA 5FIIA 2B0GA 5IYCC 4X4RA 4A3MC 3HX9A 2Q1LA 4LRFA 3LW5C 4U9RA 4ITSA 4NLPA 2NZCA 5RUBA 3BN7A 2EKNA 2C22A 2XS5A 4C8KA 3JSMB 2OAUA 1L3TA 1N5SA 1FXDA 4DQPA 1FXLA 4PG8A 5HP1A 3ICLA 1UV7A 1UFKA 2B4OA 1S6UA 4PG7A 3MM5A 2CAJA 1F9FA 1SQFA 5CHPA 2RU3A 3EXYA 4O0NA 2PPBA 3GEIA 1I1GA 1TR0A 2MLZA 1AUSL 4KM9A 1F1BB 1VRTA 2ZWPA 3FKIC 1VJWA 1NDCA 4TYBA 2IRXA 3GTOK 3AOAA 4CT9A 2KG0A 1U1LA 2HNDA 1IS1A 1DY3A 1TL3A 4AXJA 4ZA1A 2HQFA 2W7VA 1MWZA 2E2HC 5HQMA 2VA2A 4DBQA 4U7CA 4NMXA 1BQMA 4I7FA 3MR3A 5C44K 3AJDA 4EK2A 2R2RA 2DT9A 4J90A 2GV1A 1X4CA 2ZBCA 4P2XA 2HFSA 2CQ3A 4K4WA 3UI3A 1SQEA 3N28A 2WW4A 4MK7A 1SKUB 2MKKA 3ITHB 2CDQA 4ICLA 5F8GA 3QIPA 2AQ4A 2DNLA 4X65J 1HFEL 2Q66A 2C2OB 4X64F 4MKYA 5A8WB 1XPPA 2HHSA 2RS2A 5H1SV 3K0JA 5M5YK 3DLKA 2J6UA 5KT7A 4J9LA 3J7Z5 2AIRB 5K14B 4K4SA 2VFUA 5DG8A 3P3DA 1DBDA 5LJ3Y 3I5BA 2Z58B 1FRMA 3VF0B 1HBMB 5FLXY 4K4XA 4CLPA 2YWFA 4RW4A 1T94A 4BHQA 1L3KA 1KBRA 1Y5LB 2DTJA 2HWTA 3GSIA 3N5BA 5DJBA 3W60A 4F3OA 3R1LA 1XZQA 4C8YA 1FEHA 3D4JA 3PO3K 3L09A 3TUIC 4ZCKA 5DDRC 2E1AA 2QSWA 4KFBB 1JLFA 3M30A 4DPOA 3SCKE 4WP8A 3FEYB 2CWKA 2DXEA 1TWCA 1BS2A 2E1PA 3ZXWA 1PG5B 2BKNA 4C7QA 4DL7A 2E5LF 3GIMA 2L9WA 4BWMA 4JI8F 4DR6F 2ROGA 1FXRA 3MZIA 2PGCA 3PFOA 4DUZF 2XS7A 1CJVB 1IBMF 4DUYF 3SDEA 4H4MA 2VONA 3NMRA 3HSZA 3IBCB 3VWSA 1VQNS 2VJVA 1EZZB 2R7ZA 1Q1KA 3GTMK 2CPYA 2QMUB 2Z2YB 1RGVA 3TQ1A 3DI6B 2ERRA 2CZVC 4A3IK 2Q43A 2OPRA 2J0XA 3B4MA 4GC6A 3TO8A 4IH6A 2MQMA 3J80Y 1R89A 1LWXA 2XC9A 1VRQC 1S0NA 2HHWA 4ZITA 1SKRA 3LP1B 2NREA 4KAWX 4OQJA 2IDEA 3C3LA 3DOMB 4IG0A 1NKEA 5EX0A 3AB4B 1UTAA 3FSYA 4DX5A 4AQYJ 5D4DA 2CRLA 3HULA 1IL2A 4YR3A 4G1QB 2POKA 5JJBA 3HOYK 1O29A 3A3NB 3DHXA 2F4FA 3K5NA 3DFEA 1HQEB 3NGSA 3GV7B 4B9LA 2Z2MA 4QYZJ 1TP7A 2MSSA 1NSKL 3S1MC 4KO0B 3I82A 1KVIA 4WIQA 1SKSA 2IHR1 2WONB 1WNEA 3Q8SB 4ED8A 3V81B 3OR1A 2R92C 3CB4A 4YFUA 2COLA 1TELA 2D74B 4X62J 3OL9A 3AA8A 3MMLB 1N52B 5IOSA 3GE9A 2A0FB 1BDFA 5CD4A 3ILJA 3P8BB 4O3NA 2DHXA 1RHQB 3R3TA 2GGPA 4XK8C 1C1BB 1ITPA 3HOWC 3OLAA 3AJ1A 2FJXA 3W64A 3W3SA 3G8QA 3IXQA 1IKVA 5LT5A 2XSJB 5L39A 3AQPA 3K7AK 3OTCA 3G96A 3I0SA 1F60B 3H40A 1A0OB 4CT8A 2VFTA 1QAYA 3UQSA 2HMIA 1TL7B 2OPSB 5AE1A 5HROA 4KASA 1C0UB 2AU0A 3FBBA 4L74A 4KB4A 2UUWA 2E29A 1LW0B 4YFXA 2AJ1A 3GTJK 3DRSB 3G4CA 2XM3A 1EH1A 1LWCB 3JYTA 1RBLA 2AGOA 4LF6F 4OIXA 1HI8A 2XO7A 2ZH1A 5A0YA 5EHHA 3S6EA 5KG1A 3KHGA 1R6VA 4OYPA 2P9CA 3R27A 5IC6B 2VL1A 1PC5A 5BYQA 3MEEB 4HACB 3GP9A 4YR2A 2QLJB 3ILLA 1VC6A 3BKTA 2JX2A 4ZVGA 5HBMA 3IFEA 2R2UA 3GV5B 1ZM9A 2B7BB 4B9SA 3UNGC 5EDWA 4DSFA 4A46A 2W9BA 5K9FA 1KQGB 2DO4A 3MMBA 1N6QA 1JLAB 4OIPA 2BQ3A 4RZRA 1UJ6A 3CCWA 4OLPA 4KATA 1MMDA 1ZAWA 2CYYA 4HHUA 3GYGA 1EJ7L 5IYDK 2H65B 2YH0A 3LA0A 3S7RA 4NA3A 3WX8A 5IM0A 2OSQA 1WOSA 3DLGB 3I4HX 4IFYA 1APSA 4ZCMA 1TWGK 3NGKA 4F25A 3S1MK 1IBCB 4D3GA 3TRGA 1N5YA 1SPBP 4DI6A 4KSEB 3EQLA 2FQOA 3RB0A 3IBFB 1XBWA 1NJYA 4KM8A 3MMAA 3G2XA 4DDQA 2WK4A 4URGA 1O2BA 4L76A 3JTNA 2XSFA 4P74A 2FLPA 4ATNA 1IKYB 1VQ6S 3DLLQ 3CCLS 4ER8A 5C2GA 2K1RB 1KVJA 1KR4A 3TA2A 1WEYA 2LQJA 3HOWK 3HXMA 2B51A 2KO1A 1I3QK 1S7HA 4DL2A 3H59A 4IRCA 3PKMA 1CQMA 2V4JA 1Q4RA 1C2PA 2AGPA 1XTZA 3W9HA 4CLFA 1ZM2A 1S99A 3SYZA 4KTQA 3OFEA 4DL3A 4YN3B 1IR2A 3FMBA 3TP2A 3KK1B 5DGAA 2OD4A 3HFKA 1WF1A 1X4HA 4MAKA 1K83K 1HPZB 4LVOP 1YJUA 1RT2A 5IT0A 3HO1A 1FT8A 3TAMB 3CCVS 3ZNJ1 3Q89A 4WE1B 2IC3B 1WACA 4ZN1A 1PYOB 5KFKA 5CYMB 5C5JA 5HMYA 2F40A 1N36F 3TNVA 1HR0J 1U6BA 4MKBA 1QVFR 2DR5A 4FF4A 3T02A 2W01A 2H1YA 5LMNJ 4WXWA 3ETMA 1RT4A 3GJTB 3ZZYA 1IWGA 1PKUA 4WBFA 3BEGB 5CAAA 1XR6A 5CHCB 3A13A 4NZ0A 4J7CA 3NLCA 4PXBA 5A6PA 4OZLA 3PNIA 4ZHRA 4CIOA 4X4QA 1T11A 1WC4A 2Z4PA 3IWXA 3QAUA 4M5LA 2MHNA 4LBIA 4ZN3A 4DXLA 1XMOJ 2BOAA 1U1MA 4FPRA 4F8RA 4K4ZA 2PMWA 3OW2R 3FNNA 3J81Y 3ZO7A 1B0TA 3GR1A 2E2IA 2CDRB 3MECB 2C1EB 3AHPA 2AHOB 5J1EB 1KEKA 1BQNB 4A8XA 1SJRA 2QN6B 2JJ4D 1CLFA 3IWNC 2B7CB 2ZUGA 2LLZA 2CJAA 2G4BA 5C3EK 2ZZMA 4KT0C 3GZ7A 3B82A 1NPRA 8ATCB 2BUNA 1JJHA 3PIPQ 2ZOGA 1B99A 1YITS 4PG6A 3M2VB 2LDIA 3ZC4A 3FJ2A 2F7VA 5KFEA 4KY3A 2CPJA 2ZJQQ 4DJBA 5B09A 2ZUAA 2HWHA 2KYZA 4OYXA 2E5IA 1GX6A 3W65A 4DPYA 4CQ1A 1E6YA 5GMDA 3GEHA 3HZGA 2R7XA 3HZEA 1LOUA 4QYZK 3TFHA 5FJ8K 1TWAA 1RBAA 1CC8A 4MH8A 1SC3B 2UV8A 2MKIA 1S1TB 2YKAA 2ZVSA 5FLXU 4OYZA 3QLHB 3QBCA 1X5TA 1SL1A 3N0CA 1R8BA 5FDLB 1O24A 3BO3A 3VV2B 3H7HB 2HHPA 3OL7A 3BR9A 4K50A 3AD8C 5J2PB 3UDVA 1F2GA 1CG2A 3LPYA 4DL5A 5DGBA 2KZMA 1WIHA 1TKXB 1WD6A 1KN6A 4MK8A 2GMLA 2XI3A 3KJFB 4BBRK 1G4CA 4Y2KA 2F63A 1FESA 1KHWA 2UUBF 2MXYA 3S16C 4DG1B 3BPDA 3CJ8A 2W4PA 4LIRA 2QSFA 2DVIA 4A3BK 1CJKB 1VIXA 5J1PA 1U1KA 4NLRA 2UV8G 1SBRA 4FDFA 3R7NB 3L4KA 2IRYA 1DHMA 3BH7B 4QIFA 3JAMY 5A8RB 1VI7A 5ETSA 3J81j 4C2MA 1S57A 1Y1VA 2E2JC 2C2MB 3SV3A 3QYYA 5HN0A 3ZZTA 1VQPS 1A6LA 2LXUA 4DPWA 5D0EA 2E7XA 3THPA 2A1BA 4KBIA 3F44A 2W9CB 3J7YI 3R5BA 1C4CA 1GE9A 4ILLA 4I6AA 4GTCA 4CYUB 4LBPA 5KG0A 2ZH2A 2RF2A 1Y1WA 3I0RB 4DR1F 1RU1A 2V34A 2YQ3A 4JI3F 3KLIB 4PG5A 3J80U 3GMGA 3K8VA 3RGIA 5LM7E 4ZVOB 4UT4A 2DIUA 1HWJA 4ZP8A 3QJJA 2NVQK 2ZKUA 4LRBA 3H5XA 2FHKA 4ERDA 1NB2A 4WWSA 2MGZA 2BKOA 4V19J 1X0FA 2WOMB 4A8FA 1RT7A 3OL8A 2HSEB 2ZH6A 3GTQK 3VHQA 2L08A 2RIJA 3UD5A 3V6KA 4OIRA 1QAXA 3HVTB 2AJQA 1NU4A 3C6TB 2WBMA 1NXIA 4A8SA 1RWVB 3R2CJ 2E1CA 4J9NA 2VV5A 2ATLA 3EICA 5A6WA 3M6UA 2F65A 1YBAA 2R7TA 3S14K 2VUMK 4WZQA 2I38A 4DCPB 1XEZA 3NBPB 2L9NA 3RUBL 4HDHA 3TA1A 3KG4A 1S12A 3G6YA 3OTBA 3A8EA 3VAJA 1SUQA 1KTVA 3KHRA 2DH7A 1UP1A 3CQZK 2XCRB 3G86A 3OL6A 1OSCA 1Q82T 2ZH4A 3BGUA 4F4KA 2MKCA 4OYIA 1CULA 5AE2A 1R9TA 4DR4J 1N33J 5B0AA 2VQEJ 3P96A 1K73T 1UEKA 3BSCA 3RYLA 2R93C 4EI2A 3E51A 2WZ1A 1LV5A 3S1QK 3CCTA 3DDKA 1RHRB 1MU2A 2XMUA 1WC6A 4DDFA 1Y10A 1JLCA 1OMSA 4HI2A 3Q3QA 4N7TA 1XN9A 3BZQA 1FE0A 4PYDA 2J5AA 1RTDA 4PWDA 1SCJB 1REVB 4IKAA 3M8SA 4BLGA 4AD6A 3D1HA 1JLQA 1LEOA 2DNNA 3IO1A 4KC5A 4IDKB 2IA6A 2Y1IA 3I9ZA 4KQZA 4O0IA 3SZ2A 4F3MA 1VMBA 3R7BB 3D0IE 4B3OA 1H74A 2NXJA 1RHKB 2KB2A 4USVA 2I6WA 1GXTA 4A93C 1F9HA 1TKTA 4DL6A 4IG3B 3I6PA 2NYIA 3TEGA 3QRRA 1ZAVA 4TU7A 2NVXK 1MWQA 3RZDK 1ZBSA 2HHHJ 1WCMC 4P73A 1XJWB 5KFTA 2JLEA 3H3VD 3KKFA 3VA7A 3C6UB 2JA8C 1CC7A 4IRDA 4KMUA 4RX6A 1S9EB 5DQIA 4M63A 1PO6A 1YQHA 4B17A 2CNKB 3RW6A 3O3LA 3GTPK 1UEUA 1EQRA 5F41A 3JS9A 1G3OA 1RE1B 5GMKa 1BWEA 3M9NB 3MM6A 3IRXA 3CCES 1EIYB 4OI2A 3V6JA 2XG8A 2NVYA 2XEXA 1I3OB 1U2RA 2ADBA 3MEDA 3M7VA 3TVYA 2BE2A 2FZCB 3R5JB 2DNRA 5KFQA 4E0DA 4KHPJ 1BC6A 4DR3F 1TWFK 3C14A 3AJ2A 3B4DA 3CJ5A 1RI7A 3UN2A 4B3SF 2MY7A 5GAEI 1X4FA 1HNVA 2AGQA 3BV8A 4KKOB 4YDDB 2P5VA 1S72S 1JXVA 3WZ0A 2CPHA 2WSEC 3KLGB 2RSQA 4C3MA 1M5HA 1WG5A 3FZBA 3I4PA 4DV1J 3BYRA 4A8YA 4XSXA 2H5EA 2P6SA 2ZFHA 4O23A 1R0AB 4MTPA 4OHZA 3OJUA 4ZVTB 1LK7A 3TUZC 1NDLA 3BQ2A 1FJGJ 2YWEA 4O44A 2HFUA 4KYZA 2Q3PA 4H4KC 3H2UB 2ZNZA 5D77A 5J2NA 3OPFA 2G0JA 1KWMA 5ETNA 1WKKA 3IGVA 1P6TA 3VZIA 4DV7J 1RBOB 2CG4A 3D3CJ 2BJ1A 4BY7K 4IR9A 1SC1B 4PQUB 2JWNA 2K3IA 2LU2A 2FLNA 5CCMA 1IR0A 3HSGA 3GTGA 5ETVA 4HHHA 4K4YA 1FWPA 3EVMA 3NOCA 2D3ZA 3CDEA 3HHKA 1J5EJ 4NRTA 2RH6A 2MKYA 3M2UB 1QM9A 2RVJA 4CZCA 3IR6B 4WTOB 2IY5B 4GKJF 3MHYA 1AB4A 1FO1A 3RBZA 1EHWA 3HOVC 2YWWA 1JLEA 1B4AA 4LSNA 1RZMA 4GFQA 1ZQ1C 1X9WA 2NVTK 3G6XA 5IP9C 1S1XA 1G7CB 2A3JA 3EJMA 2KDOA 1WEZA 3W8PA 3R6GB 1TWHA 3W9IA 3HOUK 3BF4A 2C3UA 4FYVB 2GFFA 2O5DA 1RAOA 3FFIB 2BZ2A 3MOJB 2D41A 1M5OC 1LNQA 2Z0GA 4JUZA 1I6HK 2XZDB 4ZPVR 3PJWA 5LXRA 4LR9A 2R8JA 2FLLA 3BSNA 4YMEA 1U02A 1P1TA 1UL3A 2VBXA 1SVDA 5ITHA 4Z7YA 3PYDA 1N88A 2ZC4A 4NLQA 3GTLK 1X9MA 1GAOA 2RHQB 3GIKA 4LSLB 3EDRB 2EW9A 2IVMA 3CCJS 1VBKA 4IOAQ 1RADB 2KH9A 1P9YA 2CQ0A 5KFSA 2ZD1A 1H38A 2RMLA 5F9NA 1C1CB 4A3FK 3DNCA 3WDOA 4CM0A 2R7SA 3D67A 2QA2A 2JA5C 3HKWA 2EI5A 1O26A 4X6AC 1DCPA 4UY85 4NLSA 2HVHA 4KN4A 4FM9A 2IAJB 2GQ2A 4KV8B 2YNGB 3VAIA 4KRWA 3EXCX 1YZ7A 3BGLA 4ZPWR 2E44A 4I1TA 1SJ3P 2C2DA 1X31C 3EZUA 3S0XA 2LKZA 1G2EA 4J9RA 5B0EA 2MPUA 1P9QC 4Y7NK 2HW3A 4OZNA 1M1GA 4CO2A 1J6XA 1WSRA 3THTA 1PSDA 1DQ8A 2VG5B 2O66A 4AUKA 1WI6A 2A2DA 4HEA9 3BQ1A 2CJ9A 1O25A 4LF5F 3DOLB 3VTIA 1ZTWA 2JA7K 3T9ZA 1HNZF 1IXKA 2JEIA 3HXAA 2DPJA 2Y9HA 2BRKA 3V4IA 1YSJA 3S17C 1FFWB 2QG9B 1Y0HA 4YUDA 4BXXK 3OEPA 4DR2F 3I5AA 4LF2A 4WYWA 4WIIA 5GMEA 3AODA 1WG1A 3S15K 2AEMA 1DCHA 3OXLA 4YHHF 2VQFJ 1YRTA 4EYHB 1SI9A 2X1AA 1RT3B 1RU0A 3MM5B 1GNKA 2FJDB 1Q8KA 4KGKA 3GONA 2BV3A 2M5YA 3VQTA 3BBFA 3QO9A 1VS3A 3CF5Q 1PILA 3PY8A 5EUHA 2KHDA 4CLTA 1FVQA 3OREA 2DK2A 4HH1A 3RZOC 3N6NA 1IN0A 2HNDB 3GCWP 3PEJA 5BJRA 1M5VC 3ZZUA 5C4XK 4LQ3A 3QZ8A 2DNOA 4I67A 4KGMA 4GVLA 2R7VA 3NY0A 3KJVB 1Q7LB 2HIQA 4CO0A 4JI4F 1TV6B 2IMOA 2WSCC 2R2TA 2V69A 3CO9A 4F4YA 4KIAA 4EFAC 4A3CK 4K4TA 3NGTA 2FZKB 1ZA1B 5GAHI 4ZS6A 4O4GB 3P5BP 4RMFA 4TQRA 2NUHA 2HIYA 3F56A 4FKYA 3J7A1 3FCVA 1M5SA 1F2HA 4IYQA 4I2QA 5CZXA 2PN6A 2V9WA 2G1HA 4NYZA 2W4DA 4KDDA 2OMLA 2J9DE 1VQ5S 1BGWA 1YJ7A 1N34J 3L4JA 3PX6A 4C45A 1KQFB 2BBEA 1BXNA 1I50C 2YNFA 2XI2A 2XZTB 5KFFA 1SFOK 2JH3A 3SFGA 4Q8EA 1YX2A 2G0IA 3V4MA 4X4NA 2GQQA 1NZAA 4DHVA 1YCLA 4A3EC 2CPZA 2OHDA 7AT1B 3HLUA 2DIVA 3LPXA 4WU2A 1O5JA 4J9UE 5GADI 4YG2A 4Q0BA 3BDEA 2HBRB 2E9TA 3D6MB 4ZIVA 1MN7A 1S6PB 3FRYA 2P5MA 2MJUA 2B9XA 4CO5A 2GVDB 4OI3A 4A8WA 1U2CA 2X1FA 3VALA 5L8RC 1IVZA 1Y11A 1JLFB 5AXLA 4AYBD 3FQLA 5E7OB 4J9KA 4M5JA 4PEOA 4NLXA 1UVNA 5IWAF 4LR7A 4NCGB 2WB1D 2MZSA 4JI7J 1U09A 4WFBQ 3D2WA 5IQQA 3GIRA 3IS9A 1NK9A 1WSVA 3PG9A 2FJAB 4RW8B 3LP2A 3W61A 2MB0B 1UVIA 2E2HA 3A1YG 5HMZA 1K0TA 1FKPA 4DV3J 5HJYA 1JJCB 1O8BA 4ZVRB 1YBTA 3KDNA 1LQ9A 3T1YJ 3ZZZA 2FHMA 4M95A 4LFBJ 4H4MB 2MZQA 1NK4A 4DR5F 5HAOA 3ET6A 5KFCA 1USOA 5I4MA 1S49A 3GTMA 3S2HK 4HDGA 1CQNA 1WHXA 2G2OA 4A3DK 2XMMA 1PYSB 2CFAA 4MFBB 3ELHA 1RDRA 2I0XA 2OSRA 4QU6A 4GO5X 1P27B 1Y1WC 3C15B 1TFYA 2FUG9 1GTHA 2F8EX 4KN7A 4U96A 3B78A 4F4ZA 1XQIA 4IG0B 1UW4A 5L1JA 1VLYA 2FLOA 1WKLA 3SBMA 3J7AN 3M3YC 2ZH5A 2UUCJ 4X2BA 1GK8A 1M0SA 1R7IA 4WTYA 1UMJA 4OHWA 1UWBA 3CC7S 2JRSA 2KRRA 5BR8J 1I94J 4YFKA 3N6LA 4RJVA 2KRBA 4B3MF 2F9JA 2E7WA 2C2EA 3K2YA 3OV7A 4M5GA 4EZ9A 5F8MA 2VODA 2ZNYA 3GG1A 4NL5A 5GVQA 3UVJA 1XNQF 2UXDJ 1B0VA 1T0TV 4F0MA 5F3ZA 3R2DJ 4KJIA 4DV5F 4U8YA 4K0KF 3QRPA 2VA3A 3I31A 2ZHOA 2F4VJ 4IR1A 2UVRA 3KNGA 1NNDA 4ECUA 4DU7A 4C8NA 4C0HA 5M3MK 5J1NA 3KWMA 3DM2B 1S0OA 1VYAA 4RNHA 2FC9A 3DRYA 2YX7A 2GJFA 4L75A 1H3DA 4A3GC 4AXIA 1RTHB 1E6VA 4ECSA 3HCXA 3M8YA 2ZBRA 2XMJA 2C3OA 1KC8T 1LW2A 2D69A 2RQ4A 3TR5A 1W7WA 3MAAA 2HMIB 2LQ5A 1QUVA 2IJFA 1RHJB 3DLEB 5HROB 1RWKB 2XGQA 2ZZTA 1OYDA 2MQ8A 3TOQA 4A48A 2VG7A 3JB9k 4JI2F 5H9EJ 2YKPA 4OHXA 3F73A 4USIA 4GTAA 2J8AA 3JYTB 1FKOA 2SXLA 4AE5A 2JVOA 1QSLA 1EP4A 5E0OA 4DV6F 1HA1A 4ES2A 3UCGA 3LAJA 1HQUA 4R5PA 2ROEA 3IC1A 4X4UA 3GCXP 1EK8A 1FEEA 4MEXA 4DX6A 2N3OA 4OIOA 1BHNA 3HP6A 2X1BA 4U95A 3T1HJ 4FYWB 1TK5A 3L7OA 3CCUS 4DR7J 2YQ0A 1X8DA 2W9BB 3QGGA 5EGHA 2FQTA 4IQXA 4PR6A 4KMAA 3BH6B 5F8NA 1HYSA 1F3VA 2R9LA 1Y9OA 2V4RA 5IM0B 1EB0A 4Q4ZA 5G0RB 2W2QP 5AJ3J 3GILA 4IFYB 2KFYA 4OX6A 2J6TA 4X4TA 1Q5VA 2JEJA 1RKJA 2HRTA 3HHLB 4ID5B 4WXOA 4JV5J 4OINA 3NRBA 2ZDOA 1S5ZA 2IIHA 2V8PA 5KG7A 1Q81T 1D1UA 3DLBA 2FHOB 2YKMA 3P45B 3K89A 4KH1B 4B3RJ 2ASYA 2FYXA 2DCUB 1YNNA 2FD2A 1UKUA 3MUMP 2DXDA 3NNAA 4RUCA 1VQ9S 3GFXA 2NVYC 4FZBA 2BM0A 1YZ6A 2GZOA 1VH2A 2R7UA 2B4VA 3H20A 3SI8A 1YJTA 1JQGA 3AOCA 4YP3A 1JOEA 2VKRA 3CVKA 4P72A 2GNKA 4EBDA 3QRQA 3S1NC 4JI0J 3VGTA 3OFHA 4Y52K 2PDAA 2H4WB 1WELA 1VHFA 3TJ9A 1EX8A 5DETA 4YY3J 3LP0A 4CNZA 4FPIA 1XZPB 3VVUA 1Y3JA 5KFRA 1UEVA 2PC6A 2B5JA 1RT4B 1NPKA 3V6DA 3PM9A 4PAAA 4FS1A 2H3EB 1VQSA 4NLYA 2EK1A 2ZITA 4G1IA 4EO8A 3DGVA 2XQCA 4A3LC 4ZHRB 5F8LA 5LSLA 2PMZL 4B9TA 4LF7F 3A12A 4C98A 2NQPA 3GTGC 3MWBA 2CQIA 3S1RC 3LWMA 2CPXA 4JYAJ 4A3KK 5E3CA 1WEXA 5KT4A 2XYGB 1IKWB 2U1AA 3JSBA 3T6BA 2XY6A 2OI2A 1AB8A 5DDQC 2CNNB 3D0GE 1X9SA 2FVRA 1TFWA 5IFMA 2XB2D 3H0GC 5BYRA 2XYHB 3D28A 4A3JK 2F1FA 3U1MA 2MMYA 1SMYA 3KJNB 5JFEA 1OY9A 2XMTA 2HLUA 3G8SA 1TL5A 3JQKA 2HRYA 2MHEA 3HVWA 5K14A 1M5PC 4JI5F 1TWHC 1S77D 3EGVA 1RLDA 3DOKB 4HKQA 2P2CB 1HBMA 2D1CA 3NCQA 4CLSA 2B8QA 1KOHA 4QIEA 2XMKA 1SJ4P 2ZH7A 1E6YB 3JSYA 3GTKC 5JVGQ 4Q7AA 3EUNA 1ISEA 3S2DK 2BM1A 2GHVC 4LF4F 1YIJS 2J8SA 3QMQA 1GH8A 2DNZA 1DAXA 5IXUA 1AXQA 2YXLA 5IOQA 3J7YU 1N5QA 4OI1A 4U7UD 3WBZA 2XGPA 4BWJA 4LFAF 4CLYA 1VJEA 1TWCK 4QWBA 2AF6A 5ETKA 2AJ4A 4NXNF 4JK1A 2IDLA 5KG2A 4JV0A 1WUUA 2UXCJ 1X60A 2YU9C 2CW0A 2W7AA 1RUSA 2DKOB 3SEOA 1MW7A 3WODA 2HNZA 1X4EA 4K8RA 3ONQA 5L1LA 4LK1A 3RU0A 1H6KX 1X4AA 4AL7A 2EEYA 1J5OA 3CEDA 2WSFC 4B9VA 3JXOA 5KG5A 1DLOA 1F6TA 2C2ZB 1RWXB 1VC5A 3IAM9 2V2ZA 4OX9F 3GIJA 1CJVA 2ZH9A 2WHOA 3BJYA 2R7ZK 4UQGA 3S01A 4GKKF 3MD3A 3FOFA 3H90A 5I3PA 4HLBA 2MZ1A 3V4GA 1B7FA 3VAMA 1JKHA 2GS8A 3I4NC 3L9ZA 2PSZA 5L46A 5H9EK 1YG0A 3UDCA 1Q8BA 4B9NA 3MGJA 3ZZPA 2E5JA 3CD5A 4OJGA 1H2UX 1LWEB 2UU9J 5D4PA 3QWUA 4MEYA 1N0UA 2PIIA 1D3WA 1FRIA 4K59A 3SFUA 1FX4A 3HVRA 3K5LA 1X4BA 3LP1A 2DEIA 2LFVA 2BE9B 3DOMA 1SIWB 4CO4A 1XXBA 5IP7K 3SQGB 2H5IB 2KHCA 1KQKA 2F9DA 2JEGA 1YLXA 3DDIA 3CNQP 3E3XA 5B0BA 4LFCF 2DXFA 4EZ6A 5THWA 2V8DA 2DJWA 3H4DA 1B0PA 1HQEA 3DXBA 4XTTA 3OTOF 5KFLA 4WKYA 4OZ3A 6AT1B 1HI1A 2O5IA 2MGZB 4NOHA 4KO0A 2CFXA 2VB6A 1RT7B 3ISZA 2KU7A 2WONA 2QL7B 3V81A 1W25A 2GMJA 4R8UB 3GTQA 1BQXA 4OL8A 2J9DA 4F4AA 5H9FJ 2XYPB 2HBQB 1FVSA 1WJ9A 1T9TA 4M5HA 1TL4A 3TX8A 3BSOA 2IA0A 4DQRA 3AB2B 3HD1A 3MPUB 2IMWP 4J3NA 5JUMA 4JI1J 3GTOC 2CUYA 2VUMA 3C19A 4G7ZA 4F7VA 2RUGA 3Q83A 2UUAJ 4IFVA 3EPGA 1N32J 4J9VA 1DARA 2LQ8A 1G51A 3CQZA 2ROPA 3W2WB 4GRSA 3AXMA 2EBGA 4R0EA 4YDXA 4DV2J 5C44C 4XDCA 2AEFA 1TL7A 2OPSA 4ED1A 1C0UA 4NMLA 3WHIA 2KJWA 1YVFA 2DHSA 2L41A 5KFHA 5C4JK 4WJBA 4FKXA 3HM9A 1XWLA 5E41A 2AV5A 1MU2B 3UFCX 2HS3A 3U7JA 2OPPB 4C11A 1RT1B 4QOTA 4WFXA 1LWCA 4LF8J 2I2YA 4PUOB 1ACMB 2IM2A 3NOGA 4QZVB 5IV3A 3ZTQA 2OTJS 3OVBA 4PWDB 3GR0A 3NCRA 1BWVA 2Y3YA 4KMDA 2K7KA 4F02A 3MEEA 4A8MP 1TU0B 4HACA 4CLKA 1Q86T 2B56A 3PFEA 2Y0BB 1KP6A 1XC9A 4EU0A 3K8WA 4DPXA 4B3TJ 1ELOA 3DHWC 2MEWA 3QT8A 1S10A 1FTCA 2DGXA 4BKWA 1JLAA 1AZSB 2ZE2B 3FKBA 4B3OB 2BVZA 3KNAA 4CO1A 2UXBF 1KRPA 3MEGB 2H51B 1WDTA 1IBLJ 1GMWD 3DLGA 2QJ3A 4RO0A 3CIZA 3ENWA 1FF2A 1TKTB 3Q86A 2K7JA 4B08A 4DV0F 1K44A 3WIVA 2OP5A 1FJ7A 3ZFVA 1MNEA 1VISA 3HF5A 4CRJA 3PO3C 2AYEA 2W25A 3L7UA 3D1QA 1R8HA 4G3IA 1Y4ZB 2A10A 3QWPA 1VQMS 4ZPAA 4J5OA 4USHA 1XK8A 3EM1A 1FNOA 1IKYA 3CJKB 1PJ5A 1RT6B 4DV4F 1KFSA 2MDAA 2BX6A 4NI2A 1FJCA 3CJRA 1RT5A 2EC0A 2RRAA 1WF0A 2DNHA 1Q53A 3RAQA 4RU9A 3CDUA 5CYQB 4F36A 1T3OA 3MR6A 1ZETA 2B63C 3FC9A 5HLFB 2RQMA 1U45A 1Q7YT 2ZOFA 2E9ZA 1RAGB 3QT6A 4FNIA 3DRPB 5DZ6A 2Q6BA 3ZZRA 2OGUA 2F8MA 3EE3A 3R97A 3R5AA 3CJ2A 3MEDB 2UZAA 3KK1A 4NEZA 3HD2A 1GFWB 2R93A 4KR0B 4DEZA 2BE2B 2MTLA 3CXCR 2OMOA 1HPZA 3EVWA 2FGCA 5F8HA 2YKNA 3GTMC 3QX3A 1HHSA 2JLGA 4Y2IA 3A8KA 4UOCA 4FYDA 2VC1A 3TAMA 4A3IC 4I6YA 2UP1A 1TWFA 2YNHA 4WE1A 3RB4A 2IC3A 3OLBA 1JK9B 1FWLA 2HAFA 1HNVB 5U47A 3A8IA 3TZZA 1T03A 3EGNA 1BD6A 5F0WA 3ZNUA 2HWIA 1HQMA 4XCHA 2QX0A 3R5GA 2ADCA 2ZM6F 2HEKA 3CJ0A 4R0JA 4HVZA 4MT1A 1NSAA 4FVMA 2BJEA 1XNRF 3N0BA 5HMWA 1IBKF 4F3QA 4QPXA 3ULHA 4BY1K 3F0NA 4M8LA 6FD1A 2LECA 4Y34A 4NZ6A 1FRJA 2F5GA 4DN0A 2FC8A 2CPIA 3MD1A 1X0PA 1TMJA 3I32A 3HOYC 2W8KA 3GG0A 3C16B 3SZYA 3Q8RB 3NMAA 5B7WA 3LUYA 2XULA 4FNHA 4WK1A 4RW7B 4J9PA 5J2NB 1NBEB 3N79A 2CJQA 4ZLJA 3US5A 2AYGA 2GJ2A 2Z30B 4ZVFA 1Z1ZA 3VZHA 4LMZA 4EO6A 2VG6B 1PYTA 2E2IK 4TY8A 2E1RA 1HL6A 1AUDA 1HWKA 5L1IA 1WCMA 2HVZA 1U1NA 1T9WA 4FXWA 4NASA 2RE1A 4X66J 2NUUG 1BQNA 1Y7PA 4U7UK 5LSOA 3OHBA 4YEAA 1TAUA 7FD1A 4CTAB 2MY8A 2Y8WA 4OZ5A 5CXTA 3UCZP 1ZH5A 2J9CA 1NJZA 1V6HA 1WORA 4ZVPB 5TJ3A 2B63K 3I4MK 1RCOB 1K1QA 4N8NA 1NMEB 2FB0A 2KFZA 4LSNB 4DS5A 2V67A 3EGWB 1RYRA 1Q79A 4DPUA 3K7AC 2C3MA 4O2DA 3KJQB 3OPKA 3MI7X 2Z2ZA 3H2VE 1OSDA 3NG8A 4MK9A 4IH5A 4P52A 1TWAK 1DTQA 5CZVA 1PCAA 2RDIA 2N4DA 3CDBA 3POTA 3RBXA 1TQLA 4ES1A 3GTJC 1AA1B 4ZDNA 3E2EA 1S1TA 3QLHA 3LANA 3BP8C 4BLBA 2CQCA 5H9FK 3Q8VA 4HYKA 4I56A 2DR8A 4F26A 3MCSA 4FF3A 1RK8A 3G9CA 1HNWF 4P75A 5J2PA 4IOCQ 3V6HA 5ETMA 4K2JA 5CD4H 2J76E 1RTIA 2VKZG 1V3ZA 2GSNA 1TKXA 4PXEA 2C2KB 4KHRA 3NKYA 3R7SB 1R8AA 5KFBA 2ZD1B 4X4VA 1RTZA 3MAQA 2NSCA 3Q8PB 1Y5IB 5HJXA 5IYDC 1JIHA 3TJ8A 2J6SA 1WHVA 1N48A 4DG1A 4M5DA 1AT1B 4H4KA 1TWGC 4ANEA 4RKUC 3AAWB 2WCXA 1MWYA 4ED3A 3K57A 5KG6A 2QV6A 1CJKA 5D4LA 2QLWA 2HS0A 3D6HB 2JZ5A 2OKQA 3OR2B 4N77A 2Y8YA 4C2MK 3LF0A 2OIHA 1Y1VK 2EK6A 1R0CB 3D3BJ 2FTRA 5EGYA 1UVKA 2ILZA 3RG6A 2EKYA 4EBEA 2MZTA 2A6MA 3KLFB 2PA8D 5KFAA 5IT4A 2W7PA 3EZ5A 4C3HK 3GJSB 1CS4A 4GTFA 2ZHBA 3PVXA 2W9CA 3PIOQ 2MJNA 2R42A 2YWKA 3SIPB 3KXDA 2WVDA 1I3QC 2BJ3A 2JL9A 1FHTA 3DLJA 2C2RA 3I0RA 1Z2ZA 4DZ6A 2QYCA 4MIBA 1RQ0A 3KLIA 4URSA 3OVSA 1SH2A 2QL9B 5J2MB 3V4IB 4MIWA 1K83C 3UCUP 3HSJA 4WU3A 1I6JA 2WOMA 5DM6Q 3ZTRA 5KT6A 2DY9A 4DLEA 4JI6J 4K4UA 1P1LA 4HL9A 2FPHX 4DOZA 2H5JB 3HVTA 3MTJA 4WKRA 4OJ1A 3C6TA 4NPOA 4OYOA 3Q8UA 1C4AA 1H7XA 2M70A 2WAQD 3VGVA 4I69A 4NLUA 3BGOP 5IV4A 1BJTA 2XBPA 1NPPA 2JFKA 4PCQA 3OTDA 2BQRA 2R8HA 4HTJA 2BANB 1SC4B 3QT5A 3NBPA 3IR5B 1DCOA 1CBKA 1NUEA 1HBNB 3B8HA 1JXEA 4LIWA 4IOBA 5IYBK 2JA5A 4JP8A 5CQGA 4O3SA 1T05B 2LEPA 2VUGA 5LMUJ 3OT9A 2HGNA 1R9TK 4OV1A 5LL6d 2OO4A 3VAKA 4X65F 4P9SA 3RW7A 4PKDB 2CPEA 4LJZA 5C24B 1HHQA 3GFZA 4USTA 2PT0A 5D4OA 2FJBB 2MLYA 4GO7X 1PJ6A 2QA4G 4AT1B 2RNEA 5C42B 1LWFB 4ELTA 1SV5B 1IJEB 1NK6A 3TQEA 2GVZB 4NLTA 3N9UC 2CQBA 1YHQS 2WVFA 3G87A 1S1VB 5AXNA 1RAJA 1J27A 5C3EC 2ZJRQ 2HGLA 2N3LA 3HKZD 5IT9Y 4ECTA 4FN5A 3RJMB 1ZOTA 2DISA 4C97A 4IDKA 4ZK7M 3GB0A 2YBVA 3R9LA 4I0WA 2GSOA 3IN5A 4Y2CA 2NPFA 2Y0SD 3D6TB 1WF2A 1F5CA 3MF5A 3KG1A 1RWWB 5I3UB 1NZ8A 2AEJA 3T5JA 1JNZB 1NK8A 4NXMJ 1FK9B 2GQCA 1FD8A 3OQ2A 4IH7A 1R0BG 1DD5A 3D9BA 1ZPWX 2Q6CA 3G71S 2JA6C 2BXJA 1FFSB 3G82A 3CUNA 2KT2A 4RWWA 2HBYB 4LT6A 4ZH4A 4Q0BB 2GO8A
chains in the Genus database with same CATH topology
3A8KA 1XZPB 1PJ6A 3GEIA 3ADAC 1WOSA 3TFIA 3AD8C 1V5VA 1WOOA 3AD7C 4P9SA 1XZQB 1PJ5A 3GIRA 5L46A 3A8IA 1X31C 3A8JA 4PAAA 1WOPA 1WSRA 1WSVA 1PJ7A 1XZPA 4PABA 1VRQC 1YX2A 3GEHA 2GAGC 1VLOA 3GEEA 3AD9C 3GSIA 3TFHA 3TFJA 1WORA 3TTGA 1XZQA 2GAHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8K A;  1XZP B;  1PJ6 A;  3GEI A;  3ADA C;  1WOS A;  3TFI A;  3AD8 C;  1V5V A;  1WOO A;  3AD7 C;  4P9S A;  1XZQ B;  1PJ5 A;  3GIR A;  5L46 A;  3A8I A;  1X31 C;  3A8J A;  4PAA A;  1WOP A;  1WSR A;  1WSV A;  1PJ7 A;  1XZP A;  4PAB A;  1VRQ C;  1YX2 A;  3GEH A;  2GAG C;  1VLO A;  3GEE A;  3AD9 C;  3GSI A;  3TFH A;  3TFJ A;  1WOR A;  3TTG A;  1XZQ A;  2GAH C; 
#chains in the Genus database with same CATH topology
 1NHU A;  4RUA A;  3NNH A;  4I64 A;  3C66 A;  3IA0 A;  4DQS A;  2X7I A;  3LGH A;  1WOP A;  4GT9 A;  2DIT A;  1C0A A;  1FRL A;  3T6J A;  2X3G A;  1S9E A;  3KUG A;  5CCL A;  3Q8Q B;  3ADA C;  1INN A;  4RW6 A;  2CAD A;  4ED2 A;  1UFL A;  1VBY A;  4BBR C;  1SJ1 A;  3OUY A;  2D3O 1;  3N5F A;  4F04 B;  5L9N A;  2N82 B;  2AMC B;  3M8P A;  4ZPD A;  3H4B A;  2P8T A;  5KFY A;  2ACM A;  4H4O B;  1FKP B;  4A3B C;  1DZ5 A;  2EC2 A;  2NLW A;  2OH2 A;  1VLO A;  3KUH A;  3M4X A;  5E3P A;  3KYL A;  5IZH A;  4WFY A;  2X3D A;  3L3C A;  1VRU B;  5HQL A;  4LK0 A;  1I51 B;  4PRF A;  3ET6 B;  3PW7 A;  4Z2X A;  4NLW A;  2K06 A;  1IWA A;  1Z4U A;  5E68 A;  4AQY F;  3FSX A;  4KKO A;  5KFX A;  4CO3 A;  2IFX A;  3GJR B;  3M4O K;  2EFG A;  2IVF B;  2HVI A;  1Q0N A;  4ZLP A;  2DRB A;  1S0V A;  3Q22 A;  3T5H A;  1L0W A;  5A8K A;  3KLH A;  1CEZ A;  2M52 A;  5JVO A;  3PO2 K;  4ZOS A;  5K8M A;  4DF8 A;  1XXA A;  2VDH A;  3VGS A;  2WVE A;  5K20 B;  1UFW A;  3C2P A;  1WG4 A;  1R0A A;  4ECX A;  1URN A;  4YB6 A;  3O5T B;  5K8N A;  3CCR S;  5F8J A;  3MM9 B;  1YRX A;  2AT1 B;  4X62 F;  1I50 A;  2NVQ C;  4K5R A;  3MTK A;  4OI4 A;  4X64 J;  1SH0 A;  1EKR A;  3M8W A;  1QLN A;  5KFU A;  3T5L A;  3DRX A;  2VF3 A;  3GTQ C;  2Z57 B;  2JA6 K;  3AD7 C;  4BCA A;  3N6M A;  3IR7 B;  4PQU A;  2APO A;  2OEM A;  3CC2 S;  1HBO B;  1RHM B;  2HFZ A;  3UVJ B;  1HLW A;  2YNI B;  2DHH A;  4HR2 A;  5D3G A;  4WK3 A;  3S14 C;  2VUM C;  2RS8 A;  2V6T A;  5A2Q Y;  4ED4 A;  1L3V A;  3BS9 A;  1CSJ A;  1WC1 A;  1GMV A;  4KE5 A;  2VPX B;  3NUH A;  1B4S A;  1U4B A;  1EI6 A;  2MYF A;  1KDN A;  3CQZ C;  1HBU B;  2I5J A;  2MQL A;  1VBZ A;  4LSZ B;  5SUH A;  3UN3 A;  2W4C A;  3KOA A;  4MKA A;  2HNY A;  3O1L A;  4W4M A;  3MMJ A;  3EVO A;  4M5I A;  1E6V B;  1ZM3 A;  2HG4 A;  2HKE A;  1MRO A;  4PYA A;  2HVE A;  1NHV A;  2QGF B;  4W98 A;  4XLP A;  3H3V L;  3S1Q C;  4LLG A;  1NKB A;  1JLG B;  2KT5 A;  1EET A;  3FFI A;  2E5L J;  2A6E A;  1M1H A;  2CPF A;  2M3D A;  4QYR A;  3FHZ A;  4FBU A;  5KTQ A;  4JI8 J;  1G6B A;  4OJH A;  4DR6 J;  2AD9 A;  5ETL A;  2GX8 A;  1KTQ A;  4DS4 A;  4DUZ J;  1SQG A;  2D6F C;  1EP4 B;  1Q8I A;  2G2Z A;  1TVR A;  4L3N A;  1TKZ B;  3HMJ G;  1REG X;  2OPQ B;  1IBM J;  4LSL A;  4DUY J;  2QO3 A;  2VZ9 A;  4UZB A;  3M32 B;  4M94 A;  3L95 X;  3A4T A;  1GQE A;  4QW8 A;  2P9G A;  2BJ8 A;  1C1C A;  2VIH A;  3T3F A;  2DNQ A;  3T01 A;  4LRA A;  5IOR A;  4P2S A;  3S8S A;  4OYA A;  1LK5 A;  4C8M A;  1RWO B;  2C42 A;  4NYO A;  5E5N A;  2V5H G;  3L4B C;  3D66 A;  3CW2 C;  1HMV A;  1W2I A;  4C3L A;  5KAK A;  2IAJ A;  2YKO A;  4KV8 A;  3QID A;  1D9D A;  2NVX C;  1U6Z A;  5ETP A;  4BBS K;  1KD1 T;  2LQ9 A;  3RZD C;  2WVB A;  1C0T A;  5DQH A;  3HOX K;  1JNR B;  3WIU A;  4C3I K;  3MOZ A;  5IC4 B;  2HHQ A;  3PXG a;  2N7C A;  3C46 A;  4LR8 A;  2GHP A;  3H8Y A;  2HFV A;  3LOU A;  5T41 A;  3QAE A;  4USJ C;  2YKM B;  3J7Z T;  2DGO A;  2N4C A;  2FVP A;  3CCQ S;  4OZ1 A;  2FIU A;  3GTP C;  3MR2 A;  3Q0A A;  3OSN A;  1LKZ A;  2V8V A;  2GAH C;  3PJ9 A;  3DXJ A;  4AH6 A;  3M8Z A;  5EX3 A;  2VG5 A;  5HL7 Q;  2DGU A;  4ID8 A;  3H2L A;  3OFG A;  5EWG A;  3LPE A;  2YWH A;  2BEF A;  2EBE A;  3DKD A;  4OHV A;  4TYA A;  1EQM A;  2O01 C;  3I55 S;  3BGR A;  3DOL A;  2V8H A;  2XHC A;  3DYA B;  3FVY A;  1UVJ A;  4Z37 A;  1VJQ A;  1HR0 F;  1NM2 A;  1PGZ A;  4YR0 A;  5LMN F;  1RCX B;  1TWF C;  1Q16 B;  2BR0 A;  4DCJ B;  2RQK A;  2BDP A;  3PHE A;  1O51 A;  2MQO A;  1SB6 A;  1TKD A;  3DMJ B;  2XCA A;  5D78 A;  1S1U A;  1KS2 A;  1RT3 A;  1D8Y A;  2JHE A;  1KQS R;  4CLL A;  2QC3 A;  3CCZ A;  1VK3 A;  2PE8 A;  3BQ0 A;  4TNO A;  4JV1 A;  2GJI A;  3LP0 B;  1XMO F;  1BY9 A;  1RA6 A;  5D15 A;  1NCL A;  5TMF A;  2CZ9 A;  3BRE A;  4LOW A;  2C3Y A;  1FDA A;  1X5S A;  5D0G A;  2B5J B;  3V6D B;  4LF6 J;  5T7L A;  4C3J K;  1X4G A;  2R7O A;  3OTE A;  3M9O B;  3JQM A;  2E1M C;  2HAI A;  3DLH A;  1RYS A;  1S1W B;  2PI5 A;  4ZP7 A;  4DSI A;  3KJV A;  1G1X A;  2C2N A;  4N47 A;  2ALY B;  1TV6 A;  4QJV B;  4BY7 C;  1NRK A;  2V6A A;  3GFH A;  1HQ2 A;  3D5M A;  3FCW A;  3GQC A;  2OJ3 A;  2HZA A;  4LR2 A;  3DXS X;  4ALZ A;  5KFW A;  4MIA A;  2DR9 A;  3VAH A;  2BRL A;  1VQ8 S;  4MJK A;  4O4G A;  2V68 A;  1FTR A;  2OD6 A;  2V94 A;  2G1D A;  1IW7 A;  1U48 A;  4ED6 A;  1S59 A;  5M2P A;  2NXE A;  2O67 A;  3HI9 A;  2BJD A;  5B0G A;  1U0H B;  1EQ0 A;  2JC1 A;  2DHA A;  2E9R X;  1ROF A;  3KUE A;  4MKV A;  1YBU A;  1FA0 A;  4S0M A;  3TYT A;  2NVT C;  2RD5 C;  4NRU A;  1YI2 S;  2V6S A;  3HOU C;  5IT9 U;  5IYC K;  1JVI A;  4A3M K;  3QAT A;  3UDE A;  2G0C A;  1NO8 A;  2HQC A;  2RKI A;  1KOO A;  2DGT A;  4ECZ A;  2EG1 A;  3UD4 P;  2JDJ A;  2IM0 A;  1QSS A;  3O44 A;  1WQF A;  4J37 A;  1I6H C;  1B3T A;  2VC0 A;  1CJU B;  3QQC D;  4LUB A;  3Q23 A;  3FMW A;  1FWK A;  5MAO A;  1NAQ A;  1T3N A;  3E01 A;  1OYE A;  3ISN D;  5M2U A;  4P5B A;  1S6P A;  1QE1 B;  1CJT B;  3H98 A;  2HQD A;  2GVD A;  2HK3 A;  1XIQ A;  2M88 A;  3GTL C;  1O2F B;  5KT2 A;  3CIM A;  2YX1 A;  1FDD A;  4NLG A;  2NZ4 A;  2KVQ E;  3FKI K;  4A3F C;  5GAG U;  1N0V C;  3LWL A;  4NCG A;  2OEL A;  1OPZ A;  2XO6 A;  4UZC A;  1F5A A;  3CDW A;  2GHW A;  3IG1 B;  2VPW B;  3UR0 A;  2HNZ B;  5D4N A;  5HSP A;  2OFG X;  4OIQ A;  2HGM A;  2E2H K;  4RW8 A;  1RAC B;  1J5O B;  4MYU A;  4A8K A;  1UJ5 A;  4B9U A;  4OI0 A;  4I2P A;  1N36 J;  1HAR A;  3PX4 A;  1DLO B;  3PAC A;  3QFW A;  4ILD A;  1ZYQ A;  5C25 B;  2VFR A;  1UCN A;  1JLB B;  1U8S A;  2HHU A;  1TAQ A;  1YTY A;  4N56 A;  1F5B A;  1UJ4 A;  1JKH B;  2ZEJ A;  3BKF A;  4YQW A;  1NK7 A;  2MKS A;  5K8O A;  1IBA A;  3G8T A;  2YH1 A;  2VBY A;  2ZBP A;  1FDB A;  3MCO A;  3TFI A;  4MFB A;  3KLE B;  1PAU B;  2Y1R I;  4Y7N C;  2XLJ A;  3H0G A;  1ZM4 A;  2XS2 A;  3U02 A;  2P9E A;  1S79 A;  2O3D A;  2KT3 A;  3M1V B;  3C15 A;  2J0W A;  4XLN A;  2JEF A;  2W7O A;  3KG0 A;  3W2V A;  4FYX B;  5E3A A;  5K5M A;  1EAR A;  1EFW A;  2NCK L;  5HL8 A;  2JA7 C;  3U27 A;  4IO1 A;  3OXF A;  2K3K A;  4OZ2 A;  1UPM B;  3RB3 A;  1YJV A;  2H4Y B;  4CLZ A;  4BXX C;  2QE5 A;  1QTM A;  4M5K A;  4TVA B;  4OLO A;  3I9V 9;  4X84 A;  2HFN A;  3GTK A;  3S15 C;  4O3O A;  4OHY A;  4XSZ A;  1ZYR A;  3DRR A;  4EGL A;  1TL1 B;  3JTO A;  2AZ1 A;  4ZMM A;  3MCM A;  3H5Y A;  2R7Q A;  4Y6I A;  2DNY A;  2VU5 A;  4KPC A;  3W66 A;  4ZVQ B;  4ZKA A;  2DD8 S;  3CT9 A;  2J7W A;  4DR4 F;  1N33 F;  2VQE F;  1VQ4 S;  3RR8 A;  1UVL A;  2W24 A;  1S6Q B;  2FVQ A;  5I42 A;  1QDU B;  2RAQ A;  3FRZ A;  4RW9 A;  3DM2 A;  2YU9 A;  2AYM A;  3KK2 B;  5C4X C;  2E66 A;  4IFV B;  1NK0 A;  1YRU A;  1QVG R;  2BKP A;  3RRG A;  3M2R A;  1YJN S;  2AZ3 A;  1RTH A;  4L72 B;  5A2Q U;  1ZAX A;  4Q45 A;  2CVI A;  3CC4 S;  3O2I A;  2IBO A;  3PRV A;  1JQW A;  5DDO C;  1Q5Y A;  2GA7 A;  4EYI B;  4ED5 A;  2AKW B;  3DLE A;  4A3C C;  1ZZN A;  3TAR A;  1NJX A;  1FKA F;  3TAQ A;  2E7V A;  4AYB L;  3KK3 B;  1HI0 P;  2DRD A;  2KFN A;  3CDA A;  3HT0 A;  4J9M A;  4C11 B;  2UUB J;  3IRW P;  3RBE A;  2ACY A;  2FHJ D;  4EMD A;  2WB1 L;  1SIZ A;  2HFO A;  4EBC A;  2BJ9 A;  5KFP A;  4LRC A;  4ECY A;  1IKX B;  4P10 A;  1S9F A;  5D0H A;  2CQP A;  4ED7 A;  4DSL A;  3KLV A;  3VVT A;  2M8H A;  4ZP6 A;  5I3Q A;  2XMA A;  2CIM A;  1WQG A;  2V8G A;  2LU1 A;  2HHH F;  1K47 A;  1WOO A;  1IJF B;  1DUR A;  1SJF A;  2GO9 A;  1SFO C;  2NXC A;  1RAH B;  1N5V A;  1D09 B;  5DQG A;  5KT3 A;  4ZJL A;  4TU9 A;  4JBC A;  1R8P A;  1U8W A;  1WC3 A;  2CJY B;  4ILR A;  2FQQ B;  3PYE A;  4RU2 A;  1U1O A;  5G0R A;  1RIS A;  3MM8 A;  4A47 A;  5HP1 B;  4DR1 J;  1YKW A;  2R92 K;  3HHL A;  1FE4 A;  4ID5 A;  3FUY A;  2LYV A;  4JI3 J;  2DB1 A;  1RTJ A;  2QA4 S;  3ISN C;  1JXL A;  3T5K A;  3BKU A;  3JQJ A;  1PBU A;  1QD1 A;  3IAS 9;  5AXM A;  4NE9 C;  1V9O A;  4DWI A;  3Q8Y A;  1VRT B;  4YB7 A;  3BYP A;  1H72 C;  4NI2 B;  1RAA B;  4XO0 A;  1NKC A;  1RT5 B;  3BSA A;  3FSI A;  3GTO A;  1RAE B;  4KHP F;  1WTB A;  2A18 A;  4P6Q A;  4DL0 C;  3LTO A;  4PWW A;  4O3Q A;  3OSP A;  1TL3 B;  4BC7 A;  2RU9 A;  1AFI A;  4NEY A;  4CM2 A;  2WTF A;  4C9D A;  4USU A;  1FX2 A;  5JXS A;  4ANC A;  1F7V A;  1BQM B;  4I7F B;  4K2X A;  2DYA A;  5FLM C;  3QSI A;  3QGI A;  1YJ9 S;  1HIY A;  1OQ3 A;  1AYE A;  3TVK A;  4H54 A;  4DV1 F;  4ZJO A;  5F9L A;  1ICE B;  4OX7 A;  2A6O A;  2YTC A;  2YKN B;  1DTT A;  3I56 S;  2KZZ A;  4WCE Q;  3S2H C;  4DSJ A;  4ILM A;  2HZV A;  4ICL B;  4XIU A;  1FJG F;  3QIP B;  2YNH B;  4A3D C;  2KN4 A;  2PMH A;  1FER A;  1T03 B;  2B9E A;  4KGX B;  4DSE A;  1VHI A;  1VR6 A;  3GFY A;  3MM7 A;  1XZP A;  4DV7 F;  1KON A;  2RDD A;  3DLK B;  3PZP A;  2FVS A;  3TUJ C;  5HVF A;  4WJ4 A;  4K7Q A;  3TTG A;  3I96 A;  3PYF A;  2OUG A;  4QCL A;  3O8W A;  2YX4 A;  2CQH A;  3TI0 A;  1DQ9 A;  2LEB A;  1XXC A;  5DZ7 A;  4RNN A;  4F0H A;  3W5Y A;  2CJK A;  4RW4 B;  3HHD A;  1J5E F;  3BM7 A;  2L48 A;  3GTY X;  4QQB A;  3X3U A;  2J7K A;  3B54 A;  2BE7 D;  5M3F K;  2EXU A;  3SSS A;  4DU8 A;  1JJ4 A;  1KLM A;  1XZQ B;  1ZXO A;  3OHA A;  2WVC A;  4PAB A;  1HNX F;  5T14 A;  1LFP A;  1VQO S;  4TY8 B;  3W9J A;  5DM7 Q;  1IKW A;  2CG8 A;  2B6A A;  3D68 A;  3M30 B;  1IM6 A;  3AH6 A;  4G7H A;  3MAH A;  2PEH A;  4CLU A;  3PX0 A;  4PPZ A;  2U2F A;  4RPF A;  4B9M A;  1S4E A;  3QJL A;  4RLE A;  1XR5 A;  3NWR A;  2IM3 A;  1RP5 A;  1GX5 A;  8AT1 B;  3KDO A;  4X4O A;  4GVB A;  4G0U A;  2HHV A;  3R6L B;  1PBA A;  2M0G B;  3ENQ A;  2B63 A;  2GAG C;  1DJ0 A;  2A2C A;  2V63 A;  1UVM A;  3DOK A;  4UOH A;  2RGR A;  4W92 B;  4QR0 A;  4XPE A;  5FLM K;  3LAL A;  2M2B A;  1HNI A;  1V5I B;  2YWG A;  3SDE B;  3BR8 A;  3EGZ A;  2HQG A;  4G7O A;  1DTQ B;  2B3T B;  2MQP A;  4K4V A;  1VGY A;  3DDN A;  3RB6 A;  3TWZ A;  1O2A A;  1VQY A;  3POT B;  4D3H A;  2LA4 A;  2OPR B;  1S48 A;  1IQ0 A;  1XMQ F;  3WC2 A;  3NNC A;  2B9W A;  3BDP A;  4Q5S A;  1DRZ A;  1UET A;  1HKA A;  4WPA A;  5HI7 A;  4J9S A;  1U24 A;  2DEJ A;  2Y1L B;  2BAB A;  2V6U A;  1RTI B;  4TXS A;  4DR3 J;  4DFK A;  1VFJ A;  2HVD A;  2RB7 A;  1RJJ A;  4DUT A;  2OLW A;  2LQB A;  5E3R A;  4B3S J;  1PC4 A;  4ECV A;  2ASD A;  5CA5 A;  4J9O A;  3CWJ A;  2E5H A;  2VBZ A;  5KFJ A;  1TZ0 A;  1QAJ A;  2XWX A;  1H2V Z;  4Y65 A;  1UZH A;  1VQK S;  1F9N A;  4M5D B;  3AH5 A;  1PIE A;  2VIC A;  2HZC A;  3T00 A;  2V2V A;  2Y1J A;  2VDI A;  3OR1 B;  4ZLN A;  5M2R A;  3FGV A;  2H48 B;  4EEY A;  2RRB A;  3M8Q A;  4G1P A;  3DGP A;  2DPI A;  4RWX A;  3BO4 A;  4L6V 3;  1OS5 A;  2EFN A;  4UOF A;  1K0V A;  1LWE A;  2ZHA A;  2YY3 A;  1ZTT A;  5L9X A;  1HW8 A;  4C0O C;  1CS4 B;  2GGP B;  2FDN A;  4NLO A;  2MST A;  3TZW A;  3W63 A;  3MMC A;  2B9Y A;  3SQG A;  1SL0 A;  2ZH8 A;  5D0R A;  2VQF F;  3M9M B;  4ELU A;  1IKV B;  3I0S B;  1MG7 A;  1USM A;  4A8Q A;  2W1B A;  2RQC A;  1U1R A;  2XNQ A;  1J2V A;  3SCI E;  4PXD A;  2DNG A;  4GKJ J;  3P49 B;  1SH3 A;  2CQD A;  2VAS A;  2CNL B;  2XCO A;  2UVW A;  5C2C A;  3GTJ A;  3FOE A;  2QZ8 A;  4R8U A;  3DU6 A;  4Y52 C;  1J98 A;  3TX0 A;  5A0Y B;  2V50 A;  1S6O A;  5CH7 B;  3NS6 A;  1NDK A;  3SXL A;  2ZC3 A;  2ZKT A;  1S97 A;  4WF9 Q;  1F0X A;  4QW9 A;  2FVC A;  2QFJ A;  2BAC A;  3SZZ A;  1D9F A;  2HK2 A;  3N4W A;  4F2S A;  4LF9 F;  3BPS P;  3ZTP A;  2R8K A;  4Q2M A;  2VJU A;  2QEX S;  1HWU A;  2PA3 A;  3JST A;  4I68 A;  5HBM B;  2R7R A;  4Y3C A;  2KXF A;  3DC2 A;  2BMB A;  3BBB A;  3IMQ J;  2BQU A;  3IM8 A;  3MMB B;  1N6Q B;  4X4P A;  3HFZ B;  3OVA A;  2PHC B;  2HRU A;  2GSU A;  1FDN A;  3W2W A;  3S16 K;  1T9U A;  4C3K A;  4Q43 A;  3D54 A;  2RIL A;  3CCS S;  3LAK A;  2ZDP A;  5KT5 A;  5J2Q A;  2PO4 A;  1TWG A;  3CD7 A;  3P4U B;  4AL5 A;  1N5Y B;  1ZBT A;  1GMW A;  2D7S A;  1B70 B;  2BA9 A;  3CMA S;  3PW4 A;  4OYW A;  2W9A A;  4A3K C;  3MMA B;  2EFQ A;  1HD0 A;  3JSR A;  3RRK A;  1N34 F;  3OJS A;  2OPP A;  1RT1 A;  3FBC A;  4KB2 A;  2XCQ A;  3NS7 B;  1OWX A;  2B4P A;  2YPY A;  2E2J K;  3GV8 B;  4PUO A;  3MCN A;  3HJV A;  3TJA A;  3AFG A;  4NCA A;  4WZM A;  4WIL A;  4KC6 A;  2B4U A;  4A3J C;  2ATC B;  1PJ7 A;  2K8G A;  2V2Q A;  3PKY A;  4DFP A;  4ZCL A;  2LMI A;  4RUH A;  2UUT A;  3MFH A;  1I3Q A;  5F0U A;  4MQ9 A;  4P2F A;  4O3R A;  2V4J B;  1S9G A;  1WDD A;  3Q2S C;  3NAH A;  5CYJ A;  1AZS A;  2ZE2 A;  5AXK A;  3H5U A;  1U49 A;  2CA9 A;  2VPZ B;  3ILO A;  2CNO B;  5DLF A;  4QWC A;  2N7Y A;  4ETZ A;  5F3T A;  3MEG A;  1S4F A;  3JSM A;  3HHL D;  3EWG A;  1K83 A;  1RT2 B;  4DX7 A;  2J9E A;  1T7P A;  2XMW A;  2PEB A;  2EFO A;  3RAM A;  3K17 A;  3S2D C;  2L9D A;  3K7R A;  1NJW A;  4JI7 F;  2C28 A;  4PG4 A;  5FD1 A;  4ECQ A;  3G82 B;  3P5T L;  2CVE A;  4FVC A;  4LF5 J;  4QIV A;  4JB8 B;  3L7P A;  2MZR A;  1HNZ J;  1TWC C;  4YB1 P;  3RAX A;  1HHT P;  3CJK A;  4DV3 F;  1RT6 A;  1FCA A;  1UWA A;  4U6P A;  5E33 A;  5KFN A;  4N41 A;  3FEX B;  3VGU A;  3T1Y F;  4DR2 J;  2R7W A;  1RAI B;  3PO5 A;  2ZFZ A;  4LFB F;  1UA1 A;  3NP5 A;  5CYQ A;  2JVR A;  4RW6 B;  4C8O A;  3AOB A;  4YHH J;  2ZBI A;  3OUY B;  3MPV A;  5HLF A;  4DF4 A;  4YFN A;  3M6X A;  3DRP A;  3PCO B;  4OFZ A;  1YJR A;  3M8P B;  3OXG A;  3QPI A;  3CE8 A;  1U47 A;  2HLT A;  2NXU A;  2R93 K;  2M7S A;  2G9O A;  1HWI A;  4CNY A;  3W8G A;  2R7Z C;  2A69 A;  2JLF A;  5DG7 A;  5B0F A;  4O3P A;  3CJ3 A;  1YGY A;  3QFH A;  1YNJ A;  3ITH A;  3GPA A;  2W8L A;  3CD6 S;  1Z2L A;  5FJ4 A;  5HAT A;  3BO2 A;  1V3R A;  1F3F A;  1R31 A;  2NXN A;  4GMK A;  3PYG A;  4PZV A;  3THV A;  3MR5 A;  2UUC F;  4V1A k;  3MDF A;  2DGV A;  1TUG B;  5A8W A;  4JI4 J;  3CCM S;  4P2M A;  3NGR A;  1T95 A;  3WC0 A;  3AA9 A;  1NEE A;  4J9Q A;  2DRA A;  4RBV A;  5BR8 F;  1I94 F;  3SSQ A;  5A8K B;  3A3O B;  3KLH B;  5IP7 C;  1U26 A;  2IVY A;  1M1K T;  4UY8 T;  2B43 A;  4WJ3 M;  4ED0 A;  3VAG A;  4BLA A;  3G6E S;  3HSD A;  2UXD F;  4KH0 B;  3C16 A;  4A93 K;  3HK2 A;  4FZV A;  3SQO P;  2F4V F;  5KFV A;  2HQI A;  4RW7 A;  2CZ4 A;  2IM1 A;  1IE0 A;  2RT3 A;  3W62 A;  3PEH A;  2I9S A;  5ETT A;  2CQG A;  8RUC A;  2JA6 A;  2VG6 A;  2QA1 A;  2PI4 A;  1HD1 A;  2AWZ A;  1WCM K;  1TUV A;  5HMX A;  3FBE A;  4KAR A;  3CJQ A;  4L73 A;  1W26 A;  2KJV A;  3G6V A;  4BS2 A;  2FJE B;  3KMS A;  4KFB A;  2E5G A;  1FRX A;  3PO4 A;  3NXZ A;  3HDS A;  2PFF B;  3QNW B;  5HQ8 A;  2JA8 K;  3VR1 A;  4CTA A;  5D3G B;  1AFJ A;  1OY6 A;  3PW2 A;  1OIA A;  4N76 A;  1X5P A;  4OI6 A;  4V19 X;  2CXE A;  1KHV A;  2GIF A;  3EDQ B;  5KFI A;  5HVH A;  3J81 U;  3SCJ E;  1U2F A;  4RL1 A;  1T02 A;  1S0M A;  5LSR A;  1HNX J;  3MR7 A;  2I5J B;  4U67 Q;  5L38 A;  5EN1 A;  4OV6 A;  4CI0 B;  2IPO B;  9ATC B;  4P71 A;  2HBZ B;  2JFD A;  3BB5 A;  3NS5 A;  2HNY B;  4F4X A;  1SXL A;  4QU7 A;  1FRK A;  1MRO B;  2GC8 A;  4DN9 A;  4KHM A;  5IWA J;  2CJB A;  3G4S S;  2MKH A;  3OBI A;  3GU0 A;  3D1O A;  5C4J C;  3LQV A;  1EET B;  3DI6 A;  2RUS A;  1T9Y A;  1R27 B;  3GII A;  4GC7 A;  1L5U A;  3CO0 P;  3T1H F;  4DR7 F;  5ETQ A;  2VD3 A;  3Q24 A;  4LF1 A;  5IQ6 A;  1IQT A;  1UPP A;  1K8A T;  1TVR B;  3C8Y A;  4ZVS B;  3DU5 A;  2DNK A;  5AJ3 F;  1IQZ A;  2YPZ A;  5B08 A;  4DR5 J;  2W2M P;  4Y00 A;  2ZZN A;  1RSC A;  2RF2 B;  3CUL A;  2J7U A;  2KL8 A;  3PJX A;  3ERE D;  1U0S A;  4G1Q A;  4JV5 F;  3SV4 A;  5ETO A;  3MPY A;  5EWF A;  3ZTS A;  1XMQ J;  1URR A;  4F2R A;  1B7Y B;  1U7L A;  3HFV A;  1HMV B;  1RAF B;  1GEH A;  1NHK L;  2FGO A;  4B3R F;  4UW2 A;  1FD2 A;  3HHL C;  3V2U C;  1NK5 A;  4BDP A;  4NA2 A;  4UTG A;  1NH7 A;  4G0W A;  2R2S A;  2CKW A;  1R43 A;  4C4W A;  1Q8L A;  3EMT A;  1C0T B;  3OR2 A;  5ETR A;  4A8O A;  1O0P A;  1V5V A;  4YB5 A;  2LDY A;  4ZLL A;  3KLF A;  3GJQ B;  2VFV A;  3UO0 A;  2GMH A;  4Y2M A;  1U6F A;  1C1B A;  3Q2T C;  1N8R T;  3LO3 A;  1OO0 B;  4FXV A;  4DFJ A;  4B3M J;  2GCF A;  1F93 A;  4M5N A;  4L3K A;  1SUQ B;  3JAM U;  2EFP A;  5KFM A;  3HOV K;  4JI0 F;  1XNQ J;  4KPY A;  2VH7 A;  5F8I A;  2XSJ A;  1VC0 A;  5IP9 K;  1CUL B;  3HJF A;  4DV5 J;  4UQT A;  1SKW A;  3BGR B;  5KOX A;  4K0K J;  4C48 A;  4A4J A;  3EYZ A;  1AW0 A;  4YY3 F;  4G6V B;  5J2M A;  4LBH A;  4DFM A;  5CAB A;  5E2Q A;  2DGW A;  2PFD A;  4Q2L A;  1S76 D;  1LW0 A;  1XMB A;  3SSR A;  3DRS A;  1O27 A;  1JLC B;  2FZG B;  2ASL A;  4CCH A;  1GXU A;  1RTD B;  2CQ4 A;  2XNR A;  3LAM A;  1EKS A;  1NB7 A;  2R3V A;  1WI8 A;  4DQI A;  4HH0 A;  1EAY C;  1MML A;  1S1U B;  2ASJ A;  1X5O A;  1NDP A;  1JLQ B;  2ZBQ A;  4LRE A;  2JOQ A;  3K58 A;  1M90 T;  1VQ7 S;  3OFF A;  4M1K A;  2BAN A;  2BYC A;  1TK8 A;  2NS1 B;  4BY1 C;  1RA7 A;  2KM8 B;  3BN4 A;  3K5P A;  5L1K A;  2IRU A;  3MUR P;  4JI2 J;  1VCT A;  4JYA F;  1HWL A;  1W2B R;  1HBN A;  5AT1 B;  4RBT A;  2XY7 A;  3ZTO A;  3ETO A;  3VQS A;  2JA5 K;  5ADZ A;  6FDR A;  2FJW A;  5T7L B;  1WWH A;  3ZZ0 A;  1T05 A;  1X7V A;  2LXF A;  4DV6 J;  3TVZ A;  2YVS A;  4X6A K;  4Q8F A;  1J6W A;  5GAE U;  2DO0 A;  4TKT A;  3MPD A;  1YDL A;  1HW9 A;  5C24 A;  4LF9 J;  3CAG A;  2YQ1 A;  4Q5V A;  2EFV A;  1FI4 A;  2BW7 A;  2DNP A;  1JB0 C;  2J0Q D;  2NVX A;  2E2I C;  1BMQ B;  5C42 A;  4FXD A;  4FF2 A;  1LWF A;  3FK4 A;  1SV5 A;  4NZ7 A;  2LXI A;  2NSB A;  2GVZ A;  1RWN B;  2NR0 A;  2K1R A;  1S1V A;  4EUV A;  1Y3K A;  1BE4 A;  2L3M A;  3PHT A;  3PR5 B;  4DPT A;  1A9N B;  1MLA A;  3GTP A;  3I4M C;  2JC0 A;  2I1R A;  3V5R A;  2IJN A;  5HK4 A;  3MM6 B;  4Y2A A;  2D3U A;  3IRX B;  4UUW A;  5G4D A;  2QIF A;  1IR1 A;  4PXC A;  4CH7 A;  1H0H B;  2HQ3 A;  3IM9 A;  5I3U A;  2CWX A;  3GDZ A;  5DLG A;  3KMQ A;  3PRD A;  9RUB A;  4KMH A;  1ZVU A;  1TK0 A;  1Q95 G;  1FK9 A;  2HPU A;  3S17 K;  1TWA C;  4QPT A;  1ARO P;  3ILI A;  4TU8 A;  2RKI B;  2LA6 A;  2PA8 L;  1MSW D;  4TLR A;  3AT1 B;  4K5S A;  3N0V A;  2UXC F;  3C14 B;  4RBU A;  5HAN A;  3W1Y C;  4ZVE A;  2B8P A;  3ZZO A;  1WTF A;  1RLC L;  5CYM A;  4P7T A;  3T19 A;  4OMF G;  3E01 B;  3LH2 S;  5LOQ A;  1FRH A;  4I6W A;  2MQN A;  3NCP A;  5BXI A;  4KGV B;  4FF1 A;  1O28 A;  5MLC V;  4ZIW A;  2GIR A;  2AW0 A;  3HHN B;  2CQ2 A;  3NAI A;  1WHY A;  3HHE A;  1WQH A;  3AD9 C;  4F4W A;  3FKI A;  1ZZF A;  2Z56 B;  2DBB A;  2IYI A;  4DZD A;  4DLG A;  3RZO K;  3M05 A;  4TLQ A;  2EPI A;  1H73 A;  1R8C A;  2KVI A;  3IPJ A;  4O44 B;  2M4M A;  2WRM A;  2Z8Q A;  2M9K A;  2LVW A;  2UU9 F;  4I2P B;  4H4O A;  2OEK A;  1QTN B;  1RXO B;  4QIW L;  1H2T Z;  2WAQ L;  2AP6 A;  4OYM A;  4HT7 A;  4KB7 A;  2XHW A;  3MEC A;  3HOZ C;  1VRU A;  1A7G E;  5D6G A;  4C2M C;  1Y1V C;  3ENV A;  3M6V A;  5J1E A;  1RAB B;  5KG3 A;  3CJS A;  4UOG A;  4G0V A;  1JMT A;  1YK9 A;  4GTE A;  4YOE A;  3O6Q A;  1RWP B;  4EWT A;  1VDH A;  1DQA A;  3DCA A;  4C3H C;  3P6Y C;  4G65 A;  3K59 A;  2MZJ A;  1KFD A;  4LF7 J;  5LJ5 Y;  1PAE X;  4Y28 C;  3UN5 A;  2ZOM A;  5DO2 A;  5IS2 A;  3RRH A;  3M2V A;  3G4A A;  1I5O B;  4P7V A;  2PD1 A;  1JWW A;  2QYG A;  1JLE B;  1H98 A;  2NYH A;  5M5X K;  3CD0 A;  3W7B A;  1T8E A;  4AND A;  1V3S A;  4XPC A;  4XDD A;  1HI9 A;  1BUX A;  1TUW A;  4GTL A;  3TZY A;  1S1X B;  3NEK A;  3W2V B;  3MM9 A;  2BJ7 A;  1WC5 A;  3M6W A;  3KHL A;  1I50 K;  2Y3P A;  2KXN B;  5TMC A;  1UW9 A;  5KFO A;  1H7W A;  1OY8 A;  5DS7 A;  3IWL A;  1ZA2 B;  1U1Q A;  4JI1 F;  2V0N A;  4ZPC A;  1CVJ A;  4A3E K;  2G13 A;  5HVG A;  3NGD A;  2QFI A;  4OZJ A;  2D9O A;  3RTV A;  2UUA F;  5FDL A;  4JI5 J;  3HKZ L;  1RU2 A;  3DRR B;  4F50 A;  1HBO A;  1N32 F;  4RNF A;  2X51 A;  3MFI A;  3N01 A;  3CTR A;  1R3N A;  3JTP A;  2JNJ A;  4FYY B;  1OQ6 A;  1K1S A;  2YNI A;  3QGP A;  3GTL A;  4CLW A;  2H54 B;  2ZVI A;  2Y0S L;  4DV2 F;  1GTE A;  3LGM A;  4QWD A;  3BUE A;  1VBX A;  3QT7 A;  4W90 B;  4OZ0 A;  4ZPT R;  5I42 B;  4LF4 J;  4UF4 A;  2VPY B;  4CH0 S;  3FEZ A;  4RW9 B;  1UA0 A;  1HBU A;  2DGS A;  5IYB C;  5A76 A;  3MUV P;  2WB4 A;  5KFD A;  7FDR A;  1OPI A;  4C8L A;  3GWC A;  2I8E A;  2BOP A;  4LF8 F;  2AJ0 A;  2KKH A;  3NL0 A;  1R9T C;  5LXY A;  3M2R B;  4HI1 A;  4LFA J;  3FDS A;  2KWA A;  1GMU A;  4ZVH A;  4OYB A;  4CH1 A;  4TY9 A;  1MMN A;  2FY8 A;  4NXN J;  3MEK A;  1Q78 A;  4NOI A;  3SCL E;  4CDI A;  1JLG A;  4ZP9 A;  3HOZ K;  4F0K A;  5EWE A;  2X1G A;  1ZS6 A;  5A8R A;  4B3T F;  2ALZ A;  3FCH A;  4M5M A;  2DH8 A;  5IOT A;  1QJH A;  1X4D A;  3CJ4 A;  4URQ U;  1KSP A;  2CQ1 A;  2FY1 A;  2O5J A;  3OD2 A;  4RUB A;  4OX9 J;  4DL4 A;  2KYX A;  2QT7 A;  1IBL F;  1TKZ A;  2IJR A;  3H25 A;  2OPQ A;  3MPW A;  3PDN A;  2A6H A;  4CYU A;  3M32 A;  4USW A;  4TN2 A;  1Y1W K;  3RBD A;  4GKK J;  2KM8 C;  2EBB A;  4IUF A;  1D9A A;  5CJ9 A;  5DRK A;  3IBW A;  3KFW X;  3I5C A;  2F8H A;  3IP0 A;  2V4Q A;  3R1H A;  3CSK A;  1N4L A;  3UPF A;  3TFJ A;  2LCW A;  3M3Y K;  2JA7 A;  3FBF A;  2R8G A;  1QSY A;  3U1L A;  4DSK A;  4WYL A;  2DY1 A;  4ZCI A;  2RH3 A;  4RNO A;  4WFN Q;  5GAH U;  4GZY A;  2WW8 A;  3GEE A;  4R25 A;  1GT8 A;  4DX8 H;  3R8Y A;  2ZUF A;  3MM8 B;  3H0P A;  1ULR A;  4USK A;  2QMW A;  4QIW D;  1WHW A;  3VCD A;  1I6V A;  2R92 A;  4LFC J;  2MQQ A;  3UW1 A;  1KNZ A;  1RTJ B;  4N8O A;  4NA1 A;  3GLJ A;  2CPD A;  4U8V A;  2QLF B;  2GW8 A;  4JV2 A;  4IO9 Q;  4ENO A;  3QO9 B;  3OTO J;  3D7S B;  2V2K A;  3K5M A;  1RKI A;  2BE5 A;  4F67 A;  1FNM A;  3CGI A;  4TQS A;  2W2O P;  2KI2 A;  4FP9 A;  4GTB A;  4CWB A;  1UAW A;  3QSY B;  1TTH B;  2HHX A;  4WP9 A;  4A3G K;  2ZH3 A;  2VHG A;  5GAD U;  3DYA A;  1VQL S;  1B4B A;  2LP4 A;  1YWX A;  1U1P A;  2FJV A;  4HTI A;  4N5S A;  2HUR A;  3KTQ A;  2G2Y A;  3AXK A;  1Y00 A;  1L3S A;  3WQP A;  1DTT B;  4KGZ B;  4XAK A;  2P8I A;  3D0H E;  3HVA A;  3KHH A;  4DQQ A;  4P5A A;  1UZD A;  3DMJ A;  1XR7 A;  1REV A;  3M4O C;  4AFF A;  1L3U A;  2OEJ A;  2MLX A;  1RWU A;  2DHG A;  4I2Q B;  5SZT A;  1B64 A;  1R6Y A;  2XWY A;  4QR1 A;  4E98 A;  3LGN A;  3PO2 C;  3BP3 A;  3MM7 B;  2W2P P;  4ZVU B;  2RDJ A;  3BBC A;  3SMZ A;  1SL2 A;  3DN9 A;  4PQA A;  4HT5 A;  5B0C A;  4UUX A;  1S7I A;  2OFH X;  3A3P B;  2YNF B;  5DG9 A;  2DH9 A;  1T9X A;  5IOL A;  2LEA A;  1SFO A;  4X66 F;  4NYP A;  2EWH A;  3FQK A;  5K8P A;  3HT3 A;  3MXH P;  1S1W A;  3QZ7 A;  2Q79 A;  1NSQ A;  4FS2 A;  3CPW R;  4IG3 A;  4FBT A;  2QLB B;  4QJV A;  3EZO A;  2DR7 A;  2C3P A;  5E3Q A;  3TZX A;  5DDP C;  3R5D A;  4DMZ A;  1KLM B;  4MMO A;  3PRB A;  2H9Z A;  4BC9 A;  2WBR A;  3T41 A;  2XLI A;  3A8J A;  3M8R A;  3C6U A;  3NWG A;  3X1L B;  3TAP A;  2AJF E;  3PW5 A;  2UXB J;  4C8Z A;  1Y5N B;  2B6A B;  1XER A;  2P6T A;  3LAP A;  3RZA A;  4E8U A;  3GSD A;  3T1A A;  1U0H A;  1VOM A;  3UNY A;  4DV0 J;  1NH8 A;  4ELV A;  1NJI T;  5EGE A;  3CJT A;  2F3J A;  4GVB B;  2NVY K;  1TMM A;  3IS9 B;  3LP2 B;  2HS4 A;  4Y0F A;  2O1P A;  4DV4 J;  2AX1 A;  3B6B A;  2OTL S;  3IGN A;  1HNI B;  4WFA Q;  4PPD A;  1RHU B;  2NPI A;  2XZW A;  3PV8 A;  5B0D A;  3MUT P;  1CJU A;  3RR7 A;  4J91 A;  2K2P A;  3GYN A;  5JVH Q;  3S1N K;  3TEH B;  4LQY A;  4AL6 A;  5C7P A;  1F7U A;  4NLV A;  1NSP A;  2QRR A;  3KLG A;  1IUJ A;  1QE1 A;  4OJ3 A;  1CJT A;  3PR4 A;  4JOU A;  2R8I A;  2CFA B;  1LXJ A;  3U1N A;  1YJW S;  3PTW A;  3I87 A;  2UVV A;  3QJP A;  3EPI A;  4PWU A;  3PW0 A;  2XMV A;  2XLK A;  1FFG B;  3QGH A;  4Z7C A;  1OJ4 A;  2V9K A;  3H5S A;  4RNM A;  4LJM A;  2YKQ A;  2KG1 A;  1BGX T;  3IG1 A;  4WFZ A;  1GXL A;  3F41 A;  5AE3 A;  2QL5 B;  4QIG A;  2VBW A;  1D8Z A;  4A3L K;  4ZJQ A;  1LFW A;  1UWB B;  2J0S D;  2RJZ A;  1QAI A;  2QMX A;  2ZM6 J;  3H42 A;  3AQO A;  2MKJ A;  4BBS C;  1XNR J;  5C25 A;  4NWB A;  4ES3 A;  1IBK J;  3W5X A;  3GTG K;  1KLN A;  3HOX C;  1JLB A;  5BYS A;  3HPO A;  3S1R K;  1JX4 A;  4C3I C;  3D6F B;  1K9M T;  2AX0 A;  3M8Q B;  3DGP B;  1N54 B;  4BBY A;  4ZPB A;  2UVU A;  3M2U A;  1JJ2 R;  4WP3 A;  4DCO B;  3H0G K;  3GYX B;  3KLE A;  2ZJP Q;  3TAN A;  1DFD A;  3M1V A;  3CMQ A;  1WKJ A;  4JI6 F;  2IBK A;  3MMC B;  1BLU A;  1SJQ A;  1SC6 A;  5M5W K;  4I4B A;  1TWH K;  2KXH A;  3UR3 C;  5GAG I;  1VGX A;  1LW2 B;  4QR2 A;  3EX7 B;  1WC0 A;  3MAA B;  3T9N A;  2DGQ A;  3CME S;  3UD3 P;  4B02 A;  1J6V A;  2JSX A;  3WX4 A;  3GTK K;  1KKH A;  1F9E B;  2VG7 B;  3K5O A;  2D3O R;  2VFS A;  2VOO A;  2DNM A;  2PMZ D;  2ZUE A;  3R5C A;  2HYI B;  1TL1 A;  2DCL A;  2XCP A;  3VAF A;  1FKO B;  3TUP A;  2ZWO A;  4ECW A;  4QWA A;  4GTD A;  2AJ2 A;  1U25 A;  4ECR A;  4LQ9 A;  4YS2 A;  5LMU F;  2RHS B;  1RB0 A;  2FHJ A;  1HQU B;  3FZ2 A;  4R5P B;  1VK8 A;  2RRN A;  1NLK L;  1S6Q A;  1FJE B;  4IQM A;  2ABY A;  1QY7 A;  3TW0 A;  4QBU A;  4LRD A;  4HHJ A;  2YU9 K;  2M8D B;  4C3J C;  4ETX A;  3NGU A;  3KK2 A;  1D0E A;  2AYB A;  4C6A A;  2Z2L A;  3S1T A;  2QLX A;  4LVN P;  5KG4 A;  1HYS B;  1LXN A;  4NCB A;  1CPZ A;  4NLD A;  2W2N P;  4USM A;  2YNG A;  1HNW J;  2EVZ A;  3UDL A;  4IRK A;  2BW2 A;  4M1X A;  4O4R A;  4C0B A;  3ENA A;  3UWT A;  1FNX H;  5J2Q B;  4E2F B;  2R4F A;  4NX9 A;  3BGF A;  5D8H B;  2A68 A;  4CP5 A;  2GIQ A;  3KK3 A;  3N3Y A;  1N5T A;  5JMN A;  2VOP A;  1ZPV A;  4Q44 A;  3I4N K;  1O6X A;  1MN9 A;  1VIO A;  2ILY A;  2HHT A;  3W5Z A;  1IKX A;  4OX8 A;  5KFG A;  1QUP A;  4MYT A;  4NXM F;  1IM4 A;  2XY5 A;  1KQ4 A;  2CJX B;  2D9P A;  2KTQ A;  3TA0 A;  4RR5 A;  2IYG A;  4QWE A;  3E8O A;  1T9V A;  1KVK A;  4KAI A;  2QTW A;  5HO4 A;  1N56 A;  3UE2 A;  1RWM B;  2DR6 A;  5KFZ A;  5KOW A;  3AY0 A;  1M5K C;  2XTJ P;  4X4S A;  2EG2 A;  1S9G B;  1P8G A;  5FII A;  2B0G A;  5IYC C;  4X4R A;  4A3M C;  3HX9 A;  2Q1L A;  4LRF A;  3LW5 C;  4U9R A;  4ITS A;  4NLP A;  2NZC A;  5RUB A;  3BN7 A;  2EKN A;  2C22 A;  2XS5 A;  4C8K A;  3JSM B;  2OAU A;  1L3T A;  1N5S A;  1FXD A;  4DQP A;  1FXL A;  4PG8 A;  5HP1 A;  3ICL A;  1UV7 A;  1UFK A;  2B4O A;  1S6U A;  4PG7 A;  3MM5 A;  2CAJ A;  1F9F A;  1SQF A;  5CHP A;  2RU3 A;  3EXY A;  4O0N A;  2PPB A;  3GEI A;  1I1G A;  1TR0 A;  2MLZ A;  1AUS L;  4KM9 A;  1F1B B;  1VRT A;  2ZWP A;  3FKI C;  1VJW A;  1NDC A;  4TYB A;  2IRX A;  3GTO K;  3AOA A;  4CT9 A;  2KG0 A;  1U1L A;  2HND A;  1IS1 A;  1DY3 A;  1TL3 A;  4AXJ A;  4ZA1 A;  2HQF A;  2W7V A;  1MWZ A;  2E2H C;  5HQM A;  2VA2 A;  4DBQ A;  4U7C A;  4NMX A;  1BQM A;  4I7F A;  3MR3 A;  5C44 K;  3AJD A;  4EK2 A;  2R2R A;  2DT9 A;  4J90 A;  2GV1 A;  1X4C A;  2ZBC A;  4P2X A;  2HFS A;  2CQ3 A;  4K4W A;  3UI3 A;  1SQE A;  3N28 A;  2WW4 A;  4MK7 A;  1SKU B;  2MKK A;  3ITH B;  2CDQ A;  4ICL A;  5F8G A;  3QIP A;  2AQ4 A;  2DNL A;  4X65 J;  1HFE L;  2Q66 A;  2C2O B;  4X64 F;  4MKY A;  5A8W B;  1XPP A;  2HHS A;  2RS2 A;  5H1S V;  3K0J A;  5M5Y K;  3DLK A;  2J6U A;  5KT7 A;  4J9L A;  3J7Z 5;  2AIR B;  5K14 B;  4K4S A;  2VFU A;  5DG8 A;  3P3D A;  1DBD A;  5LJ3 Y;  3I5B A;  2Z58 B;  1FRM A;  3VF0 B;  1HBM B;  5FLX Y;  4K4X A;  4CLP A;  2YWF A;  4RW4 A;  1T94 A;  4BHQ A;  1L3K A;  1KBR A;  1Y5L B;  2DTJ A;  2HWT A;  3GSI A;  3N5B A;  5DJB A;  3W60 A;  4F3O A;  3R1L A;  1XZQ A;  4C8Y A;  1FEH A;  3D4J A;  3PO3 K;  3L09 A;  3TUI C;  4ZCK A;  5DDR C;  2E1A A;  2QSW A;  4KFB B;  1JLF A;  3M30 A;  4DPO A;  3SCK E;  4WP8 A;  3FEY B;  2CWK A;  2DXE A;  1TWC A;  1BS2 A;  2E1P A;  3ZXW A;  1PG5 B;  2BKN A;  4C7Q A;  4DL7 A;  2E5L F;  3GIM A;  2L9W A;  4BWM A;  4JI8 F;  4DR6 F;  2ROG A;  1FXR A;  3MZI A;  2PGC A;  3PFO A;  4DUZ F;  2XS7 A;  1CJV B;  1IBM F;  4DUY F;  3SDE A;  4H4M A;  2VON A;  3NMR A;  3HSZ A;  3IBC B;  3VWS A;  1VQN S;  2VJV A;  1EZZ B;  2R7Z A;  1Q1K A;  3GTM K;  2CPY A;  2QMU B;  2Z2Y B;  1RGV A;  3TQ1 A;  3DI6 B;  2ERR A;  2CZV C;  4A3I K;  2Q43 A;  2OPR A;  2J0X A;  3B4M A;  4GC6 A;  3TO8 A;  4IH6 A;  2MQM A;  3J80 Y;  1R89 A;  1LWX A;  2XC9 A;  1VRQ C;  1S0N A;  2HHW A;  4ZIT A;  1SKR A;  3LP1 B;  2NRE A;  4KAW X;  4OQJ A;  2IDE A;  3C3L A;  3DOM B;  4IG0 A;  1NKE A;  5EX0 A;  3AB4 B;  1UTA A;  3FSY A;  4DX5 A;  4AQY J;  5D4D A;  2CRL A;  3HUL A;  1IL2 A;  4YR3 A;  4G1Q B;  2POK A;  5JJB A;  3HOY K;  1O29 A;  3A3N B;  3DHX A;  2F4F A;  3K5N A;  3DFE A;  1HQE B;  3NGS A;  3GV7 B;  4B9L A;  2Z2M A;  4QYZ J;  1TP7 A;  2MSS A;  1NSK L;  3S1M C;  4KO0 B;  3I82 A;  1KVI A;  4WIQ A;  1SKS A;  2IHR 1;  2WON B;  1WNE A;  3Q8S B;  4ED8 A;  3V81 B;  3OR1 A;  2R92 C;  3CB4 A;  4YFU A;  2COL A;  1TEL A;  2D74 B;  4X62 J;  3OL9 A;  3AA8 A;  3MML B;  1N52 B;  5IOS A;  3GE9 A;  2A0F B;  1BDF A;  5CD4 A;  3ILJ A;  3P8B B;  4O3N A;  2DHX A;  1RHQ B;  3R3T A;  2GGP A;  4XK8 C;  1C1B B;  1ITP A;  3HOW C;  3OLA A;  3AJ1 A;  2FJX A;  3W64 A;  3W3S A;  3G8Q A;  3IXQ A;  1IKV A;  5LT5 A;  2XSJ B;  5L39 A;  3AQP A;  3K7A K;  3OTC A;  3G96 A;  3I0S A;  1F60 B;  3H40 A;  1A0O B;  4CT8 A;  2VFT A;  1QAY A;  3UQS A;  2HMI A;  1TL7 B;  2OPS B;  5AE1 A;  5HRO A;  4KAS A;  1C0U B;  2AU0 A;  3FBB A;  4L74 A;  4KB4 A;  2UUW A;  2E29 A;  1LW0 B;  4YFX A;  2AJ1 A;  3GTJ K;  3DRS B;  3G4C A;  2XM3 A;  1EH1 A;  1LWC B;  3JYT A;  1RBL A;  2AGO A;  4LF6 F;  4OIX A;  1HI8 A;  2XO7 A;  2ZH1 A;  5A0Y A;  5EHH A;  3S6E A;  5KG1 A;  3KHG A;  1R6V A;  4OYP A;  2P9C A;  3R27 A;  5IC6 B;  2VL1 A;  1PC5 A;  5BYQ A;  3MEE B;  4HAC B;  3GP9 A;  4YR2 A;  2QLJ B;  3ILL A;  1VC6 A;  3BKT A;  2JX2 A;  4ZVG A;  5HBM A;  3IFE A;  2R2U A;  3GV5 B;  1ZM9 A;  2B7B B;  4B9S A;  3UNG C;  5EDW A;  4DSF A;  4A46 A;  2W9B A;  5K9F A;  1KQG B;  2DO4 A;  3MMB A;  1N6Q A;  1JLA B;  4OIP A;  2BQ3 A;  4RZR A;  1UJ6 A;  3CCW A;  4OLP A;  4KAT A;  1MMD A;  1ZAW A;  2CYY A;  4HHU A;  3GYG A;  1EJ7 L;  5IYD K;  2H65 B;  2YH0 A;  3LA0 A;  3S7R A;  4NA3 A;  3WX8 A;  5IM0 A;  2OSQ A;  1WOS A;  3DLG B;  3I4H X;  4IFY A;  1APS A;  4ZCM A;  1TWG K;  3NGK A;  4F25 A;  3S1M K;  1IBC B;  4D3G A;  3TRG A;  1N5Y A;  1SPB P;  4DI6 A;  4KSE B;  3EQL A;  2FQO A;  3RB0 A;  3IBF B;  1XBW A;  1NJY A;  4KM8 A;  3MMA A;  3G2X A;  4DDQ A;  2WK4 A;  4URG A;  1O2B A;  4L76 A;  3JTN A;  2XSF A;  4P74 A;  2FLP A;  4ATN A;  1IKY B;  1VQ6 S;  3DLL Q;  3CCL S;  4ER8 A;  5C2G A;  2K1R B;  1KVJ A;  1KR4 A;  3TA2 A;  1WEY A;  2LQJ A;  3HOW K;  3HXM A;  2B51 A;  2KO1 A;  1I3Q K;  1S7H A;  4DL2 A;  3H59 A;  4IRC A;  3PKM A;  1CQM A;  2V4J A;  1Q4R A;  1C2P A;  2AGP A;  1XTZ A;  3W9H A;  4CLF A;  1ZM2 A;  1S99 A;  3SYZ A;  4KTQ A;  3OFE A;  4DL3 A;  4YN3 B;  1IR2 A;  3FMB A;  3TP2 A;  3KK1 B;  5DGA A;  2OD4 A;  3HFK A;  1WF1 A;  1X4H A;  4MAK A;  1K83 K;  1HPZ B;  4LVO P;  1YJU A;  1RT2 A;  5IT0 A;  3HO1 A;  1FT8 A;  3TAM B;  3CCV S;  3ZNJ 1;  3Q89 A;  4WE1 B;  2IC3 B;  1WAC A;  4ZN1 A;  1PYO B;  5KFK A;  5CYM B;  5C5J A;  5HMY A;  2F40 A;  1N36 F;  3TNV A;  1HR0 J;  1U6B A;  4MKB A;  1QVF R;  2DR5 A;  4FF4 A;  3T02 A;  2W01 A;  2H1Y A;  5LMN J;  4WXW A;  3ETM A;  1RT4 A;  3GJT B;  3ZZY A;  1IWG A;  1PKU A;  4WBF A;  3BEG B;  5CAA A;  1XR6 A;  5CHC B;  3A13 A;  4NZ0 A;  4J7C A;  3NLC A;  4PXB A;  5A6P A;  4OZL A;  3PNI A;  4ZHR A;  4CIO A;  4X4Q A;  1T11 A;  1WC4 A;  2Z4P A;  3IWX A;  3QAU A;  4M5L A;  2MHN A;  4LBI A;  4ZN3 A;  4DXL A;  1XMO J;  2BOA A;  1U1M A;  4FPR A;  4F8R A;  4K4Z A;  2PMW A;  3OW2 R;  3FNN A;  3J81 Y;  3ZO7 A;  1B0T A;  3GR1 A;  2E2I A;  2CDR B;  3MEC B;  2C1E B;  3AHP A;  2AHO B;  5J1E B;  1KEK A;  1BQN B;  4A8X A;  1SJR A;  2QN6 B;  2JJ4 D;  1CLF A;  3IWN C;  2B7C B;  2ZUG A;  2LLZ A;  2CJA A;  2G4B A;  5C3E K;  2ZZM A;  4KT0 C;  3GZ7 A;  3B82 A;  1NPR A;  8ATC B;  2BUN A;  1JJH A;  3PIP Q;  2ZOG A;  1B99 A;  1YIT S;  4PG6 A;  3M2V B;  2LDI A;  3ZC4 A;  3FJ2 A;  2F7V A;  5KFE A;  4KY3 A;  2CPJ A;  2ZJQ Q;  4DJB A;  5B09 A;  2ZUA A;  2HWH A;  2KYZ A;  4OYX A;  2E5I A;  1GX6 A;  3W65 A;  4DPY A;  4CQ1 A;  1E6Y A;  5GMD A;  3GEH A;  3HZG A;  2R7X A;  3HZE A;  1LOU A;  4QYZ K;  3TFH A;  5FJ8 K;  1TWA A;  1RBA A;  1CC8 A;  4MH8 A;  1SC3 B;  2UV8 A;  2MKI A;  1S1T B;  2YKA A;  2ZVS A;  5FLX U;  4OYZ A;  3QLH B;  3QBC A;  1X5T A;  1SL1 A;  3N0C A;  1R8B A;  5FDL B;  1O24 A;  3BO3 A;  3VV2 B;  3H7H B;  2HHP A;  3OL7 A;  3BR9 A;  4K50 A;  3AD8 C;  5J2P B;  3UDV A;  1F2G A;  1CG2 A;  3LPY A;  4DL5 A;  5DGB A;  2KZM A;  1WIH A;  1TKX B;  1WD6 A;  1KN6 A;  4MK8 A;  2GML A;  2XI3 A;  3KJF B;  4BBR K;  1G4C A;  4Y2K A;  2F63 A;  1FES A;  1KHW A;  2UUB F;  2MXY A;  3S16 C;  4DG1 B;  3BPD A;  3CJ8 A;  2W4P A;  4LIR A;  2QSF A;  2DVI A;  4A3B K;  1CJK B;  1VIX A;  5J1P A;  1U1K A;  4NLR A;  2UV8 G;  1SBR A;  4FDF A;  3R7N B;  3L4K A;  2IRY A;  1DHM A;  3BH7 B;  4QIF A;  3JAM Y;  5A8R B;  1VI7 A;  5ETS A;  3J81 j;  4C2M A;  1S57 A;  1Y1V A;  2E2J C;  2C2M B;  3SV3 A;  3QYY A;  5HN0 A;  3ZZT A;  1VQP S;  1A6L A;  2LXU A;  4DPW A;  5D0E A;  2E7X A;  3THP A;  2A1B A;  4KBI A;  3F44 A;  2W9C B;  3J7Y I;  3R5B A;  1C4C A;  1GE9 A;  4ILL A;  4I6A A;  4GTC A;  4CYU B;  4LBP A;  5KG0 A;  2ZH2 A;  2RF2 A;  1Y1W A;  3I0R B;  4DR1 F;  1RU1 A;  2V34 A;  2YQ3 A;  4JI3 F;  3KLI B;  4PG5 A;  3J80 U;  3GMG A;  3K8V A;  3RGI A;  5LM7 E;  4ZVO B;  4UT4 A;  2DIU A;  1HWJ A;  4ZP8 A;  3QJJ A;  2NVQ K;  2ZKU A;  4LRB A;  3H5X A;  2FHK A;  4ERD A;  1NB2 A;  4WWS A;  2MGZ A;  2BKO A;  4V19 J;  1X0F A;  2WOM B;  4A8F A;  1RT7 A;  3OL8 A;  2HSE B;  2ZH6 A;  3GTQ K;  3VHQ A;  2L08 A;  2RIJ A;  3UD5 A;  3V6K A;  4OIR A;  1QAX A;  3HVT B;  2AJQ A;  1NU4 A;  3C6T B;  2WBM A;  1NXI A;  4A8S A;  1RWV B;  3R2C J;  2E1C A;  4J9N A;  2VV5 A;  2ATL A;  3EIC A;  5A6W A;  3M6U A;  2F65 A;  1YBA A;  2R7T A;  3S14 K;  2VUM K;  4WZQ A;  2I38 A;  4DCP B;  1XEZ A;  3NBP B;  2L9N A;  3RUB L;  4HDH A;  3TA1 A;  3KG4 A;  1S12 A;  3G6Y A;  3OTB A;  3A8E A;  3VAJ A;  1SUQ A;  1KTV A;  3KHR A;  2DH7 A;  1UP1 A;  3CQZ K;  2XCR B;  3G86 A;  3OL6 A;  1OSC A;  1Q82 T;  2ZH4 A;  3BGU A;  4F4K A;  2MKC A;  4OYI A;  1CUL A;  5AE2 A;  1R9T A;  4DR4 J;  1N33 J;  5B0A A;  2VQE J;  3P96 A;  1K73 T;  1UEK A;  3BSC A;  3RYL A;  2R93 C;  4EI2 A;  3E51 A;  2WZ1 A;  1LV5 A;  3S1Q K;  3CCT A;  3DDK A;  1RHR B;  1MU2 A;  2XMU A;  1WC6 A;  4DDF A;  1Y10 A;  1JLC A;  1OMS A;  4HI2 A;  3Q3Q A;  4N7T A;  1XN9 A;  3BZQ A;  1FE0 A;  4PYD A;  2J5A A;  1RTD A;  4PWD A;  1SCJ B;  1REV B;  4IKA A;  3M8S A;  4BLG A;  4AD6 A;  3D1H A;  1JLQ A;  1LEO A;  2DNN A;  3IO1 A;  4KC5 A;  4IDK B;  2IA6 A;  2Y1I A;  3I9Z A;  4KQZ A;  4O0I A;  3SZ2 A;  4F3M A;  1VMB A;  3R7B B;  3D0I E;  4B3O A;  1H74 A;  2NXJ A;  1RHK B;  2KB2 A;  4USV A;  2I6W A;  1GXT A;  4A93 C;  1F9H A;  1TKT A;  4DL6 A;  4IG3 B;  3I6P A;  2NYI A;  3TEG A;  3QRR A;  1ZAV A;  4TU7 A;  2NVX K;  1MWQ A;  3RZD K;  1ZBS A;  2HHH J;  1WCM C;  4P73 A;  1XJW B;  5KFT A;  2JLE A;  3H3V D;  3KKF A;  3VA7 A;  3C6U B;  2JA8 C;  1CC7 A;  4IRD A;  4KMU A;  4RX6 A;  1S9E B;  5DQI A;  4M63 A;  1PO6 A;  1YQH A;  4B17 A;  2CNK B;  3RW6 A;  3O3L A;  3GTP K;  1UEU A;  1EQR A;  5F41 A;  3JS9 A;  1G3O A;  1RE1 B;  5GMK a;  1BWE A;  3M9N B;  3MM6 A;  3IRX A;  3CCE S;  1EIY B;  4OI2 A;  3V6J A;  2XG8 A;  2NVY A;  2XEX A;  1I3O B;  1U2R A;  2ADB A;  3MED A;  3M7V A;  3TVY A;  2BE2 A;  2FZC B;  3R5J B;  2DNR A;  5KFQ A;  4E0D A;  4KHP J;  1BC6 A;  4DR3 F;  1TWF K;  3C14 A;  3AJ2 A;  3B4D A;  3CJ5 A;  1RI7 A;  3UN2 A;  4B3S F;  2MY7 A;  5GAE I;  1X4F A;  1HNV A;  2AGQ A;  3BV8 A;  4KKO B;  4YDD B;  2P5V A;  1S72 S;  1JXV A;  3WZ0 A;  2CPH A;  2WSE C;  3KLG B;  2RSQ A;  4C3M A;  1M5H A;  1WG5 A;  3FZB A;  3I4P A;  4DV1 J;  3BYR A;  4A8Y A;  4XSX A;  2H5E A;  2P6S A;  2ZFH A;  4O23 A;  1R0A B;  4MTP A;  4OHZ A;  3OJU A;  4ZVT B;  1LK7 A;  3TUZ C;  1NDL A;  3BQ2 A;  1FJG J;  2YWE A;  4O44 A;  2HFU A;  4KYZ A;  2Q3P A;  4H4K C;  3H2U B;  2ZNZ A;  5D77 A;  5J2N A;  3OPF A;  2G0J A;  1KWM A;  5ETN A;  1WKK A;  3IGV A;  1P6T A;  3VZI A;  4DV7 J;  1RBO B;  2CG4 A;  3D3C J;  2BJ1 A;  4BY7 K;  4IR9 A;  1SC1 B;  4PQU B;  2JWN A;  2K3I A;  2LU2 A;  2FLN A;  5CCM A;  1IR0 A;  3HSG A;  3GTG A;  5ETV A;  4HHH A;  4K4Y A;  1FWP A;  3EVM A;  3NOC A;  2D3Z A;  3CDE A;  3HHK A;  1J5E J;  4NRT A;  2RH6 A;  2MKY A;  3M2U B;  1QM9 A;  2RVJ A;  4CZC A;  3IR6 B;  4WTO B;  2IY5 B;  4GKJ F;  3MHY A;  1AB4 A;  1FO1 A;  3RBZ A;  1EHW A;  3HOV C;  2YWW A;  1JLE A;  1B4A A;  4LSN A;  1RZM A;  4GFQ A;  1ZQ1 C;  1X9W A;  2NVT K;  3G6X A;  5IP9 C;  1S1X A;  1G7C B;  2A3J A;  3EJM A;  2KDO A;  1WEZ A;  3W8P A;  3R6G B;  1TWH A;  3W9I A;  3HOU K;  3BF4 A;  2C3U A;  4FYV B;  2GFF A;  2O5D A;  1RAO A;  3FFI B;  2BZ2 A;  3MOJ B;  2D41 A;  1M5O C;  1LNQ A;  2Z0G A;  4JUZ A;  1I6H K;  2XZD B;  4ZPV R;  3PJW A;  5LXR A;  4LR9 A;  2R8J A;  2FLL A;  3BSN A;  4YME A;  1U02 A;  1P1T A;  1UL3 A;  2VBX A;  1SVD A;  5ITH A;  4Z7Y A;  3PYD A;  1N88 A;  2ZC4 A;  4NLQ A;  3GTL K;  1X9M A;  1GAO A;  2RHQ B;  3GIK A;  4LSL B;  3EDR B;  2EW9 A;  2IVM A;  3CCJ S;  1VBK A;  4IOA Q;  1RAD B;  2KH9 A;  1P9Y A;  2CQ0 A;  5KFS A;  2ZD1 A;  1H38 A;  2RML A;  5F9N A;  1C1C B;  4A3F K;  3DNC A;  3WDO A;  4CM0 A;  2R7S A;  3D67 A;  2QA2 A;  2JA5 C;  3HKW A;  2EI5 A;  1O26 A;  4X6A C;  1DCP A;  4UY8 5;  4NLS A;  2HVH A;  4KN4 A;  4FM9 A;  2IAJ B;  2GQ2 A;  4KV8 B;  2YNG B;  3VAI A;  4KRW A;  3EXC X;  1YZ7 A;  3BGL A;  4ZPW R;  2E44 A;  4I1T A;  1SJ3 P;  2C2D A;  1X31 C;  3EZU A;  3S0X A;  2LKZ A;  1G2E A;  4J9R A;  5B0E A;  2MPU A;  1P9Q C;  4Y7N K;  2HW3 A;  4OZN A;  1M1G A;  4CO2 A;  1J6X A;  1WSR A;  3THT A;  1PSD A;  1DQ8 A;  2VG5 B;  2O66 A;  4AUK A;  1WI6 A;  2A2D A;  4HEA 9;  3BQ1 A;  2CJ9 A;  1O25 A;  4LF5 F;  3DOL B;  3VTI A;  1ZTW A;  2JA7 K;  3T9Z A;  1HNZ F;  1IXK A;  2JEI A;  3HXA A;  2DPJ A;  2Y9H A;  2BRK A;  3V4I A;  1YSJ A;  3S17 C;  1FFW B;  2QG9 B;  1Y0H A;  4YUD A;  4BXX K;  3OEP A;  4DR2 F;  3I5A A;  4LF2 A;  4WYW A;  4WII A;  5GME A;  3AOD A;  1WG1 A;  3S15 K;  2AEM A;  1DCH A;  3OXL A;  4YHH F;  2VQF J;  1YRT A;  4EYH B;  1SI9 A;  2X1A A;  1RT3 B;  1RU0 A;  3MM5 B;  1GNK A;  2FJD B;  1Q8K A;  4KGK A;  3GON A;  2BV3 A;  2M5Y A;  3VQT A;  3BBF A;  3QO9 A;  1VS3 A;  3CF5 Q;  1PIL A;  3PY8 A;  5EUH A;  2KHD A;  4CLT A;  1FVQ A;  3ORE A;  2DK2 A;  4HH1 A;  3RZO C;  3N6N A;  1IN0 A;  2HND B;  3GCW P;  3PEJ A;  5BJR A;  1M5V C;  3ZZU A;  5C4X K;  4LQ3 A;  3QZ8 A;  2DNO A;  4I67 A;  4KGM A;  4GVL A;  2R7V A;  3NY0 A;  3KJV B;  1Q7L B;  2HIQ A;  4CO0 A;  4JI4 F;  1TV6 B;  2IMO A;  2WSC C;  2R2T A;  2V69 A;  3CO9 A;  4F4Y A;  4KIA A;  4EFA C;  4A3C K;  4K4T A;  3NGT A;  2FZK B;  1ZA1 B;  5GAH I;  4ZS6 A;  4O4G B;  3P5B P;  4RMF A;  4TQR A;  2NUH A;  2HIY A;  3F56 A;  4FKY A;  3J7A 1;  3FCV A;  1M5S A;  1F2H A;  4IYQ A;  4I2Q A;  5CZX A;  2PN6 A;  2V9W A;  2G1H A;  4NYZ A;  2W4D A;  4KDD A;  2OML A;  2J9D E;  1VQ5 S;  1BGW A;  1YJ7 A;  1N34 J;  3L4J A;  3PX6 A;  4C45 A;  1KQF B;  2BBE A;  1BXN A;  1I50 C;  2YNF A;  2XI2 A;  2XZT B;  5KFF A;  1SFO K;  2JH3 A;  3SFG A;  4Q8E A;  1YX2 A;  2G0I A;  3V4M A;  4X4N A;  2GQQ A;  1NZA A;  4DHV A;  1YCL A;  4A3E C;  2CPZ A;  2OHD A;  7AT1 B;  3HLU A;  2DIV A;  3LPX A;  4WU2 A;  1O5J A;  4J9U E;  5GAD I;  4YG2 A;  4Q0B A;  3BDE A;  2HBR B;  2E9T A;  3D6M B;  4ZIV A;  1MN7 A;  1S6P B;  3FRY A;  2P5M A;  2MJU A;  2B9X A;  4CO5 A;  2GVD B;  4OI3 A;  4A8W A;  1U2C A;  2X1F A;  3VAL A;  5L8R C;  1IVZ A;  1Y11 A;  1JLF B;  5AXL A;  4AYB D;  3FQL A;  5E7O B;  4J9K A;  4M5J A;  4PEO A;  4NLX A;  1UVN A;  5IWA F;  4LR7 A;  4NCG B;  2WB1 D;  2MZS A;  4JI7 J;  1U09 A;  4WFB Q;  3D2W A;  5IQQ A;  3GIR A;  3IS9 A;  1NK9 A;  1WSV A;  3PG9 A;  2FJA B;  4RW8 B;  3LP2 A;  3W61 A;  2MB0 B;  1UVI A;  2E2H A;  3A1Y G;  5HMZ A;  1K0T A;  1FKP A;  4DV3 J;  5HJY A;  1JJC B;  1O8B A;  4ZVR B;  1YBT A;  3KDN A;  1LQ9 A;  3T1Y J;  3ZZZ A;  2FHM A;  4M95 A;  4LFB J;  4H4M B;  2MZQ A;  1NK4 A;  4DR5 F;  5HAO A;  3ET6 A;  5KFC A;  1USO A;  5I4M A;  1S49 A;  3GTM A;  3S2H K;  4HDG A;  1CQN A;  1WHX A;  2G2O A;  4A3D K;  2XMM A;  1PYS B;  2CFA A;  4MFB B;  3ELH A;  1RDR A;  2I0X A;  2OSR A;  4QU6 A;  4GO5 X;  1P27 B;  1Y1W C;  3C15 B;  1TFY A;  2FUG 9;  1GTH A;  2F8E X;  4KN7 A;  4U96 A;  3B78 A;  4F4Z A;  1XQI A;  4IG0 B;  1UW4 A;  5L1J A;  1VLY A;  2FLO A;  1WKL A;  3SBM A;  3J7A N;  3M3Y C;  2ZH5 A;  2UUC J;  4X2B A;  1GK8 A;  1M0S A;  1R7I A;  4WTY A;  1UMJ A;  4OHW A;  1UWB A;  3CC7 S;  2JRS A;  2KRR A;  5BR8 J;  1I94 J;  4YFK A;  3N6L A;  4RJV A;  2KRB A;  4B3M F;  2F9J A;  2E7W A;  2C2E A;  3K2Y A;  3OV7 A;  4M5G A;  4EZ9 A;  5F8M A;  2VOD A;  2ZNY A;  3GG1 A;  4NL5 A;  5GVQ A;  3UVJ A;  1XNQ F;  2UXD J;  1B0V A;  1T0T V;  4F0M A;  5F3Z A;  3R2D J;  4KJI A;  4DV5 F;  4U8Y A;  4K0K F;  3QRP A;  2VA3 A;  3I31 A;  2ZHO A;  2F4V J;  4IR1 A;  2UVR A;  3KNG A;  1NND A;  4ECU A;  4DU7 A;  4C8N A;  4C0H A;  5M3M K;  5J1N A;  3KWM A;  3DM2 B;  1S0O A;  1VYA A;  4RNH A;  2FC9 A;  3DRY A;  2YX7 A;  2GJF A;  4L75 A;  1H3D A;  4A3G C;  4AXI A;  1RTH B;  1E6V A;  4ECS A;  3HCX A;  3M8Y A;  2ZBR A;  2XMJ A;  2C3O A;  1KC8 T;  1LW2 A;  2D69 A;  2RQ4 A;  3TR5 A;  1W7W A;  3MAA A;  2HMI B;  2LQ5 A;  1QUV A;  2IJF A;  1RHJ B;  3DLE B;  5HRO B;  1RWK B;  2XGQ A;  2ZZT A;  1OYD A;  2MQ8 A;  3TOQ A;  4A48 A;  2VG7 A;  3JB9 k;  4JI2 F;  5H9E J;  2YKP A;  4OHX A;  3F73 A;  4USI A;  4GTA A;  2J8A A;  3JYT B;  1FKO A;  2SXL A;  4AE5 A;  2JVO A;  1QSL A;  1EP4 A;  5E0O A;  4DV6 F;  1HA1 A;  4ES2 A;  3UCG A;  3LAJ A;  1HQU A;  4R5P A;  2ROE A;  3IC1 A;  4X4U A;  3GCX P;  1EK8 A;  1FEE A;  4MEX A;  4DX6 A;  2N3O A;  4OIO A;  1BHN A;  3HP6 A;  2X1B A;  4U95 A;  3T1H J;  4FYW B;  1TK5 A;  3L7O A;  3CCU S;  4DR7 J;  2YQ0 A;  1X8D A;  2W9B B;  3QGG A;  5EGH A;  2FQT A;  4IQX A;  4PR6 A;  4KMA A;  3BH6 B;  5F8N A;  1HYS A;  1F3V A;  2R9L A;  1Y9O A;  2V4R A;  5IM0 B;  1EB0 A;  4Q4Z A;  5G0R B;  2W2Q P;  5AJ3 J;  3GIL A;  4IFY B;  2KFY A;  4OX6 A;  2J6T A;  4X4T A;  1Q5V A;  2JEJ A;  1RKJ A;  2HRT A;  3HHL B;  4ID5 B;  4WXO A;  4JV5 J;  4OIN A;  3NRB A;  2ZDO A;  1S5Z A;  2IIH A;  2V8P A;  5KG7 A;  1Q81 T;  1D1U A;  3DLB A;  2FHO B;  2YKM A;  3P45 B;  3K89 A;  4KH1 B;  4B3R J;  2ASY A;  2FYX A;  2DCU B;  1YNN A;  2FD2 A;  1UKU A;  3MUM P;  2DXD A;  3NNA A;  4RUC A;  1VQ9 S;  3GFX A;  2NVY C;  4FZB A;  2BM0 A;  1YZ6 A;  2GZO A;  1VH2 A;  2R7U A;  2B4V A;  3H20 A;  3SI8 A;  1YJT A;  1JQG A;  3AOC A;  4YP3 A;  1JOE A;  2VKR A;  3CVK A;  4P72 A;  2GNK A;  4EBD A;  3QRQ A;  3S1N C;  4JI0 J;  3VGT A;  3OFH A;  4Y52 K;  2PDA A;  2H4W B;  1WEL A;  1VHF A;  3TJ9 A;  1EX8 A;  5DET A;  4YY3 J;  3LP0 A;  4CNZ A;  4FPI A;  1XZP B;  3VVU A;  1Y3J A;  5KFR A;  1UEV A;  2PC6 A;  2B5J A;  1RT4 B;  1NPK A;  3V6D A;  3PM9 A;  4PAA A;  4FS1 A;  2H3E B;  1VQS A;  4NLY A;  2EK1 A;  2ZIT A;  4G1I A;  4EO8 A;  3DGV A;  2XQC A;  4A3L C;  4ZHR B;  5F8L A;  5LSL A;  2PMZ L;  4B9T A;  4LF7 F;  3A12 A;  4C98 A;  2NQP A;  3GTG C;  3MWB A;  2CQI A;  3S1R C;  3LWM A;  2CPX A;  4JYA J;  4A3K K;  5E3C A;  1WEX A;  5KT4 A;  2XYG B;  1IKW B;  2U1A A;  3JSB A;  3T6B A;  2XY6 A;  2OI2 A;  1AB8 A;  5DDQ C;  2CNN B;  3D0G E;  1X9S A;  2FVR A;  1TFW A;  5IFM A;  2XB2 D;  3H0G C;  5BYR A;  2XYH B;  3D28 A;  4A3J K;  2F1F A;  3U1M A;  2MMY A;  1SMY A;  3KJN B;  5JFE A;  1OY9 A;  2XMT A;  2HLU A;  3G8S A;  1TL5 A;  3JQK A;  2HRY A;  2MHE A;  3HVW A;  5K14 A;  1M5P C;  4JI5 F;  1TWH C;  1S77 D;  3EGV A;  1RLD A;  3DOK B;  4HKQ A;  2P2C B;  1HBM A;  2D1C A;  3NCQ A;  4CLS A;  2B8Q A;  1KOH A;  4QIE A;  2XMK A;  1SJ4 P;  2ZH7 A;  1E6Y B;  3JSY A;  3GTK C;  5JVG Q;  4Q7A A;  3EUN A;  1ISE A;  3S2D K;  2BM1 A;  2GHV C;  4LF4 F;  1YIJ S;  2J8S A;  3QMQ A;  1GH8 A;  2DNZ A;  1DAX A;  5IXU A;  1AXQ A;  2YXL A;  5IOQ A;  3J7Y U;  1N5Q A;  4OI1 A;  4U7U D;  3WBZ A;  2XGP A;  4BWJ A;  4LFA F;  4CLY A;  1VJE A;  1TWC K;  4QWB A;  2AF6 A;  5ETK A;  2AJ4 A;  4NXN F;  4JK1 A;  2IDL A;  5KG2 A;  4JV0 A;  1WUU A;  2UXC J;  1X60 A;  2YU9 C;  2CW0 A;  2W7A A;  1RUS A;  2DKO B;  3SEO A;  1MW7 A;  3WOD A;  2HNZ A;  1X4E A;  4K8R A;  3ONQ A;  5L1L A;  4LK1 A;  3RU0 A;  1H6K X;  1X4A A;  4AL7 A;  2EEY A;  1J5O A;  3CED A;  2WSF C;  4B9V A;  3JXO A;  5KG5 A;  1DLO A;  1F6T A;  2C2Z B;  1RWX B;  1VC5 A;  3IAM 9;  2V2Z A;  4OX9 F;  3GIJ A;  1CJV A;  2ZH9 A;  2WHO A;  3BJY A;  2R7Z K;  4UQG A;  3S01 A;  4GKK F;  3MD3 A;  3FOF A;  3H90 A;  5I3P A;  4HLB A;  2MZ1 A;  3V4G A;  1B7F A;  3VAM A;  1JKH A;  2GS8 A;  3I4N C;  3L9Z A;  2PSZ A;  5L46 A;  5H9E K;  1YG0 A;  3UDC A;  1Q8B A;  4B9N A;  3MGJ A;  3ZZP A;  2E5J A;  3CD5 A;  4OJG A;  1H2U X;  1LWE B;  2UU9 J;  5D4P A;  3QWU A;  4MEY A;  1N0U A;  2PII A;  1D3W A;  1FRI A;  4K59 A;  3SFU A;  1FX4 A;  3HVR A;  3K5L A;  1X4B A;  3LP1 A;  2DEI A;  2LFV A;  2BE9 B;  3DOM A;  1SIW B;  4CO4 A;  1XXB A;  5IP7 K;  3SQG B;  2H5I B;  2KHC A;  1KQK A;  2F9D A;  2JEG A;  1YLX A;  3DDI A;  3CNQ P;  3E3X A;  5B0B A;  4LFC F;  2DXF A;  4EZ6 A;  5THW A;  2V8D A;  2DJW A;  3H4D A;  1B0P A;  1HQE A;  3DXB A;  4XTT A;  3OTO F;  5KFL A;  4WKY A;  4OZ3 A;  6AT1 B;  1HI1 A;  2O5I A;  2MGZ B;  4NOH A;  4KO0 A;  2CFX A;  2VB6 A;  1RT7 B;  3ISZ A;  2KU7 A;  2WON A;  2QL7 B;  3V81 A;  1W25 A;  2GMJ A;  4R8U B;  3GTQ A;  1BQX A;  4OL8 A;  2J9D A;  4F4A A;  5H9F J;  2XYP B;  2HBQ B;  1FVS A;  1WJ9 A;  1T9T A;  4M5H A;  1TL4 A;  3TX8 A;  3BSO A;  2IA0 A;  4DQR A;  3AB2 B;  3HD1 A;  3MPU B;  2IMW P;  4J3N A;  5JUM A;  4JI1 J;  3GTO C;  2CUY A;  2VUM A;  3C19 A;  4G7Z A;  4F7V A;  2RUG A;  3Q83 A;  2UUA J;  4IFV A;  3EPG A;  1N32 J;  4J9V A;  1DAR A;  2LQ8 A;  1G51 A;  3CQZ A;  2ROP A;  3W2W B;  4GRS A;  3AXM A;  2EBG A;  4R0E A;  4YDX A;  4DV2 J;  5C44 C;  4XDC A;  2AEF A;  1TL7 A;  2OPS A;  4ED1 A;  1C0U A;  4NML A;  3WHI A;  2KJW A;  1YVF A;  2DHS A;  2L41 A;  5KFH A;  5C4J K;  4WJB A;  4FKX A;  3HM9 A;  1XWL A;  5E41 A;  2AV5 A;  1MU2 B;  3UFC X;  2HS3 A;  3U7J A;  2OPP B;  4C11 A;  1RT1 B;  4QOT A;  4WFX A;  1LWC A;  4LF8 J;  2I2Y A;  4PUO B;  1ACM B;  2IM2 A;  3NOG A;  4QZV B;  5IV3 A;  3ZTQ A;  2OTJ S;  3OVB A;  4PWD B;  3GR0 A;  3NCR A;  1BWV A;  2Y3Y A;  4KMD A;  2K7K A;  4F02 A;  3MEE A;  4A8M P;  1TU0 B;  4HAC A;  4CLK A;  1Q86 T;  2B56 A;  3PFE A;  2Y0B B;  1KP6 A;  1XC9 A;  4EU0 A;  3K8W A;  4DPX A;  4B3T J;  1ELO A;  3DHW C;  2MEW A;  3QT8 A;  1S10 A;  1FTC A;  2DGX A;  4BKW A;  1JLA A;  1AZS B;  2ZE2 B;  3FKB A;  4B3O B;  2BVZ A;  3KNA A;  4CO1 A;  2UXB F;  1KRP A;  3MEG B;  2H51 B;  1WDT A;  1IBL J;  1GMW D;  3DLG A;  2QJ3 A;  4RO0 A;  3CIZ A;  3ENW A;  1FF2 A;  1TKT B;  3Q86 A;  2K7J A;  4B08 A;  4DV0 F;  1K44 A;  3WIV A;  2OP5 A;  1FJ7 A;  3ZFV A;  1MNE A;  1VIS A;  3HF5 A;  4CRJ A;  3PO3 C;  2AYE A;  2W25 A;  3L7U A;  3D1Q A;  1R8H A;  4G3I A;  1Y4Z B;  2A10 A;  3QWP A;  1VQM S;  4ZPA A;  4J5O A;  4USH A;  1XK8 A;  3EM1 A;  1FNO A;  1IKY A;  3CJK B;  1PJ5 A;  1RT6 B;  4DV4 F;  1KFS A;  2MDA A;  2BX6 A;  4NI2 A;  1FJC A;  3CJR A;  1RT5 A;  2EC0 A;  2RRA A;  1WF0 A;  2DNH A;  1Q53 A;  3RAQ A;  4RU9 A;  3CDU A;  5CYQ B;  4F36 A;  1T3O A;  3MR6 A;  1ZET A;  2B63 C;  3FC9 A;  5HLF B;  2RQM A;  1U45 A;  1Q7Y T;  2ZOF A;  2E9Z A;  1RAG B;  3QT6 A;  4FNI A;  3DRP B;  5DZ6 A;  2Q6B A;  3ZZR A;  2OGU A;  2F8M A;  3EE3 A;  3R97 A;  3R5A A;  3CJ2 A;  3MED B;  2UZA A;  3KK1 A;  4NEZ A;  3HD2 A;  1GFW B;  2R93 A;  4KR0 B;  4DEZ A;  2BE2 B;  2MTL A;  3CXC R;  2OMO A;  1HPZ A;  3EVW A;  2FGC A;  5F8H A;  2YKN A;  3GTM C;  3QX3 A;  1HHS A;  2JLG A;  4Y2I A;  3A8K A;  4UOC A;  4FYD A;  2VC1 A;  3TAM A;  4A3I C;  4I6Y A;  2UP1 A;  1TWF A;  2YNH A;  4WE1 A;  3RB4 A;  2IC3 A;  3OLB A;  1JK9 B;  1FWL A;  2HAF A;  1HNV B;  5U47 A;  3A8I A;  3TZZ A;  1T03 A;  3EGN A;  1BD6 A;  5F0W A;  3ZNU A;  2HWI A;  1HQM A;  4XCH A;  2QX0 A;  3R5G A;  2ADC A;  2ZM6 F;  2HEK A;  3CJ0 A;  4R0J A;  4HVZ A;  4MT1 A;  1NSA A;  4FVM A;  2BJE A;  1XNR F;  3N0B A;  5HMW A;  1IBK F;  4F3Q A;  4QPX A;  3ULH A;  4BY1 K;  3F0N A;  4M8L A;  6FD1 A;  2LEC A;  4Y34 A;  4NZ6 A;  1FRJ A;  2F5G A;  4DN0 A;  2FC8 A;  2CPI A;  3MD1 A;  1X0P A;  1TMJ A;  3I32 A;  3HOY C;  2W8K A;  3GG0 A;  3C16 B;  3SZY A;  3Q8R B;  3NMA A;  5B7W A;  3LUY A;  2XUL A;  4FNH A;  4WK1 A;  4RW7 B;  4J9P A;  5J2N B;  1NBE B;  3N79 A;  2CJQ A;  4ZLJ A;  3US5 A;  2AYG A;  2GJ2 A;  2Z30 B;  4ZVF A;  1Z1Z A;  3VZH A;  4LMZ A;  4EO6 A;  2VG6 B;  1PYT A;  2E2I K;  4TY8 A;  2E1R A;  1HL6 A;  1AUD A;  1HWK A;  5L1I A;  1WCM A;  2HVZ A;  1U1N A;  1T9W A;  4FXW A;  4NAS A;  2RE1 A;  4X66 J;  2NUU G;  1BQN A;  1Y7P A;  4U7U K;  5LSO A;  3OHB A;  4YEA A;  1TAU A;  7FD1 A;  4CTA B;  2MY8 A;  2Y8W A;  4OZ5 A;  5CXT A;  3UCZ P;  1ZH5 A;  2J9C A;  1NJZ A;  1V6H A;  1WOR A;  4ZVP B;  5TJ3 A;  2B63 K;  3I4M K;  1RCO B;  1K1Q A;  4N8N A;  1NME B;  2FB0 A;  2KFZ A;  4LSN B;  4DS5 A;  2V67 A;  3EGW B;  1RYR A;  1Q79 A;  4DPU A;  3K7A C;  2C3M A;  4O2D A;  3KJQ B;  3OPK A;  3MI7 X;  2Z2Z A;  3H2V E;  1OSD A;  3NG8 A;  4MK9 A;  4IH5 A;  4P52 A;  1TWA K;  1DTQ A;  5CZV A;  1PCA A;  2RDI A;  2N4D A;  3CDB A;  3POT A;  3RBX A;  1TQL A;  4ES1 A;  3GTJ C;  1AA1 B;  4ZDN A;  3E2E A;  1S1T A;  3QLH A;  3LAN A;  3BP8 C;  4BLB A;  2CQC A;  5H9F K;  3Q8V A;  4HYK A;  4I56 A;  2DR8 A;  4F26 A;  3MCS A;  4FF3 A;  1RK8 A;  3G9C A;  1HNW F;  4P75 A;  5J2P A;  4IOC Q;  3V6H A;  5ETM A;  4K2J A;  5CD4 H;  2J76 E;  1RTI A;  2VKZ G;  1V3Z A;  2GSN A;  1TKX A;  4PXE A;  2C2K B;  4KHR A;  3NKY A;  3R7S B;  1R8A A;  5KFB A;  2ZD1 B;  4X4V A;  1RTZ A;  3MAQ A;  2NSC A;  3Q8P B;  1Y5I B;  5HJX A;  5IYD C;  1JIH A;  3TJ8 A;  2J6S A;  1WHV A;  1N48 A;  4DG1 A;  4M5D A;  1AT1 B;  4H4K A;  1TWG C;  4ANE A;  4RKU C;  3AAW B;  2WCX A;  1MWY A;  4ED3 A;  3K57 A;  5KG6 A;  2QV6 A;  1CJK A;  5D4L A;  2QLW A;  2HS0 A;  3D6H B;  2JZ5 A;  2OKQ A;  3OR2 B;  4N77 A;  2Y8Y A;  4C2M K;  3LF0 A;  2OIH A;  1Y1V K;  2EK6 A;  1R0C B;  3D3B J;  2FTR A;  5EGY A;  1UVK A;  2ILZ A;  3RG6 A;  2EKY A;  4EBE A;  2MZT A;  2A6M A;  3KLF B;  2PA8 D;  5KFA A;  5IT4 A;  2W7P A;  3EZ5 A;  4C3H K;  3GJS B;  1CS4 A;  4GTF A;  2ZHB A;  3PVX A;  2W9C A;  3PIO Q;  2MJN A;  2R42 A;  2YWK A;  3SIP B;  3KXD A;  2WVD A;  1I3Q C;  2BJ3 A;  2JL9 A;  1FHT A;  3DLJ A;  2C2R A;  3I0R A;  1Z2Z A;  4DZ6 A;  2QYC A;  4MIB A;  1RQ0 A;  3KLI A;  4URS A;  3OVS A;  1SH2 A;  2QL9 B;  5J2M B;  3V4I B;  4MIW A;  1K83 C;  3UCU P;  3HSJ A;  4WU3 A;  1I6J A;  2WOM A;  5DM6 Q;  3ZTR A;  5KT6 A;  2DY9 A;  4DLE A;  4JI6 J;  4K4U A;  1P1L A;  4HL9 A;  2FPH X;  4DOZ A;  2H5J B;  3HVT A;  3MTJ A;  4WKR A;  4OJ1 A;  3C6T A;  4NPO A;  4OYO A;  3Q8U A;  1C4A A;  1H7X A;  2M70 A;  2WAQ D;  3VGV A;  4I69 A;  4NLU A;  3BGO P;  5IV4 A;  1BJT A;  2XBP A;  1NPP A;  2JFK A;  4PCQ A;  3OTD A;  2BQR A;  2R8H A;  4HTJ A;  2BAN B;  1SC4 B;  3QT5 A;  3NBP A;  3IR5 B;  1DCO A;  1CBK A;  1NUE A;  1HBN B;  3B8H A;  1JXE A;  4LIW A;  4IOB A;  5IYB K;  2JA5 A;  4JP8 A;  5CQG A;  4O3S A;  1T05 B;  2LEP A;  2VUG A;  5LMU J;  3OT9 A;  2HGN A;  1R9T K;  4OV1 A;  5LL6 d;  2OO4 A;  3VAK A;  4X65 F;  4P9S A;  3RW7 A;  4PKD B;  2CPE A;  4LJZ A;  5C24 B;  1HHQ A;  3GFZ A;  4UST A;  2PT0 A;  5D4O A;  2FJB B;  2MLY A;  4GO7 X;  1PJ6 A;  2QA4 G;  4AT1 B;  2RNE A;  5C42 B;  1LWF B;  4ELT A;  1SV5 B;  1IJE B;  1NK6 A;  3TQE A;  2GVZ B;  4NLT A;  3N9U C;  2CQB A;  1YHQ S;  2WVF A;  3G87 A;  1S1V B;  5AXN A;  1RAJ A;  1J27 A;  5C3E C;  2ZJR Q;  2HGL A;  2N3L A;  3HKZ D;  5IT9 Y;  4ECT A;  4FN5 A;  3RJM B;  1ZOT A;  2DIS A;  4C97 A;  4IDK A;  4ZK7 M;  3GB0 A;  2YBV A;  3R9L A;  4I0W A;  2GSO A;  3IN5 A;  4Y2C A;  2NPF A;  2Y0S D;  3D6T B;  1WF2 A;  1F5C A;  3MF5 A;  3KG1 A;  1RWW B;  5I3U B;  1NZ8 A;  2AEJ A;  3T5J A;  1JNZ B;  1NK8 A;  4NXM J;  1FK9 B;  2GQC A;  1FD8 A;  3OQ2 A;  4IH7 A;  1R0B G;  1DD5 A;  3D9B A;  1ZPW X;  2Q6C A;  3G71 S;  2JA6 C;  2BXJ A;  1FFS B;  3G82 A;  3CUN A;  2KT2 A;  4RWW A;  2HBY B;  4LT6 A;  4ZH4 A;  4Q0B B;  2GO8 A; 
#chains in the Genus database with same CATH homology
 3A8K A;  1XZP B;  1PJ6 A;  3GEI A;  3ADA C;  1WOS A;  3TFI A;  3AD8 C;  1V5V A;  1WOO A;  3AD7 C;  4P9S A;  1XZQ B;  1PJ5 A;  3GIR A;  5L46 A;  3A8I A;  1X31 C;  3A8J A;  4PAA A;  1WOP A;  1WSR A;  1WSV A;  1PJ7 A;  1XZP A;  4PAB A;  1VRQ C;  1YX2 A;  3GEH A;  2GAG C;  1VLO A;  3GEE A;  3AD9 C;  3GSI A;  3TFH A;  3TFJ A;  1WOR A;  3TTG A;  1XZQ A;  2GAH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...