3AD8C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with pyrrole 2-carboxylate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad8C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad8C01
1VLOA 1XZPB 1V5VA 1WORA 3A8IA 1XZQB 3ADAC 3GEIA 1XZQA 4P9SA 3TFHA 4PABA 1VRQC 3GSIA 3AD8C 1WSVA 3AD7C 4PAAA 2GAHC 3AD9C 1WOOA 3A8KA 1XZPA 1PJ7A 1PJ6A 1WOPA 3TFJA 1X31C 2GAGC 5L46A 1WOSA 1YX2A 3A8JA 3GEHA 1WSRA 3TFIA 3GIRA 3GEEA 1PJ5A 3TTGA
chains in the Genus database with same CATH superfamily
4K59A 1JMTA 2XLKA 3Q23A 2DR7A 2YX4A 2R92K 2JA8K 1FE0A 3FGVA 5DDPC 3M9MB 2RUGA 1U2RA 4J9QA 2YKOA 5J1EB 1ZXOA 4OHVA 3AFGA 4MH8A 1BQNA 5GMKa 3KLEA 1I50A 3IS9B 1NLKL 2UV8G 1X9WA 5AE2A 3T1HJ 3EYZA 2IA0A 2RB7A 1OWXA 5CQGA 1RTJB 3QZ8A 3BO4A 3GFZA 5CYMA 4PEOA 4J90A 1PILA 4KYZA 5GVQA 2UU9J 3LWMA 1IBKF 3PEJA 4YG2A 4F2RA 4CLTA 3CDWA 5J2QA 1BWEA 4DR6F 4BY1K 3AOCA 3BGOP 3MGJA 5HMXA 4LOWA 5LJ3Y 2YTCA 3H5SA 2DNGA 2K7JA 5LMNJ 5KG6A 3PX6A 3R5CA 3PYDA 2V6TA 4NLSA 3V4IB 1U0HB 3MM5A 2L08A 3GTMA 1UA0A 5F8LA 2XMAA 4DFMA 2HS4A 5H9EJ 2VQFF 3JB9k 3H2UB 4QW8A 4EUVA 3M1VB 4ANDA 5AXMA 3MPYA 2HVDA 3UVJA 3QT6A 5CYQB 2MQLA 4DJBA 2O3DA 5CH7B 3FFIA 4F3MA 1RBOB 1I6VA 2M52A 1RBLA 2JC1A 1S7IA 4O0NA 1O6XA 2UUBJ 4USWA 2V4JA 4MEXA 3W9IA 3BO3A 5KFYA 3TR5A 4TU8A 4TQRA 2CQ4A 1FD2A 4QU6A 3S2DC 1KP6A 1PC4A 1VQ8S 4RJVA 2KT3A 3K7AK 1U09A 1S6OA 3CJSA 2M2BA 4F26A 2ZH7A 1RT5B 3H2VE 3WC0A 4ECQA 2R7SA 3OVBA 3PIOQ 1Z2ZA 1NB7A 3H25A 2NPIA 4P75A 4C3JC 2QEXS 1DCPA 2M4MA 2AGOA 4A3EK 4AT1B 1IBLF 3RBDA 1ZPVA 4G3IA 3D6HB 4OZLA 1RWNB 2XMTA 4XTTA 3RZOC 2HHHJ 2MTLA 3FBEA 4NX9A 3OTOF 1M1HA 2E66A 4Z37A 2WRMA 4J9PA 2YY3A 4LVNP 2N4CA 4NRTA 1TELA 2BV3A 4OHYA 5AJ3J 4UOGA 5KFFA 3OFFA 3I4MK 1CLFA 5CYJA 2YBVA 1MNEA 3LP1B 3AH5A 4NLVA 3CVKA 2CJAA 2DXDA 2NREA 1SJ4P 2CJYB 5LMUJ 4IOBA 1WF2A 5U47A 5J2NB 4P10A 1LQ9A 2HLTA 2FQTA 4B9VA 3GIIA 4O3SA 3KHGA 3PTWA 4DF8A 2NVQC 4A3LC 4QIEA 2R7QA 1R3NA 1NNDA 2O5JA 3OSNA 1T94A 3B8HA 3KXDA 3S0XA 4JV1A 4KTQA 3CD0A 2D6FC 4GTLA 2CJBA 3MCMA 1N33J 3ZNUA 2GQ2A 1TU0B 1YJTA 1HNVA 3FMBA 2ZVIA 4GTAA 3P3DA 3HKZD 2VQEF 5C42A 1LFPA 2VL1A 3PW5A 4C11A 1FRMA 3U1MA 2OEMA 2DGWA 1IKYB 2OELA 5K14B 3OSPA 1ELOA 3D3CJ 1ROFA 5I3QA 3OW2R 5LT5A 1IQTA 1KVJA 5E2QA 4IR9A 4IH5A 2AHOB 2EFPA 3R3TA 2DR9A 1S49A 4KGVB 4ZKAA 4I6AA 3B6BA 2XGPA 3DLGA 2BRKA 3TX8A 2BJEA 3W63A 5HROA 2A68A 1SKSA 3V5RA 2BE2A 2BOPA 4I6YA 1Y9OA 4A3DC 3AJDA 3DLGB 3J7AN 1AW0A 5GADI 2MY7A 1R0AB 5HAOA 4QQBA 1RYSA 1M5SA 2CPEA 2BXJA 1X5PA 2IAJB 3D67A 3VVTA 2IY5B 2R42A 1NEEA 1FKOA 2MGZB 1TL1B 3OL8A 5KG4A 3ICLA 4LMZA 3PM9A 1Y1VA 5D78A 1FDBA 3DRXA 2DNRA 1S6QA 3WQPA 4RUHA 1T9XA 1YSJA 1HQEB 1U45A 5IT9Y 4J7CA 3SZ2A 3ADAC 2W4DA 2KKHA 3M8QA 1AUSL 2OIHA 9RUBA 4RO0A 4LF5F 2GMHA 1S6QB 1R8PA 5EGEA 1T7PA 2B63K 3S2HC 2KYXA 4HH0A 3T1HF 3K89A 3ILJA 3US5A 3T1YF 3CULA 1MSWD 2E1PA 3IR7B 2H5JB 4UT4A 1IUJA 2J76E 1RT2A 4NI2B 4NXMJ 1ZYRA 1TVRB 4CI0B 2MZRA 3DGPA 2QL9B 2CIMA 5TMCA 1FK9A 3KLGB 3KK2B 1VHIA 1HPZB 4PZVA 4RNMA 3UDCA 4JI0J 1OJ4A 1G7CB 3ILLA 5CYMB 1NPRA 2BKPA 1EB0A 1J6VA 1L3KA 2XO7A 2ZHOA 2V0NA 2ZUAA 4BDPA 4ICLA 4KPCA 3CF5Q 3G82B 5HBMA 4JK1A 2MQMA 3MURP 4O23A 1ZBTA 5F8IA 2RS2A 2AZ1A 4ILRA 1WKKA 1JQGA 4P9SA 3TWZA 1EETB 4DN9A 1ZBSA 4XO0A 4C3HC 5IT0A 1WJ9A 3UN3A 3R5DA 4WJ3M 2JEGA 1NJWA 3ET6A 5D0RA 3LAPA 4LSLB 4ECTA 4MYTA 3ZO7A 4L73A 2HBRB 3I87A 2OLWA 1JNZB 2MKIA 5C4JK 2ATCB 2DHGA 4FDFA 5AE1A 2WSCC 2W2MP 3AD7C 3TFJA 2DRAA 3FFIB 4DV0J 3GDZA 3LGMA 1WTFA 3KG0A 2A6HA 1RTIA 1TL5A 2VA2A 1HBOB 2MEWA 2XNQA 2YKPA 2ILYA 7FDRA 4M5DB 3VGVA 5A0YA 4C0BA 2ZUFA 3UI3A 3N6LA 1WORA 2FB0A 1YVFA 1KOOA 5I42B 5L1JA 1DJ0A 3NP5A 2RRNA 2BQ3A 1MN7A 1PJ7A 1LV5A 3PG9A 4C9DA 1RU1A 3Q24A 1KWMA 4OZJA 2I8EA 1C0TB 1MU2A 2XYPB 4NMLA 2XMKA 2VUMC 3EX7B 1I50C 4ILMA 4PWDA 2XLIA 1JX4A 5ITHA 3MPDA 5C4XK 1Y10A 2DK2A 5AT1B 3EVOA 4NZ0A 2E2HA 1C4CA 2J7KA 4DS4A 4PG5A 2BKNA 4Z2XA 2VOPA 1HWLA 2KM8B 5H9FK 4R5PB 4C6AA 4OIRA 3CCSS 2QC3A 4GZYA 4LT6A 4FS2A 1K73T 2UZAA 1YJUA 2E1AA 3MXHP 1K1QA 4NLDA 3LP1A 5KFHA 1XERA 1YX2A 5BYQA 2CNNB 3HT3A 3OTEA 3KG4A 2XO6A 1N32J 3M30A 3NWRA 1RISA 1WEZA 1I3QK 4P2XA 2V4QA 1C1BB 3UNGC 3Q8VA 2E29A 1KTVA 3TFIA 3H8YA 1MMNA 1S10A 4CQ1A 2CVIA 4Y0FA 5FDLB 2G0IA 3MR6A 2AKWB 3IWXA 4DV3F 4ZCIA 1X4CA 3R1HA 3PKYA 3R1LA 1WDTA 3N0BA 2RHQB 2QIFA 3ZTQA 4OZ1A 4KC6A 4OL8A 4URSA 3NCRA 3QSIA 1ZM4A 4LRFA 1LEOA 4HTIA 3TQEA 3L7PA 2CQ3A 1O28A 4YDXA 2R8GA 4DWIA 5KFRA 3C3LA 3GIJA 2XULA 1FO1A 2OD6A 2AF6A 2PEHA 4DDFA 4QPXA 1U1QA 2BMBA 1SIZA 4WK1A 2PO4A 1DQ8A 3BKUA 5DM6Q 5JUMA 4OJ1A 4GC6A 2H1YA 2RD5C 2J9DA 3LPEA 3I5AA 1Y11A 4ZVGA 1I6HK 3SBMA 1FE4A 1PAEX 3JSTA 3EWGA 3M8RA 4DL2A 1YJNS 2EG2A 5KT7A 1RBAA 1VJWA 1SJQA 1P9QC 1CULB 4HDHA 3S1NC 1L3TA 2OSRA 3NKYA 2IVFB 1Y5IB 4K4ZA 2H4YB 4ANCA 1M5VC 1D9FA 2MGZA 3I56S 2ZVSA 1VQSA 3M05A 4N7TA 1YHQS 2B9WA 2HHTA 3MOZA 3CCLS 4O4RA 4IOCQ 3H2LA 1VRTB 4ZVEA 1MWYA 3QNWB 1DQ9A 2JDJA 1XR7A 2KZMA 3EUNA 4G7HA 3FBBA 1NJIT 2E1MC 2Y9HA 1S9EA 3R7BB 3GTOK 5DQIA 2A2CA 9ATCB 1SC3B 1JLEB 4RUCA 4P72A 4YHHF 4C2MA 1GX6A 1KKHA 1AA1B 2DY1A 2CUYA 1NXIA 1Y3KA 1ZTWA 2QN6B 2V34A 3BH6B 1TVRA 3QAEA 2NVYK 3O3LA 3MPUB 3JXOA 1REVB 5GAHI 1K9MT 4KO0A 2OUGA 2ZH1A 5K9FA 3V6DA 1Q7YT 4KMAA 2F8HA 2VG5A 2FYXA 1NDLA 3KFWX 2YNGB 3ZZYA 1YGYA 3S1QK 3TJAA 1N48A 1W7WA 1TWHC 3GTGA 2F8MA 4ZA1A 2HAFA 4ED4A 5GAEU 1UFWA 4Q7AA 1WG1A 2ALZA 1Z2LA 1RYRA 3W2VA 5BXIA 4BY1C 2AT1B 3GV8B 4GTDA 1VOMA 1U47A 4I6WA 3J81U 2EFNA 3VF0B 1I94J 1WC3A 4AYBL 3DOMA 4X62J 2FHMA 1EETA 1TFYA 4F02A 2BEFA 2E1RA 3N5BA 3D4JA 1Y5LB 2Y1RI 2D41A 5L38A 4X84A 4B9SA 3W9HA 4KV8B 4NA3A 5HVFA 4I64A 2X1FA 3AD9C 2I0XA 5EX3A 4CLSA 2CPJA 1YRXA 2VB6A 6AT1B 2LEAA 4JI8F 4ZK7M 3DOLA 2MQNA 1SJ3P 3K5PA 2HQIA 4OIXA 2C3PA 1G4CA 1ACMB 3TJ8A 2VFTA 1F1BB 1YBUA 4OHWA 4OIQA 2AU0A 4AFFA 5KFGA 4QJVB 1EH1A 2W2PP 2XSJB 4OFZA 4A3JK 2MHEA 3GSDA 2HMIB 2V68A 2WVFA 2K3KA 2CDQA 3TNVA 1C1CA 4WFNQ 1XQIA 2V67A 3FZ2A 2NSBA 1VC5A 2RDDA 2JH3A 4DX5A 2D1CA 2QL7B 5KFQA 5B7WA 1B4BA 2OPPB 2VC1A 1FDDA 1S59A 3TZXA 5FD1A 4JI6F 1X4FA 5T41A 3P5TL 1QUPA 2XCQA 1XNRJ 3H42A 4PWDB 2RE1A 1JIHA 1RT1A 3N6MA 4B3RJ 1ICEB 1GT8A 1M5PC 4USUA 2AX1A 1B7YB 3H5XA 4FM9A 4LLGA 2RDIA 3M8SA 4EEYA 2QZ8A 3JTPA 3X1LB 3AQPA 4A48A 1G1XA 2LYVA 2WSEC 1I94F 3PX4A 2EK6A 3HD2A 2W7OA 1RU2A 2W9CA 1WI6A 5DG9A 1VH2A 4NLPA 1NMEB 2JZ5A 3I96A 3WIUA 4A8YA 1I5OB 1RWXB 1I3QA 1CJUA 1S6UA 4W90B 4JI2J 4A8MP 5D15A 1F5BA 1K1SA 2MHNA 1U1RA 3ZFVA 2QA1A 3IN5A 2COLA 3IBCB 2CXEA 5CXTA 4Y52C 1X60A 1SCJB 1IR2A 4Y65A 1OY9A 1S1WA 2J6SA 4Y2IA 2F7VA 1J5OB 1KQGB 3W9JA 4RW8A 3CT9A 3D6FB 3OTBA 3TA1A 2FJXA 5C25B 4ZP8A 4U8YA 2KJWA 2C2EA 5B0DA 1NHUA 2E2IC 3D68A 2IYGA 3CQZC 2DB1A 4RR5A 2NVXK 1J27A 3ELHA 1PYOB 4Q2LA 4YR3A 1NJZA 3IGNA 2OI2A 2V8PA 3S15K 3N0CA 1UMJA 2IMWP 1Y0HA 3D28A 5CAAA 3HOVK 4OJGA 2E7VA 3GE9A 2V9WA 4MKYA 2RH3A 3FOFA 3OTDA 4YUDA 2PEBA 3EGWB 2BOAA 2DGQA 1HW8A 4IUFA 3KK2A 4F3QA 1HNWJ 1KONA 3OFGA 4QIWL 2GCFA 3A12A 1MG7A 4IR1A 2BW2A 3MMBB 2JVRA 3M6VA 1EP4A 4ECWA 2J0WA 2XYGB 5B0AA 4M5GA 1IW7A 3MCOA 1GXTA 2GFFA 4NLQA 5A8KA 1L3VA 2JJ4D 5HBMB 3MAQA 3A3OB 3GCXP 4YHHJ 4DN0A 2QO3A 3RBZA 1IM6A 3G4CA 2DY9A 2ZZTA 2RS8A 3JTOA 3K57A 3TQ1A 2ZE2A 1NK9A 3T1AA 3Q8YA 4DSJA 1VQ9S 1UETA 2LLZA 4A3IK 4BBYA 2IVYA 1TKXB 2R7WA 2R8JA 2ZJQQ 3SV3A 2M8DB 2HFVA 2VBWA 2VUGA 2P9GA 4LIWA 2KM8C 3V4IA 1BHNA 1X4HA 1JOEA 2MQOA 2R7OA 4DV5J 4LSNA 2YNFB 1XXCA 5IP7C 3ZTSA 3HVRA 4G7ZA 2BZ2A 1ZAVA 4ZDNA 2UUCF 3LP2A 2YKMB 1UFLA 4FYXB 2YWWA 1OIAA 3FEXB 3FQLA 1FD8A 3GTKC 2XMVA 3MUTP 2DISA 2QA4S 3IM9A 4UOFA 1R8CA 3D0IE 1CJVB 2LXFA 7AT1B 1IL2A 2GVDB 3G9CA 2C2ZB 4NXMF 3OVAA 2XM3A 3RW7A 3DNCA 3SDEA 1O51A 1KQ4A 2AGPA 4F0KA 2DIVA 2D69A 4DV2J 2H9ZA 3C15A 3NGKA 3ZC4A 1AB8A 4A46A 4ID5A 3UCUP 2VFVA 5LJ5Y 2KHCA 2MZQA 4XIUA 2OPRB 3SSRA 5E33A 5B0EA 2B6AB 4IFYA 3AY0A 2CFXA 1RT5A 1Y7PA 5IC4B 4AQYF 3NAIA 1OYDA 1X9MA 4KV8A 4ZVQB 1N6QA 1MWQA 4AL7A 3W62A 4J9KA 3K5NA 1N5TA 4TKTA 3B54A 1V5IB 3BB5A 1H74A 1UFKA 1VJQA 1LFWA 2BACA 3DOLB 1DLOA 1V3RA 4JI8J 3QJLA 2FLNA 3F41A 1X4GA 3BR9A 2B7BB 1P8GA 2ZH2A 2GMLA 2G0CA 2LDIA 4QIVA 3G6ES 1O8BA 2XQCA 1AZSA 1RT6A 4PUOA 4QJVA 1HQUA 5L9XA 3L95X 4K0KF 1DLOB 2IMOA 1NKCA 3HJVA 2EFGA 3CD5A 1G2EA 3PRVA 2HVZA 3M2VA 3GG1A 3PYGA 1CEZA 2DYAA 3M32A 1I1GA 4ELTA 4MIAA 3DU5A 2DT9A 1JXLA 1Q79A 3HOYK 2A6MA 4C0HA 1F6TA 5FDLA 3CDAA 3JQJA 3FJ2A 3HKWA 2QSWA 1FHTA 4DL4A 1S76D 4PR6A 1Y1WC 4USHA 2V6AA 2GGPA 2R7RA 3GSIA 2CRLA 2R4FA 4AE5A 1DAXA 1T03A 2E7WA 4QPTA 1RTHB 4DL3A 4PABA 2GGPB 1VQ7S 2HFUA 5KFVA 4RW4B 1FWLA 1XBWA 4C3MA 3M2RA 3KK3A 4NEZA 3C6TB 4DQPA 5ADZA 3BGUA 3NY0A 4J5OA 2DO0A 5DZ7A 5KG1A 4USTA 4DL5A 5KFCA 4YR2A 5F0UA 4NCBA 2IM3A 1F3FA 5IT4A 4RW4A 4GRSA 2ZHBA 2ILZA 4PQUA 4USMA 3DDIA 1HI0P 4GVLA 1RT4B 4P52A 2K7KA 1U1MA 2ZWPA 5RUBA 1S1XB 4Q44A 3N79A 1SL2A 3IM8A 4OI6A 3DRSB 1RHMB 3KK1B 2BE2B 3QT7A 1D9AA 1N56A 2CYYA 3FDSA 3KJFB 3I4PA 4WJ4A 2HHSA 1JLCA 3T1YJ 3DKDA 4DUYJ 4WU2A 4A3BK 5AE3A 3QO9B 3HOXC 5KT5A 4B3TF 1RWMB 3ISNC 5IWAJ 2ATLA 3Q8RB 1IKVA 3TVZA 2RQ4A 3GPAA 3N3YA 2AWZA 2KT5A 2D9OA 2VG7B 2Z58B 3FEYB 5A6WA 2DNPA 2V50A 1TAUA 1NM2A 3C46A 1CC7A 3J7YU 3NBPB 2D7SA 3WIVA 2N82B 3GCWP 1F7UA 2Z57B 2VG7A 1JLGB 2RQMA 4LF6J 5EDWA 4EYHB 2J6TA 4LF9F 4YFKA 4DUYF 4O3QA 3D0HE 3G8TA 2W1BA 3GTJK 2GNKA 4L3NA 3FK4A 2RDJA 1F0XA 1VQ4S 2JA6K 1URRA 5CD4A 4DV7F 2XI2A 2GIFA 4K4SA 2EVZA 3PJ9A 3EDRB 3CTRA 1S99A 2HZVA 4BKWA 1PYTA 1JLBB 4OLOA 1S5ZA 4K4TA 5KFPA 3MHYA 5IOTA 4Q45A 4QIGA 2UUTA 5KFWA 4WP3A 3FSYA 4F2SA 5M5YK 3BKTA 4OYZA 4CDIA 5BR8F 4DR2J 3T5JA 4A3EC 4ICLB 1KHVA 4RBTA 2EFVA 1UEUA 2LU1A 3T6BA 2M3DA 3HVTA 2QMUB 2FLLA 3O6QA 1WHXA 2AGQA 3BR8A 3I5CA 4KHPJ 4B08A 2UVRA 4KAIA 2X1GA 4LR2A 4DHVA 4V19X 4PG4A 5E3PA 5D4PA 1RXOB 4EZ9A 4NXNJ 2QJ3A 2B4PA 3JSMB 3T9ZA 2J0XA 2VU5A 1JLAB 2JEIA 2AMCB 4DSKA 4IDKB 4LJMA 3D0GE 2HIQA 3MD1A 3MECA 4IG3A 2EBEA 2B4OA 4A8KA 6FDRA 5DLGA 2ROPA 1IS1A 2MKSA 4KJIA 1XN9A 2MYFA 3CCMS 2VKRA 2R93A 2XTJP 2BQUA 4LFBF 1EIYB 5IYBK 2A3JA 4JV2A 2P8TA 3MAAB 1RZMA 2MKYA 4J37A 3DRYA 2VIHA 5KFDA 4TQSA 4DSLA 5F8NA 5I42A 1RA6A 3IC1A 3ILIA 2FHJD 2HWIA 2OPRA 3QJPA 2AEFA 3CCES 4B02A 1XNQJ 5KFJA 4OHZA 1T9TA 1VQOS 2MKCA 1B4SA 1M5OC 2GSNA 4ZLNA 2UXBJ 1RCOB 2ZZMA 2RQCA 3QX3A 3PW4A 3BGRA 1CQMA 1KQKA 3TUJC 4QIWD 2OMLA 2X1BA 2OFGX 5F8HA 4F0HA 5DGAA 1K47A 2DXEA 2KG0A 5SZTA 4PXCA 1EJ7L 4RPFA 1IXKA 1PIEA 1HNXJ 3PZPA 1RT6B 4NCAA 2BJ3A 1BQXA 3CMQA 3DXJA 4R5PA 2RVJA 3D2WA 3JQMA 4RL1A 4DZ6A 4JI7F 2ZWOA 4LK0A 2O5DA 3BREA 3KJVA 3AXMA 1WG5A 2AEJA 2M0GB 3MM7B 3Q2TC 2C2NA 1KS2A 3W8GA 4KGKA 3KJNB 2ZH8A 4EU0A 4KPYA 3M30B 1NZAA 3FEZA 3E2EA 2JRSA 3EGZA 4F4XA 4DV5F 1TK5A 2KRRA 3OD2A 2UXCJ 1R6VA 2IC3B 4JI4F 2CQ1A 4I56A 4ED7A 2HKEA 3EPIA 5JVHQ 1RAEB 2CQHA 2W8KA 1QVFR 1E6VA 3T3FA 2GS8A 3PYFA 1KDNA 3D66A 2LVWA 2ERRA 4LQ9A 1S7HA 3RYLA 4H4KA 3KK3B 3TZWA 4ENOA 3TAMA 1NBEB 3H98A 4KMHA 4I7FA 2HNYA 4XPEA 1BUXA 2GVZB 4F4WA 2YH1A 3NUHA 1Y1WA 1RWVB 2R8KA 1QSLA 4KQZA 2JA7A 1UJ6A 2Q79A 3HVAA 4H54A 3BS9A 1S6PB 3H4BA 3A3NB 3WZ0A 4X62F 4E8UA 4WBFA 1H38A 3M8YA 4K5SA 2X7IA 2HG4A 2DTJA 2A1BA 2ZOMA 1VK3A 4NWBA 3CJ2A 3W1YC 1U8SA 2JVOA 1A9NB 2QLJB 4YR0A 2OTJS 4M1XA 3I0RA 1U0SA 3R5BA 3D1OA 3BPSP 1TV6B 4ED0A 2KL8A 1CULA 3T6JA 3HHLD 2QLBB 1T02A 2RU9A 4GKJJ 1RTZA 2XCRB 4KB4A 1KOHA 2ZFZA 3G6XA 1RGVA 2F65A 3BN7A 4CLWA 4C98A 4DQRA 1L3UA 1H6KX 4A3KC 1PO6A 2V2KA 2L9WA 1YZ6A 1UAWA 3FSIA 3FHZA 1Y5NB 3TZZA 3E8OA 3R9LA 2HS3A 4U8VA 1NRKA 4ZCMA 5H9EK 1N36J 4I68A 3WX4A 2BA9A 1WELA 2JFDA 3GJQB 4LF2A 5D77A 4FP9A 4EMDA 4HDGA 1JLEA 4KHRA 4P6QA 4WFXA 3AHPA 5G0RA 2EG1A 3MOJB 4DPTA 4QZVB 3CDUA 3D1QA 2CJXB 4KM8A 4LREA 1T9VA 2WSFC 3PKMA 3CXCR 2I5JB 1S72S 5FLMC 1F5AA 1JLBA 1WNEA 3FZBA 4ILDA 3OR2B 3G8SA 2HNDA 4U96A 3BEGB 4K2XA 3GB0A 1QAJA 2VG5B 1S1VB 3BSOA 3GG0A 2D9PA 4TY8A 4DPXA 4ZPAA 3MCNA 2XY7A 2DBBA 1F9EB 4MIWA 5KFUA 1YRUA 2CWKA 5C7PA 3ZZZA 5KG0A 1OSDA 2B4VA 2Z56B 3HOVC 3CJKA 3CCRS 1U24A 5ETRA 1HNZF 1FEEA 1XZQB 1B0VA 3CD7A 4NE9C 4JI0F 1J5EF 2QA4G 3HFVA 4PG7A 1FRXA 1XR5A 3IA0A 3CJKB 3RZDK 3CPWR 1WC5A 1CJTA 2ASLA 4JI6J 1REGX 1HW9A 3A8KA 3D6TB 1WCMA 5M3MK 1Q4RA 2YNHA 1N5VA 1WF1A 2GJ2A 4CLPA 1QE1A 4FYVB 3V6KA 2HVEA 5HQLA 4IG3B 2CG8A 3E51A 1GQEA 4YY3F 1YLXA 5EWGA 2AYGA 4ANEA 4A3DK 2WAQD 4NLXA 4LFAF 3R5GA 2O01C 4C8MA 1XIQA 2B9XA 2BVZA 2E1CA 5C4XC 4ED3A 8ATCB 2HMIA 2HHQA 4CCHA 5SUHA 1X0PA 3RRHA 1HI8A 1VBYA 5KG3A 1EZZB 5M3FK 3A4TA 4YEAA 2P6TA 3NG8A 3DFEA 3P49B 2EEYA 5C24B 3K5OA 4WJBA 4F4AA 1RAAB 4O0IA 3UWTA 4CLFA 2ZBIA 3KLHB 4G0WA 3J80Y 2KJVA 1S1UA 5ETQA 2DR6A 4ZLLA 1FJ7A 4M5JA 2CQ0A 2JSXA 3Q22A 4N8NA 1WOPA 2JA8C 3BQ1A 4A3KK 2CAJA 1GK8A 4EFAC 4DQIA 3BGRB 3KUHA 4C45A 2A6OA 4M5NA 4TU9A 1U48A 2G2ZA 1YCLA 5GAGI 4BC9A 1N34J 1OMSA 5J1EA 1B0TA 5DZ6A 4HTJA 1BQNB 3KLEB 4RNOA 2Q3PA 1OPZA 1HBMA 4URQU 3MMCA 2VZ9A 3ERED 1T3NA 4PQUB 1ISEA 5JVOA 3NMAA 2KO1A 4EWTA 4NYPA 4BY7K 3NS5A 4FYDA 4WYWA 3QFHA 2KYZA 3GLJA 1XPPA 2WZ1A 3LH2S 4DUZJ 2VHGA 1SUQB 2B5JB 1VIOA 4ED6A 4K7QA 3HHLA 2RJZA 2RILA 1RQ0A 3JS9A 3MWBA 4FNHA 2Q1LA 3VAIA 2IFXA 2WHOA 2HQCA 2C2RA 3MEDB 4PXEA 3HD1A 1ZTTA 3EVWA 3PR4A 2DH9A 1FERA 4J9UE 5BJRA 3G4SS 4RWXA 2EPIA 2E9ZA 4E2FB 4DBQA 3GFHA 1IVZA 4C2MC 1WUUA 2DNNA 3K5MA 4U7UD 2DO4A 5HK4A 5F0WA 5HQ8A 1FVSA 3RAMA 4A3BC 3HFZB 4WZMA 1S4EA 1XMQF 1XXBA 3M4OK 1RT3B 1JLGA 4A3CK 3QGPA 3PFEA 2CJ9A 3UNYA 1VQYA 4EZ6A 2OFHX 5LM7E 2ASJA 3HHKA 3KTQA 3E01A 5T7LA 4LR7A 3C16A 3GTJA 2V9KA 1IQZA 4IG0B 2YNIB 3MM8A 3TVYA 4GKKJ 2M9KA 1S0OA 3KYLA 4DR5J 4FF1A 3BSAA 4NYOA 2LQ5A 2HHWA 2YPZA 3C6UA 4DMZA 3A13A 2VD3A 4AUKA 2LKZA 4N5SA 3Q8UA 2RQKA 3PXGa 3PFOA 4BCAA 4CH1A 1SVDA 4C8OA 2GO9A 1P6TA 2KFYA 1HMVA 4K50A 3V81A 3PY8A 3OPFA 4RMFA 1N36F 3T01A 4NCGB 2KT2A 2Y1LB 1VK8A 4USJC 2RRBA 3N01A 5MLCV 3QLHB 3R5JB 4WFAQ 3A3PB 5D3GA 3LW5C 1D8ZA 1WC6A 2V8HA 4FKXA 3O1LA 3TARA 3O44A 3CJ5A 3MDFA 4NMXA 5F8GA 1OY8A 3OJSA 4FYYB 5HJXA 4DL6A 2QL5B 2V8DA 3QLHA 1UCNA 1SBRA 3W60A 2V6SA 1L5UA 5GMEA 1XZPA 4P2SA 2GIQA 3IWLA 4HI2A 3TRGA 2Z2ZA 1PBAA 1KHWA 3MMAB 2X1AA 4ZIWA 4KAWX 3VAGA 2VH7A 3SMZA 1RAFB 4A8FA 1S57A 2IM2A 3LF0A 4WIQA 5E0OA 2AIRB 2G9OA 1KQSR 2FHKA 2BE7D 5HP1A 1FRJA 3QWUA 2E5JA 1E6YB 5A76A 3KNGA 2DEJA 4OYPA 4C97A 5C42B 2NYIA 2OD4A 2CNKB 1FRKA 4BS2A 2Q66A 2IM0A 1FVQA 2BUNA 2W9AA 4A3LK 2CVEA 1KN6A 3GTQK 4CM2A 1U2FA 4X4PA 1U1KA 2EI5A 1DURA 5D4DA 3AOAA 2KN4A 4N47A 1HBUB 1HHTP 4LF7J 2AJ1A 3DLEB 3JQKA 2Y1JA 2ZOGA 2ZH3A 2WCXA 2E2HK 4X6AC 3GMGA 2PC6A 1OO0B 5KOXA 5KG7A 3THTA 4AL5A 2GX8A 1T3OA 4HH1A 2CPYA 4A3FK 2B43A 4GVBB 1FXDA 4A8OA 3A8EA 1R31A 3NL0A 4H4KC 2PMZL 2HVIA 5D6GA 1CPZA 2ZUGA 4OJ3A 3ETOA 4GVBA 4YN3B 4ETZA 3S1NK 2KB2A 5THWA 1U6BA 3FKIA 1HQUB 4PAAA 6FD1A 3QRRA 4CRJA 1ZPWX 3LPXA 4QOTA 1HQEA 1QTNB 2E5IA 1NCLA 5M5XK 2C3YA 2NR0A 1VMBA 4Q43A 1NSPA 3HI9A 3DRRA 3VGTA 2W2OP 4AXJA 3M6UA 1SL0A 2MZSA 2ZFHA 4CM0A 2OMOA 5KOWA 1HNIA 3NCQA 4QYRA 3M9OB 2A69A 3GIKA 2NPFA 1U7LA 2DNKA 2PMZD 1XNQF 3TOQA 5K8PA 3GTPC 4WXWA 1BGXT 2A6EA 4ZCLA 1FX2A 4C7QA 5HATA 5A2QY 5KFEA 3WX8A 1HNIB 1IBMF 1BE4A 1WEXA 3HX9A 2WBMA 2KH9A 1HBMB 4DL7A 2FZGB 1SKRA 3THPA 5KT2A 2V63A 3SSSA 2LXIA 1H7XA 3T9NA 1PSDA 2E5LJ 2A10A 4R0EA 4XLPA 2KHDA 3M8PA 1YDLA 1HQ2A 3UCGA 2WONB 3NLCA 1N5QA 3CJQA 4KC5A 2RU3A 4B3SF 1O2AA 3PJWA 2O1PA 4P5BA 3VA7A 4USKA 2B8QA 3NOCA 1KVIA 4DSFA 5B0GA 4ZCKA 2VKZG 3PIPQ 3OL7A 1X4AA 4ZPVR 3NGTA 4O3RA 1TUWA 2DGSA 1N5SA 4BLAA 2YKAA 3ET6B 4I2PB 3DDKA 1JLCB 2W01A 3S14K 4I69A 1YJWS 1RCXB 4YB7A 3GONA 5KFTA 3BYRA 4USIA 1JLFA 1IWGA 2E2HC 4HEA9 2GHWA 1JWWA 3MFIA 4KR0B 1LKZA 1Q5VA 3VAHA 3Q0AA 2ZBRA 5LSRA 1SPBP 3H5UA 2Q43A 1PGZA 3W5ZA 3FKIC 1JLFB 3NGRA 3NGUA 2WTFA 2YKNA 1X5TA 4O44A 1SB6A 1CJKB 5EWFA 2EC2A 2JL9A 4Q2MA 1EK8A 2IHR1 1M1KT 4XK8C 1RHRB 4PPDA 1IKXA 1TWFK 3O8WA 4YP3A 2N3OA 3F0NA 2JLFA 1XC9A 1NK6A 3OJUA 2YQ1A 3BKFA 1W25A 4JV0A 1NSQA 2J0QD 4K4VA 4LF6F 3W7BA 2GJFA 4TN2A 2HFSA 1BWVA 2RF2B 3PRDA 3GZ7A 2CQCA 1OS5A 1IBKJ 2DR5A 4ZLPA 3FBCA 2AW0A 5LL6d 3KLGA 3T41A 3KNAA 4JV5F 1KVKA 2R2TA 4NZ7A 4IH6A 4B9NA 3RBXA 3H0GK 3HMJG 1RK8A 3QMQA 4OYBA 3HHLC 1RAOA 2ZBPA 2P9EA 2R7XA 1TWCK 3LANA 2LECA 5AXLA 1FI4A 2Y8YA 3HVTB 1I50K 4X6AK 1XZPB 4LSZB 3IS9A 1CVJA 3TA2A 4KATA 4J9NA 3T5HA 2PA3A 1HL6A 3M6XA 3OFHA 3KUEA 1UVIA 3DXSX 2DRDA 1R9TC 1WC0A 3R2CJ 4FVCA 4F25A 3SZZA 1AXQA 1WC4A 5HL7Q 1RWWB 3M8WA 1NU4A 2CQPA 2CPXA 5LMUF 2HFNA 1F93A 2GJIA 2W8LA 4JBCA 3QIPB 1MWZA 3BDEA 4BY7C 5IQQA 3NGDA 1RE1B 2DEIA 1SQGA 2MLZA 3MM5B 3H7HB 4OMFG 3MR5A 1XJWB 2ACMA 1NSKL 4ES3A 5AJ3F 3HKZL 5IYDK 2VFUA 3CJ0A 3M1VA 3TEHB 2G2YA 4UZBA 2RUSA 3CDEA 1HBUA 3BM7A 2C2OB 3ETMA 1XWLA 4ZJLA 4LFBJ 2HHHF 2ZC3A 1FJEB 3POTB 1S1TA 3PRBA 3NRBA 1ZM9A 4OI3A 2F9JA 3DHXA 3RZDC 2Z30B 1SJFA 5C44K 1R0BG 3M8ZA 1BY9A 5F9NA 3BQ2A 4NYZA 4DV0F 2JA6C 1HHSA 2HWHA 2RSQA 2R8IA 4A93C 2GHVC 4RX6A 1NAQA 2WB1L 1EHWA 2J5AA 4EBEA 1QJHA 2FJWA 1U1NA 4XAKA 4R0JA 3IGVA 4JI1F 4EI2A 1VRUA 4PG6A 1TL3A 1YBAA 1N0UA 1YRTA 1HQMA 1Y00A 5L1KA 2OPQA 2E9TA 1TWAA 1QD1A 5ETNA 2NVQK 5E7OB 4FYWB 1IE0A 2LA4A 1FTCA 2P8IA 1WCMC 1FKPB 1O27A 2QFIA 2FVQA 5K8MA 5CHCB 1VRUB 2DVIA 3MM7A 2G2OA 4GC7A 2HBZB 3H3VL 5GMDA 2LQJA 1NPPA 2DGUA 3AODA 3OHBA 4F67A 2AJ2A 3AB2B 3IBFB 2Z4PA 3WODA 1VQ6S 3RR8A 2NVTC 3PO4A 2CG4A 4PPZA 4KN4A 4W98A 4AH6A 2E2IA 5E3CA 2VG6B 4Q0BB 4TLQA 2WVDA 4A47A 3J7YI 2CPIA 2Z2LA 1G6BA 2NYHA 2FZCB 2M7SA 2Y0SL 1AFJA 4B3SJ 1NJYA 5KFZA 5D8HB 2UUCJ 1BXNA 2K8GA 4JI5F 3ENAA 2WVCA 2CQGA 4LF9J 4DL0C 2EKNA 3HOZC 4CTAA 4IG0A 3QAUA 3FKIK 4I1TA 1GTHA 4ZVPB 5DJBA 3QQCD 3DLJA 4LFAJ 4OX9J 2B56A 1UPMB 3D1HA 2HBYB 1HIYA 4NA2A 4KDDA 2VBYA 2YQ0A 5M5WK 1MROB 3A1YG 4K4XA 4BLGA 3QRPA 1DQAA 5IOLA 2RMLA 2XS2A 1ZZNA 3RAQA 3H0PA 2ZKUA 1WTBA 2A0FB 2GAHC 2MMYA 3QGHA 3P8BB 3G6VA 5HMYA 1NK4A 3NGSA 2FJAB 4FKYA 3KLVA 3TFHA 4R8UB 2IVMA 3BH7B 3BUEA 4HT5A 1X4BA 5C3EC 3UR3C 4WFZA 4ECZA 4F04B 4NOHA 1DCOA 3KLIA 4PYDA 5IS2A 3R27A 4URGA 1R0AA 4AD6A 2UUAJ 3AD8C 2MSSA 1TUGB 3SI8A 4Y2CA 4IH7A 1NDCA 1BDFA 1FRHA 2HIYA 3DOKA 1KLMA 2UVUA 1HBOA 4DG1B 2JHEA 1YBTA 3S17K 2QLWA 2XS5A 3PW7A 4OV6A 4G1QA 3UCZP 1CC8A 1VQPS 4C3IC 4ERDA 1TMMA 2V2VA 3F44A 2GV1A 3QGGA 1CS4A 4NLUA 3EJMA 1YIJS 1LW2B 4M5MA 2HK3A 3KG1A 4CP5A 4UW2A 4DG1A 1JJ4A 1Q8LA 1FNOA 1U2CA 1S79A 4N77A 5BYSA 5KFNA 2FY8A 3CGIA 3M8QB 2G4BA 4C8KA 2VUMA 2I5JA 4WU3A 4ED1A 2Y3PA 1WIHA 5B0BA 1ZM3A 4B3OB 3HSJA 4HYKA 1IQ0A 2XEXA 1VFJA 2ZC4A 2XMWA 2F4VJ 3UN2A 1QY7A 2Z2MA 1H98A 5K8OA 4H4OA 2F3JA 3HOWC 2YNGA 3SCJE 3BV8A 2F5GA 1USMA 1VLOA 1XZQA 1XMOJ 3HDSA 4DUZF 5IT9U 4BLBA 4WE1A 5IYBC 1K0VA 5CABA 1EI6A 4MK7A 1Q16B 2DR8A 3OHAA 3DYAA 4V19J 1KSPA 4WTYA 3R5AA 3SV4A 4MQ9A 4QWEA 2DCLA 4DR7J 4Q4ZA 3I55S 4X66J 3LWLA 1DFDA 4DV1J 4LF4J 3CAGA 2HSEB 3RZAA 2JOQA 2XSFA 1QE1B 2E2IK 4ZH4A 3P4UB 3L4BC 3F73A 2YWHA 3DM2B 1PYSB 5IQ6A 2Q6CA 3CSKA 4MK8A 2OKQA 1TK8A 1XNRF 3BBBA 5GAGU 5DQGA 4OV1A 2XG8A 1R7IA 2EC0A 4UQTA 3VZHA 4OI2A 4GTEA 2HHUA 1RHQB 2LEBA 1CSJA 2CPZA 1XK8A 2W4CA 1PG5B 1HNXF 3CMAS 5ETLA 3RU0A 1BD6A 2EKYA 1VBKA 1SL1A 3ENQA 3X3UA 3M2UB 1S1UB 2MQ8A 1CBKA 3V2UC 2IRUA 3MF5A 3IBWA 4A3MC 4ZPBA 2YH0A 3IR5B 2NS1B 1SJRA 1U02A 3DRPA 3MMJA 3AQOA 5L1LA 1N4LA 5K5MA 3H5YA 3D54A 3HOUK 4LF8F 2PPBA 3QYYA 4R25A 4J9VA 1EP4B 1AUDA 3K2YA 1QSSA 1WOOA 1TR0A 4A3JC 4IQMA 1B7FA 3DRPB 3S15C 4LQYA 2C2KB 1IBMJ 1WEYA 4ZIVA 3KUGA 4TLRA 3VQTA 3OL6A 2KFNA 2CJKA 5ETKA 4OZNA 2CW0A 1ULRA 2Y8WA 2ZE2B 1R9TK 3GYXB 4DR1F 2R8HA 3PCOB 2KZZA 2FJBB 1NK7A 2XCOA 4G1IA 4S0MA 3G4AA 4I4BA 3N6NA 1HNZJ 3UPFA 1LWEB 3OBIA 4NLOA 1U1OA 4Y28C 3VHQA 2IBOA 1RKIA 1S9EB 4O3NA 2IRYA 3IWNC 3EDQB 5DRKA 3RUBL 4DX6A 4Q0BA 1LWEA 3DI6A 2CFAA 2EFQA 2Y0SD 5KFSA 3S1TA 5B09A 1VQKS 5D4LA 2YKMA 2D3UA 1LWFA 3H40A 3KHLA 4QWAA 1IR0A 5J2PB 4ECYA 1KQFB 1AFIA 4RW8B 2LQBA 2CFAB 4XSXA 1IM4A 5AXNA 2I38A 1LWCA 1I6JA 5C25A 1CJKA 3IP0A 5IV4A 1AYEA 3CUNA 1DCHA 2YKQA 2VPZB 4B9MA 3PO3C 1H0HB 1B4AA 1NJXA 2Q6BA 2VJUA 4X2BA 5T7LB 1JLQA 4X4QA 1IKXB 4YFUA 3FC9A 2W9BB 2ADCA 3ISZA 3Q83A 4F4ZA 1PJ5A 4P5AA 1LWCB 2XWYA 2I6WA 1RU0A 3MUMP 1NPKA 1U1LA 3GTPK 4CH0S 2O66A 3AT1B 4DSIA 4UY8T 3LAJA 4CLYA 1UTAA 3THVA 1EQMA 1N6QB 1JLQB 2LQ9A 2LXUA 4JOUA 2JWNA 5LSLA 1RJJA 4DX8H 1Z1ZA 1TUVA 1F5CA 1HMVB 3HXAA 3QATA 5F3ZA 2XCAA 4F8RA 3PO5A 2HGMA 3KDOA 5KG5A 5I3UB 3CCZA 5KFMA 4WP8A 5KFIA 2XI3A 1G3OA 2GQCA 4Q8FA 4DEZA 3A8IA 2HW3A 1SV5A 2N4DA 2HEKA 1ZAXA 2CJQA 4Q5VA 4E0DA 4OYAA 3ITHA 1LXNA 3W64A 4KRWA 1OSCA 5D4NA 2HYIB 3M2VB 1OQ3A 1ITPA 2E7XA 3GTQC 2SXLA 4TYBA 3RW6A 4I2QB 4OYIA 5KFLA 1O26A 3D5MA 1GXUA 3S1RK 1HI1A 4ZVTB 1KR4A 3RBEA 4DS5A 1IBLJ 3QT8A 4ZJQA 4P2FA 3MMAA 1H2UX 4PXDA 2I9SA 4X4TA 2AD9A 2IRXA 4FS1A 2QRRA 3N5FA 4DQSA 1FKAF 4KMDA 3QIPA 1Q0NA 3GTMC 4ITSA 4F0MA 3MEKA 4JI2F 1I3QC 3IG1B 3OPKA 3CO0P 4DV6J 3RB4A 4PCQA 4G0UA 1NO8A 3LP0B 4LSNB 1T03B 2LMIA 1TKTB 3IPJA 1RWUA 1JK9B 2P6SA 3W2WB 5M2RA 4GFQA 4C2MK 1FNMA 4D3GA 2PN6A 5D0EA 1VCTA 4FVMA 2WOMA 4QCLA 3POTA 2NVYA 2DHAA 3QT5A 1VQLS 1RAIB 3PW2A 1VRQC 1GMWA 4GO5X 4C3LA 2FC8A 5HLFA 2EK1A 1CJVA 2VONA 4J9RA 3JSBA 1UVLA 3ZZRA 2R2SA 1WHVA 3V6DB 4B3RF 5BYRA 3SDEB 4NASA 2BKOA 4QWCA 5E3RA 2BABA 2UXBF 3MM6A 4NA1A 3S6EA 2HFOA 2W9CB 4EBCA 3HK2A 2K1RB 1YJVA 3BYPA 1VBXA 5A6PA 3DLBA 1HI9A 2MQPA 2PMHA 4IO9Q 1T05B 2LDYA 1PCAA 3MM6B 1TL3B 1J5EJ 1RAJA 3EZ5A 5L1IA 2DNMA 1MMDA 3NXZA 4OIOA 4J91A 4MEYA 2MQQA 4IO1A 7FD1A 3LQVA 3K17A 4M5IA 3CDBA 1C0UA 2E5LF 2VDHA 2QV6A 4JP8A 5J2MA 2FUG9 3CEDA 2NZCA 3OL9A 1RWOB 2DGVA 2VODA 3HO1A 1TL4A 1FF2A 3TAPA 3UD4P 4J9MA 3BJYA 4M1KA 1I3OB 3GTQA 1X0FA 3M7VA 1NK0A 2FJEB 4B3MF 3VVUA 1QUVA 4ID8A 3PYEA 4B17A 1G51A 1F3VA 3J81Y 4GO7X 1V5VA 1FK9B 1T95A 3QFWA 5TMFA 2BM1A 2W2NP 1HNVB 2CZ9A 4DR3J 4QWDA 2CNLB 3RAXA 3FVYA 3UN5A 1WQFA 3OR1B 3OTOJ 3R6GB 5G4DA 3O5TB 5KT4A 3PEHA 3P5BP 1VJEA 3TX0A 1CG2A 4X4SA 1WSVA 4UZCA 2PFFB 5EUHA 3PHTA 1IKYA 3OQ2A 2ZZNA 1TWGC 3GP9A 3ZTOA 4DV2F 4KE5A 2R7TA 3TZYA 2B0GA 1PC5A 2R2UA 3PX0A 3Q8SB 2QA2A 4KKOA 1SMYA 3HULA 1FFGB 3V4MA 4CT8A 5ETTA 3RJMB 1Q81T 3SZYA 4WIIA 4UTGA 3JYTB 1MN9A 2KVQE 1H2TZ 2IA6A 4BWMA 4OX8A 2DJWA 4PYAA 4X4UA 1D3WA 1U0HA 3VAJA 2VPWB 3OTCA 4WZQA 2I1RA 4U7UK 3TUPA 4U6PA 3S01A 1HLWA 2R9LA 3W65A 1FKOB 1JLAA 5HMZA 1U4BA 2QE5A 3MECB 5J2PA 3NOGA 3OFEA 4OYWA 4ILLA 1UEVA 2FJDB 4V1Ak 1O5JA 1GH8A 1U8WA 2AYEA 1KLMB 1SFOK 4IFVB 1HWUA 2OSQA 2RIJA 2GIRA 3UDEA 4I0WA 4W4MA 1R6YA 3T00A 2UVVA 3V6JA 4ZP6A 1HHQA 1WACA 1ZZFA 2P5VA 3P6YC 2KXNB 2YKNB 2J7WA 3ONQA 2UUBF 5DETA 3V4GA 2GVDA 2FVCA 8RUCA 1H7WA 2MLYA 5EN1A 2AZ3A 2OEKA 1YQHA 4ID5B 3KMSA 4DXLA 4MKVA 5C5JA 3AA8A 3DGPB 2JEFA 3K5LA 2WW8A 4AL6A 4X4VA 3ISND 4OHXA 4OYMA 4DQQA 4GTFA 1Q86T 4ZP9A 4OINA 3WHIA 4OI1A 4PG8A 3W8PA 1HYSB 1FWPA 3S1MK 5I3UA 4H4MA 4UF4A 3PHEA 1B0PA 4QU7A 1YZ7A 4Y2MA 3G2XA 3L9ZA 3MD3A 1YWXA 2J9EA 4KH0B 4LK1A 1HWIA 1UWBB 1SV5B 2RRAA 5FIIA 2YX7A 2RGRA 1U6FA 3K58A 3BO2A 2R7VA 2K3IA 1SXLA 4H4MB 1O24A 5DO2A 2W25A 4M63A 4J9LA 2BR0A 3MMBA 2HWTA 3EE3A 1UZDA 2JA5C 1Z4UA 3B4MA 1HKAA 2DNLA 2V5HG 5J2NA 4FPIA 5A8KB 4ZHRA 4LR8A 1KFDA 4KM9A 4RW7A 2NUHA 2LFVA 3K8VA 4LF4F 1M0SA 1TWGK 3HOXK 3SCIE 4DR3F 2WB4A 3U02A 1S0NA 2LQ8A 4DFKA 2MKJA 2B3TB 4YQWA 4L3KA 4UUXA 2IC3A 3M3YC 1DARA 3VR1A 1TKXA 2OJ3A 2H5EA 3NEKA 4DCOB 2V6UA 1ZA2B 3L4KA 3CD6S 3J80U 1N52B 4LRAA 4ZVHA 2H5IB 3UVJB 5H9FJ 1AT1B 4ED5A 4X4NA 4C11B 1WDDA 4CWBA 2JLGA 2DNOA 1RTHA 3HJFA 3VAFA 1XMQJ 3UQSA 2ZNZA 2BDPA 2XC9A 3CJTA 3EM1A 3M2UA 2DGOA 2C3OA 5JJBA 2BBEA 3H3VD 4Z7CA 3S7RA 3D6MB 3J7A1 5IC6B 4MT1A 2H51B 2NXCA 2D3OR 3UDLA 4U95A 4RZRA 2C2DA 1S1TB 2XB2D 3LA0A 3I31A 4FXDA 1R8AA 3CJ8A 4C8ZA 2XZDB 1S0VA 1XMBA 1Q82T 4I67A 2ZBCA 1VC0A 4M5HA 2CZ4A 1NK5A 2QT7A 1F9NA 2APOA 5KFAA 2J7UA 2R92A 4E98A 3JTNA 3KHHA 4BXXC 1T8EA 4NRUA 1SJ1A 3T5LA 3KK1A 2WB1D 2IAJA 3AOBA 4OI4A 2B63C 1RI7A 4XDDA 3LOUA 1TL1A 2PI5A 5F3TA 3HOYC 2VBXA 3FOEA 4RNHA 1UEKA 1UV7A 1NUEA 3PJXA 4KASA 3CC2S 2J9CA 1VS3A 2GZOA 3NWGA 3GFXA 3FNNA 4DU7A 2NCKL 3H90A 3GTPA 1DY3A 2XNRA 5IOQA 4FPRA 1SQFA 4O3OA 1V6HA 4WKRA 3MI7X 1J2VA 2LA6A 3S1RC 4P7VA 1SH3A 4X4OA 4RLEA 3M3YK 4RW6A 4FNIA 5IYCK 3GYNA 1JKHA 2ROEA 3KJVB 1TWFA 2U2FA 3CCJS 3N9UC 2IDEA 4GMKA 1AZSB 2VA3A 4L74A 4KY3A 4FF2A 3ZZUA 1RHKB 3VV2B 3NMRA 1LWFB 2YX1A 3BGLA 2HRTA 3CCUS 4FF4A 1R43A 1N0VC 3M32B 2QG9B 3IAS9 5I3PA 4C8LA 3ZNJ1 2BQRA 2DIUA 1DZ5A 1HPZA 2IM1A 2NQPA 4KT0C 4M8LA 3EPGA 1URNA 1KRPA 1VC6A 4RBVA 1JJHA 2C22A 1F9HA 5FLXY 2C3MA 3VQSA 3Q89A 2FLPA 2PMWA 5LOQA 3ZTPA 3NS6A 4LRCA 3UDVA 2FLOA 4O3PA 3G82A 1CQNA 2XY5A 1TK0A 4YY3J 5D0GA 3HSDA 3DMJA 1P27B 1RDRA 5HJYA 4U67Q 4XCHA 1TL7A 2B7CB 1VQMS 2R93C 2XHCA 2ZH5A 2RAQA 4CO5A 1VGYA 4MTPA 5HVGA 2VFSA 1YG0A 3NNCA 4A4JA 4GT9A 4YB5A 1N33F 3RZOK 4NLYA 2UP1A 4CYUB 3JSRA 3GIMA 1Y4ZB 3CB4A 2ZUEA 1FTRA 1UJ5A 1GX5A 3IAM9 2UXCF 4C8YA 1BJTA 1W2IA 1R27B 5AXKA 5L39A 1RTIB 2UU9F 1HR0J 1QAIA 5IP9C 2AJFE 4X64J 1F60B 4U7CA 3J7Z5 4WILA 4IDKA 5FLMK 3RRKA 1N88A 4KGMA 3B78A 4Y6IA 5LSOA 2FQOA 3N28A 1XR6A 2HVHA 3SQGB 4L75A 2OGUA 1LWXA 4EK2A 1AROP 5M2UA 1PKUA 1UPPA 4MIBA 5ETPA 1TKTA 1LW2A 4MMOA 4WFYA 1BMQB 2UXDJ 1WC1A 1FA0A 2FVPA 2ABYA 1T9YA 4KO0B 4DR2F 2ZITA 3CC7S 4WKYA 4DR4F 1H3DA 3HFKA 2R93K 1U6ZA 1RT2B 4NI2A 4ECUA 2V94A 4PKDB 2GQQA 5KFOA 2FHJA 4BBSC 5M2PA 1UWBA 4XLNA 4CO4A 4OLPA 3GEIA 2JA6A 4KARA 3QPIA 4P74A 2H65B 3TI0A 1CJUB 5EHHA 3W2VB 1Y1VC 3AJ2A 2I2YA 4YFXA 3HPOA 3U1NA 3EMTA 1TWHA 2XMUA 5CJ9A 4G7OA 4U9RA 3U7JA 2B9EA 4ZPWR 3TANA 2F1FA 3RR7A 1SUQA 4GKJF 2B5JA 1IN0A 1T0TV 2DGTA 2X51A 2W7PA 2NUUG 3MFHA 4PRFA 3GJRB 1Q8KA 1RAHB 2E9RX 1Q5YA 3GTKA 5J1PA 1T05A 1GTEA 4DX7A 4KIAA 4LUBA 1VQ5S 1KFSA 2HRUA 3VZIA 3LGHA 2Z0GA 4BBRK 3RGIA 3UE2A 4JYAJ 4A3MK 1X7VA 4P73A 4ZOSA 4JB8B 1UW9A 5HANA 5DM7Q 3GEEA 3AA9A 5J2MB 3TTGA 5DQHA 2JC0A 2QMXA 1FRLA 5CCMA 4ZPCA 3GTGC 2D3ZA 3FCVA 2BRLA 2GC8A 1SFOC 1KEKA 2XSJA 5KT3A 4DFPA 3OUYB 2P5MA 1A7GE 2WBRA 1C1CB 3B82A 3G96A 2KXFA 3JSMA 3Q8PB 3SCLE 1YI2S 1LK7A 3K7AC 3E01B 4K5RA 5DG8A 4JI4J 3C19A 2KVIA 2QLFB 3L09A 3TAMB 1UL3A 2OPPA 5J1NA 2F8EX 2ZKTA 5HVHA 3SCKE 3BPDA 4OYXA 3TA0A 1MLAA 1FXRA 4ZLJA 3MM9A 2PA8D 3Q3QA 1S77D 2B9YA 1LW0B 4NPOA 3KLHA 3ZZOA 1TWHK 4K4YA 3FMWA 1GMWD 1SKUB 3TEGA 2AJ4A 2MZTA 4XSZA 3C8YA 1FDNA 2DRBA 1FEHA 1FJCA 4JI7J 4NLRA 3QBCA 4NLTA 3VGUA 3MEGB 4DLEA 1X5SA 2KWAA 1TV6A 2X3DA 5IOSA 4UOCA 2W4PA 5D3GB 2YPYA 1OQ6A 1U49A 4YOEA 4HHHA 2DH8A 2WVBA 1UKUA 4N41A 2MY8A 1VRTA 4B9LA 1C4AA 3LGNA 3WDOA 4ZMMA 3ENVA 2BM0A 3OXFA 2CA9A 1DTTB 2A2DA 1S9GB 1YK9A 1P1TA 2KFZA 5CA5A 4C3JK 3U27A 1ZVUA 3DLLQ 4UY85 2LU2A 3IMQJ 3ZZPA 3MPWA 1HBNA 1UVNA 1DTTA 2HZAA 2ZOFA 3CIMA 2GMJA 3HHLB 3TJ9A 3S1MC 1RLDA 1Y1VK 4WK3A 1S1WB 3RB0A 2HK2A 5DDRC 4B9TA 4HL9A 5KAKA 5ETMA 5G0RB 2H54B 4QWBA 4IFVA 2FJVA 5HP1B 3W3SA 1V9OA 1D1UA 1O2FB 2ZH6A 4KH1B 2NSCA 1E6YA 4DCJB 1ZH5A 2UUWA 4IYQA 1DD5A 2RNEA 1HR0F 1GEHA 2E2JC 3KKFA 4ZPDA 4ZPTR 3EZOA 3GU0A 2UUAF 3R97A 2R7UA 4KB7A 2D74B 2YWKA 1SH2A 1XTZA 2HNDB 1M5KC 1XEZA 1AB4A 1NDPA 4NXNF 2HHXA 5K20B 2FC9A 3MTJA 2DITA 3IXQA 1APSA 3DMJB 2YWGA 3ENWA 3PNIA 1OYEA 1Q95G 2J6UA 1TL7B 2MKKA 1IWAA 3DOMB 2CQIA 1BQMA 3TP2A 1UJ4A 1K83A 1SFOA 3W5YA 2FIUA 3K8WA 2CPHA 2CQ2A 3PVXA 3C2PA 3K59A 4KHPF 4FN5A 4X64F 5B08A 2ZJPQ 4ALZA 2IIHA 3S17C 1RLCL 4CIOA 3KLFA 3TAQA 3GTMK 2U1AA 4C8NA 1H73A 1QDUB 4ZS6A 4MYUA 1JVIA 3UFCX 3SFUA 1LK5A 2FZKB 1CJTB 4LBHA 4IKAA 3V81B 1QAXA 2YNHB 3G86A 2R2RA 2BJDA 2G1DA 4HKQA 2PSZA 3I0RB 2BJ8A 3QWPA 3IRXA 2G1HA 1JQWA 5BR8J 3S2DK 2Y1IA 4ZHRB 2XWXA 3TYTA 1RT7A 5EGHA 4RW7B 2WAQL 2B63A 1PBUA 1W26A 4CO2A 3MEEB 4I2QA 1KC8T 1NHVA 3PR5B 1FFSB 2AQ4A 4MK9A 1R89A 3EQLA 2W7VA 4OX7A 1V3ZA 4ZVOB 3MZIA 1JNRB 4RW9A 3DDNA 3GJSB 4ZVUB 1D9DA 4RUAA 4CO0A 3CQZK 2PI4A 1RAGB 5TJ3A 1SQEA 1OY6A 3LP2B 2B51A 2GAGC 5L46A 3IG1A 2HHPA 2RT3A 1HWKA 2DHXA 4LF7F 4OQJA 4OZ3A 1C0AA 4EBDA 4ED8A 4ZN1A 2HAIA 4FBUA 2L9NA 1IR1A 1N5YB 4AYBD 4A3CC 1O25A 1GMVA 3HHEA 4IRDA 1O0PA 2Y0BB 2HS0A 1XXAA 4BC7A 2PT0A 3G71S 5A8RB 2UV8A 4OZ2A 1IKWA 3DRSA 3MMCB 4WWSA 4ES1A 1U1PA 1VIXA 3OR2A 2ZDOA 1JXVA 4IFYB 4Q5SA 4JUZA 2ZH9A 1UWAA 2QSFA 1S1VA 1INNA 2H3EB 5A8WA 2F4VF 2DPJA 1WHWA 4TY8B 2AV5A 3DLEA 4DR6J 2K1RA 2DNZA 3EXCX 5CZVA 2ZH4A 4EYIB 1YNJA 3CMES 2VFRA 1VQNS 3BP3A 3NNHA 3CJ3A 3RB6A 3UD5A 2RKIB 2VJVA 2VDIA 4DUTA 2LP4A 1SC6A 3ZZ0A 3BBCA 2HRYA 1Q53A 2HPUA 5C2CA 1K0TA 2HNZA 5D4OA 2DCUB 2EXUA 1RABB 4PUOB 2WK4A 4IOAQ 3CJRA 4BHQA 2DKOB 1C0UB 1F2GA 3OUYA 3T02A 4DR7F 4LBPA 5IM0A 4B3MJ 2BJ1A 2FD2A 3SEOA 4NOIA 1FDAA 3K7RA 2OPSB 1RWPB 3G6YA 5HL8A 5JXSA 2XCPA 3TUIC 1XMOF 2VPYB 4DPOA 4WF9Q 5B0CA 4X4RA 4A3FC 1NHKL 4Y52K 2YU9A 2DHSA 2V69A 4P2MA 2PA8L 2QTWA 2VOOA 4F3OA 3CW2C 2BANA 1F2HA 5GADU 4O2DA 2CPDA 4KBIA 4YB6A 2KTQA 1TP7A 3BDPA 3IO1A 2GW8A 3CO9A 1K83K 2DNYA 3GTLK 1RTDB 2EWHA 1NH8A 3PO3K 4KN7A 5L9NA 1UW4A 3FBFA 1KLNA 5HI7A 3GIRA 5E68A 3GILA 2AEMA 3EGNA 4ELUA 3OR1A 4KFBB 5DDOC 3OV7A 3MEGA 4BBSK 2FDNA 2BJ7A 3DHWC 1TWAC 1UVJA 3M2RB 1RT1B 2YXLA 3KWMA 4KHMA 2CNOB 2M8HA 4NCGA 4DPWA 2FGOA 3FUYA 4RUBA 3JAMU 4WTOB 3S16K 4JV5J 1S9GA 3VTIA 4Q8EA 1RT4A 1UVMA 3DLKB 3R2DJ 2AX0A 4CNZA 1F7VA 4ED2A 3EGVA 1S0MA 4M5LA 5J2QB 4ATNA 3G87A 2FVRA 5DGBA 4CYUA 3DU6A 1HFEL 2C1EB 4YMEA 4IQXA 2W24A 4HHUA 3HXMA 5JVGQ 5KG2A 4USVA 3HLUA 1Y3JA 5E3AA 1D8YA 3T5KA 4NEYA 1LXJA 3BP8C 2JA7C 4B3TJ 2VASA 5KFKA 1IKVB 2XYHB 4N56A 4I2PA 4OI0A 2AJQA 5LMNF 1VDHA 2BX6A 1BS2A 3GQCA 2NVTK 2F9DA 3AAWB 3H59A 4DOZA 3BBFA 1J5OA 5HMWA 3HHDA 4ZVSB 5T14A 3SQGA 4P71A 1ZQ1C 2M88A 4CLZA 1A6LA 2V4JB 1GNKA 3C15B 3CNQP 3GWCA 2PIIA 3GYGA 1NH7A 1BQMB 3FQKA 3UR0A 4EO8A 3MTKA 4UQGA 4A93K 2KI2A 3D9BA 1NSAA 3H0GC 3PO2C 4N8OA 2VC0A 2XMJA 3FRYA 5KT6A 5KTQA 3HSZA 4HI1A 3GTGK 1X4EA 4DU8A 3AJ1A 1M1GA 5F41A 5FLXU 3HP6A 3L7OA 2NXEA 5E5NA 2JX2A 3OLAA 4OJHA 1FT8A 3FKBA 1FCAA 2NXNA 3C66A 1DTQA 3M9NB 4QYZK 1N32F 4CH7A 3ILOA 2RF2A 1SKWA 1WCMK 3J81j 2BJ9A 1K8AT 3DGVA 4RWWA 4C48A 1NZ8A 1RT7B 3GTOC 3LTOA 3R8YA 1T9WA 3E3XA 4GKKF 1L3SA 2YWFA 3ZZTA 5K8NA 3QJJA 1EAYC 4C0OC 4C3HK 1EFWA 5IZHA 3LAMA 1WQGA 4A3GK 2C28A 4DR5F 4BWJA 4DSEA 4X65J 4MKAA 5DDQC 2K06A 4Z7YA 1ZS6A 1H72C 3FRZA 3Q2SC 4UUWA 4RW9B 3R6LB 4PXBA 2P2CB 2AJ0A 2HFZA 3TW0A 2C42A 2DD8S 1HD1A 4G65A 4WXOA 2L41A 3MAHA 3H4DA 3GTJC 3T19A 1WHYA 4FZBA 2YNFA 4BXXK 2PDAA 3V6HA 2MDAA 2HLUA 1L0WA 2F63A 1EKRA 2HNYB 2GVZA 3BSCA 4CT9A 2KDOA 1QVGR 3GR0A 3HVWA 3SYZA 5ETSA 4J3NA 3C6TA 2HZCA 3ULHA 1M5HA 3GFYA 1TKZB 4JI3J 1TMJA 2P9CA 5KFXA 5ETVA 4DPYA 2QMWA 1Q7LB 3W61A 4K0KJ 1SH0A 1LW0A 4LFCF 4ZVRB 4FZVA 1RB0A 3SXLA 2CPFA 1QM9A 4QYZJ 1YITS 4DI6A 1TKZA 3M4XA 1GE9A 4CNYA 4ECSA 5DG7A 3I32A 1BGWA 4IRKA 4EO6A 3I6PA 2B6AA 2BYCA 2ROGA 2NZ4A 2RKIA 1FRIA 3CCQS 1NB2A 4QIFA 4LRBA 4YFNA 2OP5A 4WP9A 1RUSA 2J0SD 2HNZB 4ELVA 4MFBB 4R8UA 2W7AA 4ZVFA 3D7SB 5IYDC 1LOUA 2IDLA 1N8RT 2DHHA 3OXLA 1YKWA 1Y1WK 1R8HA 1N34F 1SC1B 3I4MC 3RTVA 3BQ0A 2OPSA 1USOA 2R7ZC 3SQOP 3VGSA 1HBNB 3NBPA 2ZEJA 1B64A 2ADBA 3MR7A 2O5IA 4FXWA 1WSRA 2BW7A 2NXUA 2GSUA 2DH7A 1YJRA 4RW6B 3PV8A 4RBUA 3SFGA 3MUVP 4MAKA 4DV6F 1JKHB 2GO8A 2GA7A 5LXYA 2ZHAA 2HQFA 4QR2A 4B9UA 1M90T 1FXLA 4ECVA 5C3EK 1RTDA 5IORA 2JA7K 3CJ4A 1GXLA 3OXGA 2Z8QA 3G8QA 3H0GA 3ZTRA 1UA1A 2VUMK 3OVSA 4D3HA 4A3GC 2VBZA 3TVKA 4KFBA 1QSYA 4M5KA 4LF5J 2HGLA 1BC6A 3FCHA 1TWCA 4C4WA 1FJGJ 2E5HA 4WPAA 3GTOA 2VG6A 2RH6A 3HSGA 1NDKA 4LBIA 2KXHA 1LNQA 4G0VA 5IP9K 4O4GA 2POKA 4ECRA 1I6HC 4JI1J 2VQEJ 2IYIA 4PWUA 2DNHA 2H4WB 2PGCA 4QW9A 4CTAB 4CLUA 2IJRA 1VISA 4GTBA 2IPOB 4PQAA 2YVSA 1Q8BA 2C2MB 3KMQA 4L6V3 4P7TA 3MR2A 2HURA 2YU9K 3KLFB 2MPUA 4MJKA 2A18A 1VHFA 1FWKA 3DC2A 2QX0A 1S1XA 3M6WA 4JYAF 2L9DA 3UO0A 4KMUA 3NNAA 2NVYC 4NZ6A 1O29A 4HHJA 3GTLA 3I4NC 2FPHX 8AT1B 4PWWA 2WW4A 4LSLA 3AXKA 3PACA 1RACB 3D3BJ 3HOZK 2ASYA 4F4KA 4RKUC 4M94A 3R7SB 3KHRA 5DS7A 3P96A 1RHJB 2JFKA 3JAMY 4RU9A 3QO9A 2O67A 5LXRA 3BN4A 4LVOP 1WD6A 2N7CA 4NL5A 3LUYA 4FXVA 3MPVA 2VPXB 3TO8A 2R7ZA 5E41A 3PDNA 5A0YB 1P1LA 2RHSB 2VF3A 1Q78A 4HACB 5JMNA 3RRGA 2UXDF 1T11A 4LR9A 3S2HK 2JLEA 1Q1KA 4ECXA 4QR1A 1P9YA 1RWKB 2LCWA 2MLXA 4N76A 2KG1A 2FTRA 2BE5A 2CWXA 4CLLA 3F56A 4G1QB 2IJFA 2G13A 1PAUB 4OZ5A 2AP6A 4HACA 4W92B 1TQLA 3VWSA 4WCEQ 3S1QC 1C0TA 4RNFA 1MU2B 3VALA 1DHMA 4A8QA 2E44A 2YU9C 2FHOB 4O44B 4K4UA 2X3GA 3JSYA 2NXJA 2ZNYA 2XHWA 5FJ8K 4DR1J 1TWCC 2CDRB 4YS2A 4A8WA 1ZETA 2XLJA 4B3OA 2IJNA 2CKWA 4MKBA 1OPIA 3FCWA 3S16C 1VGXA 1IJEB 5A8WB 4TYAA 3CWJA 4CO3A 1EARA 2E5GA 1JXEA 4GTCA 1S48A 2EBGA 5H1SV 4X65F 3MEDA 3DXBA 2JA5K 4CLKA 5IV3A 1TTHB 2ACYA 1K83C 5E3QA 2VQFJ 5CCLA 2DPIA 2CADA 2WVEA 3IRWP 4WE1B 1NKEA 3Q8QB 3DYAB 5HQMA 1C1BA 2ASDA 3OREA 3CC4S 1X8DA 3I82A 4M95A 1RT3A 1U26A 5HSPA 4KSEB 1KTQA 1E6VB 1S12A 3HOWK 3LPYA 2PD1A 2VV5A 5C2GA 2MB0B 5D0HA 4A3IC 2ZM6F 2CQDA 3QIDA 3J7ZT 4DF4A 2QYGA 3U1LA 2YNIA 2LEPA 3DM2A 1RA7A 3IR6B 2DXFA 1IBAA 5FJ4A 2CZVC 4HLBA 3N4WA 3NCPA 1IJFB 4TXSA 3HCXA 4QR0A 1DBDA 2XS7A 1PJ6A 4FBTA 4TU7A 1RHUB 4Y2AA 3MAAA 1S6PA 4Y00A 4TNOA 4KB2A 3B4DA 4DCPB 4Y7NK 4DV1F 3WC2A 3AB4B 2DGXA 3MM9B 5K14A 4JI5J 1C2PA 3UD3P 1U25A 3GTKK 4LIRA 1V3SA 4A8SA 1VBZA 4KGXB 3EICA 4QBUA 3O2IA 5IFMA 3RG6A 3I4HX 2W2QP 3P45B 1HARA 3WBZA 2J9DE 2MZ1A 3HM9A 1EKSA 3HF5A 4NLWA 3VAMA 1VR6A 3I9V9 4MFBA 3GTLC 4EGLA 5HROB 1R9TA 2MZJA 4DV3J 4WYLA 4DR4J 2XZTB 2NVXC 3DLKA 5CHPA 2F40A 3CCWA 5IXUA 2E2JK 3DCAA 4Y34A 2ZM6J 2FY1A 1JB0C 4DPUA 1HWJA 1RTJA 4A8XA 2MJNA 2XGQA 3LALA 1RSCA 1S9FA 1GMUA 3GEHA 4K8RA 2Z2YB 1NKBA 1Q8IA 2OPQB 1ZOTA 3HOUC 2L48A 3AH6A 2ZD1A 3DOKB 1X4DA 1MW7A 3QRQA 4LFCJ 2AYMA 3UW1A 5GAEI 3R7NB 1FKPA 1GFWB 3VCDA 3EVMA 2OEJA 3GV7B 4Y2KA 3LP0A 4ZP7A 1X5OA 2B4UA 4TY9A 4DZDA 3GV5B 4Y7NC 1N54B 1JJCB 3W2WA 3QGIA 5HO4A 1WKLA 2ZD1B 2CQBA 1TFWA 3DI6B 3CQZA 4C3KA 1REVA 4JI3F 1S4FA 2QYCA 1FESA 3N0VA 2KRBA 2N7YA 4LRDA 5CYQA 1KD1T 1EQRA 1JJ2R 1EX8A 2WOMB 4O4GB 3S8SA 2GSOA 1WF0A 3H20A 1YNNA 5HLFB 4F4YA 2MSTA 1GAOA 4L76A 3GTYX 3MM8B 3GJTB 1J98A 3KJQB 4I7FB 2FVSA 2FGCA 1HD0A 4YB1P 3L3CA 1FNXH 5EGYA 1D09B 3C6UB 2V8GA 1RP5A 4LJZA 2OH2A 4Y3CA 4J9SA 3BZQA 1FJGF 4LF8J 3BGFA 2HQGA 4CO1A 3MMLB 1DTQB 4UOHA 2H48B 1B3TA 2MKHA 3I5BA 3S14C 3IFEA 4HR2A 2V2ZA 2QLXA 2ALYB 3NAHA 5I4MA 5A2QU 2PHCB 2BE9B 2OTLS 3LO3A 3CCVS 1H2VZ 5F9LA 3A8JA 1MROA 3LAKA 2OO4A 2HGNA 4ETXA 5ETOA 5EWEA 2FQQB 2VICA 4ZJOA 4DV7J 2EW9A 1T9UA 3IRXB 4F7VA 1TWGA 2YQ3A 4C3IK 1QLNA 2V2QA 1VI7A 2R7ZK 2GHPA 2JNJA 2XBPA 4NLGA 2M5YA 2XY6A 2IBKA 1HA1A 1ZM2A 2DNQA 2ZBQA 1SC4B 3ITHB 3MEEA 4ZN3A 5C24A 4OYOA 2J8SA 3BF4A 5F8JA 5IP7K 3GR1A 1J6WA 4DLGA 1A0OB 4XDCA 4OX6A 2HQ3A 3HZGA 3I9ZA 2OHDA 3ZXWA 2MJUA 2JEJA 4FF3A 3OEPA 3FSXA 3NS7B 1TWFC 2J8AA 3KLIB 4OX9F 3CIZA 2EFOA 1ZAWA 5CZXA 4M5DA 4ZITA 3PW0A 2PE8A 3M4OC 2PFDA 2R3VA 4ES2A 5IWAF 4X66F 2F4FA 2K2PA 2M70A 4G1PA 3MCSA 3EXYA 1WOSA 5IYCC 1MMLA 4AQYJ 2G0JA 1TZ0A 1IBCB 4BBRC 4LQ3A 3M8PB 2WONA 2ZDPA 2QFJA 3VAKA 4LF1A 5KFBA 1NK8A 4WFBQ 1VLYA 2MXYA 1CS4B 1YJ9S 2EBBA 1FX4A 1O2BA 3QSYB 1N5YA 3W66A 4F50A 1YJ7A 5C4JC 3HT0A 3SIPB 2UVWA 4KKOB 3OLBA 3L4JA 2NVXA 4K4WA 5A8RA 4F36A 1BLUA 1IKWB 3DN9A 1QTMA 2R92C 2HQDA 3I0SA 1S97A 1D0EA 1TAQA 3RB3A 4G6VB 1J6XA 5EX0A 4DV4F 3EZUA 3K0JA 3JYTA 2L3MA 1UP1A 3KDNA 1SI9A 5F8MA 4DDQA 1R0CB 1X9SA 4DFJA 5HN0A 5DLFA 1WQHA 3W5XA 3L7UA 4IRCA 1YTYA 4L72B 4H4OB 3CCTA 1ZA1B 3I4NK 4RNNA 3I0SB 4HVZA 1RADB 4K2JA 5GAHU 2N3LA 3Q86A 1SIWB 3DLHA 1TKDA 4RU2A 1WI8A 5L8RC 3KOAA 4YDDB 1QAYA 2KU7A 1KNZA 5MAOA 2QGFB 5CD4H 3BSNA 1FFWB 1TWAK 2AYBA 5JFEA 1F9FA 2HHVA 2NLWA 4OZ0A 2YWEA 4HT7A 2ZJRQ 2HBQB 5IM0B 1B99A 3QZ7A 1I51B 2Y3YA 1KBRA 2V8VA 4KGZB 5B0FA 3DRRB 1RKJA 3C16B 3OT9A 3TUZC 4J9OA 2OAUA 3C14B 2JA5A 1VYAA 4CZCA 5C44C 1X31C 2B8PA 4XPCA 1DRZA 1K44A 1ZYQA 2BANB 2V4RA 2D3O1 2W9BA 1HNWF 1WG4A 3HZEA 3C14A 4OIPA 1B70B 4TVAB 4DV4J 1W2BR 3MR3A 4AXIA 1WKJA 1WWHA 3SSQA 2C3UA 2XMMA 1UVKA 2XZWA 1UZHA 3HHNB 1R8BA 1EQ0A 3PO2K 1HYSA 3CE8A 4ER8A
chains in the Genus database with same CATH topology
1VLOA 1XZPB 1V5VA 1WORA 3A8IA 1XZQB 3ADAC 3GEIA 1XZQA 4P9SA 3TFHA 4PABA 1VRQC 3GSIA 3AD8C 1WSVA 3AD7C 4PAAA 2GAHC 3AD9C 1WOOA 3A8KA 1XZPA 1PJ7A 1PJ6A 1WOPA 3TFJA 1X31C 2GAGC 5L46A 1WOSA 1YX2A 3A8JA 3GEHA 1WSRA 3TFIA 3GIRA 3GEEA 1PJ5A 3TTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLO A;  1XZP B;  1V5V A;  1WOR A;  3A8I A;  1XZQ B;  3ADA C;  3GEI A;  1XZQ A;  4P9S A;  3TFH A;  4PAB A;  1VRQ C;  3GSI A;  3AD8 C;  1WSV A;  3AD7 C;  4PAA A;  2GAH C;  3AD9 C;  1WOO A;  3A8K A;  1XZP A;  1PJ7 A;  1PJ6 A;  1WOP A;  3TFJ A;  1X31 C;  2GAG C;  5L46 A;  1WOS A;  1YX2 A;  3A8J A;  3GEH A;  1WSR A;  3TFI A;  3GIR A;  3GEE A;  1PJ5 A;  3TTG A; 
#chains in the Genus database with same CATH topology
 4K59 A;  1JMT A;  2XLK A;  3Q23 A;  2DR7 A;  2YX4 A;  2R92 K;  2JA8 K;  1FE0 A;  3FGV A;  5DDP C;  3M9M B;  2RUG A;  1U2R A;  4J9Q A;  2YKO A;  5J1E B;  1ZXO A;  4OHV A;  3AFG A;  4MH8 A;  1BQN A;  5GMK a;  3KLE A;  1I50 A;  3IS9 B;  1NLK L;  2UV8 G;  1X9W A;  5AE2 A;  3T1H J;  3EYZ A;  2IA0 A;  2RB7 A;  1OWX A;  5CQG A;  1RTJ B;  3QZ8 A;  3BO4 A;  3GFZ A;  5CYM A;  4PEO A;  4J90 A;  1PIL A;  4KYZ A;  5GVQ A;  2UU9 J;  3LWM A;  1IBK F;  3PEJ A;  4YG2 A;  4F2R A;  4CLT A;  3CDW A;  5J2Q A;  1BWE A;  4DR6 F;  4BY1 K;  3AOC A;  3BGO P;  3MGJ A;  5HMX A;  4LOW A;  5LJ3 Y;  2YTC A;  3H5S A;  2DNG A;  2K7J A;  5LMN J;  5KG6 A;  3PX6 A;  3R5C A;  3PYD A;  2V6T A;  4NLS A;  3V4I B;  1U0H B;  3MM5 A;  2L08 A;  3GTM A;  1UA0 A;  5F8L A;  2XMA A;  4DFM A;  2HS4 A;  5H9E J;  2VQF F;  3JB9 k;  3H2U B;  4QW8 A;  4EUV A;  3M1V B;  4AND A;  5AXM A;  3MPY A;  2HVD A;  3UVJ A;  3QT6 A;  5CYQ B;  2MQL A;  4DJB A;  2O3D A;  5CH7 B;  3FFI A;  4F3M A;  1RBO B;  1I6V A;  2M52 A;  1RBL A;  2JC1 A;  1S7I A;  4O0N A;  1O6X A;  2UUB J;  4USW A;  2V4J A;  4MEX A;  3W9I A;  3BO3 A;  5KFY A;  3TR5 A;  4TU8 A;  4TQR A;  2CQ4 A;  1FD2 A;  4QU6 A;  3S2D C;  1KP6 A;  1PC4 A;  1VQ8 S;  4RJV A;  2KT3 A;  3K7A K;  1U09 A;  1S6O A;  3CJS A;  2M2B A;  4F26 A;  2ZH7 A;  1RT5 B;  3H2V E;  3WC0 A;  4ECQ A;  2R7S A;  3OVB A;  3PIO Q;  1Z2Z A;  1NB7 A;  3H25 A;  2NPI A;  4P75 A;  4C3J C;  2QEX S;  1DCP A;  2M4M A;  2AGO A;  4A3E K;  4AT1 B;  1IBL F;  3RBD A;  1ZPV A;  4G3I A;  3D6H B;  4OZL A;  1RWN B;  2XMT A;  4XTT A;  3RZO C;  2HHH J;  2MTL A;  3FBE A;  4NX9 A;  3OTO F;  1M1H A;  2E66 A;  4Z37 A;  2WRM A;  4J9P A;  2YY3 A;  4LVN P;  2N4C A;  4NRT A;  1TEL A;  2BV3 A;  4OHY A;  5AJ3 J;  4UOG A;  5KFF A;  3OFF A;  3I4M K;  1CLF A;  5CYJ A;  2YBV A;  1MNE A;  3LP1 B;  3AH5 A;  4NLV A;  3CVK A;  2CJA A;  2DXD A;  2NRE A;  1SJ4 P;  2CJY B;  5LMU J;  4IOB A;  1WF2 A;  5U47 A;  5J2N B;  4P10 A;  1LQ9 A;  2HLT A;  2FQT A;  4B9V A;  3GII A;  4O3S A;  3KHG A;  3PTW A;  4DF8 A;  2NVQ C;  4A3L C;  4QIE A;  2R7Q A;  1R3N A;  1NND A;  2O5J A;  3OSN A;  1T94 A;  3B8H A;  3KXD A;  3S0X A;  4JV1 A;  4KTQ A;  3CD0 A;  2D6F C;  4GTL A;  2CJB A;  3MCM A;  1N33 J;  3ZNU A;  2GQ2 A;  1TU0 B;  1YJT A;  1HNV A;  3FMB A;  2ZVI A;  4GTA A;  3P3D A;  3HKZ D;  2VQE F;  5C42 A;  1LFP A;  2VL1 A;  3PW5 A;  4C11 A;  1FRM A;  3U1M A;  2OEM A;  2DGW A;  1IKY B;  2OEL A;  5K14 B;  3OSP A;  1ELO A;  3D3C J;  1ROF A;  5I3Q A;  3OW2 R;  5LT5 A;  1IQT A;  1KVJ A;  5E2Q A;  4IR9 A;  4IH5 A;  2AHO B;  2EFP A;  3R3T A;  2DR9 A;  1S49 A;  4KGV B;  4ZKA A;  4I6A A;  3B6B A;  2XGP A;  3DLG A;  2BRK A;  3TX8 A;  2BJE A;  3W63 A;  5HRO A;  2A68 A;  1SKS A;  3V5R A;  2BE2 A;  2BOP A;  4I6Y A;  1Y9O A;  4A3D C;  3AJD A;  3DLG B;  3J7A N;  1AW0 A;  5GAD I;  2MY7 A;  1R0A B;  5HAO A;  4QQB A;  1RYS A;  1M5S A;  2CPE A;  2BXJ A;  1X5P A;  2IAJ B;  3D67 A;  3VVT A;  2IY5 B;  2R42 A;  1NEE A;  1FKO A;  2MGZ B;  1TL1 B;  3OL8 A;  5KG4 A;  3ICL A;  4LMZ A;  3PM9 A;  1Y1V A;  5D78 A;  1FDB A;  3DRX A;  2DNR A;  1S6Q A;  3WQP A;  4RUH A;  1T9X A;  1YSJ A;  1HQE B;  1U45 A;  5IT9 Y;  4J7C A;  3SZ2 A;  3ADA C;  2W4D A;  2KKH A;  3M8Q A;  1AUS L;  2OIH A;  9RUB A;  4RO0 A;  4LF5 F;  2GMH A;  1S6Q B;  1R8P A;  5EGE A;  1T7P A;  2B63 K;  3S2H C;  2KYX A;  4HH0 A;  3T1H F;  3K89 A;  3ILJ A;  3US5 A;  3T1Y F;  3CUL A;  1MSW D;  2E1P A;  3IR7 B;  2H5J B;  4UT4 A;  1IUJ A;  2J76 E;  1RT2 A;  4NI2 B;  4NXM J;  1ZYR A;  1TVR B;  4CI0 B;  2MZR A;  3DGP A;  2QL9 B;  2CIM A;  5TMC A;  1FK9 A;  3KLG B;  3KK2 B;  1VHI A;  1HPZ B;  4PZV A;  4RNM A;  3UDC A;  4JI0 J;  1OJ4 A;  1G7C B;  3ILL A;  5CYM B;  1NPR A;  2BKP A;  1EB0 A;  1J6V A;  1L3K A;  2XO7 A;  2ZHO A;  2V0N A;  2ZUA A;  4BDP A;  4ICL A;  4KPC A;  3CF5 Q;  3G82 B;  5HBM A;  4JK1 A;  2MQM A;  3MUR P;  4O23 A;  1ZBT A;  5F8I A;  2RS2 A;  2AZ1 A;  4ILR A;  1WKK A;  1JQG A;  4P9S A;  3TWZ A;  1EET B;  4DN9 A;  1ZBS A;  4XO0 A;  4C3H C;  5IT0 A;  1WJ9 A;  3UN3 A;  3R5D A;  4WJ3 M;  2JEG A;  1NJW A;  3ET6 A;  5D0R A;  3LAP A;  4LSL B;  4ECT A;  4MYT A;  3ZO7 A;  4L73 A;  2HBR B;  3I87 A;  2OLW A;  1JNZ B;  2MKI A;  5C4J K;  2ATC B;  2DHG A;  4FDF A;  5AE1 A;  2WSC C;  2W2M P;  3AD7 C;  3TFJ A;  2DRA A;  3FFI B;  4DV0 J;  3GDZ A;  3LGM A;  1WTF A;  3KG0 A;  2A6H A;  1RTI A;  1TL5 A;  2VA2 A;  1HBO B;  2MEW A;  2XNQ A;  2YKP A;  2ILY A;  7FDR A;  4M5D B;  3VGV A;  5A0Y A;  4C0B A;  2ZUF A;  3UI3 A;  3N6L A;  1WOR A;  2FB0 A;  1YVF A;  1KOO A;  5I42 B;  5L1J A;  1DJ0 A;  3NP5 A;  2RRN A;  2BQ3 A;  1MN7 A;  1PJ7 A;  1LV5 A;  3PG9 A;  4C9D A;  1RU1 A;  3Q24 A;  1KWM A;  4OZJ A;  2I8E A;  1C0T B;  1MU2 A;  2XYP B;  4NML A;  2XMK A;  2VUM C;  3EX7 B;  1I50 C;  4ILM A;  4PWD A;  2XLI A;  1JX4 A;  5ITH A;  3MPD A;  5C4X K;  1Y10 A;  2DK2 A;  5AT1 B;  3EVO A;  4NZ0 A;  2E2H A;  1C4C A;  2J7K A;  4DS4 A;  4PG5 A;  2BKN A;  4Z2X A;  2VOP A;  1HWL A;  2KM8 B;  5H9F K;  4R5P B;  4C6A A;  4OIR A;  3CCS S;  2QC3 A;  4GZY A;  4LT6 A;  4FS2 A;  1K73 T;  2UZA A;  1YJU A;  2E1A A;  3MXH P;  1K1Q A;  4NLD A;  3LP1 A;  5KFH A;  1XER A;  1YX2 A;  5BYQ A;  2CNN B;  3HT3 A;  3OTE A;  3KG4 A;  2XO6 A;  1N32 J;  3M30 A;  3NWR A;  1RIS A;  1WEZ A;  1I3Q K;  4P2X A;  2V4Q A;  1C1B B;  3UNG C;  3Q8V A;  2E29 A;  1KTV A;  3TFI A;  3H8Y A;  1MMN A;  1S10 A;  4CQ1 A;  2CVI A;  4Y0F A;  5FDL B;  2G0I A;  3MR6 A;  2AKW B;  3IWX A;  4DV3 F;  4ZCI A;  1X4C A;  3R1H A;  3PKY A;  3R1L A;  1WDT A;  3N0B A;  2RHQ B;  2QIF A;  3ZTQ A;  4OZ1 A;  4KC6 A;  4OL8 A;  4URS A;  3NCR A;  3QSI A;  1ZM4 A;  4LRF A;  1LEO A;  4HTI A;  3TQE A;  3L7P A;  2CQ3 A;  1O28 A;  4YDX A;  2R8G A;  4DWI A;  5KFR A;  3C3L A;  3GIJ A;  2XUL A;  1FO1 A;  2OD6 A;  2AF6 A;  2PEH A;  4DDF A;  4QPX A;  1U1Q A;  2BMB A;  1SIZ A;  4WK1 A;  2PO4 A;  1DQ8 A;  3BKU A;  5DM6 Q;  5JUM A;  4OJ1 A;  4GC6 A;  2H1Y A;  2RD5 C;  2J9D A;  3LPE A;  3I5A A;  1Y11 A;  4ZVG A;  1I6H K;  3SBM A;  1FE4 A;  1PAE X;  3JST A;  3EWG A;  3M8R A;  4DL2 A;  1YJN S;  2EG2 A;  5KT7 A;  1RBA A;  1VJW A;  1SJQ A;  1P9Q C;  1CUL B;  4HDH A;  3S1N C;  1L3T A;  2OSR A;  3NKY A;  2IVF B;  1Y5I B;  4K4Z A;  2H4Y B;  4ANC A;  1M5V C;  1D9F A;  2MGZ A;  3I56 S;  2ZVS A;  1VQS A;  3M05 A;  4N7T A;  1YHQ S;  2B9W A;  2HHT A;  3MOZ A;  3CCL S;  4O4R A;  4IOC Q;  3H2L A;  1VRT B;  4ZVE A;  1MWY A;  3QNW B;  1DQ9 A;  2JDJ A;  1XR7 A;  2KZM A;  3EUN A;  4G7H A;  3FBB A;  1NJI T;  2E1M C;  2Y9H A;  1S9E A;  3R7B B;  3GTO K;  5DQI A;  2A2C A;  9ATC B;  1SC3 B;  1JLE B;  4RUC A;  4P72 A;  4YHH F;  4C2M A;  1GX6 A;  1KKH A;  1AA1 B;  2DY1 A;  2CUY A;  1NXI A;  1Y3K A;  1ZTW A;  2QN6 B;  2V34 A;  3BH6 B;  1TVR A;  3QAE A;  2NVY K;  3O3L A;  3MPU B;  3JXO A;  1REV B;  5GAH I;  1K9M T;  4KO0 A;  2OUG A;  2ZH1 A;  5K9F A;  3V6D A;  1Q7Y T;  4KMA A;  2F8H A;  2VG5 A;  2FYX A;  1NDL A;  3KFW X;  2YNG B;  3ZZY A;  1YGY A;  3S1Q K;  3TJA A;  1N48 A;  1W7W A;  1TWH C;  3GTG A;  2F8M A;  4ZA1 A;  2HAF A;  4ED4 A;  5GAE U;  1UFW A;  4Q7A A;  1WG1 A;  2ALZ A;  1Z2L A;  1RYR A;  3W2V A;  5BXI A;  4BY1 C;  2AT1 B;  3GV8 B;  4GTD A;  1VOM A;  1U47 A;  4I6W A;  3J81 U;  2EFN A;  3VF0 B;  1I94 J;  1WC3 A;  4AYB L;  3DOM A;  4X62 J;  2FHM A;  1EET A;  1TFY A;  4F02 A;  2BEF A;  2E1R A;  3N5B A;  3D4J A;  1Y5L B;  2Y1R I;  2D41 A;  5L38 A;  4X84 A;  4B9S A;  3W9H A;  4KV8 B;  4NA3 A;  5HVF A;  4I64 A;  2X1F A;  3AD9 C;  2I0X A;  5EX3 A;  4CLS A;  2CPJ A;  1YRX A;  2VB6 A;  6AT1 B;  2LEA A;  4JI8 F;  4ZK7 M;  3DOL A;  2MQN A;  1SJ3 P;  3K5P A;  2HQI A;  4OIX A;  2C3P A;  1G4C A;  1ACM B;  3TJ8 A;  2VFT A;  1F1B B;  1YBU A;  4OHW A;  4OIQ A;  2AU0 A;  4AFF A;  5KFG A;  4QJV B;  1EH1 A;  2W2P P;  2XSJ B;  4OFZ A;  4A3J K;  2MHE A;  3GSD A;  2HMI B;  2V68 A;  2WVF A;  2K3K A;  2CDQ A;  3TNV A;  1C1C A;  4WFN Q;  1XQI A;  2V67 A;  3FZ2 A;  2NSB A;  1VC5 A;  2RDD A;  2JH3 A;  4DX5 A;  2D1C A;  2QL7 B;  5KFQ A;  5B7W A;  1B4B A;  2OPP B;  2VC1 A;  1FDD A;  1S59 A;  3TZX A;  5FD1 A;  4JI6 F;  1X4F A;  5T41 A;  3P5T L;  1QUP A;  2XCQ A;  1XNR J;  3H42 A;  4PWD B;  2RE1 A;  1JIH A;  1RT1 A;  3N6M A;  4B3R J;  1ICE B;  1GT8 A;  1M5P C;  4USU A;  2AX1 A;  1B7Y B;  3H5X A;  4FM9 A;  4LLG A;  2RDI A;  3M8S A;  4EEY A;  2QZ8 A;  3JTP A;  3X1L B;  3AQP A;  4A48 A;  1G1X A;  2LYV A;  2WSE C;  1I94 F;  3PX4 A;  2EK6 A;  3HD2 A;  2W7O A;  1RU2 A;  2W9C A;  1WI6 A;  5DG9 A;  1VH2 A;  4NLP A;  1NME B;  2JZ5 A;  3I96 A;  3WIU A;  4A8Y A;  1I5O B;  1RWX B;  1I3Q A;  1CJU A;  1S6U A;  4W90 B;  4JI2 J;  4A8M P;  5D15 A;  1F5B A;  1K1S A;  2MHN A;  1U1R A;  3ZFV A;  2QA1 A;  3IN5 A;  2COL A;  3IBC B;  2CXE A;  5CXT A;  4Y52 C;  1X60 A;  1SCJ B;  1IR2 A;  4Y65 A;  1OY9 A;  1S1W A;  2J6S A;  4Y2I A;  2F7V A;  1J5O B;  1KQG B;  3W9J A;  4RW8 A;  3CT9 A;  3D6F B;  3OTB A;  3TA1 A;  2FJX A;  5C25 B;  4ZP8 A;  4U8Y A;  2KJW A;  2C2E A;  5B0D A;  1NHU A;  2E2I C;  3D68 A;  2IYG A;  3CQZ C;  2DB1 A;  4RR5 A;  2NVX K;  1J27 A;  3ELH A;  1PYO B;  4Q2L A;  4YR3 A;  1NJZ A;  3IGN A;  2OI2 A;  2V8P A;  3S15 K;  3N0C A;  1UMJ A;  2IMW P;  1Y0H A;  3D28 A;  5CAA A;  3HOV K;  4OJG A;  2E7V A;  3GE9 A;  2V9W A;  4MKY A;  2RH3 A;  3FOF A;  3OTD A;  4YUD A;  2PEB A;  3EGW B;  2BOA A;  2DGQ A;  1HW8 A;  4IUF A;  3KK2 A;  4F3Q A;  1HNW J;  1KON A;  3OFG A;  4QIW L;  2GCF A;  3A12 A;  1MG7 A;  4IR1 A;  2BW2 A;  3MMB B;  2JVR A;  3M6V A;  1EP4 A;  4ECW A;  2J0W A;  2XYG B;  5B0A A;  4M5G A;  1IW7 A;  3MCO A;  1GXT A;  2GFF A;  4NLQ A;  5A8K A;  1L3V A;  2JJ4 D;  5HBM B;  3MAQ A;  3A3O B;  3GCX P;  4YHH J;  4DN0 A;  2QO3 A;  3RBZ A;  1IM6 A;  3G4C A;  2DY9 A;  2ZZT A;  2RS8 A;  3JTO A;  3K57 A;  3TQ1 A;  2ZE2 A;  1NK9 A;  3T1A A;  3Q8Y A;  4DSJ A;  1VQ9 S;  1UET A;  2LLZ A;  4A3I K;  4BBY A;  2IVY A;  1TKX B;  2R7W A;  2R8J A;  2ZJQ Q;  3SV3 A;  2M8D B;  2HFV A;  2VBW A;  2VUG A;  2P9G A;  4LIW A;  2KM8 C;  3V4I A;  1BHN A;  1X4H A;  1JOE A;  2MQO A;  2R7O A;  4DV5 J;  4LSN A;  2YNF B;  1XXC A;  5IP7 C;  3ZTS A;  3HVR A;  4G7Z A;  2BZ2 A;  1ZAV A;  4ZDN A;  2UUC F;  3LP2 A;  2YKM B;  1UFL A;  4FYX B;  2YWW A;  1OIA A;  3FEX B;  3FQL A;  1FD8 A;  3GTK C;  2XMV A;  3MUT P;  2DIS A;  2QA4 S;  3IM9 A;  4UOF A;  1R8C A;  3D0I E;  1CJV B;  2LXF A;  7AT1 B;  1IL2 A;  2GVD B;  3G9C A;  2C2Z B;  4NXM F;  3OVA A;  2XM3 A;  3RW7 A;  3DNC A;  3SDE A;  1O51 A;  1KQ4 A;  2AGP A;  4F0K A;  2DIV A;  2D69 A;  4DV2 J;  2H9Z A;  3C15 A;  3NGK A;  3ZC4 A;  1AB8 A;  4A46 A;  4ID5 A;  3UCU P;  2VFV A;  5LJ5 Y;  2KHC A;  2MZQ A;  4XIU A;  2OPR B;  3SSR A;  5E33 A;  5B0E A;  2B6A B;  4IFY A;  3AY0 A;  2CFX A;  1RT5 A;  1Y7P A;  5IC4 B;  4AQY F;  3NAI A;  1OYD A;  1X9M A;  4KV8 A;  4ZVQ B;  1N6Q A;  1MWQ A;  4AL7 A;  3W62 A;  4J9K A;  3K5N A;  1N5T A;  4TKT A;  3B54 A;  1V5I B;  3BB5 A;  1H74 A;  1UFK A;  1VJQ A;  1LFW A;  2BAC A;  3DOL B;  1DLO A;  1V3R A;  4JI8 J;  3QJL A;  2FLN A;  3F41 A;  1X4G A;  3BR9 A;  2B7B B;  1P8G A;  2ZH2 A;  2GML A;  2G0C A;  2LDI A;  4QIV A;  3G6E S;  1O8B A;  2XQC A;  1AZS A;  1RT6 A;  4PUO A;  4QJV A;  1HQU A;  5L9X A;  3L95 X;  4K0K F;  1DLO B;  2IMO A;  1NKC A;  3HJV A;  2EFG A;  3CD5 A;  1G2E A;  3PRV A;  2HVZ A;  3M2V A;  3GG1 A;  3PYG A;  1CEZ A;  2DYA A;  3M32 A;  1I1G A;  4ELT A;  4MIA A;  3DU5 A;  2DT9 A;  1JXL A;  1Q79 A;  3HOY K;  2A6M A;  4C0H A;  1F6T A;  5FDL A;  3CDA A;  3JQJ A;  3FJ2 A;  3HKW A;  2QSW A;  1FHT A;  4DL4 A;  1S76 D;  4PR6 A;  1Y1W C;  4USH A;  2V6A A;  2GGP A;  2R7R A;  3GSI A;  2CRL A;  2R4F A;  4AE5 A;  1DAX A;  1T03 A;  2E7W A;  4QPT A;  1RTH B;  4DL3 A;  4PAB A;  2GGP B;  1VQ7 S;  2HFU A;  5KFV A;  4RW4 B;  1FWL A;  1XBW A;  4C3M A;  3M2R A;  3KK3 A;  4NEZ A;  3C6T B;  4DQP A;  5ADZ A;  3BGU A;  3NY0 A;  4J5O A;  2DO0 A;  5DZ7 A;  5KG1 A;  4UST A;  4DL5 A;  5KFC A;  4YR2 A;  5F0U A;  4NCB A;  2IM3 A;  1F3F A;  5IT4 A;  4RW4 A;  4GRS A;  2ZHB A;  2ILZ A;  4PQU A;  4USM A;  3DDI A;  1HI0 P;  4GVL A;  1RT4 B;  4P52 A;  2K7K A;  1U1M A;  2ZWP A;  5RUB A;  1S1X B;  4Q44 A;  3N79 A;  1SL2 A;  3IM8 A;  4OI6 A;  3DRS B;  1RHM B;  3KK1 B;  2BE2 B;  3QT7 A;  1D9A A;  1N56 A;  2CYY A;  3FDS A;  3KJF B;  3I4P A;  4WJ4 A;  2HHS A;  1JLC A;  3T1Y J;  3DKD A;  4DUY J;  4WU2 A;  4A3B K;  5AE3 A;  3QO9 B;  3HOX C;  5KT5 A;  4B3T F;  1RWM B;  3ISN C;  5IWA J;  2ATL A;  3Q8R B;  1IKV A;  3TVZ A;  2RQ4 A;  3GPA A;  3N3Y A;  2AWZ A;  2KT5 A;  2D9O A;  2VG7 B;  2Z58 B;  3FEY B;  5A6W A;  2DNP A;  2V50 A;  1TAU A;  1NM2 A;  3C46 A;  1CC7 A;  3J7Y U;  3NBP B;  2D7S A;  3WIV A;  2N82 B;  3GCW P;  1F7U A;  2Z57 B;  2VG7 A;  1JLG B;  2RQM A;  4LF6 J;  5EDW A;  4EYH B;  2J6T A;  4LF9 F;  4YFK A;  4DUY F;  4O3Q A;  3D0H E;  3G8T A;  2W1B A;  3GTJ K;  2GNK A;  4L3N A;  3FK4 A;  2RDJ A;  1F0X A;  1VQ4 S;  2JA6 K;  1URR A;  5CD4 A;  4DV7 F;  2XI2 A;  2GIF A;  4K4S A;  2EVZ A;  3PJ9 A;  3EDR B;  3CTR A;  1S99 A;  2HZV A;  4BKW A;  1PYT A;  1JLB B;  4OLO A;  1S5Z A;  4K4T A;  5KFP A;  3MHY A;  5IOT A;  4Q45 A;  4QIG A;  2UUT A;  5KFW A;  4WP3 A;  3FSY A;  4F2S A;  5M5Y K;  3BKT A;  4OYZ A;  4CDI A;  5BR8 F;  4DR2 J;  3T5J A;  4A3E C;  4ICL B;  1KHV A;  4RBT A;  2EFV A;  1UEU A;  2LU1 A;  3T6B A;  2M3D A;  3HVT A;  2QMU B;  2FLL A;  3O6Q A;  1WHX A;  2AGQ A;  3BR8 A;  3I5C A;  4KHP J;  4B08 A;  2UVR A;  4KAI A;  2X1G A;  4LR2 A;  4DHV A;  4V19 X;  4PG4 A;  5E3P A;  5D4P A;  1RXO B;  4EZ9 A;  4NXN J;  2QJ3 A;  2B4P A;  3JSM B;  3T9Z A;  2J0X A;  2VU5 A;  1JLA B;  2JEI A;  2AMC B;  4DSK A;  4IDK B;  4LJM A;  3D0G E;  2HIQ A;  3MD1 A;  3MEC A;  4IG3 A;  2EBE A;  2B4O A;  4A8K A;  6FDR A;  5DLG A;  2ROP A;  1IS1 A;  2MKS A;  4KJI A;  1XN9 A;  2MYF A;  3CCM S;  2VKR A;  2R93 A;  2XTJ P;  2BQU A;  4LFB F;  1EIY B;  5IYB K;  2A3J A;  4JV2 A;  2P8T A;  3MAA B;  1RZM A;  2MKY A;  4J37 A;  3DRY A;  2VIH A;  5KFD A;  4TQS A;  4DSL A;  5F8N A;  5I42 A;  1RA6 A;  3IC1 A;  3ILI A;  2FHJ D;  2HWI A;  2OPR A;  3QJP A;  2AEF A;  3CCE S;  4B02 A;  1XNQ J;  5KFJ A;  4OHZ A;  1T9T A;  1VQO S;  2MKC A;  1B4S A;  1M5O C;  2GSN A;  4ZLN A;  2UXB J;  1RCO B;  2ZZM A;  2RQC A;  3QX3 A;  3PW4 A;  3BGR A;  1CQM A;  1KQK A;  3TUJ C;  4QIW D;  2OML A;  2X1B A;  2OFG X;  5F8H A;  4F0H A;  5DGA A;  1K47 A;  2DXE A;  2KG0 A;  5SZT A;  4PXC A;  1EJ7 L;  4RPF A;  1IXK A;  1PIE A;  1HNX J;  3PZP A;  1RT6 B;  4NCA A;  2BJ3 A;  1BQX A;  3CMQ A;  3DXJ A;  4R5P A;  2RVJ A;  3D2W A;  3JQM A;  4RL1 A;  4DZ6 A;  4JI7 F;  2ZWO A;  4LK0 A;  2O5D A;  3BRE A;  3KJV A;  3AXM A;  1WG5 A;  2AEJ A;  2M0G B;  3MM7 B;  3Q2T C;  2C2N A;  1KS2 A;  3W8G A;  4KGK A;  3KJN B;  2ZH8 A;  4EU0 A;  4KPY A;  3M30 B;  1NZA A;  3FEZ A;  3E2E A;  2JRS A;  3EGZ A;  4F4X A;  4DV5 F;  1TK5 A;  2KRR A;  3OD2 A;  2UXC J;  1R6V A;  2IC3 B;  4JI4 F;  2CQ1 A;  4I56 A;  4ED7 A;  2HKE A;  3EPI A;  5JVH Q;  1RAE B;  2CQH A;  2W8K A;  1QVF R;  1E6V A;  3T3F A;  2GS8 A;  3PYF A;  1KDN A;  3D66 A;  2LVW A;  2ERR A;  4LQ9 A;  1S7H A;  3RYL A;  4H4K A;  3KK3 B;  3TZW A;  4ENO A;  3TAM A;  1NBE B;  3H98 A;  4KMH A;  4I7F A;  2HNY A;  4XPE A;  1BUX A;  2GVZ B;  4F4W A;  2YH1 A;  3NUH A;  1Y1W A;  1RWV B;  2R8K A;  1QSL A;  4KQZ A;  2JA7 A;  1UJ6 A;  2Q79 A;  3HVA A;  4H54 A;  3BS9 A;  1S6P B;  3H4B A;  3A3N B;  3WZ0 A;  4X62 F;  4E8U A;  4WBF A;  1H38 A;  3M8Y A;  4K5S A;  2X7I A;  2HG4 A;  2DTJ A;  2A1B A;  2ZOM A;  1VK3 A;  4NWB A;  3CJ2 A;  3W1Y C;  1U8S A;  2JVO A;  1A9N B;  2QLJ B;  4YR0 A;  2OTJ S;  4M1X A;  3I0R A;  1U0S A;  3R5B A;  3D1O A;  3BPS P;  1TV6 B;  4ED0 A;  2KL8 A;  1CUL A;  3T6J A;  3HHL D;  2QLB B;  1T02 A;  2RU9 A;  4GKJ J;  1RTZ A;  2XCR B;  4KB4 A;  1KOH A;  2ZFZ A;  3G6X A;  1RGV A;  2F65 A;  3BN7 A;  4CLW A;  4C98 A;  4DQR A;  1L3U A;  1H6K X;  4A3K C;  1PO6 A;  2V2K A;  2L9W A;  1YZ6 A;  1UAW A;  3FSI A;  3FHZ A;  1Y5N B;  3TZZ A;  3E8O A;  3R9L A;  2HS3 A;  4U8V A;  1NRK A;  4ZCM A;  5H9E K;  1N36 J;  4I68 A;  3WX4 A;  2BA9 A;  1WEL A;  2JFD A;  3GJQ B;  4LF2 A;  5D77 A;  4FP9 A;  4EMD A;  4HDG A;  1JLE A;  4KHR A;  4P6Q A;  4WFX A;  3AHP A;  5G0R A;  2EG1 A;  3MOJ B;  4DPT A;  4QZV B;  3CDU A;  3D1Q A;  2CJX B;  4KM8 A;  4LRE A;  1T9V A;  2WSF C;  3PKM A;  3CXC R;  2I5J B;  1S72 S;  5FLM C;  1F5A A;  1JLB A;  1WNE A;  3FZB A;  4ILD A;  3OR2 B;  3G8S A;  2HND A;  4U96 A;  3BEG B;  4K2X A;  3GB0 A;  1QAJ A;  2VG5 B;  1S1V B;  3BSO A;  3GG0 A;  2D9P A;  4TY8 A;  4DPX A;  4ZPA A;  3MCN A;  2XY7 A;  2DBB A;  1F9E B;  4MIW A;  5KFU A;  1YRU A;  2CWK A;  5C7P A;  3ZZZ A;  5KG0 A;  1OSD A;  2B4V A;  2Z56 B;  3HOV C;  3CJK A;  3CCR S;  1U24 A;  5ETR A;  1HNZ F;  1FEE A;  1XZQ B;  1B0V A;  3CD7 A;  4NE9 C;  4JI0 F;  1J5E F;  2QA4 G;  3HFV A;  4PG7 A;  1FRX A;  1XR5 A;  3IA0 A;  3CJK B;  3RZD K;  3CPW R;  1WC5 A;  1CJT A;  2ASL A;  4JI6 J;  1REG X;  1HW9 A;  3A8K A;  3D6T B;  1WCM A;  5M3M K;  1Q4R A;  2YNH A;  1N5V A;  1WF1 A;  2GJ2 A;  4CLP A;  1QE1 A;  4FYV B;  3V6K A;  2HVE A;  5HQL A;  4IG3 B;  2CG8 A;  3E51 A;  1GQE A;  4YY3 F;  1YLX A;  5EWG A;  2AYG A;  4ANE A;  4A3D K;  2WAQ D;  4NLX A;  4LFA F;  3R5G A;  2O01 C;  4C8M A;  1XIQ A;  2B9X A;  2BVZ A;  2E1C A;  5C4X C;  4ED3 A;  8ATC B;  2HMI A;  2HHQ A;  4CCH A;  5SUH A;  1X0P A;  3RRH A;  1HI8 A;  1VBY A;  5KG3 A;  1EZZ B;  5M3F K;  3A4T A;  4YEA A;  2P6T A;  3NG8 A;  3DFE A;  3P49 B;  2EEY A;  5C24 B;  3K5O A;  4WJB A;  4F4A A;  1RAA B;  4O0I A;  3UWT A;  4CLF A;  2ZBI A;  3KLH B;  4G0W A;  3J80 Y;  2KJV A;  1S1U A;  5ETQ A;  2DR6 A;  4ZLL A;  1FJ7 A;  4M5J A;  2CQ0 A;  2JSX A;  3Q22 A;  4N8N A;  1WOP A;  2JA8 C;  3BQ1 A;  4A3K K;  2CAJ A;  1GK8 A;  4EFA C;  4DQI A;  3BGR B;  3KUH A;  4C45 A;  2A6O A;  4M5N A;  4TU9 A;  1U48 A;  2G2Z A;  1YCL A;  5GAG I;  4BC9 A;  1N34 J;  1OMS A;  5J1E A;  1B0T A;  5DZ6 A;  4HTJ A;  1BQN B;  3KLE B;  4RNO A;  2Q3P A;  1OPZ A;  1HBM A;  4URQ U;  3MMC A;  2VZ9 A;  3ERE D;  1T3N A;  4PQU B;  1ISE A;  5JVO A;  3NMA A;  2KO1 A;  4EWT A;  4NYP A;  4BY7 K;  3NS5 A;  4FYD A;  4WYW A;  3QFH A;  2KYZ A;  3GLJ A;  1XPP A;  2WZ1 A;  3LH2 S;  4DUZ J;  2VHG A;  1SUQ B;  2B5J B;  1VIO A;  4ED6 A;  4K7Q A;  3HHL A;  2RJZ A;  2RIL A;  1RQ0 A;  3JS9 A;  3MWB A;  4FNH A;  2Q1L A;  3VAI A;  2IFX A;  2WHO A;  2HQC A;  2C2R A;  3MED B;  4PXE A;  3HD1 A;  1ZTT A;  3EVW A;  3PR4 A;  2DH9 A;  1FER A;  4J9U E;  5BJR A;  3G4S S;  4RWX A;  2EPI A;  2E9Z A;  4E2F B;  4DBQ A;  3GFH A;  1IVZ A;  4C2M C;  1WUU A;  2DNN A;  3K5M A;  4U7U D;  2DO4 A;  5HK4 A;  5F0W A;  5HQ8 A;  1FVS A;  3RAM A;  4A3B C;  3HFZ B;  4WZM A;  1S4E A;  1XMQ F;  1XXB A;  3M4O K;  1RT3 B;  1JLG A;  4A3C K;  3QGP A;  3PFE A;  2CJ9 A;  3UNY A;  1VQY A;  4EZ6 A;  2OFH X;  5LM7 E;  2ASJ A;  3HHK A;  3KTQ A;  3E01 A;  5T7L A;  4LR7 A;  3C16 A;  3GTJ A;  2V9K A;  1IQZ A;  4IG0 B;  2YNI B;  3MM8 A;  3TVY A;  4GKK J;  2M9K A;  1S0O A;  3KYL A;  4DR5 J;  4FF1 A;  3BSA A;  4NYO A;  2LQ5 A;  2HHW A;  2YPZ A;  3C6U A;  4DMZ A;  3A13 A;  2VD3 A;  4AUK A;  2LKZ A;  4N5S A;  3Q8U A;  2RQK A;  3PXG a;  3PFO A;  4BCA A;  4CH1 A;  1SVD A;  4C8O A;  2GO9 A;  1P6T A;  2KFY A;  1HMV A;  4K50 A;  3V81 A;  3PY8 A;  3OPF A;  4RMF A;  1N36 F;  3T01 A;  4NCG B;  2KT2 A;  2Y1L B;  1VK8 A;  4USJ C;  2RRB A;  3N01 A;  5MLC V;  3QLH B;  3R5J B;  4WFA Q;  3A3P B;  5D3G A;  3LW5 C;  1D8Z A;  1WC6 A;  2V8H A;  4FKX A;  3O1L A;  3TAR A;  3O44 A;  3CJ5 A;  3MDF A;  4NMX A;  5F8G A;  1OY8 A;  3OJS A;  4FYY B;  5HJX A;  4DL6 A;  2QL5 B;  2V8D A;  3QLH A;  1UCN A;  1SBR A;  3W60 A;  2V6S A;  1L5U A;  5GME A;  1XZP A;  4P2S A;  2GIQ A;  3IWL A;  4HI2 A;  3TRG A;  2Z2Z A;  1PBA A;  1KHW A;  3MMA B;  2X1A A;  4ZIW A;  4KAW X;  3VAG A;  2VH7 A;  3SMZ A;  1RAF B;  4A8F A;  1S57 A;  2IM2 A;  3LF0 A;  4WIQ A;  5E0O A;  2AIR B;  2G9O A;  1KQS R;  2FHK A;  2BE7 D;  5HP1 A;  1FRJ A;  3QWU A;  2E5J A;  1E6Y B;  5A76 A;  3KNG A;  2DEJ A;  4OYP A;  4C97 A;  5C42 B;  2NYI A;  2OD4 A;  2CNK B;  1FRK A;  4BS2 A;  2Q66 A;  2IM0 A;  1FVQ A;  2BUN A;  2W9A A;  4A3L K;  2CVE A;  1KN6 A;  3GTQ K;  4CM2 A;  1U2F A;  4X4P A;  1U1K A;  2EI5 A;  1DUR A;  5D4D A;  3AOA A;  2KN4 A;  4N47 A;  1HBU B;  1HHT P;  4LF7 J;  2AJ1 A;  3DLE B;  3JQK A;  2Y1J A;  2ZOG A;  2ZH3 A;  2WCX A;  2E2H K;  4X6A C;  3GMG A;  2PC6 A;  1OO0 B;  5KOX A;  5KG7 A;  3THT A;  4AL5 A;  2GX8 A;  1T3O A;  4HH1 A;  2CPY A;  4A3F K;  2B43 A;  4GVB B;  1FXD A;  4A8O A;  3A8E A;  1R31 A;  3NL0 A;  4H4K C;  2PMZ L;  2HVI A;  5D6G A;  1CPZ A;  2ZUG A;  4OJ3 A;  3ETO A;  4GVB A;  4YN3 B;  4ETZ A;  3S1N K;  2KB2 A;  5THW A;  1U6B A;  3FKI A;  1HQU B;  4PAA A;  6FD1 A;  3QRR A;  4CRJ A;  1ZPW X;  3LPX A;  4QOT A;  1HQE A;  1QTN B;  2E5I A;  1NCL A;  5M5X K;  2C3Y A;  2NR0 A;  1VMB A;  4Q43 A;  1NSP A;  3HI9 A;  3DRR A;  3VGT A;  2W2O P;  4AXJ A;  3M6U A;  1SL0 A;  2MZS A;  2ZFH A;  4CM0 A;  2OMO A;  5KOW A;  1HNI A;  3NCQ A;  4QYR A;  3M9O B;  2A69 A;  3GIK A;  2NPF A;  1U7L A;  2DNK A;  2PMZ D;  1XNQ F;  3TOQ A;  5K8P A;  3GTP C;  4WXW A;  1BGX T;  2A6E A;  4ZCL A;  1FX2 A;  4C7Q A;  5HAT A;  5A2Q Y;  5KFE A;  3WX8 A;  1HNI B;  1IBM F;  1BE4 A;  1WEX A;  3HX9 A;  2WBM A;  2KH9 A;  1HBM B;  4DL7 A;  2FZG B;  1SKR A;  3THP A;  5KT2 A;  2V63 A;  3SSS A;  2LXI A;  1H7X A;  3T9N A;  1PSD A;  2E5L J;  2A10 A;  4R0E A;  4XLP A;  2KHD A;  3M8P A;  1YDL A;  1HQ2 A;  3UCG A;  2WON B;  3NLC A;  1N5Q A;  3CJQ A;  4KC5 A;  2RU3 A;  4B3S F;  1O2A A;  3PJW A;  2O1P A;  4P5B A;  3VA7 A;  4USK A;  2B8Q A;  3NOC A;  1KVI A;  4DSF A;  5B0G A;  4ZCK A;  2VKZ G;  3PIP Q;  3OL7 A;  1X4A A;  4ZPV R;  3NGT A;  4O3R A;  1TUW A;  2DGS A;  1N5S A;  4BLA A;  2YKA A;  3ET6 B;  4I2P B;  3DDK A;  1JLC B;  2W01 A;  3S14 K;  4I69 A;  1YJW S;  1RCX B;  4YB7 A;  3GON A;  5KFT A;  3BYR A;  4USI A;  1JLF A;  1IWG A;  2E2H C;  4HEA 9;  2GHW A;  1JWW A;  3MFI A;  4KR0 B;  1LKZ A;  1Q5V A;  3VAH A;  3Q0A A;  2ZBR A;  5LSR A;  1SPB P;  3H5U A;  2Q43 A;  1PGZ A;  3W5Z A;  3FKI C;  1JLF B;  3NGR A;  3NGU A;  2WTF A;  2YKN A;  1X5T A;  4O44 A;  1SB6 A;  1CJK B;  5EWF A;  2EC2 A;  2JL9 A;  4Q2M A;  1EK8 A;  2IHR 1;  1M1K T;  4XK8 C;  1RHR B;  4PPD A;  1IKX A;  1TWF K;  3O8W A;  4YP3 A;  2N3O A;  3F0N A;  2JLF A;  1XC9 A;  1NK6 A;  3OJU A;  2YQ1 A;  3BKF A;  1W25 A;  4JV0 A;  1NSQ A;  2J0Q D;  4K4V A;  4LF6 F;  3W7B A;  2GJF A;  4TN2 A;  2HFS A;  1BWV A;  2RF2 B;  3PRD A;  3GZ7 A;  2CQC A;  1OS5 A;  1IBK J;  2DR5 A;  4ZLP A;  3FBC A;  2AW0 A;  5LL6 d;  3KLG A;  3T41 A;  3KNA A;  4JV5 F;  1KVK A;  2R2T A;  4NZ7 A;  4IH6 A;  4B9N A;  3RBX A;  3H0G K;  3HMJ G;  1RK8 A;  3QMQ A;  4OYB A;  3HHL C;  1RAO A;  2ZBP A;  2P9E A;  2R7X A;  1TWC K;  3LAN A;  2LEC A;  5AXL A;  1FI4 A;  2Y8Y A;  3HVT B;  1I50 K;  4X6A K;  1XZP B;  4LSZ B;  3IS9 A;  1CVJ A;  3TA2 A;  4KAT A;  4J9N A;  3T5H A;  2PA3 A;  1HL6 A;  3M6X A;  3OFH A;  3KUE A;  1UVI A;  3DXS X;  2DRD A;  1R9T C;  1WC0 A;  3R2C J;  4FVC A;  4F25 A;  3SZZ A;  1AXQ A;  1WC4 A;  5HL7 Q;  1RWW B;  3M8W A;  1NU4 A;  2CQP A;  2CPX A;  5LMU F;  2HFN A;  1F93 A;  2GJI A;  2W8L A;  4JBC A;  3QIP B;  1MWZ A;  3BDE A;  4BY7 C;  5IQQ A;  3NGD A;  1RE1 B;  2DEI A;  1SQG A;  2MLZ A;  3MM5 B;  3H7H B;  4OMF G;  3MR5 A;  1XJW B;  2ACM A;  1NSK L;  4ES3 A;  5AJ3 F;  3HKZ L;  5IYD K;  2VFU A;  3CJ0 A;  3M1V A;  3TEH B;  2G2Y A;  4UZB A;  2RUS A;  3CDE A;  1HBU A;  3BM7 A;  2C2O B;  3ETM A;  1XWL A;  4ZJL A;  4LFB J;  2HHH F;  2ZC3 A;  1FJE B;  3POT B;  1S1T A;  3PRB A;  3NRB A;  1ZM9 A;  4OI3 A;  2F9J A;  3DHX A;  3RZD C;  2Z30 B;  1SJF A;  5C44 K;  1R0B G;  3M8Z A;  1BY9 A;  5F9N A;  3BQ2 A;  4NYZ A;  4DV0 F;  2JA6 C;  1HHS A;  2HWH A;  2RSQ A;  2R8I A;  4A93 C;  2GHV C;  4RX6 A;  1NAQ A;  2WB1 L;  1EHW A;  2J5A A;  4EBE A;  1QJH A;  2FJW A;  1U1N A;  4XAK A;  4R0J A;  3IGV A;  4JI1 F;  4EI2 A;  1VRU A;  4PG6 A;  1TL3 A;  1YBA A;  1N0U A;  1YRT A;  1HQM A;  1Y00 A;  5L1K A;  2OPQ A;  2E9T A;  1TWA A;  1QD1 A;  5ETN A;  2NVQ K;  5E7O B;  4FYW B;  1IE0 A;  2LA4 A;  1FTC A;  2P8I A;  1WCM C;  1FKP B;  1O27 A;  2QFI A;  2FVQ A;  5K8M A;  5CHC B;  1VRU B;  2DVI A;  3MM7 A;  2G2O A;  4GC7 A;  2HBZ B;  3H3V L;  5GMD A;  2LQJ A;  1NPP A;  2DGU A;  3AOD A;  3OHB A;  4F67 A;  2AJ2 A;  3AB2 B;  3IBF B;  2Z4P A;  3WOD A;  1VQ6 S;  3RR8 A;  2NVT C;  3PO4 A;  2CG4 A;  4PPZ A;  4KN4 A;  4W98 A;  4AH6 A;  2E2I A;  5E3C A;  2VG6 B;  4Q0B B;  4TLQ A;  2WVD A;  4A47 A;  3J7Y I;  2CPI A;  2Z2L A;  1G6B A;  2NYH A;  2FZC B;  2M7S A;  2Y0S L;  1AFJ A;  4B3S J;  1NJY A;  5KFZ A;  5D8H B;  2UUC J;  1BXN A;  2K8G A;  4JI5 F;  3ENA A;  2WVC A;  2CQG A;  4LF9 J;  4DL0 C;  2EKN A;  3HOZ C;  4CTA A;  4IG0 A;  3QAU A;  3FKI K;  4I1T A;  1GTH A;  4ZVP B;  5DJB A;  3QQC D;  3DLJ A;  4LFA J;  4OX9 J;  2B56 A;  1UPM B;  3D1H A;  2HBY B;  1HIY A;  4NA2 A;  4KDD A;  2VBY A;  2YQ0 A;  5M5W K;  1MRO B;  3A1Y G;  4K4X A;  4BLG A;  3QRP A;  1DQA A;  5IOL A;  2RML A;  2XS2 A;  1ZZN A;  3RAQ A;  3H0P A;  2ZKU A;  1WTB A;  2A0F B;  2GAH C;  2MMY A;  3QGH A;  3P8B B;  3G6V A;  5HMY A;  1NK4 A;  3NGS A;  2FJA B;  4FKY A;  3KLV A;  3TFH A;  4R8U B;  2IVM A;  3BH7 B;  3BUE A;  4HT5 A;  1X4B A;  5C3E C;  3UR3 C;  4WFZ A;  4ECZ A;  4F04 B;  4NOH A;  1DCO A;  3KLI A;  4PYD A;  5IS2 A;  3R27 A;  4URG A;  1R0A A;  4AD6 A;  2UUA J;  3AD8 C;  2MSS A;  1TUG B;  3SI8 A;  4Y2C A;  4IH7 A;  1NDC A;  1BDF A;  1FRH A;  2HIY A;  3DOK A;  1KLM A;  2UVU A;  1HBO A;  4DG1 B;  2JHE A;  1YBT A;  3S17 K;  2QLW A;  2XS5 A;  3PW7 A;  4OV6 A;  4G1Q A;  3UCZ P;  1CC8 A;  1VQP S;  4C3I C;  4ERD A;  1TMM A;  2V2V A;  3F44 A;  2GV1 A;  3QGG A;  1CS4 A;  4NLU A;  3EJM A;  1YIJ S;  1LW2 B;  4M5M A;  2HK3 A;  3KG1 A;  4CP5 A;  4UW2 A;  4DG1 A;  1JJ4 A;  1Q8L A;  1FNO A;  1U2C A;  1S79 A;  4N77 A;  5BYS A;  5KFN A;  2FY8 A;  3CGI A;  3M8Q B;  2G4B A;  4C8K A;  2VUM A;  2I5J A;  4WU3 A;  4ED1 A;  2Y3P A;  1WIH A;  5B0B A;  1ZM3 A;  4B3O B;  3HSJ A;  4HYK A;  1IQ0 A;  2XEX A;  1VFJ A;  2ZC4 A;  2XMW A;  2F4V J;  3UN2 A;  1QY7 A;  2Z2M A;  1H98 A;  5K8O A;  4H4O A;  2F3J A;  3HOW C;  2YNG A;  3SCJ E;  3BV8 A;  2F5G A;  1USM A;  1VLO A;  1XZQ A;  1XMO J;  3HDS A;  4DUZ F;  5IT9 U;  4BLB A;  4WE1 A;  5IYB C;  1K0V A;  5CAB A;  1EI6 A;  4MK7 A;  1Q16 B;  2DR8 A;  3OHA A;  3DYA A;  4V19 J;  1KSP A;  4WTY A;  3R5A A;  3SV4 A;  4MQ9 A;  4QWE A;  2DCL A;  4DR7 J;  4Q4Z A;  3I55 S;  4X66 J;  3LWL A;  1DFD A;  4DV1 J;  4LF4 J;  3CAG A;  2HSE B;  3RZA A;  2JOQ A;  2XSF A;  1QE1 B;  2E2I K;  4ZH4 A;  3P4U B;  3L4B C;  3F73 A;  2YWH A;  3DM2 B;  1PYS B;  5IQ6 A;  2Q6C A;  3CSK A;  4MK8 A;  2OKQ A;  1TK8 A;  1XNR F;  3BBB A;  5GAG U;  5DQG A;  4OV1 A;  2XG8 A;  1R7I A;  2EC0 A;  4UQT A;  3VZH A;  4OI2 A;  4GTE A;  2HHU A;  1RHQ B;  2LEB A;  1CSJ A;  2CPZ A;  1XK8 A;  2W4C A;  1PG5 B;  1HNX F;  3CMA S;  5ETL A;  3RU0 A;  1BD6 A;  2EKY A;  1VBK A;  1SL1 A;  3ENQ A;  3X3U A;  3M2U B;  1S1U B;  2MQ8 A;  1CBK A;  3V2U C;  2IRU A;  3MF5 A;  3IBW A;  4A3M C;  4ZPB A;  2YH0 A;  3IR5 B;  2NS1 B;  1SJR A;  1U02 A;  3DRP A;  3MMJ A;  3AQO A;  5L1L A;  1N4L A;  5K5M A;  3H5Y A;  3D54 A;  3HOU K;  4LF8 F;  2PPB A;  3QYY A;  4R25 A;  4J9V A;  1EP4 B;  1AUD A;  3K2Y A;  1QSS A;  1WOO A;  1TR0 A;  4A3J C;  4IQM A;  1B7F A;  3DRP B;  3S15 C;  4LQY A;  2C2K B;  1IBM J;  1WEY A;  4ZIV A;  3KUG A;  4TLR A;  3VQT A;  3OL6 A;  2KFN A;  2CJK A;  5ETK A;  4OZN A;  2CW0 A;  1ULR A;  2Y8W A;  2ZE2 B;  1R9T K;  3GYX B;  4DR1 F;  2R8H A;  3PCO B;  2KZZ A;  2FJB B;  1NK7 A;  2XCO A;  4G1I A;  4S0M A;  3G4A A;  4I4B A;  3N6N A;  1HNZ J;  3UPF A;  1LWE B;  3OBI A;  4NLO A;  1U1O A;  4Y28 C;  3VHQ A;  2IBO A;  1RKI A;  1S9E B;  4O3N A;  2IRY A;  3IWN C;  3EDQ B;  5DRK A;  3RUB L;  4DX6 A;  4Q0B A;  1LWE A;  3DI6 A;  2CFA A;  2EFQ A;  2Y0S D;  5KFS A;  3S1T A;  5B09 A;  1VQK S;  5D4L A;  2YKM A;  2D3U A;  1LWF A;  3H40 A;  3KHL A;  4QWA A;  1IR0 A;  5J2P B;  4ECY A;  1KQF B;  1AFI A;  4RW8 B;  2LQB A;  2CFA B;  4XSX A;  1IM4 A;  5AXN A;  2I38 A;  1LWC A;  1I6J A;  5C25 A;  1CJK A;  3IP0 A;  5IV4 A;  1AYE A;  3CUN A;  1DCH A;  2YKQ A;  2VPZ B;  4B9M A;  3PO3 C;  1H0H B;  1B4A A;  1NJX A;  2Q6B A;  2VJU A;  4X2B A;  5T7L B;  1JLQ A;  4X4Q A;  1IKX B;  4YFU A;  3FC9 A;  2W9B B;  2ADC A;  3ISZ A;  3Q83 A;  4F4Z A;  1PJ5 A;  4P5A A;  1LWC B;  2XWY A;  2I6W A;  1RU0 A;  3MUM P;  1NPK A;  1U1L A;  3GTP K;  4CH0 S;  2O66 A;  3AT1 B;  4DSI A;  4UY8 T;  3LAJ A;  4CLY A;  1UTA A;  3THV A;  1EQM A;  1N6Q B;  1JLQ B;  2LQ9 A;  2LXU A;  4JOU A;  2JWN A;  5LSL A;  1RJJ A;  4DX8 H;  1Z1Z A;  1TUV A;  1F5C A;  1HMV B;  3HXA A;  3QAT A;  5F3Z A;  2XCA A;  4F8R A;  3PO5 A;  2HGM A;  3KDO A;  5KG5 A;  5I3U B;  3CCZ A;  5KFM A;  4WP8 A;  5KFI A;  2XI3 A;  1G3O A;  2GQC A;  4Q8F A;  4DEZ A;  3A8I A;  2HW3 A;  1SV5 A;  2N4D A;  2HEK A;  1ZAX A;  2CJQ A;  4Q5V A;  4E0D A;  4OYA A;  3ITH A;  1LXN A;  3W64 A;  4KRW A;  1OSC A;  5D4N A;  2HYI B;  3M2V B;  1OQ3 A;  1ITP A;  2E7X A;  3GTQ C;  2SXL A;  4TYB A;  3RW6 A;  4I2Q B;  4OYI A;  5KFL A;  1O26 A;  3D5M A;  1GXU A;  3S1R K;  1HI1 A;  4ZVT B;  1KR4 A;  3RBE A;  4DS5 A;  1IBL J;  3QT8 A;  4ZJQ A;  4P2F A;  3MMA A;  1H2U X;  4PXD A;  2I9S A;  4X4T A;  2AD9 A;  2IRX A;  4FS1 A;  2QRR A;  3N5F A;  4DQS A;  1FKA F;  4KMD A;  3QIP A;  1Q0N A;  3GTM C;  4ITS A;  4F0M A;  3MEK A;  4JI2 F;  1I3Q C;  3IG1 B;  3OPK A;  3CO0 P;  4DV6 J;  3RB4 A;  4PCQ A;  4G0U A;  1NO8 A;  3LP0 B;  4LSN B;  1T03 B;  2LMI A;  1TKT B;  3IPJ A;  1RWU A;  1JK9 B;  2P6S A;  3W2W B;  5M2R A;  4GFQ A;  4C2M K;  1FNM A;  4D3G A;  2PN6 A;  5D0E A;  1VCT A;  4FVM A;  2WOM A;  4QCL A;  3POT A;  2NVY A;  2DHA A;  3QT5 A;  1VQL S;  1RAI B;  3PW2 A;  1VRQ C;  1GMW A;  4GO5 X;  4C3L A;  2FC8 A;  5HLF A;  2EK1 A;  1CJV A;  2VON A;  4J9R A;  3JSB A;  1UVL A;  3ZZR A;  2R2S A;  1WHV A;  3V6D B;  4B3R F;  5BYR A;  3SDE B;  4NAS A;  2BKO A;  4QWC A;  5E3R A;  2BAB A;  2UXB F;  3MM6 A;  4NA1 A;  3S6E A;  2HFO A;  2W9C B;  4EBC A;  3HK2 A;  2K1R B;  1YJV A;  3BYP A;  1VBX A;  5A6P A;  3DLB A;  1HI9 A;  2MQP A;  2PMH A;  4IO9 Q;  1T05 B;  2LDY A;  1PCA A;  3MM6 B;  1TL3 B;  1J5E J;  1RAJ A;  3EZ5 A;  5L1I A;  2DNM A;  1MMD A;  3NXZ A;  4OIO A;  4J91 A;  4MEY A;  2MQQ A;  4IO1 A;  7FD1 A;  3LQV A;  3K17 A;  4M5I A;  3CDB A;  1C0U A;  2E5L F;  2VDH A;  2QV6 A;  4JP8 A;  5J2M A;  2FUG 9;  3CED A;  2NZC A;  3OL9 A;  1RWO B;  2DGV A;  2VOD A;  3HO1 A;  1TL4 A;  1FF2 A;  3TAP A;  3UD4 P;  4J9M A;  3BJY A;  4M1K A;  1I3O B;  3GTQ A;  1X0F A;  3M7V A;  1NK0 A;  2FJE B;  4B3M F;  3VVU A;  1QUV A;  4ID8 A;  3PYE A;  4B17 A;  1G51 A;  1F3V A;  3J81 Y;  4GO7 X;  1V5V A;  1FK9 B;  1T95 A;  3QFW A;  5TMF A;  2BM1 A;  2W2N P;  1HNV B;  2CZ9 A;  4DR3 J;  4QWD A;  2CNL B;  3RAX A;  3FVY A;  3UN5 A;  1WQF A;  3OR1 B;  3OTO J;  3R6G B;  5G4D A;  3O5T B;  5KT4 A;  3PEH A;  3P5B P;  1VJE A;  3TX0 A;  1CG2 A;  4X4S A;  1WSV A;  4UZC A;  2PFF B;  5EUH A;  3PHT A;  1IKY A;  3OQ2 A;  2ZZN A;  1TWG C;  3GP9 A;  3ZTO A;  4DV2 F;  4KE5 A;  2R7T A;  3TZY A;  2B0G A;  1PC5 A;  2R2U A;  3PX0 A;  3Q8S B;  2QA2 A;  4KKO A;  1SMY A;  3HUL A;  1FFG B;  3V4M A;  4CT8 A;  5ETT A;  3RJM B;  1Q81 T;  3SZY A;  4WII A;  4UTG A;  3JYT B;  1MN9 A;  2KVQ E;  1H2T Z;  2IA6 A;  4BWM A;  4OX8 A;  2DJW A;  4PYA A;  4X4U A;  1D3W A;  1U0H A;  3VAJ A;  2VPW B;  3OTC A;  4WZQ A;  2I1R A;  4U7U K;  3TUP A;  4U6P A;  3S01 A;  1HLW A;  2R9L A;  3W65 A;  1FKO B;  1JLA A;  5HMZ A;  1U4B A;  2QE5 A;  3MEC B;  5J2P A;  3NOG A;  3OFE A;  4OYW A;  4ILL A;  1UEV A;  2FJD B;  4V1A k;  1O5J A;  1GH8 A;  1U8W A;  2AYE A;  1KLM B;  1SFO K;  4IFV B;  1HWU A;  2OSQ A;  2RIJ A;  2GIR A;  3UDE A;  4I0W A;  4W4M A;  1R6Y A;  3T00 A;  2UVV A;  3V6J A;  4ZP6 A;  1HHQ A;  1WAC A;  1ZZF A;  2P5V A;  3P6Y C;  2KXN B;  2YKN B;  2J7W A;  3ONQ A;  2UUB F;  5DET A;  3V4G A;  2GVD A;  2FVC A;  8RUC A;  1H7W A;  2MLY A;  5EN1 A;  2AZ3 A;  2OEK A;  1YQH A;  4ID5 B;  3KMS A;  4DXL A;  4MKV A;  5C5J A;  3AA8 A;  3DGP B;  2JEF A;  3K5L A;  2WW8 A;  4AL6 A;  4X4V A;  3ISN D;  4OHX A;  4OYM A;  4DQQ A;  4GTF A;  1Q86 T;  4ZP9 A;  4OIN A;  3WHI A;  4OI1 A;  4PG8 A;  3W8P A;  1HYS B;  1FWP A;  3S1M K;  5I3U A;  4H4M A;  4UF4 A;  3PHE A;  1B0P A;  4QU7 A;  1YZ7 A;  4Y2M A;  3G2X A;  3L9Z A;  3MD3 A;  1YWX A;  2J9E A;  4KH0 B;  4LK1 A;  1HWI A;  1UWB B;  1SV5 B;  2RRA A;  5FII A;  2YX7 A;  2RGR A;  1U6F A;  3K58 A;  3BO2 A;  2R7V A;  2K3I A;  1SXL A;  4H4M B;  1O24 A;  5DO2 A;  2W25 A;  4M63 A;  4J9L A;  2BR0 A;  3MMB A;  2HWT A;  3EE3 A;  1UZD A;  2JA5 C;  1Z4U A;  3B4M A;  1HKA A;  2DNL A;  2V5H G;  5J2N A;  4FPI A;  5A8K B;  4ZHR A;  4LR8 A;  1KFD A;  4KM9 A;  4RW7 A;  2NUH A;  2LFV A;  3K8V A;  4LF4 F;  1M0S A;  1TWG K;  3HOX K;  3SCI E;  4DR3 F;  2WB4 A;  3U02 A;  1S0N A;  2LQ8 A;  4DFK A;  2MKJ A;  2B3T B;  4YQW A;  4L3K A;  4UUX A;  2IC3 A;  3M3Y C;  1DAR A;  3VR1 A;  1TKX A;  2OJ3 A;  2H5E A;  3NEK A;  4DCO B;  2V6U A;  1ZA2 B;  3L4K A;  3CD6 S;  3J80 U;  1N52 B;  4LRA A;  4ZVH A;  2H5I B;  3UVJ B;  5H9F J;  1AT1 B;  4ED5 A;  4X4N A;  4C11 B;  1WDD A;  4CWB A;  2JLG A;  2DNO A;  1RTH A;  3HJF A;  3VAF A;  1XMQ J;  3UQS A;  2ZNZ A;  2BDP A;  2XC9 A;  3CJT A;  3EM1 A;  3M2U A;  2DGO A;  2C3O A;  5JJB A;  2BBE A;  3H3V D;  4Z7C A;  3S7R A;  3D6M B;  3J7A 1;  5IC6 B;  4MT1 A;  2H51 B;  2NXC A;  2D3O R;  3UDL A;  4U95 A;  4RZR A;  2C2D A;  1S1T B;  2XB2 D;  3LA0 A;  3I31 A;  4FXD A;  1R8A A;  3CJ8 A;  4C8Z A;  2XZD B;  1S0V A;  1XMB A;  1Q82 T;  4I67 A;  2ZBC A;  1VC0 A;  4M5H A;  2CZ4 A;  1NK5 A;  2QT7 A;  1F9N A;  2APO A;  5KFA A;  2J7U A;  2R92 A;  4E98 A;  3JTN A;  3KHH A;  4BXX C;  1T8E A;  4NRU A;  1SJ1 A;  3T5L A;  3KK1 A;  2WB1 D;  2IAJ A;  3AOB A;  4OI4 A;  2B63 C;  1RI7 A;  4XDD A;  3LOU A;  1TL1 A;  2PI5 A;  5F3T A;  3HOY C;  2VBX A;  3FOE A;  4RNH A;  1UEK A;  1UV7 A;  1NUE A;  3PJX A;  4KAS A;  3CC2 S;  2J9C A;  1VS3 A;  2GZO A;  3NWG A;  3GFX A;  3FNN A;  4DU7 A;  2NCK L;  3H90 A;  3GTP A;  1DY3 A;  2XNR A;  5IOQ A;  4FPR A;  1SQF A;  4O3O A;  1V6H A;  4WKR A;  3MI7 X;  1J2V A;  2LA6 A;  3S1R C;  4P7V A;  1SH3 A;  4X4O A;  4RLE A;  3M3Y K;  4RW6 A;  4FNI A;  5IYC K;  3GYN A;  1JKH A;  2ROE A;  3KJV B;  1TWF A;  2U2F A;  3CCJ S;  3N9U C;  2IDE A;  4GMK A;  1AZS B;  2VA3 A;  4L74 A;  4KY3 A;  4FF2 A;  3ZZU A;  1RHK B;  3VV2 B;  3NMR A;  1LWF B;  2YX1 A;  3BGL A;  2HRT A;  3CCU S;  4FF4 A;  1R43 A;  1N0V C;  3M32 B;  2QG9 B;  3IAS 9;  5I3P A;  4C8L A;  3ZNJ 1;  2BQR A;  2DIU A;  1DZ5 A;  1HPZ A;  2IM1 A;  2NQP A;  4KT0 C;  4M8L A;  3EPG A;  1URN A;  1KRP A;  1VC6 A;  4RBV A;  1JJH A;  2C22 A;  1F9H A;  5FLX Y;  2C3M A;  3VQS A;  3Q89 A;  2FLP A;  2PMW A;  5LOQ A;  3ZTP A;  3NS6 A;  4LRC A;  3UDV A;  2FLO A;  4O3P A;  3G82 A;  1CQN A;  2XY5 A;  1TK0 A;  4YY3 J;  5D0G A;  3HSD A;  3DMJ A;  1P27 B;  1RDR A;  5HJY A;  4U67 Q;  4XCH A;  1TL7 A;  2B7C B;  1VQM S;  2R93 C;  2XHC A;  2ZH5 A;  2RAQ A;  4CO5 A;  1VGY A;  4MTP A;  5HVG A;  2VFS A;  1YG0 A;  3NNC A;  4A4J A;  4GT9 A;  4YB5 A;  1N33 F;  3RZO K;  4NLY A;  2UP1 A;  4CYU B;  3JSR A;  3GIM A;  1Y4Z B;  3CB4 A;  2ZUE A;  1FTR A;  1UJ5 A;  1GX5 A;  3IAM 9;  2UXC F;  4C8Y A;  1BJT A;  1W2I A;  1R27 B;  5AXK A;  5L39 A;  1RTI B;  2UU9 F;  1HR0 J;  1QAI A;  5IP9 C;  2AJF E;  4X64 J;  1F60 B;  4U7C A;  3J7Z 5;  4WIL A;  4IDK A;  5FLM K;  3RRK A;  1N88 A;  4KGM A;  3B78 A;  4Y6I A;  5LSO A;  2FQO A;  3N28 A;  1XR6 A;  2HVH A;  3SQG B;  4L75 A;  2OGU A;  1LWX A;  4EK2 A;  1ARO P;  5M2U A;  1PKU A;  1UPP A;  4MIB A;  5ETP A;  1TKT A;  1LW2 A;  4MMO A;  4WFY A;  1BMQ B;  2UXD J;  1WC1 A;  1FA0 A;  2FVP A;  2ABY A;  1T9Y A;  4KO0 B;  4DR2 F;  2ZIT A;  3CC7 S;  4WKY A;  4DR4 F;  1H3D A;  3HFK A;  2R93 K;  1U6Z A;  1RT2 B;  4NI2 A;  4ECU A;  2V94 A;  4PKD B;  2GQQ A;  5KFO A;  2FHJ A;  4BBS C;  5M2P A;  1UWB A;  4XLN A;  4CO4 A;  4OLP A;  3GEI A;  2JA6 A;  4KAR A;  3QPI A;  4P74 A;  2H65 B;  3TI0 A;  1CJU B;  5EHH A;  3W2V B;  1Y1V C;  3AJ2 A;  2I2Y A;  4YFX A;  3HPO A;  3U1N A;  3EMT A;  1TWH A;  2XMU A;  5CJ9 A;  4G7O A;  4U9R A;  3U7J A;  2B9E A;  4ZPW R;  3TAN A;  2F1F A;  3RR7 A;  1SUQ A;  4GKJ F;  2B5J A;  1IN0 A;  1T0T V;  2DGT A;  2X51 A;  2W7P A;  2NUU G;  3MFH A;  4PRF A;  3GJR B;  1Q8K A;  1RAH B;  2E9R X;  1Q5Y A;  3GTK A;  5J1P A;  1T05 A;  1GTE A;  4DX7 A;  4KIA A;  4LUB A;  1VQ5 S;  1KFS A;  2HRU A;  3VZI A;  3LGH A;  2Z0G A;  4BBR K;  3RGI A;  3UE2 A;  4JYA J;  4A3M K;  1X7V A;  4P73 A;  4ZOS A;  4JB8 B;  1UW9 A;  5HAN A;  5DM7 Q;  3GEE A;  3AA9 A;  5J2M B;  3TTG A;  5DQH A;  2JC0 A;  2QMX A;  1FRL A;  5CCM A;  4ZPC A;  3GTG C;  2D3Z A;  3FCV A;  2BRL A;  2GC8 A;  1SFO C;  1KEK A;  2XSJ A;  5KT3 A;  4DFP A;  3OUY B;  2P5M A;  1A7G E;  2WBR A;  1C1C B;  3B82 A;  3G96 A;  2KXF A;  3JSM A;  3Q8P B;  3SCL E;  1YI2 S;  1LK7 A;  3K7A C;  3E01 B;  4K5R A;  5DG8 A;  4JI4 J;  3C19 A;  2KVI A;  2QLF B;  3L09 A;  3TAM B;  1UL3 A;  2OPP A;  5J1N A;  2F8E X;  2ZKT A;  5HVH A;  3SCK E;  3BPD A;  4OYX A;  3TA0 A;  1MLA A;  1FXR A;  4ZLJ A;  3MM9 A;  2PA8 D;  3Q3Q A;  1S77 D;  2B9Y A;  1LW0 B;  4NPO A;  3KLH A;  3ZZO A;  1TWH K;  4K4Y A;  3FMW A;  1GMW D;  1SKU B;  3TEG A;  2AJ4 A;  2MZT A;  4XSZ A;  3C8Y A;  1FDN A;  2DRB A;  1FEH A;  1FJC A;  4JI7 J;  4NLR A;  3QBC A;  4NLT A;  3VGU A;  3MEG B;  4DLE A;  1X5S A;  2KWA A;  1TV6 A;  2X3D A;  5IOS A;  4UOC A;  2W4P A;  5D3G B;  2YPY A;  1OQ6 A;  1U49 A;  4YOE A;  4HHH A;  2DH8 A;  2WVB A;  1UKU A;  4N41 A;  2MY8 A;  1VRT A;  4B9L A;  1C4A A;  3LGN A;  3WDO A;  4ZMM A;  3ENV A;  2BM0 A;  3OXF A;  2CA9 A;  1DTT B;  2A2D A;  1S9G B;  1YK9 A;  1P1T A;  2KFZ A;  5CA5 A;  4C3J K;  3U27 A;  1ZVU A;  3DLL Q;  4UY8 5;  2LU2 A;  3IMQ J;  3ZZP A;  3MPW A;  1HBN A;  1UVN A;  1DTT A;  2HZA A;  2ZOF A;  3CIM A;  2GMJ A;  3HHL B;  3TJ9 A;  3S1M C;  1RLD A;  1Y1V K;  4WK3 A;  1S1W B;  3RB0 A;  2HK2 A;  5DDR C;  4B9T A;  4HL9 A;  5KAK A;  5ETM A;  5G0R B;  2H54 B;  4QWB A;  4IFV A;  2FJV A;  5HP1 B;  3W3S A;  1V9O A;  1D1U A;  1O2F B;  2ZH6 A;  4KH1 B;  2NSC A;  1E6Y A;  4DCJ B;  1ZH5 A;  2UUW A;  4IYQ A;  1DD5 A;  2RNE A;  1HR0 F;  1GEH A;  2E2J C;  3KKF A;  4ZPD A;  4ZPT R;  3EZO A;  3GU0 A;  2UUA F;  3R97 A;  2R7U A;  4KB7 A;  2D74 B;  2YWK A;  1SH2 A;  1XTZ A;  2HND B;  1M5K C;  1XEZ A;  1AB4 A;  1NDP A;  4NXN F;  2HHX A;  5K20 B;  2FC9 A;  3MTJ A;  2DIT A;  3IXQ A;  1APS A;  3DMJ B;  2YWG A;  3ENW A;  3PNI A;  1OYE A;  1Q95 G;  2J6U A;  1TL7 B;  2MKK A;  1IWA A;  3DOM B;  2CQI A;  1BQM A;  3TP2 A;  1UJ4 A;  1K83 A;  1SFO A;  3W5Y A;  2FIU A;  3K8W A;  2CPH A;  2CQ2 A;  3PVX A;  3C2P A;  3K59 A;  4KHP F;  4FN5 A;  4X64 F;  5B08 A;  2ZJP Q;  4ALZ A;  2IIH A;  3S17 C;  1RLC L;  4CIO A;  3KLF A;  3TAQ A;  3GTM K;  2U1A A;  4C8N A;  1H73 A;  1QDU B;  4ZS6 A;  4MYU A;  1JVI A;  3UFC X;  3SFU A;  1LK5 A;  2FZK B;  1CJT B;  4LBH A;  4IKA A;  3V81 B;  1QAX A;  2YNH B;  3G86 A;  2R2R A;  2BJD A;  2G1D A;  4HKQ A;  2PSZ A;  3I0R B;  2BJ8 A;  3QWP A;  3IRX A;  2G1H A;  1JQW A;  5BR8 J;  3S2D K;  2Y1I A;  4ZHR B;  2XWX A;  3TYT A;  1RT7 A;  5EGH A;  4RW7 B;  2WAQ L;  2B63 A;  1PBU A;  1W26 A;  4CO2 A;  3MEE B;  4I2Q A;  1KC8 T;  1NHV A;  3PR5 B;  1FFS B;  2AQ4 A;  4MK9 A;  1R89 A;  3EQL A;  2W7V A;  4OX7 A;  1V3Z A;  4ZVO B;  3MZI A;  1JNR B;  4RW9 A;  3DDN A;  3GJS B;  4ZVU B;  1D9D A;  4RUA A;  4CO0 A;  3CQZ K;  2PI4 A;  1RAG B;  5TJ3 A;  1SQE A;  1OY6 A;  3LP2 B;  2B51 A;  2GAG C;  5L46 A;  3IG1 A;  2HHP A;  2RT3 A;  1HWK A;  2DHX A;  4LF7 F;  4OQJ A;  4OZ3 A;  1C0A A;  4EBD A;  4ED8 A;  4ZN1 A;  2HAI A;  4FBU A;  2L9N A;  1IR1 A;  1N5Y B;  4AYB D;  4A3C C;  1O25 A;  1GMV A;  3HHE A;  4IRD A;  1O0P A;  2Y0B B;  2HS0 A;  1XXA A;  4BC7 A;  2PT0 A;  3G71 S;  5A8R B;  2UV8 A;  4OZ2 A;  1IKW A;  3DRS A;  3MMC B;  4WWS A;  4ES1 A;  1U1P A;  1VIX A;  3OR2 A;  2ZDO A;  1JXV A;  4IFY B;  4Q5S A;  4JUZ A;  2ZH9 A;  1UWA A;  2QSF A;  1S1V A;  1INN A;  2H3E B;  5A8W A;  2F4V F;  2DPJ A;  1WHW A;  4TY8 B;  2AV5 A;  3DLE A;  4DR6 J;  2K1R A;  2DNZ A;  3EXC X;  5CZV A;  2ZH4 A;  4EYI B;  1YNJ A;  3CME S;  2VFR A;  1VQN S;  3BP3 A;  3NNH A;  3CJ3 A;  3RB6 A;  3UD5 A;  2RKI B;  2VJV A;  2VDI A;  4DUT A;  2LP4 A;  1SC6 A;  3ZZ0 A;  3BBC A;  2HRY A;  1Q53 A;  2HPU A;  5C2C A;  1K0T A;  2HNZ A;  5D4O A;  2DCU B;  2EXU A;  1RAB B;  4PUO B;  2WK4 A;  4IOA Q;  3CJR A;  4BHQ A;  2DKO B;  1C0U B;  1F2G A;  3OUY A;  3T02 A;  4DR7 F;  4LBP A;  5IM0 A;  4B3M J;  2BJ1 A;  2FD2 A;  3SEO A;  4NOI A;  1FDA A;  3K7R A;  2OPS B;  1RWP B;  3G6Y A;  5HL8 A;  5JXS A;  2XCP A;  3TUI C;  1XMO F;  2VPY B;  4DPO A;  4WF9 Q;  5B0C A;  4X4R A;  4A3F C;  1NHK L;  4Y52 K;  2YU9 A;  2DHS A;  2V69 A;  4P2M A;  2PA8 L;  2QTW A;  2VOO A;  4F3O A;  3CW2 C;  2BAN A;  1F2H A;  5GAD U;  4O2D A;  2CPD A;  4KBI A;  4YB6 A;  2KTQ A;  1TP7 A;  3BDP A;  3IO1 A;  2GW8 A;  3CO9 A;  1K83 K;  2DNY A;  3GTL K;  1RTD B;  2EWH A;  1NH8 A;  3PO3 K;  4KN7 A;  5L9N A;  1UW4 A;  3FBF A;  1KLN A;  5HI7 A;  3GIR A;  5E68 A;  3GIL A;  2AEM A;  3EGN A;  4ELU A;  3OR1 A;  4KFB B;  5DDO C;  3OV7 A;  3MEG A;  4BBS K;  2FDN A;  2BJ7 A;  3DHW C;  1TWA C;  1UVJ A;  3M2R B;  1RT1 B;  2YXL A;  3KWM A;  4KHM A;  2CNO B;  2M8H A;  4NCG A;  4DPW A;  2FGO A;  3FUY A;  4RUB A;  3JAM U;  4WTO B;  3S16 K;  4JV5 J;  1S9G A;  3VTI A;  4Q8E A;  1RT4 A;  1UVM A;  3DLK B;  3R2D J;  2AX0 A;  4CNZ A;  1F7V A;  4ED2 A;  3EGV A;  1S0M A;  4M5L A;  5J2Q B;  4ATN A;  3G87 A;  2FVR A;  5DGB A;  4CYU A;  3DU6 A;  1HFE L;  2C1E B;  4YME A;  4IQX A;  2W24 A;  4HHU A;  3HXM A;  5JVG Q;  5KG2 A;  4USV A;  3HLU A;  1Y3J A;  5E3A A;  1D8Y A;  3T5K A;  4NEY A;  1LXJ A;  3BP8 C;  2JA7 C;  4B3T J;  2VAS A;  5KFK A;  1IKV B;  2XYH B;  4N56 A;  4I2P A;  4OI0 A;  2AJQ A;  5LMN F;  1VDH A;  2BX6 A;  1BS2 A;  3GQC A;  2NVT K;  2F9D A;  3AAW B;  3H59 A;  4DOZ A;  3BBF A;  1J5O A;  5HMW A;  3HHD A;  4ZVS B;  5T14 A;  3SQG A;  4P71 A;  1ZQ1 C;  2M88 A;  4CLZ A;  1A6L A;  2V4J B;  1GNK A;  3C15 B;  3CNQ P;  3GWC A;  2PII A;  3GYG A;  1NH7 A;  1BQM B;  3FQK A;  3UR0 A;  4EO8 A;  3MTK A;  4UQG A;  4A93 K;  2KI2 A;  3D9B A;  1NSA A;  3H0G C;  3PO2 C;  4N8O A;  2VC0 A;  2XMJ A;  3FRY A;  5KT6 A;  5KTQ A;  3HSZ A;  4HI1 A;  3GTG K;  1X4E A;  4DU8 A;  3AJ1 A;  1M1G A;  5F41 A;  5FLX U;  3HP6 A;  3L7O A;  2NXE A;  5E5N A;  2JX2 A;  3OLA A;  4OJH A;  1FT8 A;  3FKB A;  1FCA A;  2NXN A;  3C66 A;  1DTQ A;  3M9N B;  4QYZ K;  1N32 F;  4CH7 A;  3ILO A;  2RF2 A;  1SKW A;  1WCM K;  3J81 j;  2BJ9 A;  1K8A T;  3DGV A;  4RWW A;  4C48 A;  1NZ8 A;  1RT7 B;  3GTO C;  3LTO A;  3R8Y A;  1T9W A;  3E3X A;  4GKK F;  1L3S A;  2YWF A;  3ZZT A;  5K8N A;  3QJJ A;  1EAY C;  4C0O C;  4C3H K;  1EFW A;  5IZH A;  3LAM A;  1WQG A;  4A3G K;  2C28 A;  4DR5 F;  4BWJ A;  4DSE A;  4X65 J;  4MKA A;  5DDQ C;  2K06 A;  4Z7Y A;  1ZS6 A;  1H72 C;  3FRZ A;  3Q2S C;  4UUW A;  4RW9 B;  3R6L B;  4PXB A;  2P2C B;  2AJ0 A;  2HFZ A;  3TW0 A;  2C42 A;  2DD8 S;  1HD1 A;  4G65 A;  4WXO A;  2L41 A;  3MAH A;  3H4D A;  3GTJ C;  3T19 A;  1WHY A;  4FZB A;  2YNF A;  4BXX K;  2PDA A;  3V6H A;  2MDA A;  2HLU A;  1L0W A;  2F63 A;  1EKR A;  2HNY B;  2GVZ A;  3BSC A;  4CT9 A;  2KDO A;  1QVG R;  3GR0 A;  3HVW A;  3SYZ A;  5ETS A;  4J3N A;  3C6T A;  2HZC A;  3ULH A;  1M5H A;  3GFY A;  1TKZ B;  4JI3 J;  1TMJ A;  2P9C A;  5KFX A;  5ETV A;  4DPY A;  2QMW A;  1Q7L B;  3W61 A;  4K0K J;  1SH0 A;  1LW0 A;  4LFC F;  4ZVR B;  4FZV A;  1RB0 A;  3SXL A;  2CPF A;  1QM9 A;  4QYZ J;  1YIT S;  4DI6 A;  1TKZ A;  3M4X A;  1GE9 A;  4CNY A;  4ECS A;  5DG7 A;  3I32 A;  1BGW A;  4IRK A;  4EO6 A;  3I6P A;  2B6A A;  2BYC A;  2ROG A;  2NZ4 A;  2RKI A;  1FRI A;  3CCQ S;  1NB2 A;  4QIF A;  4LRB A;  4YFN A;  2OP5 A;  4WP9 A;  1RUS A;  2J0S D;  2HNZ B;  4ELV A;  4MFB B;  4R8U A;  2W7A A;  4ZVF A;  3D7S B;  5IYD C;  1LOU A;  2IDL A;  1N8R T;  2DHH A;  3OXL A;  1YKW A;  1Y1W K;  1R8H A;  1N34 F;  1SC1 B;  3I4M C;  3RTV A;  3BQ0 A;  2OPS A;  1USO A;  2R7Z C;  3SQO P;  3VGS A;  1HBN B;  3NBP A;  2ZEJ A;  1B64 A;  2ADB A;  3MR7 A;  2O5I A;  4FXW A;  1WSR A;  2BW7 A;  2NXU A;  2GSU A;  2DH7 A;  1YJR A;  4RW6 B;  3PV8 A;  4RBU A;  3SFG A;  3MUV P;  4MAK A;  4DV6 F;  1JKH B;  2GO8 A;  2GA7 A;  5LXY A;  2ZHA A;  2HQF A;  4QR2 A;  4B9U A;  1M90 T;  1FXL A;  4ECV A;  5C3E K;  1RTD A;  5IOR A;  2JA7 K;  3CJ4 A;  1GXL A;  3OXG A;  2Z8Q A;  3G8Q A;  3H0G A;  3ZTR A;  1UA1 A;  2VUM K;  3OVS A;  4D3H A;  4A3G C;  2VBZ A;  3TVK A;  4KFB A;  1QSY A;  4M5K A;  4LF5 J;  2HGL A;  1BC6 A;  3FCH A;  1TWC A;  4C4W A;  1FJG J;  2E5H A;  4WPA A;  3GTO A;  2VG6 A;  2RH6 A;  3HSG A;  1NDK A;  4LBI A;  2KXH A;  1LNQ A;  4G0V A;  5IP9 K;  4O4G A;  2POK A;  4ECR A;  1I6H C;  4JI1 J;  2VQE J;  2IYI A;  4PWU A;  2DNH A;  2H4W B;  2PGC A;  4QW9 A;  4CTA B;  4CLU A;  2IJR A;  1VIS A;  4GTB A;  2IPO B;  4PQA A;  2YVS A;  1Q8B A;  2C2M B;  3KMQ A;  4L6V 3;  4P7T A;  3MR2 A;  2HUR A;  2YU9 K;  3KLF B;  2MPU A;  4MJK A;  2A18 A;  1VHF A;  1FWK A;  3DC2 A;  2QX0 A;  1S1X A;  3M6W A;  4JYA F;  2L9D A;  3UO0 A;  4KMU A;  3NNA A;  2NVY C;  4NZ6 A;  1O29 A;  4HHJ A;  3GTL A;  3I4N C;  2FPH X;  8AT1 B;  4PWW A;  2WW4 A;  4LSL A;  3AXK A;  3PAC A;  1RAC B;  3D3B J;  3HOZ K;  2ASY A;  4F4K A;  4RKU C;  4M94 A;  3R7S B;  3KHR A;  5DS7 A;  3P96 A;  1RHJ B;  2JFK A;  3JAM Y;  4RU9 A;  3QO9 A;  2O67 A;  5LXR A;  3BN4 A;  4LVO P;  1WD6 A;  2N7C A;  4NL5 A;  3LUY A;  4FXV A;  3MPV A;  2VPX B;  3TO8 A;  2R7Z A;  5E41 A;  3PDN A;  5A0Y B;  1P1L A;  2RHS B;  2VF3 A;  1Q78 A;  4HAC B;  5JMN A;  3RRG A;  2UXD F;  1T11 A;  4LR9 A;  3S2H K;  2JLE A;  1Q1K A;  4ECX A;  4QR1 A;  1P9Y A;  1RWK B;  2LCW A;  2MLX A;  4N76 A;  2KG1 A;  2FTR A;  2BE5 A;  2CWX A;  4CLL A;  3F56 A;  4G1Q B;  2IJF A;  2G13 A;  1PAU B;  4OZ5 A;  2AP6 A;  4HAC A;  4W92 B;  1TQL A;  3VWS A;  4WCE Q;  3S1Q C;  1C0T A;  4RNF A;  1MU2 B;  3VAL A;  1DHM A;  4A8Q A;  2E44 A;  2YU9 C;  2FHO B;  4O44 B;  4K4U A;  2X3G A;  3JSY A;  2NXJ A;  2ZNY A;  2XHW A;  5FJ8 K;  4DR1 J;  1TWC C;  2CDR B;  4YS2 A;  4A8W A;  1ZET A;  2XLJ A;  4B3O A;  2IJN A;  2CKW A;  4MKB A;  1OPI A;  3FCW A;  3S16 C;  1VGX A;  1IJE B;  5A8W B;  4TYA A;  3CWJ A;  4CO3 A;  1EAR A;  2E5G A;  1JXE A;  4GTC A;  1S48 A;  2EBG A;  5H1S V;  4X65 F;  3MED A;  3DXB A;  2JA5 K;  4CLK A;  5IV3 A;  1TTH B;  2ACY A;  1K83 C;  5E3Q A;  2VQF J;  5CCL A;  2DPI A;  2CAD A;  2WVE A;  3IRW P;  4WE1 B;  1NKE A;  3Q8Q B;  3DYA B;  5HQM A;  1C1B A;  2ASD A;  3ORE A;  3CC4 S;  1X8D A;  3I82 A;  4M95 A;  1RT3 A;  1U26 A;  5HSP A;  4KSE B;  1KTQ A;  1E6V B;  1S12 A;  3HOW K;  3LPY A;  2PD1 A;  2VV5 A;  5C2G A;  2MB0 B;  5D0H A;  4A3I C;  2ZM6 F;  2CQD A;  3QID A;  3J7Z T;  4DF4 A;  2QYG A;  3U1L A;  2YNI A;  2LEP A;  3DM2 A;  1RA7 A;  3IR6 B;  2DXF A;  1IBA A;  5FJ4 A;  2CZV C;  4HLB A;  3N4W A;  3NCP A;  1IJF B;  4TXS A;  3HCX A;  4QR0 A;  1DBD A;  2XS7 A;  1PJ6 A;  4FBT A;  4TU7 A;  1RHU B;  4Y2A A;  3MAA A;  1S6P A;  4Y00 A;  4TNO A;  4KB2 A;  3B4D A;  4DCP B;  4Y7N K;  4DV1 F;  3WC2 A;  3AB4 B;  2DGX A;  3MM9 B;  5K14 A;  4JI5 J;  1C2P A;  3UD3 P;  1U25 A;  3GTK K;  4LIR A;  1V3S A;  4A8S A;  1VBZ A;  4KGX B;  3EIC A;  4QBU A;  3O2I A;  5IFM A;  3RG6 A;  3I4H X;  2W2Q P;  3P45 B;  1HAR A;  3WBZ A;  2J9D E;  2MZ1 A;  3HM9 A;  1EKS A;  3HF5 A;  4NLW A;  3VAM A;  1VR6 A;  3I9V 9;  4MFB A;  3GTL C;  4EGL A;  5HRO B;  1R9T A;  2MZJ A;  4DV3 J;  4WYL A;  4DR4 J;  2XZT B;  2NVX C;  3DLK A;  5CHP A;  2F40 A;  3CCW A;  5IXU A;  2E2J K;  3DCA A;  4Y34 A;  2ZM6 J;  2FY1 A;  1JB0 C;  4DPU A;  1HWJ A;  1RTJ A;  4A8X A;  2MJN A;  2XGQ A;  3LAL A;  1RSC A;  1S9F A;  1GMU A;  3GEH A;  4K8R A;  2Z2Y B;  1NKB A;  1Q8I A;  2OPQ B;  1ZOT A;  3HOU C;  2L48 A;  3AH6 A;  2ZD1 A;  3DOK B;  1X4D A;  1MW7 A;  3QRQ A;  4LFC J;  2AYM A;  3UW1 A;  5GAE I;  3R7N B;  1FKP A;  1GFW B;  3VCD A;  3EVM A;  2OEJ A;  3GV7 B;  4Y2K A;  3LP0 A;  4ZP7 A;  1X5O A;  2B4U A;  4TY9 A;  4DZD A;  3GV5 B;  4Y7N C;  1N54 B;  1JJC B;  3W2W A;  3QGI A;  5HO4 A;  1WKL A;  2ZD1 B;  2CQB A;  1TFW A;  3DI6 B;  3CQZ A;  4C3K A;  1REV A;  4JI3 F;  1S4F A;  2QYC A;  1FES A;  3N0V A;  2KRB A;  2N7Y A;  4LRD A;  5CYQ A;  1KD1 T;  1EQR A;  1JJ2 R;  1EX8 A;  2WOM B;  4O4G B;  3S8S A;  2GSO A;  1WF0 A;  3H20 A;  1YNN A;  5HLF B;  4F4Y A;  2MST A;  1GAO A;  4L76 A;  3GTY X;  3MM8 B;  3GJT B;  1J98 A;  3KJQ B;  4I7F B;  2FVS A;  2FGC A;  1HD0 A;  4YB1 P;  3L3C A;  1FNX H;  5EGY A;  1D09 B;  3C6U B;  2V8G A;  1RP5 A;  4LJZ A;  2OH2 A;  4Y3C A;  4J9S A;  3BZQ A;  1FJG F;  4LF8 J;  3BGF A;  2HQG A;  4CO1 A;  3MML B;  1DTQ B;  4UOH A;  2H48 B;  1B3T A;  2MKH A;  3I5B A;  3S14 C;  3IFE A;  4HR2 A;  2V2Z A;  2QLX A;  2ALY B;  3NAH A;  5I4M A;  5A2Q U;  2PHC B;  2BE9 B;  2OTL S;  3LO3 A;  3CCV S;  1H2V Z;  5F9L A;  3A8J A;  1MRO A;  3LAK A;  2OO4 A;  2HGN A;  4ETX A;  5ETO A;  5EWE A;  2FQQ B;  2VIC A;  4ZJO A;  4DV7 J;  2EW9 A;  1T9U A;  3IRX B;  4F7V A;  1TWG A;  2YQ3 A;  4C3I K;  1QLN A;  2V2Q A;  1VI7 A;  2R7Z K;  2GHP A;  2JNJ A;  2XBP A;  4NLG A;  2M5Y A;  2XY6 A;  2IBK A;  1HA1 A;  1ZM2 A;  2DNQ A;  2ZBQ A;  1SC4 B;  3ITH B;  3MEE A;  4ZN3 A;  5C24 A;  4OYO A;  2J8S A;  3BF4 A;  5F8J A;  5IP7 K;  3GR1 A;  1J6W A;  4DLG A;  1A0O B;  4XDC A;  4OX6 A;  2HQ3 A;  3HZG A;  3I9Z A;  2OHD A;  3ZXW A;  2MJU A;  2JEJ A;  4FF3 A;  3OEP A;  3FSX A;  3NS7 B;  1TWF C;  2J8A A;  3KLI B;  4OX9 F;  3CIZ A;  2EFO A;  1ZAW A;  5CZX A;  4M5D A;  4ZIT A;  3PW0 A;  2PE8 A;  3M4O C;  2PFD A;  2R3V A;  4ES2 A;  5IWA F;  4X66 F;  2F4F A;  2K2P A;  2M70 A;  4G1P A;  3MCS A;  3EXY A;  1WOS A;  5IYC C;  1MML A;  4AQY J;  2G0J A;  1TZ0 A;  1IBC B;  4BBR C;  4LQ3 A;  3M8P B;  2WON A;  2ZDP A;  2QFJ A;  3VAK A;  4LF1 A;  5KFB A;  1NK8 A;  4WFB Q;  1VLY A;  2MXY A;  1CS4 B;  1YJ9 S;  2EBB A;  1FX4 A;  1O2B A;  3QSY B;  1N5Y A;  3W66 A;  4F50 A;  1YJ7 A;  5C4J C;  3HT0 A;  3SIP B;  2UVW A;  4KKO B;  3OLB A;  3L4J A;  2NVX A;  4K4W A;  5A8R A;  4F36 A;  1BLU A;  1IKW B;  3DN9 A;  1QTM A;  2R92 C;  2HQD A;  3I0S A;  1S97 A;  1D0E A;  1TAQ A;  3RB3 A;  4G6V B;  1J6X A;  5EX0 A;  4DV4 F;  3EZU A;  3K0J A;  3JYT A;  2L3M A;  1UP1 A;  3KDN A;  1SI9 A;  5F8M A;  4DDQ A;  1R0C B;  1X9S A;  4DFJ A;  5HN0 A;  5DLF A;  1WQH A;  3W5X A;  3L7U A;  4IRC A;  1YTY A;  4L72 B;  4H4O B;  3CCT A;  1ZA1 B;  3I4N K;  4RNN A;  3I0S B;  4HVZ A;  1RAD B;  4K2J A;  5GAH U;  2N3L A;  3Q86 A;  1SIW B;  3DLH A;  1TKD A;  4RU2 A;  1WI8 A;  5L8R C;  3KOA A;  4YDD B;  1QAY A;  2KU7 A;  1KNZ A;  5MAO A;  2QGF B;  5CD4 H;  3BSN A;  1FFW B;  1TWA K;  2AYB A;  5JFE A;  1F9F A;  2HHV A;  2NLW A;  4OZ0 A;  2YWE A;  4HT7 A;  2ZJR Q;  2HBQ B;  5IM0 B;  1B99 A;  3QZ7 A;  1I51 B;  2Y3Y A;  1KBR A;  2V8V A;  4KGZ B;  5B0F A;  3DRR B;  1RKJ A;  3C16 B;  3OT9 A;  3TUZ C;  4J9O A;  2OAU A;  3C14 B;  2JA5 A;  1VYA A;  4CZC A;  5C44 C;  1X31 C;  2B8P A;  4XPC A;  1DRZ A;  1K44 A;  1ZYQ A;  2BAN B;  2V4R A;  2D3O 1;  2W9B A;  1HNW F;  1WG4 A;  3HZE A;  3C14 A;  4OIP A;  1B70 B;  4TVA B;  4DV4 J;  1W2B R;  3MR3 A;  4AXI A;  1WKJ A;  1WWH A;  3SSQ A;  2C3U A;  2XMM A;  1UVK A;  2XZW A;  1UZH A;  3HHN B;  1R8B A;  1EQ0 A;  3PO2 K;  1HYS A;  3CE8 A;  4ER8 A; 
#chains in the Genus database with same CATH homology
 1VLO A;  1XZP B;  1V5V A;  1WOR A;  3A8I A;  1XZQ B;  3ADA C;  3GEI A;  1XZQ A;  4P9S A;  3TFH A;  4PAB A;  1VRQ C;  3GSI A;  3AD8 C;  1WSV A;  3AD7 C;  4PAA A;  2GAH C;  3AD9 C;  1WOO A;  3A8K A;  1XZP A;  1PJ7 A;  1PJ6 A;  1WOP A;  3TFJ A;  1X31 C;  2GAG C;  5L46 A;  1WOS A;  1YX2 A;  3A8J A;  3GEH A;  1WSR A;  3TFI A;  3GIR A;  3GEE A;  1PJ5 A;  3TTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...