3AD8C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with pyrrole 2-carboxylate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
molecule tags Oxidoreductase
source organism Corynebacterium sp. u-96
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad8C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad8C01
2GAGC 3TFJA 3A8IA 1YX2A 1X31C 3AD9C 1XZPA 1VLOA 2GAHC 3ADAC 4P9SA 3A8KA 3GIRA 4PABA 3TFIA 1VRQC 3A8JA 4PAAA 3AD7C 5L46A 3AD8C 1WSVA 3GSIA 1PJ5A 3TFHA 3TTGA 1WOOA 1XZQB 1XZQA 1WOPA 3GEHA 1V5VA 1XZPB 1WSRA 1PJ7A 1WORA 1PJ6A 3GEIA 3GEEA 1WOSA
chains in the Genus database with same CATH superfamily
3MDFA 2BANB 5D4OA 2GS8A 4RNOA 4CLFA 1QUPA 3IWNC 4LF6J 2UVVA 3NOCA 1S77D 3LW5C 2MZJA 2OI2A 2C2ZB 2OHDA 1X4GA 3PM9A 3HPOA 3BH7B 5TJ3A 3S15C 5CD4H 3KFWX 3FUYA 4XLNA 2ZH3A 3N0BA 5HL8A 2CQCA 2KU7A 1F3VA 4MQ9A 3MUTP 1DTQB 4ZVQB 1PC5A 2MHEA 1S4FA 3EDRB 4DQQA 4DCJB 3BP3A 1VQYA 2R7QA 1XTZA 4NMLA 2Y8WA 3KK1B 2VFUA 1CJVB 3AH6A 2JA6C 3GTYX 3DHWC 4ZPAA 2PE8A 2VOPA 4PQUB 1FKOA 3GV7B 4K0KJ 1Y5LB 2B7CB 2BE7D 3GFZA 4O4GA 3BYPA 4CCHA 3ILOA 3IWLA 1BUXA 4OV1A 2YKMB 3L95X 1TMMA 3M4XA 4F2SA 4CO3A 2CWKA 3LALA 1NK6A 4WE1B 2E2HK 4O44B 1UVJA 4O44A 1VQ9S 3MPVA 4PZVA 5DDPC 4C3JC 3SV3A 1VMBA 1UEVA 5GAEU 1AZSB 3KWMA 2OEKA 4OHZA 2M70A 1QTMA 4ID5B 3S16C 1R43A 1BGWA 5L1JA 3SQGB 3AT1B 4OIRA 5AJ3J 2IA0A 2D7SA 5DG7A 1IKXB 4ED5A 1FRXA 2DH9A 3VVTA 2BE2A 1PYSB 2YKNB 4IO1A 3Q8RB 3UD4P 1TUVA 2W25A 4TU7A 1U26A 2ATLA 4PXBA 1Q16B 4JI1J 3JSBA 1B64A 3JTOA 2QSFA 2D9PA 3Q89A 1CG2A 1UWBB 1ELOA 1VC6A 4A3KK 2EC0A 3FEZA 1O27A 2W4PA 2IVFB 2KN4A 1S48A 3SCKE 1M5VC 1I1GA 1HNIB 1RAIB 4WKRA 4L3KA 3MUVP 5E33A 1WF2A 2E2IA 4QIGA 2ASYA 4ALZA 3ENVA 4OX7A 5AXKA 1FKPB 3R2DJ 3N6MA 3IPJA 4TXSA 3EQLA 4DLGA 3NS6A 1NJIT 4DX7A 2GFFA 3KJFB 4YHHJ 2I5JA 2J6TA 5H9EJ 1KWMA 3CIMA 1GE9A 4BHQA 2XEXA 2A1BA 3MMCA 1IM4A 1FHTA 3T5JA 4O4GB 4ETZA 1GT8A 4GKKF 2EFNA 2N3OA 2FZCB 2Z58B 5EX0A 2QIFA 5DLGA 1EX8A 2E1MC 3ZTRA 2BBEA 2KVIA 4WFZA 2RHQB 3BGUA 5B0FA 1PJ5A 4NLQA 3NXZA 4YP3A 3TZZA 1ZZFA 3DRSA 1YJNS 2JOQA 2ZZTA 2AGPA 2PPBA 2HG4A 4B3MJ 3M8PA 2HBRB 3PJ9A 5F9LA 4YR3A 3ETMA 3AHPA 3SZ2A 2XMVA 3G71S 1WG5A 1WJ9A 2DIVA 1NUEA 3NOGA 3PV8A 3SV4A 3KKFA 3BB5A 2W2NP 1VI7A 2MY8A 2ZD1A 5IQQA 1JQGA 1RBLA 1T9VA 4F8RA 3UR0A 2XS2A 2E9TA 2GHPA 5L9XA 3DXBA 1EQMA 1BQMB 4BXXK 2HQGA 1FDBA 3UO0A 5AXNA 3GTOC 3L7UA 4LREA 4DN0A 3M8RA 4P2FA 4QYRA 4O3QA 4JI8F 1S1VB 2V4QA 4K4WA 4BBYA 2KT5A 1S6UA 4DV2F 2GQ2A 2M5YA 4L3NA 3FFIB 3J81j 2V50A 4JI7F 3HVWA 2ILYA 3L4JA 4OYZA 3CXCR 3B4DA 1IJEB 3LP0B 2FZKB 2AJFE 1S12A 2R8KA 4AL7A 1YZ7A 2UV8A 3PACA 3D6FB 4ES1A 3L3CA 1PSDA 4LF5J 3GJSB 2GMHA 2VDHA 2GSNA 2G0JA 3HM9A 2PGCA 2XY6A 4GRSA 3FVYA 3SYZA 4FYDA 1JJCB 4NCBA 2AYBA 1FI4A 1OQ6A 3PO3K 4UQTA 3Q2TC 1IN0A 2DGWA 2HVEA 2QSWA 4LF1A 3PRVA 2NYHA 5C4XK 3HOZC 3K8VA 3QGHA 4FVCA 4Y00A 2XGPA 1TAQA 4X4SA 3PYGA 5IXUA 1QAYA 2V8DA 5JVGQ 3C6TA 4Y34A 2W2QP 3A8KA 2FVQA 1CS4B 4CH1A 2B51A 3T19A 3I32A 2KFZA 3CCVS 3ZZOA 4NYPA 5K14A 3FBFA 2VJUA 4NCGB 3EVOA 4I7FA 4ZPBA 2QA4S 5E3CA 2WOMA 1QLNA 1X5SA 3UN5A 2CJ9A 5TMCA 3PVXA 2RVJA 1NLKL 2ROGA 3Q2SC 3CGIA 2JC1A 2CUYA 2C22A 4CH0S 1ZM9A 3UFCX 2GO8A 2VG7B 3D6HB 3MEDB 2E2IK 3QJJA 4CO4A 4NX9A 1OMSA 2NZ4A 3GTJC 1F5CA 2MKSA 1FJ7A 1I50A 3G96A 1XNQJ 2VOOA 3EPGA 3HHLB 3I4NK 2LYVA 2JHEA 4IFYB 1TWAC 5D3GB 3HOYC 4ZVTB 4KASA 2BM1A 3W1YC 3HFKA 3K89A 4EBEA 1WSRA 1X4AA 2PFFB 3ZNUA 3UVJB 1FF2A 1T9XA 2H4WB 1S1WB 2FVRA 5FDLB 3VZIA 1GNKA 4DDQA 3K5MA 4YN3B 4JI4F 1SV5B 2DNZA 3QT5A 3HOXC 1UJ4A 3UDVA 3GQCA 4YB5A 2I2YA 2DISA 4HT5A 1NRKA 4EBCA 1VIXA 2MKCA 2MQOA 2FZGB 2J9CA 4OLPA 5HROA 4KHPF 2W2MP 5HROB 4HTJA 2YWFA 2IVYA 3PTWA 3VGUA 4G0VA 1I50K 2RRNA 3H2LA 2KRRA 3TARA 3UDEA 1N36F 3OTOJ 4DSIA 5HP1A 1X5PA 2ZH9A 1FFSB 4B9NA 2FC8A 4F4YA 4K4YA 4OJ3A 2FJAB 3VHQA 3HOXK 5K5MA 1SC6A 4OZLA 1I94F 3LA0A 4C48A 1CC7A 1NPPA 2RS2A 1X0FA 3QIPB 4IFYA 1ULRA 5ETVA 2KXFA 4ZVOB 4HI2A 2Q1LA 1NHKL 2RU3A 1SJ4P 2BVZA 1M5OC 4OYBA 2KM8B 3PG9A 3FKBA 1HWLA 4LRAA 2PEBA 4NRTA 1NK7A 1U49A 1RBOB 3TZWA 3KTQA 2E44A 1S6PB 3TAQA 2XZTB 3PYFA 2JEFA 1RBAA 2WB1L 3GONA 2ASDA 3HOUC 2JA7A 3J7YU 1W2IA 3CCSS 4ECQA 2MDAA 4LRBA 5THWA 5A8RA 1I3QK 1D09B 1KTQA 2R4FA 1S9GA 3CUNA 2HHQA 1U1KA 5CHPA 3D2WA 2AMCB 1NDKA 1LXJA 1FERA 1UV7A 4KB7A 4KE5A 1U8WA 5C4XC 1UCNA 1RP5A 4WPAA 3LP1B 3Q8UA 3MECB 4I2QB 3TX8A 1XR6A 4BS2A 4ZHRA 2HLTA 2IAJB 3L7PA 1U7LA 4MKBA 3H4DA 4NYZA 2J0WA 2QMXA 5F8NA 2JEGA 2JEIA 3LPXA 2UXCF 1WC4A 4XDCA 3TP2A 2Z56B 5M3FK 4A47A 4LIWA 3M2UA 4AXJA 1G7CB 5KOXA 1FO1A 3C46A 2XSJA 3DGPA 2DGUA 1N34F 3GILA 1O28A 2MJNA 1U2RA 1B4AA 2K7JA 4MJKA 2CQ4A 1RYRA 3OFEA 1FDNA 1VGXA 4MTPA 3QLHA 1L3KA 3M30A 4DR6J 4PQAA 5A8WB 1OIAA 3GSIA 3B8HA 2BZ2A 4ZPTR 2FDNA 1OY9A 1K83K 1TWFC 4GZYA 1NM2A 3VAKA 2W01A 1TKZA 5DGBA 4YFNA 4AL5A 3GV5B 3DYAA 5L9NA 4YHHF 1IQ0A 2QE5A 1UAWA 1RWKB 3BKTA 4K59A 3KOAA 1B0VA 3GFHA 4PRFA 2AJ0A 4IH6A 2XI3A 1ZBTA 5F8MA 1GK8A 3OTOF 3K5LA 3EPIA 1B0PA 3CDUA 1RT5A 1SH2A 2ZH5A 2UUWA 2GJ2A 4KM9A 3TVYA 3MMCB 2E1PA 2K1RA 3CJQA 2MLXA 2K1RB 2F4VF 1O29A 3G9CA 1C2PA 3TTGA 1JXVA 5B0EA 1T8EA 1S59A 5DLFA 1OSCA 4HVZA 3S1QK 1U1PA 2CVIA 2P5VA 3JQKA 5DJBA 2W24A 4TVAB 1TWCC 2OMLA 4F4ZA 2G2YA 4J9VA 4OX8A 1N5QA 5IOQA 5IM0A 1V3ZA 4YFUA 2K3IA 1H74A 3W9IA 1HA1A 1NZAA 4Z2XA 4DG1B 3V6JA 1FRIA 1EETB 4J5OA 4XCHA 4IG0A 2AZ1A 3MPDA 1S99A 4JI6F 1JXEA 1LW0A 1LW0B 2H9ZA 4DUZF 5HATA 4OYAA 1S79A 2C2MB 3Q8QB 4GTEA 3K17A 4A3JK 4ED7A 4QWBA 2CJKA 5KOWA 2A10A 1XIQA 2R7ZK 2DNRA 4M5KA 5K14B 4PPDA 5CZXA 2W7PA 2BXJA 2DY9A 1MU2B 4JI8J 4IH7A 3I0RA 2ALZA 4DR4J 4QIWD 2KRBA 2QA4G 3HK2A 4QW8A 1HD1A 3PO3C 4OIPA 1SQGA 2L48A 2CNNB 2GNKA 4DSEA 5IT9Y 4C2MC 1O26A 5BJRA 2FJEB 5IP7K 4P5BA 2AYGA 5LMUF 1ZYRA 4RBUA 3F44A 4IRKA 1O8BA 8RUCA 4DEZA 3LGMA 4PG6A 1XXAA 1SJ3P 3OHAA 1I3QA 2PMZL 4LSLA 4P2MA 2B9WA 2F8HA 1K1SA 4GKJJ 1Q82T 5F0UA 4FBTA 3D0HE 4NLXA 1K0TA 4ATNA 4TU8A 1WQHA 3H5SA 3NNCA 2E9ZA 4E2FB 2K7KA 1IBCB 3GTOA 3K5OA 2VASA 4P74A 4USUA 5F8LA 5F8JA 3DOKB 4C8NA 3MAQA 4DJBA 4ZHRB 4QPXA 5EDWA 4DV6F 5C3EC 5KT2A 1VRUA 2CFXA 2AP6A 2FHOB 4N8NA 5IT0A 4A8QA 5J1EB 3GB0A 3RZDC 2DHGA 4MKAA 1DQ8A 4KH0B 3MOZA 2W7OA 4TLQA 4ILRA 3M2UB 2ZH7A 1O6XA 2A6OA 2JC0A 3ETOA 3VGSA 1U4BA 4A3LK 3N4WA 1KQGB 3FEYB 5LXRA 4CNYA 1TL3A 3DDIA 2NPIA 3DFEA 3GR1A 2BRKA 3SMZA 3J7YI 1D8ZA 2JA6A 2BR0A 1A9NB 3DLGB 1Y1WA 1U47A 4C45A 1OYEA 1YJ7A 4DR5F 4P72A 2HFUA 3TW0A 1DBDA 1U2CA 3ZC4A 2FLPA 2EPIA 5HO4A 3TA2A 2OIHA 2MZ1A 5KFHA 3TNVA 3GIMA 3U02A 5D0RA 2ZDOA 1H98A 4HL9A 1QUVA 3RRHA 4XTTA 3LAMA 5E7OB 1IWGA 2UXBF 4V19X 2Z0GA 4ANDA 1W2BR 3T1HJ 4Y52C 1VIOA 2YPZA 1NJXA 3GP9A 3F56A 5LSRA 4RNMA 2IMOA 1AFJA 4X2BA 4ZLJA 2YU9K 1TZ0A 3PEJA 3S0XA 3MM5B 3I96A 4DV1F 5L1IA 2KYZA 1VH2A 4CO0A 4GVLA 2QLJB 5KG1A 3NMRA 2AW0A 4USJC 1GEHA 1BC6A 2DD8S 5IOLA 4NMXA 1OPZA 2O01C 3GYGA 1FX4A 1PAUB 2VPWB 2XMMA 4KMHA 4J9UE 2DGVA 1R8BA 2VIHA 1FT8A 3H20A 4ZLPA 2VFTA 4JI4J 1U24A 1F9HA 1HL6A 1DCOA 3DLGA 3BSAA 1K44A 1NK9A 5IC6B 2QL9B 4K0KF 2KT3A 2PA3A 1E6YB 2OELA 2Y1JA 3OTBA 1S1TA 2JZ5A 2I9SA 2E5IA 3PFEA 1I94J 2FHJA 2AJ2A 3T6BA 2HZCA 3FOFA 5DDQC 3QRPA 1Y00A 3BYRA 3TAMA 2JLEA 1EB0A 4I7FB 1HR0J 1C4CA 3VA7A 3H0PA 3V4MA 4BWMA 3A8JA 4Y65A 2VFSA 4I1TA 4AYBD 1HWIA 3DRXA 1S0NA 3JSTA 3MEKA 1WKLA 4MT1A 4RUHA 1SUQA 2XSFA 3LAJA 1MW7A 3FNNA 1EP4B 4F3OA 2MLYA 5GAGI 3JTNA 3BH6B 1IKYA 3IBWA 2B3TB 1H72C 3O44A 3AJ2A 2Q6BA 4C8KA 3BQ2A 2CXEA 3AB2B 4FPIA 2HHHF 1RKIA 3OFFA 3DCAA 2PD1A 2LXIA 4A8KA 1KDNA 2WVCA 4NLVA 4Y7NC 3IR5B 2AGQA 3NL0A 3S14C 4DBQA 1KS2A 3QJPA 5EWEA 3R6LB 3DKDA 3OR2B 5T7LB 4DV1J 3A4TA 1X4FA 4BXXC 1GXLA 3K0JA 1SIZA 3M32B 5GVQA 3I4HX 2VG5B 1NJZA 2IM2A 3OTCA 1N4LA 3OLAA 2V8VA 3B82A 3DC2A 1UVIA 2Q43A 4NZ7A 1VQKS 4OMFG 4WTOB 3BSCA 3QPIA 2VQEJ 3KG4A 1YVFA 4ZLNA 3BBCA 4HTIA 1QAIA 4GO7X 3GU0A 1RTHA 3ERED 5CAAA 2RUGA 4U8YA 2MMYA 2NZCA 1UL3A 4DQIA 3FMBA 2G2ZA 2YNFA 3TUJC 2E1AA 1RT7A 4B08A 2HNZB 3WC2A 1EQRA 3K8WA 2R2RA 1T03B 1IQZA 3DGPB 3ILJA 1U02A 2J7UA 1SQFA 3FDSA 4AD6A 3O8WA 3MFHA 1H2UX 3CULA 3PFOA 4BY7K 5K8MA 4Q0BA 4DV0F 2BE9B 1YNNA 4JI2J 2DRBA 2MPUA 1UEKA 1NSAA 2BW7A 4Z37A 3MR6A 2BJ1A 3HZGA 4DUTA 1NK4A 3CC4S 1O2BA 3FZ2A 3W5YA 4LR7A 1XNRJ 3KLEA 3EE3A 4QIFA 3SFUA 4UF4A 3CB4A 1TVRA 5KFPA 5IYDK 2VPXB 1KP6A 5C24A 3O1LA 2A68A 4LSLB 1UVNA 2R42A 3RW7A 1P27B 3NG8A 2JX2A 2BKPA 1CPZA 3GWCA 3PYDA 4LF4J 2NS1B 4LR2A 2LQ8A 1YSJA 2HHHJ 1XMQJ 2A0FB 2G4BA 3R7BB 1FVSA 3VZHA 3WODA 1RWWB 2C28A 2NSBA 2G13A 1LKZA 1HNXJ 3IG1B 1TL5A 3I87A 5E2QA 1GMUA 2WONA 5JJBA 1JLFB 5KFFA 4EZ6A 4DR3J 1ZAVA 4FKXA 5EGEA 2XC9A 4QU6A 2IMWP 2VHGA 4DR4F 4YDDB 4Q4ZA 3PY8A 3DI6B 4MK8A 4M5JA 2DJWA 2B6AB 2KHDA 4OYOA 4IG3A 2CG8A 3C3LA 2HHWA 2XO6A 3PEHA 4QWAA 5JVHQ 2P8IA 4YFXA 3I4MK 4G7ZA 2F5GA 3MMLB 1RT2A 1REVA 3CD5A 1U1LA 4C11B 3R1LA 2DO4A 3NCRA 2UUTA 2OD4A 3KLFA 3WZ0A 2IJNA 3BDPA 3C15A 1VDHA 1MMLA 4DPOA 1JLEB 3R5DA 5ETPA 1HD0A 4S0MA 1A7GE 4KGKA 3NCPA 5LT5A 3POTA 3IXQA 2ZJRQ 4BBSK 4CDIA 3PYEA 1JJ2R 1UJ5A 4NLOA 5D0GA 1KNZA 2QA1A 1JMTA 4LF9F 2O5JA 1SCJB 1CJKB 5J2QB 1UVLA 3DMJB 4HH0A 3I56S 3VF0B 4DV0J 5F9NA 4ZPDA 4QOTA 1WI8A 3ZTPA 2KFNA 4WYWA 4DSJA 4A3DK 5ADZA 4H4OA 2OAUA 3TI0A 2DBBA 3NP5A 2O67A 1U09A 2OPQA 4MEYA 2P6SA 4CWBA 2QFJA 4Y2MA 3A1YG 4RBTA 4PWDB 2H5EA 3S1QC 3OR1A 2DEIA 4A3MK 3JYTB 4G6VB 2RNEA 5HVHA 5GADI 3MM9A 1WC5A 4DFMA 1FNOA 1ZM3A 1EKRA 2OPPA 2OPPB 2F3JA 3H0GC 2IY5B 1Q81T 3UCUP 4RW4A 1KONA 4AE5A 4M5NA 3GG0A 3PKMA 3KLIA 5JXSA 3VGVA 1RU1A 2MHNA 3J7AN 1N6QB 3EGZA 4KKOB 4B3TJ 8AT1B 2VH7A 4LSNB 2C1EB 2V4RA 4ED0A 2B8PA 5ETQA 1U1NA 1IL2A 1OY8A 2R2SA 3C14B 4OYPA 4FKYA 4XDDA 3CJ2A 3CD6S 3LO3A 4A3LC 1KOOA 3Q8VA 1KQFB 4RWWA 1RT2B 1G1XA 3T6JA 1ZQ1C 3HVRA 4EZ9A 2D3UA 1M5SA 2QG9B 5IC4B 3Q0AA 1KQKA 1RCOB 4EMDA 3EGVA 1QDUB 2AV5A 2XI2A 1RABB 3G8SA 3CW2C 5F8HA 1RQ0A 1USOA 4DL4A 1ZVUA 5FJ8K 1WKJA 2VQFJ 1G2EA 3GLJA 4DFKA 1CJVA 3G6ES 2HKEA 3KLGB 1RT1B 3CCWA 1O0PA 2RQ4A 2UUBF 3W65A 4USWA 3OXLA 1A6LA 2CQDA 4HT7A 4R8UB 3WIVA 3ITHB 1S6PA 1ACMB 3PO2K 3H5UA 3LP0A 1TL7A 4MKYA 3DLLQ 2CQHA 1B3TA 3BP8C 2CG4A 1RT4A 4DCPB 3BSOA 2QGFB 2C3PA 3H3VL 4DG1A 4ES2A 1Y4ZB 2E2JC 4U7UK 2DNYA 1HNZJ 2HVHA 1KD1T 3CWJA 2LFVA 1UA0A 1N48A 5KFWA 4AH6A 2CZ9A 4C3HK 1R89A 3NGKA 3DU5A 3QX3A 3EVMA 4G3IA 1SKRA 4JI5J 2UV8G 4U67Q 3QGIA 4Y28C 1VRUB 2C3MA 5CQGA 2B4OA 3A3OB 1TV6B 1F0XA 5IWAJ 1SL1A 2VPYB 3GEEA 4ZKAA 2JA5K 1F3FA 3NAHA 1VQSA 2UP1A 2D3O1 3A8EA 4ELUA 2AWZA 1GTEA 2VC0A 1ZM2A 3HP6A 3CJKA 1MMDA 4USHA 3C6UB 4G1QA 4C3HC 1TKZB 1D9AA 5I3UA 5KG4A 3MAHA 4TYBA 4IQMA 3NCQA 3JSRA 3GV8B 3OBIA 4ZVGA 2V5HG 2HIQA 3UW1A 2B4VA 5LJ5Y 2HBYB 3ICLA 5C42B 2C2EA 3RJMB 4ED4A 4N5SA 1YJWS 1SC1B 3MMAB 3IP0A 4X4QA 5K20B 2YNGB 2WSCC 5E3AA 4F4XA 1HMVB 2Q66A 3BR9A 2AKWB 2E9RX 4X6AC 1PGZA 3C16A 2HAFA 4KFBB 2F65A 3VALA 5EHHA 2CRLA 3CCMS 1IW7A 3HOZK 4U8VA 3OPFA 4O3RA 2NVXK 1YITS 4DZ6A 2V6AA 2AX1A 2XCAA 4UT4A 2R8IA 3MEEA 5A2QY 3GIKA 3PO5A 5T7LA 3JAMY 5CYJA 1O51A 3OD2A 3BKUA 1Z2LA 3OR2A 4UTGA 1FTRA 2N3LA 4YB1P 1S9EB 2XULA 3S14K 1GH8A 2ROEA 3SSSA 1N6QA 2YQ1A 3ILLA 3RAMA 1RYSA 2HNYB 3BR8A 3T1HF 4DUYF 3AXKA 5C2GA 2LCWA 3JB9k 2IRUA 4PQUA 1TR0A 3RB6A 3FQLA 3SFGA 4DZDA 1HR0F 4KB4A 1S0MA 1EFWA 1SFOA 2H65B 3QBCA 3CIZA 3NGUA 1FNXH 4NXNF 2PI4A 3TFHA 4C11A 5GAHU 3H90A 2CPZA 2NXCA 5KFZA 1HNVA 3DMJA 2WAQL 5M5WK 2KB2A 3CAGA 1TKTB 2EFGA 3JTPA 1TK8A 2GIQA 4UQGA 2JWNA 4KPYA 3LGHA 1AFIA 3EZUA 1SMYA 5C24B 4CRJA 2K3KA 4N76A 3BZQA 5KTQA 1UKUA 4F04B 4OJ1A 4B9TA 4WE1A 4DR6F 1I6HC 4BY1C 2I5JB 4OZ0A 4B3TF 4KN4A 4H4OB 3LP2A 2HQDA 2WVFA 3V6HA 1SJRA 2IJRA 2AEJA 4X4PA 3GTQK 3SDEB 4LFBJ 2W9AA 2DXFA 4KQZA 4TLRA 2HVZA 4YFKA 4J9NA 2CQBA 3TVZA 4XIUA 4I56A 2FC9A 1XBWA 3I82A 4URGA 5G0RA 4MEXA 4DR3F 4JUZA 2RF2B 1VQ5S 3S7RA 2WVDA 1TK5A 4R8UA 1J98A 4Y7NK 3MAAA 1TL7B 3KUEA 3OSNA 1BD6A 1PBAA 3DRSB 3PRDA 3RBZA 1TKXA 1L0WA 2OTJS 1RTJB 3RG6A 3M05A 3DGVA 5IV4A 3J7A1 1YLXA 3V6DA 1RWMB 3CVKA 3M2RB 4WJBA 4RUCA 3T1YJ 1LWCB 2NVYK 2BOAA 2QZ8A 1OS5A 2QV6A 3W60A 4Y2CA 4LQ3A 4QR2A 3M6UA 5KFXA 4KAWX 2N7CA 1V5VA 1RSCA 4NOIA 4PXDA 1QM9A 2HQ3A 4YQWA 4TU9A 5KFQA 2WW4A 1U45A 2CJQA 5KFBA 4L73A 5D0HA 1T7PA 4LF2A 1PO6A 4LVNP 2B8QA 1WHWA 4RW6A 3TRGA 2Z2LA 3MM7B 1UEUA 4WIIA 2VJVA 3H4BA 3C19A 1SH0A 4ZJOA 1FFWB 3DLHA 4P73A 4JOUA 1S57A 1NSQA 1U25A 1Z4UA 3QAUA 1IKYB 1FX2A 3OTEA 4KGXB 4QBUA 3OVBA 5K8PA 2VB6A 3W7BA 2MKIA 2VUMC 2F63A 1X31C 3MCNA 4F3MA 2J7KA 3MR2A 3CO9A 3GIRA 4CP5A 3H2VE 3GTMK 4X4RA 2G0IA 1HMVA 4Q7AA 1PIEA 2W1BA 3AOAA 4WCEQ 3FBEA 1PCAA 4ED6A 2CQ3A 3W8PA 1PJ6A 2LP4A 3V2UC 1S4EA 2DGOA 4RW4B 4CYUA 2ILZA 1T3NA 1NPKA 1TKXB 2ZM6J 3RBXA 5KAKA 4C3LA 1IBLF 3MWBA 1T05B 2E2IC 4IR1A 1R0BG 2D74B 4RPFA 4DMZA 5ITHA 2EFPA 3CCLS 4EU0A 4C0OC 4LBIA 2XTJP 5D0EA 1TTHB 2PN6A 1SJFA 2ZUEA 2HZVA 4KO0A 4I69A 4V19J 1IKVA 4C2MK 1BQXA 1TWFA 4FNIA 3VQTA 3FZBA 1HHTP 2DITA 3OUYA 1LW2B 4WFXA 3DLEB 2C2KB 3CMES 1K1QA 4TNOA 3CMAS 2W9CA 1DY3A 1S0OA 4DPUA 4ELVA 3U1LA 4FPRA 2HWHA 1ISEA 1Y1VA 4NXNJ 2GSOA 3K57A 1WTBA 5E68A 3HHNB 1HPZB 1WC6A 4KYZA 2XCOA 4J9RA 1JLBB 3HHLD 4QYZK 5HJYA 1HIYA 1LWCA 4AYBL 3POTB 1S1TB 1U6BA 3KLFB 4O3NA 1RT3A 1EP4A 3M6VA 3ENQA 4MIAA 3EJMA 4A93C 4C98A 3UDLA 2CYYA 5H1SV 2HFNA 2RJZA 1FXDA 3MEGA 2IJFA 2YWWA 4YY3J 2BQRA 1Y3KA 5IOTA 2RSQA 3QMQA 3S1NC 4YR0A 4GTDA 1HHQA 1LFPA 2R7TA 1F7VA 2DY1A 4B17A 2J9EA 5H9FJ 4A3CC 3VWSA 3QGGA 4DV4F 3AOBA 3CQZA 3GTMC 1KKHA 2PEHA 4BLBA 4DPWA 2VG6B 3T3FA 3TUZC 3B6BA 3QWUA 2HNDB 2ZUAA 1GMWD 2DHHA 4OIQA 1HBUB 1UTAA 3RAXA 2QLWA 4MK7A 3G8TA 5BXIA 4KHPJ 5D77A 3Q8SB 2BRLA 1YBAA 2GMLA 2H1YA 3TOQA 4Y6IA 1F6TA 2U2FA 2IHR1 3OREA 4M63A 2OLWA 3EICA 2Y0SL 4OV6A 1QSLA 4QIVA 4QW9A 1SKSA 1AB4A 4C8MA 5F8IA 4J9LA 3GTKC 2U1AA 3C2PA 3P5TL 4USKA 5KFSA 2NQPA 3P8BB 2XCQA 1BLUA 2AU0A 3TQ1A 4ZCMA 5B0BA 3PW0A 4IKAA 4ETXA 5HBMB 4X65J 4WIQA 3D66A 4JV1A 2B9YA 1ITPA 2W9CB 2DNHA 1C1BB 3BQ1A 2RGRA 5B08A 2I38A 1VQ4S 1XMBA 3AB4B 3HT0A 5A8WA 2XO7A 4BBRC 3N28A 3D3BJ 4LQ9A 3N79A 3R5BA 5KFYA 1KOHA 4ECZA 2B4UA 3S8SA 2VU5A 1E6VB 1DCPA 1O25A 2A18A 4NI2A 4G1QB 3S2HK 2ASJA 2NXUA 4A46A 4A3BC 4P9SA 4UZCA 4GTAA 4NRUA 2CPYA 4JI3J 4ZVHA 4OI1A 1P8GA 2ASLA 2X3GA 1LFWA 5DETA 4JYAF 3WX8A 1VQ8S 5JUMA 1M0SA 3I31A 1Y1WC 4Q2MA 2BQ3A 4I2QA 2ZH8A 1Q5VA 4QPTA 3Q23A 2OPQB 2BABA 2R7VA 3MOJB 3U1NA 4FXDA 2DPIA 4GMKA 2HBQB 2BJDA 4UZBA 4Y0FA 4OL8A 4EYIB 2M2BA 5DZ6A 1N56A 4BLGA 2NREA 1FRKA 4MIWA 1N5TA 3CSKA 4PYDA 3AXMA 4CO2A 3TO8A 2CPHA 1XZQA 1C4AA 1F9EB 4Q8FA 1H0HB 2ERRA 4WU3A 1D9FA 2O3DA 1JVIA 3GJRB 1XZPA 1TUWA 1X5OA 2RT3A 2FHMA 4TY8A 4TY8B 2A6HA 2WB4A 1Q8LA 1BJTA 1TWGA 2XMUA 4RUBA 4CLYA 4C4WA 3C6TB 4RU9A 1WTFA 2JJ4D 4CLUA 4LMZA 4QIEA 4BKWA 5DS7A 5AE3A 1NXIA 3CT9A 1WHYA 1DTQA 4FF4A 2FYXA 3EXCX 4KN7A 3MF5A 5A2QU 3EYZA 2IVMA 3OFGA 4LT6A 5DQGA 2AYEA 1BWVA 1D8YA 4C3JK 3V6DB 4F26A 3NY0A 2V34A 1EH1A 4CTAA 1KBRA 4O3PA 2RQKA 1PBUA 4X65F 4NOHA 3E2EA 3QFHA 2XCPA 1FTCA 3LOUA 2LQ5A 3IR6B 3C6UA 3GDZA 2DK2A 4NA2A 2V69A 1BGXT 4CT9A 3O2IA 1Q8KA 2YNHB 4X64F 1J5OB 3CJTA 3EZOA 2GVDA 4X6AK 1SH3A 3BPSP 3FSXA 4YB7A 3N0CA 2MY7A 2GHVC 3T5HA 2R8GA 2KG1A 2YX7A 1XK8A 4WXWA 2DNNA 2YU9A 3G82B 3NGSA 4DX5A 3OJSA 3UR3C 2XS7A 2MYFA 2LA4A 1SVDA 1RT4B 3KJQB 4ZITA 3KLEB 3US5A 3ITHA 1LXNA 1VQMS 4ZJQA 3B54A 2PA8L 4C7QA 4NXMJ 3S6EA 3TYTA 3BS9A 3V4IA 2IBOA 2Y1LB 2WCXA 5D4NA 3QGPA 5AT1B 4ECRA 3GTLC 1IQTA 1SL0A 3R5AA 2MZTA 1Q0NA 2XGQA 3FCHA 2M4MA 4DV7J 3MM9B 1RTJA 2G9OA 4DSFA 3T5KA 3NLCA 4PEOA 2YU9C 4CLKA 4CLLA 3J7ZT 5ETOA 4H4MA 1SJ1A 2VUMA 5C7PA 2PI5A 1TELA 4ZP9A 4GFQA 4J9KA 2FPHX 4IO9Q 2P9GA 2SXLA 2XLJA 3CCES 4AXIA 3TJ8A 3MUMP 1WOOA 1KSPA 4NLDA 1HBMA 5ETLA 5K8OA 3CJKB 3DNCA 3ET6A 3BV8A 4K2XA 2EK1A 1QAXA 2RQMA 3GEIA 1UPPA 2GCFA 3FC9A 2O5IA 2KJWA 1F2HA 3FRYA 2F9JA 2M88A 3M7VA 3R7NB 2MKHA 2WOMB 1N34J 3MEDA 4KJIA 4A3GK 3HOYK 4I6YA 3W8GA 3GEHA 4LR8A 2AX0A 2Z8QA 2E7WA 1M1KT 1Y10A 1TUGB 3NGTA 3FGVA 2Q79A 1RXOB 2MQNA 2EKNA 4LQYA 2F8EX 4A3EC 3PW5A 5BYQA 2C2RA 4KB2A 3D0IE 3QSIA 1V9OA 4PR6A 3MM7A 5DM7Q 4HLBA 1XPPA 3Q24A 3IR7B 4JV5J 4B3SJ 2EW9A 3HKZL 1UVKA 2QFIA 1ICEB 1BMQB 4JI0F 1RUSA 2BX6A 1YJ9S 3S16K 1WEYA 2LVWA 1JK9B 2FQOA 2GVDB 3F41A 5KG5A 2VUGA 1NB7A 1D1UA 2Z4PA 4IUFA 1YRXA 1RAJA 3OSPA 2MZSA 3WX4A 2FVPA 2CQ0A 3IO1A 3MM8B 4Q5VA 4I6AA 2PMWA 3ZZ0A 3OTDA 2ZNZA 3HVTB 1T9YA 4WP9A 1FXRA 2YWEA 2BANA 1CVJA 3QLHB 5H9FK 4OIOA 3ENAA 4B9SA 3ZFVA 4DFPA 5EGHA 2DH8A 1ZPVA 2ZZMA 2G0CA 3JYTA 3IM9A 1TWCK 1XEZA 3HO1A 1N5YA 3EUNA 2RILA 3MCMA 2JA7C 1HYSA 1IS1A 2WB1D 4A3FK 2JFKA 4RU2A 3IGVA 4CNZA 2DRAA 1KR4A 5EX3A 1KVKA 3MI7X 1S1VA 3KLHA 1F2GA 1JLEA 3DLKB 1NK0A 1U1OA 5J2PB 1RLCL 1C1BA 3TANA 3HJFA 4DR1F 4K5SA 2YWHA 1TVRB 4C3IC 2LXUA 2J9DE 5A8KB 3EVWA 2ADCA 3R27A 3NRBA 4KGVB 3DM2B 4RX6A 2IIHA 4EUVA 1ZM4A 2K8GA 5AE1A 2XYGB 2XLIA 5M2UA 4JK1A 3E3XA 3LWLA 1S0VA 4A8XA 4J9OA 1Y0HA 2NXNA 2J5AA 1WOSA 3GTGA 1C1CB 5T41A 1UETA 4OYMA 3PW4A 1H2TZ 3S2DC 1Y1WK 4D3GA 3NGDA 5IV3A 4C0HA 2G1DA 2HK2A 1JNRB 1URNA 3NKYA 3T1YF 2X7IA 4KH1B 1NCLA 2HQIA 2RH3A 4PG8A 2H51B 1NSKL 1R0AB 4A3KC 1SPBP 1Y5IB 2HS4A 2IM0A 3KMSA 3JXOA 2APOA 1R9TC 4YG2A 1CS4A 4RJVA 3FSIA 3KLVA 2JL9A 5GMDA 3BF4A 2RUSA 4ECYA 2XMAA 3Q22A 1I3QC 3DXSX 1J6VA 2IBKA 2DNQA 1TFWA 3FK4A 1VHIA 3S17C 2HGNA 4DL6A 1K73T 1WCMC 4ZVFA 4XSXA 4B3OA 4OYIA 2EG1A 5D15A 1VLOA 2V6SA 1GMWA 1XERA 3OL9A 4LSNA 3Q8YA 1HYSB 5HI7A 2D1CA 4K4XA 2CADA 2NVXA 5CA5A 2CA9A 1LWFA 1HPZA 5CYQA 1KRPA 3ZTQA 5J2MA 1FJGJ 3IMQJ 2IYGA 2MQ8A 2MGZB 5KT6A 4CQ1A 5C44K 1BQMA 3W2WB 1PILA 1IXKA 1TWGC 1IR0A 2D3OR 2Z57B 1ROFA 4KGMA 3ISND 1QVGR 3TVKA 2VL1A 2ZOMA 2Y1RI 2JLGA 4Q0BB 5B0AA 1MN9A 4GTLA 2VA3A 2DH7A 4F0MA 3RBDA 1YCLA 2HW3A 1GTHA 3QRRA 1R8HA 2RDDA 3H3VD 1WC0A 4J9SA 3BEGB 5JFEA 7FD1A 2QX0A 2V8HA 3IG1A 3CJ3A 2RRAA 2BDPA 2VDIA 1HI0P 1P1LA 2VBYA 4MAKA 3MCSA 4DQPA 2ZJPQ 4I6WA 3U27A 3BQ0A 1QSYA 1I6JA 3R8YA 3D68A 3EXYA 1UW9A 1MN7A 3CTRA 5AXMA 1E6YA 4M5LA 2V0NA 4QWDA 1G51A 4LFCJ 4DWIA 1RTHB 1U0HA 1RWNB 4L74A 4OYXA 4LF5F 2KM8C 2HQFA 3H5XA 5KFAA 3DOMA 5HLFA 2GMJA 5C25B 4KARA 4IOCQ 2HURA 4F50A 1WORA 4B9VA 2OP5A 3HSGA 2VA2A 2NSCA 1RWOB 2CQPA 2LEAA 1FFGB 2DTJA 1N0UA 3D5MA 3PW7A 2W8KA 3QQCD 1M1HA 3GTGC 2A2DA 3TQEA 4C2MA 5D8HB 3MR3A 1YX2A 5ETNA 1N54B 4GC6A 3EX7B 1NU4A 3D6MB 1B7FA 4CIOA 1WI6A 1GFWB 3GJQB 5CJ9A 5IZHA 4OJHA 1R9TA 4MIBA 4YUDA 1HI1A 3QIPA 2RD5C 5F3TA 2QLXA 3O6QA 2WSFC 1JLBA 4URQU 4F7VA 2FLNA 2VFRA 4A8MP 2GC8A 4KMAA 2NYIA 1X7VA 4F4AA 4UY85 4FN5A 2JSXA 3N9UC 1NDCA 1PYOB 4ZVEA 1EJ7L 2LEBA 3GTGK 1RHQB 5I42A 5E41A 2GX8A 1Z2ZA 1UFLA 3BO2A 3PHEA 3G82A 4Q8EA 3UE2A 3KJVB 3OQ2A 4H4KC 2WVEA 3PX0A 1F93A 4P71A 1TK0A 4F0HA 4USIA 4I0WA 1VK3A 4HACB 2OGUA 5ETMA 2E5LF 2EFQA 3UWTA 2FHJD 4NXMF 4KGZB 3PJXA 5G4DA 4F0KA 4DL7A 5KFDA 4DCOB 2E2HA 3A13A 3VVUA 2MQMA 5J1EA 4LJMA 1HARA 1IVZA 2HFSA 2MKJA 1SFOC 1C0UA 4LBHA 3B78A 4HR2A 2NVXC 4RNNA 3KK2A 4CO5A 2R3VA 4KV8A 4ECWA 4LLGA 2EBEA 2O66A 4ED3A 2R92A 1IKXA 4ED8A 2X1GA 2M3DA 5C5JA 2ZJQQ 3BN7A 1BDFA 3O3LA 2UVRA 3HSDA 2J7WA 2R2TA 1YKWA 4N41A 5IP9K 1VQLS 3G6XA 2LDYA 1HWUA 3L09A 1X4DA 1J2VA 2Y9HA 3HD1A 2QO3A 1YG0A 3ISZA 4DN9A 4P6QA 2VQEF 3D1QA 4FXWA 1HNVB 1T94A 4EK2A 4BWJA 1URRA 4R25A 2P9EA 4XSZA 1VISA 5FLXY 3GTKA 4WWSA 1UFKA 5EN1A 4WTYA 3ZXWA 1WDTA 1TWFK 4ILDA 1N8RT 3FSYA 1WNEA 2V94A 2OMOA 4ZJLA 4FYYB 4U7CA 1F7UA 2PMZD 4L76A 4P7VA 1O2FB 3BKFA 2BE5A 4DS4A 3SZYA 2BV3A 1MLAA 2CDRB 2UXCJ 3K7RA 2HBZB 3HSZA 4HEA9 1D0EA 2GVZA 1WF1A 4OI2A 5LSLA 2J8SA 2MZQA 2W7AA 2BOPA 3AQPA 3D0GE 2NVYA 3V4GA 1RAHB 3WBZA 4PWWA 4OJGA 3R1HA 1TQLA 1SC3B 1X9WA 5D4PA 1OQ3A 4LFCF 3J7Z5 3TAPA 3CCRS 2QJ3A 2LEPA 2RS8A 1LWEA 4AL6A 2YTCA 1B0TA 3CD0A 4FZBA 2FJBB 4XO0A 3J80Y 3DOLA 3SSRA 1AZSA 3FCWA 2KKHA 1S6OA 2DT9A 4PPZA 4WJ3M 4Y2AA 4RL1A 4ECXA 4DR2J 4WK3A 2VBXA 4MK9A 3D7SB 4RW9B 3SZZA 4H4KA 2CIMA 2H4YB 1XR5A 1JWWA 3CCZA 2BJ9A 2ZBCA 3DRPA 4NLYA 4KT0C 2OPRB 2OSQA 3R2CJ 4NA3A 3RU0A 3FKIA 4YR2A 4ECVA 4DFJA 5CYQB 4OYWA 5FLXU 5J2NA 1AA1B 4DR1J 3BSNA 2D41A 2DHAA 2J76E 5L39A 1N0VC 4FYWB 5JMNA 4KTQA 4RWXA 4WFAQ 1U48A 3TJ9A 5F0WA 1K83C 4A8OA 5DO2A 3IN5A 1TU0B 3EWGA 2QEXS 2NVTK 3DYAB 3NAIA 2KVQE 5HMZA 3R3TA 4IFVB 4ZVRB 1TWHC 2KZZA 5IYBC 4B3RJ 2ZOFA 1L3UA 4X66J 1OYDA 3CJRA 4EFAC 2A2CA 1S1WA 3KHLA 4I68A 2FQTA 3F0NA 2W8LA 1BQNA 1E6VA 4PG4A 1RTIB 2V8PA 2KTQA 5IT4A 2FY1A 3LGNA 4WU2A 2CDQA 1RADB 3A3NB 1KLNA 3DOLB 4QU7A 3HKZD 3M2VB 4A3DC 3TUPA 4DU7A 2AQ4A 3LPEA 1YJRA 3MAAB 1RAAB 1RGVA 2B63A 3GYNA 1HQEB 4K50A 4JI2F 4LFAJ 2XSJB 4WJ4A 2CJXB 3A3PB 1U6ZA 3HOUK 1RK8A 2LU1A 2FHKA 1FDDA 2IAJA 3T01A 4TQSA 4RNHA 2XHCA 4L72B 4Y52K 2ZHOA 3G4SS 3D28A 1VOMA 3PCOB 2R92K 1OY6A 1QVFR 5DGAA 2FB0A 1FWPA 4M1KA 2UXDJ 1FJGF 1XZQB 4XK8C 4R0JA 3CD7A 4ECSA 1X5TA 3VTIA 1IR1A 4PXEA 5KFIA 5M5XK 5IWAF 2F8MA 2HRYA 5FLMC 3VAGA 3ZZUA 4HI1A 1VGYA 4M8LA 3R6GB 1KLMB 2R2UA 3FMWA 1JQWA 3HJVA 3FKIK 3PHTA 4BC7A 3KK1A 4C8YA 3MM6A 2UVWA 3GTKK 3CCJS 3PJWA 2R7ZC 4LSZB 2BJEA 3OEPA 2XMJA 2R7WA 2V8GA 3FHZA 5J2NB 2DO0A 4WK1A 1CBKA 2WW8A 2V9WA 4DXLA 1ZPWX 1J5OA 6FD1A 3NNHA 2CQ1A 1HQ2A 4YDXA 1FXLA 1LWXA 4PG7A 2HZAA 1GAOA 3QYYA 1MWQA 2J6UA 4NI2B 2VD3A 4HH1A 4OHVA 4TQRA 1WF0A 3LP1A 2ZC4A 2JA5A 4O0IA 2W7VA 3E51A 3JQJA 1HNWF 1RA7A 2R8JA 5IP9C 1ZH5A 4I2PA 5LMUJ 2VG5A 2ZHAA 2HVIA 3EDQB 5B0GA 1BS2A 3UNGC 3OL8A 1WQGA 2AD9A 3M8WA 3IGNA 4GVBB 3GE9A 5C2CA 1QE1B 4HYKA 2KYXA 4OIXA 2MSSA 4YS2A 3MMBA 3MECA 3MCOA 5H9EK 2M52A 5U47A 4GT9A 1FRHA 4WILA 4KY3A 1JKHB 2BYCA 1JKHA 2V67A 1VC0A 4B02A 5EWFA 2R7UA 1G6BA 4X66F 1SC4B 3G86A 2KJVA 2IM1A 2XYPB 1J5EJ 2YQ3A 2B5JA 1L3VA 3SXLA 2DGTA 3QT7A 3IWXA 1S10A 3L4BC 3DOMB 4PABA 3N6NA 4ZPVR 2UVUA 2CJYB 3KK3B 1NH8A 2OSRA 1DFDA 4P5AA 3UN3A 4YEAA 1ZA2B 2EKYA 3EZ5A 1AUDA 3M2RA 3AA8A 1SUQB 3AOCA 4ECTA 1QD1A 1RWVB 2NXEA 5C42A 5CABA 3CDAA 3TWZA 1LWFB 4DR5J 4BDPA 4J9MA 4DLEA 5J2MB 1RT5B 1WIHA 3MURP 4WFYA 5KT7A 3BPDA 4FF2A 2DNKA 4KSEB 2ZBIA 2Z2ZA 4KM8A 1CJTB 2EC2A 2ZBRA 1R6VA 5KFOA 2N7YA 1B4SA 5IORA 2H3EB 2HVDA 3L9ZA 1HBOB 3M3YC 2NLWA 1JLCA 2GAGC 4C3KA 2J0SD 1T9WA 2GVZB 3SI8A 2OH2A 2OTLS 4UOFA 2EBGA 4V1Ak 1WDDA 3J80U 2XLKA 3K5NA 2ZH1A 2CNLB 3GTQC 4FBUA 1FKAF 3CC7S 1IM6A 2QLFB 1LW2A 2FJDB 2ZUGA 5DM6Q 1PYTA 3G6YA 2WBMA 2FVCA 1YZ6A 1SKWA 2CFAA 3DXJA 2EFOA 3IM8A 2HFOA 2YH1A 1VJQA 3W3SA 1WKKA 4LRCA 1REVB 3LANA 1Y5NB 5D78A 4B9UA 5MAOA 4I64A 2IA6A 2M7SA 4F02A 4A3IC 4RKUC 1MROB 3DI6A 1ZETA 3BGRA 2R7OA 1N5SA 4H54A 2FQQB 3IBFB 3KYLA 3GTQA 7AT1B 2YKPA 4WXOA 4PAAA 4RLEA 4Y3CA 1X0PA 2A6EA 5F8GA 5M2RA 2HQCA 2B5JB 2CQ2A 2HGLA 4IQXA 2PSZA 2ZWOA 3RR7A 5A8KA 2B0GA 1T0TV 3ELHA 1XR7A 4DV7F 2R93A 1VHFA 4OX9F 2G2OA 4NL5A 2GSUA 1GQEA 4A8FA 4RMFA 4TYAA 3PIOQ 3RBEA 5J2PA 4IRDA 3AAWB 4ILMA 4UOGA 1NDPA 5FD1A 3ZZRA 1CLFA 2MKYA 2ATCB 4X4VA 3KUHA 1JB0C 4DL3A 2KWAA 3G6VA 1TL1B 5A76A 1AT1B 4DSKA 3DN9A 1T05A 3RR8A 4HACA 4JI6J 2F9DA 3D9BA 4DUYJ 2YKMA 1SJQA 3CO0P 4A3FC 3KDNA 2IDEA 2KO1A 4KDDA 4J90A 2Y1IA 1F5AA 1S9GB 1N32F 4LR9A 5D4LA 5HQLA 1RHRB 2WK4A 3S1MK 1C0AA 2ZH6A 3GTPA 3I55S 1M5PC 2A3JA 4Q44A 3MM8A 4E98A 2ZFHA 2FY8A 4ZP6A 4LFBF 2RU9A 1O2AA 5C4JC 3PKYA 3JS9A 4AQYF 4ZK7M 2XM3A 3G87A 2WBRA 4ECUA 4EBDA 3M9NB 3CCQS 2CFAB 3X1LB 1QY7A 4BY7C 5KG7A 5CCMA 4TY9A 4UUWA 3W64A 1UWBA 3U7JA 4A3MC 2P2CB 1EI6A 4QIWL 3I0SA 1FD2A 2UUAF 4BBRK 1HBNB 2Y3YA 3QRQA 2IRXA 3LTOA 2GIFA 2BE2B 3MTKA 3K2YA 2V2ZA 5LL6d 3KK3A 2YQ0A 4EWTA 1H2VZ 1JXLA 2IC3B 1SIWB 4OHYA 4CLTA 2CAJA 2LKZA 5CXTA 4B3RF 1Z1ZA 4ZDNA 4NLPA 1JLQA 3LUYA 1N88A 4P2XA 1UJ6A 5D3GA 2E29A 3Q3QA 1W25A 3O5TB 2BEFA 3ULHA 3KDOA 3P3DA 2IYIA 3CCTA 1N33F 4FM9A 1RAOA 5FJ4A 2NVQK 4LF7J 2VODA 3UVJA 2HHUA 1RTIA 3MTJA 1HQEA 4G1IA 5HVGA 4O2DA 1SFOK 4JV2A 2F1FA 1TWAK 4G1PA 3W66A 5EWGA 1T3OA 1H6KX 5KFEA 2L41A 4O4RA 3FQKA 4A8SA 1YWXA 2R8HA 2HS3A 3HOWC 3GTOK 3OV7A 2MKKA 3UQSA 3TZYA 3S1TA 5B0CA 3SEOA 3MD3A 4DR2F 4LFAF 5RUBA 1P9YA 3N3YA 4KRWA 1VYAA 2XNRA 3ZTSA 4D3HA 4C9DA 4KV8B 3HD2A 2KHCA 5CCLA 2ACMA 2YH0A 3KUGA 3TA0A 2JA6K 2E7XA 3QT6A 2B9EA 1GXUA 2Z2YB 1TL3B 4CT8A 3MXHP 1VRTA 2XQCA 3WDOA 5DZ7A 1F60B 4WFBQ 4A3JC 3M4OC 1KFDA 2HHPA 1XXCA 2BUNA 3FEXB 1UMJA 3M8YA 4NCGA 2XZDB 3LPYA 3MPYA 3UD3P 3JSYA 2B63C 1IWAA 2RH6A 2IDLA 3I0SB 4HHHA 2R92C 3EGNA 1X9MA 3HF5A 2IRYA 5L8RC 2XMKA 1AROP 2VKZG 2ZBPA 3BUEA 2KDOA 2W2PP 4M95A 4DF8A 1NO8A 1RHUB 4WF9Q 4TKTA 1JNZB 4L75A 5AXLA 3V81A 2NUUG 2LLZA 4ZPCA 3VV2B 3RB0A 4DV3J 5AJ3F 1CJTA 4ICLA 3HHLA 4DI6A 2QN6B 3RUBL 5DRKA 3UD5A 5L46A 4DL2A 1FNMA 1I3OB 2CQGA 4DOZA 4OZ3A 4F2RA 1IJFB 4N56A 4DS5A 2VV5A 1Q7YT 4Q2LA 1IBMF 2X1BA 1ZYQA 4LK0A 4IRCA 1HNWJ 1M5HA 4ES3A 1RTDA 2R93K 1NDLA 2EWHA 3R5JB 4OFZA 1B70B 1MNEA 1TL1A 4DQRA 3L7OA 5HQ8A 2E2JK 3GTJA 1GX5A 2V4JA 2Y8YA 3I9V9 4N7TA 2H5IB 4KHMA 2E5LJ 5TMFA 2KI2A 2DNPA 3HHLC 5BR8J 3QATA 1RTDB 1G4CA 1PG5B 5BYSA 2VFVA 4WYLA 3M32A 4GKKJ 1YK9A 1R27B 2LA6A 3ZO7A 1S76D 1SL2A 4JB8B 4NEZA 1Y9OA 2OUGA 1I5OB 3DLEA 3P5BP 4OZ1A 4FNHA 2BJ8A 4QYZJ 3NWGA 3FBCA 3AD8C 1XNRF 2ZVIA 2PHCB 3C15B 4F3QA 3GJTB 2QTWA 1EARA 1FEHA 4WZQA 2DCLA 2HIYA 2AYMA 3CCUS 4RUAA 3HVAA 2QL5B 1ZXOA 4DR7F 1SBRA 4OQJA 3NNAA 3BBFA 5GMEA 2BMBA 1SQEA 1RKJA 3S17K 5M5YK 3TR5A 4M5HA 4OHXA 4OZNA 1T9TA 2M0GB 5LXYA 1X9SA 2YXLA 2RHSB 3MMAA 3P4UB 2GGPB 1IBLJ 5GMKa 2CPEA 3G4CA 1FK9B 2YBVA 4BCAA 3KNAA 4MYTA 1HI8A 2ZNYA 1NBEB 1SB6A 1YQHA 1VQ7S 3BGLA 3T9ZA 2WVBA 2MGZA 3MFIA 1HQUA 1DTTB 5KG0A 2JA7K 3LAPA 5IT9U 3CNQP 3SCJE 2RF2A 3HCXA 3M2VA 5IYCK 1M1GA 1Y7PA 3JAMU 4U96A 3CDWA 3FRZA 3TEHB 2HRUA 2KXHA 4A48A 3PIPQ 1K0VA 4FP9A 2P5MA 3K59A 1RHKB 4QR0A 5HJXA 1AXQA 2E5JA 1FESA 2XB2D 3HHKA 2LQJA 3HULA 4LIRA 3LF0A 4J91A 2EVZA 2XZWA 4N47A 2PFDA 4DU8A 3MMJA 1LK5A 2DR8A 2ROPA 3DOKA 1B7YB 3RGIA 2R7XA 1NH7A 3GTJK 3KJNB 4NEYA 2CPIA 3SCIE 1IUJA 1UPMB 4K4ZA 3I4NC 1XC9A 3NS5A 3KHHA 2CJBA 1CEZA 3H25A 3OVSA 3IC1A 2HRTA 3CJ4A 2HNZA 1MROA 1S97A 4DPTA 1IBKF 3HHEA 2NUHA 2XWXA 4R0EA 2XHWA 3TFIA 3D4JA 3S1RK 1KLMA 1RT7B 2BJ7A 1F1BB 3I5AA 4JI5F 1FWLA 2NCKL 1NHVA 1REGX 1S6QA 2QT7A 3DHXA 1DQ9A 4DL0C 4EGLA 2H48B 2YKAA 4NLWA 4ED1A 4NE9C 3M3YK 3SDEA 3E01A 1D3WA 3CQZK 5MLCV 1TWCA 5LM7E 3C16B 2C2DA 4ZVPB 1HNXF 1DJ0A 2YVSA 3W9JA 1X4CA 1U0SA 4C0BA 2R7ZA 1FKOB 3OXGA 1FJCA 4KAIA 1YNJA 2HWTA 5E3PA 2ZE2B 3THPA 2AEMA 4Y2KA 1N32J 4ICLB 4H4MB 1IKWB 4ZS6A 1KQ4A 3QAEA 2B63K 2HMIA 3HOWK 4HKQA 2DKOB 1T11A 2LMIA 1B99A 5BR8F 1KN6A 1R8AA 5KG3A 3V6KA 1FRJA 1TWHA 2R7RA 1X8DA 5KT4A 2C3OA 1ZTWA 1YJTA 5FIIA 2LU2A 4QZVB 1Q95G 1KTVA 4LF9J 1IBMJ 2KT2A 2XCRB 3QFWA 5A0YB 1BHNA 4K4UA 2HK3A 2UUAJ 1EETA 5LOQA 3QT8A 3NMAA 1PJ7A 4DQSA 1FRMA 1D9DA 2FGOA 3OFHA 3BBBA 4O3OA 4W98A 4UOHA 3GTPK 5HP1B 1VRTB 1FVQA 2XMTA 4RBVA 4GC7A 2HEKA 1K47A 4ZA1A 5JVOA 5KFJA 1UA1A 5M3MK 3BM7A 3WIUA 4YOEA 1G3OA 2P6TA 5LSOA 3R9LA 3VR1A 3I0RB 1RISA 4ANEA 4U95A 5IP7C 2JA8C 3P45B 4EO8A 4A3GC 5IQ6A 2A6MA 2ZUFA 2HPUA 2ZKTA 3N5BA 3H59A 5KFKA 4DR7J 4Z7CA 4FZVA 4ZCLA 2NPFA 1CJKA 5J2QA 2AGOA 4IH5A 3T00A 3GG1A 2ZH2A 1DD5A 1Q8IA 3M6XA 4UOCA 1QAJA 5FLMK 1WCMA 2CVEA 4ZH4A 2ZITA 2JRSA 3ZZYA 5D6GA 1VBYA 2IFXA 1NAQA 3OL6A 3K58A 2W9BB 2HHTA 1N36J 3M8PB 3H0GK 3EM1A 1X4EA 2JA8K 3FKIC 2L3MA 3D3CJ 1S1UA 3MPWA 4QWEA 4RR5A 3W61A 2HHSA 4ERDA 1BQNB 3AD9C 5IM0B 3I4MC 2ZDPA 3ISNC 4OZJA 1I6HK 2B6AA 1RB0A 2XS5A 2HS0A 3UNYA 5CD4A 1Y3JA 1NHUA 5L38A 2QC3A 5IFMA 4P75A 1S9EA 4ZN1A 5DDRC 1P6TA 4LF4F 1BY9A 3S1MC 2X1FA 4X4TA 2ZFZA 4TN2A 3KXDA 4KKOA 2AJQA 3NWRA 3HXMA 5HBMA 1V5IB 4NASA 1S1XA 4DHVA 2MQPA 3OT9A 1HW8A 4OI3A 1JLGA 2DB1A 2YY3A 1XNQF 3GTLA 1XWLA 2OPSB 4X62J 2I1RA 3F73A 3H0GA 3RZOC 4U7UD 5E3QA 1V3RA 4UY8T 3NUHA 2V6UA 1CULB 2CNKB 2D69A 4XAKA 2E5HA 5GAEI 1V3SA 3AA9A 2A69A 1YDLA 3H42A 2B7BB 2E1CA 3GIIA 5KFGA 1VBXA 1HQUB 4IR9A 4Q45A 2IC3A 4PUOB 1SI9A 2QMWA 4GTBA 3BN4A 3M4OK 2OKQA 4GTFA 1M5KC 4PWDA 1Q79A 3RZOK 2OO4A 1FK9A 1IBKJ 1EZZB 2AHOB 1ZBSA 1HBUA 2PDAA 5ETRA 1JLCB 3W2WA 4DL5A 1RWXB 1RACB 2X51A 4QJVA 3NBPB 3HLUA 4UW2A 2DRDA 3FFIA 5KFUA 1DLOA 2H5JB 2YKQA 1ZZNA 5F41A 3UDCA 1H38A 3ONQA 4BLAA 2YPYA 2JDJA 5J1PA 3DLJA 4WKYA 4L6V3 1NSPA 1KVIA 4J7CA 2WZ1A 5C3EK 2PMHA 3D6TB 2HMIB 1YI2S 5IOSA 3D54A 4G0WA 1SKUB 2ZE2A 3OR1B 2CZ4A 2ZBQA 4JI0J 3GCWP 2MEWA 3BO3A 5LJ3Y 4ZOSA 1RJJA 3CJ8A 2RDJA 4WBFA 1S1XB 1QTNB 2XBPA 5EUHA 1QE1A 1XZPB 3UI3A 2HFZA 1KC8T 2X1AA 2XYHB 1AUSL 2GJFA 4JV5F 3KG0A 5HL7Q 4GVBA 3VGTA 2CPJA 3PR5B 3H8YA 1NMEB 3IRWP 4URSA 3ET6B 3GTPC 1HFEL 5HLFB 3HT3A 3CJSA 3VAJA 3PX6A 1DZ5A 1NKCA 3SQOP 2PC6A 4OX6A 3GTLK 4UUXA 1TKTA 4CZCA 3MZIA 1OO0B 4G0UA 3WC0A 4IG3B 1AYEA 3MEGB 4KIAA 3RYLA 3M9OB 2C42A 4NYOA 3C8YA 3CDEA 5HMXA 2JLFA 4LUBA 4NLRA 2MQLA 5ETTA 4J37A 1RZMA 3G8QA 1RE1B 3QNWB 4QQBA 1VJEA 4OINA 1YJVA 3H5YA 1TAUA 5HMWA 2YX4A 2ZHBA 3G4AA 2V68A 3MPUB 2R7SA 5E0OA 3W5ZA 2ZC3A 4CYUB 4A8WA 3QO9A 1JX4A 1XMOF 4BBSC 4PUOA 1WD6A 4DF4A 4HHJA 4KC6A 5KFMA 2KG0A 2RMLA 5J1NA 1MWZA 1OPIA 1WC3A 2DNLA 1T95A 4K4VA 1TP7A 3KG1A 3KK2B 1NJYA 2VICA 2E66A 2YNIB 4BC9A 1ZAWA 1KHWA 3LP2B 2CNOB 1CJUB 3R97A 4W90B 4HDHA 1HBOA 3QZ8A 1MWYA 4FF3A 1WUUA 3D1HA 4EYHB 2HSEB 4ZPWR 2R9LA 4CLPA 3MD1A 2CW0A 4C8ZA 4OZ5A 2J0XA 2FIUA 4DV4J 1I50C 3JSMA 2FJXA 2CZVC 1AW0A 3PXGa 4KR0B 2B9XA 2QRRA 2RAQA 2UUBJ 1CJUA 1SV5A 2OD6A 5B7WA 2BKNA 4C3MA 3M8SA 4CO1A 2N82B 4C8OA 2E2HC 1FRLA 1OJ4A 2DGXA 2BJ3A 2WAQD 4WFNQ 2XNQA 4NCAA 4ZVSB 3CDBA 4ITSA 4MYUA 1RWUA 1RT6A 4OZ2A 2YKOA 4F4WA 3BGFA 2LXFA 4ANCA 2ZEJA 3P96A 2OFHX 4FS2A 1TWHK 2RE1A 1HKAA 2J6SA 4DPYA 4FF1A 5DG8A 4OX9J 3V81B 1KQSR 2HHVA 1RHJB 3I4PA 3MR7A 4A4JA 1VC5A 2Q6CA 4GO5X 4I4BA 2L9WA 1UZHA 3EGWB 1GMVA 3FBBA 1IE0A 2WTFA 4NPOA 1W26A 1Y11A 2RKIA 4IDKB 3L4KA 1X4HA 1U6FA 4Y2IA 2UUCF 2M8HA 1EHWA 4KFBA 4IOAQ 1VR6A 2V2KA 3ILIA 2AEFA 3M8QA 1R3NA 1UWAA 3M8QB 2QL7B 3TFJA 2W2OP 2COLA 1R0AA 3S15K 4OHWA 1HW9A 1Q8BA 3J81U 1QJHA 3TX0A 3VAHA 3ENWA 1WSVA 2YNGA 1VCTA 5M2PA 2N4CA 1L3SA 1QSSA 4X4NA 1MMNA 3EMTA 3RRGA 1ZTTA 2W9BA 3A8IA 2QA2A 4LF7F 3SBMA 4G7HA 1EK8A 1YGYA 4CH7A 2AZ3A 3NS7B 4JBCA 7FDRA 4KHRA 5IYCC 1LWEB 2DGQA 2FLLA 4F4KA 3UCGA 1VJWA 1F9FA 3MR5A 2V6TA 4USTA 2GJIA 2FVSA 4U6PA 3OXFA 4EEYA 1JLFA 4WP3A 1TV6A 3S2HC 3KLIB 5F3ZA 3RB3A 2V63A 2ABYA 1X4BA 1I6VA 2W4CA 5AE2A 2DR5A 1CSJA 4YY3F 1A0OB 3TZXA 3LAKA 4M5MA 1KHVA 3DLKA 3TAMB 2RB7A 2AT1B 1NZ8A 5HMYA 2P9CA 3AJ1A 4O0NA 3DRYA 1L5UA 3W9HA 1H3DA 1U1MA 2EEYA 3HFVA 1R31A 8ATCB 1RLDA 2EBBA 1RDRA 2ZWPA 5KFNA 4F67A 1FA0A 3WQPA 3OVAA 2IPOB 1S7HA 1LV5A 3TEGA 3MM6B 4IOBA 4LRDA 6AT1B 4ZIWA 4KATA 1RAFB 4C6AA 5FDLA 4FDFA 1JJHA 2K06A 3PDNA 2GGPA 3HKWA 4OI4A 3M1VB 9ATCB 4AQYJ 1YBTA 4RW8B 4C8LA 1CQNA 1Q5YA 2VBWA 2ZVSA 2E7VA 1IBAA 1K83A 4F25A 2C3UA 3T9NA 3KLGA 3QO9B 2DGSA 2VONA 3TUIC 3UPFA 4NWBA 4QR1A 1S1UB 2L9NA 4A93K 3N6LA 4XLPA 1EAYC 4A3BK 2M8DB 1CQMA 1Y1VC 4K8RA 2HNDA 4U9RA 5D4DA 2UXBJ 2JVRA 3HZEA 1WEZA 2MSTA 2VG6A 4LVOP 4A3IK 2F4VJ 4J9QA 4AUKA 5CZVA 3D1OA 2WONB 2GQCA 4KBIA 1C0UB 2E5GA 3N01A 1R9TK 3TA1A 2C2NA 4XPEA 1VQOS 3IA0A 3PX4A 1NJWA 2PIIA 3GMGA 5KFVA 3B4MA 2HAIA 1K8AT 2PO4A 2C3YA 4DV5J 3NEKA 5DG9A 1JIHA 1DAXA 2PA8D 4CTAB 2DXDA 1RU2A 1KVJA 3MHYA 2VKRA 1XMOJ 5KFCA 3C14A 2AJ1A 3HDSA 3X3UA 2D3ZA 2I6WA 4NLGA 1ZS6A 2FTRA 5IYDC 2HNYA 1EKSA 3OJUA 2FUG9 3SIPB 4LOWA 3P6YC 2ZH4A 1RAEB 1S6QB 3GTMA 5K9FA 3PR4A 2WSEC 1O24A 3S01A 1TKDA 4CLSA 2HHXA 1PAEX 5HAOA 4X62F 1HLWA 2EXUA 2IM3A 3M1VA 5A8RB 5I42B 2AF6A 1JLQB 1BXNA 2XG8A 4F36A 1WC1A 1HBNA 2V9KA 3CC2S 2ZZNA 4DV2J 5BYRA 4RNFA 1U1RA 3SCLE 1RT6B 1YHQS 3AY0A 2RRBA 2DPJA 4I2PB 3CJ5A 4ZIVA 1J6XA 4USVA 3KJVA 5IYBK 1Q53A 2DCUB 4KMDA 5GADU 4P10A 3AFGA 1H7WA 4A3CK 3HMJG 3R5GA 4B3MF 2DHXA 1I51B 3IS9A 3FOEA 4QJVB 1WHVA 5GAGU 2D9OA 2Y3PA 2J0QD 1V6HA 1XQIA 4X4UA 2DR7A 1XJWB 1Y1VK 1YBUA 2BKOA 3BJYA 3CJ0A 4MFBA 1TL4A 3SSQA 1SXLA 1RT1A 5KG2A 2V2QA 3HHDA 4K7QA 3AJDA 2GO9A 2XWYA 1VK8A 3NGRA 4WZMA 5C4JK 4FVMA 5ETKA 1FJEB 2O5DA 3E8OA 2BQUA 3A12A 4DV3F 1UVMA 3I6PA 1WWHA 4DSLA 2Z2MA 2YNFB 4GTCA 2MB0B 1S49A 2EFVA 1VFJA 5IS2A 3KHRA 2GA7A 4B3OB 2XMWA 4PKDB 1LQ9A 1YRUA 5B0DA 1HQMA 5I3PA 3R5CA 3N0VA 3IBCB 3KLHB 1L3TA 1S9FA 3ZZTA 5SZTA 1O5JA 2DNMA 3JQMA 3MMBB 3FJ2A 1MU2A 2V4JB 1N5YB 1H73A 2WHOA 2Y0BB 5LMNF 1XN9A 1ZAXA 4J3NA 2HWIA 1MG7A 4NZ6A 4O23A 4RO0A 1TWAA 2BACA 2RDIA 4CI0B 2KL8A 4JI7J 1LK7A 1VS3A 2CPFA 3LWMA 3VQSA 1U1QA 2OFGX 2OJ3A 3MM5A 2RQCA 3V5RA 2NVYC 2W4DA 2ZOGA 1LOUA 5L1LA 5DQIA 4PCQA 2B56A 4PG5A 3BDEA 1N52B 5DDOC 5B09A 2XY5A 4CM0A 2DNGA 1MSWD 4JI1F 3RZAA 2VZ9A 2QMUB 1FE4A 1C1CA 4NLUA 4NA1A 1WG1A 5I3UB 5KFTA 4R5PA 4M5IA 3KMQA 3HFZB 4K4TA 2OEJA 1HHSA 3GPAA 2R93C 5E3RA 4LK1A 4HHUA 3VCDA 3BO4A 4I67A 1UP1A 4LF8J 3HX9A 1R8PA 3DDNA 5HQMA 1ZOTA 2VC1A 2F7VA 1X60A 3LQVA 3TJAA 2MLZA 4Q5SA 5CHCB 4JI3F 1JLAB 1WEXA 4X4OA 4E0DA 3AH5A 1U2FA 1NK8A 3IFEA 5L1KA 2KFYA 1R8CA 2Z30B 2YWKA 1RA6A 2C2OB 2YNIA 3CF5Q 3LH2S 3THTA 2VUMK 2GHWA 2EI5A 2GIRA 2XY7A 1DHMA 1P1TA 2VF3A 4ENOA 3VAIA 2ZKUA 5KG6A 1VLYA 1VQ6S 1VBKA 1LEOA 4MMOA 1TWGK 5HSPA 2JFDA 2NVTC 5C44C 1NNDA 1OSDA 4JV0A 4G65A 4IG0B 4PWUA 5T14A 2YX1A 4M1XA 1DQAA 2O1PA 2YWGA 4N77A 2QYGA 4ZCIA 5DQHA 3GCXP 1HWKA 3M30B 3H7HB 4X84A 5KT5A 3HSJA 3RB4A 3T5LA 2CWXA 1DRZA 2LDIA 4KPCA 2FJWA 3K7AC 4MKVA 3M6WA 3W63A 1NK5A 4NZ0A 3T41A 1CULA 2GAHC 1M90T 1EIYB 4EO6A 2B43A 4NLTA 2AIRB 3J81Y 1T03A 4LBPA 4QWCA 4RW7A 3GIJA 2LECA 2HGMA 4IFVA 3W2VA 3W2VB 1C0TB 3IRXA 4RW8A 1RT3B 4ZVUB 2I8EA 2MTLA 4ZP8A 1R6YA 4AT1B 2DNOA 4DV6J 1F5BA 1WELA 2UXDF 4ZP7A 1VQPS 1OWXA 1GXTA 2Q3PA 1C0TA 2HFVA 3IRXB 1YIJS 2GW8A 3E01B 4A3EK 2L08A 2ZM6F 1FD8A 5CYMB 4LRFA 5C25A 4CLWA 3M9MB 3P49B 3DRPB 2JNJA 4MFBB 2OPRA 2LQBA 1GX6A 2ALYB 3DU6A 4ED2A 3VAMA 4RW9A 2NR0A 2UZAA 4YMEA 4W4MA 3MGJA 3BGRB 3AODA 2RIJA 2N4DA 4ID8A 3DLBA 2J9DA 1RU0A 4OI6A 1IKVB 1FE0A 3HVTA 3UCZP 2H54B 2L9DA 2EG2A 3GR0A 2X3DA 1HNIA 1CC8A 4KO0B 4JP8A 3JSMB 3DDKA 4ILLA 9RUBA 3GSDA 2QYCA 2CPDA 3T1AA 4M5DA 3ZNJ1 2BW2A 4G7OA 3RTVA 1RHMB 1UW4A 4P2SA 2BM0A 3OPKA 1F9NA 4DX6A 2JA5C 2CJAA 2JVOA 3PO4A 3BREA 1S5ZA 2UU9F 1S72S 3S1RC 1INNA 1YTYA 3DRRB 4M5DB 2Y0SD 4ZLLA 3I5CA 2MQQA 1AB8A 1WOPA 2POKA 4ELTA 1Q7LB 4RW6B 4DPXA 3H2UB 1BE4A 4XPCA 4ZMMA 1LNQA 1N5VA 4FYXB 3PW2A 4C97A 2YNHA 1UZDA 3K7AK 2CQIA 1PKUA 1B4BA 4RW7B 3U1MA 3RZDK 5EGYA 1J5EF 3CEDA 3MEEB 2MXYA 4LF6F 4C3IK 4QCLA 2JEJA 3KNGA 5KFLA 4M94A 1T02A 3ZZPA 1NEEA 3GZ7A 2P8TA 4CLZA 4B9LA 5HK4A 2CKWA 5G0RB 2VPZB 4W92B 3GFYA 1NKBA 4DUZJ 1S7IA 2VQFF 5SUHA 3M8ZA 4N8OA 2ZD1B 3SQGA 2DR6A 1KEKA 4LJZA 1HI9A 1IKWA 2AJ4A 2FJVA 3UN2A 2MJUA 4O3SA 1KFSA 1RTZA 5KT3A 1DURA 2E1RA 1R0CB 2MZRA 3KHGA 4B9MA 1NPRA 1XMQF 2ADBA 4K2JA 3AD7C 2UUCJ 2NVQC 5HVFA 3G2XA 2ACYA 3QIDA 4J9PA 5A6WA 2VG7A 1ZA1B 3OUYB 2G1HA 3ADAC 4K4SA 2BA9A 1VBZA 2B4PA 3CQZC 1JLGB 5A0YA 1WACA 1H7XA 4HDGA 3DRRA 3C66A 3K5PA 2M9KA 3Q8PB 4M5GA 1FKPA 4WP8A 2JH3A 2RKIB 4IDKA 3GFXA 2DEJA 1JJ4A 2HYIB 1Q78A 1RWPB 1NB2A 1R7IA 1RI7A 1HWJA 1K9MT 3PO2C 1BWEA 3W5XA 1PC4A 3HOVC 4R5PB 3OW2R 4GKJF 5HN0A 4FXVA 1FWKA 1YJUA 3PZPA 4ID5A 3Q83A 2DYAA 2VBZA 2DIUA 2HLUA 2GQQA 4JYAJ 1DARA 1DTTA 3OHBA 2DHSA 3NBPA 3WHIA 4ZN3A 3VAFA 3CE8A 2YKNA 2KXNB 4ZCKA 1Q4RA 3I9ZA 3THVA 3H40A 2D6FC 2OEMA 4AFFA 1NKEA 1FEEA 3IS9B 2F4FA 1USMA 4B3SF 3ZZZA 1JOEA 3HXAA 3W62A 3OLBA 4DDFA 1WHXA 4A8YA 3RW6A 3R7SB 4CM2A 4K5RA 5CYMA 3BGOP 4FYVB 4P7TA 3Q86A 1U8SA 4Q43A 1VQNS 1T9UA 1U0HB 2J8AA 4PXCA 3D67A 1Q1KA 1RAGB 4DX8H 4P52A 4KC5A 3ZTOA 1HBMB 2OPSA 4IYQA 4FS1A 4BY1K 1WCMK 5ETSA 4OI0A 3S2DK 2GZOA 2F40A 2FGCA 1Q86T 4YB6A 3I5BA 4Z7YA 5HANA 3QWPA 4USMA 4ER8A 5LMNJ 3QJLA 1EQ0A 5K8NA 5KFRA 2I0XA 1P9QC 4RZRA 2LQ9A 2KH9A 2CPXA 1YRTA 3H98A 3FCVA 3AQOA 1J6WA 3OL7A 1DLOB 2DVIA 4MH8A 3S1NK 5I4MA 3PRBA 3RAQA 1FDAA 3IAS9 4NLSA 4KMUA 3DM2A 6FDRA 4OLOA 1UFWA 2EK6A 2DXEA 2NXJA 4DV5F 3N5FA 3HI9A 4PYAA 5A6PA 1XXBA 3CPWR 3IAM9 3T02A 1RCXB 2FD2A 1J27A 5I3QA 2V2VA 4EI2A 5GAHI 2FLOA 1FCAA 2K2PA 1W7WA 4X64J 1WG4A 3RRKA 5E5NA 2GV1A 1TFYA 3QSYB 1HNZF 1N33J 2DR9A 4LF8F 2KZMA 1APSA 3GYXB 1VRQC 2UU9J 3QZ7A 3HOVK 1JLAA 3V4IB 5CH7B 2WRMA 1TMJA 2PT0A 4E8UA 1WQFA 1DCHA 1IR2A 3PNIA 3CMQA 2QLBB
chains in the Genus database with same CATH topology
2GAGC 3TFJA 3A8IA 1YX2A 1X31C 3AD9C 1XZPA 1VLOA 2GAHC 3ADAC 4P9SA 3A8KA 3GIRA 4PABA 3TFIA 1VRQC 3A8JA 4PAAA 3AD7C 5L46A 3AD8C 1WSVA 3GSIA 1PJ5A 3TFHA 3TTGA 1WOOA 1XZQB 1XZQA 1WOPA 3GEHA 1V5VA 1XZPB 1WSRA 1PJ7A 1WORA 1PJ6A 3GEIA 3GEEA 1WOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAG C;  3TFJ A;  3A8I A;  1YX2 A;  1X31 C;  3AD9 C;  1XZP A;  1VLO A;  2GAH C;  3ADA C;  4P9S A;  3A8K A;  3GIR A;  4PAB A;  3TFI A;  1VRQ C;  3A8J A;  4PAA A;  3AD7 C;  5L46 A;  3AD8 C;  1WSV A;  3GSI A;  1PJ5 A;  3TFH A;  3TTG A;  1WOO A;  1XZQ B;  1XZQ A;  1WOP A;  3GEH A;  1V5V A;  1XZP B;  1WSR A;  1PJ7 A;  1WOR A;  1PJ6 A;  3GEI A;  3GEE A;  1WOS A; 
#chains in the Genus database with same CATH topology
 3MDF A;  2BAN B;  5D4O A;  2GS8 A;  4RNO A;  4CLF A;  1QUP A;  3IWN C;  4LF6 J;  2UVV A;  3NOC A;  1S77 D;  3LW5 C;  2MZJ A;  2OI2 A;  2C2Z B;  2OHD A;  1X4G A;  3PM9 A;  3HPO A;  3BH7 B;  5TJ3 A;  3S15 C;  5CD4 H;  3KFW X;  3FUY A;  4XLN A;  2ZH3 A;  3N0B A;  5HL8 A;  2CQC A;  2KU7 A;  1F3V A;  4MQ9 A;  3MUT P;  1DTQ B;  4ZVQ B;  1PC5 A;  2MHE A;  1S4F A;  3EDR B;  4DQQ A;  4DCJ B;  3BP3 A;  1VQY A;  2R7Q A;  1XTZ A;  4NML A;  2Y8W A;  3KK1 B;  2VFU A;  1CJV B;  3AH6 A;  2JA6 C;  3GTY X;  3DHW C;  4ZPA A;  2PE8 A;  2VOP A;  4PQU B;  1FKO A;  3GV7 B;  4K0K J;  1Y5L B;  2B7C B;  2BE7 D;  3GFZ A;  4O4G A;  3BYP A;  4CCH A;  3ILO A;  3IWL A;  1BUX A;  4OV1 A;  2YKM B;  3L95 X;  1TMM A;  3M4X A;  4F2S A;  4CO3 A;  2CWK A;  3LAL A;  1NK6 A;  4WE1 B;  2E2H K;  4O44 B;  1UVJ A;  4O44 A;  1VQ9 S;  3MPV A;  4PZV A;  5DDP C;  4C3J C;  3SV3 A;  1VMB A;  1UEV A;  5GAE U;  1AZS B;  3KWM A;  2OEK A;  4OHZ A;  2M70 A;  1QTM A;  4ID5 B;  3S16 C;  1R43 A;  1BGW A;  5L1J A;  3SQG B;  3AT1 B;  4OIR A;  5AJ3 J;  2IA0 A;  2D7S A;  5DG7 A;  1IKX B;  4ED5 A;  1FRX A;  2DH9 A;  3VVT A;  2BE2 A;  1PYS B;  2YKN B;  4IO1 A;  3Q8R B;  3UD4 P;  1TUV A;  2W25 A;  4TU7 A;  1U26 A;  2ATL A;  4PXB A;  1Q16 B;  4JI1 J;  3JSB A;  1B64 A;  3JTO A;  2QSF A;  2D9P A;  3Q89 A;  1CG2 A;  1UWB B;  1ELO A;  1VC6 A;  4A3K K;  2EC0 A;  3FEZ A;  1O27 A;  2W4P A;  2IVF B;  2KN4 A;  1S48 A;  3SCK E;  1M5V C;  1I1G A;  1HNI B;  1RAI B;  4WKR A;  4L3K A;  3MUV P;  5E33 A;  1WF2 A;  2E2I A;  4QIG A;  2ASY A;  4ALZ A;  3ENV A;  4OX7 A;  5AXK A;  1FKP B;  3R2D J;  3N6M A;  3IPJ A;  4TXS A;  3EQL A;  4DLG A;  3NS6 A;  1NJI T;  4DX7 A;  2GFF A;  3KJF B;  4YHH J;  2I5J A;  2J6T A;  5H9E J;  1KWM A;  3CIM A;  1GE9 A;  4BHQ A;  2XEX A;  2A1B A;  3MMC A;  1IM4 A;  1FHT A;  3T5J A;  4O4G B;  4ETZ A;  1GT8 A;  4GKK F;  2EFN A;  2N3O A;  2FZC B;  2Z58 B;  5EX0 A;  2QIF A;  5DLG A;  1EX8 A;  2E1M C;  3ZTR A;  2BBE A;  2KVI A;  4WFZ A;  2RHQ B;  3BGU A;  5B0F A;  1PJ5 A;  4NLQ A;  3NXZ A;  4YP3 A;  3TZZ A;  1ZZF A;  3DRS A;  1YJN S;  2JOQ A;  2ZZT A;  2AGP A;  2PPB A;  2HG4 A;  4B3M J;  3M8P A;  2HBR B;  3PJ9 A;  5F9L A;  4YR3 A;  3ETM A;  3AHP A;  3SZ2 A;  2XMV A;  3G71 S;  1WG5 A;  1WJ9 A;  2DIV A;  1NUE A;  3NOG A;  3PV8 A;  3SV4 A;  3KKF A;  3BB5 A;  2W2N P;  1VI7 A;  2MY8 A;  2ZD1 A;  5IQQ A;  1JQG A;  1RBL A;  1T9V A;  4F8R A;  3UR0 A;  2XS2 A;  2E9T A;  2GHP A;  5L9X A;  3DXB A;  1EQM A;  1BQM B;  4BXX K;  2HQG A;  1FDB A;  3UO0 A;  5AXN A;  3GTO C;  3L7U A;  4LRE A;  4DN0 A;  3M8R A;  4P2F A;  4QYR A;  4O3Q A;  4JI8 F;  1S1V B;  2V4Q A;  4K4W A;  4BBY A;  2KT5 A;  1S6U A;  4DV2 F;  2GQ2 A;  2M5Y A;  4L3N A;  3FFI B;  3J81 j;  2V50 A;  4JI7 F;  3HVW A;  2ILY A;  3L4J A;  4OYZ A;  3CXC R;  3B4D A;  1IJE B;  3LP0 B;  2FZK B;  2AJF E;  1S12 A;  2R8K A;  4AL7 A;  1YZ7 A;  2UV8 A;  3PAC A;  3D6F B;  4ES1 A;  3L3C A;  1PSD A;  4LF5 J;  3GJS B;  2GMH A;  2VDH A;  2GSN A;  2G0J A;  3HM9 A;  2PGC A;  2XY6 A;  4GRS A;  3FVY A;  3SYZ A;  4FYD A;  1JJC B;  4NCB A;  2AYB A;  1FI4 A;  1OQ6 A;  3PO3 K;  4UQT A;  3Q2T C;  1IN0 A;  2DGW A;  2HVE A;  2QSW A;  4LF1 A;  3PRV A;  2NYH A;  5C4X K;  3HOZ C;  3K8V A;  3QGH A;  4FVC A;  4Y00 A;  2XGP A;  1TAQ A;  4X4S A;  3PYG A;  5IXU A;  1QAY A;  2V8D A;  5JVG Q;  3C6T A;  4Y34 A;  2W2Q P;  3A8K A;  2FVQ A;  1CS4 B;  4CH1 A;  2B51 A;  3T19 A;  3I32 A;  2KFZ A;  3CCV S;  3ZZO A;  4NYP A;  5K14 A;  3FBF A;  2VJU A;  4NCG B;  3EVO A;  4I7F A;  4ZPB A;  2QA4 S;  5E3C A;  2WOM A;  1QLN A;  1X5S A;  3UN5 A;  2CJ9 A;  5TMC A;  3PVX A;  2RVJ A;  1NLK L;  2ROG A;  3Q2S C;  3CGI A;  2JC1 A;  2CUY A;  2C22 A;  4CH0 S;  1ZM9 A;  3UFC X;  2GO8 A;  2VG7 B;  3D6H B;  3MED B;  2E2I K;  3QJJ A;  4CO4 A;  4NX9 A;  1OMS A;  2NZ4 A;  3GTJ C;  1F5C A;  2MKS A;  1FJ7 A;  1I50 A;  3G96 A;  1XNQ J;  2VOO A;  3EPG A;  3HHL B;  3I4N K;  2LYV A;  2JHE A;  4IFY B;  1TWA C;  5D3G B;  3HOY C;  4ZVT B;  4KAS A;  2BM1 A;  3W1Y C;  3HFK A;  3K89 A;  4EBE A;  1WSR A;  1X4A A;  2PFF B;  3ZNU A;  3UVJ B;  1FF2 A;  1T9X A;  2H4W B;  1S1W B;  2FVR A;  5FDL B;  3VZI A;  1GNK A;  4DDQ A;  3K5M A;  4YN3 B;  4JI4 F;  1SV5 B;  2DNZ A;  3QT5 A;  3HOX C;  1UJ4 A;  3UDV A;  3GQC A;  4YB5 A;  2I2Y A;  2DIS A;  4HT5 A;  1NRK A;  4EBC A;  1VIX A;  2MKC A;  2MQO A;  2FZG B;  2J9C A;  4OLP A;  5HRO A;  4KHP F;  2W2M P;  5HRO B;  4HTJ A;  2YWF A;  2IVY A;  3PTW A;  3VGU A;  4G0V A;  1I50 K;  2RRN A;  3H2L A;  2KRR A;  3TAR A;  3UDE A;  1N36 F;  3OTO J;  4DSI A;  5HP1 A;  1X5P A;  2ZH9 A;  1FFS B;  4B9N A;  2FC8 A;  4F4Y A;  4K4Y A;  4OJ3 A;  2FJA B;  3VHQ A;  3HOX K;  5K5M A;  1SC6 A;  4OZL A;  1I94 F;  3LA0 A;  4C48 A;  1CC7 A;  1NPP A;  2RS2 A;  1X0F A;  3QIP B;  4IFY A;  1ULR A;  5ETV A;  2KXF A;  4ZVO B;  4HI2 A;  2Q1L A;  1NHK L;  2RU3 A;  1SJ4 P;  2BVZ A;  1M5O C;  4OYB A;  2KM8 B;  3PG9 A;  3FKB A;  1HWL A;  4LRA A;  2PEB A;  4NRT A;  1NK7 A;  1U49 A;  1RBO B;  3TZW A;  3KTQ A;  2E44 A;  1S6P B;  3TAQ A;  2XZT B;  3PYF A;  2JEF A;  1RBA A;  2WB1 L;  3GON A;  2ASD A;  3HOU C;  2JA7 A;  3J7Y U;  1W2I A;  3CCS S;  4ECQ A;  2MDA A;  4LRB A;  5THW A;  5A8R A;  1I3Q K;  1D09 B;  1KTQ A;  2R4F A;  1S9G A;  3CUN A;  2HHQ A;  1U1K A;  5CHP A;  3D2W A;  2AMC B;  1NDK A;  1LXJ A;  1FER A;  1UV7 A;  4KB7 A;  4KE5 A;  1U8W A;  5C4X C;  1UCN A;  1RP5 A;  4WPA A;  3LP1 B;  3Q8U A;  3MEC B;  4I2Q B;  3TX8 A;  1XR6 A;  4BS2 A;  4ZHR A;  2HLT A;  2IAJ B;  3L7P A;  1U7L A;  4MKB A;  3H4D A;  4NYZ A;  2J0W A;  2QMX A;  5F8N A;  2JEG A;  2JEI A;  3LPX A;  2UXC F;  1WC4 A;  4XDC A;  3TP2 A;  2Z56 B;  5M3F K;  4A47 A;  4LIW A;  3M2U A;  4AXJ A;  1G7C B;  5KOX A;  1FO1 A;  3C46 A;  2XSJ A;  3DGP A;  2DGU A;  1N34 F;  3GIL A;  1O28 A;  2MJN A;  1U2R A;  1B4A A;  2K7J A;  4MJK A;  2CQ4 A;  1RYR A;  3OFE A;  1FDN A;  1VGX A;  4MTP A;  3QLH A;  1L3K A;  3M30 A;  4DR6 J;  4PQA A;  5A8W B;  1OIA A;  3GSI A;  3B8H A;  2BZ2 A;  4ZPT R;  2FDN A;  1OY9 A;  1K83 K;  1TWF C;  4GZY A;  1NM2 A;  3VAK A;  2W01 A;  1TKZ A;  5DGB A;  4YFN A;  4AL5 A;  3GV5 B;  3DYA A;  5L9N A;  4YHH F;  1IQ0 A;  2QE5 A;  1UAW A;  1RWK B;  3BKT A;  4K59 A;  3KOA A;  1B0V A;  3GFH A;  4PRF A;  2AJ0 A;  4IH6 A;  2XI3 A;  1ZBT A;  5F8M A;  1GK8 A;  3OTO F;  3K5L A;  3EPI A;  1B0P A;  3CDU A;  1RT5 A;  1SH2 A;  2ZH5 A;  2UUW A;  2GJ2 A;  4KM9 A;  3TVY A;  3MMC B;  2E1P A;  2K1R A;  3CJQ A;  2MLX A;  2K1R B;  2F4V F;  1O29 A;  3G9C A;  1C2P A;  3TTG A;  1JXV A;  5B0E A;  1T8E A;  1S59 A;  5DLF A;  1OSC A;  4HVZ A;  3S1Q K;  1U1P A;  2CVI A;  2P5V A;  3JQK A;  5DJB A;  2W24 A;  4TVA B;  1TWC C;  2OML A;  4F4Z A;  2G2Y A;  4J9V A;  4OX8 A;  1N5Q A;  5IOQ A;  5IM0 A;  1V3Z A;  4YFU A;  2K3I A;  1H74 A;  3W9I A;  1HA1 A;  1NZA A;  4Z2X A;  4DG1 B;  3V6J A;  1FRI A;  1EET B;  4J5O A;  4XCH A;  4IG0 A;  2AZ1 A;  3MPD A;  1S99 A;  4JI6 F;  1JXE A;  1LW0 A;  1LW0 B;  2H9Z A;  4DUZ F;  5HAT A;  4OYA A;  1S79 A;  2C2M B;  3Q8Q B;  4GTE A;  3K17 A;  4A3J K;  4ED7 A;  4QWB A;  2CJK A;  5KOW A;  2A10 A;  1XIQ A;  2R7Z K;  2DNR A;  4M5K A;  5K14 B;  4PPD A;  5CZX A;  2W7P A;  2BXJ A;  2DY9 A;  1MU2 B;  4JI8 J;  4IH7 A;  3I0R A;  2ALZ A;  4DR4 J;  4QIW D;  2KRB A;  2QA4 G;  3HK2 A;  4QW8 A;  1HD1 A;  3PO3 C;  4OIP A;  1SQG A;  2L48 A;  2CNN B;  2GNK A;  4DSE A;  5IT9 Y;  4C2M C;  1O26 A;  5BJR A;  2FJE B;  5IP7 K;  4P5B A;  2AYG A;  5LMU F;  1ZYR A;  4RBU A;  3F44 A;  4IRK A;  1O8B A;  8RUC A;  4DEZ A;  3LGM A;  4PG6 A;  1XXA A;  1SJ3 P;  3OHA A;  1I3Q A;  2PMZ L;  4LSL A;  4P2M A;  2B9W A;  2F8H A;  1K1S A;  4GKJ J;  1Q82 T;  5F0U A;  4FBT A;  3D0H E;  4NLX A;  1K0T A;  4ATN A;  4TU8 A;  1WQH A;  3H5S A;  3NNC A;  2E9Z A;  4E2F B;  2K7K A;  1IBC B;  3GTO A;  3K5O A;  2VAS A;  4P74 A;  4USU A;  5F8L A;  5F8J A;  3DOK B;  4C8N A;  3MAQ A;  4DJB A;  4ZHR B;  4QPX A;  5EDW A;  4DV6 F;  5C3E C;  5KT2 A;  1VRU A;  2CFX A;  2AP6 A;  2FHO B;  4N8N A;  5IT0 A;  4A8Q A;  5J1E B;  3GB0 A;  3RZD C;  2DHG A;  4MKA A;  1DQ8 A;  4KH0 B;  3MOZ A;  2W7O A;  4TLQ A;  4ILR A;  3M2U B;  2ZH7 A;  1O6X A;  2A6O A;  2JC0 A;  3ETO A;  3VGS A;  1U4B A;  4A3L K;  3N4W A;  1KQG B;  3FEY B;  5LXR A;  4CNY A;  1TL3 A;  3DDI A;  2NPI A;  3DFE A;  3GR1 A;  2BRK A;  3SMZ A;  3J7Y I;  1D8Z A;  2JA6 A;  2BR0 A;  1A9N B;  3DLG B;  1Y1W A;  1U47 A;  4C45 A;  1OYE A;  1YJ7 A;  4DR5 F;  4P72 A;  2HFU A;  3TW0 A;  1DBD A;  1U2C A;  3ZC4 A;  2FLP A;  2EPI A;  5HO4 A;  3TA2 A;  2OIH A;  2MZ1 A;  5KFH A;  3TNV A;  3GIM A;  3U02 A;  5D0R A;  2ZDO A;  1H98 A;  4HL9 A;  1QUV A;  3RRH A;  4XTT A;  3LAM A;  5E7O B;  1IWG A;  2UXB F;  4V19 X;  2Z0G A;  4AND A;  1W2B R;  3T1H J;  4Y52 C;  1VIO A;  2YPZ A;  1NJX A;  3GP9 A;  3F56 A;  5LSR A;  4RNM A;  2IMO A;  1AFJ A;  4X2B A;  4ZLJ A;  2YU9 K;  1TZ0 A;  3PEJ A;  3S0X A;  3MM5 B;  3I96 A;  4DV1 F;  5L1I A;  2KYZ A;  1VH2 A;  4CO0 A;  4GVL A;  2QLJ B;  5KG1 A;  3NMR A;  2AW0 A;  4USJ C;  1GEH A;  1BC6 A;  2DD8 S;  5IOL A;  4NMX A;  1OPZ A;  2O01 C;  3GYG A;  1FX4 A;  1PAU B;  2VPW B;  2XMM A;  4KMH A;  4J9U E;  2DGV A;  1R8B A;  2VIH A;  1FT8 A;  3H20 A;  4ZLP A;  2VFT A;  4JI4 J;  1U24 A;  1F9H A;  1HL6 A;  1DCO A;  3DLG A;  3BSA A;  1K44 A;  1NK9 A;  5IC6 B;  2QL9 B;  4K0K F;  2KT3 A;  2PA3 A;  1E6Y B;  2OEL A;  2Y1J A;  3OTB A;  1S1T A;  2JZ5 A;  2I9S A;  2E5I A;  3PFE A;  1I94 J;  2FHJ A;  2AJ2 A;  3T6B A;  2HZC A;  3FOF A;  5DDQ C;  3QRP A;  1Y00 A;  3BYR A;  3TAM A;  2JLE A;  1EB0 A;  4I7F B;  1HR0 J;  1C4C A;  3VA7 A;  3H0P A;  3V4M A;  4BWM A;  3A8J A;  4Y65 A;  2VFS A;  4I1T A;  4AYB D;  1HWI A;  3DRX A;  1S0N A;  3JST A;  3MEK A;  1WKL A;  4MT1 A;  4RUH A;  1SUQ A;  2XSF A;  3LAJ A;  1MW7 A;  3FNN A;  1EP4 B;  4F3O A;  2MLY A;  5GAG I;  3JTN A;  3BH6 B;  1IKY A;  3IBW A;  2B3T B;  1H72 C;  3O44 A;  3AJ2 A;  2Q6B A;  4C8K A;  3BQ2 A;  2CXE A;  3AB2 B;  4FPI A;  2HHH F;  1RKI A;  3OFF A;  3DCA A;  2PD1 A;  2LXI A;  4A8K A;  1KDN A;  2WVC A;  4NLV A;  4Y7N C;  3IR5 B;  2AGQ A;  3NL0 A;  3S14 C;  4DBQ A;  1KS2 A;  3QJP A;  5EWE A;  3R6L B;  3DKD A;  3OR2 B;  5T7L B;  4DV1 J;  3A4T A;  1X4F A;  4BXX C;  1GXL A;  3K0J A;  1SIZ A;  3M32 B;  5GVQ A;  3I4H X;  2VG5 B;  1NJZ A;  2IM2 A;  3OTC A;  1N4L A;  3OLA A;  2V8V A;  3B82 A;  3DC2 A;  1UVI A;  2Q43 A;  4NZ7 A;  1VQK S;  4OMF G;  4WTO B;  3BSC A;  3QPI A;  2VQE J;  3KG4 A;  1YVF A;  4ZLN A;  3BBC A;  4HTI A;  1QAI A;  4GO7 X;  3GU0 A;  1RTH A;  3ERE D;  5CAA A;  2RUG A;  4U8Y A;  2MMY A;  2NZC A;  1UL3 A;  4DQI A;  3FMB A;  2G2Z A;  2YNF A;  3TUJ C;  2E1A A;  1RT7 A;  4B08 A;  2HNZ B;  3WC2 A;  1EQR A;  3K8W A;  2R2R A;  1T03 B;  1IQZ A;  3DGP B;  3ILJ A;  1U02 A;  2J7U A;  1SQF A;  3FDS A;  4AD6 A;  3O8W A;  3MFH A;  1H2U X;  3CUL A;  3PFO A;  4BY7 K;  5K8M A;  4Q0B A;  4DV0 F;  2BE9 B;  1YNN A;  4JI2 J;  2DRB A;  2MPU A;  1UEK A;  1NSA A;  2BW7 A;  4Z37 A;  3MR6 A;  2BJ1 A;  3HZG A;  4DUT A;  1NK4 A;  3CC4 S;  1O2B A;  3FZ2 A;  3W5Y A;  4LR7 A;  1XNR J;  3KLE A;  3EE3 A;  4QIF A;  3SFU A;  4UF4 A;  3CB4 A;  1TVR A;  5KFP A;  5IYD K;  2VPX B;  1KP6 A;  5C24 A;  3O1L A;  2A68 A;  4LSL B;  1UVN A;  2R42 A;  3RW7 A;  1P27 B;  3NG8 A;  2JX2 A;  2BKP A;  1CPZ A;  3GWC A;  3PYD A;  4LF4 J;  2NS1 B;  4LR2 A;  2LQ8 A;  1YSJ A;  2HHH J;  1XMQ J;  2A0F B;  2G4B A;  3R7B B;  1FVS A;  3VZH A;  3WOD A;  1RWW B;  2C28 A;  2NSB A;  2G13 A;  1LKZ A;  1HNX J;  3IG1 B;  1TL5 A;  3I87 A;  5E2Q A;  1GMU A;  2WON A;  5JJB A;  1JLF B;  5KFF A;  4EZ6 A;  4DR3 J;  1ZAV A;  4FKX A;  5EGE A;  2XC9 A;  4QU6 A;  2IMW P;  2VHG A;  4DR4 F;  4YDD B;  4Q4Z A;  3PY8 A;  3DI6 B;  4MK8 A;  4M5J A;  2DJW A;  2B6A B;  2KHD A;  4OYO A;  4IG3 A;  2CG8 A;  3C3L A;  2HHW A;  2XO6 A;  3PEH A;  4QWA A;  5JVH Q;  2P8I A;  4YFX A;  3I4M K;  4G7Z A;  2F5G A;  3MML B;  1RT2 A;  1REV A;  3CD5 A;  1U1L A;  4C11 B;  3R1L A;  2DO4 A;  3NCR A;  2UUT A;  2OD4 A;  3KLF A;  3WZ0 A;  2IJN A;  3BDP A;  3C15 A;  1VDH A;  1MML A;  4DPO A;  1JLE B;  3R5D A;  5ETP A;  1HD0 A;  4S0M A;  1A7G E;  4KGK A;  3NCP A;  5LT5 A;  3POT A;  3IXQ A;  2ZJR Q;  4BBS K;  4CDI A;  3PYE A;  1JJ2 R;  1UJ5 A;  4NLO A;  5D0G A;  1KNZ A;  2QA1 A;  1JMT A;  4LF9 F;  2O5J A;  1SCJ B;  1CJK B;  5J2Q B;  1UVL A;  3DMJ B;  4HH0 A;  3I56 S;  3VF0 B;  4DV0 J;  5F9N A;  4ZPD A;  4QOT A;  1WI8 A;  3ZTP A;  2KFN A;  4WYW A;  4DSJ A;  4A3D K;  5ADZ A;  4H4O A;  2OAU A;  3TI0 A;  2DBB A;  3NP5 A;  2O67 A;  1U09 A;  2OPQ A;  4MEY A;  2P6S A;  4CWB A;  2QFJ A;  4Y2M A;  3A1Y G;  4RBT A;  4PWD B;  2H5E A;  3S1Q C;  3OR1 A;  2DEI A;  4A3M K;  3JYT B;  4G6V B;  2RNE A;  5HVH A;  5GAD I;  3MM9 A;  1WC5 A;  4DFM A;  1FNO A;  1ZM3 A;  1EKR A;  2OPP A;  2OPP B;  2F3J A;  3H0G C;  2IY5 B;  1Q81 T;  3UCU P;  4RW4 A;  1KON A;  4AE5 A;  4M5N A;  3GG0 A;  3PKM A;  3KLI A;  5JXS A;  3VGV A;  1RU1 A;  2MHN A;  3J7A N;  1N6Q B;  3EGZ A;  4KKO B;  4B3T J;  8AT1 B;  2VH7 A;  4LSN B;  2C1E B;  2V4R A;  4ED0 A;  2B8P A;  5ETQ A;  1U1N A;  1IL2 A;  1OY8 A;  2R2S A;  3C14 B;  4OYP A;  4FKY A;  4XDD A;  3CJ2 A;  3CD6 S;  3LO3 A;  4A3L C;  1KOO A;  3Q8V A;  1KQF B;  4RWW A;  1RT2 B;  1G1X A;  3T6J A;  1ZQ1 C;  3HVR A;  4EZ9 A;  2D3U A;  1M5S A;  2QG9 B;  5IC4 B;  3Q0A A;  1KQK A;  1RCO B;  4EMD A;  3EGV A;  1QDU B;  2AV5 A;  2XI2 A;  1RAB B;  3G8S A;  3CW2 C;  5F8H A;  1RQ0 A;  1USO A;  4DL4 A;  1ZVU A;  5FJ8 K;  1WKJ A;  2VQF J;  1G2E A;  3GLJ A;  4DFK A;  1CJV A;  3G6E S;  2HKE A;  3KLG B;  1RT1 B;  3CCW A;  1O0P A;  2RQ4 A;  2UUB F;  3W65 A;  4USW A;  3OXL A;  1A6L A;  2CQD A;  4HT7 A;  4R8U B;  3WIV A;  3ITH B;  1S6P A;  1ACM B;  3PO2 K;  3H5U A;  3LP0 A;  1TL7 A;  4MKY A;  3DLL Q;  2CQH A;  1B3T A;  3BP8 C;  2CG4 A;  1RT4 A;  4DCP B;  3BSO A;  2QGF B;  2C3P A;  3H3V L;  4DG1 A;  4ES2 A;  1Y4Z B;  2E2J C;  4U7U K;  2DNY A;  1HNZ J;  2HVH A;  1KD1 T;  3CWJ A;  2LFV A;  1UA0 A;  1N48 A;  5KFW A;  4AH6 A;  2CZ9 A;  4C3H K;  1R89 A;  3NGK A;  3DU5 A;  3QX3 A;  3EVM A;  4G3I A;  1SKR A;  4JI5 J;  2UV8 G;  4U67 Q;  3QGI A;  4Y28 C;  1VRU B;  2C3M A;  5CQG A;  2B4O A;  3A3O B;  1TV6 B;  1F0X A;  5IWA J;  1SL1 A;  2VPY B;  3GEE A;  4ZKA A;  2JA5 K;  1F3F A;  3NAH A;  1VQS A;  2UP1 A;  2D3O 1;  3A8E A;  4ELU A;  2AWZ A;  1GTE A;  2VC0 A;  1ZM2 A;  3HP6 A;  3CJK A;  1MMD A;  4USH A;  3C6U B;  4G1Q A;  4C3H C;  1TKZ B;  1D9A A;  5I3U A;  5KG4 A;  3MAH A;  4TYB A;  4IQM A;  3NCQ A;  3JSR A;  3GV8 B;  3OBI A;  4ZVG A;  2V5H G;  2HIQ A;  3UW1 A;  2B4V A;  5LJ5 Y;  2HBY B;  3ICL A;  5C42 B;  2C2E A;  3RJM B;  4ED4 A;  4N5S A;  1YJW S;  1SC1 B;  3MMA B;  3IP0 A;  4X4Q A;  5K20 B;  2YNG B;  2WSC C;  5E3A A;  4F4X A;  1HMV B;  2Q66 A;  3BR9 A;  2AKW B;  2E9R X;  4X6A C;  1PGZ A;  3C16 A;  2HAF A;  4KFB B;  2F65 A;  3VAL A;  5EHH A;  2CRL A;  3CCM S;  1IW7 A;  3HOZ K;  4U8V A;  3OPF A;  4O3R A;  2NVX K;  1YIT S;  4DZ6 A;  2V6A A;  2AX1 A;  2XCA A;  4UT4 A;  2R8I A;  3MEE A;  5A2Q Y;  3GIK A;  3PO5 A;  5T7L A;  3JAM Y;  5CYJ A;  1O51 A;  3OD2 A;  3BKU A;  1Z2L A;  3OR2 A;  4UTG A;  1FTR A;  2N3L A;  4YB1 P;  1S9E B;  2XUL A;  3S14 K;  1GH8 A;  2ROE A;  3SSS A;  1N6Q A;  2YQ1 A;  3ILL A;  3RAM A;  1RYS A;  2HNY B;  3BR8 A;  3T1H F;  4DUY F;  3AXK A;  5C2G A;  2LCW A;  3JB9 k;  2IRU A;  4PQU A;  1TR0 A;  3RB6 A;  3FQL A;  3SFG A;  4DZD A;  1HR0 F;  4KB4 A;  1S0M A;  1EFW A;  1SFO A;  2H65 B;  3QBC A;  3CIZ A;  3NGU A;  1FNX H;  4NXN F;  2PI4 A;  3TFH A;  4C11 A;  5GAH U;  3H90 A;  2CPZ A;  2NXC A;  5KFZ A;  1HNV A;  3DMJ A;  2WAQ L;  5M5W K;  2KB2 A;  3CAG A;  1TKT B;  2EFG A;  3JTP A;  1TK8 A;  2GIQ A;  4UQG A;  2JWN A;  4KPY A;  3LGH A;  1AFI A;  3EZU A;  1SMY A;  5C24 B;  4CRJ A;  2K3K A;  4N76 A;  3BZQ A;  5KTQ A;  1UKU A;  4F04 B;  4OJ1 A;  4B9T A;  4WE1 A;  4DR6 F;  1I6H C;  4BY1 C;  2I5J B;  4OZ0 A;  4B3T F;  4KN4 A;  4H4O B;  3LP2 A;  2HQD A;  2WVF A;  3V6H A;  1SJR A;  2IJR A;  2AEJ A;  4X4P A;  3GTQ K;  3SDE B;  4LFB J;  2W9A A;  2DXF A;  4KQZ A;  4TLR A;  2HVZ A;  4YFK A;  4J9N A;  2CQB A;  3TVZ A;  4XIU A;  4I56 A;  2FC9 A;  1XBW A;  3I82 A;  4URG A;  5G0R A;  4MEX A;  4DR3 F;  4JUZ A;  2RF2 B;  1VQ5 S;  3S7R A;  2WVD A;  1TK5 A;  4R8U A;  1J98 A;  4Y7N K;  3MAA A;  1TL7 B;  3KUE A;  3OSN A;  1BD6 A;  1PBA A;  3DRS B;  3PRD A;  3RBZ A;  1TKX A;  1L0W A;  2OTJ S;  1RTJ B;  3RG6 A;  3M05 A;  3DGV A;  5IV4 A;  3J7A 1;  1YLX A;  3V6D A;  1RWM B;  3CVK A;  3M2R B;  4WJB A;  4RUC A;  3T1Y J;  1LWC B;  2NVY K;  2BOA A;  2QZ8 A;  1OS5 A;  2QV6 A;  3W60 A;  4Y2C A;  4LQ3 A;  4QR2 A;  3M6U A;  5KFX A;  4KAW X;  2N7C A;  1V5V A;  1RSC A;  4NOI A;  4PXD A;  1QM9 A;  2HQ3 A;  4YQW A;  4TU9 A;  5KFQ A;  2WW4 A;  1U45 A;  2CJQ A;  5KFB A;  4L73 A;  5D0H A;  1T7P A;  4LF2 A;  1PO6 A;  4LVN P;  2B8Q A;  1WHW A;  4RW6 A;  3TRG A;  2Z2L A;  3MM7 B;  1UEU A;  4WII A;  2VJV A;  3H4B A;  3C19 A;  1SH0 A;  4ZJO A;  1FFW B;  3DLH A;  4P73 A;  4JOU A;  1S57 A;  1NSQ A;  1U25 A;  1Z4U A;  3QAU A;  1IKY B;  1FX2 A;  3OTE A;  4KGX B;  4QBU A;  3OVB A;  5K8P A;  2VB6 A;  3W7B A;  2MKI A;  2VUM C;  2F63 A;  1X31 C;  3MCN A;  4F3M A;  2J7K A;  3MR2 A;  3CO9 A;  3GIR A;  4CP5 A;  3H2V E;  3GTM K;  4X4R A;  2G0I A;  1HMV A;  4Q7A A;  1PIE A;  2W1B A;  3AOA A;  4WCE Q;  3FBE A;  1PCA A;  4ED6 A;  2CQ3 A;  3W8P A;  1PJ6 A;  2LP4 A;  3V2U C;  1S4E A;  2DGO A;  4RW4 B;  4CYU A;  2ILZ A;  1T3N A;  1NPK A;  1TKX B;  2ZM6 J;  3RBX A;  5KAK A;  4C3L A;  1IBL F;  3MWB A;  1T05 B;  2E2I C;  4IR1 A;  1R0B G;  2D74 B;  4RPF A;  4DMZ A;  5ITH A;  2EFP A;  3CCL S;  4EU0 A;  4C0O C;  4LBI A;  2XTJ P;  5D0E A;  1TTH B;  2PN6 A;  1SJF A;  2ZUE A;  2HZV A;  4KO0 A;  4I69 A;  4V19 J;  1IKV A;  4C2M K;  1BQX A;  1TWF A;  4FNI A;  3VQT A;  3FZB A;  1HHT P;  2DIT A;  3OUY A;  1LW2 B;  4WFX A;  3DLE B;  2C2K B;  3CME S;  1K1Q A;  4TNO A;  3CMA S;  2W9C A;  1DY3 A;  1S0O A;  4DPU A;  4ELV A;  3U1L A;  4FPR A;  2HWH A;  1ISE A;  1Y1V A;  4NXN J;  2GSO A;  3K57 A;  1WTB A;  5E68 A;  3HHN B;  1HPZ B;  1WC6 A;  4KYZ A;  2XCO A;  4J9R A;  1JLB B;  3HHL D;  4QYZ K;  5HJY A;  1HIY A;  1LWC A;  4AYB L;  3POT B;  1S1T B;  1U6B A;  3KLF B;  4O3N A;  1RT3 A;  1EP4 A;  3M6V A;  3ENQ A;  4MIA A;  3EJM A;  4A93 C;  4C98 A;  3UDL A;  2CYY A;  5H1S V;  2HFN A;  2RJZ A;  1FXD A;  3MEG A;  2IJF A;  2YWW A;  4YY3 J;  2BQR A;  1Y3K A;  5IOT A;  2RSQ A;  3QMQ A;  3S1N C;  4YR0 A;  4GTD A;  1HHQ A;  1LFP A;  2R7T A;  1F7V A;  2DY1 A;  4B17 A;  2J9E A;  5H9F J;  4A3C C;  3VWS A;  3QGG A;  4DV4 F;  3AOB A;  3CQZ A;  3GTM C;  1KKH A;  2PEH A;  4BLB A;  4DPW A;  2VG6 B;  3T3F A;  3TUZ C;  3B6B A;  3QWU A;  2HND B;  2ZUA A;  1GMW D;  2DHH A;  4OIQ A;  1HBU B;  1UTA A;  3RAX A;  2QLW A;  4MK7 A;  3G8T A;  5BXI A;  4KHP J;  5D77 A;  3Q8S B;  2BRL A;  1YBA A;  2GML A;  2H1Y A;  3TOQ A;  4Y6I A;  1F6T A;  2U2F A;  2IHR 1;  3ORE A;  4M63 A;  2OLW A;  3EIC A;  2Y0S L;  4OV6 A;  1QSL A;  4QIV A;  4QW9 A;  1SKS A;  1AB4 A;  4C8M A;  5F8I A;  4J9L A;  3GTK C;  2U1A A;  3C2P A;  3P5T L;  4USK A;  5KFS A;  2NQP A;  3P8B B;  2XCQ A;  1BLU A;  2AU0 A;  3TQ1 A;  4ZCM A;  5B0B A;  3PW0 A;  4IKA A;  4ETX A;  5HBM B;  4X65 J;  4WIQ A;  3D66 A;  4JV1 A;  2B9Y A;  1ITP A;  2W9C B;  2DNH A;  1C1B B;  3BQ1 A;  2RGR A;  5B08 A;  2I38 A;  1VQ4 S;  1XMB A;  3AB4 B;  3HT0 A;  5A8W A;  2XO7 A;  4BBR C;  3N28 A;  3D3B J;  4LQ9 A;  3N79 A;  3R5B A;  5KFY A;  1KOH A;  4ECZ A;  2B4U A;  3S8S A;  2VU5 A;  1E6V B;  1DCP A;  1O25 A;  2A18 A;  4NI2 A;  4G1Q B;  3S2H K;  2ASJ A;  2NXU A;  4A46 A;  4A3B C;  4P9S A;  4UZC A;  4GTA A;  4NRU A;  2CPY A;  4JI3 J;  4ZVH A;  4OI1 A;  1P8G A;  2ASL A;  2X3G A;  1LFW A;  5DET A;  4JYA F;  3WX8 A;  1VQ8 S;  5JUM A;  1M0S A;  3I31 A;  1Y1W C;  4Q2M A;  2BQ3 A;  4I2Q A;  2ZH8 A;  1Q5V A;  4QPT A;  3Q23 A;  2OPQ B;  2BAB A;  2R7V A;  3MOJ B;  3U1N A;  4FXD A;  2DPI A;  4GMK A;  2HBQ B;  2BJD A;  4UZB A;  4Y0F A;  4OL8 A;  4EYI B;  2M2B A;  5DZ6 A;  1N56 A;  4BLG A;  2NRE A;  1FRK A;  4MIW A;  1N5T A;  3CSK A;  4PYD A;  3AXM A;  4CO2 A;  3TO8 A;  2CPH A;  1XZQ A;  1C4A A;  1F9E B;  4Q8F A;  1H0H B;  2ERR A;  4WU3 A;  1D9F A;  2O3D A;  1JVI A;  3GJR B;  1XZP A;  1TUW A;  1X5O A;  2RT3 A;  2FHM A;  4TY8 A;  4TY8 B;  2A6H A;  2WB4 A;  1Q8L A;  1BJT A;  1TWG A;  2XMU A;  4RUB A;  4CLY A;  4C4W A;  3C6T B;  4RU9 A;  1WTF A;  2JJ4 D;  4CLU A;  4LMZ A;  4QIE A;  4BKW A;  5DS7 A;  5AE3 A;  1NXI A;  3CT9 A;  1WHY A;  1DTQ A;  4FF4 A;  2FYX A;  3EXC X;  4KN7 A;  3MF5 A;  5A2Q U;  3EYZ A;  2IVM A;  3OFG A;  4LT6 A;  5DQG A;  2AYE A;  1BWV A;  1D8Y A;  4C3J K;  3V6D B;  4F26 A;  3NY0 A;  2V34 A;  1EH1 A;  4CTA A;  1KBR A;  4O3P A;  2RQK A;  1PBU A;  4X65 F;  4NOH A;  3E2E A;  3QFH A;  2XCP A;  1FTC A;  3LOU A;  2LQ5 A;  3IR6 B;  3C6U A;  3GDZ A;  2DK2 A;  4NA2 A;  2V69 A;  1BGX T;  4CT9 A;  3O2I A;  1Q8K A;  2YNH B;  4X64 F;  1J5O B;  3CJT A;  3EZO A;  2GVD A;  4X6A K;  1SH3 A;  3BPS P;  3FSX A;  4YB7 A;  3N0C A;  2MY7 A;  2GHV C;  3T5H A;  2R8G A;  2KG1 A;  2YX7 A;  1XK8 A;  4WXW A;  2DNN A;  2YU9 A;  3G82 B;  3NGS A;  4DX5 A;  3OJS A;  3UR3 C;  2XS7 A;  2MYF A;  2LA4 A;  1SVD A;  1RT4 B;  3KJQ B;  4ZIT A;  3KLE B;  3US5 A;  3ITH A;  1LXN A;  1VQM S;  4ZJQ A;  3B54 A;  2PA8 L;  4C7Q A;  4NXM J;  3S6E A;  3TYT A;  3BS9 A;  3V4I A;  2IBO A;  2Y1L B;  2WCX A;  5D4N A;  3QGP A;  5AT1 B;  4ECR A;  3GTL C;  1IQT A;  1SL0 A;  3R5A A;  2MZT A;  1Q0N A;  2XGQ A;  3FCH A;  2M4M A;  4DV7 J;  3MM9 B;  1RTJ A;  2G9O A;  4DSF A;  3T5K A;  3NLC A;  4PEO A;  2YU9 C;  4CLK A;  4CLL A;  3J7Z T;  5ETO A;  4H4M A;  1SJ1 A;  2VUM A;  5C7P A;  2PI5 A;  1TEL A;  4ZP9 A;  4GFQ A;  4J9K A;  2FPH X;  4IO9 Q;  2P9G A;  2SXL A;  2XLJ A;  3CCE S;  4AXI A;  3TJ8 A;  3MUM P;  1WOO A;  1KSP A;  4NLD A;  1HBM A;  5ETL A;  5K8O A;  3CJK B;  3DNC A;  3ET6 A;  3BV8 A;  4K2X A;  2EK1 A;  1QAX A;  2RQM A;  3GEI A;  1UPP A;  2GCF A;  3FC9 A;  2O5I A;  2KJW A;  1F2H A;  3FRY A;  2F9J A;  2M88 A;  3M7V A;  3R7N B;  2MKH A;  2WOM B;  1N34 J;  3MED A;  4KJI A;  4A3G K;  3HOY K;  4I6Y A;  3W8G A;  3GEH A;  4LR8 A;  2AX0 A;  2Z8Q A;  2E7W A;  1M1K T;  1Y10 A;  1TUG B;  3NGT A;  3FGV A;  2Q79 A;  1RXO B;  2MQN A;  2EKN A;  4LQY A;  2F8E X;  4A3E C;  3PW5 A;  5BYQ A;  2C2R A;  4KB2 A;  3D0I E;  3QSI A;  1V9O A;  4PR6 A;  3MM7 A;  5DM7 Q;  4HLB A;  1XPP A;  3Q24 A;  3IR7 B;  4JV5 J;  4B3S J;  2EW9 A;  3HKZ L;  1UVK A;  2QFI A;  1ICE B;  1BMQ B;  4JI0 F;  1RUS A;  2BX6 A;  1YJ9 S;  3S16 K;  1WEY A;  2LVW A;  1JK9 B;  2FQO A;  2GVD B;  3F41 A;  5KG5 A;  2VUG A;  1NB7 A;  1D1U A;  2Z4P A;  4IUF A;  1YRX A;  1RAJ A;  3OSP A;  2MZS A;  3WX4 A;  2FVP A;  2CQ0 A;  3IO1 A;  3MM8 B;  4Q5V A;  4I6A A;  2PMW A;  3ZZ0 A;  3OTD A;  2ZNZ A;  3HVT B;  1T9Y A;  4WP9 A;  1FXR A;  2YWE A;  2BAN A;  1CVJ A;  3QLH B;  5H9F K;  4OIO A;  3ENA A;  4B9S A;  3ZFV A;  4DFP A;  5EGH A;  2DH8 A;  1ZPV A;  2ZZM A;  2G0C A;  3JYT A;  3IM9 A;  1TWC K;  1XEZ A;  3HO1 A;  1N5Y A;  3EUN A;  2RIL A;  3MCM A;  2JA7 C;  1HYS A;  1IS1 A;  2WB1 D;  4A3F K;  2JFK A;  4RU2 A;  3IGV A;  4CNZ A;  2DRA A;  1KR4 A;  5EX3 A;  1KVK A;  3MI7 X;  1S1V A;  3KLH A;  1F2G A;  1JLE A;  3DLK B;  1NK0 A;  1U1O A;  5J2P B;  1RLC L;  1C1B A;  3TAN A;  3HJF A;  4DR1 F;  4K5S A;  2YWH A;  1TVR B;  4C3I C;  2LXU A;  2J9D E;  5A8K B;  3EVW A;  2ADC A;  3R27 A;  3NRB A;  4KGV B;  3DM2 B;  4RX6 A;  2IIH A;  4EUV A;  1ZM4 A;  2K8G A;  5AE1 A;  2XYG B;  2XLI A;  5M2U A;  4JK1 A;  3E3X A;  3LWL A;  1S0V A;  4A8X A;  4J9O A;  1Y0H A;  2NXN A;  2J5A A;  1WOS A;  3GTG A;  1C1C B;  5T41 A;  1UET A;  4OYM A;  3PW4 A;  1H2T Z;  3S2D C;  1Y1W K;  4D3G A;  3NGD A;  5IV3 A;  4C0H A;  2G1D A;  2HK2 A;  1JNR B;  1URN A;  3NKY A;  3T1Y F;  2X7I A;  4KH1 B;  1NCL A;  2HQI A;  2RH3 A;  4PG8 A;  2H51 B;  1NSK L;  1R0A B;  4A3K C;  1SPB P;  1Y5I B;  2HS4 A;  2IM0 A;  3KMS A;  3JXO A;  2APO A;  1R9T C;  4YG2 A;  1CS4 A;  4RJV A;  3FSI A;  3KLV A;  2JL9 A;  5GMD A;  3BF4 A;  2RUS A;  4ECY A;  2XMA A;  3Q22 A;  1I3Q C;  3DXS X;  1J6V A;  2IBK A;  2DNQ A;  1TFW A;  3FK4 A;  1VHI A;  3S17 C;  2HGN A;  4DL6 A;  1K73 T;  1WCM C;  4ZVF A;  4XSX A;  4B3O A;  4OYI A;  2EG1 A;  5D15 A;  1VLO A;  2V6S A;  1GMW A;  1XER A;  3OL9 A;  4LSN A;  3Q8Y A;  1HYS B;  5HI7 A;  2D1C A;  4K4X A;  2CAD A;  2NVX A;  5CA5 A;  2CA9 A;  1LWF A;  1HPZ A;  5CYQ A;  1KRP A;  3ZTQ A;  5J2M A;  1FJG J;  3IMQ J;  2IYG A;  2MQ8 A;  2MGZ B;  5KT6 A;  4CQ1 A;  5C44 K;  1BQM A;  3W2W B;  1PIL A;  1IXK A;  1TWG C;  1IR0 A;  2D3O R;  2Z57 B;  1ROF A;  4KGM A;  3ISN D;  1QVG R;  3TVK A;  2VL1 A;  2ZOM A;  2Y1R I;  2JLG A;  4Q0B B;  5B0A A;  1MN9 A;  4GTL A;  2VA3 A;  2DH7 A;  4F0M A;  3RBD A;  1YCL A;  2HW3 A;  1GTH A;  3QRR A;  1R8H A;  2RDD A;  3H3V D;  1WC0 A;  4J9S A;  3BEG B;  5JFE A;  7FD1 A;  2QX0 A;  2V8H A;  3IG1 A;  3CJ3 A;  2RRA A;  2BDP A;  2VDI A;  1HI0 P;  1P1L A;  2VBY A;  4MAK A;  3MCS A;  4DQP A;  2ZJP Q;  4I6W A;  3U27 A;  3BQ0 A;  1QSY A;  1I6J A;  3R8Y A;  3D68 A;  3EXY A;  1UW9 A;  1MN7 A;  3CTR A;  5AXM A;  1E6Y A;  4M5L A;  2V0N A;  4QWD A;  1G51 A;  4LFC J;  4DWI A;  1RTH B;  1U0H A;  1RWN B;  4L74 A;  4OYX A;  4LF5 F;  2KM8 C;  2HQF A;  3H5X A;  5KFA A;  3DOM A;  5HLF A;  2GMJ A;  5C25 B;  4KAR A;  4IOC Q;  2HUR A;  4F50 A;  1WOR A;  4B9V A;  2OP5 A;  3HSG A;  2VA2 A;  2NSC A;  1RWO B;  2CQP A;  2LEA A;  1FFG B;  2DTJ A;  1N0U A;  3D5M A;  3PW7 A;  2W8K A;  3QQC D;  1M1H A;  3GTG C;  2A2D A;  3TQE A;  4C2M A;  5D8H B;  3MR3 A;  1YX2 A;  5ETN A;  1N54 B;  4GC6 A;  3EX7 B;  1NU4 A;  3D6M B;  1B7F A;  4CIO A;  1WI6 A;  1GFW B;  3GJQ B;  5CJ9 A;  5IZH A;  4OJH A;  1R9T A;  4MIB A;  4YUD A;  1HI1 A;  3QIP A;  2RD5 C;  5F3T A;  2QLX A;  3O6Q A;  2WSF C;  1JLB A;  4URQ U;  4F7V A;  2FLN A;  2VFR A;  4A8M P;  2GC8 A;  4KMA A;  2NYI A;  1X7V A;  4F4A A;  4UY8 5;  4FN5 A;  2JSX A;  3N9U C;  1NDC A;  1PYO B;  4ZVE A;  1EJ7 L;  2LEB A;  3GTG K;  1RHQ B;  5I42 A;  5E41 A;  2GX8 A;  1Z2Z A;  1UFL A;  3BO2 A;  3PHE A;  3G82 A;  4Q8E A;  3UE2 A;  3KJV B;  3OQ2 A;  4H4K C;  2WVE A;  3PX0 A;  1F93 A;  4P71 A;  1TK0 A;  4F0H A;  4USI A;  4I0W A;  1VK3 A;  4HAC B;  2OGU A;  5ETM A;  2E5L F;  2EFQ A;  3UWT A;  2FHJ D;  4NXM F;  4KGZ B;  3PJX A;  5G4D A;  4F0K A;  4DL7 A;  5KFD A;  4DCO B;  2E2H A;  3A13 A;  3VVU A;  2MQM A;  5J1E A;  4LJM A;  1HAR A;  1IVZ A;  2HFS A;  2MKJ A;  1SFO C;  1C0U A;  4LBH A;  3B78 A;  4HR2 A;  2NVX C;  4RNN A;  3KK2 A;  4CO5 A;  2R3V A;  4KV8 A;  4ECW A;  4LLG A;  2EBE A;  2O66 A;  4ED3 A;  2R92 A;  1IKX A;  4ED8 A;  2X1G A;  2M3D A;  5C5J A;  2ZJQ Q;  3BN7 A;  1BDF A;  3O3L A;  2UVR A;  3HSD A;  2J7W A;  2R2T A;  1YKW A;  4N41 A;  5IP9 K;  1VQL S;  3G6X A;  2LDY A;  1HWU A;  3L09 A;  1X4D A;  1J2V A;  2Y9H A;  3HD1 A;  2QO3 A;  1YG0 A;  3ISZ A;  4DN9 A;  4P6Q A;  2VQE F;  3D1Q A;  4FXW A;  1HNV B;  1T94 A;  4EK2 A;  4BWJ A;  1URR A;  4R25 A;  2P9E A;  4XSZ A;  1VIS A;  5FLX Y;  3GTK A;  4WWS A;  1UFK A;  5EN1 A;  4WTY A;  3ZXW A;  1WDT A;  1TWF K;  4ILD A;  1N8R T;  3FSY A;  1WNE A;  2V94 A;  2OMO A;  4ZJL A;  4FYY B;  4U7C A;  1F7U A;  2PMZ D;  4L76 A;  4P7V A;  1O2F B;  3BKF A;  2BE5 A;  4DS4 A;  3SZY A;  2BV3 A;  1MLA A;  2CDR B;  2UXC J;  3K7R A;  2HBZ B;  3HSZ A;  4HEA 9;  1D0E A;  2GVZ A;  1WF1 A;  4OI2 A;  5LSL A;  2J8S A;  2MZQ A;  2W7A A;  2BOP A;  3AQP A;  3D0G E;  2NVY A;  3V4G A;  1RAH B;  3WBZ A;  4PWW A;  4OJG A;  3R1H A;  1TQL A;  1SC3 B;  1X9W A;  5D4P A;  1OQ3 A;  4LFC F;  3J7Z 5;  3TAP A;  3CCR S;  2QJ3 A;  2LEP A;  2RS8 A;  1LWE A;  4AL6 A;  2YTC A;  1B0T A;  3CD0 A;  4FZB A;  2FJB B;  4XO0 A;  3J80 Y;  3DOL A;  3SSR A;  1AZS A;  3FCW A;  2KKH A;  1S6O A;  2DT9 A;  4PPZ A;  4WJ3 M;  4Y2A A;  4RL1 A;  4ECX A;  4DR2 J;  4WK3 A;  2VBX A;  4MK9 A;  3D7S B;  4RW9 B;  3SZZ A;  4H4K A;  2CIM A;  2H4Y B;  1XR5 A;  1JWW A;  3CCZ A;  2BJ9 A;  2ZBC A;  3DRP A;  4NLY A;  4KT0 C;  2OPR B;  2OSQ A;  3R2C J;  4NA3 A;  3RU0 A;  3FKI A;  4YR2 A;  4ECV A;  4DFJ A;  5CYQ B;  4OYW A;  5FLX U;  5J2N A;  1AA1 B;  4DR1 J;  3BSN A;  2D41 A;  2DHA A;  2J76 E;  5L39 A;  1N0V C;  4FYW B;  5JMN A;  4KTQ A;  4RWX A;  4WFA Q;  1U48 A;  3TJ9 A;  5F0W A;  1K83 C;  4A8O A;  5DO2 A;  3IN5 A;  1TU0 B;  3EWG A;  2QEX S;  2NVT K;  3DYA B;  3NAI A;  2KVQ E;  5HMZ A;  3R3T A;  4IFV B;  4ZVR B;  1TWH C;  2KZZ A;  5IYB C;  4B3R J;  2ZOF A;  1L3U A;  4X66 J;  1OYD A;  3CJR A;  4EFA C;  2A2C A;  1S1W A;  3KHL A;  4I68 A;  2FQT A;  3F0N A;  2W8L A;  1BQN A;  1E6V A;  4PG4 A;  1RTI B;  2V8P A;  2KTQ A;  5IT4 A;  2FY1 A;  3LGN A;  4WU2 A;  2CDQ A;  1RAD B;  3A3N B;  1KLN A;  3DOL B;  4QU7 A;  3HKZ D;  3M2V B;  4A3D C;  3TUP A;  4DU7 A;  2AQ4 A;  3LPE A;  1YJR A;  3MAA B;  1RAA B;  1RGV A;  2B63 A;  3GYN A;  1HQE B;  4K50 A;  4JI2 F;  4LFA J;  2XSJ B;  4WJ4 A;  2CJX B;  3A3P B;  1U6Z A;  3HOU K;  1RK8 A;  2LU1 A;  2FHK A;  1FDD A;  2IAJ A;  3T01 A;  4TQS A;  4RNH A;  2XHC A;  4L72 B;  4Y52 K;  2ZHO A;  3G4S S;  3D28 A;  1VOM A;  3PCO B;  2R92 K;  1OY6 A;  1QVF R;  5DGA A;  2FB0 A;  1FWP A;  4M1K A;  2UXD J;  1FJG F;  1XZQ B;  4XK8 C;  4R0J A;  3CD7 A;  4ECS A;  1X5T A;  3VTI A;  1IR1 A;  4PXE A;  5KFI A;  5M5X K;  5IWA F;  2F8M A;  2HRY A;  5FLM C;  3VAG A;  3ZZU A;  4HI1 A;  1VGY A;  4M8L A;  3R6G B;  1KLM B;  2R2U A;  3FMW A;  1JQW A;  3HJV A;  3FKI K;  3PHT A;  4BC7 A;  3KK1 A;  4C8Y A;  3MM6 A;  2UVW A;  3GTK K;  3CCJ S;  3PJW A;  2R7Z C;  4LSZ B;  2BJE A;  3OEP A;  2XMJ A;  2R7W A;  2V8G A;  3FHZ A;  5J2N B;  2DO0 A;  4WK1 A;  1CBK A;  2WW8 A;  2V9W A;  4DXL A;  1ZPW X;  1J5O A;  6FD1 A;  3NNH A;  2CQ1 A;  1HQ2 A;  4YDX A;  1FXL A;  1LWX A;  4PG7 A;  2HZA A;  1GAO A;  3QYY A;  1MWQ A;  2J6U A;  4NI2 B;  2VD3 A;  4HH1 A;  4OHV A;  4TQR A;  1WF0 A;  3LP1 A;  2ZC4 A;  2JA5 A;  4O0I A;  2W7V A;  3E51 A;  3JQJ A;  1HNW F;  1RA7 A;  2R8J A;  5IP9 C;  1ZH5 A;  4I2P A;  5LMU J;  2VG5 A;  2ZHA A;  2HVI A;  3EDQ B;  5B0G A;  1BS2 A;  3UNG C;  3OL8 A;  1WQG A;  2AD9 A;  3M8W A;  3IGN A;  4GVB B;  3GE9 A;  5C2C A;  1QE1 B;  4HYK A;  2KYX A;  4OIX A;  2MSS A;  4YS2 A;  3MMB A;  3MEC A;  3MCO A;  5H9E K;  2M52 A;  5U47 A;  4GT9 A;  1FRH A;  4WIL A;  4KY3 A;  1JKH B;  2BYC A;  1JKH A;  2V67 A;  1VC0 A;  4B02 A;  5EWF A;  2R7U A;  1G6B A;  4X66 F;  1SC4 B;  3G86 A;  2KJV A;  2IM1 A;  2XYP B;  1J5E J;  2YQ3 A;  2B5J A;  1L3V A;  3SXL A;  2DGT A;  3QT7 A;  3IWX A;  1S10 A;  3L4B C;  3DOM B;  4PAB A;  3N6N A;  4ZPV R;  2UVU A;  2CJY B;  3KK3 B;  1NH8 A;  2OSR A;  1DFD A;  4P5A A;  3UN3 A;  4YEA A;  1ZA2 B;  2EKY A;  3EZ5 A;  1AUD A;  3M2R A;  3AA8 A;  1SUQ B;  3AOC A;  4ECT A;  1QD1 A;  1RWV B;  2NXE A;  5C42 A;  5CAB A;  3CDA A;  3TWZ A;  1LWF B;  4DR5 J;  4BDP A;  4J9M A;  4DLE A;  5J2M B;  1RT5 B;  1WIH A;  3MUR P;  4WFY A;  5KT7 A;  3BPD A;  4FF2 A;  2DNK A;  4KSE B;  2ZBI A;  2Z2Z A;  4KM8 A;  1CJT B;  2EC2 A;  2ZBR A;  1R6V A;  5KFO A;  2N7Y A;  1B4S A;  5IOR A;  2H3E B;  2HVD A;  3L9Z A;  1HBO B;  3M3Y C;  2NLW A;  1JLC A;  2GAG C;  4C3K A;  2J0S D;  1T9W A;  2GVZ B;  3SI8 A;  2OH2 A;  2OTL S;  4UOF A;  2EBG A;  4V1A k;  1WDD A;  3J80 U;  2XLK A;  3K5N A;  2ZH1 A;  2CNL B;  3GTQ C;  4FBU A;  1FKA F;  3CC7 S;  1IM6 A;  2QLF B;  1LW2 A;  2FJD B;  2ZUG A;  5DM6 Q;  1PYT A;  3G6Y A;  2WBM A;  2FVC A;  1YZ6 A;  1SKW A;  2CFA A;  3DXJ A;  2EFO A;  3IM8 A;  2HFO A;  2YH1 A;  1VJQ A;  3W3S A;  1WKK A;  4LRC A;  1REV B;  3LAN A;  1Y5N B;  5D78 A;  4B9U A;  5MAO A;  4I64 A;  2IA6 A;  2M7S A;  4F02 A;  4A3I C;  4RKU C;  1MRO B;  3DI6 A;  1ZET A;  3BGR A;  2R7O A;  1N5S A;  4H54 A;  2FQQ B;  3IBF B;  3KYL A;  3GTQ A;  7AT1 B;  2YKP A;  4WXO A;  4PAA A;  4RLE A;  4Y3C A;  1X0P A;  2A6E A;  5F8G A;  5M2R A;  2HQC A;  2B5J B;  2CQ2 A;  2HGL A;  4IQX A;  2PSZ A;  2ZWO A;  3RR7 A;  5A8K A;  2B0G A;  1T0T V;  3ELH A;  1XR7 A;  4DV7 F;  2R93 A;  1VHF A;  4OX9 F;  2G2O A;  4NL5 A;  2GSU A;  1GQE A;  4A8F A;  4RMF A;  4TYA A;  3PIO Q;  3RBE A;  5J2P A;  4IRD A;  3AAW B;  4ILM A;  4UOG A;  1NDP A;  5FD1 A;  3ZZR A;  1CLF A;  2MKY A;  2ATC B;  4X4V A;  3KUH A;  1JB0 C;  4DL3 A;  2KWA A;  3G6V A;  1TL1 B;  5A76 A;  1AT1 B;  4DSK A;  3DN9 A;  1T05 A;  3RR8 A;  4HAC A;  4JI6 J;  2F9D A;  3D9B A;  4DUY J;  2YKM A;  1SJQ A;  3CO0 P;  4A3F C;  3KDN A;  2IDE A;  2KO1 A;  4KDD A;  4J90 A;  2Y1I A;  1F5A A;  1S9G B;  1N32 F;  4LR9 A;  5D4L A;  5HQL A;  1RHR B;  2WK4 A;  3S1M K;  1C0A A;  2ZH6 A;  3GTP A;  3I55 S;  1M5P C;  2A3J A;  4Q44 A;  3MM8 A;  4E98 A;  2ZFH A;  2FY8 A;  4ZP6 A;  4LFB F;  2RU9 A;  1O2A A;  5C4J C;  3PKY A;  3JS9 A;  4AQY F;  4ZK7 M;  2XM3 A;  3G87 A;  2WBR A;  4ECU A;  4EBD A;  3M9N B;  3CCQ S;  2CFA B;  3X1L B;  1QY7 A;  4BY7 C;  5KG7 A;  5CCM A;  4TY9 A;  4UUW A;  3W64 A;  1UWB A;  3U7J A;  4A3M C;  2P2C B;  1EI6 A;  4QIW L;  3I0S A;  1FD2 A;  2UUA F;  4BBR K;  1HBN B;  2Y3Y A;  3QRQ A;  2IRX A;  3LTO A;  2GIF A;  2BE2 B;  3MTK A;  3K2Y A;  2V2Z A;  5LL6 d;  3KK3 A;  2YQ0 A;  4EWT A;  1H2V Z;  1JXL A;  2IC3 B;  1SIW B;  4OHY A;  4CLT A;  2CAJ A;  2LKZ A;  5CXT A;  4B3R F;  1Z1Z A;  4ZDN A;  4NLP A;  1JLQ A;  3LUY A;  1N88 A;  4P2X A;  1UJ6 A;  5D3G A;  2E29 A;  3Q3Q A;  1W25 A;  3O5T B;  2BEF A;  3ULH A;  3KDO A;  3P3D A;  2IYI A;  3CCT A;  1N33 F;  4FM9 A;  1RAO A;  5FJ4 A;  2NVQ K;  4LF7 J;  2VOD A;  3UVJ A;  2HHU A;  1RTI A;  3MTJ A;  1HQE A;  4G1I A;  5HVG A;  4O2D A;  1SFO K;  4JV2 A;  2F1F A;  1TWA K;  4G1P A;  3W66 A;  5EWG A;  1T3O A;  1H6K X;  5KFE A;  2L41 A;  4O4R A;  3FQK A;  4A8S A;  1YWX A;  2R8H A;  2HS3 A;  3HOW C;  3GTO K;  3OV7 A;  2MKK A;  3UQS A;  3TZY A;  3S1T A;  5B0C A;  3SEO A;  3MD3 A;  4DR2 F;  4LFA F;  5RUB A;  1P9Y A;  3N3Y A;  4KRW A;  1VYA A;  2XNR A;  3ZTS A;  4D3H A;  4C9D A;  4KV8 B;  3HD2 A;  2KHC A;  5CCL A;  2ACM A;  2YH0 A;  3KUG A;  3TA0 A;  2JA6 K;  2E7X A;  3QT6 A;  2B9E A;  1GXU A;  2Z2Y B;  1TL3 B;  4CT8 A;  3MXH P;  1VRT A;  2XQC A;  3WDO A;  5DZ7 A;  1F60 B;  4WFB Q;  4A3J C;  3M4O C;  1KFD A;  2HHP A;  1XXC A;  2BUN A;  3FEX B;  1UMJ A;  3M8Y A;  4NCG A;  2XZD B;  3LPY A;  3MPY A;  3UD3 P;  3JSY A;  2B63 C;  1IWA A;  2RH6 A;  2IDL A;  3I0S B;  4HHH A;  2R92 C;  3EGN A;  1X9M A;  3HF5 A;  2IRY A;  5L8R C;  2XMK A;  1ARO P;  2VKZ G;  2ZBP A;  3BUE A;  2KDO A;  2W2P P;  4M95 A;  4DF8 A;  1NO8 A;  1RHU B;  4WF9 Q;  4TKT A;  1JNZ B;  4L75 A;  5AXL A;  3V81 A;  2NUU G;  2LLZ A;  4ZPC A;  3VV2 B;  3RB0 A;  4DV3 J;  5AJ3 F;  1CJT A;  4ICL A;  3HHL A;  4DI6 A;  2QN6 B;  3RUB L;  5DRK A;  3UD5 A;  5L46 A;  4DL2 A;  1FNM A;  1I3O B;  2CQG A;  4DOZ A;  4OZ3 A;  4F2R A;  1IJF B;  4N56 A;  4DS5 A;  2VV5 A;  1Q7Y T;  4Q2L A;  1IBM F;  2X1B A;  1ZYQ A;  4LK0 A;  4IRC A;  1HNW J;  1M5H A;  4ES3 A;  1RTD A;  2R93 K;  1NDL A;  2EWH A;  3R5J B;  4OFZ A;  1B70 B;  1MNE A;  1TL1 A;  4DQR A;  3L7O A;  5HQ8 A;  2E2J K;  3GTJ A;  1GX5 A;  2V4J A;  2Y8Y A;  3I9V 9;  4N7T A;  2H5I B;  4KHM A;  2E5L J;  5TMF A;  2KI2 A;  2DNP A;  3HHL C;  5BR8 J;  3QAT A;  1RTD B;  1G4C A;  1PG5 B;  5BYS A;  2VFV A;  4WYL A;  3M32 A;  4GKK J;  1YK9 A;  1R27 B;  2LA6 A;  3ZO7 A;  1S76 D;  1SL2 A;  4JB8 B;  4NEZ A;  1Y9O A;  2OUG A;  1I5O B;  3DLE A;  3P5B P;  4OZ1 A;  4FNH A;  2BJ8 A;  4QYZ J;  3NWG A;  3FBC A;  3AD8 C;  1XNR F;  2ZVI A;  2PHC B;  3C15 B;  4F3Q A;  3GJT B;  2QTW A;  1EAR A;  1FEH A;  4WZQ A;  2DCL A;  2HIY A;  2AYM A;  3CCU S;  4RUA A;  3HVA A;  2QL5 B;  1ZXO A;  4DR7 F;  1SBR A;  4OQJ A;  3NNA A;  3BBF A;  5GME A;  2BMB A;  1SQE A;  1RKJ A;  3S17 K;  5M5Y K;  3TR5 A;  4M5H A;  4OHX A;  4OZN A;  1T9T A;  2M0G B;  5LXY A;  1X9S A;  2YXL A;  2RHS B;  3MMA A;  3P4U B;  2GGP B;  1IBL J;  5GMK a;  2CPE A;  3G4C A;  1FK9 B;  2YBV A;  4BCA A;  3KNA A;  4MYT A;  1HI8 A;  2ZNY A;  1NBE B;  1SB6 A;  1YQH A;  1VQ7 S;  3BGL A;  3T9Z A;  2WVB A;  2MGZ A;  3MFI A;  1HQU A;  1DTT B;  5KG0 A;  2JA7 K;  3LAP A;  5IT9 U;  3CNQ P;  3SCJ E;  2RF2 A;  3HCX A;  3M2V A;  5IYC K;  1M1G A;  1Y7P A;  3JAM U;  4U96 A;  3CDW A;  3FRZ A;  3TEH B;  2HRU A;  2KXH A;  4A48 A;  3PIP Q;  1K0V A;  4FP9 A;  2P5M A;  3K59 A;  1RHK B;  4QR0 A;  5HJX A;  1AXQ A;  2E5J A;  1FES A;  2XB2 D;  3HHK A;  2LQJ A;  3HUL A;  4LIR A;  3LF0 A;  4J91 A;  2EVZ A;  2XZW A;  4N47 A;  2PFD A;  4DU8 A;  3MMJ A;  1LK5 A;  2DR8 A;  2ROP A;  3DOK A;  1B7Y B;  3RGI A;  2R7X A;  1NH7 A;  3GTJ K;  3KJN B;  4NEY A;  2CPI A;  3SCI E;  1IUJ A;  1UPM B;  4K4Z A;  3I4N C;  1XC9 A;  3NS5 A;  3KHH A;  2CJB A;  1CEZ A;  3H25 A;  3OVS A;  3IC1 A;  2HRT A;  3CJ4 A;  2HNZ A;  1MRO A;  1S97 A;  4DPT A;  1IBK F;  3HHE A;  2NUH A;  2XWX A;  4R0E A;  2XHW A;  3TFI A;  3D4J A;  3S1R K;  1KLM A;  1RT7 B;  2BJ7 A;  1F1B B;  3I5A A;  4JI5 F;  1FWL A;  2NCK L;  1NHV A;  1REG X;  1S6Q A;  2QT7 A;  3DHX A;  1DQ9 A;  4DL0 C;  4EGL A;  2H48 B;  2YKA A;  4NLW A;  4ED1 A;  4NE9 C;  3M3Y K;  3SDE A;  3E01 A;  1D3W A;  3CQZ K;  5MLC V;  1TWC A;  5LM7 E;  3C16 B;  2C2D A;  4ZVP B;  1HNX F;  1DJ0 A;  2YVS A;  3W9J A;  1X4C A;  1U0S A;  4C0B A;  2R7Z A;  1FKO B;  3OXG A;  1FJC A;  4KAI A;  1YNJ A;  2HWT A;  5E3P A;  2ZE2 B;  3THP A;  2AEM A;  4Y2K A;  1N32 J;  4ICL B;  4H4M B;  1IKW B;  4ZS6 A;  1KQ4 A;  3QAE A;  2B63 K;  2HMI A;  3HOW K;  4HKQ A;  2DKO B;  1T11 A;  2LMI A;  1B99 A;  5BR8 F;  1KN6 A;  1R8A A;  5KG3 A;  3V6K A;  1FRJ A;  1TWH A;  2R7R A;  1X8D A;  5KT4 A;  2C3O A;  1ZTW A;  1YJT A;  5FII A;  2LU2 A;  4QZV B;  1Q95 G;  1KTV A;  4LF9 J;  1IBM J;  2KT2 A;  2XCR B;  3QFW A;  5A0Y B;  1BHN A;  4K4U A;  2HK3 A;  2UUA J;  1EET A;  5LOQ A;  3QT8 A;  3NMA A;  1PJ7 A;  4DQS A;  1FRM A;  1D9D A;  2FGO A;  3OFH A;  3BBB A;  4O3O A;  4W98 A;  4UOH A;  3GTP K;  5HP1 B;  1VRT B;  1FVQ A;  2XMT A;  4RBV A;  4GC7 A;  2HEK A;  1K47 A;  4ZA1 A;  5JVO A;  5KFJ A;  1UA1 A;  5M3M K;  3BM7 A;  3WIU A;  4YOE A;  1G3O A;  2P6T A;  5LSO A;  3R9L A;  3VR1 A;  3I0R B;  1RIS A;  4ANE A;  4U95 A;  5IP7 C;  2JA8 C;  3P45 B;  4EO8 A;  4A3G C;  5IQ6 A;  2A6M A;  2ZUF A;  2HPU A;  2ZKT A;  3N5B A;  3H59 A;  5KFK A;  4DR7 J;  4Z7C A;  4FZV A;  4ZCL A;  2NPF A;  1CJK A;  5J2Q A;  2AGO A;  4IH5 A;  3T00 A;  3GG1 A;  2ZH2 A;  1DD5 A;  1Q8I A;  3M6X A;  4UOC A;  1QAJ A;  5FLM K;  1WCM A;  2CVE A;  4ZH4 A;  2ZIT A;  2JRS A;  3ZZY A;  5D6G A;  1VBY A;  2IFX A;  1NAQ A;  3OL6 A;  3K58 A;  2W9B B;  2HHT A;  1N36 J;  3M8P B;  3H0G K;  3EM1 A;  1X4E A;  2JA8 K;  3FKI C;  2L3M A;  3D3C J;  1S1U A;  3MPW A;  4QWE A;  4RR5 A;  3W61 A;  2HHS A;  4ERD A;  1BQN B;  3AD9 C;  5IM0 B;  3I4M C;  2ZDP A;  3ISN C;  4OZJ A;  1I6H K;  2B6A A;  1RB0 A;  2XS5 A;  2HS0 A;  3UNY A;  5CD4 A;  1Y3J A;  1NHU A;  5L38 A;  2QC3 A;  5IFM A;  4P75 A;  1S9E A;  4ZN1 A;  5DDR C;  1P6T A;  4LF4 F;  1BY9 A;  3S1M C;  2X1F A;  4X4T A;  2ZFZ A;  4TN2 A;  3KXD A;  4KKO A;  2AJQ A;  3NWR A;  3HXM A;  5HBM A;  1V5I B;  4NAS A;  1S1X A;  4DHV A;  2MQP A;  3OT9 A;  1HW8 A;  4OI3 A;  1JLG A;  2DB1 A;  2YY3 A;  1XNQ F;  3GTL A;  1XWL A;  2OPS B;  4X62 J;  2I1R A;  3F73 A;  3H0G A;  3RZO C;  4U7U D;  5E3Q A;  1V3R A;  4UY8 T;  3NUH A;  2V6U A;  1CUL B;  2CNK B;  2D69 A;  4XAK A;  2E5H A;  5GAE I;  1V3S A;  3AA9 A;  2A69 A;  1YDL A;  3H42 A;  2B7B B;  2E1C A;  3GII A;  5KFG A;  1VBX A;  1HQU B;  4IR9 A;  4Q45 A;  2IC3 A;  4PUO B;  1SI9 A;  2QMW A;  4GTB A;  3BN4 A;  3M4O K;  2OKQ A;  4GTF A;  1M5K C;  4PWD A;  1Q79 A;  3RZO K;  2OO4 A;  1FK9 A;  1IBK J;  1EZZ B;  2AHO B;  1ZBS A;  1HBU A;  2PDA A;  5ETR A;  1JLC B;  3W2W A;  4DL5 A;  1RWX B;  1RAC B;  2X51 A;  4QJV A;  3NBP B;  3HLU A;  4UW2 A;  2DRD A;  3FFI A;  5KFU A;  1DLO A;  2H5J B;  2YKQ A;  1ZZN A;  5F41 A;  3UDC A;  1H38 A;  3ONQ A;  4BLA A;  2YPY A;  2JDJ A;  5J1P A;  3DLJ A;  4WKY A;  4L6V 3;  1NSP A;  1KVI A;  4J7C A;  2WZ1 A;  5C3E K;  2PMH A;  3D6T B;  2HMI B;  1YI2 S;  5IOS A;  3D54 A;  4G0W A;  1SKU B;  2ZE2 A;  3OR1 B;  2CZ4 A;  2ZBQ A;  4JI0 J;  3GCW P;  2MEW A;  3BO3 A;  5LJ3 Y;  4ZOS A;  1RJJ A;  3CJ8 A;  2RDJ A;  4WBF A;  1S1X B;  1QTN B;  2XBP A;  5EUH A;  1QE1 A;  1XZP B;  3UI3 A;  2HFZ A;  1KC8 T;  2X1A A;  2XYH B;  1AUS L;  2GJF A;  4JV5 F;  3KG0 A;  5HL7 Q;  4GVB A;  3VGT A;  2CPJ A;  3PR5 B;  3H8Y A;  1NME B;  3IRW P;  4URS A;  3ET6 B;  3GTP C;  1HFE L;  5HLF B;  3HT3 A;  3CJS A;  3VAJ A;  3PX6 A;  1DZ5 A;  1NKC A;  3SQO P;  2PC6 A;  4OX6 A;  3GTL K;  4UUX A;  1TKT A;  4CZC A;  3MZI A;  1OO0 B;  4G0U A;  3WC0 A;  4IG3 B;  1AYE A;  3MEG B;  4KIA A;  3RYL A;  3M9O B;  2C42 A;  4NYO A;  3C8Y A;  3CDE A;  5HMX A;  2JLF A;  4LUB A;  4NLR A;  2MQL A;  5ETT A;  4J37 A;  1RZM A;  3G8Q A;  1RE1 B;  3QNW B;  4QQB A;  1VJE A;  4OIN A;  1YJV A;  3H5Y A;  1TAU A;  5HMW A;  2YX4 A;  2ZHB A;  3G4A A;  2V68 A;  3MPU B;  2R7S A;  5E0O A;  3W5Z A;  2ZC3 A;  4CYU B;  4A8W A;  3QO9 A;  1JX4 A;  1XMO F;  4BBS C;  4PUO A;  1WD6 A;  4DF4 A;  4HHJ A;  4KC6 A;  5KFM A;  2KG0 A;  2RML A;  5J1N A;  1MWZ A;  1OPI A;  1WC3 A;  2DNL A;  1T95 A;  4K4V A;  1TP7 A;  3KG1 A;  3KK2 B;  1NJY A;  2VIC A;  2E66 A;  2YNI B;  4BC9 A;  1ZAW A;  1KHW A;  3LP2 B;  2CNO B;  1CJU B;  3R97 A;  4W90 B;  4HDH A;  1HBO A;  3QZ8 A;  1MWY A;  4FF3 A;  1WUU A;  3D1H A;  4EYH B;  2HSE B;  4ZPW R;  2R9L A;  4CLP A;  3MD1 A;  2CW0 A;  4C8Z A;  4OZ5 A;  2J0X A;  2FIU A;  4DV4 J;  1I50 C;  3JSM A;  2FJX A;  2CZV C;  1AW0 A;  3PXG a;  4KR0 B;  2B9X A;  2QRR A;  2RAQ A;  2UUB J;  1CJU A;  1SV5 A;  2OD6 A;  5B7W A;  2BKN A;  4C3M A;  3M8S A;  4CO1 A;  2N82 B;  4C8O A;  2E2H C;  1FRL A;  1OJ4 A;  2DGX A;  2BJ3 A;  2WAQ D;  4WFN Q;  2XNQ A;  4NCA A;  4ZVS B;  3CDB A;  4ITS A;  4MYU A;  1RWU A;  1RT6 A;  4OZ2 A;  2YKO A;  4F4W A;  3BGF A;  2LXF A;  4ANC A;  2ZEJ A;  3P96 A;  2OFH X;  4FS2 A;  1TWH K;  2RE1 A;  1HKA A;  2J6S A;  4DPY A;  4FF1 A;  5DG8 A;  4OX9 J;  3V81 B;  1KQS R;  2HHV A;  1RHJ B;  3I4P A;  3MR7 A;  4A4J A;  1VC5 A;  2Q6C A;  4GO5 X;  4I4B A;  2L9W A;  1UZH A;  3EGW B;  1GMV A;  3FBB A;  1IE0 A;  2WTF A;  4NPO A;  1W26 A;  1Y11 A;  2RKI A;  4IDK B;  3L4K A;  1X4H A;  1U6F A;  4Y2I A;  2UUC F;  2M8H A;  1EHW A;  4KFB A;  4IOA Q;  1VR6 A;  2V2K A;  3ILI A;  2AEF A;  3M8Q A;  1R3N A;  1UWA A;  3M8Q B;  2QL7 B;  3TFJ A;  2W2O P;  2COL A;  1R0A A;  3S15 K;  4OHW A;  1HW9 A;  1Q8B A;  3J81 U;  1QJH A;  3TX0 A;  3VAH A;  3ENW A;  1WSV A;  2YNG A;  1VCT A;  5M2P A;  2N4C A;  1L3S A;  1QSS A;  4X4N A;  1MMN A;  3EMT A;  3RRG A;  1ZTT A;  2W9B A;  3A8I A;  2QA2 A;  4LF7 F;  3SBM A;  4G7H A;  1EK8 A;  1YGY A;  4CH7 A;  2AZ3 A;  3NS7 B;  4JBC A;  7FDR A;  4KHR A;  5IYC C;  1LWE B;  2DGQ A;  2FLL A;  4F4K A;  3UCG A;  1VJW A;  1F9F A;  3MR5 A;  2V6T A;  4UST A;  2GJI A;  2FVS A;  4U6P A;  3OXF A;  4EEY A;  1JLF A;  4WP3 A;  1TV6 A;  3S2H C;  3KLI B;  5F3Z A;  3RB3 A;  2V63 A;  2ABY A;  1X4B A;  1I6V A;  2W4C A;  5AE2 A;  2DR5 A;  1CSJ A;  4YY3 F;  1A0O B;  3TZX A;  3LAK A;  4M5M A;  1KHV A;  3DLK A;  3TAM B;  2RB7 A;  2AT1 B;  1NZ8 A;  5HMY A;  2P9C A;  3AJ1 A;  4O0N A;  3DRY A;  1L5U A;  3W9H A;  1H3D A;  1U1M A;  2EEY A;  3HFV A;  1R31 A;  8ATC B;  1RLD A;  2EBB A;  1RDR A;  2ZWP A;  5KFN A;  4F67 A;  1FA0 A;  3WQP A;  3OVA A;  2IPO B;  1S7H A;  1LV5 A;  3TEG A;  3MM6 B;  4IOB A;  4LRD A;  6AT1 B;  4ZIW A;  4KAT A;  1RAF B;  4C6A A;  5FDL A;  4FDF A;  1JJH A;  2K06 A;  3PDN A;  2GGP A;  3HKW A;  4OI4 A;  3M1V B;  9ATC B;  4AQY J;  1YBT A;  4RW8 B;  4C8L A;  1CQN A;  1Q5Y A;  2VBW A;  2ZVS A;  2E7V A;  1IBA A;  1K83 A;  4F25 A;  2C3U A;  3T9N A;  3KLG A;  3QO9 B;  2DGS A;  2VON A;  3TUI C;  3UPF A;  4NWB A;  4QR1 A;  1S1U B;  2L9N A;  4A93 K;  3N6L A;  4XLP A;  1EAY C;  4A3B K;  2M8D B;  1CQM A;  1Y1V C;  4K8R A;  2HND A;  4U9R A;  5D4D A;  2UXB J;  2JVR A;  3HZE A;  1WEZ A;  2MST A;  2VG6 A;  4LVO P;  4A3I K;  2F4V J;  4J9Q A;  4AUK A;  5CZV A;  3D1O A;  2WON B;  2GQC A;  4KBI A;  1C0U B;  2E5G A;  3N01 A;  1R9T K;  3TA1 A;  2C2N A;  4XPE A;  1VQO S;  3IA0 A;  3PX4 A;  1NJW A;  2PII A;  3GMG A;  5KFV A;  3B4M A;  2HAI A;  1K8A T;  2PO4 A;  2C3Y A;  4DV5 J;  3NEK A;  5DG9 A;  1JIH A;  1DAX A;  2PA8 D;  4CTA B;  2DXD A;  1RU2 A;  1KVJ A;  3MHY A;  2VKR A;  1XMO J;  5KFC A;  3C14 A;  2AJ1 A;  3HDS A;  3X3U A;  2D3Z A;  2I6W A;  4NLG A;  1ZS6 A;  2FTR A;  5IYD C;  2HNY A;  1EKS A;  3OJU A;  2FUG 9;  3SIP B;  4LOW A;  3P6Y C;  2ZH4 A;  1RAE B;  1S6Q B;  3GTM A;  5K9F A;  3PR4 A;  2WSE C;  1O24 A;  3S01 A;  1TKD A;  4CLS A;  2HHX A;  1PAE X;  5HAO A;  4X62 F;  1HLW A;  2EXU A;  2IM3 A;  3M1V A;  5A8R B;  5I42 B;  2AF6 A;  1JLQ B;  1BXN A;  2XG8 A;  4F36 A;  1WC1 A;  1HBN A;  2V9K A;  3CC2 S;  2ZZN A;  4DV2 J;  5BYR A;  4RNF A;  1U1R A;  3SCL E;  1RT6 B;  1YHQ S;  3AY0 A;  2RRB A;  2DPJ A;  4I2P B;  3CJ5 A;  4ZIV A;  1J6X A;  4USV A;  3KJV A;  5IYB K;  1Q53 A;  2DCU B;  4KMD A;  5GAD U;  4P10 A;  3AFG A;  1H7W A;  4A3C K;  3HMJ G;  3R5G A;  4B3M F;  2DHX A;  1I51 B;  3IS9 A;  3FOE A;  4QJV B;  1WHV A;  5GAG U;  2D9O A;  2Y3P A;  2J0Q D;  1V6H A;  1XQI A;  4X4U A;  2DR7 A;  1XJW B;  1Y1V K;  1YBU A;  2BKO A;  3BJY A;  3CJ0 A;  4MFB A;  1TL4 A;  3SSQ A;  1SXL A;  1RT1 A;  5KG2 A;  2V2Q A;  3HHD A;  4K7Q A;  3AJD A;  2GO9 A;  2XWY A;  1VK8 A;  3NGR A;  4WZM A;  5C4J K;  4FVM A;  5ETK A;  1FJE B;  2O5D A;  3E8O A;  2BQU A;  3A12 A;  4DV3 F;  1UVM A;  3I6P A;  1WWH A;  4DSL A;  2Z2M A;  2YNF B;  4GTC A;  2MB0 B;  1S49 A;  2EFV A;  1VFJ A;  5IS2 A;  3KHR A;  2GA7 A;  4B3O B;  2XMW A;  4PKD B;  1LQ9 A;  1YRU A;  5B0D A;  1HQM A;  5I3P A;  3R5C A;  3N0V A;  3IBC B;  3KLH B;  1L3T A;  1S9F A;  3ZZT A;  5SZT A;  1O5J A;  2DNM A;  3JQM A;  3MMB B;  3FJ2 A;  1MU2 A;  2V4J B;  1N5Y B;  1H73 A;  2WHO A;  2Y0B B;  5LMN F;  1XN9 A;  1ZAX A;  4J3N A;  2HWI A;  1MG7 A;  4NZ6 A;  4O23 A;  4RO0 A;  1TWA A;  2BAC A;  2RDI A;  4CI0 B;  2KL8 A;  4JI7 J;  1LK7 A;  1VS3 A;  2CPF A;  3LWM A;  3VQS A;  1U1Q A;  2OFG X;  2OJ3 A;  3MM5 A;  2RQC A;  3V5R A;  2NVY C;  2W4D A;  2ZOG A;  1LOU A;  5L1L A;  5DQI A;  4PCQ A;  2B56 A;  4PG5 A;  3BDE A;  1N52 B;  5DDO C;  5B09 A;  2XY5 A;  4CM0 A;  2DNG A;  1MSW D;  4JI1 F;  3RZA A;  2VZ9 A;  2QMU B;  1FE4 A;  1C1C A;  4NLU A;  4NA1 A;  1WG1 A;  5I3U B;  5KFT A;  4R5P A;  4M5I A;  3KMQ A;  3HFZ B;  4K4T A;  2OEJ A;  1HHS A;  3GPA A;  2R93 C;  5E3R A;  4LK1 A;  4HHU A;  3VCD A;  3BO4 A;  4I67 A;  1UP1 A;  4LF8 J;  3HX9 A;  1R8P A;  3DDN A;  5HQM A;  1ZOT A;  2VC1 A;  2F7V A;  1X60 A;  3LQV A;  3TJA A;  2MLZ A;  4Q5S A;  5CHC B;  4JI3 F;  1JLA B;  1WEX A;  4X4O A;  4E0D A;  3AH5 A;  1U2F A;  1NK8 A;  3IFE A;  5L1K A;  2KFY A;  1R8C A;  2Z30 B;  2YWK A;  1RA6 A;  2C2O B;  2YNI A;  3CF5 Q;  3LH2 S;  3THT A;  2VUM K;  2GHW A;  2EI5 A;  2GIR A;  2XY7 A;  1DHM A;  1P1T A;  2VF3 A;  4ENO A;  3VAI A;  2ZKU A;  5KG6 A;  1VLY A;  1VQ6 S;  1VBK A;  1LEO A;  4MMO A;  1TWG K;  5HSP A;  2JFD A;  2NVT C;  5C44 C;  1NND A;  1OSD A;  4JV0 A;  4G65 A;  4IG0 B;  4PWU A;  5T14 A;  2YX1 A;  4M1X A;  1DQA A;  2O1P A;  2YWG A;  4N77 A;  2QYG A;  4ZCI A;  5DQH A;  3GCX P;  1HWK A;  3M30 B;  3H7H B;  4X84 A;  5KT5 A;  3HSJ A;  3RB4 A;  3T5L A;  2CWX A;  1DRZ A;  2LDI A;  4KPC A;  2FJW A;  3K7A C;  4MKV A;  3M6W A;  3W63 A;  1NK5 A;  4NZ0 A;  3T41 A;  1CUL A;  2GAH C;  1M90 T;  1EIY B;  4EO6 A;  2B43 A;  4NLT A;  2AIR B;  3J81 Y;  1T03 A;  4LBP A;  4QWC A;  4RW7 A;  3GIJ A;  2LEC A;  2HGM A;  4IFV A;  3W2V A;  3W2V B;  1C0T B;  3IRX A;  4RW8 A;  1RT3 B;  4ZVU B;  2I8E A;  2MTL A;  4ZP8 A;  1R6Y A;  4AT1 B;  2DNO A;  4DV6 J;  1F5B A;  1WEL A;  2UXD F;  4ZP7 A;  1VQP S;  1OWX A;  1GXT A;  2Q3P A;  1C0T A;  2HFV A;  3IRX B;  1YIJ S;  2GW8 A;  3E01 B;  4A3E K;  2L08 A;  2ZM6 F;  1FD8 A;  5CYM B;  4LRF A;  5C25 A;  4CLW A;  3M9M B;  3P49 B;  3DRP B;  2JNJ A;  4MFB B;  2OPR A;  2LQB A;  1GX6 A;  2ALY B;  3DU6 A;  4ED2 A;  3VAM A;  4RW9 A;  2NR0 A;  2UZA A;  4YME A;  4W4M A;  3MGJ A;  3BGR B;  3AOD A;  2RIJ A;  2N4D A;  4ID8 A;  3DLB A;  2J9D A;  1RU0 A;  4OI6 A;  1IKV B;  1FE0 A;  3HVT A;  3UCZ P;  2H54 B;  2L9D A;  2EG2 A;  3GR0 A;  2X3D A;  1HNI A;  1CC8 A;  4KO0 B;  4JP8 A;  3JSM B;  3DDK A;  4ILL A;  9RUB A;  3GSD A;  2QYC A;  2CPD A;  3T1A A;  4M5D A;  3ZNJ 1;  2BW2 A;  4G7O A;  3RTV A;  1RHM B;  1UW4 A;  4P2S A;  2BM0 A;  3OPK A;  1F9N A;  4DX6 A;  2JA5 C;  2CJA A;  2JVO A;  3PO4 A;  3BRE A;  1S5Z A;  2UU9 F;  1S72 S;  3S1R C;  1INN A;  1YTY A;  3DRR B;  4M5D B;  2Y0S D;  4ZLL A;  3I5C A;  2MQQ A;  1AB8 A;  1WOP A;  2POK A;  4ELT A;  1Q7L B;  4RW6 B;  4DPX A;  3H2U B;  1BE4 A;  4XPC A;  4ZMM A;  1LNQ A;  1N5V A;  4FYX B;  3PW2 A;  4C97 A;  2YNH A;  1UZD A;  3K7A K;  2CQI A;  1PKU A;  1B4B A;  4RW7 B;  3U1M A;  3RZD K;  5EGY A;  1J5E F;  3CED A;  3MEE B;  2MXY A;  4LF6 F;  4C3I K;  4QCL A;  2JEJ A;  3KNG A;  5KFL A;  4M94 A;  1T02 A;  3ZZP A;  1NEE A;  3GZ7 A;  2P8T A;  4CLZ A;  4B9L A;  5HK4 A;  2CKW A;  5G0R B;  2VPZ B;  4W92 B;  3GFY A;  1NKB A;  4DUZ J;  1S7I A;  2VQF F;  5SUH A;  3M8Z A;  4N8O A;  2ZD1 B;  3SQG A;  2DR6 A;  1KEK A;  4LJZ A;  1HI9 A;  1IKW A;  2AJ4 A;  2FJV A;  3UN2 A;  2MJU A;  4O3S A;  1KFS A;  1RTZ A;  5KT3 A;  1DUR A;  2E1R A;  1R0C B;  2MZR A;  3KHG A;  4B9M A;  1NPR A;  1XMQ F;  2ADB A;  4K2J A;  3AD7 C;  2UUC J;  2NVQ C;  5HVF A;  3G2X A;  2ACY A;  3QID A;  4J9P A;  5A6W A;  2VG7 A;  1ZA1 B;  3OUY B;  2G1H A;  3ADA C;  4K4S A;  2BA9 A;  1VBZ A;  2B4P A;  3CQZ C;  1JLG B;  5A0Y A;  1WAC A;  1H7X A;  4HDG A;  3DRR A;  3C66 A;  3K5P A;  2M9K A;  3Q8P B;  4M5G A;  1FKP A;  4WP8 A;  2JH3 A;  2RKI B;  4IDK A;  3GFX A;  2DEJ A;  1JJ4 A;  2HYI B;  1Q78 A;  1RWP B;  1NB2 A;  1R7I A;  1RI7 A;  1HWJ A;  1K9M T;  3PO2 C;  1BWE A;  3W5X A;  1PC4 A;  3HOV C;  4R5P B;  3OW2 R;  4GKJ F;  5HN0 A;  4FXV A;  1FWK A;  1YJU A;  3PZP A;  4ID5 A;  3Q83 A;  2DYA A;  2VBZ A;  2DIU A;  2HLU A;  2GQQ A;  4JYA J;  1DAR A;  1DTT A;  3OHB A;  2DHS A;  3NBP A;  3WHI A;  4ZN3 A;  3VAF A;  3CE8 A;  2YKN A;  2KXN B;  4ZCK A;  1Q4R A;  3I9Z A;  3THV A;  3H40 A;  2D6F C;  2OEM A;  4AFF A;  1NKE A;  1FEE A;  3IS9 B;  2F4F A;  1USM A;  4B3S F;  3ZZZ A;  1JOE A;  3HXA A;  3W62 A;  3OLB A;  4DDF A;  1WHX A;  4A8Y A;  3RW6 A;  3R7S B;  4CM2 A;  4K5R A;  5CYM A;  3BGO P;  4FYV B;  4P7T A;  3Q86 A;  1U8S A;  4Q43 A;  1VQN S;  1T9U A;  1U0H B;  2J8A A;  4PXC A;  3D67 A;  1Q1K A;  1RAG B;  4DX8 H;  4P52 A;  4KC5 A;  3ZTO A;  1HBM B;  2OPS A;  4IYQ A;  4FS1 A;  4BY1 K;  1WCM K;  5ETS A;  4OI0 A;  3S2D K;  2GZO A;  2F40 A;  2FGC A;  1Q86 T;  4YB6 A;  3I5B A;  4Z7Y A;  5HAN A;  3QWP A;  4USM A;  4ER8 A;  5LMN J;  3QJL A;  1EQ0 A;  5K8N A;  5KFR A;  2I0X A;  1P9Q C;  4RZR A;  2LQ9 A;  2KH9 A;  2CPX A;  1YRT A;  3H98 A;  3FCV A;  3AQO A;  1J6W A;  3OL7 A;  1DLO B;  2DVI A;  4MH8 A;  3S1N K;  5I4M A;  3PRB A;  3RAQ A;  1FDA A;  3IAS 9;  4NLS A;  4KMU A;  3DM2 A;  6FDR A;  4OLO A;  1UFW A;  2EK6 A;  2DXE A;  2NXJ A;  4DV5 F;  3N5F A;  3HI9 A;  4PYA A;  5A6P A;  1XXB A;  3CPW R;  3IAM 9;  3T02 A;  1RCX B;  2FD2 A;  1J27 A;  5I3Q A;  2V2V A;  4EI2 A;  5GAH I;  2FLO A;  1FCA A;  2K2P A;  1W7W A;  4X64 J;  1WG4 A;  3RRK A;  5E5N A;  2GV1 A;  1TFY A;  3QSY B;  1HNZ F;  1N33 J;  2DR9 A;  4LF8 F;  2KZM A;  1APS A;  3GYX B;  1VRQ C;  2UU9 J;  3QZ7 A;  3HOV K;  1JLA A;  3V4I B;  5CH7 B;  2WRM A;  1TMJ A;  2PT0 A;  4E8U A;  1WQF A;  1DCH A;  1IR2 A;  3PNI A;  3CMQ A;  2QLB B; 
#chains in the Genus database with same CATH homology
 2GAG C;  3TFJ A;  3A8I A;  1YX2 A;  1X31 C;  3AD9 C;  1XZP A;  1VLO A;  2GAH C;  3ADA C;  4P9S A;  3A8K A;  3GIR A;  4PAB A;  3TFI A;  1VRQ C;  3A8J A;  4PAA A;  3AD7 C;  5L46 A;  3AD8 C;  1WSV A;  3GSI A;  1PJ5 A;  3TFH A;  3TTG A;  1WOO A;  1XZQ B;  1XZQ A;  1WOP A;  3GEH A;  1V5V A;  1XZP B;  1WSR A;  1PJ7 A;  1WOR A;  1PJ6 A;  3GEI A;  3GEE A;  1WOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...