3AD8C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with pyrrole 2-carboxylate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad8C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad8C01
1PJ6A 3TTGA 3ADAC 1WOSA 3GEIA 1WOOA 1WSRA 1XZPA 1V5VA 2GAHC 3TFIA 3AD7C 3GEHA 1X31C 1WSVA 1YX2A 3GEEA 3A8JA 2GAGC 1WORA 3A8KA 1XZQA 3GSIA 4PAAA 4P9SA 5L46A 1PJ5A 1WOPA 3TFJA 1XZPB 3AD8C 1VRQC 1VLOA 3TFHA 3AD9C 3A8IA 1PJ7A 4PABA 3GIRA 1XZQB
chains in the Genus database with same CATH superfamily
3SCJE 1WELA 3BBCA 3SEOA 3MPDA 3CJ4A 4A3DC 4ZJLA 2GO9A 2M9KA 3VF0B 2FLLA 5DZ7A 4G1QB 3GTMA 4QZVB 1LFPA 2VH7A 3NCRA 3C14B 3M4OC 4R25A 3W63A 3H20A 4MAKA 1YG0A 4D3HA 4EI2A 2LP4A 3LPEA 3GTKK 2JDJA 3CXCR 2MJNA 4F4ZA 1RT3A 3TFJA 5LMUF 2FC8A 2M0GB 1FJGF 2M8DB 3JQKA 4ALZA 5DETA 3FEXB 2KB2A 2ALZA 1ZAXA 4AUKA 4A3GC 1KLNA 2AJ2A 2EXUA 2VJUA 3BH7B 1RTDB 2R7WA 1HBMB 2C2ZB 4GT9A 4CCHA 4OMFG 1XMQF 1T9YA 1RZMA 4KE5A 1FWKA 3V6KA 3MHYA 3J80U 2EEYA 3M8PB 1U2RA 1VBXA 8RUCA 5CXTA 2NYHA 4ZP8A 1HBNB 2FVQA 2A3JA 1R3NA 4W98A 4ITSA 1BD6A 4KIAA 2BE7D 2VUGA 3VAGA 3H2UB 4FXDA 2OSQA 3H7HB 5A8RB 1YBAA 1TMJA 1NK6A 3Q89A 5HROA 4LFCJ 3FSXA 3K5OA 5KFQA 2HYIB 3BF4A 2ZUGA 1LW0B 1HNIA 3MECA 3QJLA 3ONQA 3FZBA 1FE4A 3NGTA 4K5RA 4U7CA 2GQCA 4B02A 2E2JC 4YB6A 4I4BA 2DNRA 3I4MC 2BKPA 2GGPB 4K4TA 4IQXA 4CI0B 3EVMA 2XBPA 2FZCB 2Z8QA 4ES1A 3PTWA 3R7NB 5CZXA 1WC6A 4N8OA 3BP3A 1FWPA 4IYQA 2M4MA 1RISA 1TWAK 4M5JA 4ZLLA 2HWIA 5C44C 3S16C 4LF7F 1YVFA 1VC5A 4GKKF 4X4NA 2RQKA 3ERED 4ANCA 3TFHA 2HBZB 5KFJA 2BBEA 2DPIA 4FYWB 5HANA 2G2YA 2IRYA 2OEJA 2XCQA 4V19X 1O29A 3RU0A 4DV7J 5D0GA 3X1LB 3NAIA 2FUG9 4TVAB 3BJYA 4DS4A 2VG6A 3GIIA 2EG1A 1XERA 2AGPA 2KM8C 1Q78A 2HNZA 3DXBA 4DF4A 3GTKA 1TL3A 3BGOP 3OUYB 1C0TA 2BANB 1M5HA 5G0RA 5J2QA 5IORA 3AD8C 3GTQK 1TQLA 2E2IK 3T5KA 3BB5A 2YXLA 3MCNA 4DR6F 4QYZK 4A3JC 4OJHA 4M1XA 2FJVA 4KAIA 1FTRA 1BDFA 4U8YA 3N9UC 3CIZA 5MAOA 5KG2A 4LR2A 2G0IA 4CT9A 1WF2A 4PWWA 3C16B 4FNIA 4DR4F 4C0BA 4A3KK 3AHPA 3MZIA 2F5GA 3SIPB 1TWGK 3BKTA 4DL2A 2SXLA 2MQMA 5MLCV 2CPHA 5J1PA 5DM7Q 4DDFA 1FWLA 3EDRB 1HBUB 2AZ1A 3N0CA 2ERRA 2ZKUA 4KBIA 2BVZA 4AL7A 3BR8A 1F60B 2RS2A 3EZUA 2VU5A 4G1PA 4WE1B 2E5GA 1IKYB 3FOEA 5F41A 5CQGA 3GTYX 1R27B 3V81A 2EWHA 3HSZA 3DLKB 3S1TA 1EH1A 1XMOJ 3D3BJ 4R5PA 3HOUK 3LP0A 4ZVEA 1ZM2A 1TWAA 5KFLA 3RZOK 3V4GA 1WC0A 4OIXA 5IYCC 3BQ0A 4ZPTR 2DGVA 4TU7A 2OD4A 4C3IK 4B3MJ 2PPBA 2ASDA 1RU2A 2VOPA 1RTIA 4JI2F 4M5DB 4KB7A 3RB3A 3OL9A 1UVLA 5KFRA 3HULA 3MMCA 3QGHA 2MJUA 3OTDA 3W5YA 2Q43A 1RHRB 3ILJA 3TUJC 4WXWA 1PYSB 2GJFA 4A3BK 4TY8B 3UD4P 2E5IA 1MROB 1IBCB 2NREA 2F63A 3GTQA 2M8HA 1G7CB 3HHLB 2CQ0A 3PVXA 4CLYA 2RRAA 2CG4A 5AE2A 1RT4B 2MQPA 1HFEL 3LPYA 1HHQA 2DNPA 2V8GA 5EGHA 3KK3B 3S2HK 5M3MK 4EBEA 4CLFA 2E1PA 1XMQJ 1FKOA 3JSBA 2M88A 3W2VA 1BY9A 4GKJJ 2R7XA 3PACA 2FHOB 3QO9B 1TWGA 4YDXA 3UD3P 1NAQA 2W7AA 3AODA 1YHQS 5C5JA 3DGPB 1FERA 3GP9A 1XNRJ 1B4BA 4GRSA 3OT9A 5FIIA 3UCGA 1CJKB 5A2QY 1Q8LA 2UZAA 3S17K 1PGZA 3BYRA 3OR1A 4LF4J 2BACA 3BS9A 1J27A 1FRJA 2MLZA 2GMLA 2FTRA 1IJFB 4LLGA 5H1SV 4ZH4A 3N6NA 1WI8A 1VRUA 2BOAA 4F8RA 4XPEA 3K5MA 5KFBA 5L38A 4AL6A 2XTJP 1NB7A 3OTOJ 2VFUA 2POKA 2UXCJ 3CQZC 4DV6J 2V34A 1E6YA 3AD9C 2W7OA 2DD8S 4DUZF 4M1KA 1QD1A 4FYVB 5KFCA 3H3VD 1O51A 3FQLA 3PEHA 1I50K 3MMLB 1SB6A 2IM1A 3ILOA 2X1GA 5CHCB 5D4DA 1AFIA 3IG1B 4DFPA 3SBMA 1ZBSA 4A3FK 4MYTA 4LSNB 4KGXB 3H5YA 4CLZA 1N5SA 2DK2A 1KOHA 1U0HA 1NSPA 4CH0S 1XMBA 3MCSA 2H3EB 2FY8A 2M2BA 4URSA 2RDIA 4CRJA 3W9IA 2HIQA 2DITA 3TI0A 2HHHJ 2W1BA 2AJFE 1HL6A 4WF9Q 2W4CA 4LSZB 4DSEA 4P7VA 4ECSA 3HOWK 1N8RT 1NSAA 2YKOA 2DVIA 3VVUA 2P2CB 3CDUA 1Y7PA 3HVTA 3D0HE 1QAIA 3GQCA 3UFCX 4WKYA 2F8HA 2V0NA 1RYSA 4ED8A 3UDLA 2I2YA 3M2VB 5HN0A 2FLPA 1N54B 4QIVA 1FVQA 3H0GK 1TUGB 4ZLPA 2PA8D 2ILYA 1U6ZA 5T7LB 2R8HA 2RMLA 3SV3A 3PJXA 1OY9A 5J2NB 2HFSA 4KV8A 1WOSA 1EQ0A 4DV1J 4FN5A 2DH9A 2DISA 3QRPA 4ZLJA 4DMZA 2GAGC 4P9SA 2ZZTA 3NUHA 4M5NA 1KNZA 4ICLB 1SKUB 3SYZA 5KFPA 1NK4A 2G0CA 3HJVA 4NOHA 4YR0A 1HPZB 1CVJA 3TOQA 2VASA 1R0CB 1WCMK 4JI3F 1HWIA 3BSCA 1N33J 4RU9A 3FEZA 3ICLA 2I0XA 4GVBB 4L73A 3MFHA 1VRTA 1JQWA 3V4IA 2FDNA 2LDIA 2BM1A 5E3QA 1K0VA 3UW1A 3I5CA 1SL2A 5IP7K 1RP5A 4NYPA 1KD1T 3T01A 3W8PA 3X3UA 2Z2MA 3W64A 2JA6A 4ZVSB 2ASYA 3MFIA 2YQ3A 4C6AA 2DGOA 2NR0A 2QX0A 2Q79A 4HT5A 3U1LA 2H4YB 1FDBA 2JEFA 3K58A 3MR6A 1HR0J 3HXAA 3U7JA 1OY8A 1FK9A 2OPPB 1SIWB 3I87A 2WAQL 1PAEX 3L09A 1X0FA 4QR2A 2W9BA 4JI2J 1SJ3P 3S8SA 4UOGA 4AL5A 5GAEI 3FFIA 3M6UA 2DGTA 5A8KA 4UF4A 4OI4A 3DXSX 4K2JA 4OIPA 1TVRB 1SFOK 2E5LF 1WKJA 3WX4A 1QUVA 4IR1A 4PXCA 2VL1A 1XZPB 2XHWA 2HHQA 2I8EA 3H42A 3CCES 1KLMB 2QZ8A 2C28A 4MK7A 4ZITA 3LGNA 5HP1B 1UAWA 4KR0B 5F3TA 4RBUA 3CULA 4I69A 3HXMA 1S6UA 2HNDA 1REVB 5CH7B 1S1VB 2YU9C 3KJQB 4C9DA 5HATA 3C6TB 3H0GA 1LK5A 4KHRA 2XM3A 5DLGA 3C6UB 4MTPA 2CXEA 3LGHA 3MEEA 5A6PA 1VH2A 5E68A 3LA0A 2HQDA 2Z30B 1NHKL 3FOFA 2GV1A 3N4WA 3K5LA 2AF6A 3ISND 4A3LC 3FRZA 2RH6A 1JJCB 5IOLA 2IM2A 3CDAA 2YH1A 4DF8A 1FRMA 4WU3A 4Y52C 3PY8A 3HOZK 4OYIA 1RWPB 3OL6A 1WCMA 2PMZL 1WSRA 2XCRB 1NNDA 4A3IC 1GE9A 2YX4A 3IM9A 3Q8VA 1AT1B 5B0CA 1NZAA 2EKNA 4PQUA 4RKUC 4ZVOB 5LXRA 3JYTB 5ITHA 1P1TA 4P2FA 5HK4A 4UUWA 3IS9B 3GTGK 4FS2A 3IRXA 2KO1A 4OZ3A 1TL7A 3PO4A 3P6YC 2R92C 2YNHA 1KKHA 3GTJK 1JLGA 2FJWA 1TL1B 1QTNB 5L46A 2VOOA 3DM2B 2AU0A 1WQGA 2J9DE 3TA2A 4WFNQ 2PDAA 2F65A 5ETVA 2IJFA 3LP1B 2YWFA 3M8ZA 3IWNC 4C8ZA 2CQBA 3NS6A 4BXXC 4CH1A 2ZNZA 2F3JA 4DV3J 1RWNB 2EKYA 1GH8A 1S77D 1WG4A 4ERDA 4DR7F 1S7HA 3OSPA 4O2DA 1SFOA 2HHTA 1VMBA 1RWMB 3VCDA 1VIXA 2Y0SD 2GZOA 1EIYB 3EQLA 2HQGA 1TWCC 2GIQA 3UE2A 4CLTA 3U27A 4PQAA 1F6TA 3OXFA 2NPFA 1NXIA 4F25A 2QMXA 1GMWA 3A4TA 2M5YA 2L41A 1S6QB 4ANDA 1SJRA 1QTMA 4UQTA 1SJ1A 4L3KA 3IFEA 5B7WA 1P9QC 4O3NA 2BX6A 2DO4A 4G0WA 2KXFA 1C1BA 2CJBA 4Z7YA 3T02A 5M5XK 5IYDC 5F9NA 2QIFA 1FDAA 1RT2A 5A0YA 2P9CA 3R1HA 1FD2A 2Q3PA 2B56A 1UL3A 2W9CA 1IWAA 1ZA1B 2XYPB 2DH7A 2CQPA 4HVZA 1M0SA 3CTRA 2D74B 1WOOA 5K8PA 2YX7A 3P3DA 5CD4A 2M70A 2AP6A 1VQ6S 1SQEA 2E1RA 4DV0F 4DR5F 3L7OA 1S76D 5HVGA 1EETB 1SC1B 3CCLS 5E2QA 5C4JK 1UVIA 5KFHA 1AB8A 2JOQA 3MECB 3QMQA 2WZ1A 4YB1P 2I5JA 1KQKA 2XWYA 4K4YA 1KONA 3HSJA 4NLGA 1B70B 4JI8J 3M8YA 1Y00A 2IDEA 5C42A 4Q43A 3TEHB 2JC1A 2XS7A 1ZTWA 3OTBA 1AZSB 2ZDPA 1TWFK 1JLEB 4J9UE 1SKRA 1TK8A 1Y10A 2MPUA 4DR1F 4ZIWA 2OHDA 4Q2MA 2D3UA 3C3LA 1ZPVA 4E0DA 3MEDB 3EX7B 3CVKA 2NVQC 3QAUA 4ETZA 3KJFB 5DG9A 3CJTA 4FBUA 4XPCA 2GVZA 3P96A 1LEOA 2FD2A 3I4NC 3MAHA 3DRRB 8ATCB 4LRDA 2RUGA 5HLFA 2EPIA 5IM0B 1N34F 1UWBA 3AFGA 5B09A 2NVXK 4DR2J 1XNQJ 4PAAA 4BS2A 3EM1A 4RNMA 4CH7A 3EGWB 4CNZA 3TQEA 1X9WA 2DY1A 1Q53A 4Y2AA 4OV1A 4NLVA 4P2XA 1C0TB 3HOXC 2FLNA 3TAMA 2EK6A 2JH3A 4KKOB 4F4YA 4Y2KA 1X4EA 2HK2A 3A8EA 2LLZA 3T6BA 3P5BP 2UU9J 2D1CA 4C8YA 2AQ4A 2DNQA 5EWGA 5B0BA 3GG1A 4Y2CA 2XMVA 3TVZA 2DGQA 4OI2A 3ET6B 4DSIA 1JIHA 3NGDA 3T41A 2R9LA 2HQ3A 3K59A 3BSOA 2FZGB 2R2TA 2ACYA 1L3KA 3FSIA 1B3TA 2A6HA 3I96A 4OHXA 4H4KA 1J6VA 2CVEA 3S1RK 2CADA 3OFFA 3H40A 2VDHA 1I3QK 3JTNA 3BBFA 3UN5A 2Z58B 3FHZA 1Y9OA 1TV6B 1YZ6A 2MGZA 4FYXB 4OJ3A 3PO2C 3A12A 2ZH6A 2CQ4A 4O44B 3GILA 2DEJA 2N7YA 3LO3A 4ANEA 1ULRA 2HWTA 3V81B 3GR0A 2RDDA 3BGUA 5KT5A 5HQ8A 2HHPA 1KN6A 1RAEB 1H7WA 1S6PA 1TWFA 1KQGB 4X4OA 3DOKA 4LF9F 2DXFA 1GXTA 1HMVB 2XQCA 3KMQA 3AJDA 3DRSA 2DNGA 3CMAS 4Q5SA 5KTQA 4L75A 2IFXA 3MCOA 4M5IA 1HI0P 2LU2A 1NH8A 3GE9A 1WDTA 4GZYA 3I31A 1KC8T 5TJ3A 3MEGA 2KFZA 4TU9A 4RUCA 1OY6A 1RWUA 1SKSA 4X66J 3MMCB 1O2FB 2NVXA 3EZ5A 5D78A 4PWDA 2WOMB 1FDNA 3FC9A 1T94A 2B9YA 4BC9A 3Q3QA 3RGIA 4OLPA 4QIFA 4UZBA 3M9NB 1UTAA 4I2QA 1X9MA 3D68A 2HBQB 1XZQB 2UXBJ 3C19A 3IBWA 4WFYA 3GTOC 4MFBA 3HCXA 3KLGA 2ZOFA 1RU0A 3MR7A 3FNNA 1VQSA 2BE2B 3CJKB 4K0KJ 2MZSA 4R0EA 3BP8C 4L3NA 4MYUA 4H4MA 4NEZA 3KK2A 3GCWP 4O3QA 4F4XA 5L9NA 1KDNA 2GQ2A 3DLGA 2JVOA 3GCXP 2NZ4A 1WWHA 1B4AA 1YK9A 2B43A 3W2VB 2IYGA 4OHWA 4WBFA 3KLFB 4B3OB 2XMAA 4ZPBA 2CNOB 4OX9J 1QDUB 1UP1A 3ZZPA 4A8FA 1I3QA 4NYOA 3G6XA 4K4WA 4MH8A 2QFJA 2O5JA 2XB2D 2H5EA 3OR1B 2XNQA 2JFDA 5F8NA 3FKIC 2FQOA 1ZAVA 5J2PA 4NXNF 2KFNA 5FLMK 1H2TZ 2MKSA 2Z2LA 3UNGC 4OYMA 3RJMB 2N4CA 1YJ7A 3WZ0A 2D3ZA 4HTIA 2U1AA 2A68A 1RJJA 5EUHA 4PYDA 3OEPA 2KYXA 4F7VA 2B63A 3BR9A 2PA3A 3D1HA 1JMTA 2L3MA 3RYLA 1C1CB 1YJVA 1YDLA 4O4RA 4OL8A 3TZZA 2H5JB 4B9LA 3Q8PB 3NG8A 3SDEA 4KB2A 2IAJA 2R7ZC 2N3LA 2XYGB 5HJXA 1NKBA 4KN7A 1IQ0A 1UFKA 3FSYA 1HNXF 3BDEA 1T9XA 1IKXA 1RT5B 1FCAA 2O5IA 4KM8A 3JS9A 4OFZA 2Q6BA 4ZP9A 3VZHA 2E2HA 3OTCA 3VQSA 2XWXA 4GTBA 5HQLA 4YHHJ 1YQHA 4QIWL 2OFGX 2LQ8A 1JWWA 1HQMA 4OI3A 4PXEA 3AB4B 4OYOA 2VONA 1H2UX 3LP2B 4C3HC 1UFLA 2K3KA 4EWTA 4DI6A 3R27A 4X62F 3BYPA 2HVZA 1NJYA 2RIJA 2DRDA 4X6AC 3KJVA 3G96A 3ZC4A 2L9WA 3QX3A 1U02A 2HFOA 2O67A 3GONA 4NZ6A 1GXLA 1R43A 4KHPJ 3JQMA 2KRRA 4DFJA 4X4RA 5K5MA 1KQ4A 2BJ7A 3VGUA 2QN6B 5I42B 2IRUA 2MSTA 1F5BA 2XSFA 3CCVS 3G4SS 1WQFA 5I3PA 3CB4A 1IVZA 4NLRA 2VIHA 2N3OA 3OLAA 1R0AA 1YRTA 2E2JK 5AXNA 4DQIA 2DKOB 5CAAA 2AIRB 4ZHRA 3QNWB 1ZM3A 1ZM4A 3EGVA 3HD2A 3Q83A 4KGVB 1VRTB 3AH6A 2F1FA 4DDQA 1TKTA 1P6TA 5FDLB 3PO3K 4U95A 2YWGA 3TJ8A 3R5AA 3C2PA 5C44K 2PEBA 2LQJA 2VPZB 3ZFVA 1TKDA 3OPKA 5GAGU 4JI6F 1MWYA 1FK9B 3EXCX 5KFYA 1CQMA 5KT7A 3D66A 4JV2A 4NLUA 2IPOB 1ZQ1C 2DNOA 5E3RA 3TVYA 2ZOMA 4JP8A 1FHTA 4X64J 2ZD1B 3GFHA 3WDOA 1FNMA 1QAJA 3DLEA 1TAUA 5A8KB 1ZM9A 2E1MC 3E01A 2HVIA 3G8QA 3IMQJ 3M32B 1FX4A 3ELHA 4CM0A 2AD9A 1ZVUA 2P8TA 4ZMMA 1U2FA 3KFWX 4ZOSA 5A8WA 1RTHA 2YWKA 3BEGB 2YQ1A 4J37A 4BBRC 2FHKA 1EARA 2X1BA 1YJTA 2CJ9A 1R8BA 4C11B 9RUBA 2DRAA 2OTLS 3DMJA 2A6OA 4PG4A 4N7TA 4JI5J 2HNDB 4LSLB 1UV7A 1TP7A 4M5GA 2WW8A 2LMIA 2Y1JA 4RPFA 2OPRA 3HKWA 3BO3A 2C2EA 3CDWA 3OR2A 5K8MA 2Z0GA 2MQOA 1C0UA 4OZJA 1YJ9S 3LAPA 1TZ0A 4W4MA 1FXRA 2H9ZA 4YY3F 2IBOA 3N0VA 3GYGA 3PX4A 4C8MA 4FPRA 4JV0A 2MSSA 3HP6A 4J9NA 4QR1A 1UJ5A 4PWUA 4O23A 4YQWA 1OWXA 1DTTA 2RS8A 2YQ0A 3D54A 1U1OA 4NRUA 1RB0A 2X3DA 4RW4B 1NDCA 3KLEA 1S48A 3AOCA 2VBXA 2XMMA 2W2NP 1U25A 1FKAF 1RCOB 3HLUA 2D9OA 2CFAB 2YNHB 3MAAA 1IKVA 5LJ3Y 1SMYA 5IYCK 1G2EA 4ECTA 2DH8A 4CT8A 3D1QA 1EZZB 4Q8FA 1TWHC 2ZHAA 3M2RA 4DL0C 4OZ2A 5KFMA 3OVSA 4F4AA 2JLFA 2AYEA 1RHQB 2Q66A 2H48B 3HHLD 3ZZOA 4PABA 2G13A 5KT4A 2FVPA 1HNVB 2ZBCA 2E29A 1HNXJ 4G3IA 2B6AA 1FXLA 1MNEA 1IBKF 2J5AA 3BREA 2RQCA 2XS5A 4NL5A 5GMKa 4RW7A 4YG2A 3S14K 4NZ7A 1CS4B 2WB4A 2Y0BB 2JJ4D 5J1EB 2CJAA 3E51A 2C3YA 4QPXA 1N4LA 2B4OA 3H5UA 1FF2A 4USJC 1U4BA 1D9FA 2DNNA 1AUSL 2OD6A 2ATCB 1IM6A 2RJZA 3QT8A 3KLVA 3IN5A 3MEKA 1SJQA 4X62J 3C8YA 4KMDA 1EP4B 2CPXA 2ZFHA 1Y11A 3OHAA 5LOQA 1VJEA 4E2FB 4CYUB 3OFHA 3DYAA 2ZH4A 4HTJA 2BJEA 1XBWA 1RAFB 2XLJA 5K9FA 4ZP7A 2E7XA 2O01C 3W65A 3DOMA 4OQJA 4J9PA 4ED0A 2HK3A 5CYQA 2Y8WA 4XDDA 4UTGA 1GNKA 3A3OB 1RT2B 3PIOQ 1SUQB 4H54A 1Q8IA 4Q8EA 2V2QA 2V8DA 3GSIA 4ZP6A 3MMJA 2H65B 2AJ0A 3HSGA 4XO0A 1NH7A 1SCJB 2BKNA 1WDDA 3OQ2A 3M1VA 3ENQA 3CQZK 1JOEA 1FKPA 5D4NA 1BWEA 4OJ1A 1IN0A 4NCGA 1NBEB 3DGVA 5IOQA 3PFEA 2I5JB 1S49A 4WZMA 3NS5A 1NKCA 4KTQA 4LRCA 5IC4B 2UP1A 3HVAA 2K1RA 2M7SA 3NAHA 1NJWA 3PJWA 3LWLA 4F04B 4LF8J 2ZZMA 2OLWA 1YNNA 2JNJA 1VK3A 3CNQP 1UZDA 1DFDA 1MLAA 2LYVA 4CTAB 1NHVA 2EFGA 2XMKA 2WONB 4DL5A 4WYWA 5C7PA 3K7RA 2HAFA 1NMEB 1UKUA 2YKMB 4KGZB 1TK0A 2XMTA 5FLXY 1DCPA 4WIIA 1RAGB 1G51A 1L3VA 1WIHA 5B0DA 1I1GA 3MM6B 1R8PA 3D9BA 2EW9A 2BA9A 2X51A 3M2UB 3KK1B 1D3WA 5F0WA 2FHMA 2RGRA 3H2VE 2YNFB 1T03A 2NSBA 3ITHA 4Q4ZA 1M5OC 4JI0F 2RRBA 2P6TA 3IP0A 3R8YA 1LV5A 1GK8A 2ZEJA 5LMNJ 3DHXA 3I82A 4FS1A 1RI7A 1K0TA 1W7WA 4TU8A 5L1IA 5J2MB 1H2VZ 4CLLA 1X5SA 1WHVA 1JJHA 2JFKA 3EVWA 3UR0A 2DHXA 2BW7A 1AB4A 1NB2A 3O1LA 1HBOB 4FYYB 1FO1A 3NBPB 1NHUA 1D9AA 1KFSA 2PIIA 5FJ8K 5E41A 4RWWA 2LXIA 1IBAA 5ADZA 4DCJB 2RILA 4ED2A 1RTJB 4I68A 1LWCB 2PMWA 3CQZA 3PYGA 4JI1J 5CZVA 5U47A 1YCLA 5IYBK 3T1HF 1JLFB 3V6HA 2W4DA 1FJ7A 2QO3A 2BOPA 4ETXA 5RUBA 2A69A 2J0WA 4R8UA 1JB0C 3MAQA 5D0RA 3TP2A 1S6PB 2YWWA 5ETMA 4LFAF 2UVWA 1OQ6A 3PDNA 4N5SA 3NMAA 1B0PA 2A1BA 4X65F 1DLOA 4EZ9A 1PKUA 2JL9A 4QWBA 2ROGA 4DWIA 3G2XA 4IH6A 2P5VA 2CJXB 1SBRA 1OJ4A 4IG3B 1C0AA 2YKAA 4I6AA 4QPTA 3PKYA 2V4QA 2DR5A 3S1NC 4Y7NC 4BLAA 2A2DA 4FM9A 2HS3A 1N48A 4C8LA 2QV6A 2LQBA 2B8QA 2PGCA 4USTA 5GAEU 3UVJA 2HNYA 3GJSB 4QU7A 4ILRA 1RT6B 2LFVA 4OZ5A 5F9LA 2KG0A 1WEXA 1DQ9A 4I2QB 3O2IA 4Q0BB 3KLGB 3HOYK 4ILLA 4A3LK 1R9TK 3PCOB 1ELOA 1QE1A 4NLWA 1UEKA 4H4MB 4Y52K 1UA1A 3ZZRA 3EE3A 1HD1A 3SMZA 2VV5A 1WEYA 3DLGB 2HPUA 4J3NA 1FRKA 1WC3A 2QT7A 5T41A 1ICEB 1NU4A 2UUCJ 3CCQS 3MM8A 3WIVA 4A3IK 1K83K 3RAQA 2C3MA 2HGLA 2DGSA 3PYEA 2ZHBA 3OJSA 3H3VL 5IWAF 4Y28C 4I7FB 5E0OA 3SCLE 5IV3A 4IG0B 4DN0A 1S1UA 2KVIA 3RR8A 5DS7A 5DQGA 2X1FA 2VG5B 4IQMA 3BQ2A 1IE0A 5AJ3F 2QLWA 2K2PA 4CLPA 3M6VA 3MI7X 4NLXA 2DIUA 2FVSA 2BJ8A 2R3VA 3HT3A 2C2OB 2V68A 1IKWA 3S01A 2ROPA 2OI2A 3G87A 2CZ4A 2FIUA 2QGFB 1X0PA 1CULB 3MM9B 4IH7A 1N6QB 1V9OA 2AEMA 1YJRA 3T1YF 2HMIA 3DCAA 2F9JA 3DNCA 2UXDF 5M5YK 4FP9A 5I3QA 2G1HA 2OSRA 2X1AA 3SDEB 1N5VA 1TWCK 2RRNA 2Y3PA 4DX7A 2IAJB 1VJQA 3UPFA 3GU0A 2W8LA 4LOWA 1WKKA 2YNGA 4Y3CA 2KHDA 4DV5F 4HH1A 2PA8L 1B99A 3UR3C 3KOAA 2QA4S 4JV1A 4DSJA 4P5BA 3PJ9A 2PD1A 2OAUA 4OI0A 2P9EA 3EGZA 1JKHA 1SIZA 4ZLNA 1JJ4A 2YU9A 3SQGA 4C4WA 3WX8A 2FZKB 2JX2A 3LALA 3HHNB 4LBHA 2R2UA 2R93K 4ID8A 2ZH1A 3DRXA 4EEYA 1HYSB 3TUPA 2RKIA 4EFAC 4K59A 3BSNA 3C46A 1F3FA 4DU8A 2NZCA 4GC6A 4QBUA 4UOCA 2W2OP 4F3OA 2NUUG 3PIPQ 4RJVA 4H4OA 2QA2A 1TKXA 3DRPA 2UUWA 3GZ7A 3TJAA 1MN7A 4AQYJ 3K2YA 2HFNA 1TFYA 1NSQA 1TMMA 4MKVA 5JVOA 1F9NA 4C3KA 2CRLA 3GJQB 2NSCA 3AJ1A 4LFBJ 4HDGA 4O4GB 2QA1A 1HHTP 2CYYA 4ELUA 1S0NA 1JVIA 5CCMA 3KHGA 2R92A 1S1TB 3DHWC 4ECVA 4B9TA 2QSFA 5D6GA 2R8JA 4FDFA 2G2OA 2UUAJ 5C3EC 5I4MA 4IFYB 3TVKA 3MM5B 3TAQA 3G86A 2K7KA 2QYGA 4ZHRB 4KMHA 2OPQA 2HRTA 1HQEA 3Q86A 2VKZG 3PEJA 4EMDA 5A6WA 4J9OA 4ZVTB 1Q95G 4U96A 4LFAJ 3KUEA 5IQ6A 2CPJA 4RO0A 4LFCF 1SQFA 1PIEA 2Y8YA 3JSRA 2R7QA 3B8HA 3E2EA 2ZH2A 3J7YI 1BQMA 4B9MA 2HSEB 4DOZA 4QW8A 2V8HA 5I3UA 5M2RA 3I4NK 4J5OA 1TWCA 2CNLB 5ETNA 1AXQA 2YKNB 4CO1A 1REGX 2F40A 3LOUA 3R97A 3RTVA 1U49A 4NI2B 1U6BA 4KATA 3LF0A 5KFVA 3BN7A 3W61A 4LR8A 1VCTA 1RKJA 1O5JA 3ZNJ1 2ZJPQ 3TX8A 1OPIA 1XJWB 5THWA 1S1XB 2DGWA 4OI6A 3VAFA 3FBFA 1X31C 4IDKA 1DZ5A 3QJJA 1WF0A 4HR2A 3GEEA 4DV7F 1WQHA 1WORA 2R4FA 1RT1A 2CPEA 3FBBA 2HFVA 4QJVA 2ZFZA 2ZH8A 2PI5A 4HT7A 3H4BA 3QT7A 4EO8A 1TK5A 3VGTA 4TNOA 1R8HA 1OPZA 2E5HA 4Z7CA 3ZZTA 2B8PA 3LW5C 1U1QA 4WFZA 4CO3A 5SUHA 1L3TA 4HH0A 1Q82T 4LRFA 5HL8A 2E2IC 2CNNB 3KWMA 1IW7A 5IP9K 3VAMA 1ZOTA 3PO2K 4A8MP 3HSDA 4L6V3 4NRTA 4ZPVR 1SC3B 1U26A 3V6DA 1K8AT 3GLJA 4Z2XA 3BPSP 3AD7C 2B7CB 1MU2A 1C4CA 3PW5A 1U1RA 2Y0SL 3R1LA 2QLBB 3QWPA 3KHLA 2QG9B 3QLHA 1DD5A 1EAYC 2CQIA 1NPPA 3KG4A 1ZYRA 4UOFA 1APSA 3CD7A 4ECWA 2UXDJ 8AT1B 1CJUA 2BJ1A 2MZTA 3BV8A 4DUTA 1DCHA 1PYOB 3AXKA 1F7UA 1XMOF 4RLEA 4DV5J 3GDZA 4RU2A 1VDHA 2KM8B 2B6AB 3BO4A 2VDIA 4RW7B 4ID5B 3IGVA 3SCKE 3TUIC 3QZ7A 2R7RA 4B3MF 3GTOK 2W2QP 4NA3A 2Q1LA 2GIFA 1LWFB 3WIUA 1FI4A 4MKAA 2XEXA 2M3DA 2V2KA 4WJ4A 5JXSA 1XR7A 2OGUA 1VYAA 3KG1A 4X4TA 2XGPA 5H9FK 4Y00A 1XIQA 2QYCA 5T14A 3MR5A 2XO6A 1S1WA 2FJEB 1PSDA 5HL7Q 4A3BC 1U45A 1Y3JA 3U02A 1YNJA 3KXDA 3RZDC 4DCOB 5KG1A 4OI1A 1WJ9A 3DU6A 3DOMB 3MMAA 1YIJS 3HOVC 2C1EB 4ZN3A 3GTLC 2XMUA 2VKRA 6FD1A 3GFXA 5ETTA 5LM7E 1SV5A 2ILZA 4YP3A 3H4DA 1Q5VA 2UV8G 4OX7A 3Q2TC 3W8GA 4JI7J 4XK8C 6FDRA 4GKJF 3MTKA 3Q24A 3CGIA 1X9SA 4BBSC 4JI4J 2V5HG 3K8WA 4ECYA 2Q6CA 1XNRF 4LF2A 1S9GB 3QGIA 1IS1A 3QWUA 3AOAA 1H74A 1UEUA 3D3CJ 5M3FK 1VHIA 4LF4F 3CSKA 1BMQB 3LTOA 1GFWB 3IXQA 1RT7B 5GAGI 4K5SA 1HQ2A 4ZVRB 2JC0A 2R7ZK 1PC5A 2IA0A 2R42A 1PJ7A 3F56A 1B0TA 4F50A 3POTB 1ISEA 4YB7A 2G9OA 2UVUA 3H5XA 3OTOF 5C24B 2UXCF 4KMAA 3KYLA 1FTCA 1W2BR 4DV6F 2BR0A 3SV4A 3N3YA 4GTAA 3G82A 1C4AA 5D8HB 2R7VA 1F2GA 3QYYA 4XLNA 2V50A 3HZEA 4LREA 3QIPB 3GTOA 4TYAA 5B0FA 1SC4B 2HEKA 1NDLA 4C3HK 2CQGA 4MEYA 4NZ0A 1I50C 2E7VA 1FJEB 1VC0A 1HLWA 2IJRA 4G1QA 1Y5IB 4BLGA 3RRGA 3UCUP 1Z2ZA 3C14A 2VA2A 2GFFA 5KG0A 3J81Y 2MZJA 1RWOB 4IOAQ 4ZN1A 3UO0A 4X6AK 4PCQA 2VQEJ 3GFYA 2XMWA 4PG5A 1VIOA 5LXYA 5GMEA 2R8GA 3I0SA 5KOXA 3NXZA 4NCAA 3T9ZA 2VB6A 4I67A 4OZNA 2HHHF 2I38A 5K20B 1R7IA 4NLPA 1TKZB 2GSNA 3M8WA 3M3YK 1VOMA 3SXLA 2J8AA 1RTDA 4CO2A 3HOWC 3VV2B 2ZH5A 3IR6B 3FKIA 2L9DA 1RGVA 2W7PA 3GMGA 2HBRB 3CC7S 3M8PA 1SPBP 1VR6A 3BGRA 2MKIA 5D77A 2KDOA 7FDRA 3R2CJ 4DPOA 4DV1F 1I51B 3V5RA 1NJIT 5A8RA 4JOUA 3H98A 1F93A 4J9KA 1EKRA 3RB6A 1SQGA 1WKLA 4A8QA 3MGJA 1LW0A 2IJNA 2M52A 3CMES 3BKFA 2GA7A 1RKIA 5AT1B 3PRDA 4LIRA 1T05B 2R7ZA 3D0IE 1N33F 3MM7B 1BS2A 4U6PA 3DU5A 3CJQA 5HBMB 2GGPA 3D0GE 4BDPA 1D0EA 2CZ9A 1JLBB 1QVGR 4G7ZA 5JFEA 3R5CA 5IP7C 3G4AA 3EPIA 1SKWA 2ATLA 3M8SA 2GS8A 1UJ6A 4L72B 1NCLA 3DKDA 3W60A 2WHOA 4BBRK 1HR0F 4DFMA 2OFHX 5IT4A 1ZZNA 1NJXA 2E1AA 2EK1A 1S97A 1HWJA 4L74A 4WK1A 3DC2A 2JA8C 1TUWA 4DUYJ 2VG7B 1VQNS 3FUYA 3NEKA 2P9GA 3SZYA 3BN4A 3HT0A 4I1TA 1Q81T 2ZBQA 1QAYA 1DTQB 3PR4A 4EZ6A 1P27B 3IRWP 2XY6A 5DG7A 2QSWA 1YKWA 1VISA 1ITPA 4NX9A 4KDDA 4HHJA 4LUBA 3OUYA 4AXIA 4LT6A 2ROEA 5KFXA 2BANA 3G9CA 3JXOA 3MUTP 3PM9A 4UY85 4PUOA 2OO4A 2U2FA 2X7IA 1WC5A 5LT5A 2DR9A 3GV5B 1AW0A 4HACB 4EBCA 1CC7A 3MUVP 3EMTA 3NS7B 4A3EC 1TU0B 2AGOA 3UD5A 2J7KA 2CWXA 4URQU 1KVIA 2LA4A 4G6VB 2MKKA 1HWLA 1S4FA 1FEHA 4TYBA 3MXHP 3S2DC 1BQNB 2AEFA 3BO2A 4U9RA 4TY9A 7FD1A 3BM7A 1QAXA 4OYWA 3GG0A 3I32A 1IQZA 1S1UB 5DM6Q 4MIBA 1HBUA 5BJRA 1BJTA 5ETPA 1F9HA 1O26A 3JSTA 4WE1A 1GQEA 1G3OA 5KFDA 1TWHK 1IKYA 2XHCA 1X8DA 1B0VA 1PO6A 2BEFA 3HOZC 1A9NB 4NOIA 5KFSA 3M6XA 2VZ9A 1XR5A 3KG0A 4GTFA 1OYEA 2FYXA 4BY7C 3PV8A 4KYZA 2N7CA 4WCEQ 3SQOP 4TQRA 1GMWD 2JA6K 4RR5A 3EGNA 3CC2S 4FXWA 3G6VA 2VBWA 3GTGC 4WFXA 2LXFA 2OPSA 3GTJC 3J7A1 2E9RX 5D3GB 5C25A 1X5OA 2DY9A 2RF2B 1L3SA 1N0UA 1XK8A 2WCXA 2IC3B 1XC9A 4A93C 2AW0A 5E7OB 2ZM6J 4QWCA 3HFVA 3MMBA 4M5DA 1H38A 3D1OA 3QGGA 2JWNA 2QRRA 2LCWA 2EFNA 1Q8KA 4DV3F 1JXVA 2Z2ZA 3D5MA 2V4RA 2GVDB 3T6JA 5CA5A 3TFIA 4PYAA 3DOLB 3H25A 2O5DA 5E3AA 5JJBA 3CJ5A 1VQOS 3MCMA 2AJQA 2ADBA 1BUXA 3N0BA 2A2CA 2GJIA 4DSKA 1VQ8S 3IC1A 4TLQA 3W7BA 3E3XA 2KU7A 2QFIA 1RT4A 1YJNS 2PEHA 2XY5A 2LECA 3M30B 2DT9A 3FMBA 3DRPB 4F0MA 4X4PA 3NCQA 3S1QC 1LWEB 4DX6A 3TA1A 4IH5A 3HF5A 2XGQA 1YBUA 2W4PA 1FD8A 4WFBQ 4C3JK 1IXKA 1IR1A 1AUDA 2RUSA 3HDSA 4RW8B 4YN3B 2L48A 2V8VA 2IBKA 4KGKA 3DGPA 3CO0P 2CJKA 1KWMA 3TWZA 1H73A 5BYRA 2YY3A 3KUGA 1CJKA 5KT3A 1U48A 3I9V9 1JLQA 1UFWA 4Y65A 1TWHA 1V3RA 4RX6A 3H59A 3Q8UA 2XG8A 1J5OB 2C3OA 1BXNA 3KUHA 2OPQB 4BY1K 3W1YC 1WNEA 2MZQA 3TZYA 1VLYA 4ZDNA 1HQUA 3ENVA 3VR1A 4J9SA 3PKMA 4IKAA 3ZNUA 5KFZA 1SJ4P 1YSJA 1K44A 2DB1A 3A3NB 1RAAB 3LANA 1R31A 2ACMA 4LR9A 1JX4A 3N28A 4C2MC 4M5HA 4M95A 4JI8F 3O8WA 1F1BB 4J9QA 1QLNA 4B3SF 1VC6A 4FF1A 1UCNA 2KG1A 4YS2A 1U8WA 1U47A 1UMJA 4A3CK 5F8GA 2F7VA 4N77A 1X4BA 2FHJA 2HVDA 5KG3A 1Z2LA 3JB9k 4LSNA 4AD6A 2HHXA 2RVJA 5IT9Y 1KHVA 2VQFJ 4RNOA 1URNA 1IBMJ 5CYMB 3PRVA 5GMDA 4CQ1A 4UQGA 2AWZA 2BZ2A 5K14A 1YRUA 4B3TJ 3ISNC 2QL9B 4P2MA 2H51B 3QIDA 4J9LA 1R6YA 3FBCA 4N41A 1UVJA 4JB8B 4ILDA 2GHWA 2MKCA 1LK7A 4B9VA 5HVFA 1XR6A 3FJ2A 4LMZA 1INNA 5CJ9A 1QUPA 4ZKAA 2ZNYA 4ES2A 2AKWB 1F3VA 2B4UA 3NGRA 3NWGA 4DR2F 1XNQF 2VBYA 3M2VA 3VAJA 4DL6A 3JAMY 2XLKA 1MW7A 4I2PB 3ZTQA 1G6BA 4RW9A 3DDNA 1HW9A 1DBDA 3CJRA 1NRKA 2APOA 2E66A 3RRKA 5J2NA 3AH5A 2HRUA 1G4CA 4KRWA 1VHFA 2KRBA 2UU9F 4WXOA 3EUNA 1OYDA 2NUHA 1NDPA 3UN3A 2VUMC 3NP5A 2CW0A 1Q0NA 3PYFA 1HNZJ 2JA5A 5AE3A 1U24A 5FLXU 2E1CA 3PX6A 2VICA 2X3GA 4WU2A 4CZCA 1FVSA 4DV2J 3PW2A 5KG6A 2VPWB 3CD0A 1ZBTA 3RBZA 3RBDA 1TUVA 2HS4A 4GVBA 3EJMA 4AH6A 1CC8A 1R6VA 3HHKA 2V63A 3UI3A 4ZCMA 5E5NA 2CQ3A 4KMUA 1A6LA 2CIMA 4EYHB 3S1RC 2A0FB 4IO1A 4YEAA 4P7TA 9ATCB 2HBYB 1CJTB 1PILA 1RWKB 3FKBA 2OKQA 2ZJQQ 3O44A 4TKTA 3OTEA 6AT1B 3TZWA 4QYZJ 4RBTA 3B4MA 3S1NK 3FGVA 4Y7NK 3AOBA 4AYBD 2Z57B 5KAKA 3RG6A 4DG1A 1RK8A 3E8OA 3OBIA 4OYZA 3Q0AA 3R7SB 1T9VA 1HW8A 3GIJA 1X4DA 4DQQA 2B51A 2B5JB 1TVRA 1H6KX 2VC1A 4JYAJ 5DG8A 1XZPA 1KVJA 1MMNA 3CJ3A 3OD2A 2C2NA 1N5YB 2DHHA 1D8YA 2HVHA 1U8SA 1KLMA 1NDKA 2KFYA 3BH6B 3HM9A 4USHA 3PG9A 1YLXA 1Z4UA 4X66F 2BUNA 2EFPA 1ZTTA 4KGMA 1REVA 2N4DA 2BDPA 4ZIVA 5CABA 3BGFA 3CJ8A 3EPGA 1MG7A 2FQTA 1PJ5A 3S6EA 1RHKB 1S9EA 4CLSA 3C6TA 3C66A 1S1WB 1M1GA 7AT1B 4OLOA 2UXBF 1RT3B 4AE5A 1DHMA 4DZDA 3NKYA 4LK0A 2LEBA 1CJVA 2J9DA 1N5TA 2WK4A 2Z4PA 4K0KF 4G0UA 2AYMA 1VRQC 1CPZA 2BJ9A 4UUXA 4BLBA 2JEJA 3OL8A 1GTHA 4DSLA 1I6HC 1WHXA 1X7VA 1RAIB 3WC2A 1AA1B 2RB7A 4FF4A 3EICA 3HZGA 2F4VJ 2QL5B 4A8YA 4DPYA 3ILIA 4OX9F 2WVEA 4DX8H 2ZWOA 2R7UA 4NA1A 3KHRA 4IR9A 3LAJA 3R5DA 3IBCB 1BWVA 5HROB 1TL1A 1P9YA 2J9EA 4K2XA 3D7SB 3FCWA 4RL1A 3QGPA 1HNIB 3DM2A 3PW4A 4IRKA 1U1MA 3LP1A 3D2WA 1SH2A 4B3SJ 4CDIA 4BWMA 2DYAA 5FJ4A 3NMRA 1UJ4A 2IM0A 1ZYQA 3L4KA 5DGAA 2KYZA 2OMOA 2OELA 1U09A 3MPUB 2HG4A 4J91A 2QJ3A 2ZDOA 2RSQA 1B64A 4OIOA 1X5TA 5IZHA 4FVMA 2IA6A 3FCVA 1YGYA 5AXMA 3AA8A 3RW7A 1KVKA 3VQTA 2VD3A 3MR2A 2HFZA 2XC9A 3I0SB 5HSPA 1S59A 2VG6B 5AXKA 5DGBA 3CDBA 1UVNA 4YHHF 2HNZB 2MZRA 3HKZD 1S6QA 1TL3B 1YBTA 2H54B 1LXJA 3DI6A 4QIEA 2OP5A 2E9TA 3FMWA 5G0RB 5J2QB 2CZVC 4OX8A 4C98A 4BCAA 1MN9A 5DDOC 2EC0A 3I4PA 5BR8J 1NK9A 5C3EK 2COLA 3WHIA 1YWXA 3IO1A 2WSFC 1VGYA 4NA2A 2MLXA 4M5MA 1RYRA 1EQMA 3P5TL 4KPCA 2WB1L 4NXMJ 3WQPA 3BGRB 4KHPF 3B54A 2B3TB 4W90B 2PFFB 3P45B 1RTZA 3I0RA 2AX0A 3HO1A 3EYZA 3TO8A 2J6TA 1F5CA 1XQIA 4KFBA 2IVFB 1EETA 2K06A 4GTEA 3TYTA 1FXDA 5EHHA 4YOEA 4DL3A 3GB0A 4OYPA 3FRYA 5D15A 3GIRA 1Q79A 5DQIA 1I94J 4TQSA 1VQYA 4OINA 1DY3A 1AZSA 4PG8A 1JLEA 1FFSB 4XIUA 4GFQA 4NLDA 4LIWA 4N76A 2B63K 4R5PB 3MEDA 3PO3C 2BE9B 3LP0B 4JBCA 3S15K 4RW6A 2F8MA 3J7YU 4HI1A 3TUZC 3QT6A 3A13A 2B4VA 2WVFA 3EZOA 1V6HA 2WBRA 3N6MA 5HMWA 2E7WA 3Q8SB 3CJ2A 4NLOA 3FCHA 2C3UA 4J7CA 4FZBA 2VHGA 4YUDA 1PYTA 3QJPA 3HVWA 2HQIA 5CYJA 1RTIB 2LVWA 3DRRA 4X64F 3DDIA 2NLWA 1Q16B 4GC7A 5IM0A 2CPFA 1J5EF 1W25A 1RBOB 5DLFA 5HJYA 2LKZA 4M5LA 2XNRA 4HI2A 1F2HA 1NK5A 3PXGa 2E2HK 1U1NA 1LQ9A 3TNVA 2DR6A 1XEZA 1RWVB 2CDRB 4J9MA 5G4DA 2UVVA 4KKOA 3NNAA 1NM2A 4PUOB 4DR3J 4F67A 1Y0HA 3TTGA 3NNCA 1G1XA 1FRHA 1NEEA 3I56S 3EWGA 4USKA 2YPYA 2BV3A 4JI5F 1HNWJ 4J9RA 3IA0A 2LEPA 1RDRA 3N6LA 5JVHQ 4DQSA 1CG2A 3ET6A 1U1PA 1T7PA 1D09B 4P75A 3ENWA 4ZVHA 4ECRA 1FKOB 2RT3A 3SSQA 5BXIA 3H90A 3LWMA 2ADCA 2DXDA 4HHHA 2E5JA 1NK0A 1L3UA 1TV6A 4P52A 1PAUB 2NVYC 4I56A 3L7PA 3C15A 1T11A 3M6WA 2V69A 4O44A 4I6YA 4USMA 5JVGQ 5KFUA 2ZWPA 3D67A 2XY7A 3M8QA 5C4XC 2JVRA 2XCPA 4YR3A 4J90A 4N8NA 1KHWA 4IO9Q 4FZVA 4F3MA 2CFXA 1VRUB 3O3LA 4KASA 3SFGA 2J0SD 5KOWA 1HMVA 2QE5A 2HAIA 3KLIA 4F4WA 4ECZA 1Y5NB 1Y1VC 4P6QA 4ZPDA 1N32J 3NOCA 4FKXA 3RZAA 2UUBJ 3Q8RB 4UZCA 2HRYA 1E6YB 2OPSB 2W25A 4B3RJ 3P8BB 5C25B 3BBBA 4G7OA 2RU9A 2HZVA 4A3DK 3NRBA 4PG6A 4DX5A 4QYRA 1PJ6A 3MMBB 3M4OK 2F9DA 1VQ5S 2HHWA 3A8JA 3CC4S 2DHAA 1UEVA 3JSYA 3LQVA 5KG7A 2P5MA 1U0HB 3QBCA 2WOMA 2V4JA 4MIWA 2RQMA 5HMXA 3ZZUA 3S14C 4NASA 1RA6A 2RHSB 3RZDK 2OUGA 3W62A 1XZQA 1SI9A 5LMUJ 3J7AN 2E2IA 4YR2A 3HOVK 2PT0A 1FJGJ 4A3GK 3GTLK 1EX8A 2BE2A 3CJKA 1XTZA 3P49B 3Q22A 1RHJB 3HVTB 2IM3A 5FD1A 4F02A 2CPYA 3WODA 5K8OA 2MQNA 4HDHA 1S6OA 4ZVPB 1VBZA 4BBSK 4PR6A 3KLFA 4B3OA 1NK7A 5EGEA 4KQZA 5IOSA 2ZOGA 2XI2A 4KV8B 4ZVQB 2ZE2A 3HK2A 1VBKA 2RE1A 2DO0A 4ZPWR 1R8AA 4RBVA 2B9EA 1JLQB 1N56A 2H1YA 2NS1B 1Q1KA 2MXYA 2VPXB 3D6HB 1O6XA 2OH2A 4MK9A 5IC6B 4OV6A 3NL0A 3D28A 3I4MK 1VQLS 4ED6A 1SXLA 1HQUB 3ENAA 3GTPC 1PG5B 4PRFA 2JEIA 1SL0A 1GT8A 3V4IB 3G4CA 3KMSA 1YX2A 3VGSA 1QY7A 3K89A 2HURA 2UUTA 1C1CA 4MEXA 4ECQA 3S16K 5IXUA 1EI6A 1MWZA 3VWSA 2HKEA 4ZK7M 4USVA 5GAHI 4FKYA 4LF7J 4GKKJ 3AB2B 1M90T 4LVNP 4B08A 4LF8F 1LNQA 4R0JA 2ZH3A 3DLHA 3O6QA 4WIQA 1RT5A 2WW4A 4DZ6A 4KH1B 4D3GA 2W9BB 4K4VA 3QATA 3H8YA 2HZAA 1J5EJ 3FFIB 2DNYA 2G2ZA 1NO8A 5K14B 1FNXH 4WZQA 1Y1WC 1FFGB 4Y2MA 4A8OA 3L4JA 3QZ8A 3T9NA 1CEZA 3N01A 4WJBA 1S72S 1K47A 3GJRB 3ZZYA 3LP2A 3GTLA 1FX2A 4A3JK 3VA7A 4OZ1A 2V6TA 4LBIA 1T3OA 4ED4A 4OYBA 4DR6J 5TMFA 4DEZA 2A18A 2KJVA 4PPDA 5F8HA 5D0HA 5ETRA 3QT5A 1FNOA 4C8OA 4FBTA 2Y1RI 3LPXA 2FQQB 2Y3YA 3DRYA 4RW9B 4XAKA 4DXLA 3K7AC 2VFRA 4DR4J 2ZH7A 1F9FA 5BYQA 5I42A 1NK8A 3A3PB 2CQ2A 1P8GA 5LMNF 1FESA 1UW9A 3MEEB 1DJ0A 3HHLC 4EGLA 4RNHA 3ZTPA 1BE4A 4USIA 4CNYA 1HWUA 2OTJS 1VBYA 1O28A 4C0HA 3J81U 1X4CA 4OX6A 2R7OA 5EX0A 3KKFA 4C45A 3BUEA 3HPOA 2PMHA 3RBEA 1EFWA 4WWSA 3CCSS 5IQQA 1IJEB 4YB5A 4A8XA 4I64A 5FDLA 5JUMA 2AJ4A 4JI1F 4PQUB 1WG5A 3CCJS 2J0QD 2NQPA 2MQQA 4E8UA 3IRXB 5F0UA 4RMFA 1TL7B 4N56A 5IYBC 3Q2SC 2PC6A 1H98A 3SZZA 1JLGB 1XXAA 3CO9A 2QMWA 4CLWA 4FYDA 2G1DA 1WEZA 2BRKA 3MD1A 4IFVA 4LF1A 2P8IA 1I50A 5KG5A 1S12A 1OSDA 2JA8K 3LAKA 4A46A 2BQRA 1Q4RA 4DG1B 2ZD1A 2VA3A 2JA7C 3IWLA 5HQMA 3PR5B 4U7UD 3CCTA 2IIHA 3PHTA 2BM0A 2XCOA 1RWWB 1I6VA 4X2BA 5K8NA 3M32A 3MPWA 1UWAA 1S7IA 1M1KT 1FRLA 2V8PA 2FY1A 3I9ZA 2VFVA 2MYFA 4P74A 2Z2YB 2V9WA 2HGMA 2ALYB 2XS2A 2CJYB 4A3EK 4C11A 3GPAA 2DGUA 3PW7A 1CLFA 4NLYA 4LSLA 4DPXA 3GV8B 1S9EB 3S2DK 1ZZFA 2ZBIA 1F7VA 3PNIA 3TA0A 3RB0A 1RADB 3GR1A 4YFKA 1T3NA 4GO7X 1CJVB 3CWJA 2R2RA 5GADI 2FLOA 1HI1A 3HOYC 3GYNA 1U1LA 2O3DA 3TJ9A 2QTWA 5L1KA 1R9TC 1C1BB 2C2MB 3RAMA 3GFZA 2CKWA 2UUCF 3MTJA 3JSMA 5A0YB 1O25A 4DFKA 3IAM9 1K83C 2QMUB 1DQ8A 2W9CB 1VK8A 5LL6d 4BY7K 2D9PA 1FA0A 3OL7A 4RW4A 3MR3A 3HI9A 3HFZB 1RACB 3V6JA 1YRXA 5KFAA 2J7WA 4DU7A 3TQ1A 2DTJA 4HEA9 1R0BG 2CFAA 2LU1A 2QLXA 4DLGA 4WP9A 1GAOA 2JA5C 3EDQB 4DUZJ 1GXUA 3OV7A 1KS2A 1FFWB 4A93K 4FXVA 1QM9A 5C42B 2DHSA 5F8LA 3OXGA 1Z1ZA 2IMWP 4U67Q 3UCZP 1HNVA 4USUA 4MIAA 1S0VA 3LAMA 3G8TA 2WVDA 2IVMA 1O0PA 5DJBA 3OJUA 3U1NA 2IYIA 1CS4A 2W2MP 2CA9A 1DAXA 1LKZA 4GMKA 5J1EA 1U2CA 3N79A 2D3OR 4A3MC 2PE8A 2V67A 2HHVA 2GVZB 2YNIA 4OHZA 2YVSA 2V6AA 3CIMA 3THTA 2GIRA 3GWCA 3I5AA 5A2QU 2MTLA 4KN4A 5HLFB 3S1QK 2Y1LB 3NLCA 1BLUA 3N5FA 1UWBB 1RBAA 3R7BB 1WUUA 5F8JA 3BDPA 1EP4A 2NPIA 4ZJOA 3QFHA 4CYUA 4CO4A 2FVCA 4OZ0A 2R93C 4AXJA 3OLBA 3DI6B 3S1MC 2DNHA 2PFDA 1S0MA 3TAMB 4HYKA 2EG2A 1ZAWA 2YX1A 4UY8T 4ATNA 5KFOA 2CQDA 3R6LB 3T00A 1C2PA 4U7UK 3T5HA 3AXMA 2BXJA 1VQ4S 5C2GA 1SH0A 1T9WA 1RSCA 3BSAA 4AQYF 1V3SA 3NNHA 1SUQA 2YKQA 3RRHA 1H0HB 5E3PA 4OYXA 4LFBF 4O0NA 4KHMA 4WTYA 4JI3J 1GX5A 1E6VA 4S0MA 4CIOA 3I0RB 3R2DJ 3VALA 4YFXA 1O8BA 5KFIA 4KFBB 3GTGA 2I6WA 2BYCA 5KT2A 1RA7A 3IR5B 3F73A 4LJMA 4B9SA 4C2MK 3GTJA 2UUAF 2MGZB 2CQCA 2R7TA 3W3SA 3A8KA 4KO0A 4NLTA 1W2IA 1BC6A 4V19J 1HA1A 2RHQB 3QSIA 3R3TA 2FJXA 2K7JA 4Y34A 4DBQA 1O2AA 2KT2A 3CCMS 4CTAA 2B9WA 2JLEA 3J81j 3DOKB 3DDKA 5D0EA 4QWAA 4RW6B 4LF6F 2B0GA 4NYZA 2WONA 5HMYA 3DRSB 4BC7A 2WB1D 4DQRA 2YKMA 2LQ5A 5KFKA 1LW2A 2E5LJ 1FDDA 5IS2A 3RBXA 2R2SA 1IR0A 2CDQA 2D7SA 5ETKA 4DQPA 5JMNA 4RUAA 3D6FB 3MM6A 1H7XA 3CEDA 1EB0A 1OQ3A 3MEGB 5BYSA 1X60A 3HHDA 1F9EB 2FVRA 1NUEA 2QLFB 2KVQE 2E9ZA 4ELVA 3QAEA 2NVTC 3M2UA 3KK1A 4JK1A 1RXOB 2W8KA 3U1MA 1YZ7A 2YU9K 2JLGA 2YNFA 4PWDB 2ZUEA 4ENOA 1HHSA 5B0GA 3PX0A 1OSCA 4J9VA 3PHEA 2BQUA 3H2LA 2RNEA 2CQHA 4LRBA 3PZPA 4CO0A 4MFBB 2VUMK 2FJBB 3BZQA 1O27A 1CBKA 1JXEA 2JEGA 1PCAA 4WYLA 5J2MA 3GTMC 2GMHA 3UQSA 2FB0A 2GHVC 3KK2B 3M4XA 3ZZZA 1HBOA 4E98A 1EK8A 2QL7B 3NBPA 4KJIA 5IT9U 2IY5B 2ZZNA 2ZJRQ 2CJQA 2YBVA 2KL8A 1RTJA 3UNYA 2HQCA 1LWCA 3THPA 2NXEA 2F8EX 4F0HA 4BWJA 1YTYA 1WTFA 1W26A 2R92K 1JLFA 1DARA 5IP9C 3C15B 4C2MA 1M5VC 4X84A 2MLYA 2A10A 3I4HX 2KWAA 2DGXA 4DCPB 3M8QB 5J2PB 3R9LA 4WILA 2W2PP 2ASLA 4WTOB 1Q7LB 1RLDA 2DXEA 1J2VA 4OIRA 4AT1B 2DRBA 3FEYB 2QA4G 2V6UA 5EX3A 3JAMU 3D6MB 1UETA 4BXXK 4FF3A 4LBPA 4MKYA 2AYBA 1JLAA 3KLIB 4QWEA 3T3FA 4HHUA 4PEOA 1UW4A 2EC2A 1JQGA 3RR7A 3OFEA 3B78A 4M5KA 2DNMA 2Y9HA 3W9JA 4PZVA 2MHEA 4DR7J 2C42A 3NGKA 3HJFA 5J1NA 4IG3A 2GMJA 3WBZA 3IAS9 5EN1A 4F3QA 1IM4A 4P5AA 2KXNB 3J80Y 4IUFA 3ILLA 1IKXB 3VAKA 2O66A 1RT6A 4PKDB 5DO2A 2LEAA 2V4JB 4V1Ak 3NGSA 2XULA 2K3IA 4Q0BA 1B7FA 4K4UA 4O0IA 1KOOA 5IFMA 3M7VA 1M5PC 2O1PA 2VUMA 3IPJA 1TELA 1RAJA 5EDWA 4Y0FA 1WG1A 3G8SA 1I6HK 3OVBA 5IYDK 1MMLA 1YJWS 1S79A 3KJVB 5D4LA 1J6XA 2WBMA 4QU6A 4NMXA 3H0PA 3D4JA 1U7LA 3GTKC 3CCUS 4CWBA 4I7FA 1MMDA 3SCIE 4IG0A 2ZE2B 3NOGA 1UPPA 4IOBA 2EI5A 2VG5A 2BQ3A 4DL4A 2EBBA 4DV0J 4DR5J 4YDDB 2OEKA 3GIKA 5C2CA 1V5IB 2GW8A 3KTQA 4I0WA 1H72C 1USOA 1JLCA 4NLSA 4WP3A 2Y1IA 1S4EA 4JI7F 4F26A 2KXHA 4DV4F 1R0AB 2KH9A 2G4BA 1XWLA 1V3ZA 4CP5A 1WOPA 4F2RA 2HLUA 3J7ZT 4JI4F 2AGQA 1CULA 4LQYA 4OIQA 3MM9A 3D6TB 1N6QA 4C8KA 1TKTB 4HKQA 1RBLA 4DR1J 1K1SA 4QCLA 4RZRA 1AROP 2NVQK 3K8VA 1JJ2R 3T1AA 2WSEC 2ZBPA 4LF6J 2KT5A 3S7RA 4ZPAA 3MOZA 4LF5F 1DQAA 1S10A 4F0KA 4WK3A 5AXLA 5DQHA 2EFQA 2DCUB 1B4SA 4U8VA 1IWGA 1VQMS 5M2UA 3DLEB 4KARA 1N34J 2RAQA 5HAOA 4F2SA 3E01B 2XZWA 1TWAC 3QSYB 3JQJA 1BGWA 4FF2A 1HYSA 3L3CA 1ZXOA 5B0EA 2JHEA 3HOXK 5A8WB 3Q8YA 1RTHB 4NPOA 1GTEA 4KC5A 4QOTA 1T0TV 3CE8A 3OW2R 2VQEF 4FNHA 1N5QA 3DMJB 1LOUA 1RABB 2HZCA 4X4VA 1MSWD 2RQ4A 4KAWX 4RNNA 3CD6S 3MUMP 2OPRB 2C2RA 1M5SA 3JTPA 4O4GA 5ETSA 3RUBL 4KC6A 3OR2B 5L1JA 1C0UB 3UN2A 3ZTRA 3LH2S 1T02A 5KFWA 1JNRB 3IGNA 3GTQC 3ZTOA 5IOTA 1S1TA 4G65A 4AYBL 3M3YC 4URGA 4C48A 3NWRA 4QW9A 3KLHA 3DLBA 1NSKL 4NE9C 3G71S 3VVTA 2LXUA 3CPWR 4IFYA 3MM5A 3W9HA 2YPZA 2VODA 4MT1A 3CCWA 1VS3A 4O3PA 1DTTB 1GMUA 5F8IA 2EBEA 3FBEA 4EBDA 1OS5A 5A76A 4A3KC 5F3ZA 2CAJA 3AQOA 1HI9A 3KLEB 2J9CA 3CDEA 1TWGC 2ZKTA 1WI6A 1Y4ZB 2J8SA 3G6ES 2A6EA 2BMBA 3KJNB 4LF9J 2HQFA 4K50A 2NCKL 2J0XA 2HHSA 1X5PA 3MAAB 1IKVB 1CQNA 1QVFR 4X4QA 4ZS6A 5E3CA 3T19A 2GC8A 5HMZA 3IR7B 4IFVB 3KDNA 4YMEA 1Q7YT 3QRRA 3MWBA 2V9KA 4KPYA 4CLKA 2UV8A 2VFSA 2YKNA 5AE1A 3M2RB 2DIVA 4ZVUB 1A7GE 1S57A 2WVBA 4ZA1A 3DLLQ 2WSCC 4NI2A 2R8KA 2VF3A 1OIAA 1VJWA 2EVZA 4EU0A 2C2DA 3HOUC 1UPMB 4O3RA 3ZO7A 2EFOA 3FDSA 1M5KC 1S1XA 3RZOC 2MY8A 4DPUA 2FJDB 3F0NA 2BKOA 4WJ3M 4C3IC 3B6BA 3ZZ0A 4DUYF 1FEEA 4YFUA 1S5ZA 2VBZA 1T9TA 5SZTA 3R6GB 2WTFA 1BQXA 2BE5A 4ZJQA 2WAQD 3DYAB 1TAQA 2ABYA 5EGYA 1YI2S 3F44A 4Q44A 2YKPA 1JK9B 5F8MA 2XZTB 2CQ1A 3FVYA 2NVYK 4Y2IA 2AYGA 4ELTA 2HLTA 3FK4A 2F4FA 5CYQB 3V2UC 3FKIK 1SC6A 5C4XK 1RHUB 4GTCA 3JSMB 2AT1B 3LUYA 3B82A 3EVOA 4ER8A 4NXNJ 2QEXS 3GV7B 3QFWA 3S2HC 5B0AA 4DV4J 1VFJA 1GX6A 2XSJA 3NGUA 2VFTA 1TFWA 2V2ZA 1Y1VK 1WHYA 1KQSR 3PFOA 2ZH9A 4XSXA 3M1VB 2ZVIA 2MKJA 3VHQA 1FKPB 4ILMA 4KT0C 4BHQA 4NCGB 1PC4A 4GTLA 1O2BA 1X4GA 1USMA 3W5XA 3S17C 2K1RB 2PN6A 4HLBA 3VTIA 3HKZL 4KSEB 1UVKA 3W2WA 2CPDA 4LF5J 1S9FA 3CMQA 2CNKB 3CCZA 2JA6C 4A4JA 1EJ7L 2QLJB 4ID5A 2PMZD 3I55S 3K17A 4TN2A 2KT3A 3UDVA 2DPJA 4JUZA 3DFEA 1DURA 2AMCB 2YWEA 3K5PA 3L7UA 3GIMA 1N88A 2YNIB 1WC4A 4K4XA 2ZM6F 1LWFA 4XLPA 3CW2C 4W92B 3AJ2A 3HX9A 2KJWA 5LSOA 2PO4A 3DXJA 4A3FC 1RWXB 4XTTA 1EQRA 2NXUA 4GO5X 1EKSA 4B9NA 2R7SA 2JSXA 3R5JB 4ED3A 4QQBA 3LGMA 3VAHA 4G7HA 1T03B 1L5UA 3ITHB 2XLIA 4IRCA 5DZ6A 4L76A 4DHVA 1KP6A 2KZMA 3TR5A 4X4SA 4A8SA 2I1RA 3VAIA 2NVYA 3BQ1A 2CG8A 3Q23A 1KSPA 4MJKA 2XMJA 2PSZA 1HBMA 5E33A 1T9UA 1U1KA 1LFWA 4X4UA 4A48A 2HS0A 2K8GA 1WF1A 3OSNA 1AYEA 4NLQA 4M8LA 2DNZA 3GTPK 3FZ2A 5KT6A 4ED7A 1E6VB 5EWFA 2YWHA 1SH3A 3H0GC 4C3JC 1HBNA 1IBLF 4RNFA 2FHJD 4F4KA 3RW6A 3GEIA 3AT1B 4TXSA 3S0XA 1Y1VA 1S9GA 2KTQA 4ECXA 3RAXA 1HIYA 2NXCA 4WPAA 2DR8A 2UVRA 2IVYA 3M05A 1RT7A 2LA6A 1NJZA 2P6SA 4LK1A 4KO0B 2J6SA 4JI6J 1SJFA 3T5LA 2NXJA 2GAHC 1M1HA 4A8WA 2B4PA 1B7YB 4LVOP 3GEHA 4DPWA 3POTA 3V4MA 3EXYA 2XI3A 4R8UB 1WCMC 5EWEA 4DSFA 4BY1C 2V94A 2DHGA 2H5IB 2YH0A 1RQ0A 5C24A 2HW3A 2GO8A 2DR7A 4K8RA 3R5BA 2DBBA 3UDCA 1RUSA 3IWXA 1Y1WK 5GAHU 1DLOB 4A47A 2V2VA 2ZUFA 5L1LA 1LW2B 2XZDB 3QIPA 4QR0A 2G0JA 1K9MT 4MK8A 1FRIA 3TRGA 1X4FA 1YITS 4C3MA 2FC9A 1IR2A 5M5WK 4ZCLA 1FE0A 5HI7A 1ZETA 3WC0A 5KFGA 1ZPWX 4A3CC 2VQFF 4F36A 2MKHA 4UOHA 3PO5A 4OHYA 1ROFA 3GSDA 1IBMF 1Y3KA 4B9UA 3SSSA 4EO6A 3UVJB 2HNYB 4DL7A 1D9DA 2J6UA 2N82B 4B3TF 4ZVGA 1KRPA 4RWXA 1UA0A 2IHR1 2HHUA 3K7AK 1ACMB 2VJVA 3GJTB 2FJAB 4DN9A 1SFOC 1TR0A 3IBFB 1XXBA 4QWDA 4Q7AA 4EK2A 1TKZA 4LRAA 4YY3J 1R8CA 2GJ2A 3W5ZA 2XYHB 4K7QA 1NPKA 1QE1B 3M9MB 3TZXA 4C3LA 1CSJA 2DNLA 1BHNA 5M2PA 2R8IA 4C97A 2ASJA 3MM8B 2H4WB 3C16A 4PXBA 3GTPA 4Q2LA 2C2KB 1HKAA 2W9AA 1VQPS 3L9ZA 1VQ9S 3PRBA 3ETMA 1KBRA 1KFDA 2KKHA 1HNZF 4TLRA 1WSVA 2HIYA 2MQ8A 3CT9A 3BPDA 3L95X 4DV2F 5ETQA 2HVEA 5H9EJ 1T05A 1QSLA 3TAPA 3HHEA 3MM7A 1FJCA 1IL2A 1FT8A 1JXLA 1K73T 1L0WA 3GYXB 3B4DA 1IKWB 3CUNA 2JA7K 5HBMA 3DLKA 4M94A 1SVDA 2GX8A 1F0XA 3FQKA 1EHWA 2LQ9A 3MDFA 4A8KA 2W7VA 1JLBA 1JLAB 3H5SA 4NCBA 2WRMA 4N47A 1Y1WA 3OHBA 1IBKJ 4WKRA 3K57A 4MKBA 4ZVFA 4QIGA 2OMLA 2HMIB 4HL9A 1J98A 2AZ3A 1VQKS 4C7QA 2EBGA 1GEHA 2YNGB 1U6FA 1I5OB 3HD1A 2VG7A 3R5GA 3OREA 1AFJA 1HI8A 1QJHA 2ZC3A 4IOCQ 4DLEA 1DTQA 2BJDA 1NLKL 1JKHB 3CJSA 2NYIA 5L8RC 3SQGB 4JYAF 4OZLA 2CPIA 1N0VC 1T95A 3KHHA 4TY8A 1QSSA 2RKIB 4KB4A 1MROA 3ULHA 1HARA 5DDRC 2FPHX 4IRDA 3HHLA 2IMOA 4HACA 2AHOB 1V5VA 3DN9A 2ZBRA 5KFEA 4WFAQ 3TARA 1DRZA 4H4OB 2ZITA 5KFNA 3OPFA 1Q8BA 1TKXB 2KN4A 3N5BA 4P72A 4YFNA 4JV5F 2A6MA 4UW2A 3KK3A 4O3SA 2OEMA 1BQNA 3MURP 4LQ9A 4ES3A 1GMVA 2LDYA 3QO9A 2CPZA 3AAWB 5GADU 5CD4H 1IBLJ 1WC1A 2DEIA 2GNKA 3PW0A 5TMCA 5HO4A 1FRXA 2CVIA 2JA5K 4OHVA 4CO5A 3SZ2A 2GSUA 3QRQA 1JLCB 2D69A 2QC3A 2JZ5A 2BRLA 3A8IA 1QSYA 2AJ1A 4ZCKA 2F4VF 1WD6A 2JA7A 4Y6IA 2ZVSA 1HQEB 5H9FJ 5CHPA 2W24A 3K0JA 1K1QA 2V6SA 5HVHA 4PG7A 3MD3A 3CD5A 4H4KC 1N36F 1UVMA 1J6WA 4PXDA 3I5BA 1RAOA 5B08A 1BGXT 1VQ7S 4FPIA 1BQMB 1TL4A 4A3MK 5D3GA 4CLUA 5C4JC 3SSRA 1UZHA 5I3UB 2RF2A 3M8RA 4LQ3A 2IC3A 4I6WA 4WP8A 2MB0B 3HFKA 3IG1A 2YTCA 5D4OA 4Q45A 1TWFC 1SL1A 1OO0B 2GVDA 3CF5Q 1HWKA 1VLOA 2MZ1A 2FGOA 3DOLA 4NWBA 3SI8A 2GCFA 4M63A 4UT4A 1A0OB 3S1MK 2RDJA 4BBYA 1R89A 1RU1A 2Z56B 1KR4A 1NZ8A 4C0OC 4JI0J 2C22A 4IDKB 1D1UA 1URRA 1R9TA 4G0VA 2NXNA 3TEGA 3M30A 1RT1B 2JRSA 4GVLA 4NMLA 3AQPA 5LSLA 3HMJG 2ZUAA 4OYAA 4QJVB 3ZXWA 4EUVA 1LWEA 2I9SA 1YJUA 3BKUA 4DPTA 1PBUA 4XSZA 1K83A 2NVXC 5DDPC 1WACA 2DNKA 1HD0A 3KNGA 4DJBA 2MY7A 2J76E 4OJGA 5T7LA 4RW8A 1VI7A 3QPIA 2CUYA 4LJZA 4MQ9A 5KG4A 4P73A 5BR8F 2RD5C 4ED1A 1RLCL 2RH3A 2FGCA 2IDLA 3KLHB 3QQCD 4ICLA 5GVQA 3T1HJ 4K4ZA 4BKWA 2D3O1 4QIWD 1HPZA 2CWKA 2MMYA 1N52B 4NXMF 1T8EA 4P2SA 1IQTA 2J7UA 4B17A 1J5OA 3V6DB 3J7Z5 2AX1A 2MEWA 5DDQC 3KNAA 1MU2B 2OIHA 2MHNA 1ZH5A 2B9XA 1IUJA 3JTOA 3TX0A 4GTDA 2BABA 5IV4A 3I6PA 5KFTA 3QLHB 3NY0A 1X4HA 2D6FC 2GSOA 2XCAA 3L4BC 1X4AA 2OJ3A 1I3QC 2L9NA 4X65J 3HVRA 2L08A 4ECUA 1D8ZA 3ETOA 3VZIA 1RAHB 3US5A 2HWHA 1I94F 4PPZA 1Q5YA 4ZCIA 2ZHOA 3OFGA 2OPPA 1CJUB 1F5AA 2KZZA 5ETLA 2NVTK 2XO7A 4KY3A 4CM2A 1Q86T 2IRXA 3TW0A 5CYMA 3VGVA 2B63C 5L39A 2R93A 2BW2A 3OXLA 3S15C 2VC0A 4KM9A 4O3OA 3O5TB 5KFFA 3Q8QB 2C3PA 2W01A 5H9EK 5D4PA 5CCLA 3IM8A 1RE1B 1U0SA 3GTMK 1O24A 5HP1A 3MF5A 3K5NA 4NEYA 2PHCB 3AY0A 3AA9A 2AEJA 2AV5A 2HFUA 2KI2A 2D41A 1ZS6A 1S1VA 1XN9A 4I2PA 1PBAA 1KEKA 3UWTA 1I3OB 3BGLA 2E2HC 5L9XA 3M9OB 1I6JA 4JV5J 5ETOA 1KTVA 4AFFA 2ZC4A 1JNZB 4EYIB 4DR3F 3C6UA 3SFUA 1TL5A 2BJ3A 5IWAJ 1XXCA 2VPYB 3MMAB 2MQLA 1HNWF 1RCXB 4Z37A 2WVCA 3G6YA 1TTHB 1KTQA 2HGNA 5DRKA 3MOJB 1NPRA 1SV5B 5AJ3J 4DS5A 3MPYA 5LSRA 3KDOA 3MPVA 1DCOA 3NCPA 4G1IA 4ZPCA 4ED5A 2GQQA 1P1LA 2XSJB 1WHWA 3F41A 1ZA2B 2GHPA 4FVCA 2DCLA 1LXNA 1S0OA 1VGXA 2B7BB 3JYTA 3T5JA 3W66A 3A1YG 3IS9A 1CJTA 3OVAA 1N36J 4K4SA 1LWXA 3P4UB 1H3DA 3T1YJ 4C8NA 4XCHA 3CJ0A 1XPPA 2EFVA 4XDCA 1MWQA 1NKEA 2KHCA 3CAGA 4RUBA 1WTBA 1Y5LB 2MKYA 3PYDA 5FLMC 2DJWA 3W2WB 1S99A 4KH0B 4P10A 2RU3A 3UDEA 4RUHA 3ISZA 4LR7A 3RB4A 2PI4A 5LJ5Y 1KQFB 2MDAA 5IT0A 3ADAC 3TANA 1N32F 2E44A 2UUBF 4P71A 2B5JA 3ZTSA 4B3RF 1RHMB 4MMOA 3G82B 3THVA 4USWA 1OMSA 3DLJA 1N5YA 3CCRS 4Q5VA
chains in the Genus database with same CATH topology
1PJ6A 3TTGA 3ADAC 1WOSA 3GEIA 1WOOA 1WSRA 1XZPA 1V5VA 2GAHC 3TFIA 3AD7C 3GEHA 1X31C 1WSVA 1YX2A 3GEEA 3A8JA 2GAGC 1WORA 3A8KA 1XZQA 3GSIA 4PAAA 4P9SA 5L46A 1PJ5A 1WOPA 3TFJA 1XZPB 3AD8C 1VRQC 1VLOA 3TFHA 3AD9C 3A8IA 1PJ7A 4PABA 3GIRA 1XZQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJ6 A;  3TTG A;  3ADA C;  1WOS A;  3GEI A;  1WOO A;  1WSR A;  1XZP A;  1V5V A;  2GAH C;  3TFI A;  3AD7 C;  3GEH A;  1X31 C;  1WSV A;  1YX2 A;  3GEE A;  3A8J A;  2GAG C;  1WOR A;  3A8K A;  1XZQ A;  3GSI A;  4PAA A;  4P9S A;  5L46 A;  1PJ5 A;  1WOP A;  3TFJ A;  1XZP B;  3AD8 C;  1VRQ C;  1VLO A;  3TFH A;  3AD9 C;  3A8I A;  1PJ7 A;  4PAB A;  3GIR A;  1XZQ B; 
#chains in the Genus database with same CATH topology
 3SCJ E;  1WEL A;  3BBC A;  3SEO A;  3MPD A;  3CJ4 A;  4A3D C;  4ZJL A;  2GO9 A;  2M9K A;  3VF0 B;  2FLL A;  5DZ7 A;  4G1Q B;  3GTM A;  4QZV B;  1LFP A;  2VH7 A;  3NCR A;  3C14 B;  3M4O C;  4R25 A;  3W63 A;  3H20 A;  4MAK A;  1YG0 A;  4D3H A;  4EI2 A;  2LP4 A;  3LPE A;  3GTK K;  2JDJ A;  3CXC R;  2MJN A;  4F4Z A;  1RT3 A;  3TFJ A;  5LMU F;  2FC8 A;  2M0G B;  1FJG F;  2M8D B;  3JQK A;  4ALZ A;  5DET A;  3FEX B;  2KB2 A;  2ALZ A;  1ZAX A;  4AUK A;  4A3G C;  1KLN A;  2AJ2 A;  2EXU A;  2VJU A;  3BH7 B;  1RTD B;  2R7W A;  1HBM B;  2C2Z B;  4GT9 A;  4CCH A;  4OMF G;  1XMQ F;  1T9Y A;  1RZM A;  4KE5 A;  1FWK A;  3V6K A;  3MHY A;  3J80 U;  2EEY A;  3M8P B;  1U2R A;  1VBX A;  8RUC A;  5CXT A;  2NYH A;  4ZP8 A;  1HBN B;  2FVQ A;  2A3J A;  1R3N A;  4W98 A;  4ITS A;  1BD6 A;  4KIA A;  2BE7 D;  2VUG A;  3VAG A;  3H2U B;  4FXD A;  2OSQ A;  3H7H B;  5A8R B;  1YBA A;  1TMJ A;  1NK6 A;  3Q89 A;  5HRO A;  4LFC J;  3FSX A;  3K5O A;  5KFQ A;  2HYI B;  3BF4 A;  2ZUG A;  1LW0 B;  1HNI A;  3MEC A;  3QJL A;  3ONQ A;  3FZB A;  1FE4 A;  3NGT A;  4K5R A;  4U7C A;  2GQC A;  4B02 A;  2E2J C;  4YB6 A;  4I4B A;  2DNR A;  3I4M C;  2BKP A;  2GGP B;  4K4T A;  4IQX A;  4CI0 B;  3EVM A;  2XBP A;  2FZC B;  2Z8Q A;  4ES1 A;  3PTW A;  3R7N B;  5CZX A;  1WC6 A;  4N8O A;  3BP3 A;  1FWP A;  4IYQ A;  2M4M A;  1RIS A;  1TWA K;  4M5J A;  4ZLL A;  2HWI A;  5C44 C;  3S16 C;  4LF7 F;  1YVF A;  1VC5 A;  4GKK F;  4X4N A;  2RQK A;  3ERE D;  4ANC A;  3TFH A;  2HBZ B;  5KFJ A;  2BBE A;  2DPI A;  4FYW B;  5HAN A;  2G2Y A;  2IRY A;  2OEJ A;  2XCQ A;  4V19 X;  1O29 A;  3RU0 A;  4DV7 J;  5D0G A;  3X1L B;  3NAI A;  2FUG 9;  4TVA B;  3BJY A;  4DS4 A;  2VG6 A;  3GII A;  2EG1 A;  1XER A;  2AGP A;  2KM8 C;  1Q78 A;  2HNZ A;  3DXB A;  4DF4 A;  3GTK A;  1TL3 A;  3BGO P;  3OUY B;  1C0T A;  2BAN B;  1M5H A;  5G0R A;  5J2Q A;  5IOR A;  3AD8 C;  3GTQ K;  1TQL A;  2E2I K;  3T5K A;  3BB5 A;  2YXL A;  3MCN A;  4DR6 F;  4QYZ K;  4A3J C;  4OJH A;  4M1X A;  2FJV A;  4KAI A;  1FTR A;  1BDF A;  4U8Y A;  3N9U C;  3CIZ A;  5MAO A;  5KG2 A;  4LR2 A;  2G0I A;  4CT9 A;  1WF2 A;  4PWW A;  3C16 B;  4FNI A;  4DR4 F;  4C0B A;  4A3K K;  3AHP A;  3MZI A;  2F5G A;  3SIP B;  1TWG K;  3BKT A;  4DL2 A;  2SXL A;  2MQM A;  5MLC V;  2CPH A;  5J1P A;  5DM7 Q;  4DDF A;  1FWL A;  3EDR B;  1HBU B;  2AZ1 A;  3N0C A;  2ERR A;  2ZKU A;  4KBI A;  2BVZ A;  4AL7 A;  3BR8 A;  1F60 B;  2RS2 A;  3EZU A;  2VU5 A;  4G1P A;  4WE1 B;  2E5G A;  1IKY B;  3FOE A;  5F41 A;  5CQG A;  3GTY X;  1R27 B;  3V81 A;  2EWH A;  3HSZ A;  3DLK B;  3S1T A;  1EH1 A;  1XMO J;  3D3B J;  4R5P A;  3HOU K;  3LP0 A;  4ZVE A;  1ZM2 A;  1TWA A;  5KFL A;  3RZO K;  3V4G A;  1WC0 A;  4OIX A;  5IYC C;  3BQ0 A;  4ZPT R;  2DGV A;  4TU7 A;  2OD4 A;  4C3I K;  4B3M J;  2PPB A;  2ASD A;  1RU2 A;  2VOP A;  1RTI A;  4JI2 F;  4M5D B;  4KB7 A;  3RB3 A;  3OL9 A;  1UVL A;  5KFR A;  3HUL A;  3MMC A;  3QGH A;  2MJU A;  3OTD A;  3W5Y A;  2Q43 A;  1RHR B;  3ILJ A;  3TUJ C;  4WXW A;  1PYS B;  2GJF A;  4A3B K;  4TY8 B;  3UD4 P;  2E5I A;  1MRO B;  1IBC B;  2NRE A;  2F63 A;  3GTQ A;  2M8H A;  1G7C B;  3HHL B;  2CQ0 A;  3PVX A;  4CLY A;  2RRA A;  2CG4 A;  5AE2 A;  1RT4 B;  2MQP A;  1HFE L;  3LPY A;  1HHQ A;  2DNP A;  2V8G A;  5EGH A;  3KK3 B;  3S2H K;  5M3M K;  4EBE A;  4CLF A;  2E1P A;  1XMQ J;  1FKO A;  3JSB A;  2M88 A;  3W2V A;  1BY9 A;  4GKJ J;  2R7X A;  3PAC A;  2FHO B;  3QO9 B;  1TWG A;  4YDX A;  3UD3 P;  1NAQ A;  2W7A A;  3AOD A;  1YHQ S;  5C5J A;  3DGP B;  1FER A;  3GP9 A;  1XNR J;  1B4B A;  4GRS A;  3OT9 A;  5FII A;  3UCG A;  1CJK B;  5A2Q Y;  1Q8L A;  2UZA A;  3S17 K;  1PGZ A;  3BYR A;  3OR1 A;  4LF4 J;  2BAC A;  3BS9 A;  1J27 A;  1FRJ A;  2MLZ A;  2GML A;  2FTR A;  1IJF B;  4LLG A;  5H1S V;  4ZH4 A;  3N6N A;  1WI8 A;  1VRU A;  2BOA A;  4F8R A;  4XPE A;  3K5M A;  5KFB A;  5L38 A;  4AL6 A;  2XTJ P;  1NB7 A;  3OTO J;  2VFU A;  2POK A;  2UXC J;  3CQZ C;  4DV6 J;  2V34 A;  1E6Y A;  3AD9 C;  2W7O A;  2DD8 S;  4DUZ F;  4M1K A;  1QD1 A;  4FYV B;  5KFC A;  3H3V D;  1O51 A;  3FQL A;  3PEH A;  1I50 K;  3MML B;  1SB6 A;  2IM1 A;  3ILO A;  2X1G A;  5CHC B;  5D4D A;  1AFI A;  3IG1 B;  4DFP A;  3SBM A;  1ZBS A;  4A3F K;  4MYT A;  4LSN B;  4KGX B;  3H5Y A;  4CLZ A;  1N5S A;  2DK2 A;  1KOH A;  1U0H A;  1NSP A;  4CH0 S;  1XMB A;  3MCS A;  2H3E B;  2FY8 A;  2M2B A;  4URS A;  2RDI A;  4CRJ A;  3W9I A;  2HIQ A;  2DIT A;  3TI0 A;  2HHH J;  2W1B A;  2AJF E;  1HL6 A;  4WF9 Q;  2W4C A;  4LSZ B;  4DSE A;  4P7V A;  4ECS A;  3HOW K;  1N8R T;  1NSA A;  2YKO A;  2DVI A;  3VVU A;  2P2C B;  3CDU A;  1Y7P A;  3HVT A;  3D0H E;  1QAI A;  3GQC A;  3UFC X;  4WKY A;  2F8H A;  2V0N A;  1RYS A;  4ED8 A;  3UDL A;  2I2Y A;  3M2V B;  5HN0 A;  2FLP A;  1N54 B;  4QIV A;  1FVQ A;  3H0G K;  1TUG B;  4ZLP A;  2PA8 D;  2ILY A;  1U6Z A;  5T7L B;  2R8H A;  2RML A;  3SV3 A;  3PJX A;  1OY9 A;  5J2N B;  2HFS A;  4KV8 A;  1WOS A;  1EQ0 A;  4DV1 J;  4FN5 A;  2DH9 A;  2DIS A;  3QRP A;  4ZLJ A;  4DMZ A;  2GAG C;  4P9S A;  2ZZT A;  3NUH A;  4M5N A;  1KNZ A;  4ICL B;  1SKU B;  3SYZ A;  5KFP A;  1NK4 A;  2G0C A;  3HJV A;  4NOH A;  4YR0 A;  1HPZ B;  1CVJ A;  3TOQ A;  2VAS A;  1R0C B;  1WCM K;  4JI3 F;  1HWI A;  3BSC A;  1N33 J;  4RU9 A;  3FEZ A;  3ICL A;  2I0X A;  4GVB B;  4L73 A;  3MFH A;  1VRT A;  1JQW A;  3V4I A;  2FDN A;  2LDI A;  2BM1 A;  5E3Q A;  1K0V A;  3UW1 A;  3I5C A;  1SL2 A;  5IP7 K;  1RP5 A;  4NYP A;  1KD1 T;  3T01 A;  3W8P A;  3X3U A;  2Z2M A;  3W64 A;  2JA6 A;  4ZVS B;  2ASY A;  3MFI A;  2YQ3 A;  4C6A A;  2DGO A;  2NR0 A;  2QX0 A;  2Q79 A;  4HT5 A;  3U1L A;  2H4Y B;  1FDB A;  2JEF A;  3K58 A;  3MR6 A;  1HR0 J;  3HXA A;  3U7J A;  1OY8 A;  1FK9 A;  2OPP B;  1SIW B;  3I87 A;  2WAQ L;  1PAE X;  3L09 A;  1X0F A;  4QR2 A;  2W9B A;  4JI2 J;  1SJ3 P;  3S8S A;  4UOG A;  4AL5 A;  5GAE I;  3FFI A;  3M6U A;  2DGT A;  5A8K A;  4UF4 A;  4OI4 A;  3DXS X;  4K2J A;  4OIP A;  1TVR B;  1SFO K;  2E5L F;  1WKJ A;  3WX4 A;  1QUV A;  4IR1 A;  4PXC A;  2VL1 A;  1XZP B;  2XHW A;  2HHQ A;  2I8E A;  3H42 A;  3CCE S;  1KLM B;  2QZ8 A;  2C28 A;  4MK7 A;  4ZIT A;  3LGN A;  5HP1 B;  1UAW A;  4KR0 B;  5F3T A;  4RBU A;  3CUL A;  4I69 A;  3HXM A;  1S6U A;  2HND A;  1REV B;  5CH7 B;  1S1V B;  2YU9 C;  3KJQ B;  4C9D A;  5HAT A;  3C6T B;  3H0G A;  1LK5 A;  4KHR A;  2XM3 A;  5DLG A;  3C6U B;  4MTP A;  2CXE A;  3LGH A;  3MEE A;  5A6P A;  1VH2 A;  5E68 A;  3LA0 A;  2HQD A;  2Z30 B;  1NHK L;  3FOF A;  2GV1 A;  3N4W A;  3K5L A;  2AF6 A;  3ISN D;  4A3L C;  3FRZ A;  2RH6 A;  1JJC B;  5IOL A;  2IM2 A;  3CDA A;  2YH1 A;  4DF8 A;  1FRM A;  4WU3 A;  4Y52 C;  3PY8 A;  3HOZ K;  4OYI A;  1RWP B;  3OL6 A;  1WCM A;  2PMZ L;  1WSR A;  2XCR B;  1NND A;  4A3I C;  1GE9 A;  2YX4 A;  3IM9 A;  3Q8V A;  1AT1 B;  5B0C A;  1NZA A;  2EKN A;  4PQU A;  4RKU C;  4ZVO B;  5LXR A;  3JYT B;  5ITH A;  1P1T A;  4P2F A;  5HK4 A;  4UUW A;  3IS9 B;  3GTG K;  4FS2 A;  3IRX A;  2KO1 A;  4OZ3 A;  1TL7 A;  3PO4 A;  3P6Y C;  2R92 C;  2YNH A;  1KKH A;  3GTJ K;  1JLG A;  2FJW A;  1TL1 B;  1QTN B;  5L46 A;  2VOO A;  3DM2 B;  2AU0 A;  1WQG A;  2J9D E;  3TA2 A;  4WFN Q;  2PDA A;  2F65 A;  5ETV A;  2IJF A;  3LP1 B;  2YWF A;  3M8Z A;  3IWN C;  4C8Z A;  2CQB A;  3NS6 A;  4BXX C;  4CH1 A;  2ZNZ A;  2F3J A;  4DV3 J;  1RWN B;  2EKY A;  1GH8 A;  1S77 D;  1WG4 A;  4ERD A;  4DR7 F;  1S7H A;  3OSP A;  4O2D A;  1SFO A;  2HHT A;  1VMB A;  1RWM B;  3VCD A;  1VIX A;  2Y0S D;  2GZO A;  1EIY B;  3EQL A;  2HQG A;  1TWC C;  2GIQ A;  3UE2 A;  4CLT A;  3U27 A;  4PQA A;  1F6T A;  3OXF A;  2NPF A;  1NXI A;  4F25 A;  2QMX A;  1GMW A;  3A4T A;  2M5Y A;  2L41 A;  1S6Q B;  4AND A;  1SJR A;  1QTM A;  4UQT A;  1SJ1 A;  4L3K A;  3IFE A;  5B7W A;  1P9Q C;  4O3N A;  2BX6 A;  2DO4 A;  4G0W A;  2KXF A;  1C1B A;  2CJB A;  4Z7Y A;  3T02 A;  5M5X K;  5IYD C;  5F9N A;  2QIF A;  1FDA A;  1RT2 A;  5A0Y A;  2P9C A;  3R1H A;  1FD2 A;  2Q3P A;  2B56 A;  1UL3 A;  2W9C A;  1IWA A;  1ZA1 B;  2XYP B;  2DH7 A;  2CQP A;  4HVZ A;  1M0S A;  3CTR A;  2D74 B;  1WOO A;  5K8P A;  2YX7 A;  3P3D A;  5CD4 A;  2M70 A;  2AP6 A;  1VQ6 S;  1SQE A;  2E1R A;  4DV0 F;  4DR5 F;  3L7O A;  1S76 D;  5HVG A;  1EET B;  1SC1 B;  3CCL S;  5E2Q A;  5C4J K;  1UVI A;  5KFH A;  1AB8 A;  2JOQ A;  3MEC B;  3QMQ A;  2WZ1 A;  4YB1 P;  2I5J A;  1KQK A;  2XWY A;  4K4Y A;  1KON A;  3HSJ A;  4NLG A;  1B70 B;  4JI8 J;  3M8Y A;  1Y00 A;  2IDE A;  5C42 A;  4Q43 A;  3TEH B;  2JC1 A;  2XS7 A;  1ZTW A;  3OTB A;  1AZS B;  2ZDP A;  1TWF K;  1JLE B;  4J9U E;  1SKR A;  1TK8 A;  1Y10 A;  2MPU A;  4DR1 F;  4ZIW A;  2OHD A;  4Q2M A;  2D3U A;  3C3L A;  1ZPV A;  4E0D A;  3MED B;  3EX7 B;  3CVK A;  2NVQ C;  3QAU A;  4ETZ A;  3KJF B;  5DG9 A;  3CJT A;  4FBU A;  4XPC A;  2GVZ A;  3P96 A;  1LEO A;  2FD2 A;  3I4N C;  3MAH A;  3DRR B;  8ATC B;  4LRD A;  2RUG A;  5HLF A;  2EPI A;  5IM0 B;  1N34 F;  1UWB A;  3AFG A;  5B09 A;  2NVX K;  4DR2 J;  1XNQ J;  4PAA A;  4BS2 A;  3EM1 A;  4RNM A;  4CH7 A;  3EGW B;  4CNZ A;  3TQE A;  1X9W A;  2DY1 A;  1Q53 A;  4Y2A A;  4OV1 A;  4NLV A;  4P2X A;  1C0T B;  3HOX C;  2FLN A;  3TAM A;  2EK6 A;  2JH3 A;  4KKO B;  4F4Y A;  4Y2K A;  1X4E A;  2HK2 A;  3A8E A;  2LLZ A;  3T6B A;  3P5B P;  2UU9 J;  2D1C A;  4C8Y A;  2AQ4 A;  2DNQ A;  5EWG A;  5B0B A;  3GG1 A;  4Y2C A;  2XMV A;  3TVZ A;  2DGQ A;  4OI2 A;  3ET6 B;  4DSI A;  1JIH A;  3NGD A;  3T41 A;  2R9L A;  2HQ3 A;  3K59 A;  3BSO A;  2FZG B;  2R2T A;  2ACY A;  1L3K A;  3FSI A;  1B3T A;  2A6H A;  3I96 A;  4OHX A;  4H4K A;  1J6V A;  2CVE A;  3S1R K;  2CAD A;  3OFF A;  3H40 A;  2VDH A;  1I3Q K;  3JTN A;  3BBF A;  3UN5 A;  2Z58 B;  3FHZ A;  1Y9O A;  1TV6 B;  1YZ6 A;  2MGZ A;  4FYX B;  4OJ3 A;  3PO2 C;  3A12 A;  2ZH6 A;  2CQ4 A;  4O44 B;  3GIL A;  2DEJ A;  2N7Y A;  3LO3 A;  4ANE A;  1ULR A;  2HWT A;  3V81 B;  3GR0 A;  2RDD A;  3BGU A;  5KT5 A;  5HQ8 A;  2HHP A;  1KN6 A;  1RAE B;  1H7W A;  1S6P A;  1TWF A;  1KQG B;  4X4O A;  3DOK A;  4LF9 F;  2DXF A;  1GXT A;  1HMV B;  2XQC A;  3KMQ A;  3AJD A;  3DRS A;  2DNG A;  3CMA S;  4Q5S A;  5KTQ A;  4L75 A;  2IFX A;  3MCO A;  4M5I A;  1HI0 P;  2LU2 A;  1NH8 A;  3GE9 A;  1WDT A;  4GZY A;  3I31 A;  1KC8 T;  5TJ3 A;  3MEG A;  2KFZ A;  4TU9 A;  4RUC A;  1OY6 A;  1RWU A;  1SKS A;  4X66 J;  3MMC B;  1O2F B;  2NVX A;  3EZ5 A;  5D78 A;  4PWD A;  2WOM B;  1FDN A;  3FC9 A;  1T94 A;  2B9Y A;  4BC9 A;  3Q3Q A;  3RGI A;  4OLP A;  4QIF A;  4UZB A;  3M9N B;  1UTA A;  4I2Q A;  1X9M A;  3D68 A;  2HBQ B;  1XZQ B;  2UXB J;  3C19 A;  3IBW A;  4WFY A;  3GTO C;  4MFB A;  3HCX A;  3KLG A;  2ZOF A;  1RU0 A;  3MR7 A;  3FNN A;  1VQS A;  2BE2 B;  3CJK B;  4K0K J;  2MZS A;  4R0E A;  3BP8 C;  4L3N A;  4MYU A;  4H4M A;  4NEZ A;  3KK2 A;  3GCW P;  4O3Q A;  4F4X A;  5L9N A;  1KDN A;  2GQ2 A;  3DLG A;  2JVO A;  3GCX P;  2NZ4 A;  1WWH A;  1B4A A;  1YK9 A;  2B43 A;  3W2V B;  2IYG A;  4OHW A;  4WBF A;  3KLF B;  4B3O B;  2XMA A;  4ZPB A;  2CNO B;  4OX9 J;  1QDU B;  1UP1 A;  3ZZP A;  4A8F A;  1I3Q A;  4NYO A;  3G6X A;  4K4W A;  4MH8 A;  2QFJ A;  2O5J A;  2XB2 D;  2H5E A;  3OR1 B;  2XNQ A;  2JFD A;  5F8N A;  3FKI C;  2FQO A;  1ZAV A;  5J2P A;  4NXN F;  2KFN A;  5FLM K;  1H2T Z;  2MKS A;  2Z2L A;  3UNG C;  4OYM A;  3RJM B;  2N4C A;  1YJ7 A;  3WZ0 A;  2D3Z A;  4HTI A;  2U1A A;  2A68 A;  1RJJ A;  5EUH A;  4PYD A;  3OEP A;  2KYX A;  4F7V A;  2B63 A;  3BR9 A;  2PA3 A;  3D1H A;  1JMT A;  2L3M A;  3RYL A;  1C1C B;  1YJV A;  1YDL A;  4O4R A;  4OL8 A;  3TZZ A;  2H5J B;  4B9L A;  3Q8P B;  3NG8 A;  3SDE A;  4KB2 A;  2IAJ A;  2R7Z C;  2N3L A;  2XYG B;  5HJX A;  1NKB A;  4KN7 A;  1IQ0 A;  1UFK A;  3FSY A;  1HNX F;  3BDE A;  1T9X A;  1IKX A;  1RT5 B;  1FCA A;  2O5I A;  4KM8 A;  3JS9 A;  4OFZ A;  2Q6B A;  4ZP9 A;  3VZH A;  2E2H A;  3OTC A;  3VQS A;  2XWX A;  4GTB A;  5HQL A;  4YHH J;  1YQH A;  4QIW L;  2OFG X;  2LQ8 A;  1JWW A;  1HQM A;  4OI3 A;  4PXE A;  3AB4 B;  4OYO A;  2VON A;  1H2U X;  3LP2 B;  4C3H C;  1UFL A;  2K3K A;  4EWT A;  4DI6 A;  3R27 A;  4X62 F;  3BYP A;  2HVZ A;  1NJY A;  2RIJ A;  2DRD A;  4X6A C;  3KJV A;  3G96 A;  3ZC4 A;  2L9W A;  3QX3 A;  1U02 A;  2HFO A;  2O67 A;  3GON A;  4NZ6 A;  1GXL A;  1R43 A;  4KHP J;  3JQM A;  2KRR A;  4DFJ A;  4X4R A;  5K5M A;  1KQ4 A;  2BJ7 A;  3VGU A;  2QN6 B;  5I42 B;  2IRU A;  2MST A;  1F5B A;  2XSF A;  3CCV S;  3G4S S;  1WQF A;  5I3P A;  3CB4 A;  1IVZ A;  4NLR A;  2VIH A;  2N3O A;  3OLA A;  1R0A A;  1YRT A;  2E2J K;  5AXN A;  4DQI A;  2DKO B;  5CAA A;  2AIR B;  4ZHR A;  3QNW B;  1ZM3 A;  1ZM4 A;  3EGV A;  3HD2 A;  3Q83 A;  4KGV B;  1VRT B;  3AH6 A;  2F1F A;  4DDQ A;  1TKT A;  1P6T A;  5FDL B;  3PO3 K;  4U95 A;  2YWG A;  3TJ8 A;  3R5A A;  3C2P A;  5C44 K;  2PEB A;  2LQJ A;  2VPZ B;  3ZFV A;  1TKD A;  3OPK A;  5GAG U;  4JI6 F;  1MWY A;  1FK9 B;  3EXC X;  5KFY A;  1CQM A;  5KT7 A;  3D66 A;  4JV2 A;  4NLU A;  2IPO B;  1ZQ1 C;  2DNO A;  5E3R A;  3TVY A;  2ZOM A;  4JP8 A;  1FHT A;  4X64 J;  2ZD1 B;  3GFH A;  3WDO A;  1FNM A;  1QAJ A;  3DLE A;  1TAU A;  5A8K B;  1ZM9 A;  2E1M C;  3E01 A;  2HVI A;  3G8Q A;  3IMQ J;  3M32 B;  1FX4 A;  3ELH A;  4CM0 A;  2AD9 A;  1ZVU A;  2P8T A;  4ZMM A;  1U2F A;  3KFW X;  4ZOS A;  5A8W A;  1RTH A;  2YWK A;  3BEG B;  2YQ1 A;  4J37 A;  4BBR C;  2FHK A;  1EAR A;  2X1B A;  1YJT A;  2CJ9 A;  1R8B A;  4C11 B;  9RUB A;  2DRA A;  2OTL S;  3DMJ A;  2A6O A;  4PG4 A;  4N7T A;  4JI5 J;  2HND B;  4LSL B;  1UV7 A;  1TP7 A;  4M5G A;  2WW8 A;  2LMI A;  2Y1J A;  4RPF A;  2OPR A;  3HKW A;  3BO3 A;  2C2E A;  3CDW A;  3OR2 A;  5K8M A;  2Z0G A;  2MQO A;  1C0U A;  4OZJ A;  1YJ9 S;  3LAP A;  1TZ0 A;  4W4M A;  1FXR A;  2H9Z A;  4YY3 F;  2IBO A;  3N0V A;  3GYG A;  3PX4 A;  4C8M A;  4FPR A;  4JV0 A;  2MSS A;  3HP6 A;  4J9N A;  4QR1 A;  1UJ5 A;  4PWU A;  4O23 A;  4YQW A;  1OWX A;  1DTT A;  2RS8 A;  2YQ0 A;  3D54 A;  1U1O A;  4NRU A;  1RB0 A;  2X3D A;  4RW4 B;  1NDC A;  3KLE A;  1S48 A;  3AOC A;  2VBX A;  2XMM A;  2W2N P;  1U25 A;  1FKA F;  1RCO B;  3HLU A;  2D9O A;  2CFA B;  2YNH B;  3MAA A;  1IKV A;  5LJ3 Y;  1SMY A;  5IYC K;  1G2E A;  4ECT A;  2DH8 A;  4CT8 A;  3D1Q A;  1EZZ B;  4Q8F A;  1TWH C;  2ZHA A;  3M2R A;  4DL0 C;  4OZ2 A;  5KFM A;  3OVS A;  4F4A A;  2JLF A;  2AYE A;  1RHQ B;  2Q66 A;  2H48 B;  3HHL D;  3ZZO A;  4PAB A;  2G13 A;  5KT4 A;  2FVP A;  1HNV B;  2ZBC A;  2E29 A;  1HNX J;  4G3I A;  2B6A A;  1FXL A;  1MNE A;  1IBK F;  2J5A A;  3BRE A;  2RQC A;  2XS5 A;  4NL5 A;  5GMK a;  4RW7 A;  4YG2 A;  3S14 K;  4NZ7 A;  1CS4 B;  2WB4 A;  2Y0B B;  2JJ4 D;  5J1E B;  2CJA A;  3E51 A;  2C3Y A;  4QPX A;  1N4L A;  2B4O A;  3H5U A;  1FF2 A;  4USJ C;  1U4B A;  1D9F A;  2DNN A;  1AUS L;  2OD6 A;  2ATC B;  1IM6 A;  2RJZ A;  3QT8 A;  3KLV A;  3IN5 A;  3MEK A;  1SJQ A;  4X62 J;  3C8Y A;  4KMD A;  1EP4 B;  2CPX A;  2ZFH A;  1Y11 A;  3OHA A;  5LOQ A;  1VJE A;  4E2F B;  4CYU B;  3OFH A;  3DYA A;  2ZH4 A;  4HTJ A;  2BJE A;  1XBW A;  1RAF B;  2XLJ A;  5K9F A;  4ZP7 A;  2E7X A;  2O01 C;  3W65 A;  3DOM A;  4OQJ A;  4J9P A;  4ED0 A;  2HK3 A;  5CYQ A;  2Y8W A;  4XDD A;  4UTG A;  1GNK A;  3A3O B;  1RT2 B;  3PIO Q;  1SUQ B;  4H54 A;  1Q8I A;  4Q8E A;  2V2Q A;  2V8D A;  3GSI A;  4ZP6 A;  3MMJ A;  2H65 B;  2AJ0 A;  3HSG A;  4XO0 A;  1NH7 A;  1SCJ B;  2BKN A;  1WDD A;  3OQ2 A;  3M1V A;  3ENQ A;  3CQZ K;  1JOE A;  1FKP A;  5D4N A;  1BWE A;  4OJ1 A;  1IN0 A;  4NCG A;  1NBE B;  3DGV A;  5IOQ A;  3PFE A;  2I5J B;  1S49 A;  4WZM A;  3NS5 A;  1NKC A;  4KTQ A;  4LRC A;  5IC4 B;  2UP1 A;  3HVA A;  2K1R A;  2M7S A;  3NAH A;  1NJW A;  3PJW A;  3LWL A;  4F04 B;  4LF8 J;  2ZZM A;  2OLW A;  1YNN A;  2JNJ A;  1VK3 A;  3CNQ P;  1UZD A;  1DFD A;  1MLA A;  2LYV A;  4CTA B;  1NHV A;  2EFG A;  2XMK A;  2WON B;  4DL5 A;  4WYW A;  5C7P A;  3K7R A;  2HAF A;  1NME B;  1UKU A;  2YKM B;  4KGZ B;  1TK0 A;  2XMT A;  5FLX Y;  1DCP A;  4WII A;  1RAG B;  1G51 A;  1L3V A;  1WIH A;  5B0D A;  1I1G A;  3MM6 B;  1R8P A;  3D9B A;  2EW9 A;  2BA9 A;  2X51 A;  3M2U B;  3KK1 B;  1D3W A;  5F0W A;  2FHM A;  2RGR A;  3H2V E;  2YNF B;  1T03 A;  2NSB A;  3ITH A;  4Q4Z A;  1M5O C;  4JI0 F;  2RRB A;  2P6T A;  3IP0 A;  3R8Y A;  1LV5 A;  1GK8 A;  2ZEJ A;  5LMN J;  3DHX A;  3I82 A;  4FS1 A;  1RI7 A;  1K0T A;  1W7W A;  4TU8 A;  5L1I A;  5J2M B;  1H2V Z;  4CLL A;  1X5S A;  1WHV A;  1JJH A;  2JFK A;  3EVW A;  3UR0 A;  2DHX A;  2BW7 A;  1AB4 A;  1NB2 A;  3O1L A;  1HBO B;  4FYY B;  1FO1 A;  3NBP B;  1NHU A;  1D9A A;  1KFS A;  2PII A;  5FJ8 K;  5E41 A;  4RWW A;  2LXI A;  1IBA A;  5ADZ A;  4DCJ B;  2RIL A;  4ED2 A;  1RTJ B;  4I68 A;  1LWC B;  2PMW A;  3CQZ A;  3PYG A;  4JI1 J;  5CZV A;  5U47 A;  1YCL A;  5IYB K;  3T1H F;  1JLF B;  3V6H A;  2W4D A;  1FJ7 A;  2QO3 A;  2BOP A;  4ETX A;  5RUB A;  2A69 A;  2J0W A;  4R8U A;  1JB0 C;  3MAQ A;  5D0R A;  3TP2 A;  1S6P B;  2YWW A;  5ETM A;  4LFA F;  2UVW A;  1OQ6 A;  3PDN A;  4N5S A;  3NMA A;  1B0P A;  2A1B A;  4X65 F;  1DLO A;  4EZ9 A;  1PKU A;  2JL9 A;  4QWB A;  2ROG A;  4DWI A;  3G2X A;  4IH6 A;  2P5V A;  2CJX B;  1SBR A;  1OJ4 A;  4IG3 B;  1C0A A;  2YKA A;  4I6A A;  4QPT A;  3PKY A;  2V4Q A;  2DR5 A;  3S1N C;  4Y7N C;  4BLA A;  2A2D A;  4FM9 A;  2HS3 A;  1N48 A;  4C8L A;  2QV6 A;  2LQB A;  2B8Q A;  2PGC A;  4UST A;  5GAE U;  3UVJ A;  2HNY A;  3GJS B;  4QU7 A;  4ILR A;  1RT6 B;  2LFV A;  4OZ5 A;  5F9L A;  2KG0 A;  1WEX A;  1DQ9 A;  4I2Q B;  3O2I A;  4Q0B B;  3KLG B;  3HOY K;  4ILL A;  4A3L K;  1R9T K;  3PCO B;  1ELO A;  1QE1 A;  4NLW A;  1UEK A;  4H4M B;  4Y52 K;  1UA1 A;  3ZZR A;  3EE3 A;  1HD1 A;  3SMZ A;  2VV5 A;  1WEY A;  3DLG B;  2HPU A;  4J3N A;  1FRK A;  1WC3 A;  2QT7 A;  5T41 A;  1ICE B;  1NU4 A;  2UUC J;  3CCQ S;  3MM8 A;  3WIV A;  4A3I K;  1K83 K;  3RAQ A;  2C3M A;  2HGL A;  2DGS A;  3PYE A;  2ZHB A;  3OJS A;  3H3V L;  5IWA F;  4Y28 C;  4I7F B;  5E0O A;  3SCL E;  5IV3 A;  4IG0 B;  4DN0 A;  1S1U A;  2KVI A;  3RR8 A;  5DS7 A;  5DQG A;  2X1F A;  2VG5 B;  4IQM A;  3BQ2 A;  1IE0 A;  5AJ3 F;  2QLW A;  2K2P A;  4CLP A;  3M6V A;  3MI7 X;  4NLX A;  2DIU A;  2FVS A;  2BJ8 A;  2R3V A;  3HT3 A;  2C2O B;  2V68 A;  1IKW A;  3S01 A;  2ROP A;  2OI2 A;  3G87 A;  2CZ4 A;  2FIU A;  2QGF B;  1X0P A;  1CUL B;  3MM9 B;  4IH7 A;  1N6Q B;  1V9O A;  2AEM A;  1YJR A;  3T1Y F;  2HMI A;  3DCA A;  2F9J A;  3DNC A;  2UXD F;  5M5Y K;  4FP9 A;  5I3Q A;  2G1H A;  2OSR A;  2X1A A;  3SDE B;  1N5V A;  1TWC K;  2RRN A;  2Y3P A;  4DX7 A;  2IAJ B;  1VJQ A;  3UPF A;  3GU0 A;  2W8L A;  4LOW A;  1WKK A;  2YNG A;  4Y3C A;  2KHD A;  4DV5 F;  4HH1 A;  2PA8 L;  1B99 A;  3UR3 C;  3KOA A;  2QA4 S;  4JV1 A;  4DSJ A;  4P5B A;  3PJ9 A;  2PD1 A;  2OAU A;  4OI0 A;  2P9E A;  3EGZ A;  1JKH A;  1SIZ A;  4ZLN A;  1JJ4 A;  2YU9 A;  3SQG A;  4C4W A;  3WX8 A;  2FZK B;  2JX2 A;  3LAL A;  3HHN B;  4LBH A;  2R2U A;  2R93 K;  4ID8 A;  2ZH1 A;  3DRX A;  4EEY A;  1HYS B;  3TUP A;  2RKI A;  4EFA C;  4K59 A;  3BSN A;  3C46 A;  1F3F A;  4DU8 A;  2NZC A;  4GC6 A;  4QBU A;  4UOC A;  2W2O P;  4F3O A;  2NUU G;  3PIP Q;  4RJV A;  4H4O A;  2QA2 A;  1TKX A;  3DRP A;  2UUW A;  3GZ7 A;  3TJA A;  1MN7 A;  4AQY J;  3K2Y A;  2HFN A;  1TFY A;  1NSQ A;  1TMM A;  4MKV A;  5JVO A;  1F9N A;  4C3K A;  2CRL A;  3GJQ B;  2NSC A;  3AJ1 A;  4LFB J;  4HDG A;  4O4G B;  2QA1 A;  1HHT P;  2CYY A;  4ELU A;  1S0N A;  1JVI A;  5CCM A;  3KHG A;  2R92 A;  1S1T B;  3DHW C;  4ECV A;  4B9T A;  2QSF A;  5D6G A;  2R8J A;  4FDF A;  2G2O A;  2UUA J;  5C3E C;  5I4M A;  4IFY B;  3TVK A;  3MM5 B;  3TAQ A;  3G86 A;  2K7K A;  2QYG A;  4ZHR B;  4KMH A;  2OPQ A;  2HRT A;  1HQE A;  3Q86 A;  2VKZ G;  3PEJ A;  4EMD A;  5A6W A;  4J9O A;  4ZVT B;  1Q95 G;  4U96 A;  4LFA J;  3KUE A;  5IQ6 A;  2CPJ A;  4RO0 A;  4LFC F;  1SQF A;  1PIE A;  2Y8Y A;  3JSR A;  2R7Q A;  3B8H A;  3E2E A;  2ZH2 A;  3J7Y I;  1BQM A;  4B9M A;  2HSE B;  4DOZ A;  4QW8 A;  2V8H A;  5I3U A;  5M2R A;  3I4N K;  4J5O A;  1TWC A;  2CNL B;  5ETN A;  1AXQ A;  2YKN B;  4CO1 A;  1REG X;  2F40 A;  3LOU A;  3R97 A;  3RTV A;  1U49 A;  4NI2 B;  1U6B A;  4KAT A;  3LF0 A;  5KFV A;  3BN7 A;  3W61 A;  4LR8 A;  1VCT A;  1RKJ A;  1O5J A;  3ZNJ 1;  2ZJP Q;  3TX8 A;  1OPI A;  1XJW B;  5THW A;  1S1X B;  2DGW A;  4OI6 A;  3VAF A;  3FBF A;  1X31 C;  4IDK A;  1DZ5 A;  3QJJ A;  1WF0 A;  4HR2 A;  3GEE A;  4DV7 F;  1WQH A;  1WOR A;  2R4F A;  1RT1 A;  2CPE A;  3FBB A;  2HFV A;  4QJV A;  2ZFZ A;  2ZH8 A;  2PI5 A;  4HT7 A;  3H4B A;  3QT7 A;  4EO8 A;  1TK5 A;  3VGT A;  4TNO A;  1R8H A;  1OPZ A;  2E5H A;  4Z7C A;  3ZZT A;  2B8P A;  3LW5 C;  1U1Q A;  4WFZ A;  4CO3 A;  5SUH A;  1L3T A;  4HH0 A;  1Q82 T;  4LRF A;  5HL8 A;  2E2I C;  2CNN B;  3KWM A;  1IW7 A;  5IP9 K;  3VAM A;  1ZOT A;  3PO2 K;  4A8M P;  3HSD A;  4L6V 3;  4NRT A;  4ZPV R;  1SC3 B;  1U26 A;  3V6D A;  1K8A T;  3GLJ A;  4Z2X A;  3BPS P;  3AD7 C;  2B7C B;  1MU2 A;  1C4C A;  3PW5 A;  1U1R A;  2Y0S L;  3R1L A;  2QLB B;  3QWP A;  3KHL A;  2QG9 B;  3QLH A;  1DD5 A;  1EAY C;  2CQI A;  1NPP A;  3KG4 A;  1ZYR A;  4UOF A;  1APS A;  3CD7 A;  4ECW A;  2UXD J;  8AT1 B;  1CJU A;  2BJ1 A;  2MZT A;  3BV8 A;  4DUT A;  1DCH A;  1PYO B;  3AXK A;  1F7U A;  1XMO F;  4RLE A;  4DV5 J;  3GDZ A;  4RU2 A;  1VDH A;  2KM8 B;  2B6A B;  3BO4 A;  2VDI A;  4RW7 B;  4ID5 B;  3IGV A;  3SCK E;  3TUI C;  3QZ7 A;  2R7R A;  4B3M F;  3GTO K;  2W2Q P;  4NA3 A;  2Q1L A;  2GIF A;  1LWF B;  3WIU A;  1FI4 A;  4MKA A;  2XEX A;  2M3D A;  2V2K A;  4WJ4 A;  5JXS A;  1XR7 A;  2OGU A;  1VYA A;  3KG1 A;  4X4T A;  2XGP A;  5H9F K;  4Y00 A;  1XIQ A;  2QYC A;  5T14 A;  3MR5 A;  2XO6 A;  1S1W A;  2FJE B;  1PSD A;  5HL7 Q;  4A3B C;  1U45 A;  1Y3J A;  3U02 A;  1YNJ A;  3KXD A;  3RZD C;  4DCO B;  5KG1 A;  4OI1 A;  1WJ9 A;  3DU6 A;  3DOM B;  3MMA A;  1YIJ S;  3HOV C;  2C1E B;  4ZN3 A;  3GTL C;  2XMU A;  2VKR A;  6FD1 A;  3GFX A;  5ETT A;  5LM7 E;  1SV5 A;  2ILZ A;  4YP3 A;  3H4D A;  1Q5V A;  2UV8 G;  4OX7 A;  3Q2T C;  3W8G A;  4JI7 J;  4XK8 C;  6FDR A;  4GKJ F;  3MTK A;  3Q24 A;  3CGI A;  1X9S A;  4BBS C;  4JI4 J;  2V5H G;  3K8W A;  4ECY A;  2Q6C A;  1XNR F;  4LF2 A;  1S9G B;  3QGI A;  1IS1 A;  3QWU A;  3AOA A;  1H74 A;  1UEU A;  3D3C J;  5M3F K;  1VHI A;  4LF4 F;  3CSK A;  1BMQ B;  3LTO A;  1GFW B;  3IXQ A;  1RT7 B;  5GAG I;  4K5S A;  1HQ2 A;  4ZVR B;  2JC0 A;  2R7Z K;  1PC5 A;  2IA0 A;  2R42 A;  1PJ7 A;  3F56 A;  1B0T A;  4F50 A;  3POT B;  1ISE A;  4YB7 A;  2G9O A;  2UVU A;  3H5X A;  3OTO F;  5C24 B;  2UXC F;  4KMA A;  3KYL A;  1FTC A;  1W2B R;  4DV6 F;  2BR0 A;  3SV4 A;  3N3Y A;  4GTA A;  3G82 A;  1C4A A;  5D8H B;  2R7V A;  1F2G A;  3QYY A;  4XLN A;  2V50 A;  3HZE A;  4LRE A;  3QIP B;  3GTO A;  4TYA A;  5B0F A;  1SC4 B;  2HEK A;  1NDL A;  4C3H K;  2CQG A;  4MEY A;  4NZ0 A;  1I50 C;  2E7V A;  1FJE B;  1VC0 A;  1HLW A;  2IJR A;  4G1Q A;  1Y5I B;  4BLG A;  3RRG A;  3UCU P;  1Z2Z A;  3C14 A;  2VA2 A;  2GFF A;  5KG0 A;  3J81 Y;  2MZJ A;  1RWO B;  4IOA Q;  4ZN1 A;  3UO0 A;  4X6A K;  4PCQ A;  2VQE J;  3GFY A;  2XMW A;  4PG5 A;  1VIO A;  5LXY A;  5GME A;  2R8G A;  3I0S A;  5KOX A;  3NXZ A;  4NCA A;  3T9Z A;  2VB6 A;  4I67 A;  4OZN A;  2HHH F;  2I38 A;  5K20 B;  1R7I A;  4NLP A;  1TKZ B;  2GSN A;  3M8W A;  3M3Y K;  1VOM A;  3SXL A;  2J8A A;  1RTD A;  4CO2 A;  3HOW C;  3VV2 B;  2ZH5 A;  3IR6 B;  3FKI A;  2L9D A;  1RGV A;  2W7P A;  3GMG A;  2HBR B;  3CC7 S;  3M8P A;  1SPB P;  1VR6 A;  3BGR A;  2MKI A;  5D77 A;  2KDO A;  7FDR A;  3R2C J;  4DPO A;  4DV1 F;  1I51 B;  3V5R A;  1NJI T;  5A8R A;  4JOU A;  3H98 A;  1F93 A;  4J9K A;  1EKR A;  3RB6 A;  1SQG A;  1WKL A;  4A8Q A;  3MGJ A;  1LW0 A;  2IJN A;  2M52 A;  3CME S;  3BKF A;  2GA7 A;  1RKI A;  5AT1 B;  3PRD A;  4LIR A;  1T05 B;  2R7Z A;  3D0I E;  1N33 F;  3MM7 B;  1BS2 A;  4U6P A;  3DU5 A;  3CJQ A;  5HBM B;  2GGP A;  3D0G E;  4BDP A;  1D0E A;  2CZ9 A;  1JLB B;  1QVG R;  4G7Z A;  5JFE A;  3R5C A;  5IP7 C;  3G4A A;  3EPI A;  1SKW A;  2ATL A;  3M8S A;  2GS8 A;  1UJ6 A;  4L72 B;  1NCL A;  3DKD A;  3W60 A;  2WHO A;  4BBR K;  1HR0 F;  4DFM A;  2OFH X;  5IT4 A;  1ZZN A;  1NJX A;  2E1A A;  2EK1 A;  1S97 A;  1HWJ A;  4L74 A;  4WK1 A;  3DC2 A;  2JA8 C;  1TUW A;  4DUY J;  2VG7 B;  1VQN S;  3FUY A;  3NEK A;  2P9G A;  3SZY A;  3BN4 A;  3HT0 A;  4I1T A;  1Q81 T;  2ZBQ A;  1QAY A;  1DTQ B;  3PR4 A;  4EZ6 A;  1P27 B;  3IRW P;  2XY6 A;  5DG7 A;  2QSW A;  1YKW A;  1VIS A;  1ITP A;  4NX9 A;  4KDD A;  4HHJ A;  4LUB A;  3OUY A;  4AXI A;  4LT6 A;  2ROE A;  5KFX A;  2BAN A;  3G9C A;  3JXO A;  3MUT P;  3PM9 A;  4UY8 5;  4PUO A;  2OO4 A;  2U2F A;  2X7I A;  1WC5 A;  5LT5 A;  2DR9 A;  3GV5 B;  1AW0 A;  4HAC B;  4EBC A;  1CC7 A;  3MUV P;  3EMT A;  3NS7 B;  4A3E C;  1TU0 B;  2AGO A;  3UD5 A;  2J7K A;  2CWX A;  4URQ U;  1KVI A;  2LA4 A;  4G6V B;  2MKK A;  1HWL A;  1S4F A;  1FEH A;  4TYB A;  3MXH P;  3S2D C;  1BQN B;  2AEF A;  3BO2 A;  4U9R A;  4TY9 A;  7FD1 A;  3BM7 A;  1QAX A;  4OYW A;  3GG0 A;  3I32 A;  1IQZ A;  1S1U B;  5DM6 Q;  4MIB A;  1HBU A;  5BJR A;  1BJT A;  5ETP A;  1F9H A;  1O26 A;  3JST A;  4WE1 A;  1GQE A;  1G3O A;  5KFD A;  1TWH K;  1IKY A;  2XHC A;  1X8D A;  1B0V A;  1PO6 A;  2BEF A;  3HOZ C;  1A9N B;  4NOI A;  5KFS A;  3M6X A;  2VZ9 A;  1XR5 A;  3KG0 A;  4GTF A;  1OYE A;  2FYX A;  4BY7 C;  3PV8 A;  4KYZ A;  2N7C A;  4WCE Q;  3SQO P;  4TQR A;  1GMW D;  2JA6 K;  4RR5 A;  3EGN A;  3CC2 S;  4FXW A;  3G6V A;  2VBW A;  3GTG C;  4WFX A;  2LXF A;  2OPS A;  3GTJ C;  3J7A 1;  2E9R X;  5D3G B;  5C25 A;  1X5O A;  2DY9 A;  2RF2 B;  1L3S A;  1N0U A;  1XK8 A;  2WCX A;  2IC3 B;  1XC9 A;  4A93 C;  2AW0 A;  5E7O B;  2ZM6 J;  4QWC A;  3HFV A;  3MMB A;  4M5D A;  1H38 A;  3D1O A;  3QGG A;  2JWN A;  2QRR A;  2LCW A;  2EFN A;  1Q8K A;  4DV3 F;  1JXV A;  2Z2Z A;  3D5M A;  2V4R A;  2GVD B;  3T6J A;  5CA5 A;  3TFI A;  4PYA A;  3DOL B;  3H25 A;  2O5D A;  5E3A A;  5JJB A;  3CJ5 A;  1VQO S;  3MCM A;  2AJQ A;  2ADB A;  1BUX A;  3N0B A;  2A2C A;  2GJI A;  4DSK A;  1VQ8 S;  3IC1 A;  4TLQ A;  3W7B A;  3E3X A;  2KU7 A;  2QFI A;  1RT4 A;  1YJN S;  2PEH A;  2XY5 A;  2LEC A;  3M30 B;  2DT9 A;  3FMB A;  3DRP B;  4F0M A;  4X4P A;  3NCQ A;  3S1Q C;  1LWE B;  4DX6 A;  3TA1 A;  4IH5 A;  3HF5 A;  2XGQ A;  1YBU A;  2W4P A;  1FD8 A;  4WFB Q;  4C3J K;  1IXK A;  1IR1 A;  1AUD A;  2RUS A;  3HDS A;  4RW8 B;  4YN3 B;  2L48 A;  2V8V A;  2IBK A;  4KGK A;  3DGP A;  3CO0 P;  2CJK A;  1KWM A;  3TWZ A;  1H73 A;  5BYR A;  2YY3 A;  3KUG A;  1CJK A;  5KT3 A;  1U48 A;  3I9V 9;  1JLQ A;  1UFW A;  4Y65 A;  1TWH A;  1V3R A;  4RX6 A;  3H59 A;  3Q8U A;  2XG8 A;  1J5O B;  2C3O A;  1BXN A;  3KUH A;  2OPQ B;  4BY1 K;  3W1Y C;  1WNE A;  2MZQ A;  3TZY A;  1VLY A;  4ZDN A;  1HQU A;  3ENV A;  3VR1 A;  4J9S A;  3PKM A;  4IKA A;  3ZNU A;  5KFZ A;  1SJ4 P;  1YSJ A;  1K44 A;  2DB1 A;  3A3N B;  1RAA B;  3LAN A;  1R31 A;  2ACM A;  4LR9 A;  1JX4 A;  3N28 A;  4C2M C;  4M5H A;  4M95 A;  4JI8 F;  3O8W A;  1F1B B;  4J9Q A;  1QLN A;  4B3S F;  1VC6 A;  4FF1 A;  1UCN A;  2KG1 A;  4YS2 A;  1U8W A;  1U47 A;  1UMJ A;  4A3C K;  5F8G A;  2F7V A;  4N77 A;  1X4B A;  2FHJ A;  2HVD A;  5KG3 A;  1Z2L A;  3JB9 k;  4LSN A;  4AD6 A;  2HHX A;  2RVJ A;  5IT9 Y;  1KHV A;  2VQF J;  4RNO A;  1URN A;  1IBM J;  5CYM B;  3PRV A;  5GMD A;  4CQ1 A;  4UQG A;  2AWZ A;  2BZ2 A;  5K14 A;  1YRU A;  4B3T J;  3ISN C;  2QL9 B;  4P2M A;  2H51 B;  3QID A;  4J9L A;  1R6Y A;  3FBC A;  4N41 A;  1UVJ A;  4JB8 B;  4ILD A;  2GHW A;  2MKC A;  1LK7 A;  4B9V A;  5HVF A;  1XR6 A;  3FJ2 A;  4LMZ A;  1INN A;  5CJ9 A;  1QUP A;  4ZKA A;  2ZNY A;  4ES2 A;  2AKW B;  1F3V A;  2B4U A;  3NGR A;  3NWG A;  4DR2 F;  1XNQ F;  2VBY A;  3M2V A;  3VAJ A;  4DL6 A;  3JAM Y;  2XLK A;  1MW7 A;  4I2P B;  3ZTQ A;  1G6B A;  4RW9 A;  3DDN A;  1HW9 A;  1DBD A;  3CJR A;  1NRK A;  2APO A;  2E66 A;  3RRK A;  5J2N A;  3AH5 A;  2HRU A;  1G4C A;  4KRW A;  1VHF A;  2KRB A;  2UU9 F;  4WXO A;  3EUN A;  1OYD A;  2NUH A;  1NDP A;  3UN3 A;  2VUM C;  3NP5 A;  2CW0 A;  1Q0N A;  3PYF A;  1HNZ J;  2JA5 A;  5AE3 A;  1U24 A;  5FLX U;  2E1C A;  3PX6 A;  2VIC A;  2X3G A;  4WU2 A;  4CZC A;  1FVS A;  4DV2 J;  3PW2 A;  5KG6 A;  2VPW B;  3CD0 A;  1ZBT A;  3RBZ A;  3RBD A;  1TUV A;  2HS4 A;  4GVB A;  3EJM A;  4AH6 A;  1CC8 A;  1R6V A;  3HHK A;  2V63 A;  3UI3 A;  4ZCM A;  5E5N A;  2CQ3 A;  4KMU A;  1A6L A;  2CIM A;  4EYH B;  3S1R C;  2A0F B;  4IO1 A;  4YEA A;  4P7T A;  9ATC B;  2HBY B;  1CJT B;  1PIL A;  1RWK B;  3FKB A;  2OKQ A;  2ZJQ Q;  3O44 A;  4TKT A;  3OTE A;  6AT1 B;  3TZW A;  4QYZ J;  4RBT A;  3B4M A;  3S1N K;  3FGV A;  4Y7N K;  3AOB A;  4AYB D;  2Z57 B;  5KAK A;  3RG6 A;  4DG1 A;  1RK8 A;  3E8O A;  3OBI A;  4OYZ A;  3Q0A A;  3R7S B;  1T9V A;  1HW8 A;  3GIJ A;  1X4D A;  4DQQ A;  2B51 A;  2B5J B;  1TVR A;  1H6K X;  2VC1 A;  4JYA J;  5DG8 A;  1XZP A;  1KVJ A;  1MMN A;  3CJ3 A;  3OD2 A;  2C2N A;  1N5Y B;  2DHH A;  1D8Y A;  2HVH A;  1U8S A;  1KLM A;  1NDK A;  2KFY A;  3BH6 B;  3HM9 A;  4USH A;  3PG9 A;  1YLX A;  1Z4U A;  4X66 F;  2BUN A;  2EFP A;  1ZTT A;  4KGM A;  1REV A;  2N4D A;  2BDP A;  4ZIV A;  5CAB A;  3BGF A;  3CJ8 A;  3EPG A;  1MG7 A;  2FQT A;  1PJ5 A;  3S6E A;  1RHK B;  1S9E A;  4CLS A;  3C6T A;  3C66 A;  1S1W B;  1M1G A;  7AT1 B;  4OLO A;  2UXB F;  1RT3 B;  4AE5 A;  1DHM A;  4DZD A;  3NKY A;  4LK0 A;  2LEB A;  1CJV A;  2J9D A;  1N5T A;  2WK4 A;  2Z4P A;  4K0K F;  4G0U A;  2AYM A;  1VRQ C;  1CPZ A;  2BJ9 A;  4UUX A;  4BLB A;  2JEJ A;  3OL8 A;  1GTH A;  4DSL A;  1I6H C;  1WHX A;  1X7V A;  1RAI B;  3WC2 A;  1AA1 B;  2RB7 A;  4FF4 A;  3EIC A;  3HZG A;  2F4V J;  2QL5 B;  4A8Y A;  4DPY A;  3ILI A;  4OX9 F;  2WVE A;  4DX8 H;  2ZWO A;  2R7U A;  4NA1 A;  3KHR A;  4IR9 A;  3LAJ A;  3R5D A;  3IBC B;  1BWV A;  5HRO B;  1TL1 A;  1P9Y A;  2J9E A;  4K2X A;  3D7S B;  3FCW A;  4RL1 A;  3QGP A;  1HNI B;  3DM2 A;  3PW4 A;  4IRK A;  1U1M A;  3LP1 A;  3D2W A;  1SH2 A;  4B3S J;  4CDI A;  4BWM A;  2DYA A;  5FJ4 A;  3NMR A;  1UJ4 A;  2IM0 A;  1ZYQ A;  3L4K A;  5DGA A;  2KYZ A;  2OMO A;  2OEL A;  1U09 A;  3MPU B;  2HG4 A;  4J91 A;  2QJ3 A;  2ZDO A;  2RSQ A;  1B64 A;  4OIO A;  1X5T A;  5IZH A;  4FVM A;  2IA6 A;  3FCV A;  1YGY A;  5AXM A;  3AA8 A;  3RW7 A;  1KVK A;  3VQT A;  2VD3 A;  3MR2 A;  2HFZ A;  2XC9 A;  3I0S B;  5HSP A;  1S59 A;  2VG6 B;  5AXK A;  5DGB A;  3CDB A;  1UVN A;  4YHH F;  2HNZ B;  2MZR A;  3HKZ D;  1S6Q A;  1TL3 B;  1YBT A;  2H54 B;  1LXJ A;  3DI6 A;  4QIE A;  2OP5 A;  2E9T A;  3FMW A;  5G0R B;  5J2Q B;  2CZV C;  4OX8 A;  4C98 A;  4BCA A;  1MN9 A;  5DDO C;  2EC0 A;  3I4P A;  5BR8 J;  1NK9 A;  5C3E K;  2COL A;  3WHI A;  1YWX A;  3IO1 A;  2WSF C;  1VGY A;  4NA2 A;  2MLX A;  4M5M A;  1RYR A;  1EQM A;  3P5T L;  4KPC A;  2WB1 L;  4NXM J;  3WQP A;  3BGR B;  4KHP F;  3B54 A;  2B3T B;  4W90 B;  2PFF B;  3P45 B;  1RTZ A;  3I0R A;  2AX0 A;  3HO1 A;  3EYZ A;  3TO8 A;  2J6T A;  1F5C A;  1XQI A;  4KFB A;  2IVF B;  1EET A;  2K06 A;  4GTE A;  3TYT A;  1FXD A;  5EHH A;  4YOE A;  4DL3 A;  3GB0 A;  4OYP A;  3FRY A;  5D15 A;  3GIR A;  1Q79 A;  5DQI A;  1I94 J;  4TQS A;  1VQY A;  4OIN A;  1DY3 A;  1AZS A;  4PG8 A;  1JLE A;  1FFS B;  4XIU A;  4GFQ A;  4NLD A;  4LIW A;  4N76 A;  2B63 K;  4R5P B;  3MED A;  3PO3 C;  2BE9 B;  3LP0 B;  4JBC A;  3S15 K;  4RW6 A;  2F8M A;  3J7Y U;  4HI1 A;  3TUZ C;  3QT6 A;  3A13 A;  2B4V A;  2WVF A;  3EZO A;  1V6H A;  2WBR A;  3N6M A;  5HMW A;  2E7W A;  3Q8S B;  3CJ2 A;  4NLO A;  3FCH A;  2C3U A;  4J7C A;  4FZB A;  2VHG A;  4YUD A;  1PYT A;  3QJP A;  3HVW A;  2HQI A;  5CYJ A;  1RTI B;  2LVW A;  3DRR A;  4X64 F;  3DDI A;  2NLW A;  1Q16 B;  4GC7 A;  5IM0 A;  2CPF A;  1J5E F;  1W25 A;  1RBO B;  5DLF A;  5HJY A;  2LKZ A;  4M5L A;  2XNR A;  4HI2 A;  1F2H A;  1NK5 A;  3PXG a;  2E2H K;  1U1N A;  1LQ9 A;  3TNV A;  2DR6 A;  1XEZ A;  1RWV B;  2CDR B;  4J9M A;  5G4D A;  2UVV A;  4KKO A;  3NNA A;  1NM2 A;  4PUO B;  4DR3 J;  4F67 A;  1Y0H A;  3TTG A;  3NNC A;  1G1X A;  1FRH A;  1NEE A;  3I56 S;  3EWG A;  4USK A;  2YPY A;  2BV3 A;  4JI5 F;  1HNW J;  4J9R A;  3IA0 A;  2LEP A;  1RDR A;  3N6L A;  5JVH Q;  4DQS A;  1CG2 A;  3ET6 A;  1U1P A;  1T7P A;  1D09 B;  4P75 A;  3ENW A;  4ZVH A;  4ECR A;  1FKO B;  2RT3 A;  3SSQ A;  5BXI A;  3H90 A;  3LWM A;  2ADC A;  2DXD A;  4HHH A;  2E5J A;  1NK0 A;  1L3U A;  1TV6 A;  4P52 A;  1PAU B;  2NVY C;  4I56 A;  3L7P A;  3C15 A;  1T11 A;  3M6W A;  2V69 A;  4O44 A;  4I6Y A;  4USM A;  5JVG Q;  5KFU A;  2ZWP A;  3D67 A;  2XY7 A;  3M8Q A;  5C4X C;  2JVR A;  2XCP A;  4YR3 A;  4J90 A;  4N8N A;  1KHW A;  4IO9 Q;  4FZV A;  4F3M A;  2CFX A;  1VRU B;  3O3L A;  4KAS A;  3SFG A;  2J0S D;  5KOW A;  1HMV A;  2QE5 A;  2HAI A;  3KLI A;  4F4W A;  4ECZ A;  1Y5N B;  1Y1V C;  4P6Q A;  4ZPD A;  1N32 J;  3NOC A;  4FKX A;  3RZA A;  2UUB J;  3Q8R B;  4UZC A;  2HRY A;  1E6Y B;  2OPS B;  2W25 A;  4B3R J;  3P8B B;  5C25 B;  3BBB A;  4G7O A;  2RU9 A;  2HZV A;  4A3D K;  3NRB A;  4PG6 A;  4DX5 A;  4QYR A;  1PJ6 A;  3MMB B;  3M4O K;  2F9D A;  1VQ5 S;  2HHW A;  3A8J A;  3CC4 S;  2DHA A;  1UEV A;  3JSY A;  3LQV A;  5KG7 A;  2P5M A;  1U0H B;  3QBC A;  2WOM A;  2V4J A;  4MIW A;  2RQM A;  5HMX A;  3ZZU A;  3S14 C;  4NAS A;  1RA6 A;  2RHS B;  3RZD K;  2OUG A;  3W62 A;  1XZQ A;  1SI9 A;  5LMU J;  3J7A N;  2E2I A;  4YR2 A;  3HOV K;  2PT0 A;  1FJG J;  4A3G K;  3GTL K;  1EX8 A;  2BE2 A;  3CJK A;  1XTZ A;  3P49 B;  3Q22 A;  1RHJ B;  3HVT B;  2IM3 A;  5FD1 A;  4F02 A;  2CPY A;  3WOD A;  5K8O A;  2MQN A;  4HDH A;  1S6O A;  4ZVP B;  1VBZ A;  4BBS K;  4PR6 A;  3KLF A;  4B3O A;  1NK7 A;  5EGE A;  4KQZ A;  5IOS A;  2ZOG A;  2XI2 A;  4KV8 B;  4ZVQ B;  2ZE2 A;  3HK2 A;  1VBK A;  2RE1 A;  2DO0 A;  4ZPW R;  1R8A A;  4RBV A;  2B9E A;  1JLQ B;  1N56 A;  2H1Y A;  2NS1 B;  1Q1K A;  2MXY A;  2VPX B;  3D6H B;  1O6X A;  2OH2 A;  4MK9 A;  5IC6 B;  4OV6 A;  3NL0 A;  3D28 A;  3I4M K;  1VQL S;  4ED6 A;  1SXL A;  1HQU B;  3ENA A;  3GTP C;  1PG5 B;  4PRF A;  2JEI A;  1SL0 A;  1GT8 A;  3V4I B;  3G4C A;  3KMS A;  1YX2 A;  3VGS A;  1QY7 A;  3K89 A;  2HUR A;  2UUT A;  1C1C A;  4MEX A;  4ECQ A;  3S16 K;  5IXU A;  1EI6 A;  1MWZ A;  3VWS A;  2HKE A;  4ZK7 M;  4USV A;  5GAH I;  4FKY A;  4LF7 J;  4GKK J;  3AB2 B;  1M90 T;  4LVN P;  4B08 A;  4LF8 F;  1LNQ A;  4R0J A;  2ZH3 A;  3DLH A;  3O6Q A;  4WIQ A;  1RT5 A;  2WW4 A;  4DZ6 A;  4KH1 B;  4D3G A;  2W9B B;  4K4V A;  3QAT A;  3H8Y A;  2HZA A;  1J5E J;  3FFI B;  2DNY A;  2G2Z A;  1NO8 A;  5K14 B;  1FNX H;  4WZQ A;  1Y1W C;  1FFG B;  4Y2M A;  4A8O A;  3L4J A;  3QZ8 A;  3T9N A;  1CEZ A;  3N01 A;  4WJB A;  1S72 S;  1K47 A;  3GJR B;  3ZZY A;  3LP2 A;  3GTL A;  1FX2 A;  4A3J K;  3VA7 A;  4OZ1 A;  2V6T A;  4LBI A;  1T3O A;  4ED4 A;  4OYB A;  4DR6 J;  5TMF A;  4DEZ A;  2A18 A;  2KJV A;  4PPD A;  5F8H A;  5D0H A;  5ETR A;  3QT5 A;  1FNO A;  4C8O A;  4FBT A;  2Y1R I;  3LPX A;  2FQQ B;  2Y3Y A;  3DRY A;  4RW9 B;  4XAK A;  4DXL A;  3K7A C;  2VFR A;  4DR4 J;  2ZH7 A;  1F9F A;  5BYQ A;  5I42 A;  1NK8 A;  3A3P B;  2CQ2 A;  1P8G A;  5LMN F;  1FES A;  1UW9 A;  3MEE B;  1DJ0 A;  3HHL C;  4EGL A;  4RNH A;  3ZTP A;  1BE4 A;  4USI A;  4CNY A;  1HWU A;  2OTJ S;  1VBY A;  1O28 A;  4C0H A;  3J81 U;  1X4C A;  4OX6 A;  2R7O A;  5EX0 A;  3KKF A;  4C45 A;  3BUE A;  3HPO A;  2PMH A;  3RBE A;  1EFW A;  4WWS A;  3CCS S;  5IQQ A;  1IJE B;  4YB5 A;  4A8X A;  4I64 A;  5FDL A;  5JUM A;  2AJ4 A;  4JI1 F;  4PQU B;  1WG5 A;  3CCJ S;  2J0Q D;  2NQP A;  2MQQ A;  4E8U A;  3IRX B;  5F0U A;  4RMF A;  1TL7 B;  4N56 A;  5IYB C;  3Q2S C;  2PC6 A;  1H98 A;  3SZZ A;  1JLG B;  1XXA A;  3CO9 A;  2QMW A;  4CLW A;  4FYD A;  2G1D A;  1WEZ A;  2BRK A;  3MD1 A;  4IFV A;  4LF1 A;  2P8I A;  1I50 A;  5KG5 A;  1S12 A;  1OSD A;  2JA8 K;  3LAK A;  4A46 A;  2BQR A;  1Q4R A;  4DG1 B;  2ZD1 A;  2VA3 A;  2JA7 C;  3IWL A;  5HQM A;  3PR5 B;  4U7U D;  3CCT A;  2IIH A;  3PHT A;  2BM0 A;  2XCO A;  1RWW B;  1I6V A;  4X2B A;  5K8N A;  3M32 A;  3MPW A;  1UWA A;  1S7I A;  1M1K T;  1FRL A;  2V8P A;  2FY1 A;  3I9Z A;  2VFV A;  2MYF A;  4P74 A;  2Z2Y B;  2V9W A;  2HGM A;  2ALY B;  2XS2 A;  2CJY B;  4A3E K;  4C11 A;  3GPA A;  2DGU A;  3PW7 A;  1CLF A;  4NLY A;  4LSL A;  4DPX A;  3GV8 B;  1S9E B;  3S2D K;  1ZZF A;  2ZBI A;  1F7V A;  3PNI A;  3TA0 A;  3RB0 A;  1RAD B;  3GR1 A;  4YFK A;  1T3N A;  4GO7 X;  1CJV B;  3CWJ A;  2R2R A;  5GAD I;  2FLO A;  1HI1 A;  3HOY C;  3GYN A;  1U1L A;  2O3D A;  3TJ9 A;  2QTW A;  5L1K A;  1R9T C;  1C1B B;  2C2M B;  3RAM A;  3GFZ A;  2CKW A;  2UUC F;  3MTJ A;  3JSM A;  5A0Y B;  1O25 A;  4DFK A;  3IAM 9;  1K83 C;  2QMU B;  1DQ8 A;  2W9C B;  1VK8 A;  5LL6 d;  4BY7 K;  2D9P A;  1FA0 A;  3OL7 A;  4RW4 A;  3MR3 A;  3HI9 A;  3HFZ B;  1RAC B;  3V6J A;  1YRX A;  5KFA A;  2J7W A;  4DU7 A;  3TQ1 A;  2DTJ A;  4HEA 9;  1R0B G;  2CFA A;  2LU1 A;  2QLX A;  4DLG A;  4WP9 A;  1GAO A;  2JA5 C;  3EDQ B;  4DUZ J;  1GXU A;  3OV7 A;  1KS2 A;  1FFW B;  4A93 K;  4FXV A;  1QM9 A;  5C42 B;  2DHS A;  5F8L A;  3OXG A;  1Z1Z A;  2IMW P;  4U67 Q;  3UCZ P;  1HNV A;  4USU A;  4MIA A;  1S0V A;  3LAM A;  3G8T A;  2WVD A;  2IVM A;  1O0P A;  5DJB A;  3OJU A;  3U1N A;  2IYI A;  1CS4 A;  2W2M P;  2CA9 A;  1DAX A;  1LKZ A;  4GMK A;  5J1E A;  1U2C A;  3N79 A;  2D3O R;  4A3M C;  2PE8 A;  2V67 A;  2HHV A;  2GVZ B;  2YNI A;  4OHZ A;  2YVS A;  2V6A A;  3CIM A;  3THT A;  2GIR A;  3GWC A;  3I5A A;  5A2Q U;  2MTL A;  4KN4 A;  5HLF B;  3S1Q K;  2Y1L B;  3NLC A;  1BLU A;  3N5F A;  1UWB B;  1RBA A;  3R7B B;  1WUU A;  5F8J A;  3BDP A;  1EP4 A;  2NPI A;  4ZJO A;  3QFH A;  4CYU A;  4CO4 A;  2FVC A;  4OZ0 A;  2R93 C;  4AXJ A;  3OLB A;  3DI6 B;  3S1M C;  2DNH A;  2PFD A;  1S0M A;  3TAM B;  4HYK A;  2EG2 A;  1ZAW A;  2YX1 A;  4UY8 T;  4ATN A;  5KFO A;  2CQD A;  3R6L B;  3T00 A;  1C2P A;  4U7U K;  3T5H A;  3AXM A;  2BXJ A;  1VQ4 S;  5C2G A;  1SH0 A;  1T9W A;  1RSC A;  3BSA A;  4AQY F;  1V3S A;  3NNH A;  1SUQ A;  2YKQ A;  3RRH A;  1H0H B;  5E3P A;  4OYX A;  4LFB F;  4O0N A;  4KHM A;  4WTY A;  4JI3 J;  1GX5 A;  1E6V A;  4S0M A;  4CIO A;  3I0R B;  3R2D J;  3VAL A;  4YFX A;  1O8B A;  5KFI A;  4KFB B;  3GTG A;  2I6W A;  2BYC A;  5KT2 A;  1RA7 A;  3IR5 B;  3F73 A;  4LJM A;  4B9S A;  4C2M K;  3GTJ A;  2UUA F;  2MGZ B;  2CQC A;  2R7T A;  3W3S A;  3A8K A;  4KO0 A;  4NLT A;  1W2I A;  1BC6 A;  4V19 J;  1HA1 A;  2RHQ B;  3QSI A;  3R3T A;  2FJX A;  2K7J A;  4Y34 A;  4DBQ A;  1O2A A;  2KT2 A;  3CCM S;  4CTA A;  2B9W A;  2JLE A;  3J81 j;  3DOK B;  3DDK A;  5D0E A;  4QWA A;  4RW6 B;  4LF6 F;  2B0G A;  4NYZ A;  2WON A;  5HMY A;  3DRS B;  4BC7 A;  2WB1 D;  4DQR A;  2YKM A;  2LQ5 A;  5KFK A;  1LW2 A;  2E5L J;  1FDD A;  5IS2 A;  3RBX A;  2R2S A;  1IR0 A;  2CDQ A;  2D7S A;  5ETK A;  4DQP A;  5JMN A;  4RUA A;  3D6F B;  3MM6 A;  1H7X A;  3CED A;  1EB0 A;  1OQ3 A;  3MEG B;  5BYS A;  1X60 A;  3HHD A;  1F9E B;  2FVR A;  1NUE A;  2QLF B;  2KVQ E;  2E9Z A;  4ELV A;  3QAE A;  2NVT C;  3M2U A;  3KK1 A;  4JK1 A;  1RXO B;  2W8K A;  3U1M A;  1YZ7 A;  2YU9 K;  2JLG A;  2YNF A;  4PWD B;  2ZUE A;  4ENO A;  1HHS A;  5B0G A;  3PX0 A;  1OSC A;  4J9V A;  3PHE A;  2BQU A;  3H2L A;  2RNE A;  2CQH A;  4LRB A;  3PZP A;  4CO0 A;  4MFB B;  2VUM K;  2FJB B;  3BZQ A;  1O27 A;  1CBK A;  1JXE A;  2JEG A;  1PCA A;  4WYL A;  5J2M A;  3GTM C;  2GMH A;  3UQS A;  2FB0 A;  2GHV C;  3KK2 B;  3M4X A;  3ZZZ A;  1HBO A;  4E98 A;  1EK8 A;  2QL7 B;  3NBP A;  4KJI A;  5IT9 U;  2IY5 B;  2ZZN A;  2ZJR Q;  2CJQ A;  2YBV A;  2KL8 A;  1RTJ A;  3UNY A;  2HQC A;  1LWC A;  3THP A;  2NXE A;  2F8E X;  4F0H A;  4BWJ A;  1YTY A;  1WTF A;  1W26 A;  2R92 K;  1JLF A;  1DAR A;  5IP9 C;  3C15 B;  4C2M A;  1M5V C;  4X84 A;  2MLY A;  2A10 A;  3I4H X;  2KWA A;  2DGX A;  4DCP B;  3M8Q B;  5J2P B;  3R9L A;  4WIL A;  2W2P P;  2ASL A;  4WTO B;  1Q7L B;  1RLD A;  2DXE A;  1J2V A;  4OIR A;  4AT1 B;  2DRB A;  3FEY B;  2QA4 G;  2V6U A;  5EX3 A;  3JAM U;  3D6M B;  1UET A;  4BXX K;  4FF3 A;  4LBP A;  4MKY A;  2AYB A;  1JLA A;  3KLI B;  4QWE A;  3T3F A;  4HHU A;  4PEO A;  1UW4 A;  2EC2 A;  1JQG A;  3RR7 A;  3OFE A;  3B78 A;  4M5K A;  2DNM A;  2Y9H A;  3W9J A;  4PZV A;  2MHE A;  4DR7 J;  2C42 A;  3NGK A;  3HJF A;  5J1N A;  4IG3 A;  2GMJ A;  3WBZ A;  3IAS 9;  5EN1 A;  4F3Q A;  1IM4 A;  4P5A A;  2KXN B;  3J80 Y;  4IUF A;  3ILL A;  1IKX B;  3VAK A;  2O66 A;  1RT6 A;  4PKD B;  5DO2 A;  2LEA A;  2V4J B;  4V1A k;  3NGS A;  2XUL A;  2K3I A;  4Q0B A;  1B7F A;  4K4U A;  4O0I A;  1KOO A;  5IFM A;  3M7V A;  1M5P C;  2O1P A;  2VUM A;  3IPJ A;  1TEL A;  1RAJ A;  5EDW A;  4Y0F A;  1WG1 A;  3G8S A;  1I6H K;  3OVB A;  5IYD K;  1MML A;  1YJW S;  1S79 A;  3KJV B;  5D4L A;  1J6X A;  2WBM A;  4QU6 A;  4NMX A;  3H0P A;  3D4J A;  1U7L A;  3GTK C;  3CCU S;  4CWB A;  4I7F A;  1MMD A;  3SCI E;  4IG0 A;  2ZE2 B;  3NOG A;  1UPP A;  4IOB A;  2EI5 A;  2VG5 A;  2BQ3 A;  4DL4 A;  2EBB A;  4DV0 J;  4DR5 J;  4YDD B;  2OEK A;  3GIK A;  5C2C A;  1V5I B;  2GW8 A;  3KTQ A;  4I0W A;  1H72 C;  1USO A;  1JLC A;  4NLS A;  4WP3 A;  2Y1I A;  1S4E A;  4JI7 F;  4F26 A;  2KXH A;  4DV4 F;  1R0A B;  2KH9 A;  2G4B A;  1XWL A;  1V3Z A;  4CP5 A;  1WOP A;  4F2R A;  2HLU A;  3J7Z T;  4JI4 F;  2AGQ A;  1CUL A;  4LQY A;  4OIQ A;  3MM9 A;  3D6T B;  1N6Q A;  4C8K A;  1TKT B;  4HKQ A;  1RBL A;  4DR1 J;  1K1S A;  4QCL A;  4RZR A;  1ARO P;  2NVQ K;  3K8V A;  1JJ2 R;  3T1A A;  2WSE C;  2ZBP A;  4LF6 J;  2KT5 A;  3S7R A;  4ZPA A;  3MOZ A;  4LF5 F;  1DQA A;  1S10 A;  4F0K A;  4WK3 A;  5AXL A;  5DQH A;  2EFQ A;  2DCU B;  1B4S A;  4U8V A;  1IWG A;  1VQM S;  5M2U A;  3DLE B;  4KAR A;  1N34 J;  2RAQ A;  5HAO A;  4F2S A;  3E01 B;  2XZW A;  1TWA C;  3QSY B;  3JQJ A;  1BGW A;  4FF2 A;  1HYS A;  3L3C A;  1ZXO A;  5B0E A;  2JHE A;  3HOX K;  5A8W B;  3Q8Y A;  1RTH B;  4NPO A;  1GTE A;  4KC5 A;  4QOT A;  1T0T V;  3CE8 A;  3OW2 R;  2VQE F;  4FNH A;  1N5Q A;  3DMJ B;  1LOU A;  1RAB B;  2HZC A;  4X4V A;  1MSW D;  2RQ4 A;  4KAW X;  4RNN A;  3CD6 S;  3MUM P;  2OPR B;  2C2R A;  1M5S A;  3JTP A;  4O4G A;  5ETS A;  3RUB L;  4KC6 A;  3OR2 B;  5L1J A;  1C0U B;  3UN2 A;  3ZTR A;  3LH2 S;  1T02 A;  5KFW A;  1JNR B;  3IGN A;  3GTQ C;  3ZTO A;  5IOT A;  1S1T A;  4G65 A;  4AYB L;  3M3Y C;  4URG A;  4C48 A;  3NWR A;  4QW9 A;  3KLH A;  3DLB A;  1NSK L;  4NE9 C;  3G71 S;  3VVT A;  2LXU A;  3CPW R;  4IFY A;  3MM5 A;  3W9H A;  2YPZ A;  2VOD A;  4MT1 A;  3CCW A;  1VS3 A;  4O3P A;  1DTT B;  1GMU A;  5F8I A;  2EBE A;  3FBE A;  4EBD A;  1OS5 A;  5A76 A;  4A3K C;  5F3Z A;  2CAJ A;  3AQO A;  1HI9 A;  3KLE B;  2J9C A;  3CDE A;  1TWG C;  2ZKT A;  1WI6 A;  1Y4Z B;  2J8S A;  3G6E S;  2A6E A;  2BMB A;  3KJN B;  4LF9 J;  2HQF A;  4K50 A;  2NCK L;  2J0X A;  2HHS A;  1X5P A;  3MAA B;  1IKV B;  1CQN A;  1QVF R;  4X4Q A;  4ZS6 A;  5E3C A;  3T19 A;  2GC8 A;  5HMZ A;  3IR7 B;  4IFV B;  3KDN A;  4YME A;  1Q7Y T;  3QRR A;  3MWB A;  2V9K A;  4KPY A;  4CLK A;  2UV8 A;  2VFS A;  2YKN A;  5AE1 A;  3M2R B;  2DIV A;  4ZVU B;  1A7G E;  1S57 A;  2WVB A;  4ZA1 A;  3DLL Q;  2WSC C;  4NI2 A;  2R8K A;  2VF3 A;  1OIA A;  1VJW A;  2EVZ A;  4EU0 A;  2C2D A;  3HOU C;  1UPM B;  4O3R A;  3ZO7 A;  2EFO A;  3FDS A;  1M5K C;  1S1X A;  3RZO C;  2MY8 A;  4DPU A;  2FJD B;  3F0N A;  2BKO A;  4WJ3 M;  4C3I C;  3B6B A;  3ZZ0 A;  4DUY F;  1FEE A;  4YFU A;  1S5Z A;  2VBZ A;  1T9T A;  5SZT A;  3R6G B;  2WTF A;  1BQX A;  2BE5 A;  4ZJQ A;  2WAQ D;  3DYA B;  1TAQ A;  2ABY A;  5EGY A;  1YI2 S;  3F44 A;  4Q44 A;  2YKP A;  1JK9 B;  5F8M A;  2XZT B;  2CQ1 A;  3FVY A;  2NVY K;  4Y2I A;  2AYG A;  4ELT A;  2HLT A;  3FK4 A;  2F4F A;  5CYQ B;  3V2U C;  3FKI K;  1SC6 A;  5C4X K;  1RHU B;  4GTC A;  3JSM B;  2AT1 B;  3LUY A;  3B82 A;  3EVO A;  4ER8 A;  4NXN J;  2QEX S;  3GV7 B;  3QFW A;  3S2H C;  5B0A A;  4DV4 J;  1VFJ A;  1GX6 A;  2XSJ A;  3NGU A;  2VFT A;  1TFW A;  2V2Z A;  1Y1V K;  1WHY A;  1KQS R;  3PFO A;  2ZH9 A;  4XSX A;  3M1V B;  2ZVI A;  2MKJ A;  3VHQ A;  1FKP B;  4ILM A;  4KT0 C;  4BHQ A;  4NCG B;  1PC4 A;  4GTL A;  1O2B A;  1X4G A;  1USM A;  3W5X A;  3S17 C;  2K1R B;  2PN6 A;  4HLB A;  3VTI A;  3HKZ L;  4KSE B;  1UVK A;  3W2W A;  2CPD A;  4LF5 J;  1S9F A;  3CMQ A;  2CNK B;  3CCZ A;  2JA6 C;  4A4J A;  1EJ7 L;  2QLJ B;  4ID5 A;  2PMZ D;  3I55 S;  3K17 A;  4TN2 A;  2KT3 A;  3UDV A;  2DPJ A;  4JUZ A;  3DFE A;  1DUR A;  2AMC B;  2YWE A;  3K5P A;  3L7U A;  3GIM A;  1N88 A;  2YNI B;  1WC4 A;  4K4X A;  2ZM6 F;  1LWF A;  4XLP A;  3CW2 C;  4W92 B;  3AJ2 A;  3HX9 A;  2KJW A;  5LSO A;  2PO4 A;  3DXJ A;  4A3F C;  1RWX B;  4XTT A;  1EQR A;  2NXU A;  4GO5 X;  1EKS A;  4B9N A;  2R7S A;  2JSX A;  3R5J B;  4ED3 A;  4QQB A;  3LGM A;  3VAH A;  4G7H A;  1T03 B;  1L5U A;  3ITH B;  2XLI A;  4IRC A;  5DZ6 A;  4L76 A;  4DHV A;  1KP6 A;  2KZM A;  3TR5 A;  4X4S A;  4A8S A;  2I1R A;  3VAI A;  2NVY A;  3BQ1 A;  2CG8 A;  3Q23 A;  1KSP A;  4MJK A;  2XMJ A;  2PSZ A;  1HBM A;  5E33 A;  1T9U A;  1U1K A;  1LFW A;  4X4U A;  4A48 A;  2HS0 A;  2K8G A;  1WF1 A;  3OSN A;  1AYE A;  4NLQ A;  4M8L A;  2DNZ A;  3GTP K;  3FZ2 A;  5KT6 A;  4ED7 A;  1E6V B;  5EWF A;  2YWH A;  1SH3 A;  3H0G C;  4C3J C;  1HBN A;  1IBL F;  4RNF A;  2FHJ D;  4F4K A;  3RW6 A;  3GEI A;  3AT1 B;  4TXS A;  3S0X A;  1Y1V A;  1S9G A;  2KTQ A;  4ECX A;  3RAX A;  1HIY A;  2NXC A;  4WPA A;  2DR8 A;  2UVR A;  2IVY A;  3M05 A;  1RT7 A;  2LA6 A;  1NJZ A;  2P6S A;  4LK1 A;  4KO0 B;  2J6S A;  4JI6 J;  1SJF A;  3T5L A;  2NXJ A;  2GAH C;  1M1H A;  4A8W A;  2B4P A;  1B7Y B;  4LVO P;  3GEH A;  4DPW A;  3POT A;  3V4M A;  3EXY A;  2XI3 A;  4R8U B;  1WCM C;  5EWE A;  4DSF A;  4BY1 C;  2V94 A;  2DHG A;  2H5I B;  2YH0 A;  1RQ0 A;  5C24 A;  2HW3 A;  2GO8 A;  2DR7 A;  4K8R A;  3R5B A;  2DBB A;  3UDC A;  1RUS A;  3IWX A;  1Y1W K;  5GAH U;  1DLO B;  4A47 A;  2V2V A;  2ZUF A;  5L1L A;  1LW2 B;  2XZD B;  3QIP A;  4QR0 A;  2G0J A;  1K9M T;  4MK8 A;  1FRI A;  3TRG A;  1X4F A;  1YIT S;  4C3M A;  2FC9 A;  1IR2 A;  5M5W K;  4ZCL A;  1FE0 A;  5HI7 A;  1ZET A;  3WC0 A;  5KFG A;  1ZPW X;  4A3C C;  2VQF F;  4F36 A;  2MKH A;  4UOH A;  3PO5 A;  4OHY A;  1ROF A;  3GSD A;  1IBM F;  1Y3K A;  4B9U A;  3SSS A;  4EO6 A;  3UVJ B;  2HNY B;  4DL7 A;  1D9D A;  2J6U A;  2N82 B;  4B3T F;  4ZVG A;  1KRP A;  4RWX A;  1UA0 A;  2IHR 1;  2HHU A;  3K7A K;  1ACM B;  2VJV A;  3GJT B;  2FJA B;  4DN9 A;  1SFO C;  1TR0 A;  3IBF B;  1XXB A;  4QWD A;  4Q7A A;  4EK2 A;  1TKZ A;  4LRA A;  4YY3 J;  1R8C A;  2GJ2 A;  3W5Z A;  2XYH B;  4K7Q A;  1NPK A;  1QE1 B;  3M9M B;  3TZX A;  4C3L A;  1CSJ A;  2DNL A;  1BHN A;  5M2P A;  2R8I A;  4C97 A;  2ASJ A;  3MM8 B;  2H4W B;  3C16 A;  4PXB A;  3GTP A;  4Q2L A;  2C2K B;  1HKA A;  2W9A A;  1VQP S;  3L9Z A;  1VQ9 S;  3PRB A;  3ETM A;  1KBR A;  1KFD A;  2KKH A;  1HNZ F;  4TLR A;  1WSV A;  2HIY A;  2MQ8 A;  3CT9 A;  3BPD A;  3L95 X;  4DV2 F;  5ETQ A;  2HVE A;  5H9E J;  1T05 A;  1QSL A;  3TAP A;  3HHE A;  3MM7 A;  1FJC A;  1IL2 A;  1FT8 A;  1JXL A;  1K73 T;  1L0W A;  3GYX B;  3B4D A;  1IKW B;  3CUN A;  2JA7 K;  5HBM A;  3DLK A;  4M94 A;  1SVD A;  2GX8 A;  1F0X A;  3FQK A;  1EHW A;  2LQ9 A;  3MDF A;  4A8K A;  2W7V A;  1JLB A;  1JLA B;  3H5S A;  4NCB A;  2WRM A;  4N47 A;  1Y1W A;  3OHB A;  1IBK J;  4WKR A;  3K57 A;  4MKB A;  4ZVF A;  4QIG A;  2OML A;  2HMI B;  4HL9 A;  1J98 A;  2AZ3 A;  1VQK S;  4C7Q A;  2EBG A;  1GEH A;  2YNG B;  1U6F A;  1I5O B;  3HD1 A;  2VG7 A;  3R5G A;  3ORE A;  1AFJ A;  1HI8 A;  1QJH A;  2ZC3 A;  4IOC Q;  4DLE A;  1DTQ A;  2BJD A;  1NLK L;  1JKH B;  3CJS A;  2NYI A;  5L8R C;  3SQG B;  4JYA F;  4OZL A;  2CPI A;  1N0V C;  1T95 A;  3KHH A;  4TY8 A;  1QSS A;  2RKI B;  4KB4 A;  1MRO A;  3ULH A;  1HAR A;  5DDR C;  2FPH X;  4IRD A;  3HHL A;  2IMO A;  4HAC A;  2AHO B;  1V5V A;  3DN9 A;  2ZBR A;  5KFE A;  4WFA Q;  3TAR A;  1DRZ A;  4H4O B;  2ZIT A;  5KFN A;  3OPF A;  1Q8B A;  1TKX B;  2KN4 A;  3N5B A;  4P72 A;  4YFN A;  4JV5 F;  2A6M A;  4UW2 A;  3KK3 A;  4O3S A;  2OEM A;  1BQN A;  3MUR P;  4LQ9 A;  4ES3 A;  1GMV A;  2LDY A;  3QO9 A;  2CPZ A;  3AAW B;  5GAD U;  5CD4 H;  1IBL J;  1WC1 A;  2DEI A;  2GNK A;  3PW0 A;  5TMC A;  5HO4 A;  1FRX A;  2CVI A;  2JA5 K;  4OHV A;  4CO5 A;  3SZ2 A;  2GSU A;  3QRQ A;  1JLC B;  2D69 A;  2QC3 A;  2JZ5 A;  2BRL A;  3A8I A;  1QSY A;  2AJ1 A;  4ZCK A;  2F4V F;  1WD6 A;  2JA7 A;  4Y6I A;  2ZVS A;  1HQE B;  5H9F J;  5CHP A;  2W24 A;  3K0J A;  1K1Q A;  2V6S A;  5HVH A;  4PG7 A;  3MD3 A;  3CD5 A;  4H4K C;  1N36 F;  1UVM A;  1J6W A;  4PXD A;  3I5B A;  1RAO A;  5B08 A;  1BGX T;  1VQ7 S;  4FPI A;  1BQM B;  1TL4 A;  4A3M K;  5D3G A;  4CLU A;  5C4J C;  3SSR A;  1UZH A;  5I3U B;  2RF2 A;  3M8R A;  4LQ3 A;  2IC3 A;  4I6W A;  4WP8 A;  2MB0 B;  3HFK A;  3IG1 A;  2YTC A;  5D4O A;  4Q45 A;  1TWF C;  1SL1 A;  1OO0 B;  2GVD A;  3CF5 Q;  1HWK A;  1VLO A;  2MZ1 A;  2FGO A;  3DOL A;  4NWB A;  3SI8 A;  2GCF A;  4M63 A;  4UT4 A;  1A0O B;  3S1M K;  2RDJ A;  4BBY A;  1R89 A;  1RU1 A;  2Z56 B;  1KR4 A;  1NZ8 A;  4C0O C;  4JI0 J;  2C22 A;  4IDK B;  1D1U A;  1URR A;  1R9T A;  4G0V A;  2NXN A;  3TEG A;  3M30 A;  1RT1 B;  2JRS A;  4GVL A;  4NML A;  3AQP A;  5LSL A;  3HMJ G;  2ZUA A;  4OYA A;  4QJV B;  3ZXW A;  4EUV A;  1LWE A;  2I9S A;  1YJU A;  3BKU A;  4DPT A;  1PBU A;  4XSZ A;  1K83 A;  2NVX C;  5DDP C;  1WAC A;  2DNK A;  1HD0 A;  3KNG A;  4DJB A;  2MY7 A;  2J76 E;  4OJG A;  5T7L A;  4RW8 A;  1VI7 A;  3QPI A;  2CUY A;  4LJZ A;  4MQ9 A;  5KG4 A;  4P73 A;  5BR8 F;  2RD5 C;  4ED1 A;  1RLC L;  2RH3 A;  2FGC A;  2IDL A;  3KLH B;  3QQC D;  4ICL A;  5GVQ A;  3T1H J;  4K4Z A;  4BKW A;  2D3O 1;  4QIW D;  1HPZ A;  2CWK A;  2MMY A;  1N52 B;  4NXM F;  1T8E A;  4P2S A;  1IQT A;  2J7U A;  4B17 A;  1J5O A;  3V6D B;  3J7Z 5;  2AX1 A;  2MEW A;  5DDQ C;  3KNA A;  1MU2 B;  2OIH A;  2MHN A;  1ZH5 A;  2B9X A;  1IUJ A;  3JTO A;  3TX0 A;  4GTD A;  2BAB A;  5IV4 A;  3I6P A;  5KFT A;  3QLH B;  3NY0 A;  1X4H A;  2D6F C;  2GSO A;  2XCA A;  3L4B C;  1X4A A;  2OJ3 A;  1I3Q C;  2L9N A;  4X65 J;  3HVR A;  2L08 A;  4ECU A;  1D8Z A;  3ETO A;  3VZI A;  1RAH B;  3US5 A;  2HWH A;  1I94 F;  4PPZ A;  1Q5Y A;  4ZCI A;  2ZHO A;  3OFG A;  2OPP A;  1CJU B;  1F5A A;  2KZZ A;  5ETL A;  2NVT K;  2XO7 A;  4KY3 A;  4CM2 A;  1Q86 T;  2IRX A;  3TW0 A;  5CYM A;  3VGV A;  2B63 C;  5L39 A;  2R93 A;  2BW2 A;  3OXL A;  3S15 C;  2VC0 A;  4KM9 A;  4O3O A;  3O5T B;  5KFF A;  3Q8Q B;  2C3P A;  2W01 A;  5H9E K;  5D4P A;  5CCL A;  3IM8 A;  1RE1 B;  1U0S A;  3GTM K;  1O24 A;  5HP1 A;  3MF5 A;  3K5N A;  4NEY A;  2PHC B;  3AY0 A;  3AA9 A;  2AEJ A;  2AV5 A;  2HFU A;  2KI2 A;  2D41 A;  1ZS6 A;  1S1V A;  1XN9 A;  4I2P A;  1PBA A;  1KEK A;  3UWT A;  1I3O B;  3BGL A;  2E2H C;  5L9X A;  3M9O B;  1I6J A;  4JV5 J;  5ETO A;  1KTV A;  4AFF A;  2ZC4 A;  1JNZ B;  4EYI B;  4DR3 F;  3C6U A;  3SFU A;  1TL5 A;  2BJ3 A;  5IWA J;  1XXC A;  2VPY B;  3MMA B;  2MQL A;  1HNW F;  1RCX B;  4Z37 A;  2WVC A;  3G6Y A;  1TTH B;  1KTQ A;  2HGN A;  5DRK A;  3MOJ B;  1NPR A;  1SV5 B;  5AJ3 J;  4DS5 A;  3MPY A;  5LSR A;  3KDO A;  3MPV A;  1DCO A;  3NCP A;  4G1I A;  4ZPC A;  4ED5 A;  2GQQ A;  1P1L A;  2XSJ B;  1WHW A;  3F41 A;  1ZA2 B;  2GHP A;  4FVC A;  2DCL A;  1LXN A;  1S0O A;  1VGX A;  2B7B B;  3JYT A;  3T5J A;  3W66 A;  3A1Y G;  3IS9 A;  1CJT A;  3OVA A;  1N36 J;  4K4S A;  1LWX A;  3P4U B;  1H3D A;  3T1Y J;  4C8N A;  4XCH A;  3CJ0 A;  1XPP A;  2EFV A;  4XDC A;  1MWQ A;  1NKE A;  2KHC A;  3CAG A;  4RUB A;  1WTB A;  1Y5L B;  2MKY A;  3PYD A;  5FLM C;  2DJW A;  3W2W B;  1S99 A;  4KH0 B;  4P10 A;  2RU3 A;  3UDE A;  4RUH A;  3ISZ A;  4LR7 A;  3RB4 A;  2PI4 A;  5LJ5 Y;  1KQF B;  2MDA A;  5IT0 A;  3ADA C;  3TAN A;  1N32 F;  2E44 A;  2UUB F;  4P71 A;  2B5J A;  3ZTS A;  4B3R F;  1RHM B;  4MMO A;  3G82 B;  3THV A;  4USW A;  1OMS A;  3DLJ A;  1N5Y A;  3CCR S;  4Q5V A; 
#chains in the Genus database with same CATH homology
 1PJ6 A;  3TTG A;  3ADA C;  1WOS A;  3GEI A;  1WOO A;  1WSR A;  1XZP A;  1V5V A;  2GAH C;  3TFI A;  3AD7 C;  3GEH A;  1X31 C;  1WSV A;  1YX2 A;  3GEE A;  3A8J A;  2GAG C;  1WOR A;  3A8K A;  1XZQ A;  3GSI A;  4PAA A;  4P9S A;  5L46 A;  1PJ5 A;  1WOP A;  3TFJ A;  1XZP B;  3AD8 C;  1VRQ C;  1VLO A;  3TFH A;  3AD9 C;  3A8I A;  1PJ7 A;  4PAB A;  3GIR A;  1XZQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...