3AD8C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with pyrrole 2-carboxylate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad8C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad8C01
3ADAC 1VRQC 4PABA 1XZPB 1WOOA 4PAAA 3TFJA 4P9SA 3GIRA 1WOPA 1WOSA 3GEEA 3GSIA 3TFHA 1VLOA 2GAGC 1XZQB 1V5VA 3A8IA 3A8KA 3AD8C 1PJ6A 3GEIA 3TTGA 1WORA 1PJ7A 1XZPA 3AD7C 3A8JA 1YX2A 3AD9C 1PJ5A 1WSRA 2GAHC 1WSVA 5L46A 1X31C 1XZQA 3TFIA 3GEHA
chains in the Genus database with same CATH superfamily
4I2PB 3MMCB 4O3RA 4LFCJ 2LMIA 4CLTA 3JQMA 2NPIA 1NB7A 3PO3C 1AFJA 4K4TA 3DOLA 2I5JB 2K8GA 3R6LB 4CT8A 2VOOA 1U1LA 4FM9A 3POTB 2HWHA 3OUYB 3RZAA 5B0BA 2VASA 5E0OA 1RT3B 3MCNA 2FQTA 2LDYA 2VDHA 1NHVA 3OL6A 3GTOK 3BGUA 4BWMA 4KAIA 1WD6A 2PI5A 1PAEX 3H4BA 4YOEA 3THPA 3U7JA 1H3DA 3SCLE 2K2PA 3JTPA 2HZVA 3DNCA 2IBOA 1CEZA 3PIPQ 2FVRA 4G7HA 2E5HA 3C16A 4ZJQA 4A3EC 5FDLA 1LFWA 2QSFA 3JAMU 1XZPB 1UJ4A 4I64A 2Q43A 3ITHA 1RK8A 3OJSA 3TX8A 5A2QU 1NDPA 4ZPCA 3I9ZA 2XO6A 1BWEA 3L7OA 2L08A 3N0CA 4YFKA 1JLEA 3HZEA 3J81U 2I2YA 4P5AA 2ALYB 3EXCX 3MECB 1EP4A 1OPZA 3EMTA 3HVTB 1QLNA 4LVOP 3TJAA 5F8JA 4I2QB 3MFHA 2MQLA 1DZ5A 4NMXA 1R89A 4CLLA 4KPCA 1L3TA 4DJBA 3ENQA 1UEKA 4EMDA 1N4LA 2BE9B 3G6VA 4M5GA 2V69A 2ZH2A 3FCHA 5DQIA 2HMIA 2XYGB 2LQ5A 4QU6A 1JLCB 4OZ1A 4KC5A 5IYDK 2Z8QA 1Y1VK 3C46A 5DS7A 4DF8A 3W2WA 1N34J 2HNDA 4R25A 4I56A 4RU9A 1LWEA 1UAWA 2NYHA 3BQ2A 4O4RA 3MPUB 4U96A 3WODA 2OI2A 5KFMA 1NSQA 4RPFA 1RAFB 4NASA 1V5VA 4NPOA 2HHUA 3MM9B 2DCUB 2B8QA 3I5CA 2O5JA 2R2TA 1VFJA 4OX9J 1FRIA 1SQGA 4GVBA 2FY8A 5KFZA 1YRXA 4X4NA 1XR7A 3JQJA 1UETA 4C2MA 4X65J 1FF2A 2EFGA 4GTBA 2YWFA 1WHXA 4X64J 3QRQA 3AOCA 2W2PP 3AD9C 5HAOA 4Y00A 2QLJB 4TU8A 5JFEA 2V9KA 2DPIA 1VRQC 1Y5NB 2AEFA 3FMWA 1O27A 1EHWA 1VMBA 2ZH4A 3LWLA 1S6PA 2DNZA 3ENVA 3NGDA 1LW0A 3O3LA 1TWCA 1SH0A 1S1WB 1TMJA 1X4BA 3L09A 4KB4A 2KXFA 3DLKA 1VLYA 5D6GA 3S17C 4ZP6A 1N54B 2DT9A 1QDUB 3JSYA 2P9GA 2Q3PA 2H65B 1VK8A 3VGTA 2B4OA 2R9LA 1Y9OA 1U0HB 2CJXB 3FKIK 4ZDNA 2QGFB 1SQFA 5IWAF 2K7JA 1KKHA 1F3VA 1SJ3P 4DR4F 2DNQA 2GQ2A 3GIIA 3R2CJ 3UN2A 3SZYA 1GMWD 4QYRA 3VAGA 3W9IA 1T3OA 4C8OA 4GC7A 1XR5A 5ETLA 2DGOA 4N5SA 1RWNB 2ZZTA 5ETPA 3M1VB 3SFGA 1VQ7S 2WBMA 1RBLA 1Q8BA 2HPUA 2ZM6J 4G3IA 3S15K 2NREA 1RAIB 2DVIA 2W8KA 2ZH6A 5CCLA 4ZCLA 3TVYA 1DJ0A 3M9MB 3RBEA 5J1PA 3TFJA 1NO8A 4O4GA 4P2MA 1SUQA 3IG1A 3DCAA 2AGQA 3SCJE 2P6SA 2UXDJ 2ZHOA 3S2DK 2OPQB 3EE3A 3K7AK 2E5GA 2RNEA 4EUVA 3PX6A 2JOQA 1Q8IA 1Y11A 3OD2A 2C42A 4G7ZA 1F7VA 3IM8A 4JI4J 5A8RA 2V9WA 3LP1B 4DUYF 2XS7A 5C4JK 2B63C 1WF0A 3EDQB 3OV7A 2GVZB 3VZHA 4M5DA 4PUOB 1D0EA 2B4VA 4TQRA 2R92K 1N32J 4XSXA 5LMNJ 1XXBA 3FKBA 4GKKJ 3V4IB 3MOJB 2XS5A 4B9NA 4ED1A 4CLWA 3S1QC 3TEHB 3G6ES 2YNHA 4DPTA 4AYBL 3OBIA 1K9MT 4WZQA 1AB8A 2DHGA 3B8HA 2KTQA 3S01A 2BOPA 2VOPA 1FERA 2XCOA 3NMRA 1MNEA 2IRXA 4DG1A 1LWFA 4H54A 5EN1A 4CIOA 3D66A 2ACYA 4QU7A 1IKYB 1CQMA 3GTPA 2F40A 1UTAA 2MZRA 3TJ9A 3CJ5A 3MCOA 2DKOB 3SDEB 3LF0A 3CW2C 2HVIA 5F8MA 3GYGA 3HHLB 1YNJA 5EX3A 2KFZA 2Y3YA 2QRRA 3V6JA 1T0TV 2RQ4A 5F8NA 3I96A 1IR2A 1RT2B 2JA6K 4OZ5A 3L4KA 1SL1A 3LA0A 3T5LA 4P5BA 1HNXF 1S1UA 1U24A 3HOYC 5J2QB 2OKQA 4A93C 2RB7A 3RZOK 1S1VA 5ETTA 4A3BC 1O26A 2JL9A 3TR5A 3BGRA 3LANA 1GXLA 2GA7A 3ZTSA 4QYZJ 3MMAA 4TU9A 2ZC3A 3T01A 3GIKA 2V6SA 3GTLA 1IJFB 4OHYA 3RR7A 2KYXA 2CYYA 2ATCB 3DI6B 4DR2J 4ELUA 4CT9A 3A3OB 2CFAA 5EWEA 1FTRA 1OPIA 2OTLS 2B5JA 5K8PA 3K2YA 5LXRA 2VC0A 1FRHA 3FMBA 3PVXA 3TVZA 3AXMA 1F0XA 1H2VZ 1E6YA 4JV0A 1NKCA 3J7Z5 2C2OB 2WBRA 3GCXP 1AZSA 4JI1J 1TUGB 1B4SA 2BE2A 2AHOB 2BV3A 2Y1IA 2C2KB 3D1HA 5KFPA 1L5UA 3CCMS 4MFBB 4LREA 3PTWA 3EX7B 1BWVA 2CPEA 4Y2AA 1QSYA 3TNVA 4XCHA 1RTZA 1KHWA 2XZDB 4EZ9A 3PV8A 4B3RJ 1XC9A 1BLUA 1CJTB 5GMEA 3G6XA 4IYQA 3MEGA 4ZLLA 4JI6J 3VGSA 1USOA 3LOUA 2QJ3A 3AD7C 2FVPA 4EK2A 2R42A 1RADB 3QT7A 3IR6B 4BLGA 1LW2A 3I0RB 3H5SA 4KPYA 3QYYA 2GX8A 4DN9A 4DFPA 3HOZK 5K9FA 2ZUGA 2MGZB 2Y0BB 1UV7A 4C11A 2XI3A 1YRUA 3I4NC 2KI2A 4M5IA 1HNZJ 2IRUA 2F65A 1C4AA 1VCTA 3DLGA 2GCFA 3UW1A 5KFQA 3SSRA 1FWLA 1N36F 2OPRB 2WB1L 4MH8A 5FD1A 4EBCA 2OLWA 4CWBA 4A3JC 1HMVA 1O2FB 4C3LA 3ZZTA 1XNRF 4J9OA 4RBTA 2F4VJ 1QUPA 4RW6B 4B3OA 1R7IA 3F41A 4I67A 2G2YA 1TKTB 4J9MA 4LF8J 1R9TA 1LWCA 1F5AA 4Q2MA 1DLOB 3R5BA 4EI2A 4A8WA 2POKA 1O6XA 4QYZK 3KMSA 3HDSA 3MR5A 3ENAA 2JA5K 3H0GK 1WG4A 1TWGC 2C2EA 2C2ZB 1U48A 2FZCB 4DSFA 2UP1A 4CLKA 1E6VA 3GTKC 2CADA 2CPHA 2XMUA 1OY8A 1NJXA 3FRYA 1UVLA 4ECQA 2LXIA 5DDRC 5D4LA 1Y00A 2OD6A 5IT9Y 1SL2A 2ZE2B 5CHPA 1WEZA 2HFUA 2QLFB 5F9LA 3W9JA 1BD6A 1F9FA 3H8YA 3SSQA 4KRWA 2HHXA 3U02A 1QAIA 3DOKB 2HQIA 5L1KA 1HI8A 4H4KA 3OTCA 2AJ1A 4J9UE 4YR3A 2E1PA 1U1MA 4AL7A 2JA7K 2D6FC 3L4JA 2ASLA 3K0JA 4F04B 3GFXA 2PMWA 1RTDA 2G9OA 5TMFA 5ADZA 2HSEB 4CI0B 4FYDA 4JI3J 1J5EJ 5C24A 4J9QA 2W4PA 2BE5A 4O2DA 2BJ9A 5M2UA 4JI8F 2JVOA 1YJVA 3M8QB 1AUDA 4N7TA 3HO1A 3LPYA 3CC7S 4ECWA 1KDNA 3CCRS 4X4QA 4BKWA 1GK8A 1R8BA 5AT1B 3AT1B 1S0OA 4OYXA 1K0TA 5IXUA 4XPEA 4X4RA 3EZ5A 3MAHA 2PA3A 3T00A 4LLGA 4DL6A 1T94A 2BKNA 2CAJA 3DXBA 5C7PA 1UL3A 3W3SA 1S7HA 5B0CA 2C3OA 2WAQD 1YSJA 1BQMA 2AF6A 2KHDA 3G4SS 4M5HA 4XDCA 4ZK7M 5JJBA 2MTLA 5KG7A 4CLPA 4I2PA 3HSZA 2JJ4D 4DV5F 2F63A 3IA0A 2QZ8A 4UOHA 4C3HK 3QGGA 3GLJA 3GTGK 3Q89A 1DCOA 5DGAA 5E3RA 2AT1B 3PACA 2CPXA 1ZAXA 2I5JA 4ID8A 5MAOA 4ZP8A 1S4EA 3JYTB 3CCVS 3MPDA 2LEBA 5KFWA 1GXUA 2A3JA 3OUYA 4DDFA 3JB9k 1BMQB 2AYBA 1D9FA 2MKHA 4NLOA 4ELVA 1YJTA 3QSIA 1XQIA 1ICEB 3BKFA 1EQRA 4EGLA 1IBAA 4JV5J 2OPSB 4RW9A 5KFJA 4B3TF 2GGPB 1VHFA 3KLEB 4DR7J 5HN0A 2UUCJ 4OIXA 3BYRA 3NY0A 3V6HA 1RWUA 2UXCF 3GSIA 1VRUA 3UN5A 4X6AK 2MYFA 2XI2A 4ID5B 3HCXA 1HR0J 2E9RX 2NR0A 1PIEA 4RW8B 3MEKA 1XZPA 2YY3A 3GB0A 1MU2B 1HQEA 4M5KA 1ZAVA 3HFZB 3JTOA 2AJQA 2GV1A 2B6AA 1RAHB 4LF6J 4USHA 2IM1A 5GVQA 1DCHA 2MKSA 3MEDB 3CCZA 2ZOFA 2B4PA 4IG3B 4C0HA 2JHEA 3K5PA 3MECA 4Y7NC 2VFRA 1VHIA 1U7LA 2WVEA 1ZVUA 1EARA 2NCKL 3PW0A 1HI1A 1NSKL 4QPXA 3GV5B 2YBVA 2XMKA 2X1BA 4C3MA 4ALZA 4NRTA 1WG1A 1ZM4A 3LGMA 3VF0B 2JC1A 3K5MA 3S1RC 1TV6B 4YB1P 1JLGB 3H59A 4G1PA 1N0UA 1HHTP 1JLCA 3HD2A 4LF1A 3R5DA 4C8MA 2IC3B 3VVTA 4WZMA 2N4DA 2PMZD 2IM2A 2YKMB 2I9SA 1FEHA 4LFCF 4RNHA 3WHIA 2HNZB 1NH8A 5C2CA 2DD8S 5KG6A 3KLGA 3BUEA 3GEIA 1JWWA 5U47A 1I50K 1OYDA 4WKRA 1QJHA 1S79A 3F73A 2O66A 1O29A 3IRXB 2FY1A 1VRTA 4W4MA 2B9XA 3D4JA 3ONQA 4OLOA 3R9LA 4RZRA 3PM9A 1TKZB 2C1EB 2DEJA 1Q95G 1H74A 3UPFA 1KHVA 2M0GB 3C15B 1T95A 4ZITA 4G0VA 3WZ0A 5B0FA 3CIMA 2DR7A 1X5PA 3NOCA 4KASA 3L7UA 3B4MA 4PRFA 1FEEA 4WXWA 2ZKUA 3HPOA 4XSZA 1YX2A 3CNQP 3NOGA 3UDVA 4RNMA 1AB4A 2FZKB 2FB0A 4G1QA 5L1JA 1U0HA 4BBRK 2HG4A 4XK8C 1LV5A 4Y65A 4A48A 4X84A 4A8MP 3FQLA 4LSNB 3H0PA 3AB4B 2GFFA 4ZKAA 1NB2A 3BREA 4L76A 2BXJA 5I3QA 4HL9A 4LRFA 2RKIB 3VVUA 1HBOB 2M5YA 2XZTB 1RAEB 5C4XK 3M1VA 2AMCB 2XTJP 1JJ4A 4UF4A 4NLSA 1N34F 2YWKA 3JSRA 4CNZA 1S9FA 2DK2A 4DUTA 1UFWA 2BRLA 3Q2TC 2BR0A 1VOMA 1X31C 1MN7A 2RUGA 1B64A 1J6WA 1N5YA 4TYBA 1M1HA 4ED6A 1CC7A 4RX6A 2BDPA 4ZLNA 1REGX 2HVHA 2LCWA 4HTIA 4E2FB 4OX9F 4YR2A 3NAHA 4QR1A 2GVZA 4PUOA 1NAQA 4X65F 2N3OA 5HL7Q 3LWMA 3CUNA 2IY5B 2DGVA 4X64F 3H98A 1HQ2A 3NGTA 1TL1B 4ZMMA 3G4CA 3N0BA 3I9V9 4R5PB 2RH3A 2V6TA 2BVZA 1F1BB 1UWAA 2WTFA 2M8DB 2M88A 3KJNB 1GMWA 2HBZB 4Y6IA 4ZVGA 5I3UA 1H2UX 1HHSA 2ERRA 2D41A 3VGVA 1U26A 4KMHA 1TL4A 4HHJA 2XC9A 2FJEB 2J5AA 5CAAA 2G0IA 1JQWA 4UQGA 3TZWA 2QL9B 3C6TB 1RT1A 5KG3A 2W01A 4MK7A 1S77D 4U7UD 1M90T 1AUSL 2J0QD 4C8ZA 1VQKS 1I3QK 4XLPA 1C1BB 4B17A 3R1LA 1HQUB 2FLLA 1ACMB 2IVYA 2DGQA 3CCSS 4ER8A 4PWUA 5HMZA 3QAEA 3CT9A 4HR2A 3DGVA 2Q1LA 2A6EA 2XWXA 1CLFA 2PI4A 4KAWX 1DQ8A 4JB8B 1EZZB 5CJ9A 1UWBA 4WJ4A 1CJUA 3AOBA 3I5AA 2ZM6F 1NJIT 2CJBA 4RBUA 1Z4UA 1MG7A 2CJ9A 4ENOA 4CZCA 2W8LA 3MMBB 1S0NA 1NLKL 3MM7A 3EPIA 5I42B 1KNZA 3EUNA 3PFEA 1X9MA 2KB2A 2W7AA 5F41A 2UXDF 3Q83A 2NXNA 4A3KC 4IOCQ 1Y1WA 4HHUA 5BYRA 3DI6A 1ZYQA 2R93A 1XIQA 4BY1C 1WQFA 5KT3A 1DTQB 1DHMA 4X4VA 3EICA 1CJVB 1GX5A 1RACB 3DRXA 4R8UB 4JI4F 1I3QA 1NRKA 2PDAA 1URNA 1HWJA 4P7VA 3OREA 1WI8A 1N32F 4KMDA 5LMNF 4GKKF 4MIAA 1HI9A 4R0JA 4TY9A 2MKCA 1HD1A 4PQUA 1TKDA 2HFNA 2PD1A 4UW2A 4MFBA 4U8YA 3E01B 2FC9A 3FSYA 3ZNUA 4UZBA 4ZCIA 2AEJA 2E2HC 2GHWA 4C3IC 4ZPVR 2DIVA 5E68A 2J7UA 1RU2A 1I3OB 2EFNA 2VPXB 2D3OR 3ENWA 1BJTA 4O44A 1NCLA 2DXEA 2ZWOA 1I94J 1EFWA 3VWSA 4KJIA 3KLFB 4FYVB 4A3EK 2VUMC 3M8PB 3G82A 3S1MC 3OR1B 2DXDA 3Q86A 5DZ7A 4UTGA 2ZHBA 4O3NA 4NLYA 1HFEL 2C2DA 2F1FA 4MK8A 5IV3A 2MGZA 4KV8B 2DB1A 3CVKA 1S6QA 5AXLA 4QIWD 2GJIA 3MPWA 4A3GC 2B3TB 3AH5A 4Y2IA 4FBTA 1IKVB 3OL9A 2F8MA 2ZH1A 4BXXK 2XNQA 1RTJB 1J5OB 1DTTB 4RWWA 2J76E 2OPRA 4DX7A 3I0SA 4OIPA 2NXJA 1P8GA 3NLCA 2FLNA 3S14K 3K5NA 2WVBA 2ADCA 5HBMA 5IT9U 3FHZA 1Q5VA 4FS1A 3GTYX 2IRYA 4X62J 3W65A 4ES1A 4WBFA 2D74B 4DR2F 5DDPC 3FDSA 3K8WA 1TKTA 5D15A 5K14A 3GILA 4PXEA 3W66A 1B3TA 1VIOA 5JMNA 2W4DA 4QWEA 4IQMA 4BY7K 1U8SA 2E7WA 3M9NB 1X4CA 1UZDA 1RKIA 3S6EA 1XMBA 3SEOA 4JI1F 4QIGA 4IOBA 1P1LA 2VF3A 2HIQA 5B08A 5HP1B 2ZC4A 4E8UA 2BOAA 3I87A 1Q0NA 2HKEA 4F50A 5BJRA 1NSPA 1HWUA 1Q7LB 4OJ3A 4L72B 4QPTA 1KQ4A 4YHHJ 3FSXA 4PYAA 4YUDA 2GSOA 1HNVA 2XWYA 3KJVB 1V3RA 1ZA1B 2ZE2A 4B3RF 1T7PA 2XS2A 3NP5A 3H5XA 2UUBJ 2WRMA 4JI6F 3QSYB 2DGUA 3DU6A 4O0IA 3DOKA 1YZ7A 3RYLA 2XBPA 3ZC4A 3IC1A 1BQXA 3GIJA 1SXLA 4NI2B 2NXEA 2GHPA 5BXIA 4PCQA 4MQ9A 2HFVA 2DO4A 2XLJA 3GG0A 3U27A 2FJWA 5E3CA 4X2BA 3BO2A 2V8GA 1DQAA 3OTBA 5A6PA 1VH2A 1YITS 3T19A 3DC2A 2W2MP 1HNZF 3M8QA 4BHQA 2YQ1A 3OFHA 2ZH5A 1TWHC 4ZPBA 3NGRA 2UVUA 4LK0A 4ILRA 3FEXB 2M7SA 1TZ0A 5KT4A 2EKNA 3BM7A 2JX2A 2YTCA 2F4VF 1K83K 2GO8A 3NNAA 1H0HB 1TWAA 1Q78A 3DGPB 4LF8F 1KFSA 1I6HC 2VJVA 1GFWB 2GHVC 2CQ3A 4IDKA 3HLUA 4DV6J 4PZVA 2QEXS 2BBEA 2IMWP 1FDAA 3IFEA 3EDRB 3CTRA 1H73A 5DZ6A 5KG0A 2Z4PA 3AFGA 3D1OA 1KVIA 4CDIA 3BBCA 3FVYA 1VBZA 1SKRA 5EX0A 1ZBTA 5B0DA 3WX4A 3JYTA 3CD0A 4DV7J 2DNNA 4KHRA 3TQ1A 2EEYA 3I31A 3Q8RB 2DHHA 2LYVA 1PKUA 3B82A 2W9CB 4FVMA 3J81j 2H9ZA 4RNNA 2GGPA 4QWDA 4ERDA 5D77A 1BXNA 4A3CK 3A8KA 2E7XA 4ED8A 5D0EA 1B4AA 1XMQJ 2R7ZK 3TRGA 2VQEJ 2HQCA 1GTHA 1U8WA 2HHTA 1EKSA 4ID5A 3GP9A 4RW8A 3SV3A 4JI3F 3NCRA 2M2BA 4DFMA 1J5EF 1IKWA 2HIYA 5I3PA 1RT7B 5LSLA 3LAJA 4YR0A 2BZ2A 1Q8KA 3H7HB 3N4WA 4BCAA 3VAFA 4NYZA 2HZAA 4UOFA 2B63A 1VGYA 4AQYJ 4PEOA 1MW7A 4KIAA 5M2RA 2GC8A 2B4UA 4J91A 5AXNA 2AD9A 3Q8QB 2KRBA 1RT5B 4DV2J 3DRRA 2HS4A 2FJDB 3PW5A 4QBUA 1SVDA 4MT1A 3NS5A 4HEA9 2GSNA 1HBNB 4H4OA 4DUZJ 5AXMA 1FKOB 1IM4A 3ZZYA 3HOYK 3V6DA 4A93K 1UKUA 2B51A 4A3BK 4IRKA 2OH2A 5M5XK 1B0TA 5J2NA 2DNHA 3L3CA 5IT4A 1TWFK 2IC3A 5A8WB 2OGUA 1FESA 2QA4G 3NS7B 1HD0A 4WK1A 3SZ2A 2YKMA 4A46A 2D69A 4LFBJ 2NYIA 3RAXA 1S97A 3THTA 2DJWA 2HNZA 2HLTA 4NCGA 1F93A 3IP0A 3CWJA 2KKHA 2Y3PA 5C42B 1O24A 2KYZA 2NS1B 1PYOB 2HFZA 4WP9A 1V3ZA 3CDBA 4G1IA 1GQEA 1QTNB 4DWIA 3QO9A 3LP0B 1SV5B 2ZUFA 2MKYA 3KWMA 2PMHA 3D6FB 4KFBB 4JV5F 1SJ1A 1WC4A 4ZHRB 4J9LA 2VIHA 2UUWA 2RH6A 4Y52C 2E2JK 4DR7F 5E33A 2D3ZA 2UUCF 2CQ2A 2C3MA 4XO0A 4OZLA 3J80Y 2ASDA 5HLFB 1FX2A 1BE4A 1U6FA 2CPZA 1G4CA 3PO2C 1HR0F 2KM8C 2OMOA 2OD4A 4AXJA 1U1QA 3GSDA 2V6UA 2EK1A 1FKPB 4PXCA 5LOQA 2PSZA 4GTFA 4M95A 5IP7K 5F8LA 1YJNS 2MZJA 4OYWA 3T9ZA 3DYAA 2JFDA 5BYQA 1RWOB 2IJRA 2OJ3A 1USMA 1L3UA 3Q23A 5IM0A 1AT1B 3PEJA 2ZBQA 1X4DA 4ED3A 3I4NK 4LSNA 4FZVA 1YK9A 4AFFA 3O5TB 2CG4A 4Q8FA 1LKZA 3T1HJ 2YNFB 1B4BA 1QD1A 1PC4A 1ZTWA 5C44K 4CO3A 2YKNB 4WIQA 2Y1LB 2RRAA 5KT6A 2RKIA 1WC6A 1HBOA 3PRDA 4CTAB 3R3TA 1G51A 4FDFA 3PRVA 3DLLQ 2CDRB 3M8RA 1FXLA 4A3JK 1RHQB 2C3PA 3SV4A 1RWVB 3PIOQ 2BJ3A 3SQOP 2AQ4A 2U1AA 1QY7A 2E2IK 1MROA 2D9PA 1N6QB 4IG0A 4DQSA 2AZ3A 1HL6A 5TJ3A 3M8ZA 4N8NA 4MTPA 5DLGA 1Q82T 4EYHB 5IC4B 1WTFA 1NM2A 4Q45A 4C8LA 3OW2R 1DCPA 1RI7A 1YVFA 3J7YI 3EM1A 4F26A 2CJAA 5LM7E 1VQNS 3PXGa 3AJDA 2HQGA 2E1RA 3DDKA 2YU9C 4N56A 3PZPA 1RWMB 1U25A 1SB6A 5AJ3J 4Q4ZA 2QN6B 4AXIA 1TL1A 4O3QA 3I4MK 2ZEJA 1SIZA 2ZBIA 3W60A 1KR4A 3KHRA 3DXJA 5KFGA 1FK9A 2LXUA 1RYRA 2XMTA 3SBMA 3M2UB 5K5MA 2A10A 5GMDA 3MR6A 3DRSB 2UZAA 3CD6S 1FDDA 2FJAB 1M5KC 4N8OA 5DG9A 3CCUS 4Z2XA 1H6KX 4HHHA 2NVXK 2KJVA 1RUSA 4LF5J 3MM6B 1FRJA 4KYZA 1IQTA 1X4GA 5T7LA 3TAMB 4RNOA 1C1BA 5F9NA 4KGMA 4MKVA 2DITA 1TWGA 1TUWA 1K8AT 4LRCA 3GWCA 1SQEA 4OYIA 2RHQB 3HI9A 4NE9C 2CQ1A 4OI0A 3VALA 3GTKA 4U6PA 3LP2B 4YDDB 2JEGA 3UCGA 2IM3A 3J7A1 2V2ZA 3R7NB 2VFTA 3HHEA 3FSIA 1ZOTA 2FC8A 2AZ1A 2LU1A 4HLBA 3B78A 4NWBA 2HBQB 5KG5A 1PCAA 2R2RA 2J9CA 2CA9A 2MSSA 1AYEA 3BKUA 5MLCV 1RHMB 4ZOSA 3RGIA 4LF9F 5A0YB 1S57A 1KQSR 3SMZA 1OSCA 4A3FK 3TZYA 1DTQA 3UDCA 1CJVA 2RD5C 2UVVA 2HEKA 4R8UA 1JLFB 2WZ1A 4F7VA 1ZZNA 3AAWB 3CPWR 1LK5A 4EEYA 4KKOB 5KFYA 2NVQK 2O5IA 3TO8A 3W5ZA 4FXDA 3OXFA 4ETZA 3Q22A 4CYUB 2BANB 4B9SA 1Z2LA 2BACA 3UNYA 2KFNA 2IMOA 4DV1J 2DCLA 1SKWA 1V5IB 4QOTA 3TI0A 3MMLB 1X4FA 1RT4A 2HVDA 4F2SA 1IKXB 4OI6A 3CCLS 3HXMA 3UR0A 2XY6A 3C6UA 3D7SB 2Y1JA 1AA1B 2ZUEA 1EB0A 2CKWA 1CJKB 3CD7A 1S0MA 1NH7A 3CO9A 4LBPA 4RKUC 2DISA 2DNLA 1WORA 2VODA 2FJXA 4NLGA 1F7UA 3PX4A 3UI3A 2COLA 1KQGB 4OI1A 3HOVC 3OR1A 4BBSK 3X3UA 1JK9B 1P1TA 2FVCA 1VC5A 1KQKA 3EJMA 1FD2A 1QVFR 1DARA 2BYCA 3R5CA 1X9WA 3MGJA 3R7BB 2XSJA 4DF4A 4KV8A 4K5SA 1JLBB 2P5VA 4KO0A 3UNGC 4DOZA 2Y0SD 1URRA 1IXKA 3DFEA 4NLWA 1IKVA 4NLRA 3GTJK 4KGKA 1NJYA 1J5OA 1KBRA 2MKKA 1HWLA 4Z37A 4DSKA 2KHCA 4LFAJ 2DHXA 2X7IA 1RA6A 3M7VA 1FJCA 4ECSA 2V2VA 3BGLA 1U1KA 4PAAA 3OTEA 1RSCA 2MQPA 4HYKA 3BP8C 3GTOC 1U6ZA 3MEEA 2DH9A 1RTIB 1U47A 2WAQL 1KFDA 4OIOA 1SC3B 1VC0A 3QPIA 3OPKA 4O3PA 3FCVA 4M1XA 2ZH9A 2B9EA 2CZVC 4CCHA 3BP3A 3IBCB 1T9WA 3MR2A 4WCEQ 4OHXA 3EZUA 4KDDA 2OIHA 2W24A 4N47A 1D8YA 2RHSB 3GTQK 5IOSA 5M3FK 1IUJA 2J9EA 5HP1A 2C2RA 1RCXB 2HYIB 4WYLA 3MUMP 1NJWA 5CZVA 4D3GA 3UQSA 1VBKA 5L9NA 4ANCA 3MTKA 1LWXA 4K4ZA 1IWGA 4DPUA 2EG1A 3CDEA 2QG9B 4FBUA 2KRRA 1I94F 1NK6A 4K8RA 3QT5A 4ZLJA 2LDIA 1G1XA 2OFHX 2H1YA 2UXBJ 3ZTQA 1U1NA 5IYDC 1Y1VC 2F3JA 3OLAA 4ZJOA 2VG5B 3KOAA 3NGUA 3BF4A 2V8VA 1JXEA 2WOMB 2EI5A 3HHLC 2D3O1 3VTIA 4ZN1A 3KNGA 5G4DA 4K4WA 4HH1A 1B70B 1WDDA 1HIYA 4B9VA 1TL3B 1IQZA 1N48A 4F0HA 4QIVA 4PPDA 3GTMK 4DL5A 1HHQA 2ZD1A 5C25B 1VQPS 4X62F 4B02A 4KB2A 2PMZL 9ATCB 5FLXU 3U1MA 2ZOMA 3HKZD 1R0BG 4ZPTR 2C2MB 4B9UA 1I51B 1QTMA 2EC0A 1WSRA 2KM8B 5ETKA 8RUCA 3PRBA 3V81B 3ILJA 4QW8A 3J7AN 1HYSA 4NXNJ 3K5LA 2CJQA 2DGWA 1BGXT 1R43A 3DXSX 1S48A 5LJ3Y 2GVDA 3MHYA 1GAOA 3CJ0A 1J2VA 4DEZA 3NBPB 1V3SA 3TJ8A 3RUBL 4F0MA 2AJ0A 1L0WA 3GIRA 5D0HA 5EWGA 3IGVA 4DU7A 4D3HA 4QWBA 1JXVA 3PO5A 3QGPA 4NMLA 3FKIC 2GS8A 4YHHF 1N5VA 4ZVSB 2H3EB 2WONB 3V5RA 1WC0A 2VG7A 4ZP7A 2LEPA 2NVYC 2H51B 1UVNA 1FRLA 4PQAA 1IS1A 4ZCKA 5IT0A 1GMUA 2OTJS 1IL2A 5KAKA 5KFVA 2KT3A 2QMWA 2XSFA 2WVDA 3EZOA 2YQ0A 3SSSA 1RJJA 1KC8T 3BBFA 2HW3A 3PHEA 2G0CA 4TY8A 2NLWA 3EVOA 1O51A 4BC7A 3S15C 3H2LA 4A8FA 5HQMA 1H38A 4HTJA 2MJNA 3BJYA 4MYUA 2I1RA 3UWTA 5HMYA 2JLEA 3ILLA 4HACB 3S2DC 3C3LA 4IR1A 2CQDA 3K7AC 2UVWA 2Y8WA 2E1MC 2JEJA 2H5IB 2HBYB 5J2PB 1MMNA 3UD3P 3OL8A 3IR7B 2Z2ZA 3AXKA 3KG0A 2JVRA 4CO0A 3BPSP 5C4JC 2OEMA 1SH2A 5ETVA 3V6KA 4O0NA 4M5JA 4TYAA 2K7KA 2R92C 4KGZB 3TA0A 1HBNA 4ECUA 3ZZZA 4P6QA 1XMOJ 5AE3A 4OL8A 3U1LA 2R8GA 2M9KA 4A3DK 5HMWA 4OQJA 3MD1A 3J80U 3D9BA 5F3ZA 2HNYB 1RHUB 2ABYA 4DV6F 4A3KK 4MMOA 4ED0A 1KSPA 3CJKB 4KB7A 3K17A 4ZN3A 1CC8A 3LGHA 3FUYA 2XMJA 4DL0C 1UMJA 1KONA 4H4MA 4WXOA 1NK8A 4EBDA 6FDRA 5C42A 4M5MA 1SKUB 4EU0A 1UEVA 5CZXA 4IUFA 3R27A 1DD5A 2LQBA 1NHKL 2ZFHA 1GTEA 4DV7F 3T6JA 2QV6A 1JLQB 1T03B 3H90A 1XWLA 1UA1A 1UA0A 2RQMA 1VQ6S 4NYPA 3BQ0A 1I6VA 1SV5A 4FS2A 2WSEC 3QIPB 4DZ6A 2HLUA 1EKRA 4MIWA 2ZBCA 4C2MK 1N5QA 2YNGB 4ZHRA 3ILOA 3KYLA 4K0KJ 4W90B 4ZVPB 1QAJA 3THVA 2EPIA 2U2FA 4ED2A 4C3IK 5LSRA 5BR8J 1XMQF 1KD1T 3KK3B 5ETSA 3RZOC 2VQEF 4P73A 2DIUA 4M63A 5M5YK 5KFDA 4LOWA 1RT6B 1TWCK 1HBUB 6AT1B 2BA9A 4MAKA 2E5JA 1NXIA 3MAAA 4OZNA 3J7YU 3S1MK 3KDOA 5KFRA 4G65A 4DCOB 1SMYA 1M1KT 3MTJA 4AQYF 2EFVA 1OYEA 1G6BA 3JSMB 5A8KA 1Y5IB 3MAQA 4DV2F 1RBAA 4NZ6A 1WHWA 2WW4A 1S59A 3OVBA 1FJGJ 2XYPB 4CQ1A 3FFIB 2GZOA 1UJ5A 4GTDA 5D0RA 5C5JA 5H9EJ 4DUZF 2QA2A 2YX4A 5HVHA 2ZZMA 3DOLB 2YNFA 2V8DA 2MLZA 2RUSA 4FKYA 4NL5A 3M8YA 1NUEA 2EKYA 3RAMA 2E2HA 2YKNA 3CCES 1K1SA 1N0VC 4CTAA 3RG6A 1S0VA 4JI2J 2Y8YA 1TQLA 4LF2A 3KKFA 1TWAC 3O1LA 2W7OA 1LEOA 2RQCA 1NKBA 2QYGA 3HD1A 1T8EA 4LFBF 2GMHA 2XY5A 3DOMB 3A8EA 2VUMA 1CULB 4ZVOB 4PG6A 1FRMA 3HHNB 4C8YA 2MMYA 5FDLB 4LIWA 3C2PA 2IIHA 4PWWA 1SC6A 3ITHB 4Q5SA 1SL0A 5KFFA 1TKXA 3HHDA 1QM9A 1YDLA 1VLOA 2VBXA 4CM2A 4NLQA 1JLEB 7FDRA 1JVIA 4NEZA 4ED5A 1U2RA 5KFUA 3S1NK 4ETXA 2CIMA 4ZPAA 3UDLA 1NSAA 1HBMA 3ELHA 3UVJA 3CE8A 3HM9A 4DS4A 4Y2KA 2J6UA 3M2UA 1M0SA 2NXCA 3LAKA 1RDRA 3KK2A 2MZ1A 3A12A 4PWDA 2DR9A 2HMIB 1YRTA 5IYCK 1F60B 3GTPK 2E1AA 4ECRA 3M6VA 2WK4A 1NK9A 3HHLD 1TMMA 3ET6A 4DZDA 4NLXA 2ILYA 4TQSA 1T02A 1IQ0A 3W2WB 3NUHA 2HNDB 1S10A 2A6OA 2IYGA 1UFLA 4LSLB 3CCWA 4QIWL 1TK5A 1LWEB 1WOSA 1PYSB 2MHNA 5IOQA 4LIRA 4F8RA 2ZJQQ 3F0NA 2JA5C 3H0GC 1SJRA 3T1HF 2B7BB 3LP2A 2KG1A 1TWHK 2DH8A 4LJZA 3MI7X 3ERED 3TEGA 1QUVA 2F8HA 3JXOA 1TK0A 2RU3A 1SJFA 4J90A 4YB5A 2HFSA 4RW7B 2KT2A 3IPJA 3CQZA 3GJSB 4IO9Q 5H9EK 2CPFA 3QATA 2V4JA 3ZZ0A 3RAQA 3P5BP 1IBKJ 5HROA 3GTLK 2GW8A 2P8TA 3VAIA 1S6PB 4I7FA 1VK3A 3OEPA 1RBOB 1YJ9S 1AW0A 1VQSA 2FZGB 3DLKB 4W92B 4C98A 1F2HA 1WF1A 2NSCA 1TP7A 2BANA 1VQLS 3DM2B 4FPIA 1RZMA 2Z2YB 1TWHA 4Y28C 3MUTP 3HHKA 1UCNA 2FHKA 1KRPA 3MOZA 1F2GA 3BR8A 2R7OA 4C8KA 2DGXA 1Q53A 2K1RB 1D3WA 2J0SD 1MLAA 2W9BB 3FBFA 4ZIWA 5LXYA 1CJKA 5E3QA 1A6LA 3UD4P 1HNXJ 8ATCB 3CJQA 2X1AA 3ZZRA 2L41A 1H2TZ 3LO3A 3QWUA 1A7GE 2FQQB 3W2VB 2LU2A 2VKZG 4LF5F 2NZ4A 4F4YA 4QQBA 2OAUA 2A2CA 3LQVA 3KLHA 3HXAA 4LJMA 2MY7A 5L8RC 4OINA 1KQFB 1UW4A 2IVMA 2MQ8A 3O8WA 1WQGA 1X60A 4IO1A 2X51A 1TL5A 1PYTA 1SUQB 3F44A 4DSIA 2PC6A 3P49B 4Z7YA 2B9WA 1EETB 1JLBA 4G0WA 3PKYA 3CDUA 3VAJA 3GTGC 2RRBA 4IH7A 3R7SB 4A3MK 2YWWA 3S0XA 5IQ6A 1FNOA 5A8RB 3KHHA 4K7QA 1CBKA 3TUZC 2XHCA 2CVEA 1PBAA 1KS2A 1S1TA 2HGNA 1APSA 2J9DA 4WFBQ 2KXHA 3GU0A 5DM6Q 5C3EC 4UY85 3A1YG 1KLMA 1B7FA 1VR6A 5DQHA 2ZNYA 5AXKA 2B0GA 2ACMA 4LF7J 5JVHQ 2HURA 4OV1A 3BB5A 3H2VE 3TUPA 1KOOA 4BS2A 4NYOA 3QMQA 3I55S 4DV0J 3QJPA 1R9TK 2RS2A 1XZQA 4USUA 1LWFB 3SQGB 1OIAA 2M8HA 4X6AC 2LVWA 4Y3CA 3QJLA 3WX8A 3OSNA 1N5TA 4F25A 4B9MA 3I6PA 4GKJJ 4UZCA 2VU5A 3LPEA 2JLGA 4TXSA 4DV1F 1FT8A 1Y7PA 5G0RA 4HT7A 1WACA 1MWZA 1ZM3A 3IWLA 2FDNA 3HFKA 1IR1A 3NS6A 2G1DA 1W7WA 2GQCA 2L9DA 4Y52K 2HRUA 2K3KA 1LFPA 1S1UB 2NSBA 2CZ4A 4NLTA 2DPJA 1S1VB 3WIVA 2PIIA 3PO2K 3OHBA 4OYAA 3BGRB 3WC0A 2VC1A 1WC5A 1S72S 3MMAB 3KK1A 5D0GA 5EUHA 4IRCA 4G6VB 4L3KA 4AT1B 1EIYB 4GFQA 3OL7A 1HNWJ 1O0PA 4WTOB 3KG1A 3BDEA 2CFAB 2QFJA 4YB6A 4DV4F 5CA5A 3MPVA 1KWMA 5GAEI 2VHGA 1I50C 4WE1B 1ROFA 3UD5A 2DR6A 3U1NA 1FD8A 2V50A 2XEXA 4F3MA 1TL3A 3GFZA 4YFXA 1E6YB 4LFAF 3EGWB 1YI2S 1NPKA 3W61A 2E66A 1AZSB 3GQCA 5SZTA 2EFOA 3HOUC 4I6WA 5C25A 1J98A 1ZAWA 4DN0A 1HWKA 4DSLA 4NOIA 2ZH7A 5GAGI 3V4GA 2J8AA 4Q0BA 1NNDA 5DRKA 2ZHAA 4GTCA 4F3QA 3KJFB 4QCLA 2YX1A 4Q43A 1Q8LA 1X0PA 3FZ2A 2FPHX 2XULA 3R2DJ 1XBWA 3DLBA 1M5PC 4PPZA 4HI2A 2QLXA 2E9ZA 1RLCL 3NBPA 1NZ8A 4A8YA 5AE2A 2RE1A 1LW2B 1FFWB 3KUGA 3D5MA 3Q8VA 1S9GA 1WNEA 4BBRC 3R5GA 4C11B 3MMJA 2WONA 1NMEB 2KWAA 2RS8A 1YBTA 2BQ3A 3MM8A 4OYZA 3DLGB 2UVRA 4KHMA 4RBVA 1HNIB 3PKMA 4OZJA 3ILIA 2PN6A 4OZ2A 4MIBA 1IJEB 3Q8YA 4HVZA 2UXBF 1X5TA 4DPOA 2HHVA 5C4XC 4NLDA 1NK0A 3KHLA 5M5WK 2YH0A 3F56A 5HO4A 3N01A 1X0FA 4MK9A 4QIFA 4NLVA 2JZ5A 4JV1A 3N5FA 5IV4A 2N7YA 2FUG9 4B3OB 5FJ4A 3RZDK 2XGPA 1HKAA 4J9RA 2AYGA 3MMCA 2MB0B 1LWCB 2JEIA 1UVIA 1N5SA 2W2QP 3C19A 3DN9A 1ZM2A 2E9TA 2CWKA 5CHCB 4DCJB 1IBLF 3MZIA 3M2VB 4AD6A 3KHGA 1C0UB 4IKAA 4DSJA 4PG7A 4M8LA 2LLZA 1K1QA 3POTA 1IBCB 3AJ1A 1CQNA 4M5NA 4J37A 1UEUA 1RT3A 2YU9A 4LT6A 5H1SV 2W9AA 1N8RT 2CPDA 2RDJA 1U6BA 3OVAA 4P52A 4PG5A 3CCJS 2ZUAA 2AV5A 2J7WA 3AH6A 1N88A 1R8AA 4WIIA 3WBZA 2MKJA 1OS5A 3AODA 4JK1A 4EBEA 1BQNB 4N76A 1TR0A 1SBRA 3ZTOA 1VQYA 2K3IA 4NXNF 4B3MJ 5L38A 1R8HA 4ECZA 5D4PA 2PGCA 4YS2A 5EGHA 4LUBA 2VZ9A 2V94A 4YDXA 1WG5A 1PILA 3TW0A 2ZOGA 4HDGA 2OFGX 2E7VA 3TYTA 4F0KA 1T11A 5GAHI 5F8IA 3N6MA 2YX7A 5C24B 2XM3A 4U7CA 1VJQA 2EBGA 3DRYA 1JLQA 1OO0B 3ZZUA 4URGA 3HVTA 3GR0A 3RW6A 4I2QA 4E0DA 1X4EA 4I6AA 3QIPA 3S8SA 4MKAA 4FP9A 4USIA 2Z58B 1SH3A 2H48B 4YMEA 3AD8C 1Z2ZA 2YNGA 4ED4A 1S7IA 1H7WA 2FHJD 2MJUA 3NNHA 4A4JA 2V67A 2MQMA 3G86A 2RSQA 4FYWB 3DMJB 2C2NA 3QZ7A 3EYZA 2D1CA 1F5CA 2WCXA 3OR2B 2GSUA 1R0AB 2ZWPA 3CULA 1RISA 3LAMA 4OLPA 4M5LA 1YCLA 1NK4A 3B4DA 2YKPA 2AYEA 4GTLA 3HOVK 2VA2A 2W2OP 4JBCA 3S2HC 2DNOA 2RRNA 3MM9A 3GFYA 5F3TA 1OWXA 3JSMA 2N3LA 3NNCA 3CMQA 2ZFZA 1HLWA 1OQ6A 1TUVA 3PDNA 4ZVTB 3TAQA 5SUHA 1R27B 5IZHA 4IFYB 4WWSA 3M4XA 2MPUA 4F3OA 4NLPA 3FFIA 4LR8A 4I6YA 3H42A 2MQNA 4UOCA 4LRAA 3T41A 1XMOF 3HP6A 3CB4A 2PO4A 2HHPA 2WHOA 1FFSB 3AA8A 4Q2LA 4GC6A 4J5OA 2BW2A 4F4ZA 3NCQA 1WCMA 5IYBC 1WOOA 4RW9B 2J7KA 1R0CB 1S1WA 2VKRA 3CJ2A 3T02A 4WFYA 4X4TA 3DOMA 2RDDA 1CULA 4FZBA 2D9OA 1VRUB 1SFOA 2V68A 4YP3A 2RJZA 4L74A 1VQ8S 1VS3A 3OFEA 1X5OA 2AJ4A 2ZH8A 4AE5A 1FHTA 2G0JA 1HQEB 1G2EA 3RB6A 3CAGA 1R3NA 2PA8D 5L39A 3HOWC 1S9EB 2B6AB 4UQTA 4CO4A 3BDPA 3G87A 1UW9A 3B54A 5LJ5Y 1XTZA 5DG7A 5FLMC 2MZQA 2HS0A 1VJEA 3JTNA 3UO0A 3NG8A 4K0KF 2G13A 1FE4A 1S76D 2FHMA 2CW0A 3QT6A 3A13A 2BM1A 3LW5C 5BR8F 4BXXC 1ZZFA 2IDEA 5D4DA 1NDCA 1JNRB 2FHOB 2A69A 5IOTA 3GTOA 1XERA 3BSOA 4NOHA 2KDOA 2XO7A 2IJNA 1O2AA 3S14C 4R0EA 1YQHA 1FRXA 3D1QA 1Q5YA 2BM0A 2OPQA 4N41A 4J9SA 2F4FA 3GJRB 3QLHB 1Q86T 2QMXA 2VBYA 4LSLA 4MKYA 3ZZPA 3VR1A 2I0XA 4WFAQ 4WKYA 3LP1A 1YIJS 2Y0SL 1FJGF 2DEIA 3KLGB 5E3AA 3PYDA 5GADI 4BY7C 4ZIVA 3ZNJ1 2Z0GA 5CYMB 4I68A 3VGUA 3M4OC 1WC1A 1X7VA 3H2UB 1VRTB 5KFKA 3V4IA 2ROGA 4OYBA 2ZVSA 4A8KA 4WJ3M 2GNKA 1U1OA 4JI2F 4RUCA 3BH6B 3S16C 4RW7A 3E8OA 2D3UA 2VG6B 3OQ2A 2NUHA 5ETMA 1CSJA 4G0UA 2EG2A 3MDFA 3A8JA 4Y2CA 4NA3A 3H3VD 1W2BR 1WEXA 3WDOA 4K4YA 4QR2A 4G7OA 1YJWS 1IKYA 4DQRA 4E98A 3KTQA 3GYNA 1Y1WK 1Y1VA 1IR0A 2QL7B 4LSZB 1KTQA 2R93K 2B8PA 1LQ9A 3GG1A 4P7TA 5D78A 3SDEA 5IP9K 3KLIB 2E1CA 1WTBA 3TWZA 3IWXA 2B9YA 5HK4A 2GAGC 3HHLA 2DNRA 2ZBRA 2ZBPA 3T5KA 3PY8A 2J6TA 3HOXK 3DM2A 1AROP 1T9TA 4G1QB 1VQ5S 1RT2A 1J6VA 3PHTA 4DI6A 1I6JA 3DRPB 1GXTA 1BC6A 4UT4A 2B56A 5KT2A 2NVYK 2O1PA 5KT7A 5J2QA 1VQMS 4ZVQB 5E7OB 2K1RA 1IWAA 5HVGA 2CPJA 1KOHA 5LMUJ 2ZJRQ 3O44A 4KBIA 2HVEA 3BN7A 2W9BA 1BS2A 2P9CA 3MUVP 1K83C 1ZH5A 4ANDA 2OHDA 1YZ6A 1ZPWX 3W2VA 3RRKA 1X9SA 2KVQE 3MM5B 1RAGB 3A8IA 3PW7A 4A3IC 2CQGA 4QW9A 3R8YA 1K0VA 2HRTA 1N5YB 4K4SA 4KN4A 1A9NB 1EETA 4KM9A 5F0UA 3K5OA 4OFZA 5KG2A 1GE9A 3EGZA 1RU0A 2NVTC 3PO3K 2Y9HA 2MQOA 2V34A 4A3LC 3SI8A 3FKIA 4ITSA 5KT5A 3CF5Q 4ECXA 2JLFA 2NVYA 5A76A 3RBZA 3LALA 3GMGA 4PABA 4C3KA 3HKZL 1KVJA 2GQQA 3NAIA 3W8GA 2IAJB 3SCIE 4X66J 4ZCMA 1DBDA 2LQJA 2R3VA 1IBKF 4NRUA 1CJTA 4ZPWR 5ETQA 3N28A 4A3CC 3EPGA 2H54B 5I3UB 1JOEA 1O8BA 5IFMA 2JA8C 2R7ZC 1XN9A 4C3JC 3M32B 2VV5A 3KUHA 5GAEU 3SQGA 2XLKA 5HMXA 3GZ7A 2UV8G 1V9OA 1RTHB 4I4BA 2VONA 3I0RA 5A6WA 2BJ7A 2G4BA 1DQ9A 3O2IA 1BUXA 1IVZA 2VQFJ 1RT1B 2L9WA 1JKHB 2OSQA 4ECYA 3CJSA 5HVFA 1KN6A 3PJ9A 2IFXA 4KHPJ 3G6YA 3ZTPA 2V63A 1TL7B 4FVCA 2CXEA 3CXCR 1HA1A 2HK3A 3OVSA 3HVAA 2C22A 1DFDA 3M8WA 2LEAA 5DG8A 5GAGU 2Z2LA 2R92A 4F4AA 1HI0P 3OTDA 3TA1A 2OPPB 2HBRB 3IAS9 1WEYA 3L95X 4DSEA 1UWBB 3FBBA 1CJUB 2OELA 3IXQA 4YFNA 3Q8SB 3KXDA 1WKKA 2IM0A 2QO3A 4RW6A 3OJUA 2QIFA 5KFXA 2F9DA 2DNKA 2J8SA 2NZCA 4NZ0A 3L7PA 3C66A 4J9VA 2X1GA 3MM7B 3A4TA 1UZHA 3HK2A 1TWFC 1L3VA 1DLOA 1JB0C 1GNKA 2MEWA 1GH8A 1XEZA 4ED7A 2XZWA 4PKDB 1YNNA 1RWKB 2ATLA 3NKYA 3D6MB 1IM6A 3A3PB 4ZA1A 4KH1B 1YJRA 4BBYA 3HT0A 3AQPA 3KG4A 4WE1A 2WSCC 1JLAB 3VA7A 3ZXWA 1M5VC 3A3NB 3S1TA 1ISEA 4LRBA 3CD5A 3IBFB 4AUKA 2JH3A 2BABA 2JA6A 1JQGA 3T9NA 4PQUB 2AGPA 1PBUA 3CQZC 1KLNA 5LSOA 3O6QA 3MCSA 4LF7F 5CXTA 4GO7X 2E2JC 4WFNQ 1TWAK 4XTTA 1PJ7A 2A18A 2MDAA 2CWXA 4O23A 1GMVA 4F36A 4DV0F 1EAYC 3D6HB 3QJJA 2H5JB 3ETMA 1FVQA 4JOUA 4O44B 3W8PA 1ZM9A 1T3NA 6FD1A 2BUNA 4TN2A 5CD4H 2AP6A 3S17K 4GKJF 4NEYA 2QLBB 3I4PA 4P72A 1FDBA 3G82B 2JNJA 1PSDA 5IP7C 2MXYA 1JJCB 2XHWA 5F8GA 2G1HA 5EWFA 4JV2A 3NL0A 2LKZA 3BBBA 4RO0A 3L4BC 1S6QB 3PYEA 1KEKA 3L9ZA 3V2UC 4P74A 3ZO7A 1D8ZA 3DLEB 2ADBA 3VQTA 2DH7A 1Q79A 4FNIA 5C44C 1HNIA 2J9DE 3D3BJ 1DURA 1HQMA 5CD4A 4V1Ak 4ZVEA 4DR1J 5E3PA 3I0SB 3GONA 4KR0B 5HBMB 2CG8A 2KG0A 5GAHU 3D67A 7AT1B 5I4MA 4I69A 1HNWF 3HSJA 1M5OC 3TANA 3T5HA 2DR8A 2R4FA 4WFZA 5EDWA 4FXVA 5H9FJ 2E2IC 2OEKA 5K14B 4YN3B 2ALZA 2VBWA 4K59A 2YKQA 1TTHB 4OX8A 1RABB 2KZZA 1VI7A 1U45A 5D4NA 3NGKA 3M2VA 2B63K 2JFKA 3W62A 1C0UA 4USVA 3MD3A 3W1YC 2A0FB 2H5EA 1C1CB 2KL8A 4YY3J 4IFVB 2HHWA 2O67A 1CVJA 5E2QA 4JI5J 5FLXY 3S1QK 3DU5A 2V4QA 3GV7B 2OUGA 1X8DA 2P6TA 1U49A 3DDIA 5KFCA 2OPSA 3GFHA 3I4MC 2ZITA 1WUUA 4JUZA 2B7CB 2W7VA 4LK1A 5FJ8K 3KLEA 1HNVB 1FCAA 1H98A 2VPYB 1BQNA 4WU3A 1T9YA 3PR5B 2LA6A 4XDDA 3QRRA 2DR5A 1O2BA 2V2QA 4LQ3A 2RF2B 2BQUA 2PFDA 1ZYRA 1MU2A 1Y5LB 1KP6A 2QA1A 4RWXA 2NVXC 2HWTA 4FF2A 3MEDA 2VDIA 4OHVA 4IG3A 3EWGA 4J9PA 5CYJA 3VAHA 2JA5A 3H0GA 3LUYA 4WP3A 1S5ZA 4RUBA 3TUJC 2KN4A 3FEYB 5K20B 4KC6A 5DO2A 4TKTA 4P2SA 1A0OB 2KJWA 1U1RA 4DR3J 4QJVB 8AT1B 1TV6A 1JLGA 2GIRA 3DMJA 1D1UA 4DMZA 1JJHA 2X1FA 3OR2A 3BV8A 4Z7CA 2AWZA 2JEFA 4ICLB 1Q16B 1R0AA 2VPWB 3EXYA 4LR9A 4PG8A 2E5IA 4RL1A 1WQHA 2HWIA 2JA7A 3ADAC 4KGVB 4A3FC 3CJTA 1O5JA 2P2CB 4IDKB 5J2MB 3QT8A 4AH6A 1UFKA 3IRXA 2PHCB 3TAPA 3VZIA 3SXLA 2HRYA 2NVQC 5B09A 1NZAA 4IFYA 5H9FK 4TLQA 3PYGA 3C14B 3G96A 4K2JA 1TKZA 1CS4B 2EBEA 2CQ4A 2DO0A 4OHZA 1SJ4P 1P27B 3C15A 4DX5A 1Y3JA 3D3CJ 4FYYB 3HT3A 4JI0J 3TZXA 5C3EK 4RR5A 1XK8A 2AEMA 1NU4A 2FLPA 1MWYA 4WPAA 2HHSA 4KARA 4B3MF 2N4CA 1SJQA 2BJDA 4DL2A 3OXLA 4M1KA 2FHJA 1D09B 1SC4B 4KGXB 2VD3A 1RXOB 2HGMA 1YJ7A 2Z56B 2CNKB 4WU2A 5D4OA 2M3DA 1HWIA 3MCMA 1C4CA 2MHEA 4J7CA 4LF6F 4NA1A 5GADU 2CQPA 5KFAA 3HF5A 1TU0B 3Q8PB 3PO4A 3UE2A 4A8XA 2RIJA 3P3DA 1IKWB 3NRBA 3LTOA 4BBSC 3BSNA 3HJFA 4O3OA 1EQ0A 1S9EA 3GTGA 3GR1A 4EFAC 2EC2A 4C6AA 3SIPB 3OTOJ 4ZLPA 4DDQA 1TK8A 2F8EX 4ELTA 2FVSA 3TFIA 3GTJC 5J1NA 2JDJA 3DRRB 1FTCA 3PW4A 4P2FA 3E2EA 1O25A 1Q1KA 4B3SJ 3HKWA 4KM8A 1ZETA 4H4OB 2Z30B 2DRBA 2X3DA 3E3XA 2C28A 3V6DB 2YQ3A 4F02A 5J2NB 3HSGA 1DAXA 1X4AA 2R7UA 3I32A 4B9LA 5HSPA 3DLHA 5JUMA 2P5MA 3QLHA 2IHR1 2KU7A 3JS9A 2I38A 3GCWP 1INNA 4LR2A 3M2RB 1MMLA 1TWGK 1EX8A 4NCGB 2ZVIA 1HPZB 2AYMA 5CYMA 3TUIC 2L9NA 4AL5A 3GTKK 4P71A 3GTQC 2CFXA 5K8NA 3P5TL 1JXLA 4KMAA 3ZTRA 3RTVA 3ZFVA 2J0XA 2UU9J 2R7RA 1WIHA 1MWQA 1NPRA 3GDZA 3QO9B 1RHKB 3BPDA 1DY3A 4R5PA 3BQ1A 1ZQ1C 2VG6A 4LF4J 3HOUK 2YWHA 2LECA 2E5LJ 2BKPA 5F0WA 1VJWA 1BHNA 4EO6A 5F8HA 3E51A 4EO8A 1NDLA 3HVWA 1TAQA 2R7TA 2NUUG 4DR6J 3D54A 4XLNA 4F4KA 4NZ7A 2MQQA 3QX3A 3C6TA 3IM9A 2EW9A 3SCKE 2GIQA 2DBBA 1I5OB 3RR8A 5B0GA 2R8KA 3FOFA 2Q79A 3KLIA 5RUBA 1B99A 4USTA 3BS9A 3PG9A 1HQUA 1PJ5A 1I1GA 4DBQA 3SFUA 2VH7A 3P45B 2V8PA 3CJ3A 4OX6A 1I50A 5L1IA 4K2XA 1SIWB 3DYAB 4U7UK 2ILZA 3QQCD 3N6NA 4MJKA 3M8SA 4FF1A 4QIEA 4LQYA 2QMUB 3G8SA 2OO4A 3DRPA 2V4RA 1M5SA 1Q81T 4C9DA 5TMCA 5IM0B 1WDTA 4X4UA 5J1EB 1TELA 3I5BA 1Z1ZA 2I8EA 2ZKTA 1UPMB 4X4SA 4CRJA 3TARA 3MMBA 2NPFA 4DQIA 3GTMC 1N33J 2RGRA 3RU0A 4I1TA 1WJ9A 4OIRA 5I42A 4GMKA 4OYOA 3RB0A 1Q4RA 1P6TA 2QSWA 4KH0B 4LQ9A 2W2NP 3T3FA 2EBBA 5KFBA 3M3YC 4BWJA 4A8OA 1D9DA 1X5SA 3MM5A 2BQRA 4WILA 3M6UA 1F9HA 5ETNA 1FNXH 5IORA 1LNQA 1MROB 5DETA 4LF9J 4IG0B 3AY0A 1R6YA 1F5BA 2CJKA 1RAAB 5LT5A 5D3GB 2EFPA 2PT0A 3KLVA 1KVKA 3N0VA 2CNNB 4ZVRB 2LQ9A 1YBAA 3ISNC 3E01A 3KFWX 5CYQB 1K73T 5K8MA 4P2XA 4URQU 2DHSA 3KJQB 2GJFA 2IAJA 2ZDPA 2PE8A 4ECVA 2AX1A 3UFCX 2V8HA 1XNQJ 2DNMA 1WCMC 3AQOA 4IRDA 3VAKA 3PNIA 2JC0A 3K59A 1FK9B 1WELA 3KLFA 1J6XA 3EQLA 3M8PA 2GAHC 4DLGA 3M9OB 4RW4B 3M32A 1SFOC 3Q0AA 1RA7A 2CQCA 1G7CB 3N9UC 1RTHA 5DDOC 1PGZA 2ZJPQ 3MR3A 2DY1A 1NK5A 4BLBA 2R7VA 3R5JB 3IS9B 1JKHA 3VAMA 4ATNA 5T7LB 2IDLA 2RMLA 3TVKA 4WF9Q 1TL7A 4DV3J 2YXLA 3BYPA 4Y7NK 4FN5A 1NHUA 1RTJA 1DTTA 1IW7A 2JWNA 5LMUF 1F3FA 3T1YJ 2Q6CA 2OPPA 3FCWA 3MURP 4NXMJ 3CO0P 4F4WA 4QWCA 2LP4A 3S1RK 3M30B 4EWTA 4YEAA 2R7QA 4U8VA 3CC2S 4DXLA 3W5YA 4DR5J 5KFEA 2Q6BA 4A3DC 4RMFA 1TVRB 1BGWA 2ZDOA 4GRSA 1VBXA 3MXHP 1K44A 4JYAJ 3UCZP 2JRSA 3S2HK 2KZMA 1JLAA 2CJYB 2XCAA 1REVB 5HI7A 1R31A 2BEFA 3PR4A 4ILLA 2HFOA 2Y1RI 1QE1B 4X66F 1EJ7L 4ZVUB 4S0MA 2P9EA 3KJVA 4C2MC 2ASYA 1H7XA 1NKEA 3EGNA 1RT4B 4CNYA 1IE0A 4GO5X 4P9SA 3C6UB 2R8JA 2XYHB 4DPXA 4OYMA 5B0EA 2MZTA 1WHYA 3OHAA 1JX4A 1RU1A 5IYBK 3SZZA 3IMQJ 4OX7A 1B7YB 2MLXA 1Y4ZB 3HFVA 2UUAJ 1UVJA 2YPZA 3HZGA 1TWCC 3AOAA 4NI2A 1XXCA 4QWAA 1CG2A 4L73A 1U0SA 4CLFA 3RB3A 1LXJA 2VQFF 4GTAA 4X4PA 3ULHA 3Q8UA 3I56S 1NJZA 4JI7J 2HHHJ 4A8QA 5JXSA 3H25A 4OI2A 4KHPF 3TTGA 2DNYA 3H20A 1IBMJ 3CJ8A 2VB6A 3OPFA 2O5DA 2CRLA 3Q24A 1UVMA 3HOWK 2NQPA 4V19X 2XSJB 4K50A 2OMLA 4KO0B 3CEDA 5FLMK 4XAKA 3DLEA 3OLBA 5KFNA 4WK3A 3TFHA 3FQKA 5DDQC 3T6BA 2N82B 2XQCA 3R5AA 3DGPA 3LGNA 1C0TB 1YTYA 2DGTA 3MEEB 4AYBD 5IC6B 4FF3A 4EZ6A 1U2CA 3HSDA 1TFWA 5CCMA 2HZCA 2IA0A 2A1BA 2MKIA 4NX9A 2EFQA 3EVMA 3M05A 4HT5A 4FNHA 3QNWB 2YNIB 2CQIA 4GTEA 3ISZA 2DXFA 4CLUA 3JSTA 2FD2A 3D2WA 3GIMA 4IH5A 3ZZOA 4L3NA 3RJMB 3M4OK 3D0IE 4CO2A 4KT0C 3D6TB 1C1CA 3AA9A 2PFFB 2KFYA 4IFVA 2UUBF 4L6V3 3BO3A 4J3NA 1MMDA 3HJVA 1U2FA 1YKWA 2W9CA 4UOGA 3S16K 2L48A 3S1NC 1RWXB 1R8CA 1BY9A 2HAIA 3ETOA 5IS2A 4KTQA 1FVSA 2QX0A 4KMUA 1MN9A 3PFOA 2GMLA 3VCDA 3N79A 2RF2A 1VBYA 3K89A 3G2XA 3R97A 4Y0FA 5IYCC 2XMAA 1RT7A 3GTPC 3D0HE 2PA8L 1HW8A 5KFLA 3AHPA 3LH2S 4DCPB 4F4XA 4ES3A 5B7WA 1U4BA 4Y2MA 2BJ8A 3IN5A 2AJFE 2AU0A 3NEKA 3Q3QA 1RT5A 5KFOA 1VQOS 4USJC 4YG2A 4CH7A 2V6AA 2XGQA 2RILA 4A47A 1VISA 3RRHA 3OSPA 1FKOA 3H4DA 4QJVA 2DYAA 3C8YA 4DR1F 4K4VA 1RKJA 2DGSA 1LXNA 2BX6A 1P9QC 3D68A 4EYIB 3BH7B 2CQBA 2WVFA 4HH0A 2ZD1B 5A8WA 2IPOB 4ICLA 1NEEA 3G71S 2PEBA 1ITPA 2OSRA 4DLEA 3B6BA 3GTLC 2VJUA 1RCOB 2QT7A 2W4CA 4BY1K 2FVQA 2VFUA 5CABA 4LVNP 1FDNA 3I4HX 1HYSB 3RB4A 2IA6A 5J2MA 5L46A 4A3IK 4TNOA 3G8QA 3BGFA 2GVDB 1S1XB 2MSTA 3ISND 3NCPA 3UN3A 2AGOA 3K7RA 1T05B 4YY3F 1G3OA 2NVTK 3LP0A 1UJ6A 3PW2A 3C14A 4A3LK 1XXAA 3RBDA 4JI5F 3CIZA 1CS4A 4KFBA 3NMAA 1F9EB 2JA6C 3QRPA 3TP2A 2RQKA 4OZ0A 2E2HK 2R7SA 1FKAF 3GV8B 3H3VL 4PG4A 1SPBP 2VG7B 1OSDA 1U02A 3W5XA 1W2IA 3EGVA 4OJGA 1OMSA 3CJ4A 5HLFA 3H5UA 2VICA 1P9YA 4IQXA 3DDNA 1K83A 2M52A 3FGVA 2R8IA 2C3YA 2YKAA 2WB1D 1C2PA 1QAYA 1FKPA 1L3KA 5KTQA 1M1GA 2VUMK 1AXQA 4TY8B 4CLSA 2JA8K 5CH7B 2R7XA 4C3JK 4RU2A 3PEHA 3DLJA 3CGIA 3WIUA 3PYFA 1WC3A 3T5JA 1RWWB 2XLIA 5EGYA 2DY9A 3FRZA 2HQFA 2G2ZA 5HATA 2V5HG 4TLRA 1PG5B 3D0GE 1EQMA 4A3GK 3P8BB 3GPAA 1L3SA 5IOLA 2J0WA 1S49A 4A3MC 4DR3F 4UUXA 1T9UA 4DPWA 1XR6A 3KNAA 3HMJG 3OXGA 3R6GB 2YWEA 1RLDA 4ZPDA 1VYAA 5HQLA 2IYIA 3CDAA 1K47A 2V2KA 4PXBA 3CMES 4FYXB 2FTRA 4UUWA 3KDNA 3CJRA 3CCQS 3TQEA 2DTJA 2R8HA 5K8OA 2A6HA 2MY8A 1RE1B 2R7ZA 4USMA 2XCQA 3C16B 5DLFA 2ROEA 1ZS6A 1N6QA 4DL3A 2KXNB 4ZVHA 4CLZA 2IVFB 4KQZA 1R9TC 3BR9A 4PR6A 4IOAQ 1PJ6A 3TA2A 4ZS6A 2CZ9A 5JVOA 1OQ3A 3M2RA 2APOA 2HK2A 1PAUB 1HPZA 3HOZC 4H4MB 3FC9A 1R6VA 2DRAA 1VIXA 5GMKa 4ILMA 3N5BA 4JI0F 3G8TA 1EP4B 3LPXA 5AE1A 5L9XA 1SC1B 1GEHA 3VQSA 5IWAJ 4DR4J 3CQZK 1RHJB 1GX6A 9RUBA 3RBXA 1U09A 4CO1A 5KOWA 3P6YC 1T9XA 5B0AA 2W7PA 3DRSA 2VFSA 1RGVA 3QAUA 4L75A 1WF2A 5HJYA 4W98A 2HQDA 4FPRA 5T14A 4H4KC 3JAMY 1N56A 1JIHA 1TWFA 2RU9A 2A2DA 2B43A 3T1AA 3MM6A 3BEGB 4DX6A 4ZP9A 5A2QY 5DQGA 1ELOA 4JP8A 1PC5A 4U9RA 3TAMA 2D7SA 2C3UA 4LBIA 3IWNC 1S4FA 3QBCA 7FD1A 1FI4A 3PJXA 4Q44A 3MAAB 4ANEA 4QZVB 3H40A 3J81Y 3R1HA 3OTOF 1OY9A 4CM0A 2YH1A 5A8KB 4N77A 1YGYA 1TFYA 4CH1A 1U1PA 4F2RA 2LA4A 4DUYJ 4FF4A 2R2SA 1VDHA 3BGOP 1S6UA 4GVBB 5J1EA 4B3SF 2BRKA 3IRWP 2YPYA 2HVZA 4C48A 4OIQA 4CP5A 3OFGA 1YHQS 2VBZA 5BYSA 1FX4A 2CNLB 2H4WB 2ZH3A 2XMWA 1D9AA 3BZQA 4WYWA 4K4UA 2BMBA 1I6HK 5A0YA 1UP1A 2DHAA 3P4UB 4OMFG 1LW0B 2JA7C 2HAFA 1AFIA 1JLFA 4AL6A 1WKLA 1JMTA 1S12A 4KKOA 2BE7D 5E5NA 5E41A 3W7BA 3GJQB 1Y3KA 4CYUA 5KOXA 2YVSA 1FWKA 3RW7A 3WC2A 5D3GA 2LXFA 4DPYA 5AJ3F 2UU9F 1TKXB 1Q7YT 3W9HA 4KE5A 1NPPA 2CQ0A 3GYXB 2M4MA 3KMQA 3VV2B 2NXUA 4NCBA 1NDKA 5CYQA 4LF4F 2O01C 3PJWA 3LAPA 1IKXA 2E5LF 5M2PA 1CPZA 3MFIA 1XPPA 3D28A 1QVGR 1RQ0A 3IBWA 5KFSA 2ZZNA 1QAXA 4P75A 4DR6F 1HBMB 4DL7A 3UVJB 4ZJLA 1R8PA 4KATA 4C45A 3AB2B 4GT9A 3K57A 1FFGB 4FKXA 2EXUA 3NXZA 2QA4S 3KK2B 4RW4A 2VL1A 3HVRA 4Q7AA 4C97A 2Q66A 3FBEA 4PWDB 1LK7A 4DFJA 4O4GB 4KN7A 2KH9A 4C7QA 4DFKA 2E2IA 3IG1B 2FYXA 2WB4A 3RZDC 2N7CA 3ET6B 4C3HC 2RVJA 3IS9A 1RYSA 1HW9A 2RT3A 4F67A 2O3DA 4OYPA 4LBHA 3IGNA 4M5DB 4OI4A 1RAOA 1N52B 2BW7A 3TZZA 5DM7Q 2QYCA 3N6LA 1EK8A 3QWPA 1N33F 3K8VA 1B0PA 4USWA 2CDQA 3M30A 2YNHB 1YG0A 1EH1A 1C0AA 1RTIA 5THWA 1WOPA 4CO5A 4DX8H 2KT5A 3FEZA 4CH0S 2BJ1A 4WP8A 2VA3A 4MKBA 1YWXA 1B0VA 2FLOA 2V4JB 5ITHA 1TVRA 4DG1B 1SI9A 4J9NA 4OJ1A 4ES2A 2DNPA 1YBUA 2BKOA 5HROB 1FE0A 3JSBA 3MF5A 4GZYA 2NVXA 4LR7A 3ICLA 4I7FB 4Y34A 1FJEB 4OJHA 5KFTA 3RRGA 1RP5A 4WFXA 3QGIA 3X1LB 2DRDA 1REVA 4B08A 2HGLA 2LQ8A 1WI6A 2G2OA 3DHWC 2IJFA 2RDIA 4M94A 2CQHA 3NGSA 2F7VA 1QE1A 2ZNZA 1F6TA 3HULA 3TOQA 1KTVA 3MR7A 5DGBA 2YWGA 3QZ8A 3G4AA 1XNQF 3IAM9 3CCTA 4QR0A 5C2GA 1QSSA 2UUTA 4URSA 4U67Q 4YQWA 1PO6A 1ZXOA 3NWRA 3DHXA 1N36J 2P8IA 2QTWA 4RLEA 3Q2SC 3CSKA 2CVIA 2AIRB 1WWHA 2XCRB 1SKSA 5KFHA 3FNNA 2J6SA 1H72C 1Y0HA 4MYTA 4C0BA 4HKQA 2GJ2A 2KO1A 1MSWD 1XNRJ 1ZBSA 1UVKA 5JVGQ 3QGHA 2VG5A 3FK4A 1X4HA 4NLUA 3MWBA 2HHQA 4MEXA 5LL6d 3KLHB 2E29A 3M6WA 2WOMA 2X3GA 1WHVA 4DV3F 2M70A 2B5JB 3BKTA 4A8SA 1J27A 2OP5A 2AKWB 4NCAA 3J7ZT 3PCOB 4RJVA 3T1YF 1BDFA 1XJWB 5T41A 2QC3A 2XCPA 1FRKA 4IH6A 2W1BA 4NXMF 3NWGA 4DV4J 2BE2B 1ZPVA 1VQ9S 1S1TB 2W25A 1WKJA 4UY8T 5EHHA 4C4WA 1T9VA 5KG4A 4J9KA 4RUHA 4DR5F 1FXDA 1KLMB 4LRDA 1SCJB 4OV6A 1C0TA 2XY7A 2XMVA 3K58A 3V81A 3FBCA 5KFIA 3KUEA 3MEGB 2XG8A 3CDWA 3UDEA 2H4YB 3US5A 4JYAF 2FQOA 2AX0A 3IO1A 4PYDA 2A6MA 1OY6A 2Z2MA 2QL5B 1FA0A 4DS5A 3TX0A 1XZQB 3GJTB 2YNIA 1JNZB 2UV8A 2RAQA 2V0NA 2KVIA 3H5YA 3BSAA 4NA2A 5D8HB 3UCUP 4K4XA 2YU9K 4JI8J 2XB2D 4C0OC 3MPYA 5G0RB 1S6OA 4WTYA 4Q5VA 2EK6A 4DQPA 4RUAA 2GMJA 4KY3A 3GTJA 4V19J 2MZSA 4DQQA 5M3MK 3WQPA 1VC6A 1FXRA 1DRZA 2ROPA 2A68A 4HI1A 4IR9A 1ZTTA 2HS3A 3AJ2A 3OT9A 2UUAF 4FXWA 5HL8A 2F5GA 1HMVB 2XNRA 3QIDA 1V6HA 4BDPA 1EI6A 3QFWA 1RB0A 1NK7A 2R7WA 4JI7F 5HJXA 2HHHF 2QLWA 4ECTA 1NBEB 4HACA 4CLYA 1IBMF 1JJ2R 4OHWA 4C8NA 3KK1B 4MEYA 1OJ4A 1F9NA 4OZ3A 4TVAB 3UR3C 3JQKA 2WW8A 4X4OA 5J2PA 5IQQA 2E44A 3GEEA 1IN0A 4P10A 3SYZA 2CPYA 2SXLA 5CQGA 4DV5J 1W25A 2CNOB 4USKA 4K5RA 2PPBA 3GTQA 2FGCA 3OFFA 2CPIA 1E6VB 3M6XA 3CMAS 5HANA 2AW0A 1IBLJ 2FJVA 1UPPA 2OEJA 4LMZA 1FO1A 4DHVA 3PX0A 4XPCA 2ASJA 2FJBB 2FIUA 2QE5A 3P96A 3VHQA 1VGXA 1TAUA 1VQ4S 3HX9A 1RHRB 1M5HA 2DNGA 2HNYA 4GVLA 2EVZA 4BC9A 5HQ8A 4Q0BB 3I82A 4B3TJ 3CJKA 4ILDA 3M3YK 4HDHA 1Y1WC 2VFVA 3EVWA 4XIUA 3N3YA 2WVCA 1Y10A 2UXCJ 2R93C 1FWPA 1RTDB 2HQ3A 2I6WA 1YLXA 4YFUA 5IP9C 2EWHA 5FIIA 4ZVFA 1S99A 4B9TA 1RAJA 1I3QC 1S1XA 2WSFC 3G9CA 5KG1A 3W63A 2GIFA 2VUGA 1T03A 1ULRA 5EGEA 1T05A 3GEHA 3DKDA 5DJBA 4O3SA 2VPZB 3GE9A 3CC4S 1FNMA 3HOXC 2K06A 2GO9A 1ZA2B 4I0WA 4WJBA 1QSLA 1YJUA 1S9GB 5ETOA 4DL4A 2Z57B 3QFHA 4DU8A 3FJ2A 3S7RA 4OI3A 3BO4A 4PXDA 3V4MA 2IBKA 2AJ2A 3KK3A 3BN4A 4RNFA 4KSEB 3GTMA 2L3MA 2R2UA 3MM8B 3FOEA 2YKOA 3IR5B 1O28A 1LOUA 1WCMK 4BLAA 2PEHA 1RT6A 4ZH4A 1GT8A 1HBUA 5ETRA 4YB7A 2CUYA 2MLYA 2BJEA 1FJ7A 1RWPB 4U95A 2QFIA 3BSCA 1HARA 2LFVA 1SFOK 2FGOA 4TU7A 4Q8EA 3FZBA 2F9JA 1BQMB 1W26A 3W64A 1WSVA 5L1LA 2XMMA 2JSXA
chains in the Genus database with same CATH topology
3ADAC 1VRQC 4PABA 1XZPB 1WOOA 4PAAA 3TFJA 4P9SA 3GIRA 1WOPA 1WOSA 3GEEA 3GSIA 3TFHA 1VLOA 2GAGC 1XZQB 1V5VA 3A8IA 3A8KA 3AD8C 1PJ6A 3GEIA 3TTGA 1WORA 1PJ7A 1XZPA 3AD7C 3A8JA 1YX2A 3AD9C 1PJ5A 1WSRA 2GAHC 1WSVA 5L46A 1X31C 1XZQA 3TFIA 3GEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADA C;  1VRQ C;  4PAB A;  1XZP B;  1WOO A;  4PAA A;  3TFJ A;  4P9S A;  3GIR A;  1WOP A;  1WOS A;  3GEE A;  3GSI A;  3TFH A;  1VLO A;  2GAG C;  1XZQ B;  1V5V A;  3A8I A;  3A8K A;  3AD8 C;  1PJ6 A;  3GEI A;  3TTG A;  1WOR A;  1PJ7 A;  1XZP A;  3AD7 C;  3A8J A;  1YX2 A;  3AD9 C;  1PJ5 A;  1WSR A;  2GAH C;  1WSV A;  5L46 A;  1X31 C;  1XZQ A;  3TFI A;  3GEH A; 
#chains in the Genus database with same CATH topology
 4I2P B;  3MMC B;  4O3R A;  4LFC J;  2LMI A;  4CLT A;  3JQM A;  2NPI A;  1NB7 A;  3PO3 C;  1AFJ A;  4K4T A;  3DOL A;  2I5J B;  2K8G A;  3R6L B;  4CT8 A;  2VOO A;  1U1L A;  4FM9 A;  3POT B;  2HWH A;  3OUY B;  3RZA A;  5B0B A;  2VAS A;  5E0O A;  1RT3 B;  3MCN A;  2FQT A;  2LDY A;  2VDH A;  1NHV A;  3OL6 A;  3GTO K;  3BGU A;  4BWM A;  4KAI A;  1WD6 A;  2PI5 A;  1PAE X;  3H4B A;  4YOE A;  3THP A;  3U7J A;  1H3D A;  3SCL E;  2K2P A;  3JTP A;  2HZV A;  3DNC A;  2IBO A;  1CEZ A;  3PIP Q;  2FVR A;  4G7H A;  2E5H A;  3C16 A;  4ZJQ A;  4A3E C;  5FDL A;  1LFW A;  2QSF A;  3JAM U;  1XZP B;  1UJ4 A;  4I64 A;  2Q43 A;  3ITH A;  1RK8 A;  3OJS A;  3TX8 A;  5A2Q U;  1NDP A;  4ZPC A;  3I9Z A;  2XO6 A;  1BWE A;  3L7O A;  2L08 A;  3N0C A;  4YFK A;  1JLE A;  3HZE A;  3J81 U;  2I2Y A;  4P5A A;  2ALY B;  3EXC X;  3MEC B;  1EP4 A;  1OPZ A;  3EMT A;  3HVT B;  1QLN A;  4LVO P;  3TJA A;  5F8J A;  4I2Q B;  3MFH A;  2MQL A;  1DZ5 A;  4NMX A;  1R89 A;  4CLL A;  4KPC A;  1L3T A;  4DJB A;  3ENQ A;  1UEK A;  4EMD A;  1N4L A;  2BE9 B;  3G6V A;  4M5G A;  2V69 A;  2ZH2 A;  3FCH A;  5DQI A;  2HMI A;  2XYG B;  2LQ5 A;  4QU6 A;  1JLC B;  4OZ1 A;  4KC5 A;  5IYD K;  2Z8Q A;  1Y1V K;  3C46 A;  5DS7 A;  4DF8 A;  3W2W A;  1N34 J;  2HND A;  4R25 A;  4I56 A;  4RU9 A;  1LWE A;  1UAW A;  2NYH A;  3BQ2 A;  4O4R A;  3MPU B;  4U96 A;  3WOD A;  2OI2 A;  5KFM A;  1NSQ A;  4RPF A;  1RAF B;  4NAS A;  1V5V A;  4NPO A;  2HHU A;  3MM9 B;  2DCU B;  2B8Q A;  3I5C A;  2O5J A;  2R2T A;  1VFJ A;  4OX9 J;  1FRI A;  1SQG A;  4GVB A;  2FY8 A;  5KFZ A;  1YRX A;  4X4N A;  1XR7 A;  3JQJ A;  1UET A;  4C2M A;  4X65 J;  1FF2 A;  2EFG A;  4GTB A;  2YWF A;  1WHX A;  4X64 J;  3QRQ A;  3AOC A;  2W2P P;  3AD9 C;  5HAO A;  4Y00 A;  2QLJ B;  4TU8 A;  5JFE A;  2V9K A;  2DPI A;  1VRQ C;  1Y5N B;  2AEF A;  3FMW A;  1O27 A;  1EHW A;  1VMB A;  2ZH4 A;  3LWL A;  1S6P A;  2DNZ A;  3ENV A;  3NGD A;  1LW0 A;  3O3L A;  1TWC A;  1SH0 A;  1S1W B;  1TMJ A;  1X4B A;  3L09 A;  4KB4 A;  2KXF A;  3DLK A;  1VLY A;  5D6G A;  3S17 C;  4ZP6 A;  1N54 B;  2DT9 A;  1QDU B;  3JSY A;  2P9G A;  2Q3P A;  2H65 B;  1VK8 A;  3VGT A;  2B4O A;  2R9L A;  1Y9O A;  1U0H B;  2CJX B;  3FKI K;  4ZDN A;  2QGF B;  1SQF A;  5IWA F;  2K7J A;  1KKH A;  1F3V A;  1SJ3 P;  4DR4 F;  2DNQ A;  2GQ2 A;  3GII A;  3R2C J;  3UN2 A;  3SZY A;  1GMW D;  4QYR A;  3VAG A;  3W9I A;  1T3O A;  4C8O A;  4GC7 A;  1XR5 A;  5ETL A;  2DGO A;  4N5S A;  1RWN B;  2ZZT A;  5ETP A;  3M1V B;  3SFG A;  1VQ7 S;  2WBM A;  1RBL A;  1Q8B A;  2HPU A;  2ZM6 J;  4G3I A;  3S15 K;  2NRE A;  1RAI B;  2DVI A;  2W8K A;  2ZH6 A;  5CCL A;  4ZCL A;  3TVY A;  1DJ0 A;  3M9M B;  3RBE A;  5J1P A;  3TFJ A;  1NO8 A;  4O4G A;  4P2M A;  1SUQ A;  3IG1 A;  3DCA A;  2AGQ A;  3SCJ E;  2P6S A;  2UXD J;  2ZHO A;  3S2D K;  2OPQ B;  3EE3 A;  3K7A K;  2E5G A;  2RNE A;  4EUV A;  3PX6 A;  2JOQ A;  1Q8I A;  1Y11 A;  3OD2 A;  2C42 A;  4G7Z A;  1F7V A;  3IM8 A;  4JI4 J;  5A8R A;  2V9W A;  3LP1 B;  4DUY F;  2XS7 A;  5C4J K;  2B63 C;  1WF0 A;  3EDQ B;  3OV7 A;  2GVZ B;  3VZH A;  4M5D A;  4PUO B;  1D0E A;  2B4V A;  4TQR A;  2R92 K;  1N32 J;  4XSX A;  5LMN J;  1XXB A;  3FKB A;  4GKK J;  3V4I B;  3MOJ B;  2XS5 A;  4B9N A;  4ED1 A;  4CLW A;  3S1Q C;  3TEH B;  3G6E S;  2YNH A;  4DPT A;  4AYB L;  3OBI A;  1K9M T;  4WZQ A;  1AB8 A;  2DHG A;  3B8H A;  2KTQ A;  3S01 A;  2BOP A;  2VOP A;  1FER A;  2XCO A;  3NMR A;  1MNE A;  2IRX A;  4DG1 A;  1LWF A;  4H54 A;  5EN1 A;  4CIO A;  3D66 A;  2ACY A;  4QU7 A;  1IKY B;  1CQM A;  3GTP A;  2F40 A;  1UTA A;  2MZR A;  3TJ9 A;  3CJ5 A;  3MCO A;  2DKO B;  3SDE B;  3LF0 A;  3CW2 C;  2HVI A;  5F8M A;  3GYG A;  3HHL B;  1YNJ A;  5EX3 A;  2KFZ A;  2Y3Y A;  2QRR A;  3V6J A;  1T0T V;  2RQ4 A;  5F8N A;  3I96 A;  1IR2 A;  1RT2 B;  2JA6 K;  4OZ5 A;  3L4K A;  1SL1 A;  3LA0 A;  3T5L A;  4P5B A;  1HNX F;  1S1U A;  1U24 A;  3HOY C;  5J2Q B;  2OKQ A;  4A93 C;  2RB7 A;  3RZO K;  1S1V A;  5ETT A;  4A3B C;  1O26 A;  2JL9 A;  3TR5 A;  3BGR A;  3LAN A;  1GXL A;  2GA7 A;  3ZTS A;  4QYZ J;  3MMA A;  4TU9 A;  2ZC3 A;  3T01 A;  3GIK A;  2V6S A;  3GTL A;  1IJF B;  4OHY A;  3RR7 A;  2KYX A;  2CYY A;  2ATC B;  3DI6 B;  4DR2 J;  4ELU A;  4CT9 A;  3A3O B;  2CFA A;  5EWE A;  1FTR A;  1OPI A;  2OTL S;  2B5J A;  5K8P A;  3K2Y A;  5LXR A;  2VC0 A;  1FRH A;  3FMB A;  3PVX A;  3TVZ A;  3AXM A;  1F0X A;  1H2V Z;  1E6Y A;  4JV0 A;  1NKC A;  3J7Z 5;  2C2O B;  2WBR A;  3GCX P;  1AZS A;  4JI1 J;  1TUG B;  1B4S A;  2BE2 A;  2AHO B;  2BV3 A;  2Y1I A;  2C2K B;  3D1H A;  5KFP A;  1L5U A;  3CCM S;  4MFB B;  4LRE A;  3PTW A;  3EX7 B;  1BWV A;  2CPE A;  4Y2A A;  1QSY A;  3TNV A;  4XCH A;  1RTZ A;  1KHW A;  2XZD B;  4EZ9 A;  3PV8 A;  4B3R J;  1XC9 A;  1BLU A;  1CJT B;  5GME A;  3G6X A;  4IYQ A;  3MEG A;  4ZLL A;  4JI6 J;  3VGS A;  1USO A;  3LOU A;  2QJ3 A;  3AD7 C;  2FVP A;  4EK2 A;  2R42 A;  1RAD B;  3QT7 A;  3IR6 B;  4BLG A;  1LW2 A;  3I0R B;  3H5S A;  4KPY A;  3QYY A;  2GX8 A;  4DN9 A;  4DFP A;  3HOZ K;  5K9F A;  2ZUG A;  2MGZ B;  2Y0B B;  1UV7 A;  4C11 A;  2XI3 A;  1YRU A;  3I4N C;  2KI2 A;  4M5I A;  1HNZ J;  2IRU A;  2F65 A;  1C4A A;  1VCT A;  3DLG A;  2GCF A;  3UW1 A;  5KFQ A;  3SSR A;  1FWL A;  1N36 F;  2OPR B;  2WB1 L;  4MH8 A;  5FD1 A;  4EBC A;  2OLW A;  4CWB A;  4A3J C;  1HMV A;  1O2F B;  4C3L A;  3ZZT A;  1XNR F;  4J9O A;  4RBT A;  2F4V J;  1QUP A;  4RW6 B;  4B3O A;  1R7I A;  3F41 A;  4I67 A;  2G2Y A;  1TKT B;  4J9M A;  4LF8 J;  1R9T A;  1LWC A;  1F5A A;  4Q2M A;  1DLO B;  3R5B A;  4EI2 A;  4A8W A;  2POK A;  1O6X A;  4QYZ K;  3KMS A;  3HDS A;  3MR5 A;  3ENA A;  2JA5 K;  3H0G K;  1WG4 A;  1TWG C;  2C2E A;  2C2Z B;  1U48 A;  2FZC B;  4DSF A;  2UP1 A;  4CLK A;  1E6V A;  3GTK C;  2CAD A;  2CPH A;  2XMU A;  1OY8 A;  1NJX A;  3FRY A;  1UVL A;  4ECQ A;  2LXI A;  5DDR C;  5D4L A;  1Y00 A;  2OD6 A;  5IT9 Y;  1SL2 A;  2ZE2 B;  5CHP A;  1WEZ A;  2HFU A;  2QLF B;  5F9L A;  3W9J A;  1BD6 A;  1F9F A;  3H8Y A;  3SSQ A;  4KRW A;  2HHX A;  3U02 A;  1QAI A;  3DOK B;  2HQI A;  5L1K A;  1HI8 A;  4H4K A;  3OTC A;  2AJ1 A;  4J9U E;  4YR3 A;  2E1P A;  1U1M A;  4AL7 A;  2JA7 K;  2D6F C;  3L4J A;  2ASL A;  3K0J A;  4F04 B;  3GFX A;  2PMW A;  1RTD A;  2G9O A;  5TMF A;  5ADZ A;  2HSE B;  4CI0 B;  4FYD A;  4JI3 J;  1J5E J;  5C24 A;  4J9Q A;  2W4P A;  2BE5 A;  4O2D A;  2BJ9 A;  5M2U A;  4JI8 F;  2JVO A;  1YJV A;  3M8Q B;  1AUD A;  4N7T A;  3HO1 A;  3LPY A;  3CC7 S;  4ECW A;  1KDN A;  3CCR S;  4X4Q A;  4BKW A;  1GK8 A;  1R8B A;  5AT1 B;  3AT1 B;  1S0O A;  4OYX A;  1K0T A;  5IXU A;  4XPE A;  4X4R A;  3EZ5 A;  3MAH A;  2PA3 A;  3T00 A;  4LLG A;  4DL6 A;  1T94 A;  2BKN A;  2CAJ A;  3DXB A;  5C7P A;  1UL3 A;  3W3S A;  1S7H A;  5B0C A;  2C3O A;  2WAQ D;  1YSJ A;  1BQM A;  2AF6 A;  2KHD A;  3G4S S;  4M5H A;  4XDC A;  4ZK7 M;  5JJB A;  2MTL A;  5KG7 A;  4CLP A;  4I2P A;  3HSZ A;  2JJ4 D;  4DV5 F;  2F63 A;  3IA0 A;  2QZ8 A;  4UOH A;  4C3H K;  3QGG A;  3GLJ A;  3GTG K;  3Q89 A;  1DCO A;  5DGA A;  5E3R A;  2AT1 B;  3PAC A;  2CPX A;  1ZAX A;  2I5J A;  4ID8 A;  5MAO A;  4ZP8 A;  1S4E A;  3JYT B;  3CCV S;  3MPD A;  2LEB A;  5KFW A;  1GXU A;  2A3J A;  3OUY A;  4DDF A;  3JB9 k;  1BMQ B;  2AYB A;  1D9F A;  2MKH A;  4NLO A;  4ELV A;  1YJT A;  3QSI A;  1XQI A;  1ICE B;  3BKF A;  1EQR A;  4EGL A;  1IBA A;  4JV5 J;  2OPS B;  4RW9 A;  5KFJ A;  4B3T F;  2GGP B;  1VHF A;  3KLE B;  4DR7 J;  5HN0 A;  2UUC J;  4OIX A;  3BYR A;  3NY0 A;  3V6H A;  1RWU A;  2UXC F;  3GSI A;  1VRU A;  3UN5 A;  4X6A K;  2MYF A;  2XI2 A;  4ID5 B;  3HCX A;  1HR0 J;  2E9R X;  2NR0 A;  1PIE A;  4RW8 B;  3MEK A;  1XZP A;  2YY3 A;  3GB0 A;  1MU2 B;  1HQE A;  4M5K A;  1ZAV A;  3HFZ B;  3JTO A;  2AJQ A;  2GV1 A;  2B6A A;  1RAH B;  4LF6 J;  4USH A;  2IM1 A;  5GVQ A;  1DCH A;  2MKS A;  3MED B;  3CCZ A;  2ZOF A;  2B4P A;  4IG3 B;  4C0H A;  2JHE A;  3K5P A;  3MEC A;  4Y7N C;  2VFR A;  1VHI A;  1U7L A;  2WVE A;  1ZVU A;  1EAR A;  2NCK L;  3PW0 A;  1HI1 A;  1NSK L;  4QPX A;  3GV5 B;  2YBV A;  2XMK A;  2X1B A;  4C3M A;  4ALZ A;  4NRT A;  1WG1 A;  1ZM4 A;  3LGM A;  3VF0 B;  2JC1 A;  3K5M A;  3S1R C;  1TV6 B;  4YB1 P;  1JLG B;  3H59 A;  4G1P A;  1N0U A;  1HHT P;  1JLC A;  3HD2 A;  4LF1 A;  3R5D A;  4C8M A;  2IC3 B;  3VVT A;  4WZM A;  2N4D A;  2PMZ D;  2IM2 A;  2YKM B;  2I9S A;  1FEH A;  4LFC F;  4RNH A;  3WHI A;  2HNZ B;  1NH8 A;  5C2C A;  2DD8 S;  5KG6 A;  3KLG A;  3BUE A;  3GEI A;  1JWW A;  5U47 A;  1I50 K;  1OYD A;  4WKR A;  1QJH A;  1S79 A;  3F73 A;  2O66 A;  1O29 A;  3IRX B;  2FY1 A;  1VRT A;  4W4M A;  2B9X A;  3D4J A;  3ONQ A;  4OLO A;  3R9L A;  4RZR A;  3PM9 A;  1TKZ B;  2C1E B;  2DEJ A;  1Q95 G;  1H74 A;  3UPF A;  1KHV A;  2M0G B;  3C15 B;  1T95 A;  4ZIT A;  4G0V A;  3WZ0 A;  5B0F A;  3CIM A;  2DR7 A;  1X5P A;  3NOC A;  4KAS A;  3L7U A;  3B4M A;  4PRF A;  1FEE A;  4WXW A;  2ZKU A;  3HPO A;  4XSZ A;  1YX2 A;  3CNQ P;  3NOG A;  3UDV A;  4RNM A;  1AB4 A;  2FZK B;  2FB0 A;  4G1Q A;  5L1J A;  1U0H A;  4BBR K;  2HG4 A;  4XK8 C;  1LV5 A;  4Y65 A;  4A48 A;  4X84 A;  4A8M P;  3FQL A;  4LSN B;  3H0P A;  3AB4 B;  2GFF A;  4ZKA A;  1NB2 A;  3BRE A;  4L76 A;  2BXJ A;  5I3Q A;  4HL9 A;  4LRF A;  2RKI B;  3VVU A;  1HBO B;  2M5Y A;  2XZT B;  1RAE B;  5C4X K;  3M1V A;  2AMC B;  2XTJ P;  1JJ4 A;  4UF4 A;  4NLS A;  1N34 F;  2YWK A;  3JSR A;  4CNZ A;  1S9F A;  2DK2 A;  4DUT A;  1UFW A;  2BRL A;  3Q2T C;  2BR0 A;  1VOM A;  1X31 C;  1MN7 A;  2RUG A;  1B64 A;  1J6W A;  1N5Y A;  4TYB A;  1M1H A;  4ED6 A;  1CC7 A;  4RX6 A;  2BDP A;  4ZLN A;  1REG X;  2HVH A;  2LCW A;  4HTI A;  4E2F B;  4OX9 F;  4YR2 A;  3NAH A;  4QR1 A;  2GVZ A;  4PUO A;  1NAQ A;  4X65 F;  2N3O A;  5HL7 Q;  3LWM A;  3CUN A;  2IY5 B;  2DGV A;  4X64 F;  3H98 A;  1HQ2 A;  3NGT A;  1TL1 B;  4ZMM A;  3G4C A;  3N0B A;  3I9V 9;  4R5P B;  2RH3 A;  2V6T A;  2BVZ A;  1F1B B;  1UWA A;  2WTF A;  2M8D B;  2M88 A;  3KJN B;  1GMW A;  2HBZ B;  4Y6I A;  4ZVG A;  5I3U A;  1H2U X;  1HHS A;  2ERR A;  2D41 A;  3VGV A;  1U26 A;  4KMH A;  1TL4 A;  4HHJ A;  2XC9 A;  2FJE B;  2J5A A;  5CAA A;  2G0I A;  1JQW A;  4UQG A;  3TZW A;  2QL9 B;  3C6T B;  1RT1 A;  5KG3 A;  2W01 A;  4MK7 A;  1S77 D;  4U7U D;  1M90 T;  1AUS L;  2J0Q D;  4C8Z A;  1VQK S;  1I3Q K;  4XLP A;  1C1B B;  4B17 A;  3R1L A;  1HQU B;  2FLL A;  1ACM B;  2IVY A;  2DGQ A;  3CCS S;  4ER8 A;  4PWU A;  5HMZ A;  3QAE A;  3CT9 A;  4HR2 A;  3DGV A;  2Q1L A;  2A6E A;  2XWX A;  1CLF A;  2PI4 A;  4KAW X;  1DQ8 A;  4JB8 B;  1EZZ B;  5CJ9 A;  1UWB A;  4WJ4 A;  1CJU A;  3AOB A;  3I5A A;  2ZM6 F;  1NJI T;  2CJB A;  4RBU A;  1Z4U A;  1MG7 A;  2CJ9 A;  4ENO A;  4CZC A;  2W8L A;  3MMB B;  1S0N A;  1NLK L;  3MM7 A;  3EPI A;  5I42 B;  1KNZ A;  3EUN A;  3PFE A;  1X9M A;  2KB2 A;  2W7A A;  5F41 A;  2UXD F;  3Q83 A;  2NXN A;  4A3K C;  4IOC Q;  1Y1W A;  4HHU A;  5BYR A;  3DI6 A;  1ZYQ A;  2R93 A;  1XIQ A;  4BY1 C;  1WQF A;  5KT3 A;  1DTQ B;  1DHM A;  4X4V A;  3EIC A;  1CJV B;  1GX5 A;  1RAC B;  3DRX A;  4R8U B;  4JI4 F;  1I3Q A;  1NRK A;  2PDA A;  1URN A;  1HWJ A;  4P7V A;  3ORE A;  1WI8 A;  1N32 F;  4KMD A;  5LMN F;  4GKK F;  4MIA A;  1HI9 A;  4R0J A;  4TY9 A;  2MKC A;  1HD1 A;  4PQU A;  1TKD A;  2HFN A;  2PD1 A;  4UW2 A;  4MFB A;  4U8Y A;  3E01 B;  2FC9 A;  3FSY A;  3ZNU A;  4UZB A;  4ZCI A;  2AEJ A;  2E2H C;  2GHW A;  4C3I C;  4ZPV R;  2DIV A;  5E68 A;  2J7U A;  1RU2 A;  1I3O B;  2EFN A;  2VPX B;  2D3O R;  3ENW A;  1BJT A;  4O44 A;  1NCL A;  2DXE A;  2ZWO A;  1I94 J;  1EFW A;  3VWS A;  4KJI A;  3KLF B;  4FYV B;  4A3E K;  2VUM C;  3M8P B;  3G82 A;  3S1M C;  3OR1 B;  2DXD A;  3Q86 A;  5DZ7 A;  4UTG A;  2ZHB A;  4O3N A;  4NLY A;  1HFE L;  2C2D A;  2F1F A;  4MK8 A;  5IV3 A;  2MGZ A;  4KV8 B;  2DB1 A;  3CVK A;  1S6Q A;  5AXL A;  4QIW D;  2GJI A;  3MPW A;  4A3G C;  2B3T B;  3AH5 A;  4Y2I A;  4FBT A;  1IKV B;  3OL9 A;  2F8M A;  2ZH1 A;  4BXX K;  2XNQ A;  1RTJ B;  1J5O B;  1DTT B;  4RWW A;  2J76 E;  2OPR A;  4DX7 A;  3I0S A;  4OIP A;  2NXJ A;  1P8G A;  3NLC A;  2FLN A;  3S14 K;  3K5N A;  2WVB A;  2ADC A;  5HBM A;  5IT9 U;  3FHZ A;  1Q5V A;  4FS1 A;  3GTY X;  2IRY A;  4X62 J;  3W65 A;  4ES1 A;  4WBF A;  2D74 B;  4DR2 F;  5DDP C;  3FDS A;  3K8W A;  1TKT A;  5D15 A;  5K14 A;  3GIL A;  4PXE A;  3W66 A;  1B3T A;  1VIO A;  5JMN A;  2W4D A;  4QWE A;  4IQM A;  4BY7 K;  1U8S A;  2E7W A;  3M9N B;  1X4C A;  1UZD A;  1RKI A;  3S6E A;  1XMB A;  3SEO A;  4JI1 F;  4QIG A;  4IOB A;  1P1L A;  2VF3 A;  2HIQ A;  5B08 A;  5HP1 B;  2ZC4 A;  4E8U A;  2BOA A;  3I87 A;  1Q0N A;  2HKE A;  4F50 A;  5BJR A;  1NSP A;  1HWU A;  1Q7L B;  4OJ3 A;  4L72 B;  4QPT A;  1KQ4 A;  4YHH J;  3FSX A;  4PYA A;  4YUD A;  2GSO A;  1HNV A;  2XWY A;  3KJV B;  1V3R A;  1ZA1 B;  2ZE2 A;  4B3R F;  1T7P A;  2XS2 A;  3NP5 A;  3H5X A;  2UUB J;  2WRM A;  4JI6 F;  3QSY B;  2DGU A;  3DU6 A;  4O0I A;  3DOK A;  1YZ7 A;  3RYL A;  2XBP A;  3ZC4 A;  3IC1 A;  1BQX A;  3GIJ A;  1SXL A;  4NI2 B;  2NXE A;  2GHP A;  5BXI A;  4PCQ A;  4MQ9 A;  2HFV A;  2DO4 A;  2XLJ A;  3GG0 A;  3U27 A;  2FJW A;  5E3C A;  4X2B A;  3BO2 A;  2V8G A;  1DQA A;  3OTB A;  5A6P A;  1VH2 A;  1YIT S;  3T19 A;  3DC2 A;  2W2M P;  1HNZ F;  3M8Q A;  4BHQ A;  2YQ1 A;  3OFH A;  2ZH5 A;  1TWH C;  4ZPB A;  3NGR A;  2UVU A;  4LK0 A;  4ILR A;  3FEX B;  2M7S A;  1TZ0 A;  5KT4 A;  2EKN A;  3BM7 A;  2JX2 A;  2YTC A;  2F4V F;  1K83 K;  2GO8 A;  3NNA A;  1H0H B;  1TWA A;  1Q78 A;  3DGP B;  4LF8 F;  1KFS A;  1I6H C;  2VJV A;  1GFW B;  2GHV C;  2CQ3 A;  4IDK A;  3HLU A;  4DV6 J;  4PZV A;  2QEX S;  2BBE A;  2IMW P;  1FDA A;  3IFE A;  3EDR B;  3CTR A;  1H73 A;  5DZ6 A;  5KG0 A;  2Z4P A;  3AFG A;  3D1O A;  1KVI A;  4CDI A;  3BBC A;  3FVY A;  1VBZ A;  1SKR A;  5EX0 A;  1ZBT A;  5B0D A;  3WX4 A;  3JYT A;  3CD0 A;  4DV7 J;  2DNN A;  4KHR A;  3TQ1 A;  2EEY A;  3I31 A;  3Q8R B;  2DHH A;  2LYV A;  1PKU A;  3B82 A;  2W9C B;  4FVM A;  3J81 j;  2H9Z A;  4RNN A;  2GGP A;  4QWD A;  4ERD A;  5D77 A;  1BXN A;  4A3C K;  3A8K A;  2E7X A;  4ED8 A;  5D0E A;  1B4A A;  1XMQ J;  2R7Z K;  3TRG A;  2VQE J;  2HQC A;  1GTH A;  1U8W A;  2HHT A;  1EKS A;  4ID5 A;  3GP9 A;  4RW8 A;  3SV3 A;  4JI3 F;  3NCR A;  2M2B A;  4DFM A;  1J5E F;  1IKW A;  2HIY A;  5I3P A;  1RT7 B;  5LSL A;  3LAJ A;  4YR0 A;  2BZ2 A;  1Q8K A;  3H7H B;  3N4W A;  4BCA A;  3VAF A;  4NYZ A;  2HZA A;  4UOF A;  2B63 A;  1VGY A;  4AQY J;  4PEO A;  1MW7 A;  4KIA A;  5M2R A;  2GC8 A;  2B4U A;  4J91 A;  5AXN A;  2AD9 A;  3Q8Q B;  2KRB A;  1RT5 B;  4DV2 J;  3DRR A;  2HS4 A;  2FJD B;  3PW5 A;  4QBU A;  1SVD A;  4MT1 A;  3NS5 A;  4HEA 9;  2GSN A;  1HBN B;  4H4O A;  4DUZ J;  5AXM A;  1FKO B;  1IM4 A;  3ZZY A;  3HOY K;  3V6D A;  4A93 K;  1UKU A;  2B51 A;  4A3B K;  4IRK A;  2OH2 A;  5M5X K;  1B0T A;  5J2N A;  2DNH A;  3L3C A;  5IT4 A;  1TWF K;  2IC3 A;  5A8W B;  2OGU A;  1FES A;  2QA4 G;  3NS7 B;  1HD0 A;  4WK1 A;  3SZ2 A;  2YKM A;  4A46 A;  2D69 A;  4LFB J;  2NYI A;  3RAX A;  1S97 A;  3THT A;  2DJW A;  2HNZ A;  2HLT A;  4NCG A;  1F93 A;  3IP0 A;  3CWJ A;  2KKH A;  2Y3P A;  5C42 B;  1O24 A;  2KYZ A;  2NS1 B;  1PYO B;  2HFZ A;  4WP9 A;  1V3Z A;  3CDB A;  4G1I A;  1GQE A;  1QTN B;  4DWI A;  3QO9 A;  3LP0 B;  1SV5 B;  2ZUF A;  2MKY A;  3KWM A;  2PMH A;  3D6F B;  4KFB B;  4JV5 F;  1SJ1 A;  1WC4 A;  4ZHR B;  4J9L A;  2VIH A;  2UUW A;  2RH6 A;  4Y52 C;  2E2J K;  4DR7 F;  5E33 A;  2D3Z A;  2UUC F;  2CQ2 A;  2C3M A;  4XO0 A;  4OZL A;  3J80 Y;  2ASD A;  5HLF B;  1FX2 A;  1BE4 A;  1U6F A;  2CPZ A;  1G4C A;  3PO2 C;  1HR0 F;  2KM8 C;  2OMO A;  2OD4 A;  4AXJ A;  1U1Q A;  3GSD A;  2V6U A;  2EK1 A;  1FKP B;  4PXC A;  5LOQ A;  2PSZ A;  4GTF A;  4M95 A;  5IP7 K;  5F8L A;  1YJN S;  2MZJ A;  4OYW A;  3T9Z A;  3DYA A;  2JFD A;  5BYQ A;  1RWO B;  2IJR A;  2OJ3 A;  1USM A;  1L3U A;  3Q23 A;  5IM0 A;  1AT1 B;  3PEJ A;  2ZBQ A;  1X4D A;  4ED3 A;  3I4N K;  4LSN A;  4FZV A;  1YK9 A;  4AFF A;  3O5T B;  2CG4 A;  4Q8F A;  1LKZ A;  3T1H J;  2YNF B;  1B4B A;  1QD1 A;  1PC4 A;  1ZTW A;  5C44 K;  4CO3 A;  2YKN B;  4WIQ A;  2Y1L B;  2RRA A;  5KT6 A;  2RKI A;  1WC6 A;  1HBO A;  3PRD A;  4CTA B;  3R3T A;  1G51 A;  4FDF A;  3PRV A;  3DLL Q;  2CDR B;  3M8R A;  1FXL A;  4A3J K;  1RHQ B;  2C3P A;  3SV4 A;  1RWV B;  3PIO Q;  2BJ3 A;  3SQO P;  2AQ4 A;  2U1A A;  1QY7 A;  2E2I K;  1MRO A;  2D9P A;  1N6Q B;  4IG0 A;  4DQS A;  2AZ3 A;  1HL6 A;  5TJ3 A;  3M8Z A;  4N8N A;  4MTP A;  5DLG A;  1Q82 T;  4EYH B;  5IC4 B;  1WTF A;  1NM2 A;  4Q45 A;  4C8L A;  3OW2 R;  1DCP A;  1RI7 A;  1YVF A;  3J7Y I;  3EM1 A;  4F26 A;  2CJA A;  5LM7 E;  1VQN S;  3PXG a;  3AJD A;  2HQG A;  2E1R A;  3DDK A;  2YU9 C;  4N56 A;  3PZP A;  1RWM B;  1U25 A;  1SB6 A;  5AJ3 J;  4Q4Z A;  2QN6 B;  4AXI A;  1TL1 A;  4O3Q A;  3I4M K;  2ZEJ A;  1SIZ A;  2ZBI A;  3W60 A;  1KR4 A;  3KHR A;  3DXJ A;  5KFG A;  1FK9 A;  2LXU A;  1RYR A;  2XMT A;  3SBM A;  3M2U B;  5K5M A;  2A10 A;  5GMD A;  3MR6 A;  3DRS B;  2UZA A;  3CD6 S;  1FDD A;  2FJA B;  1M5K C;  4N8O A;  5DG9 A;  3CCU S;  4Z2X A;  1H6K X;  4HHH A;  2NVX K;  2KJV A;  1RUS A;  4LF5 J;  3MM6 B;  1FRJ A;  4KYZ A;  1IQT A;  1X4G A;  5T7L A;  3TAM B;  4RNO A;  1C1B A;  5F9N A;  4KGM A;  4MKV A;  2DIT A;  1TWG A;  1TUW A;  1K8A T;  4LRC A;  3GWC A;  1SQE A;  4OYI A;  2RHQ B;  3HI9 A;  4NE9 C;  2CQ1 A;  4OI0 A;  3VAL A;  3GTK A;  4U6P A;  3LP2 B;  4YDD B;  2JEG A;  3UCG A;  2IM3 A;  3J7A 1;  2V2Z A;  3R7N B;  2VFT A;  3HHE A;  3FSI A;  1ZOT A;  2FC8 A;  2AZ1 A;  2LU1 A;  4HLB A;  3B78 A;  4NWB A;  2HBQ B;  5KG5 A;  1PCA A;  2R2R A;  2J9C A;  2CA9 A;  2MSS A;  1AYE A;  3BKU A;  5MLC V;  1RHM B;  4ZOS A;  3RGI A;  4LF9 F;  5A0Y B;  1S57 A;  1KQS R;  3SMZ A;  1OSC A;  4A3F K;  3TZY A;  1DTQ A;  3UDC A;  1CJV A;  2RD5 C;  2UVV A;  2HEK A;  4R8U A;  1JLF B;  2WZ1 A;  4F7V A;  1ZZN A;  3AAW B;  3CPW R;  1LK5 A;  4EEY A;  4KKO B;  5KFY A;  2NVQ K;  2O5I A;  3TO8 A;  3W5Z A;  4FXD A;  3OXF A;  4ETZ A;  3Q22 A;  4CYU B;  2BAN B;  4B9S A;  1Z2L A;  2BAC A;  3UNY A;  2KFN A;  2IMO A;  4DV1 J;  2DCL A;  1SKW A;  1V5I B;  4QOT A;  3TI0 A;  3MML B;  1X4F A;  1RT4 A;  2HVD A;  4F2S A;  1IKX B;  4OI6 A;  3CCL S;  3HXM A;  3UR0 A;  2XY6 A;  3C6U A;  3D7S B;  2Y1J A;  1AA1 B;  2ZUE A;  1EB0 A;  2CKW A;  1CJK B;  3CD7 A;  1S0M A;  1NH7 A;  3CO9 A;  4LBP A;  4RKU C;  2DIS A;  2DNL A;  1WOR A;  2VOD A;  2FJX A;  4NLG A;  1F7U A;  3PX4 A;  3UI3 A;  2COL A;  1KQG B;  4OI1 A;  3HOV C;  3OR1 A;  4BBS K;  3X3U A;  1JK9 B;  1P1T A;  2FVC A;  1VC5 A;  1KQK A;  3EJM A;  1FD2 A;  1QVF R;  1DAR A;  2BYC A;  3R5C A;  1X9W A;  3MGJ A;  3R7B B;  2XSJ A;  4DF4 A;  4KV8 A;  4K5S A;  1JLB B;  2P5V A;  4KO0 A;  3UNG C;  4DOZ A;  2Y0S D;  1URR A;  1IXK A;  3DFE A;  4NLW A;  1IKV A;  4NLR A;  3GTJ K;  4KGK A;  1NJY A;  1J5O A;  1KBR A;  2MKK A;  1HWL A;  4Z37 A;  4DSK A;  2KHC A;  4LFA J;  2DHX A;  2X7I A;  1RA6 A;  3M7V A;  1FJC A;  4ECS A;  2V2V A;  3BGL A;  1U1K A;  4PAA A;  3OTE A;  1RSC A;  2MQP A;  4HYK A;  3BP8 C;  3GTO C;  1U6Z A;  3MEE A;  2DH9 A;  1RTI B;  1U47 A;  2WAQ L;  1KFD A;  4OIO A;  1SC3 B;  1VC0 A;  3QPI A;  3OPK A;  4O3P A;  3FCV A;  4M1X A;  2ZH9 A;  2B9E A;  2CZV C;  4CCH A;  3BP3 A;  3IBC B;  1T9W A;  3MR2 A;  4WCE Q;  4OHX A;  3EZU A;  4KDD A;  2OIH A;  2W24 A;  4N47 A;  1D8Y A;  2RHS B;  3GTQ K;  5IOS A;  5M3F K;  1IUJ A;  2J9E A;  5HP1 A;  2C2R A;  1RCX B;  2HYI B;  4WYL A;  3MUM P;  1NJW A;  5CZV A;  4D3G A;  3UQS A;  1VBK A;  5L9N A;  4ANC A;  3MTK A;  1LWX A;  4K4Z A;  1IWG A;  4DPU A;  2EG1 A;  3CDE A;  2QG9 B;  4FBU A;  2KRR A;  1I94 F;  1NK6 A;  4K8R A;  3QT5 A;  4ZLJ A;  2LDI A;  1G1X A;  2OFH X;  2H1Y A;  2UXB J;  3ZTQ A;  1U1N A;  5IYD C;  1Y1V C;  2F3J A;  3OLA A;  4ZJO A;  2VG5 B;  3KOA A;  3NGU A;  3BF4 A;  2V8V A;  1JXE A;  2WOM B;  2EI5 A;  3HHL C;  2D3O 1;  3VTI A;  4ZN1 A;  3KNG A;  5G4D A;  4K4W A;  4HH1 A;  1B70 B;  1WDD A;  1HIY A;  4B9V A;  1TL3 B;  1IQZ A;  1N48 A;  4F0H A;  4QIV A;  4PPD A;  3GTM K;  4DL5 A;  1HHQ A;  2ZD1 A;  5C25 B;  1VQP S;  4X62 F;  4B02 A;  4KB2 A;  2PMZ L;  9ATC B;  5FLX U;  3U1M A;  2ZOM A;  3HKZ D;  1R0B G;  4ZPT R;  2C2M B;  4B9U A;  1I51 B;  1QTM A;  2EC0 A;  1WSR A;  2KM8 B;  5ETK A;  8RUC A;  3PRB A;  3V81 B;  3ILJ A;  4QW8 A;  3J7A N;  1HYS A;  4NXN J;  3K5L A;  2CJQ A;  2DGW A;  1BGX T;  1R43 A;  3DXS X;  1S48 A;  5LJ3 Y;  2GVD A;  3MHY A;  1GAO A;  3CJ0 A;  1J2V A;  4DEZ A;  3NBP B;  1V3S A;  3TJ8 A;  3RUB L;  4F0M A;  2AJ0 A;  1L0W A;  3GIR A;  5D0H A;  5EWG A;  3IGV A;  4DU7 A;  4D3H A;  4QWB A;  1JXV A;  3PO5 A;  3QGP A;  4NML A;  3FKI C;  2GS8 A;  4YHH F;  1N5V A;  4ZVS B;  2H3E B;  2WON B;  3V5R A;  1WC0 A;  2VG7 A;  4ZP7 A;  2LEP A;  2NVY C;  2H51 B;  1UVN A;  1FRL A;  4PQA A;  1IS1 A;  4ZCK A;  5IT0 A;  1GMU A;  2OTJ S;  1IL2 A;  5KAK A;  5KFV A;  2KT3 A;  2QMW A;  2XSF A;  2WVD A;  3EZO A;  2YQ0 A;  3SSS A;  1RJJ A;  1KC8 T;  3BBF A;  2HW3 A;  3PHE A;  2G0C A;  4TY8 A;  2NLW A;  3EVO A;  1O51 A;  4BC7 A;  3S15 C;  3H2L A;  4A8F A;  5HQM A;  1H38 A;  4HTJ A;  2MJN A;  3BJY A;  4MYU A;  2I1R A;  3UWT A;  5HMY A;  2JLE A;  3ILL A;  4HAC B;  3S2D C;  3C3L A;  4IR1 A;  2CQD A;  3K7A C;  2UVW A;  2Y8W A;  2E1M C;  2JEJ A;  2H5I B;  2HBY B;  5J2P B;  1MMN A;  3UD3 P;  3OL8 A;  3IR7 B;  2Z2Z A;  3AXK A;  3KG0 A;  2JVR A;  4CO0 A;  3BPS P;  5C4J C;  2OEM A;  1SH2 A;  5ETV A;  3V6K A;  4O0N A;  4M5J A;  4TYA A;  2K7K A;  2R92 C;  4KGZ B;  3TA0 A;  1HBN A;  4ECU A;  3ZZZ A;  4P6Q A;  1XMO J;  5AE3 A;  4OL8 A;  3U1L A;  2R8G A;  2M9K A;  4A3D K;  5HMW A;  4OQJ A;  3MD1 A;  3J80 U;  3D9B A;  5F3Z A;  2HNY B;  1RHU B;  2ABY A;  4DV6 F;  4A3K K;  4MMO A;  4ED0 A;  1KSP A;  3CJK B;  4KB7 A;  3K17 A;  4ZN3 A;  1CC8 A;  3LGH A;  3FUY A;  2XMJ A;  4DL0 C;  1UMJ A;  1KON A;  4H4M A;  4WXO A;  1NK8 A;  4EBD A;  6FDR A;  5C42 A;  4M5M A;  1SKU B;  4EU0 A;  1UEV A;  5CZX A;  4IUF A;  3R27 A;  1DD5 A;  2LQB A;  1NHK L;  2ZFH A;  1GTE A;  4DV7 F;  3T6J A;  2QV6 A;  1JLQ B;  1T03 B;  3H90 A;  1XWL A;  1UA1 A;  1UA0 A;  2RQM A;  1VQ6 S;  4NYP A;  3BQ0 A;  1I6V A;  1SV5 A;  4FS2 A;  2WSE C;  3QIP B;  4DZ6 A;  2HLU A;  1EKR A;  4MIW A;  2ZBC A;  4C2M K;  1N5Q A;  2YNG B;  4ZHR A;  3ILO A;  3KYL A;  4K0K J;  4W90 B;  4ZVP B;  1QAJ A;  3THV A;  2EPI A;  2U2F A;  4ED2 A;  4C3I K;  5LSR A;  5BR8 J;  1XMQ F;  1KD1 T;  3KK3 B;  5ETS A;  3RZO C;  2VQE F;  4P73 A;  2DIU A;  4M63 A;  5M5Y K;  5KFD A;  4LOW A;  1RT6 B;  1TWC K;  1HBU B;  6AT1 B;  2BA9 A;  4MAK A;  2E5J A;  1NXI A;  3MAA A;  4OZN A;  3J7Y U;  3S1M K;  3KDO A;  5KFR A;  4G65 A;  4DCO B;  1SMY A;  1M1K T;  3MTJ A;  4AQY F;  2EFV A;  1OYE A;  1G6B A;  3JSM B;  5A8K A;  1Y5I B;  3MAQ A;  4DV2 F;  1RBA A;  4NZ6 A;  1WHW A;  2WW4 A;  1S59 A;  3OVB A;  1FJG J;  2XYP B;  4CQ1 A;  3FFI B;  2GZO A;  1UJ5 A;  4GTD A;  5D0R A;  5C5J A;  5H9E J;  4DUZ F;  2QA2 A;  2YX4 A;  5HVH A;  2ZZM A;  3DOL B;  2YNF A;  2V8D A;  2MLZ A;  2RUS A;  4FKY A;  4NL5 A;  3M8Y A;  1NUE A;  2EKY A;  3RAM A;  2E2H A;  2YKN A;  3CCE S;  1K1S A;  1N0V C;  4CTA A;  3RG6 A;  1S0V A;  4JI2 J;  2Y8Y A;  1TQL A;  4LF2 A;  3KKF A;  1TWA C;  3O1L A;  2W7O A;  1LEO A;  2RQC A;  1NKB A;  2QYG A;  3HD1 A;  1T8E A;  4LFB F;  2GMH A;  2XY5 A;  3DOM B;  3A8E A;  2VUM A;  1CUL B;  4ZVO B;  4PG6 A;  1FRM A;  3HHN B;  4C8Y A;  2MMY A;  5FDL B;  4LIW A;  3C2P A;  2IIH A;  4PWW A;  1SC6 A;  3ITH B;  4Q5S A;  1SL0 A;  5KFF A;  1TKX A;  3HHD A;  1QM9 A;  1YDL A;  1VLO A;  2VBX A;  4CM2 A;  4NLQ A;  1JLE B;  7FDR A;  1JVI A;  4NEZ A;  4ED5 A;  1U2R A;  5KFU A;  3S1N K;  4ETX A;  2CIM A;  4ZPA A;  3UDL A;  1NSA A;  1HBM A;  3ELH A;  3UVJ A;  3CE8 A;  3HM9 A;  4DS4 A;  4Y2K A;  2J6U A;  3M2U A;  1M0S A;  2NXC A;  3LAK A;  1RDR A;  3KK2 A;  2MZ1 A;  3A12 A;  4PWD A;  2DR9 A;  2HMI B;  1YRT A;  5IYC K;  1F60 B;  3GTP K;  2E1A A;  4ECR A;  3M6V A;  2WK4 A;  1NK9 A;  3HHL D;  1TMM A;  3ET6 A;  4DZD A;  4NLX A;  2ILY A;  4TQS A;  1T02 A;  1IQ0 A;  3W2W B;  3NUH A;  2HND B;  1S10 A;  2A6O A;  2IYG A;  1UFL A;  4LSL B;  3CCW A;  4QIW L;  1TK5 A;  1LWE B;  1WOS A;  1PYS B;  2MHN A;  5IOQ A;  4LIR A;  4F8R A;  2ZJQ Q;  3F0N A;  2JA5 C;  3H0G C;  1SJR A;  3T1H F;  2B7B B;  3LP2 A;  2KG1 A;  1TWH K;  2DH8 A;  4LJZ A;  3MI7 X;  3ERE D;  3TEG A;  1QUV A;  2F8H A;  3JXO A;  1TK0 A;  2RU3 A;  1SJF A;  4J90 A;  4YB5 A;  2HFS A;  4RW7 B;  2KT2 A;  3IPJ A;  3CQZ A;  3GJS B;  4IO9 Q;  5H9E K;  2CPF A;  3QAT A;  2V4J A;  3ZZ0 A;  3RAQ A;  3P5B P;  1IBK J;  5HRO A;  3GTL K;  2GW8 A;  2P8T A;  3VAI A;  1S6P B;  4I7F A;  1VK3 A;  3OEP A;  1RBO B;  1YJ9 S;  1AW0 A;  1VQS A;  2FZG B;  3DLK B;  4W92 B;  4C98 A;  1F2H A;  1WF1 A;  2NSC A;  1TP7 A;  2BAN A;  1VQL S;  3DM2 B;  4FPI A;  1RZM A;  2Z2Y B;  1TWH A;  4Y28 C;  3MUT P;  3HHK A;  1UCN A;  2FHK A;  1KRP A;  3MOZ A;  1F2G A;  3BR8 A;  2R7O A;  4C8K A;  2DGX A;  1Q53 A;  2K1R B;  1D3W A;  2J0S D;  1MLA A;  2W9B B;  3FBF A;  4ZIW A;  5LXY A;  1CJK A;  5E3Q A;  1A6L A;  3UD4 P;  1HNX J;  8ATC B;  3CJQ A;  2X1A A;  3ZZR A;  2L41 A;  1H2T Z;  3LO3 A;  3QWU A;  1A7G E;  2FQQ B;  3W2V B;  2LU2 A;  2VKZ G;  4LF5 F;  2NZ4 A;  4F4Y A;  4QQB A;  2OAU A;  2A2C A;  3LQV A;  3KLH A;  3HXA A;  4LJM A;  2MY7 A;  5L8R C;  4OIN A;  1KQF B;  1UW4 A;  2IVM A;  2MQ8 A;  3O8W A;  1WQG A;  1X60 A;  4IO1 A;  2X51 A;  1TL5 A;  1PYT A;  1SUQ B;  3F44 A;  4DSI A;  2PC6 A;  3P49 B;  4Z7Y A;  2B9W A;  1EET B;  1JLB A;  4G0W A;  3PKY A;  3CDU A;  3VAJ A;  3GTG C;  2RRB A;  4IH7 A;  3R7S B;  4A3M K;  2YWW A;  3S0X A;  5IQ6 A;  1FNO A;  5A8R B;  3KHH A;  4K7Q A;  1CBK A;  3TUZ C;  2XHC A;  2CVE A;  1PBA A;  1KS2 A;  1S1T A;  2HGN A;  1APS A;  2J9D A;  4WFB Q;  2KXH A;  3GU0 A;  5DM6 Q;  5C3E C;  4UY8 5;  3A1Y G;  1KLM A;  1B7F A;  1VR6 A;  5DQH A;  2ZNY A;  5AXK A;  2B0G A;  2ACM A;  4LF7 J;  5JVH Q;  2HUR A;  4OV1 A;  3BB5 A;  3H2V E;  3TUP A;  1KOO A;  4BS2 A;  4NYO A;  3QMQ A;  3I55 S;  4DV0 J;  3QJP A;  1R9T K;  2RS2 A;  1XZQ A;  4USU A;  1LWF B;  3SQG B;  1OIA A;  2M8H A;  4X6A C;  2LVW A;  4Y3C A;  3QJL A;  3WX8 A;  3OSN A;  1N5T A;  4F25 A;  4B9M A;  3I6P A;  4GKJ J;  4UZC A;  2VU5 A;  3LPE A;  2JLG A;  4TXS A;  4DV1 F;  1FT8 A;  1Y7P A;  5G0R A;  4HT7 A;  1WAC A;  1MWZ A;  1ZM3 A;  3IWL A;  2FDN A;  3HFK A;  1IR1 A;  3NS6 A;  2G1D A;  1W7W A;  2GQC A;  2L9D A;  4Y52 K;  2HRU A;  2K3K A;  1LFP A;  1S1U B;  2NSB A;  2CZ4 A;  4NLT A;  2DPJ A;  1S1V B;  3WIV A;  2PII A;  3PO2 K;  3OHB A;  4OYA A;  3BGR B;  3WC0 A;  2VC1 A;  1WC5 A;  1S72 S;  3MMA B;  3KK1 A;  5D0G A;  5EUH A;  4IRC A;  4G6V B;  4L3K A;  4AT1 B;  1EIY B;  4GFQ A;  3OL7 A;  1HNW J;  1O0P A;  4WTO B;  3KG1 A;  3BDE A;  2CFA B;  2QFJ A;  4YB6 A;  4DV4 F;  5CA5 A;  3MPV A;  1KWM A;  5GAE I;  2VHG A;  1I50 C;  4WE1 B;  1ROF A;  3UD5 A;  2DR6 A;  3U1N A;  1FD8 A;  2V50 A;  2XEX A;  4F3M A;  1TL3 A;  3GFZ A;  4YFX A;  1E6Y B;  4LFA F;  3EGW B;  1YI2 S;  1NPK A;  3W61 A;  2E66 A;  1AZS B;  3GQC A;  5SZT A;  2EFO A;  3HOU C;  4I6W A;  5C25 A;  1J98 A;  1ZAW A;  4DN0 A;  1HWK A;  4DSL A;  4NOI A;  2ZH7 A;  5GAG I;  3V4G A;  2J8A A;  4Q0B A;  1NND A;  5DRK A;  2ZHA A;  4GTC A;  4F3Q A;  3KJF B;  4QCL A;  2YX1 A;  4Q43 A;  1Q8L A;  1X0P A;  3FZ2 A;  2FPH X;  2XUL A;  3R2D J;  1XBW A;  3DLB A;  1M5P C;  4PPZ A;  4HI2 A;  2QLX A;  2E9Z A;  1RLC L;  3NBP A;  1NZ8 A;  4A8Y A;  5AE2 A;  2RE1 A;  1LW2 B;  1FFW B;  3KUG A;  3D5M A;  3Q8V A;  1S9G A;  1WNE A;  4BBR C;  3R5G A;  4C11 B;  3MMJ A;  2WON A;  1NME B;  2KWA A;  2RS8 A;  1YBT A;  2BQ3 A;  3MM8 A;  4OYZ A;  3DLG B;  2UVR A;  4KHM A;  4RBV A;  1HNI B;  3PKM A;  4OZJ A;  3ILI A;  2PN6 A;  4OZ2 A;  4MIB A;  1IJE B;  3Q8Y A;  4HVZ A;  2UXB F;  1X5T A;  4DPO A;  2HHV A;  5C4X C;  4NLD A;  1NK0 A;  3KHL A;  5M5W K;  2YH0 A;  3F56 A;  5HO4 A;  3N01 A;  1X0F A;  4MK9 A;  4QIF A;  4NLV A;  2JZ5 A;  4JV1 A;  3N5F A;  5IV4 A;  2N7Y A;  2FUG 9;  4B3O B;  5FJ4 A;  3RZD K;  2XGP A;  1HKA A;  4J9R A;  2AYG A;  3MMC A;  2MB0 B;  1LWC B;  2JEI A;  1UVI A;  1N5S A;  2W2Q P;  3C19 A;  3DN9 A;  1ZM2 A;  2E9T A;  2CWK A;  5CHC B;  4DCJ B;  1IBL F;  3MZI A;  3M2V B;  4AD6 A;  3KHG A;  1C0U B;  4IKA A;  4DSJ A;  4PG7 A;  4M8L A;  2LLZ A;  1K1Q A;  3POT A;  1IBC B;  3AJ1 A;  1CQN A;  4M5N A;  4J37 A;  1UEU A;  1RT3 A;  2YU9 A;  4LT6 A;  5H1S V;  2W9A A;  1N8R T;  2CPD A;  2RDJ A;  1U6B A;  3OVA A;  4P52 A;  4PG5 A;  3CCJ S;  2ZUA A;  2AV5 A;  2J7W A;  3AH6 A;  1N88 A;  1R8A A;  4WII A;  3WBZ A;  2MKJ A;  1OS5 A;  3AOD A;  4JK1 A;  4EBE A;  1BQN B;  4N76 A;  1TR0 A;  1SBR A;  3ZTO A;  1VQY A;  2K3I A;  4NXN F;  4B3M J;  5L38 A;  1R8H A;  4ECZ A;  5D4P A;  2PGC A;  4YS2 A;  5EGH A;  4LUB A;  2VZ9 A;  2V94 A;  4YDX A;  1WG5 A;  1PIL A;  3TW0 A;  2ZOG A;  4HDG A;  2OFG X;  2E7V A;  3TYT A;  4F0K A;  1T11 A;  5GAH I;  5F8I A;  3N6M A;  2YX7 A;  5C24 B;  2XM3 A;  4U7C A;  1VJQ A;  2EBG A;  3DRY A;  1JLQ A;  1OO0 B;  3ZZU A;  4URG A;  3HVT A;  3GR0 A;  3RW6 A;  4I2Q A;  4E0D A;  1X4E A;  4I6A A;  3QIP A;  3S8S A;  4MKA A;  4FP9 A;  4USI A;  2Z58 B;  1SH3 A;  2H48 B;  4YME A;  3AD8 C;  1Z2Z A;  2YNG A;  4ED4 A;  1S7I A;  1H7W A;  2FHJ D;  2MJU A;  3NNH A;  4A4J A;  2V67 A;  2MQM A;  3G86 A;  2RSQ A;  4FYW B;  3DMJ B;  2C2N A;  3QZ7 A;  3EYZ A;  2D1C A;  1F5C A;  2WCX A;  3OR2 B;  2GSU A;  1R0A B;  2ZWP A;  3CUL A;  1RIS A;  3LAM A;  4OLP A;  4M5L A;  1YCL A;  1NK4 A;  3B4D A;  2YKP A;  2AYE A;  4GTL A;  3HOV K;  2VA2 A;  2W2O P;  4JBC A;  3S2H C;  2DNO A;  2RRN A;  3MM9 A;  3GFY A;  5F3T A;  1OWX A;  3JSM A;  2N3L A;  3NNC A;  3CMQ A;  2ZFZ A;  1HLW A;  1OQ6 A;  1TUV A;  3PDN A;  4ZVT B;  3TAQ A;  5SUH A;  1R27 B;  5IZH A;  4IFY B;  4WWS A;  3M4X A;  2MPU A;  4F3O A;  4NLP A;  3FFI A;  4LR8 A;  4I6Y A;  3H42 A;  2MQN A;  4UOC A;  4LRA A;  3T41 A;  1XMO F;  3HP6 A;  3CB4 A;  2PO4 A;  2HHP A;  2WHO A;  1FFS B;  3AA8 A;  4Q2L A;  4GC6 A;  4J5O A;  2BW2 A;  4F4Z A;  3NCQ A;  1WCM A;  5IYB C;  1WOO A;  4RW9 B;  2J7K A;  1R0C B;  1S1W A;  2VKR A;  3CJ2 A;  3T02 A;  4WFY A;  4X4T A;  3DOM A;  2RDD A;  1CUL A;  4FZB A;  2D9O A;  1VRU B;  1SFO A;  2V68 A;  4YP3 A;  2RJZ A;  4L74 A;  1VQ8 S;  1VS3 A;  3OFE A;  1X5O A;  2AJ4 A;  2ZH8 A;  4AE5 A;  1FHT A;  2G0J A;  1HQE B;  1G2E A;  3RB6 A;  3CAG A;  1R3N A;  2PA8 D;  5L39 A;  3HOW C;  1S9E B;  2B6A B;  4UQT A;  4CO4 A;  3BDP A;  3G87 A;  1UW9 A;  3B54 A;  5LJ5 Y;  1XTZ A;  5DG7 A;  5FLM C;  2MZQ A;  2HS0 A;  1VJE A;  3JTN A;  3UO0 A;  3NG8 A;  4K0K F;  2G13 A;  1FE4 A;  1S76 D;  2FHM A;  2CW0 A;  3QT6 A;  3A13 A;  2BM1 A;  3LW5 C;  5BR8 F;  4BXX C;  1ZZF A;  2IDE A;  5D4D A;  1NDC A;  1JNR B;  2FHO B;  2A69 A;  5IOT A;  3GTO A;  1XER A;  3BSO A;  4NOH A;  2KDO A;  2XO7 A;  2IJN A;  1O2A A;  3S14 C;  4R0E A;  1YQH A;  1FRX A;  3D1Q A;  1Q5Y A;  2BM0 A;  2OPQ A;  4N41 A;  4J9S A;  2F4F A;  3GJR B;  3QLH B;  1Q86 T;  2QMX A;  2VBY A;  4LSL A;  4MKY A;  3ZZP A;  3VR1 A;  2I0X A;  4WFA Q;  4WKY A;  3LP1 A;  1YIJ S;  2Y0S L;  1FJG F;  2DEI A;  3KLG B;  5E3A A;  3PYD A;  5GAD I;  4BY7 C;  4ZIV A;  3ZNJ 1;  2Z0G A;  5CYM B;  4I68 A;  3VGU A;  3M4O C;  1WC1 A;  1X7V A;  3H2U B;  1VRT B;  5KFK A;  3V4I A;  2ROG A;  4OYB A;  2ZVS A;  4A8K A;  4WJ3 M;  2GNK A;  1U1O A;  4JI2 F;  4RUC A;  3BH6 B;  3S16 C;  4RW7 A;  3E8O A;  2D3U A;  2VG6 B;  3OQ2 A;  2NUH A;  5ETM A;  1CSJ A;  4G0U A;  2EG2 A;  3MDF A;  3A8J A;  4Y2C A;  4NA3 A;  3H3V D;  1W2B R;  1WEX A;  3WDO A;  4K4Y A;  4QR2 A;  4G7O A;  1YJW S;  1IKY A;  4DQR A;  4E98 A;  3KTQ A;  3GYN A;  1Y1W K;  1Y1V A;  1IR0 A;  2QL7 B;  4LSZ B;  1KTQ A;  2R93 K;  2B8P A;  1LQ9 A;  3GG1 A;  4P7T A;  5D78 A;  3SDE A;  5IP9 K;  3KLI B;  2E1C A;  1WTB A;  3TWZ A;  3IWX A;  2B9Y A;  5HK4 A;  2GAG C;  3HHL A;  2DNR A;  2ZBR A;  2ZBP A;  3T5K A;  3PY8 A;  2J6T A;  3HOX K;  3DM2 A;  1ARO P;  1T9T A;  4G1Q B;  1VQ5 S;  1RT2 A;  1J6V A;  3PHT A;  4DI6 A;  1I6J A;  3DRP B;  1GXT A;  1BC6 A;  4UT4 A;  2B56 A;  5KT2 A;  2NVY K;  2O1P A;  5KT7 A;  5J2Q A;  1VQM S;  4ZVQ B;  5E7O B;  2K1R A;  1IWA A;  5HVG A;  2CPJ A;  1KOH A;  5LMU J;  2ZJR Q;  3O44 A;  4KBI A;  2HVE A;  3BN7 A;  2W9B A;  1BS2 A;  2P9C A;  3MUV P;  1K83 C;  1ZH5 A;  4AND A;  2OHD A;  1YZ6 A;  1ZPW X;  3W2V A;  3RRK A;  1X9S A;  2KVQ E;  3MM5 B;  1RAG B;  3A8I A;  3PW7 A;  4A3I C;  2CQG A;  4QW9 A;  3R8Y A;  1K0V A;  2HRT A;  1N5Y B;  4K4S A;  4KN4 A;  1A9N B;  1EET A;  4KM9 A;  5F0U A;  3K5O A;  4OFZ A;  5KG2 A;  1GE9 A;  3EGZ A;  1RU0 A;  2NVT C;  3PO3 K;  2Y9H A;  2MQO A;  2V34 A;  4A3L C;  3SI8 A;  3FKI A;  4ITS A;  5KT5 A;  3CF5 Q;  4ECX A;  2JLF A;  2NVY A;  5A76 A;  3RBZ A;  3LAL A;  3GMG A;  4PAB A;  4C3K A;  3HKZ L;  1KVJ A;  2GQQ A;  3NAI A;  3W8G A;  2IAJ B;  3SCI E;  4X66 J;  4ZCM A;  1DBD A;  2LQJ A;  2R3V A;  1IBK F;  4NRU A;  1CJT A;  4ZPW R;  5ETQ A;  3N28 A;  4A3C C;  3EPG A;  2H54 B;  5I3U B;  1JOE A;  1O8B A;  5IFM A;  2JA8 C;  2R7Z C;  1XN9 A;  4C3J C;  3M32 B;  2VV5 A;  3KUH A;  5GAE U;  3SQG A;  2XLK A;  5HMX A;  3GZ7 A;  2UV8 G;  1V9O A;  1RTH B;  4I4B A;  2VON A;  3I0R A;  5A6W A;  2BJ7 A;  2G4B A;  1DQ9 A;  3O2I A;  1BUX A;  1IVZ A;  2VQF J;  1RT1 B;  2L9W A;  1JKH B;  2OSQ A;  4ECY A;  3CJS A;  5HVF A;  1KN6 A;  3PJ9 A;  2IFX A;  4KHP J;  3G6Y A;  3ZTP A;  2V63 A;  1TL7 B;  4FVC A;  2CXE A;  3CXC R;  1HA1 A;  2HK3 A;  3OVS A;  3HVA A;  2C22 A;  1DFD A;  3M8W A;  2LEA A;  5DG8 A;  5GAG U;  2Z2L A;  2R92 A;  4F4A A;  1HI0 P;  3OTD A;  3TA1 A;  2OPP B;  2HBR B;  3IAS 9;  1WEY A;  3L95 X;  4DSE A;  1UWB B;  3FBB A;  1CJU B;  2OEL A;  3IXQ A;  4YFN A;  3Q8S B;  3KXD A;  1WKK A;  2IM0 A;  2QO3 A;  4RW6 A;  3OJU A;  2QIF A;  5KFX A;  2F9D A;  2DNK A;  2J8S A;  2NZC A;  4NZ0 A;  3L7P A;  3C66 A;  4J9V A;  2X1G A;  3MM7 B;  3A4T A;  1UZH A;  3HK2 A;  1TWF C;  1L3V A;  1DLO A;  1JB0 C;  1GNK A;  2MEW A;  1GH8 A;  1XEZ A;  4ED7 A;  2XZW A;  4PKD B;  1YNN A;  1RWK B;  2ATL A;  3NKY A;  3D6M B;  1IM6 A;  3A3P B;  4ZA1 A;  4KH1 B;  1YJR A;  4BBY A;  3HT0 A;  3AQP A;  3KG4 A;  4WE1 A;  2WSC C;  1JLA B;  3VA7 A;  3ZXW A;  1M5V C;  3A3N B;  3S1T A;  1ISE A;  4LRB A;  3CD5 A;  3IBF B;  4AUK A;  2JH3 A;  2BAB A;  2JA6 A;  1JQG A;  3T9N A;  4PQU B;  2AGP A;  1PBU A;  3CQZ C;  1KLN A;  5LSO A;  3O6Q A;  3MCS A;  4LF7 F;  5CXT A;  4GO7 X;  2E2J C;  4WFN Q;  1TWA K;  4XTT A;  1PJ7 A;  2A18 A;  2MDA A;  2CWX A;  4O23 A;  1GMV A;  4F36 A;  4DV0 F;  1EAY C;  3D6H B;  3QJJ A;  2H5J B;  3ETM A;  1FVQ A;  4JOU A;  4O44 B;  3W8P A;  1ZM9 A;  1T3N A;  6FD1 A;  2BUN A;  4TN2 A;  5CD4 H;  2AP6 A;  3S17 K;  4GKJ F;  4NEY A;  2QLB B;  3I4P A;  4P72 A;  1FDB A;  3G82 B;  2JNJ A;  1PSD A;  5IP7 C;  2MXY A;  1JJC B;  2XHW A;  5F8G A;  2G1H A;  5EWF A;  4JV2 A;  3NL0 A;  2LKZ A;  3BBB A;  4RO0 A;  3L4B C;  1S6Q B;  3PYE A;  1KEK A;  3L9Z A;  3V2U C;  4P74 A;  3ZO7 A;  1D8Z A;  3DLE B;  2ADB A;  3VQT A;  2DH7 A;  1Q79 A;  4FNI A;  5C44 C;  1HNI A;  2J9D E;  3D3B J;  1DUR A;  1HQM A;  5CD4 A;  4V1A k;  4ZVE A;  4DR1 J;  5E3P A;  3I0S B;  3GON A;  4KR0 B;  5HBM B;  2CG8 A;  2KG0 A;  5GAH U;  3D67 A;  7AT1 B;  5I4M A;  4I69 A;  1HNW F;  3HSJ A;  1M5O C;  3TAN A;  3T5H A;  2DR8 A;  2R4F A;  4WFZ A;  5EDW A;  4FXV A;  5H9F J;  2E2I C;  2OEK A;  5K14 B;  4YN3 B;  2ALZ A;  2VBW A;  4K59 A;  2YKQ A;  1TTH B;  4OX8 A;  1RAB B;  2KZZ A;  1VI7 A;  1U45 A;  5D4N A;  3NGK A;  3M2V A;  2B63 K;  2JFK A;  3W62 A;  1C0U A;  4USV A;  3MD3 A;  3W1Y C;  2A0F B;  2H5E A;  1C1C B;  2KL8 A;  4YY3 J;  4IFV B;  2HHW A;  2O67 A;  1CVJ A;  5E2Q A;  4JI5 J;  5FLX Y;  3S1Q K;  3DU5 A;  2V4Q A;  3GV7 B;  2OUG A;  1X8D A;  2P6T A;  1U49 A;  3DDI A;  5KFC A;  2OPS A;  3GFH A;  3I4M C;  2ZIT A;  1WUU A;  4JUZ A;  2B7C B;  2W7V A;  4LK1 A;  5FJ8 K;  3KLE A;  1HNV B;  1FCA A;  1H98 A;  2VPY B;  1BQN A;  4WU3 A;  1T9Y A;  3PR5 B;  2LA6 A;  4XDD A;  3QRR A;  2DR5 A;  1O2B A;  2V2Q A;  4LQ3 A;  2RF2 B;  2BQU A;  2PFD A;  1ZYR A;  1MU2 A;  1Y5L B;  1KP6 A;  2QA1 A;  4RWX A;  2NVX C;  2HWT A;  4FF2 A;  3MED A;  2VDI A;  4OHV A;  4IG3 A;  3EWG A;  4J9P A;  5CYJ A;  3VAH A;  2JA5 A;  3H0G A;  3LUY A;  4WP3 A;  1S5Z A;  4RUB A;  3TUJ C;  2KN4 A;  3FEY B;  5K20 B;  4KC6 A;  5DO2 A;  4TKT A;  4P2S A;  1A0O B;  2KJW A;  1U1R A;  4DR3 J;  4QJV B;  8AT1 B;  1TV6 A;  1JLG A;  2GIR A;  3DMJ A;  1D1U A;  4DMZ A;  1JJH A;  2X1F A;  3OR2 A;  3BV8 A;  4Z7C A;  2AWZ A;  2JEF A;  4ICL B;  1Q16 B;  1R0A A;  2VPW B;  3EXY A;  4LR9 A;  4PG8 A;  2E5I A;  4RL1 A;  1WQH A;  2HWI A;  2JA7 A;  3ADA C;  4KGV B;  4A3F C;  3CJT A;  1O5J A;  2P2C B;  4IDK B;  5J2M B;  3QT8 A;  4AH6 A;  1UFK A;  3IRX A;  2PHC B;  3TAP A;  3VZI A;  3SXL A;  2HRY A;  2NVQ C;  5B09 A;  1NZA A;  4IFY A;  5H9F K;  4TLQ A;  3PYG A;  3C14 B;  3G96 A;  4K2J A;  1TKZ A;  1CS4 B;  2EBE A;  2CQ4 A;  2DO0 A;  4OHZ A;  1SJ4 P;  1P27 B;  3C15 A;  4DX5 A;  1Y3J A;  3D3C J;  4FYY B;  3HT3 A;  4JI0 J;  3TZX A;  5C3E K;  4RR5 A;  1XK8 A;  2AEM A;  1NU4 A;  2FLP A;  1MWY A;  4WPA A;  2HHS A;  4KAR A;  4B3M F;  2N4C A;  1SJQ A;  2BJD A;  4DL2 A;  3OXL A;  4M1K A;  2FHJ A;  1D09 B;  1SC4 B;  4KGX B;  2VD3 A;  1RXO B;  2HGM A;  1YJ7 A;  2Z56 B;  2CNK B;  4WU2 A;  5D4O A;  2M3D A;  1HWI A;  3MCM A;  1C4C A;  2MHE A;  4J7C A;  4LF6 F;  4NA1 A;  5GAD U;  2CQP A;  5KFA A;  3HF5 A;  1TU0 B;  3Q8P B;  3PO4 A;  3UE2 A;  4A8X A;  2RIJ A;  3P3D A;  1IKW B;  3NRB A;  3LTO A;  4BBS C;  3BSN A;  3HJF A;  4O3O A;  1EQ0 A;  1S9E A;  3GTG A;  3GR1 A;  4EFA C;  2EC2 A;  4C6A A;  3SIP B;  3OTO J;  4ZLP A;  4DDQ A;  1TK8 A;  2F8E X;  4ELT A;  2FVS A;  3TFI A;  3GTJ C;  5J1N A;  2JDJ A;  3DRR B;  1FTC A;  3PW4 A;  4P2F A;  3E2E A;  1O25 A;  1Q1K A;  4B3S J;  3HKW A;  4KM8 A;  1ZET A;  4H4O B;  2Z30 B;  2DRB A;  2X3D A;  3E3X A;  2C28 A;  3V6D B;  2YQ3 A;  4F02 A;  5J2N B;  3HSG A;  1DAX A;  1X4A A;  2R7U A;  3I32 A;  4B9L A;  5HSP A;  3DLH A;  5JUM A;  2P5M A;  3QLH A;  2IHR 1;  2KU7 A;  3JS9 A;  2I38 A;  3GCW P;  1INN A;  4LR2 A;  3M2R B;  1MML A;  1TWG K;  1EX8 A;  4NCG B;  2ZVI A;  1HPZ B;  2AYM A;  5CYM A;  3TUI C;  2L9N A;  4AL5 A;  3GTK K;  4P71 A;  3GTQ C;  2CFX A;  5K8N A;  3P5T L;  1JXL A;  4KMA A;  3ZTR A;  3RTV A;  3ZFV A;  2J0X A;  2UU9 J;  2R7R A;  1WIH A;  1MWQ A;  1NPR A;  3GDZ A;  3QO9 B;  1RHK B;  3BPD A;  1DY3 A;  4R5P A;  3BQ1 A;  1ZQ1 C;  2VG6 A;  4LF4 J;  3HOU K;  2YWH A;  2LEC A;  2E5L J;  2BKP A;  5F0W A;  1VJW A;  1BHN A;  4EO6 A;  5F8H A;  3E51 A;  4EO8 A;  1NDL A;  3HVW A;  1TAQ A;  2R7T A;  2NUU G;  4DR6 J;  3D54 A;  4XLN A;  4F4K A;  4NZ7 A;  2MQQ A;  3QX3 A;  3C6T A;  3IM9 A;  2EW9 A;  3SCK E;  2GIQ A;  2DBB A;  1I5O B;  3RR8 A;  5B0G A;  2R8K A;  3FOF A;  2Q79 A;  3KLI A;  5RUB A;  1B99 A;  4UST A;  3BS9 A;  3PG9 A;  1HQU A;  1PJ5 A;  1I1G A;  4DBQ A;  3SFU A;  2VH7 A;  3P45 B;  2V8P A;  3CJ3 A;  4OX6 A;  1I50 A;  5L1I A;  4K2X A;  1SIW B;  3DYA B;  4U7U K;  2ILZ A;  3QQC D;  3N6N A;  4MJK A;  3M8S A;  4FF1 A;  4QIE A;  4LQY A;  2QMU B;  3G8S A;  2OO4 A;  3DRP A;  2V4R A;  1M5S A;  1Q81 T;  4C9D A;  5TMC A;  5IM0 B;  1WDT A;  4X4U A;  5J1E B;  1TEL A;  3I5B A;  1Z1Z A;  2I8E A;  2ZKT A;  1UPM B;  4X4S A;  4CRJ A;  3TAR A;  3MMB A;  2NPF A;  4DQI A;  3GTM C;  1N33 J;  2RGR A;  3RU0 A;  4I1T A;  1WJ9 A;  4OIR A;  5I42 A;  4GMK A;  4OYO A;  3RB0 A;  1Q4R A;  1P6T A;  2QSW A;  4KH0 B;  4LQ9 A;  2W2N P;  3T3F A;  2EBB A;  5KFB A;  3M3Y C;  4BWJ A;  4A8O A;  1D9D A;  1X5S A;  3MM5 A;  2BQR A;  4WIL A;  3M6U A;  1F9H A;  5ETN A;  1FNX H;  5IOR A;  1LNQ A;  1MRO B;  5DET A;  4LF9 J;  4IG0 B;  3AY0 A;  1R6Y A;  1F5B A;  2CJK A;  1RAA B;  5LT5 A;  5D3G B;  2EFP A;  2PT0 A;  3KLV A;  1KVK A;  3N0V A;  2CNN B;  4ZVR B;  2LQ9 A;  1YBA A;  3ISN C;  3E01 A;  3KFW X;  5CYQ B;  1K73 T;  5K8M A;  4P2X A;  4URQ U;  2DHS A;  3KJQ B;  2GJF A;  2IAJ A;  2ZDP A;  2PE8 A;  4ECV A;  2AX1 A;  3UFC X;  2V8H A;  1XNQ J;  2DNM A;  1WCM C;  3AQO A;  4IRD A;  3VAK A;  3PNI A;  2JC0 A;  3K59 A;  1FK9 B;  1WEL A;  3KLF A;  1J6X A;  3EQL A;  3M8P A;  2GAH C;  4DLG A;  3M9O B;  4RW4 B;  3M32 A;  1SFO C;  3Q0A A;  1RA7 A;  2CQC A;  1G7C B;  3N9U C;  1RTH A;  5DDO C;  1PGZ A;  2ZJP Q;  3MR3 A;  2DY1 A;  1NK5 A;  4BLB A;  2R7V A;  3R5J B;  3IS9 B;  1JKH A;  3VAM A;  4ATN A;  5T7L B;  2IDL A;  2RML A;  3TVK A;  4WF9 Q;  1TL7 A;  4DV3 J;  2YXL A;  3BYP A;  4Y7N K;  4FN5 A;  1NHU A;  1RTJ A;  1DTT A;  1IW7 A;  2JWN A;  5LMU F;  1F3F A;  3T1Y J;  2Q6C A;  2OPP A;  3FCW A;  3MUR P;  4NXM J;  3CO0 P;  4F4W A;  4QWC A;  2LP4 A;  3S1R K;  3M30 B;  4EWT A;  4YEA A;  2R7Q A;  4U8V A;  3CC2 S;  4DXL A;  3W5Y A;  4DR5 J;  5KFE A;  2Q6B A;  4A3D C;  4RMF A;  1TVR B;  1BGW A;  2ZDO A;  4GRS A;  1VBX A;  3MXH P;  1K44 A;  4JYA J;  3UCZ P;  2JRS A;  3S2H K;  2KZM A;  1JLA A;  2CJY B;  2XCA A;  1REV B;  5HI7 A;  1R31 A;  2BEF A;  3PR4 A;  4ILL A;  2HFO A;  2Y1R I;  1QE1 B;  4X66 F;  1EJ7 L;  4ZVU B;  4S0M A;  2P9E A;  3KJV A;  4C2M C;  2ASY A;  1H7X A;  1NKE A;  3EGN A;  1RT4 B;  4CNY A;  1IE0 A;  4GO5 X;  4P9S A;  3C6U B;  2R8J A;  2XYH B;  4DPX A;  4OYM A;  5B0E A;  2MZT A;  1WHY A;  3OHA A;  1JX4 A;  1RU1 A;  5IYB K;  3SZZ A;  3IMQ J;  4OX7 A;  1B7Y B;  2MLX A;  1Y4Z B;  3HFV A;  2UUA J;  1UVJ A;  2YPZ A;  3HZG A;  1TWC C;  3AOA A;  4NI2 A;  1XXC A;  4QWA A;  1CG2 A;  4L73 A;  1U0S A;  4CLF A;  3RB3 A;  1LXJ A;  2VQF F;  4GTA A;  4X4P A;  3ULH A;  3Q8U A;  3I56 S;  1NJZ A;  4JI7 J;  2HHH J;  4A8Q A;  5JXS A;  3H25 A;  4OI2 A;  4KHP F;  3TTG A;  2DNY A;  3H20 A;  1IBM J;  3CJ8 A;  2VB6 A;  3OPF A;  2O5D A;  2CRL A;  3Q24 A;  1UVM A;  3HOW K;  2NQP A;  4V19 X;  2XSJ B;  4K50 A;  2OML A;  4KO0 B;  3CED A;  5FLM K;  4XAK A;  3DLE A;  3OLB A;  5KFN A;  4WK3 A;  3TFH A;  3FQK A;  5DDQ C;  3T6B A;  2N82 B;  2XQC A;  3R5A A;  3DGP A;  3LGN A;  1C0T B;  1YTY A;  2DGT A;  3MEE B;  4AYB D;  5IC6 B;  4FF3 A;  4EZ6 A;  1U2C A;  3HSD A;  1TFW A;  5CCM A;  2HZC A;  2IA0 A;  2A1B A;  2MKI A;  4NX9 A;  2EFQ A;  3EVM A;  3M05 A;  4HT5 A;  4FNH A;  3QNW B;  2YNI B;  2CQI A;  4GTE A;  3ISZ A;  2DXF A;  4CLU A;  3JST A;  2FD2 A;  3D2W A;  3GIM A;  4IH5 A;  3ZZO A;  4L3N A;  3RJM B;  3M4O K;  3D0I E;  4CO2 A;  4KT0 C;  3D6T B;  1C1C A;  3AA9 A;  2PFF B;  2KFY A;  4IFV A;  2UUB F;  4L6V 3;  3BO3 A;  4J3N A;  1MMD A;  3HJV A;  1U2F A;  1YKW A;  2W9C A;  4UOG A;  3S16 K;  2L48 A;  3S1N C;  1RWX B;  1R8C A;  1BY9 A;  2HAI A;  3ETO A;  5IS2 A;  4KTQ A;  1FVS A;  2QX0 A;  4KMU A;  1MN9 A;  3PFO A;  2GML A;  3VCD A;  3N79 A;  2RF2 A;  1VBY A;  3K89 A;  3G2X A;  3R97 A;  4Y0F A;  5IYC C;  2XMA A;  1RT7 A;  3GTP C;  3D0H E;  2PA8 L;  1HW8 A;  5KFL A;  3AHP A;  3LH2 S;  4DCP B;  4F4X A;  4ES3 A;  5B7W A;  1U4B A;  4Y2M A;  2BJ8 A;  3IN5 A;  2AJF E;  2AU0 A;  3NEK A;  3Q3Q A;  1RT5 A;  5KFO A;  1VQO S;  4USJ C;  4YG2 A;  4CH7 A;  2V6A A;  2XGQ A;  2RIL A;  4A47 A;  1VIS A;  3RRH A;  3OSP A;  1FKO A;  3H4D A;  4QJV A;  2DYA A;  3C8Y A;  4DR1 F;  4K4V A;  1RKJ A;  2DGS A;  1LXN A;  2BX6 A;  1P9Q C;  3D68 A;  4EYI B;  3BH7 B;  2CQB A;  2WVF A;  4HH0 A;  2ZD1 B;  5A8W A;  2IPO B;  4ICL A;  1NEE A;  3G71 S;  2PEB A;  1ITP A;  2OSR A;  4DLE A;  3B6B A;  3GTL C;  2VJU A;  1RCO B;  2QT7 A;  2W4C A;  4BY1 K;  2FVQ A;  2VFU A;  5CAB A;  4LVN P;  1FDN A;  3I4H X;  1HYS B;  3RB4 A;  2IA6 A;  5J2M A;  5L46 A;  4A3I K;  4TNO A;  3G8Q A;  3BGF A;  2GVD B;  1S1X B;  2MST A;  3ISN D;  3NCP A;  3UN3 A;  2AGO A;  3K7R A;  1T05 B;  4YY3 F;  1G3O A;  2NVT K;  3LP0 A;  1UJ6 A;  3PW2 A;  3C14 A;  4A3L K;  1XXA A;  3RBD A;  4JI5 F;  3CIZ A;  1CS4 A;  4KFB A;  3NMA A;  1F9E B;  2JA6 C;  3QRP A;  3TP2 A;  2RQK A;  4OZ0 A;  2E2H K;  2R7S A;  1FKA F;  3GV8 B;  3H3V L;  4PG4 A;  1SPB P;  2VG7 B;  1OSD A;  1U02 A;  3W5X A;  1W2I A;  3EGV A;  4OJG A;  1OMS A;  3CJ4 A;  5HLF A;  3H5U A;  2VIC A;  1P9Y A;  4IQX A;  3DDN A;  1K83 A;  2M52 A;  3FGV A;  2R8I A;  2C3Y A;  2YKA A;  2WB1 D;  1C2P A;  1QAY A;  1FKP A;  1L3K A;  5KTQ A;  1M1G A;  2VUM K;  1AXQ A;  4TY8 B;  4CLS A;  2JA8 K;  5CH7 B;  2R7X A;  4C3J K;  4RU2 A;  3PEH A;  3DLJ A;  3CGI A;  3WIU A;  3PYF A;  1WC3 A;  3T5J A;  1RWW B;  2XLI A;  5EGY A;  2DY9 A;  3FRZ A;  2HQF A;  2G2Z A;  5HAT A;  2V5H G;  4TLR A;  1PG5 B;  3D0G E;  1EQM A;  4A3G K;  3P8B B;  3GPA A;  1L3S A;  5IOL A;  2J0W A;  1S49 A;  4A3M C;  4DR3 F;  4UUX A;  1T9U A;  4DPW A;  1XR6 A;  3KNA A;  3HMJ G;  3OXG A;  3R6G B;  2YWE A;  1RLD A;  4ZPD A;  1VYA A;  5HQL A;  2IYI A;  3CDA A;  1K47 A;  2V2K A;  4PXB A;  3CME S;  4FYX B;  2FTR A;  4UUW A;  3KDN A;  3CJR A;  3CCQ S;  3TQE A;  2DTJ A;  2R8H A;  5K8O A;  2A6H A;  2MY8 A;  1RE1 B;  2R7Z A;  4USM A;  2XCQ A;  3C16 B;  5DLF A;  2ROE A;  1ZS6 A;  1N6Q A;  4DL3 A;  2KXN B;  4ZVH A;  4CLZ A;  2IVF B;  4KQZ A;  1R9T C;  3BR9 A;  4PR6 A;  4IOA Q;  1PJ6 A;  3TA2 A;  4ZS6 A;  2CZ9 A;  5JVO A;  1OQ3 A;  3M2R A;  2APO A;  2HK2 A;  1PAU B;  1HPZ A;  3HOZ C;  4H4M B;  3FC9 A;  1R6V A;  2DRA A;  1VIX A;  5GMK a;  4ILM A;  3N5B A;  4JI0 F;  3G8T A;  1EP4 B;  3LPX A;  5AE1 A;  5L9X A;  1SC1 B;  1GEH A;  3VQS A;  5IWA J;  4DR4 J;  3CQZ K;  1RHJ B;  1GX6 A;  9RUB A;  3RBX A;  1U09 A;  4CO1 A;  5KOW A;  3P6Y C;  1T9X A;  5B0A A;  2W7P A;  3DRS A;  2VFS A;  1RGV A;  3QAU A;  4L75 A;  1WF2 A;  5HJY A;  4W98 A;  2HQD A;  4FPR A;  5T14 A;  4H4K C;  3JAM Y;  1N56 A;  1JIH A;  1TWF A;  2RU9 A;  2A2D A;  2B43 A;  3T1A A;  3MM6 A;  3BEG B;  4DX6 A;  4ZP9 A;  5A2Q Y;  5DQG A;  1ELO A;  4JP8 A;  1PC5 A;  4U9R A;  3TAM A;  2D7S A;  2C3U A;  4LBI A;  3IWN C;  1S4F A;  3QBC A;  7FD1 A;  1FI4 A;  3PJX A;  4Q44 A;  3MAA B;  4ANE A;  4QZV B;  3H40 A;  3J81 Y;  3R1H A;  3OTO F;  1OY9 A;  4CM0 A;  2YH1 A;  5A8K B;  4N77 A;  1YGY A;  1TFY A;  4CH1 A;  1U1P A;  4F2R A;  2LA4 A;  4DUY J;  4FF4 A;  2R2S A;  1VDH A;  3BGO P;  1S6U A;  4GVB B;  5J1E A;  4B3S F;  2BRK A;  3IRW P;  2YPY A;  2HVZ A;  4C48 A;  4OIQ A;  4CP5 A;  3OFG A;  1YHQ S;  2VBZ A;  5BYS A;  1FX4 A;  2CNL B;  2H4W B;  2ZH3 A;  2XMW A;  1D9A A;  3BZQ A;  4WYW A;  4K4U A;  2BMB A;  1I6H K;  5A0Y A;  1UP1 A;  2DHA A;  3P4U B;  4OMF G;  1LW0 B;  2JA7 C;  2HAF A;  1AFI A;  1JLF A;  4AL6 A;  1WKL A;  1JMT A;  1S12 A;  4KKO A;  2BE7 D;  5E5N A;  5E41 A;  3W7B A;  3GJQ B;  1Y3K A;  4CYU A;  5KOX A;  2YVS A;  1FWK A;  3RW7 A;  3WC2 A;  5D3G A;  2LXF A;  4DPY A;  5AJ3 F;  2UU9 F;  1TKX B;  1Q7Y T;  3W9H A;  4KE5 A;  1NPP A;  2CQ0 A;  3GYX B;  2M4M A;  3KMQ A;  3VV2 B;  2NXU A;  4NCB A;  1NDK A;  5CYQ A;  4LF4 F;  2O01 C;  3PJW A;  3LAP A;  1IKX A;  2E5L F;  5M2P A;  1CPZ A;  3MFI A;  1XPP A;  3D28 A;  1QVG R;  1RQ0 A;  3IBW A;  5KFS A;  2ZZN A;  1QAX A;  4P75 A;  4DR6 F;  1HBM B;  4DL7 A;  3UVJ B;  4ZJL A;  1R8P A;  4KAT A;  4C45 A;  3AB2 B;  4GT9 A;  3K57 A;  1FFG B;  4FKX A;  2EXU A;  3NXZ A;  2QA4 S;  3KK2 B;  4RW4 A;  2VL1 A;  3HVR A;  4Q7A A;  4C97 A;  2Q66 A;  3FBE A;  4PWD B;  1LK7 A;  4DFJ A;  4O4G B;  4KN7 A;  2KH9 A;  4C7Q A;  4DFK A;  2E2I A;  3IG1 B;  2FYX A;  2WB4 A;  3RZD C;  2N7C A;  3ET6 B;  4C3H C;  2RVJ A;  3IS9 A;  1RYS A;  1HW9 A;  2RT3 A;  4F67 A;  2O3D A;  4OYP A;  4LBH A;  3IGN A;  4M5D B;  4OI4 A;  1RAO A;  1N52 B;  2BW7 A;  3TZZ A;  5DM7 Q;  2QYC A;  3N6L A;  1EK8 A;  3QWP A;  1N33 F;  3K8V A;  1B0P A;  4USW A;  2CDQ A;  3M30 A;  2YNH B;  1YG0 A;  1EH1 A;  1C0A A;  1RTI A;  5THW A;  1WOP A;  4CO5 A;  4DX8 H;  2KT5 A;  3FEZ A;  4CH0 S;  2BJ1 A;  4WP8 A;  2VA3 A;  4MKB A;  1YWX A;  1B0V A;  2FLO A;  2V4J B;  5ITH A;  1TVR A;  4DG1 B;  1SI9 A;  4J9N A;  4OJ1 A;  4ES2 A;  2DNP A;  1YBU A;  2BKO A;  5HRO B;  1FE0 A;  3JSB A;  3MF5 A;  4GZY A;  2NVX A;  4LR7 A;  3ICL A;  4I7F B;  4Y34 A;  1FJE B;  4OJH A;  5KFT A;  3RRG A;  1RP5 A;  4WFX A;  3QGI A;  3X1L B;  2DRD A;  1REV A;  4B08 A;  2HGL A;  2LQ8 A;  1WI6 A;  2G2O A;  3DHW C;  2IJF A;  2RDI A;  4M94 A;  2CQH A;  3NGS A;  2F7V A;  1QE1 A;  2ZNZ A;  1F6T A;  3HUL A;  3TOQ A;  1KTV A;  3MR7 A;  5DGB A;  2YWG A;  3QZ8 A;  3G4A A;  1XNQ F;  3IAM 9;  3CCT A;  4QR0 A;  5C2G A;  1QSS A;  2UUT A;  4URS A;  4U67 Q;  4YQW A;  1PO6 A;  1ZXO A;  3NWR A;  3DHX A;  1N36 J;  2P8I A;  2QTW A;  4RLE A;  3Q2S C;  3CSK A;  2CVI A;  2AIR B;  1WWH A;  2XCR B;  1SKS A;  5KFH A;  3FNN A;  2J6S A;  1H72 C;  1Y0H A;  4MYT A;  4C0B A;  4HKQ A;  2GJ2 A;  2KO1 A;  1MSW D;  1XNR J;  1ZBS A;  1UVK A;  5JVG Q;  3QGH A;  2VG5 A;  3FK4 A;  1X4H A;  4NLU A;  3MWB A;  2HHQ A;  4MEX A;  5LL6 d;  3KLH B;  2E29 A;  3M6W A;  2WOM A;  2X3G A;  1WHV A;  4DV3 F;  2M70 A;  2B5J B;  3BKT A;  4A8S A;  1J27 A;  2OP5 A;  2AKW B;  4NCA A;  3J7Z T;  3PCO B;  4RJV A;  3T1Y F;  1BDF A;  1XJW B;  5T41 A;  2QC3 A;  2XCP A;  1FRK A;  4IH6 A;  2W1B A;  4NXM F;  3NWG A;  4DV4 J;  2BE2 B;  1ZPV A;  1VQ9 S;  1S1T B;  2W25 A;  1WKJ A;  4UY8 T;  5EHH A;  4C4W A;  1T9V A;  5KG4 A;  4J9K A;  4RUH A;  4DR5 F;  1FXD A;  1KLM B;  4LRD A;  1SCJ B;  4OV6 A;  1C0T A;  2XY7 A;  2XMV A;  3K58 A;  3V81 A;  3FBC A;  5KFI A;  3KUE A;  3MEG B;  2XG8 A;  3CDW A;  3UDE A;  2H4Y B;  3US5 A;  4JYA F;  2FQO A;  2AX0 A;  3IO1 A;  4PYD A;  2A6M A;  1OY6 A;  2Z2M A;  2QL5 B;  1FA0 A;  4DS5 A;  3TX0 A;  1XZQ B;  3GJT B;  2YNI A;  1JNZ B;  2UV8 A;  2RAQ A;  2V0N A;  2KVI A;  3H5Y A;  3BSA A;  4NA2 A;  5D8H B;  3UCU P;  4K4X A;  2YU9 K;  4JI8 J;  2XB2 D;  4C0O C;  3MPY A;  5G0R B;  1S6O A;  4WTY A;  4Q5V A;  2EK6 A;  4DQP A;  4RUA A;  2GMJ A;  4KY3 A;  3GTJ A;  4V19 J;  2MZS A;  4DQQ A;  5M3M K;  3WQP A;  1VC6 A;  1FXR A;  1DRZ A;  2ROP A;  2A68 A;  4HI1 A;  4IR9 A;  1ZTT A;  2HS3 A;  3AJ2 A;  3OT9 A;  2UUA F;  4FXW A;  5HL8 A;  2F5G A;  1HMV B;  2XNR A;  3QID A;  1V6H A;  4BDP A;  1EI6 A;  3QFW A;  1RB0 A;  1NK7 A;  2R7W A;  4JI7 F;  5HJX A;  2HHH F;  2QLW A;  4ECT A;  1NBE B;  4HAC A;  4CLY A;  1IBM F;  1JJ2 R;  4OHW A;  4C8N A;  3KK1 B;  4MEY A;  1OJ4 A;  1F9N A;  4OZ3 A;  4TVA B;  3UR3 C;  3JQK A;  2WW8 A;  4X4O A;  5J2P A;  5IQQ A;  2E44 A;  3GEE A;  1IN0 A;  4P10 A;  3SYZ A;  2CPY A;  2SXL A;  5CQG A;  4DV5 J;  1W25 A;  2CNO B;  4USK A;  4K5R A;  2PPB A;  3GTQ A;  2FGC A;  3OFF A;  2CPI A;  1E6V B;  3M6X A;  3CMA S;  5HAN A;  2AW0 A;  1IBL J;  2FJV A;  1UPP A;  2OEJ A;  4LMZ A;  1FO1 A;  4DHV A;  3PX0 A;  4XPC A;  2ASJ A;  2FJB B;  2FIU A;  2QE5 A;  3P96 A;  3VHQ A;  1VGX A;  1TAU A;  1VQ4 S;  3HX9 A;  1RHR B;  1M5H A;  2DNG A;  2HNY A;  4GVL A;  2EVZ A;  4BC9 A;  5HQ8 A;  4Q0B B;  3I82 A;  4B3T J;  3CJK A;  4ILD A;  3M3Y K;  4HDH A;  1Y1W C;  2VFV A;  3EVW A;  4XIU A;  3N3Y A;  2WVC A;  1Y10 A;  2UXC J;  2R93 C;  1FWP A;  1RTD B;  2HQ3 A;  2I6W A;  1YLX A;  4YFU A;  5IP9 C;  2EWH A;  5FII A;  4ZVF A;  1S99 A;  4B9T A;  1RAJ A;  1I3Q C;  1S1X A;  2WSF C;  3G9C A;  5KG1 A;  3W63 A;  2GIF A;  2VUG A;  1T03 A;  1ULR A;  5EGE A;  1T05 A;  3GEH A;  3DKD A;  5DJB A;  4O3S A;  2VPZ B;  3GE9 A;  3CC4 S;  1FNM A;  3HOX C;  2K06 A;  2GO9 A;  1ZA2 B;  4I0W A;  4WJB A;  1QSL A;  1YJU A;  1S9G B;  5ETO A;  4DL4 A;  2Z57 B;  3QFH A;  4DU8 A;  3FJ2 A;  3S7R A;  4OI3 A;  3BO4 A;  4PXD A;  3V4M A;  2IBK A;  2AJ2 A;  3KK3 A;  3BN4 A;  4RNF A;  4KSE B;  3GTM A;  2L3M A;  2R2U A;  3MM8 B;  3FOE A;  2YKO A;  3IR5 B;  1O28 A;  1LOU A;  1WCM K;  4BLA A;  2PEH A;  1RT6 A;  4ZH4 A;  1GT8 A;  1HBU A;  5ETR A;  4YB7 A;  2CUY A;  2MLY A;  2BJE A;  1FJ7 A;  1RWP B;  4U95 A;  2QFI A;  3BSC A;  1HAR A;  2LFV A;  1SFO K;  2FGO A;  4TU7 A;  4Q8E A;  3FZB A;  2F9J A;  1BQM B;  1W26 A;  3W64 A;  1WSV A;  5L1L A;  2XMM A;  2JSX A; 
#chains in the Genus database with same CATH homology
 3ADA C;  1VRQ C;  4PAB A;  1XZP B;  1WOO A;  4PAA A;  3TFJ A;  4P9S A;  3GIR A;  1WOP A;  1WOS A;  3GEE A;  3GSI A;  3TFH A;  1VLO A;  2GAG C;  1XZQ B;  1V5V A;  3A8I A;  3A8K A;  3AD8 C;  1PJ6 A;  3GEI A;  3TTG A;  1WOR A;  1PJ7 A;  1XZP A;  3AD7 C;  3A8J A;  1YX2 A;  3AD9 C;  1PJ5 A;  1WSR A;  2GAH C;  1WSV A;  5L46 A;  1X31 C;  1XZQ A;  3TFI A;  3GEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...