3AD9C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 sarcosine-reduced form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
total genus 50
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad9C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad9C01
1XZPB 1WOSA 4PABA 1WORA 2GAHC 3AD7C 1PJ7A 1WSVA 3TFIA 5L46A 3GEHA 3TFJA 3GSIA 1PJ5A 1WOPA 3ADAC 1X31C 3AD8C 3GEEA 3AD9C 4PAAA 1XZQA 3TTGA 1PJ6A 3A8KA 1XZPA 1YX2A 1WOOA 1WSRA 3GEIA 1XZQB 1VRQC 3A8IA 3TFHA 1V5VA 3GIRA 2GAGC 4P9SA 1VLOA 3A8JA
chains in the Genus database with same CATH superfamily
2AJ4A 3QJLA 1D0EA 2UVWA 5C44K 2VG5A 3N5BA 2WK4A 3GYGA 4CWBA 3QIPB 4LBPA 5D0RA 4FBTA 3CE8A 3ZO7A 4G0UA 1W26A 2VQEF 1EHWA 1ZM2A 3JSBA 2XLIA 3FNNA 3M30A 5HL8A 4BBYA 4QW8A 4B3MJ 1H0HB 3T5KA 1U8WA 2ZE2A 4QBUA 5F8HA 3EVWA 4CT9A 2CNLB 4I2QB 4HDGA 4RW4B 4ECUA 2DPIA 3SFUA 1U6ZA 3QZ7A 2FLLA 4RUBA 4QQBA 2LU2A 2JA6K 4G3IA 1CC8A 1Y9OA 2LXFA 3RUBL 4W90B 4NLUA 2RF2A 3D6TB 2MQOA 2FPHX 2A10A 5C3EK 2DKOB 3JAMU 5A76A 3HOWC 2JLEA 3BGOP 3S7RA 1RGVA 2YQ1A 3VGTA 4ER8A 2PI4A 1FX4A 4X62J 1ROFA 2HHWA 1RT5A 3BEGB 3I5AA 1X4AA 2CAJA 4Z7YA 4KE5A 3TZXA 4GT9A 3NG8A 1RAAB 2NR0A 3HHKA 2ASJA 2JVRA 1GTHA 2UXBJ 1HI1A 2COLA 1FWKA 3VGVA 3GR0A 2OPRA 1TMMA 3TAQA 2ZDPA 2DHHA 3KLFA 2R7RA 1O2FB 3MMLB 1AT1B 1KOOA 2C42A 3OVAA 2FVCA 1N48A 2E5GA 3B4MA 4AD6A 4XO0A 1RT6A 2RGRA 4NLDA 2HRYA 3HT3A 4H4OA 3LP1A 1QAJA 1XK8A 2ZKTA 3Q86A 4NYPA 2G4BA 3D66A 4XCHA 2ZVIA 2BUNA 3M2RA 5KFYA 1GXTA 4F7VA 5E0OA 4DU7A 3W5XA 4WFYA 2WSCC 1IKXA 4OYXA 4A8FA 5LOQA 2MQ8A 4JI7J 1S1VB 3DRPB 4ILRA 3R1HA 5KOWA 4CT8A 3IRXB 2HRTA 4GMKA 5KOXA 4CTAB 4XDCA 2MQLA 4KN7A 4UOGA 2BQ3A 3P6YC 2L41A 4M95A 2HG4A 2UUCJ 4AYBL 2CQDA 3OUYA 2WB1D 4PEOA 2MKIA 4DCOB 3FBCA 5HMYA 4C45A 3MM9A 4NZ6A 4O3SA 1T95A 2V8DA 1S1XA 2R7TA 4MJKA 4WFNQ 1U02A 4DSIA 1JXLA 4LRFA 5LMUF 2V2VA 3M8ZA 3I9ZA 2EEYA 2GW8A 1XMQJ 1S0NA 2GX8A 4KMAA 5C25B 1SJFA 2GV1A 2JA6A 1WF2A 4WJ3M 1CBKA 1FK9B 5I42A 3OT9A 3FEZA 5B0AA 2Y8WA 1UP1A 5D15A 3G96A 4RNFA 4C0BA 1FVQA 3VGSA 1AA1B 4AL5A 2XULA 4B3MF 2QL5B 5F8JA 1KVKA 3IP0A 4UW2A 3ZFVA 2ZH2A 3MM7B 2Y0SD 3GYXB 3NY0A 4JI5J 4NLTA 2MYFA 2Q6BA 3GFXA 1K44A 2G1DA 2HQDA 3KOAA 4LRBA 2PN6A 2VKRA 4Y2CA 3PW4A 4TU8A 2UVVA 3GSDA 1YWXA 3VAHA 1CJKB 1R9TC 5LXRA 4KY3A 5I3UA 3EWGA 1NKCA 2GMJA 3GTKA 1L3SA 2V2KA 4QIWL 2N7CA 1HNIB 4QIGA 1F3VA 3GZ7A 3OL8A 1Q0NA 3W7BA 3A12A 4NCGB 2DR8A 3S1NC 2QYCA 2QT7A 2AHOB 1HFEL 1HNXF 5KG4A 4BY1C 1LW2B 2NQPA 4K50A 1RT2A 4OJ3A 4KB7A 4FN5A 1JLAB 3R2CJ 1UFKA 2M8DB 2C22A 3J7Z5 2HHXA 4QJVB 3CPWR 1UVNA 4Q0BB 1UVIA 1X5PA 4RNHA 4DU8A 3V6DB 2FLPA 1GXLA 2P8IA 2E2IC 3WHIA 3RZDC 1N56A 2DRDA 4ECZA 4XK8C 2J6UA 3ENVA 1M0SA 3UD4P 3NNCA 4WFXA 3G4CA 4JYAJ 2ACYA 2GIFA 2B56A 2ZVSA 4KM9A 2Q6CA 3RAMA 2FVPA 2W9BB 3ZZTA 2DHXA 2UUTA 1U1QA 2IJRA 2AEMA 1Q5YA 2GAGC 2DNQA 2Y0BB 3PX4A 3KDOA 3JQJA 5CYQA 4A8KA 3M8PB 4HH1A 2GA7A 4M94A 1RHJB 3DLGB 4Y28C 3KYLA 3S2DK 3CCES 5EGHA 4NA1A 1LWXA 1R8AA 4C8YA 2DH7A 1VJEA 4JUZA 1O28A 4KYZA 4Q2LA 1I6JA 1Q7LB 2GGPA 2FTRA 3BGUA 4JB8B 2DGUA 3CCZA 4A3DC 5F3TA 2R2SA 2B9WA 3W8PA 3BGFA 5DLGA 3EE3A 5KFDA 2V6AA 2MJNA 2BANB 1HWKA 3DM2B 4AT1B 3MM5A 3SI8A 1WC4A 3JQKA 1JB0C 4ZPDA 2QIFA 5ITHA 5M2RA 2XZTB 1HI0P 2CZ9A 1RJJA 1S59A 4CO5A 5DQIA 4DFKA 1HA1A 1T9TA 3VHQA 5F9LA 3PDNA 4LRAA 3MR6A 4MFBA 1SC4B 1C1CA 3S1QC 3SDEB 2B9YA 2HFSA 2BANA 4DR3J 1U1RA 3W66A 3HOUK 3ZZOA 3MTJA 4FNHA 3EGVA 3M30B 2OJ3A 2WSEC 3G8QA 3JTOA 2M9KA 1XNRF 4EO6A 1R31A 4L6V3 2BJ8A 4ED1A 4UY8T 2E44A 5KG7A 3GLJA 2KM8B 2LKZA 2E2HC 3BN7A 3L95X 4FZBA 2KXNB 3ERED 3PNIA 1U49A 2E2IK 3AAWB 2XZDB 2N4DA 1HBOB 4ERDA 2MZJA 4NLSA 2BW2A 1EIYB 5IT9Y 2XCOA 3I0RA 5D4LA 1YTYA 4OIXA 2QJ3A 3LH2S 5IFMA 4ALZA 1CPZA 3GTOA 5A8RA 2F65A 4TLQA 2AP6A 2K7KA 4QWEA 3PKYA 1JLQB 1U26A 1HQUA 2V0NA 3HHLB 2JDJA 2ACMA 2Q3PA 4K2XA 1EK8A 2YQ0A 2J7KA 4F4AA 1F5BA 4P73A 4TY8A 4XAKA 2EKYA 3CIZA 2V5HG 3TARA 3DFEA 4A3CK 4EFAC 3H90A 2RUGA 2CRLA 2NVYK 3BO4A 3O6QA 4HTJA 4A3IK 4WZQA 2E5JA 2C3YA 2EXUA 3D54A 5B09A 3OFHA 2Y3PA 4C9DA 4ZVFA 4GTCA 4IUFA 4EZ6A 2VH7A 3G82B 3Q8RB 5FDLB 2CPEA 5IWAJ 1LKZA 4OV1A 2R4FA 1O5JA 1MU2B 2YX7A 4WYWA 3H3VL 1NAQA 1UVKA 4ZP9A 5A8WB 5A8RB 3P5BP 3OEPA 4ILMA 5L46A 3S17K 4NE9C 3PY8A 2XWYA 4ZVUB 1B0PA 5EUHA 1XEZA 2JFKA 4WU2A 2R93C 2W7PA 1VYAA 2BV3A 1Q4RA 3FDSA 3M1VB 3TJAA 1MWYA 4MFBB 4TNOA 1IBCB 1VI7A 2EFGA 4QYRA 5ETRA 1S1VA 4IH6A 1CJVA 1RT3A 4WZMA 3MUTP 5DGAA 2MZ1A 2B51A 2OPQB 1J98A 1NRKA 3GU0A 5K8MA 2JL9A 5D0GA 3NGUA 1TL3B 2D69A 4MIWA 3RJMB 1FFWB 3NOGA 4B9UA 3UE2A 5FLXU 1YZ6A 1S1UB 3OPFA 2IRXA 3ISNC 3M9MB 1UW4A 1J5EF 1RKJA 4YR0A 4NRTA 1U47A 4N47A 3NRBA 3O2IA 5F0WA 3OL9A 3SSRA 4EWTA 1S0MA 3DRYA 4USHA 5DRKA 4MT1A 4U8YA 2VG6A 2V68A 4CO3A 2PO4A 3T19A 4P2XA 1VFJA 1NDKA 4LFAF 1S1WA 2VICA 3KKFA 1B7YB 3PW5A 3R5BA 2ZBQA 4YEAA 4OIRA 2Z2LA 1UAWA 2KWAA 1L3VA 4GTFA 3S1RC 2XYPB 4UQTA 3DRXA 2NXNA 2XCAA 2V2QA 2VG7A 2LA6A 2V8VA 1CEZA 3PRDA 1HNWJ 1IS1A 2IDLA 2VB6A 2J9DE 2VFTA 4TLRA 4CYUB 2BEFA 2YWKA 3THTA 3GTKK 1QTNB 2YKPA 1ZH5A 2R7ZK 3TTGA 3HVRA 1YBAA 1F1BB 4FVCA 3NGDA 3D1HA 4Z7CA 2VBWA 3KK2A 4I7FA 3BO2A 2DH8A 1LWFB 2CJXB 3GTMA 3CEDA 3T6BA 2P8TA 1QDUB 4CLTA 4IOCQ 1QSSA 2UV8A 5CA5A 1FJGJ 2LMIA 4LF1A 4Z2XA 4A8OA 1I94F 3KTQA 2G2YA 3WIVA 4CLUA 3CO0P 1UEKA 3SXLA 1ZETA 3LUYA 1BQMA 3I0SB 2HIYA 2XY7A 1RAOA 1Y1WC 1VLOA 1SC1B 1VQ7S 4ZPCA 2KL8A 4ICLA 1Q95G 1C1BB 2GHVC 3NWRA 3HFKA 5J1EA 5EWEA 1I6HK 4G7OA 1T9VA 2V4JA 4O23A 4G0WA 4JI4J 3H2UB 1X5OA 2QL7B 2HVHA 2HVDA 2BYCA 5JXSA 1RT7B 2YVSA 1NK8A 2ZUGA 1X4FA 1XZQA 1TUWA 3KMSA 4Y52C 4LF9J 3HHLC 1CLFA 1N33J 2WVBA 2B5JB 1SUQA 4BBRK 2GAHC 2L48A 2BVZA 1FXDA 2Y1JA 4FYYB 1NNDA 5CYJA 4JV2A 3T1YF 1F3FA 2CNKB 3QGHA 5KT5A 4FF3A 2WVCA 4JI0J 2K3IA 1K1QA 3GDZA 1OS5A 2A18A 3PX6A 4OJHA 3MM9B 5KFAA 4DV3J 3T9NA 5CHCB 4DQRA 1I5OB 3IA0A 5KG6A 5KFBA 1RWXB 5KFNA 1K8AT 4NXMJ 3ZTRA 3SCLE 4RNNA 5I3QA 3D6MB 5CZVA 4DX5A 1Z1ZA 2WAQL 1RAEB 2E1RA 4EK2A 1MMNA 5GADU 3FSYA 2XS7A 1HNIA 1S0OA 1T11A 3M2VB 2HGMA 2QLJB 4USMA 2OEJA 4RUHA 2LA4A 1K83K 1VQ4S 2LEBA 4USVA 1ZZNA 2RVJA 1XZPA 3KLIA 3FOFA 1AXQA 2FVRA 2B63K 3S1MK 2FJXA 3KG4A 1KFDA 5J2MA 3C6TA 2HBYB 5FJ8K 2OELA 3LALA 3PYFA 5JVGQ 9RUBA 4CLFA 4BY7C 1JXEA 5HLFB 2Q1LA 3BQ0A 1FRHA 2E7WA 5E3CA 4CLSA 3W63A 3S2HC 5KG2A 4IO9Q 2L9WA 1SJ1A 1NZAA 3CCRS 5M2PA 4RW8B 3V81A 2A68A 1C4CA 4D3HA 4KASA 3F41A 3BYPA 1ZBSA 2ZJRQ 3PXGa 2QFJA 3UQSA 2WOMB 2FGOA 2HURA 1SL1A 1HW8A 4ZCLA 2ZH4A 3K8WA 4I6AA 4A93C 1IBLF 4HI2A 4NCGA 2EKNA 5H9FJ 1JLBA 1OMSA 1RTJA 5EX3A 4E0DA 4DR3F 2HW3A 5EHHA 1M1GA 2WVFA 1BGWA 4DR4F 1RDRA 1DZ5A 1A7GE 4ED0A 3OXFA 2HQFA 3MD3A 4PG8A 1Q8IA 3LP1B 1PO6A 1R89A 5IP9C 3X3UA 1UA1A 3TA1A 3R2DJ 2BJEA 3HHDA 3R7NB 2FJVA 4TXSA 2CG8A 2LU1A 4BWJA 2DGSA 1CVJA 4OI1A 4Y7NC 2ZH7A 3DLHA 1VGXA 1O29A 1DY3A 5ETMA 5J2NB 1JLCB 1HQ2A 5EGEA 4GKJF 3HOVC 2FZKB 1CS4A 2I0XA 2FHKA 1TWCC 5KAKA 2I5JA 3J80Y 1L3TA 4ES2A 1VQSA 1F9NA 2K8GA 1HYSB 4V19J 4P5BA 1QE1B 3DXSX 3LWLA 2LP4A 4J7CA 1T05B 3TI0A 1RBOB 3UO0A 2C2NA 3TUZC 1EKSA 4EBCA 3T5HA 1QSYA 3AQOA 4WIIA 3DLGA 1J6VA 2RSQA 2V69A 2C2RA 4C3IK 1UVJA 3BP3A 2IPOB 1WF1A 3FFIB 3QIDA 4YHHJ 1KP6A 4BHQA 2E1PA 1N6QB 4WKYA 2PEBA 3LANA 1C4AA 3HDSA 4NI2A 4NX9A 3FCWA 2AYGA 1VQKS 1HBOA 5CJ9A 5GVQA 4NZ0A 4IOBA 5L1JA 4UZCA 1CULA 3Q8YA 4DWIA 3V6DA 4KHMA 1NPPA 5DDRC 2IJFA 1I3QC 2K3KA 3C46A 2YQ3A 3D2WA 1R3NA 1NJIT 2G2OA 2ZJPQ 2PFFB 1Q78A 1TWFK 3GEIA 2YH0A 4LR7A 2RDIA 3UPFA 1IXKA 1F0XA 3T1HF 3LP0A 3HM9A 3R3TA 2W7VA 3RAXA 2HQCA 4NLXA 4WTOB 2YBVA 4PQUA 1DRZA 2VIHA 2LEPA 3X1LB 4C4WA 2XYGB 2CFXA 2D6FC 3CDBA 3M32A 4ZCMA 4HL9A 2QRRA 1NK9A 5K14A 2XSJB 2VOOA 3H5XA 3J81j 4NWBA 4ZVRB 4EBEA 2ROGA 3WIUA 3MR2A 3VVTA 5GAHU 2UV8G 2WONA 5KG1A 3W9IA 2H5JB 1TWGA 3M05A 3OXGA 1NSPA 2VA2A 2MLXA 2GJ2A 2AT1B 5L39A 1ULRA 2IVFB 2GO8A 3JTPA 4ECYA 5HL7Q 3MUVP 3I4MC 4K0KF 3IGVA 1YRTA 1WEZA 4CLYA 1SKSA 5IM0A 4DZDA 3NEKA 2HHPA 2DPJA 1LWEA 3MR3A 5KFCA 2DISA 4NXNF 4ETZA 4LMZA 2R7SA 4ZLNA 5C44C 3IGNA 3DOLA 2YU9K 2DGQA 1R43A 2F9JA 3GV5B 4UQGA 1KTQA 4C8OA 1TV6A 3OLBA 3RG6A 3GJSB 2EFNA 2YKNB 3TJ9A 5IV3A 5H9FK 3GTLA 3OV7A 2B6AB 2KXHA 3DOMA 1SXLA 3UFCX 3N4WA 3SCIE 1YQHA 4ZVPB 3V2UC 3K7AK 4UTGA 2FJDB 2IAJB 3CCVS 4JI7F 4C8MA 3TFJA 2CQIA 3T6JA 3UCUP 1KHVA 1RTJB 3CJSA 3BKUA 3CCLS 2DNNA 3MAAB 3VALA 3SYZA 5KFVA 2CNOB 2IMOA 3GTQK 2DXFA 1TWAK 1U2FA 3VTIA 4RX6A 1IKVB 1RBAA 3DRPA 3HFVA 2J6SA 2KJVA 1D8ZA 5IT9U 2VJUA 3EVOA 4ECRA 1LOUA 4AL6A 2J76E 2J8AA 1T7PA 4M1XA 4Y2IA 2MKJA 2IA0A 1XMOJ 3DLBA 4PQAA 3CD0A 3PO3K 5DG8A 4YFXA 2EK1A 3I4NK 1WCMK 4DXLA 2A2DA 4ELTA 1J6WA 1NDPA 1F7VA 3IWXA 3S14K 5B0GA 2EC0A 3TUPA 1KBRA 2ZOMA 3UI3A 2OIHA 4XSXA 4DSKA 4K4UA 3L7PA 3TOQA 1F9FA 4NPOA 4QR0A 3QFHA 4OINA 1FEHA 1NEEA 4F0HA 1F9EB 2UXDF 2B5JA 2BQRA 2D3UA 3QMQA 4QPTA 2AJQA 2N3OA 1S57A 1ZOTA 4ZDNA 4LF7F 3D5MA 1TK8A 3M2VA 3IBFB 1RWUA 2XSJA 1MN9A 1H7WA 5AT1B 2C3PA 3AHPA 2AX1A 1VK3A 2CPHA 3CQZC 1PC5A 1O26A 2QG9B 4UF4A 4DQSA 3BBBA 4B17A 3ZZZA 4C8NA 1VIXA 1KVIA 2F9DA 2IM3A 3GTPC 2ADBA 3C16A 4USIA 2YNHB 2IRUA 5C7PA 1PGZA 2JLGA 1VBYA 1OSCA 5J2MB 2BOPA 1U0HA 4CM2A 1VQLS 2M88A 3L4KA 3K5OA 4A3BC 4DQPA 1H3DA 3GTJA 4OZNA 4OYOA 4USWA 2AD9A 2GHWA 2DR7A 1JLFA 3BR9A 1PCAA 2ZOFA 2JHEA 4EO8A 2DXEA 4MEXA 4JI0F 3N0BA 5IOLA 1O0PA 2QE5A 2XO7A 3GIJA 2HK3A 2J7WA 3CNQP 4O4GA 4DV2J 2R7UA 1TKXB 1FXRA 4QZVB 2F8HA 1HHQA 3DGVA 1FNMA 2R8HA 2R92A 4XLNA 4Q44A 1T05A 4HHHA 2IC3A 3DLKB 3BM7A 4K4TA 3DOKA 1XC9A 2V8PA 4K7QA 1LNQA 1L0WA 4DV5F 4ELVA 4NLPA 4NLVA 3L9ZA 4DHVA 2JC1A 2BE9B 4OX9F 4J37A 1OO0B 8ATCB 1R0AB 2AYBA 1H2UX 1CS4B 4Q5VA 1OQ6A 1PYTA 1Q8BA 4ZOSA 3H2LA 3W5YA 4ILLA 3DCAA 3C15A 1BGXT 2JA5A 3UWTA 3B4DA 2BABA 2JOQA 2RF2B 4ED2A 3ZZRA 3T1YJ 4ID5B 2PMHA 4DR4J 3G6XA 3OPKA 3CC4S 1NJWA 4I6WA 2RU9A 2J6TA 2W4DA 3ZZUA 4RWWA 1YLXA 4OL8A 3MEDB 5E3QA 4A3LK 4BXXK 1VC5A 2NXEA 3QJPA 3K58A 2DIVA 4GVBB 1G4CA 1ELOA 3IPJA 4F67A 2C3OA 4C11A 3L4BC 3FCHA 5HROB 2W25A 4MEYA 3IAS9 2GHPA 1DCOA 4O0NA 4USJC 1USMA 2R9LA 1S0VA 2K7JA 2ROEA 4PWDA 1ZZFA 3HX9A 1X31C 3H98A 3EMTA 3ZNUA 3QFWA 3AJ1A 3HVTA 4B3OB 4DCPB 2M8HA 1YI2S 1TUGB 3B8HA 4MKYA 3PFEA 2NREA 4K5RA 4WBFA 5D78A 5JUMA 4DV1J 2KKHA 1S10A 4LIWA 3ILJA 1SH3A 2Z0GA 2QLXA 1JLGB 2Z4PA 2IJNA 1NH8A 2P9CA 3AXMA 1GQEA 2RHQB 4CH1A 3P5TL 3HXAA 1RU2A 3DDNA 3PZPA 2XY6A 2HNYB 5F41A 2ZZNA 2HFVA 1O27A 1SQEA 5J1PA 3NCPA 2VFUA 4S0MA 2KZZA 2JH3A 3D1OA 2CPZA 4Y0FA 3DI6B 4KN4A 4MYUA 1F2HA 3P96A 2AZ1A 3JSMB 2DO4A 1DTQB 2WB4A 4OLOA 5KFWA 4XLPA 4HDHA 1HBMA 5D0HA 3H0GC 5BYSA 4B3TF 2ZEJA 1SC3B 2M5YA 2JX2A 2A1BA 1LXNA 4NCBA 2KN4A 1F5AA 4DR5F 1MN7A 5KT7A 3POTA 3FSXA 4YB7A 3VAJA 2CWXA 3TA0A 3BF4A 4OZ5A 4X4TA 1VBKA 1XBWA 4RW6A 3M4XA 4M5MA 3C19A 4C8KA 2DD8S 2HHQA 3JSTA 3BH6B 4GKKJ 2Y1RI 1YNNA 2GSOA 2IFXA 2B7CB 3CD7A 2LYVA 2N3LA 2ZFHA 1RA7A 1LV5A 1U4BA 3J7AN 2QMUB 5D4OA 3JSYA 1C0TB 1HI8A 4O3PA 3BSCA 4M5DB 4DPUA 2VC0A 3GEHA 1TWGC 1JLEA 1Y4ZB 3M4OC 3MPWA 5IOTA 1JOEA 2JNJA 5CYMA 3ZZ0A 3OJUA 5AJ3J 4KJIA 1TKTA 3GMGA 2XWXA 2J0SD 2VL1A 3G87A 3BB5A 2UXCF 4LF8F 2J9CA 3I4MK 4JI2F 4JV1A 1S49A 2Z2ZA 4XDDA 1PJ6A 1R8HA 1XJWB 3Q0AA 4F4YA 2FJAB 4QPXA 1T0TV 5AXLA 2OFGX 4BBSK 4NASA 4I7FB 3T5LA 3HHNB 3NMAA 4P72A 5M5YK 2ZDOA 1TWCA 3CJ0A 1J5OA 1MG7A 4KAIA 2BE2B 4OYMA 3ZZPA 1RU0A 1N88A 5E3RA 1WC5A 5MAOA 4RBUA 2DHAA 3RBDA 1Y1WK 4X4VA 3V6HA 3KK1B 4QIEA 1VCTA 5M5WK 3TVYA 1RTDA 3JB9k 1NHVA 3RZOC 2OTJS 1RI7A 3EDRB 1SFOK 2MSSA 1GEHA 1MROB 1X9MA 4GTBA 4C3HC 3MF5A 3M8PA 1TKTB 1C0UB 1QM9A 1Y00A 2W4PA 2IM2A 2QYGA 1TL3A 3GTMC 3UCZP 3NAHA 4B3SF 2HFZA 1GX5A 4CM0A 5LL6d 1SIZA 3R5GA 2E5HA 2DTJA 4MKBA 1RWOB 2F4FA 4OI0A 3A4TA 2V2ZA 3NOCA 2F1FA 4ICLB 1HLWA 1TVRA 1BD6A 1YZ7A 3C14B 2VPWB 1WQGA 2NVXC 2QLBB 3D67A 2XHCA 2E5LF 1NPKA 4ENOA 1X7VA 5CYQB 3CDEA 5KG0A 4DZ6A 5I3UB 1VC0A 1PBAA 3HULA 1AFJA 3GTGC 2R8IA 1U6FA 1LWCA 4DI6A 3AA8A 1JLEB 3H0GA 1H74A 1ZM4A 3CDAA 4OZ1A 2QL9B 4TYAA 2ZBIA 3KUGA 4PPDA 3D0GE 4J9PA 4RW7A 2PT0A 2NZ4A 3WZ0A 3OSNA 3OTDA 3TZZA 1CJVB 1RT3B 3J81U 1IBMJ 5KT4A 4ED3A 2LQBA 4N8NA 2D9OA 3S1NK 4DPWA 4FXWA 2JA5K 2V50A 1HWUA 1UVLA 2DH9A 3H3VD 1UKUA 1TKDA 4WE1A 2V4RA 1G51A 4FS1A 4BY1K 1XERA 1U1OA 2K1RB 1ZPWX 1SBRA 1NDCA 3NNHA 2AJ0A 4YOEA 4DUZJ 1PJ5A 5IZHA 4YG2A 2ZUEA 1AZSB 2MDAA 3IG1B 5A6PA 2W01A 3IAM9 1GMVA 2MQPA 5AE2A 4R25A 4CIOA 3SBMA 4J9QA 4F4WA 2BX6A 2Z56B 3H7HB 2IBOA 3T5JA 3OR2B 1V6HA 4KGMA 2X7IA 3IN5A 2N7YA 2I8EA 1VGYA 4AUKA 3IWLA 2MHNA 1VK8A 4OZLA 2OP5A 4N56A 4P2FA 2PE8A 3FZ2A 3W2VB 2HWIA 2AW0A 3IS9B 4DX7A 3ET6A 3DKDA 1X4CA 3WBZA 4ES3A 3FKIK 1FRLA 4NLYA 4Y6IA 1NSQA 4N8OA 1XR5A 2RH3A 3VZHA 2YKMA 2UUCF 2M70A 2CA9A 5B0CA 2H4YB 5K8PA 1KQSR 2UU9J 1Y5NB 4HR2A 1A0OB 1ACMB 1I3OB 4CLZA 1EI6A 1PIEA 1S7IA 2A6OA 3KJNB 1GMUA 3SIPB 4X6AK 3D6HB 3V4IA 2JRSA 4ZIVA 4OV6A 1MU2A 4DL4A 3NUHA 2RUSA 4L74A 3KJFB 2RU3A 4LRDA 3EJMA 4G7HA 3UDCA 2AIRB 3A3OB 3VQTA 1TL4A 3KJVB 4NEYA 2MKCA 1HQUB 2OI2A 2KDOA 4OJGA 1PJ7A 1U1KA 1C0AA 2CPJA 3PV8A 2FZGB 1YGYA 2NCKL 2AGQA 4I2QA 1S99A 4J9MA 3GE9A 2XC9A 2HLTA 1VISA 3Q24A 3HOWK 1PSDA 1X9SA 1T9XA 2LQ9A 3QX3A 4OI2A 3Q2TC 3QO9B 1BQNA 2DGVA 1YX2A 1FJ7A 4U95A 5AE1A 3ELHA 4ZVQB 2PHCB 2I1RA 2XHWA 5G0RB 2YKMB 3K5NA 1MW7A 1Y1VK 1GMWA 1ZM9A 1UWAA 3E51A 3B54A 2JEIA 2NPIA 4FDFA 2J0QD 1WC0A 3U27A 4A3FK 4A4JA 5LSLA 1GX6A 2NUUG 4N5SA 1YJUA 2P9EA 3HOXK 3PYGA 1P9QC 5F8GA 2CQHA 2UZAA 3B82A 2ZC3A 1N8RT 1HWIA 1FD2A 3HXMA 1VRUA 4RMFA 3GYNA 4KC5A 3PJWA 3EDQB 3UDLA 1C0UA 3WX8A 4J9VA 4GVBA 3ZC4A 3RZDK 3AOCA 1LWEB 2B63C 3S1MC 1PYOB 3TQEA 5HJYA 3R5CA 4DV7J 1RTIA 4YQWA 1E6YA 3UNGC 1UVMA 1NJZA 3FMBA 3K59A 4KO0A 2E29A 3NCQA 5DQHA 4C48A 5SZTA 3G4AA 2RQCA 2BRKA 5CQGA 2NS1B 5CYMB 2IC3B 2W2MP 1O8BA 4DF4A 2GS8A 1U1PA 3OUYB 1RWPB 3NS7B 1I3QA 2OGUA 3GONA 1SJ3P 4YS2A 3TAMA 2YNFA 3EICA 4Y2AA 1S5ZA 1RCXB 4ANCA 2B9EA 4K0KJ 4V1Ak 3P8BB 1FNXH 1CG2A 1UWBB 3FMWA 2P2CB 4V19X 1K73T 2O1PA 4X4QA 4TVAB 2BE2A 4ECSA 3SZ2A 1RACB 2ROPA 2ZNYA 2QV6A 2MXYA 1RYSA 3HD2A 5HROA 2HNDA 5KFQA 4OHYA 1VOMA 3DRSA 3LOUA 4XPEA 1VJQA 4RZRA 3GIRA 4Y34A 2EFQA 3GFZA 2HLUA 2AGOA 2K06A 1QD1A 4J9UE 5HJXA 2IBKA 2WW8A 3M3YK 3MEGA 5J1NA 3LP2A 1S4EA 1B4BA 1F2GA 2AEJA 3ILLA 4ZP8A 2QA1A 3V4MA 2ZH1A 4OX7A 1S6PA 2M2BA 4KHRA 1FFSB 4KQZA 4ZP6A 1WEXA 1S12A 2XMAA 2GSUA 4LJMA 5AXNA 1PAEX 4XPCA 2VA3A 1C1CB 2V63A 4C8LA 1W2BR 5KT2A 2I2YA 3CB4A 1M90T 4NOIA 1IQZA 1U0HB 2BXJA 3FQLA 2YPYA 1VRTB 3G8TA 1LK5A 1BY9A 4OHXA 1N0UA 4R8UA 3BH7B 5THWA 4DPXA 3QSYB 3A8KA 3PO2C 1SC6A 4YN3B 5CH7B 1GFWB 4RNOA 4WP9A 1YNJA 2RQ4A 4DMZA 3TX8A 3HZEA 4ECTA 2EG2A 3CGIA 1FE4A 3RU0A 3DI6A 3KXDA 3IR7B 2HHHF 1D1UA 1S4FA 3I4PA 1SKUB 2MGZA 5LSRA 4H4MA 3FRYA 1TV6B 1KWMA 1R0CB 4DR1J 1WC3A 1UA0A 2R7XA 2DHGA 2MPUA 2KFYA 2HMIA 3W2WA 3EXCX 3NBPA 1REVB 2B6AA 5F8MA 1KONA 2YWWA 1EZZB 1NKBA 1DQ9A 3FJ2A 1F93A 4WFZA 4WP3A 1QAIA 2CQBA 5FLXY 1EB0A 3L4JA 5LJ5Y 1U1MA 5DLFA 2DO0A 2RE1A 3AOAA 2C28A 1IWGA 1R8CA 4RR5A 1SI9A 3GG1A 2KG0A 4QIFA 3RAQA 4JI6J 3S16C 1W7WA 2VASA 1RT2B 1AB8A 3N5FA 4NMXA 2DCUB 2R2TA 4DCJB 2MB0B 2D41A 4DV1F 5E2QA 4IFYB 4WWSA 3QZ8A 2E9RX 2ZH6A 4ID8A 3TZYA 2CFAB 3NCRA 2O01C 2BE5A 4B3SJ 3DXBA 2C2MB 3K7RA 4ID5A 3QWPA 1U2RA 1NHUA 4WK3A 5KFKA 3I5BA 3M2RB 1F9HA 2WOMA 4LQYA 4DSLA 3UR3C 3U1MA 3MDFA 2ABYA 1SKWA 1VQOS 1EAYC 2DNGA 5F3ZA 1U6BA 2E7XA 4CO4A 4IRDA 4RW8A 3V81B 5D4NA 2MJUA 4DG1B 3EM1A 4LF7J 3CJ3A 2JEGA 3LWMA 3MEEA 1IBKJ 2PSZA 4OYBA 2O67A 1BE4A 1UJ6A 1Y10A 3ITHA 5C2GA 2IA6A 2OEMA 4ANDA 5KFLA 5J1EB 4IDKA 1GXUA 3VAKA 2MKYA 1BWEA 3H4BA 2JC0A 2JA7K 2VKZG 4QOTA 3W65A 2RB7A 2QSFA 5J2PB 1S76D 5C5JA 3BGRB 2JSXA 1WQFA 3J7YI 4R5PA 1JQGA 3ENWA 3WDOA 3D6FB 3IBCB 1YJTA 3CCTA 1RUSA 3GTGA 2DIUA 4X66F 4DJBA 3HOVK 1WG5A 4EYIB 1DCPA 3KFWX 2A6MA 1P9YA 1SL2A 1B4AA 4BKWA 1J2VA 3PIPQ 1OIAA 3H4DA 2YWFA 4LSNA 1MSWD 2CQ2A 2G0JA 3GB0A 4I2PA 5ETOA 1TFYA 4IFVA 1W2IA 3GPAA 1O6XA 4CO1A 5I42B 2HHHJ 3FKBA 4MK7A 1S9GB 2VODA 2D74B 3FZBA 1Z2ZA 3AJDA 2CJKA 4QU7A 2HQ3A 4B3OA 3CSKA 3ISND 2HEKA 4AQYJ 1TWAA 5HP1B 4EMDA 1XNRJ 1AB4A 4ZLPA 5DQGA 4L75A 4DSJA 3D0HE 1KQ4A 2QMWA 4Y2MA 3FBEA 4MH8A 3AA9A 3ICLA 1J5OB 5J2QA 2F63A 2R7OA 1ZA1B 1IQTA 4C11B 4DLEA 2W7AA 3CCSS 3MMAB 4K4YA 2XMWA 1NSAA 4F2SA 1FRXA 2B8PA 4F36A 1N6QA 2WB1L 2W9AA 3H42A 3FKIC 4MKVA 4AYBD 5IWAF 1RHQB 2DITA 3UDVA 2IYIA 2R92C 2PFDA 2XGPA 1QAXA 5GADI 4FKYA 1HBUA 5T41A 4LF4F 2KTQA 2IM1A 2ZJQQ 4G1QA 3HHLD 2VHGA 2GJIA 5TJ3A 4CLKA 4K4VA 5IYCK 4ZPAA 4F0KA 3W62A 4LFBJ 1EARA 5HQMA 2DGXA 4QR1A 2CUYA 3PKMA 4ZITA 2QA2A 1MMLA 1K47A 1KTVA 3AFGA 2WBMA 4QCLA 1RHUB 1N0VC 6FDRA 3M6XA 2CJQA 3BUEA 2XEXA 2WW4A 4ANEA 1EP4B 5CD4H 4TY9A 5CCMA 4HACA 1ZM3A 3LA0A 4RUCA 3SCKE 1I50C 4UT4A 4J91A 4RW6B 1OPIA 1XNQF 1JKHB 2QFIA 1VC6A 4BCAA 5K9FA 5IYBK 4R5PB 4KKOB 3Q23A 3MFHA 5A8KA 2MZTA 2MSTA 1NPRA 2ZHOA 3W64A 1SQFA 5SUHA 4A3KK 2MZSA 5IXUA 1RAJA 2LXIA 4L73A 3N01A 1GMWD 4EZ9A 4DS5A 2KH9A 2WAQD 4CLPA 1RA6A 3C3LA 5LMUJ 1REVA 1HD0A 2ZUAA 2CDRB 3VA7A 4KC6A 1QVFR 1JLBB 3VAFA 2JFDA 3MHYA 1WKLA 1LW0A 1Q7YT 5D0EA 1G3OA 1U2CA 1R9TA 2OSRA 3RGIA 3GJTB 2PMWA 2Y3YA 4CLLA 1VMBA 1RWNB 1XXAA 1QUPA 2AF6A 1UW9A 2OO4A 2OMOA 1LXJA 1HPZA 1EH1A 4ED6A 5L1LA 4LIRA 1HW9A 3QGGA 3O3LA 1TAUA 3LF0A 2DGOA 2XY5A 1X4DA 4GKKF 3MAHA 1VBZA 5KFPA 4BWMA 2P5VA 3HHLA 3OD2A 1VQ6S 2UVUA 4LR2A 2HQGA 4LFAJ 2ZUFA 4FM9A 3S15C 4NXMF 2KXFA 3G6YA 4DL6A 4IH5A 3GTJK 2QO3A 5JVHQ 3KUEA 4DN0A 4CNZA 4FXVA 2R7ZC 2HFNA 4CTAA 2FC8A 4NOHA 2ILZA 2XS5A 1REGX 1IN0A 1S72S 4DV7F 2E2JC 1M5HA 2NLWA 2MKSA 3W2WB 2HMIB 5FJ4A 2PC6A 2NVQC 1G6BA 1BJTA 2FUG9 4DV4F 1XR7A 3VAGA 2HWHA 5RUBA 2XSFA 1AUDA 3POTB 3G71S 2GIQA 3PW7A 1Q82T 3OFEA 4IR1A 1RLDA 2RHSB 3PHEA 3H25A 2RT3A 4U6PA 4KGZB 1APSA 2QX0A 3GIMA 2MMYA 1EETA 3UD3P 2R8JA 2XNQA 1I6HC 1RWVB 2B3TB 4USTA 3FC9A 4A3GC 4LR9A 4M5KA 3GQCA 1IKYA 1FKPB 5C42A 3CJ5A 1RADB 2BJ9A 3L09A 3ENAA 3J7YU 3WC2A 2EBEA 1Q53A 3M6VA 1T9UA 4QWDA 2ZM6J 1IBLJ 3R7BB 2IM0A 3THPA 4LF6J 3H5UA 2RQMA 4MIAA 2RKIA 1S79A 2A6EA 1S77D 1RQ0A 1N36F 1SFOA 5DZ6A 4C0HA 3AQPA 4AL7A 2J7UA 1SJQA 1WORA 1CJUA 1KR4A 1DQAA 1WHWA 3SEOA 2ZE2B 4A48A 1CQNA 2AGPA 2B4OA 4YHHF 3R5AA 4LREA 5BYQA 2VFSA 1H2TZ 4U96A 3M8QA 5BYRA 2DGWA 1WOPA 1R8PA 5CAAA 2VZ9A 4URQU 4J9OA 3Q8UA 3TO8A 4KHPJ 2QLWA 1WG4A 1Q79A 1S6PB 3DRRA 2IY5B 1FJCA 3PRBA 2N82B 2IIHA 3BN4A 1I51B 3OFGA 4J9NA 3P45B 3IM8A 4KSEB 2VC1A 5CZXA 2QLFB 4OYAA 1TL7B 2XZWA 3LAKA 8AT1B 1YJNS 2RS2A 2CJBA 1DQ8A 1USOA 4DR1F 3R27A 3MMCA 2FQOA 1V3RA 5E5NA 3A8IA 1HNWF 2QC3A 5KFXA 3C16B 1WCMA 1HBUB 1Y5IB 3EYZA 2G1HA 2XTJP 4A3JK 3S6EA 3THVA 2H65B 3NGSA 3G4SS 3UN5A 3ZTOA 4C8ZA 3K5PA 1NB2A 3KK2B 1J5EJ 2L9DA 1VRQC 2XG8A 2PA8L 4ILDA 1H7XA 5J2QB 2HZVA 2IMWP 3V5RA 4Y3CA 3HK2A 5LJ3Y 4J9RA 1N52B 4UOFA 4ECVA 3TVKA 4JI3F 2Y1IA 1INNA 3I82A 1WACA 4YB1P 3GJRB 4PG5A 3DN9A 1FRIA 1TP7A 3TAMB 2LVWA 1TUVA 3I6PA 4FF1A 3R5DA 3BKFA 2RIJA 3B6BA 3NP5A 1MMDA 2D1CA 4FP9A 3U02A 2BR0A 2CPYA 1S9FA 4OYPA 2O66A 3EGZA 1A6LA 4WFAQ 4F04B 4CZCA 3QO9A 1HBNA 3MM8B 3CJKA 2HGLA 2R8GA 4DFPA 2ZM6F 1XWLA 2DNZA 2RS8A 3MCOA 3PW2A 3M8YA 1J6XA 1P27B 2V8HA 5IT4A 3T41A 2C3MA 5HMXA 1URNA 2DNPA 1SMYA 3DNCA 4NRUA 5A0YB 4KATA 5KFRA 2HHTA 2V6SA 1CULB 3QLHA 4N76A 4RU9A 3QNWB 2UUAF 4PUOA 1WSRA 3W8GA 4WXOA 1VQ9S 1RT4A 1ZA2B 5IV4A 2P5MA 4PPZA 2C2KB 1HNVA 5HVHA 4M5IA 1FD8A 3KG0A 2C2ZB 3EX7B 1HQEB 4FKXA 4ZJLA 1ZPVA 2IRYA 1SL0A 2ZD1A 3HJFA 2F40A 4G6VB 2I38A 3JAMY 3S2DC 2ILYA 3GTMK 1HMVA 4FPIA 2FQTA 1RTIB 2U2FA 1KLNA 5E3AA 5E3PA 1WD6A 4NMLA 2F3JA 2BRLA 1NK6A 3VVUA 5L9NA 4E2FB 2C2EA 4PYDA 4LBHA 3DYAB 4DV0F 3AY0A 3H0PA 4JP8A 2FVQA 3KLIB 1XZPB 4KFBA 2VPXB 3SZZA 1IKWB 1FRMA 3TX0A 3DLLQ 2ZH8A 1VH2A 1D9FA 1KC8T 3QPIA 4H4OB 2I5JB 1UJ4A 3V4IB 3GJQB 2QA4S 2WHOA 3IO1A 5L1IA 3QWUA 2CQPA 2X1BA 4H4KA 1KSPA 3BDEA 3TEHB 2XB2D 5HQLA 3MTKA 2CJAA 1ZTWA 1YBTA 4ZPVR 3RW7A 2KHDA 1Y1VC 5KFHA 1I1GA 2BBEA 4UOHA 1YJVA 4LQ9A 3G6VA 2RDDA 4OIPA 1NDLA 4DR6J 1U24A 2UU9F 1MLAA 1QJHA 1WQHA 3HCXA 1TWCK 2W8KA 4YR2A 2X3DA 1Q1KA 3CJTA 4CP5A 3ILOA 2I6WA 3HFZB 1YIJS 2GQCA 1V9OA 2ZBCA 4B9LA 4FYWB 3CJ2A 4KR0B 3JS9A 1YRUA 4OYZA 4O44B 3K2YA 5IC6B 3GG0A 4B3RF 3MAQA 1EKRA 4OIOA 4OI6A 2NSBA 2E1CA 4OX6A 1K1SA 3KG1A 4PQUB 3FGVA 1YDLA 3KLHA 4P52A 3IBWA 4UY85 3M1VA 3F0NA 4IH7A 3T1HJ 1WC6A 4DUTA 2QSWA 5M2UA 4CYUA 4FYVB 1OYEA 2HK2A 1Y3JA 4KV8B 3OJSA 3SQGA 1S1TA 1H73A 1BHNA 4G1IA 1XQIA 4GZYA 3CJ4A 3K5LA 1VBXA 5EX0A 3PR4A 1IR0A 4ECQA 1TTHB 1TVRB 2W8LA 1FO1A 4WYLA 3HOYC 5HBMB 2FVSA 2HAIA 4LF2A 1TQLA 3HF5A 4QYZJ 1JX4A 5H9EK 4LF5J 1GAOA 2BKNA 3DLEA 3P4UB 4UUXA 2J9EA 2OAUA 4GO7X 4F3MA 4GC7A 4Q2MA 5T7LA 1EQRA 4ZCIA 2CW0A 2MLZA 4WIQA 3RBZA 5C4JC 5IM0B 4P10A 3LO3A 3UD5A 3SCJE 3R1LA 2NVTC 3EZOA 2ADCA 4EI2A 4KB4A 2VBZA 2XYHB 4H4MB 1IBKF 1O2BA 1YKWA 1Y0HA 3ZZYA 1KQFB 3VWSA 3CD5A 2L08A 4YDDB 2CQ0A 1SCJB 2XCPA 2AU0A 1WI8A 1UJ5A 2EVZA 2L3MA 4J90A 3C66A 2J9DA 2JWNA 3HD1A 4KBIA 2VBYA 4A3MC 2R93A 4DL5A 1R0AA 4JOUA 3MEGB 4KGKA 4O44A 3S1TA 3I87A 1WTFA 4YFKA 1U25A 4A8YA 2DJWA 3UCGA 3VAMA 4IQMA 4U7CA 3OXLA 5T7LB 2H54B 2OEKA 1UZHA 4OIQA 2YU9C 3EPIA 1T94A 4JI6F 3MMJA 4F26A 3GTPA 1IKWA 2YKQA 2E2HK 2F7VA 4I1TA 4IQXA 4EGLA 2WSFC 5ETNA 4DSEA 3BKTA 4B3RJ 2E1AA 1TK5A 4ZP7A 1N32J 4HHJA 4M5LA 3KJVA 2YNFB 4UUWA 2WVDA 2OHDA 3CJQA 5DZ7A 1V3SA 2E9ZA 1UTAA 4YUDA 2MQQA 4NYZA 3RB3A 2HVEA 1Y1VA 1KLMB 2FC9A 2CYYA 3M7VA 3A13A 2UP1A 1T9YA 4QWCA 3BYRA 3MAAA 5L8RC 3OHBA 2FJEB 1S6QA 4L76A 3GTQC 5E68A 4E8UA 3EUNA 3FOEA 1JLQA 2LQJA 1R8BA 3LGHA 2JVOA 4L3KA 4K4XA 1NU4A 5EN1A 5GMDA 3UN3A 3CJRA 4KGXB 3QGIA 3RW6A 1VQPS 2A3JA 2HAFA 1RWMB 3ZTQA 2V67A 2G0IA 1FKOB 2VQFF 2NVYC 2A0FB 1RCOB 2WTFA 5H1SV 2YWEA 4CCHA 3A3NB 4KFBB 4IG3A 3MOJB 4B9NA 2HHUA 1FK9A 4YP3A 4LK0A 3T01A 2ZHBA 4B9MA 2C1EB 4RW7B 4NLOA 3T1AA 3PG9A 4QU6A 3KHLA 2JA8K 3BGRA 2ZFZA 5F9NA 1LFPA 3BQ2A 3NL0A 4OI4A 1HNZF 4I6YA 3I96A 4I0WA 3VQSA 5D8HB 1JJCB 2HHVA 4OX9J 4B08A 5TMCA 2HSEB 3MZIA 4K4WA 3EXYA 4OX8A 3MEEB 4A3DK 4OZ2A 1SV5A 5CABA 4RW9A 3FBBA 1AYEA 2YXLA 3OR1B 5DM7Q 1IKXB 4IR9A 4U9RA 4RW4A 2CZ4A 1S48A 4ZS6A 5IOQA 3HMJG 3NAIA 3KWMA 4ZVGA 3M8SA 4F3QA 4DQQA 2MZQA 1RABB 2DNRA 1Y3KA 1BUXA 2AJ1A 3MPYA 2H5EA 3K57A 2VFVA 3DDKA 1TR0A 2W9CB 2E2HA 4DV6J 1TKZB 1U1LA 4GTEA 4ZH4A 2GIRA 3OVBA 4B3TJ 4YMEA 3RB6A 1TL7A 3MWBA 3CDWA 2CG4A 4DR5J 3T3FA 2GSNA 2B43A 2BJ1A 2XNRA 2JEJA 5DM6Q 2OSQA 2FGCA 3QATA 4I56A 1R27B 5JVOA 3F56A 3DLKA 4YR3A 4KGVB 2VF3A 2QTWA 3HOZC 1TL1A 4X62F 4NLGA 1F7UA 4DR7J 1RT4B 2DY9A 4IKAA 3G82A 5AE3A 2MY7A 2XMJA 2PI5A 5B0DA 2YTCA 3N28A 2Z2YB 1K0VA 3UN2A 4A3EK 2IVYA 3RR8A 3OTOJ 3BSAA 2YU9A 4R0JA 1I3QK 4NA3A 1D8YA 4K4ZA 1PYSB 3PYDA 3M8WA 3BPSP 2Y0SL 5DS7A 1RU1A 3CQZK 3C8YA 2GVZA 3GTKC 4ATNA 2V4QA 3JXOA 2LQ5A 1XMQF 5KT6A 2AKWB 4A3CC 2SXLA 3Q8PB 2YX4A 1VRTA 4I2PB 5BR8J 2KVIA 4TU7A 2HRUA 4KARA 1BLUA 2Z58B 3KK3A 1X0FA 2Z2MA 2NPFA 3DGPB 5IP7C 3DM2A 3CC2S 1S1WB 4CLWA 2R3VA 3OLAA 3D9BA 3R6LB 3BP8C 2BKPA 2HZCA 1WEYA 4QR2A 4NYOA 2UXCJ 1RAIB 5KFFA 4DL2A 3CJKB 4R0EA 3WQPA 1WC1A 1TWFC 1JLAA 5ETPA 4PR6A 4WCEQ 3S17C 2DNYA 3RBEA 1RTDB 5DG7A 5B7WA 1WELA 2DR5A 1N32F 2OUGA 2Z30B 4M5NA 3NNAA 1TU0B 2KM8C 4YFNA 2CQGA 3QAEA 2AX0A 1M1HA 3R9LA 3P3DA 1J27A 4GTDA 4M5HA 1NJXA 2J5AA 4O3NA 2WZ1A 3EGWB 3QIPA 2VPZB 4PYAA 5F8IA 5KFJA 4Y52K 3D0IE 2HWTA 2GNKA 1Q8LA 1FXLA 2YNIB 3FQKA 4BBRC 1IJEB 3AJ2A 3FUYA 3Q8QB 5HP1A 5FLMK 5BJRA 2KI2A 2U1AA 4JV5F 2GVZB 2JLFA 2XLJA 3N9UC 4RL1A 2VV5A 4FBUA 3EGNA 1ZYRA 3CMAS 3GTLK 4DV4J 2BE7D 3QT7A 3K17A 4QIWD 1K83A 3HKZD 1BWVA 4KTQA 1T8EA 4J9KA 1HR0F 3NGRA 1B3TA 2VDIA 2OH2A 2F4VF 2O5JA 3HVTB 1VDHA 3CCWA 1FHTA 1UL3A 5D4PA 3I55S 3CD6S 4LF5F 5KG5A 3TR5A 3Q3QA 1VHIA 4LVNP 1KKHA 2FY8A 3T02A 3ILIA 3PFOA 1WIHA 5G4DA 2HS0A 2FHOB 5J2NA 4ELUA 4F4XA 2H9ZA 3P49B 2EBGA 4MIBA 2KFNA 5I4MA 1Y7PA 3R7SB 4X4SA 2FHJA 5HN0A 1JK9B 1QLNA 2HBQB 4C3JC 2P9GA 2ZD1B 3AOBA 3S01A 4YY3J 1N4LA 2JEFA 2MEWA 1WKKA 1SJ4P 3KLHB 2OPSA 3U1NA 2H3EB 4KIAA 1DTQA 4BY7K 2R7ZA 4YB6A 1R0BG 5A6WA 1IVZA 2FLOA 4KH1B 2RMLA 3QRQA 4RU2A 1E6VA 4P2MA 3HJVA 2E1MC 3HHEA 3BJYA 2KO1A 2OPPA 2FIUA 1F5CA 1T9WA 3BREA 1IQ0A 5D77A 4XSZA 5CD4A 2NUHA 2R8KA 2EFPA 1SKRA 3TFIA 1N5SA 4OYWA 3QQCD 3IXQA 1T3OA 1RWKB 4ZCKA 1M5VC 4DBQA 5GMKa 4IYQA 1AROP 1HPZB 4LF8J 4QW9A 1Q81T 3D4JA 4JI4F 4JI5F 1RT5B 1FCAA 5ETVA 5GMEA 1EQMA 3JYTB 2V6TA 2HPUA 4CQ1A 4A3BK 1NM2A 1AW0A 1DJ0A 1U7LA 1U8SA 1WG1A 4U7UK 4PUOB 4Y7NK 1RTHA 1NK5A 3MUMP 1OWXA 4FXDA 3DHXA 1ISEA 4FF4A 2HBRB 4L72B 1NB7A 3LGMA 4A3FC 1QAYA 1S7HA 3CF5Q 3NBPB 3HOXC 1UFWA 1R9TK 1A9NB 4RBTA 2F8EX 5IORA 2L9NA 4B9SA 2W2NP 3AXKA 3V6KA 1JMTA 2DY1A 3Q89A 5DDOC 1RT6B 3RZOK 3BV8A 1D9DA 4OMFG 2XMTA 4OHZA 4DPTA 2GMHA 3JSRA 1V3ZA 2DT9A 5AXKA 4HHUA 1L3KA 2EK6A 4OI3A 2BM0A 2DNKA 4NLWA 2EBBA 1VIOA 3K7AC 2LECA 5K20B 4LSNB 2UUWA 1TAQA 2GJFA 1R6VA 4A3JC 2BA9A 5B0FA 3MECB 2D3OR 1YRXA 5E41A 1OYDA 4A46A 4Q5SA 1RZMA 1TZ0A 4DLGA 3W61A 4P71A 2H51B 2YNIA 3GTQA 1FVSA 1IJFB 4FYDA 3MFIA 3NMRA 4W4MA 1IWAA 3AH6A 3A3PB 5F8LA 1IBMF 1TELA 5M3FK 2JA7A 1HNXJ 2AEFA 3RB0A 1IBAA 4CDIA 1XIQA 4ZMMA 3J80U 2X51A 3LW5C 1DLOB 2V4JB 3PJ9A 4DUYF 3BO3A 4A8QA 2NVYA 2E5IA 3CC7S 4GC6A 3PTWA 4RPFA 1HNZJ 3DOKB 2CADA 1FT8A 1K83C 3UDEA 4PCQA 2NSCA 1LWCB 4KM8A 4QJVA 3CCMS 1WCMC 5DG9A 2UUAJ 4KMDA 1H6KX 3J7ZT 1N54B 1RWWB 2W1BA 1S9GA 1DARA 2ZBPA 2XBPA 4TQRA 2ALYB 4IG0B 4M5GA 5ADZA 2JA5C 4X4PA 4J3NA 3TYTA 2CJ9A 4O4GB 2AWZA 3CXCR 2KRBA 2A2CA 4K2JA 2X1GA 1MWZA 2DNLA 5L1KA 2DR9A 4M8LA 5KFMA 2A6HA 3KK3B 1BDFA 3O5TB 3BSNA 3MPVA 2V94A 5D4DA 3W60A 3TW0A 3NXZA 1UZDA 4IRCA 3PO5A 3HPOA 4Z37A 2CNNB 3TANA 3H8YA 4FS2A 1KVJA 4WU3A 7FDRA 2GGPB 1U45A 3BQ1A 3GTPK 1VS3A 3L3CA 1KDNA 2OMLA 1N34J 2DRBA 1G1XA 3CQZA 1RKIA 4A3IC 4PKDB 4LJZA 3ZTPA 5IP9K 2PIIA 1FI4A 3Q22A 3K0JA 1RT1B 3MD1A 2ERRA 3OTBA 2BACA 1RB0A 3FSIA 4LF9F 2P6TA 4C6AA 3QYYA 2WBRA 2QGFB 5ETKA 1T3NA 4C2MC 3MPUB 5B08A 5D3GB 3QT5A 4YY3F 1DCHA 3OTOF 1NBEB 4CRJA 4ZJOA 2VUMK 1NKEA 1YCLA 3AH5A 4LR8A 4F50A 1RAFB 3C6UA 2ZNZA 3V6JA 1B4SA 4X64F 1U0SA 3H0GK 3KHHA 2LQ8A 2VBXA 4DV3F 2N4CA 1XMBA 2POKA 1VQ5S 1S1UA 3R97A 1ZBTA 5IYCC 1P1TA 3PO4A 5TMFA 1HWLA 1S6OA 3E01B 2W24A 1RT7A 1T02A 2V6UA 1U09A 2GCFA 1HKAA 1E6VB 2OKQA 2YPZA 2MKKA 3HSDA 3QGPA 2KFZA 2YKAA 4DL3A 3CAGA 2W2PP 1ZAVA 3CTRA 3QSIA 4DOZA 3GV8B 2RKIB 1SUQB 5HO4A 1H38A 3ONQA 3KLEA 4X2BA 2EC2A 4A47A 2RJZA 3K8VA 4ZVEA 2Q79A 4BXXC 1O2AA 4AXIA 3PO3C 2IDEA 4ED5A 4KMUA 3QRPA 3OVSA 4TU9A 1XXCA 3O1LA 2CKWA 2PGCA 2E5LJ 4Q7AA 3I56S 1NUEA 1Q5VA 3LTOA 2IAJA 1EETB 3MEDA 4QYZK 5K8OA 1WWHA 3CW2C 2R2UA 3KLEB 5C24A 2B4PA 3CJ8A 1FTRA 4DPYA 1RBLA 3CIMA 2JA7C 3OTEA 4K8RA 4A3GK 3H5YA 4DR7F 1GH8A 1F6TA 3G6ES 3ZNJ1 1HD1A 4DDFA 2HNDB 3CCUS 3RTVA 4I67A 2FHMA 3HZGA 1D09B 2OPPB 3GILA 2FDNA 1B64A 5E33A 2ATCB 7AT1B 1EFWA 2HIQA 2HFOA 1S9EA 5K14B 4ZIWA 4TYBA 1TL5A 2FJBB 5C4JK 1RYRA 5KFSA 1RP5A 2AZ3A 4BC9A 1HI9A 1SPBP 5LT5A 4IFYA 3AB4B 4FPRA 1EJ7L 2MTLA 2W2OP 4HH0A 4O0IA 2KB2A 4MK9A 4YDXA 3AT1B 3GTLC 2KVQE 4PABA 3UNYA 3PR5B 1R7IA 4K4SA 2KRRA 3MMBA 1DBDA 3VZIA 3OW2R 1BQXA 4WF9Q 5JFEA 3NS5A 4P7TA 2RRBA 1KQGB 5HVGA 1IM4A 4DL0C 1KS2A 3QLHB 4JI1J 3A8JA 4BC7A 4HI1A 2QZ8A 4GRSA 5HI7A 2VU5A 3KLGB 3SQOP 3F73A 2UUBF 1B99A 3TNVA 1XZQB 3MXHP 1NSKL 4ECWA 1GK8A 1W25A 4LFBF 4ED4A 2XMKA 2MGZB 3DOLB 3HSGA 2LEAA 2F4VJ 3W5ZA 1FWLA 1N5VA 2AJFE 1OY8A 1U48A 2H48B 2ZH3A 4A8XA 4WJ4A 2YNHA 4X66J 3LP2B 1JXVA 3PEJA 3TUJC 3NKYA 5GAEI 3H2VE 1P8GA 1PG5B 2M3DA 2E2JK 4USKA 1URRA 2OTLS 5FD1A 1HARA 4DN9A 3M9NB 4O3QA 4ZVHA 2NVXA 1TKZA 1PKUA 4EUVA 4ZK7M 2ZHAA 5C3EC 1TWAC 5KFOA 5HMZA 3GEEA 4DUYJ 4GVLA 3EPGA 2MKHA 2XO6A 1MROA 3I31A 3MECA 5KFGA 1EP4A 4DPOA 4LBIA 3CWJA 2FYXA 2C3UA 5AXMA 4NZ7A 2D3ZA 3W9HA 3U1LA 2NYHA 4PRFA 1FEEA 1TWHA 2C2DA 2Y8YA 2YNGA 2BJDA 2LDYA 1HL6A 3VGUA 4JK1A 3MEKA 1VRUB 1ICEB 4RNMA 2DGTA 1SH2A 4HVZA 3J81Y 3D3BJ 3ZTSA 4GKJJ 3ETMA 3LPEA 2DVIA 2W7OA 4LSLA 3ZXWA 4ECXA 1KOHA 4B9VA 5HBMA 5HLFA 1JLCA 2O3DA 4ZPWR 2DK2A 4PZVA 3KNAA 2MLYA 2FHJD 2DNOA 4EU0A 3ENQA 1FDNA 4CH0S 1GTEA 3BS9A 1XR6A 3MR7A 3T9ZA 3JQMA 3EQLA 2MQMA 3IR5B 3KUHA 1IL2A 1FNOA 1B0VA 4QWBA 3FFIA 3GTOK 4W98A 3E2EA 4N7TA 4QIVA 4HLBA 5KTQA 1JNRB 4OLPA 1UCNA 3OQ2A 2NZCA 4X84A 2FD2A 1HNVB 2HVIA 3BGLA 2GQQA 1RXOB 4U67Q 2UVRA 2J8SA 3HO1A 1SVDA 4A93K 2CJYB 1NH7A 3M2UB 3RB4A 2XCQA 4MMOA 1RTHB 1NK7A 1FX2A 1FFGB 1KRPA 1BC6A 5LXYA 4DL7A 2NVXK 1IR2A 2B4VA 4LUBA 2QA4G 1YG0A 2BOAA 4JV5J 3D1QA 1FJGF 3T00A 4ITSA 3K5MA 4M63A 1CJKA 4X64J 1X4BA 2R92K 2M4MA 3QRRA 4G65A 2NVQK 2RRNA 3C6TB 2CXEA 2ASYA 3SDEA 2CQCA 3FEYB 2Z8QA 2YY3A 1JVIA 4HT5A 5GAHI 4WXWA 2GMLA 3JYTA 3TWZA 1KN6A 1Q8KA 3EVMA 4IRKA 1FKOA 2BJ7A 1JKHA 1X4HA 1KLMA 3IC1A 1DD5A 2EI5A 4MQ9A 2W2QP 3BDPA 2ZZTA 1X9WA 3WODA 3GV7B 3DGPA 2PEHA 3Q8VA 4TY8B 1YVFA 4RKUC 4ED7A 4R8UB 2R7QA 3DYAA 4F4KA 4G1PA 5IC4B 4DG1A 4H54A 5JJBA 3N0CA 2DEJA 4E98A 1I50K 3G2XA 2H4WB 2XI3A 3DRSB 4FNIA 4U7UD 2LDIA 2RNEA 4CNYA 3F44A 3D7SB 3VCDA 2CWKA 5IT0A 2CPDA 4PWUA 1C2PA 5L9XA 4O4RA 2XS2A 2VG7B 1I94J 3G8SA 3ADAC 2CQ1A 2YX1A 3WX4A 1Q16B 1I6VA 4ED8A 4BLAA 2HNZA 5HATA 3OBIA 3OL6A 2CQ3A 3CMES 2E9TA 1Y1WA 4Q43A 3I0RB 2HFUA 4O3OA 3JTNA 1FF2A 2VG6B 2WCXA 2XMUA 5HMWA 4X6AC 2KZMA 2ZH5A 1RHRB 2VJVA 1X4GA 4M5DA 3DMJA 2EPIA 1NLKL 3DU6A 4HTIA 1SFOC 3HLUA 3PIOQ 1QSLA 3RR7A 3S15K 1H98A 1CJTA 2VDHA 4DR2F 2RH6A 3I5CA 5LMNF 4U8VA 1N34F 1UEUA 4ZN3A 2K2PA 1P1LA 3SSSA 4AH6A 4ZPBA 1NHKL 1DHMA 1E6YB 3SSQA 1L5UA 1RK8A 1C0TA 1QY7A 1RHKB 3M32B 3OL7A 1NO8A 3AB2B 2RAQA 3SZYA 3BZQA 5U47A 3CCQS 1ZYQA 4ZKAA 2VONA 4LFCF 2KT5A 2YH1A 2HQIA 2BZ2A 3MM5B 4KAWX 3PO2K 4UZBA 1HBMB 5GAGI 1N5QA 3JSMA 1TL1B 3FHZA 4OZ3A 2OD4A 3LQVA 3RBXA 3H59A 3OSPA 2J0WA 2OLWA 1TWFA 3GTGK 2BMBA 3IFEA 5A2QY 2R93K 2BQUA 2FY1A 2CVIA 4LLGA 2Q43A 2AQ4A 8RUCA 5G0RA 4OZ0A 2HKEA 4TQSA 2HYIB 4RW9B 1H72C 3L7OA 1PILA 3I0SA 1BQMB 2M7SA 5IQ6A 3ETOA 4PXCA 3W2VA 1YK9A 2DEIA 2CPXA 5ETLA 4C3LA 1GE9A 4OFZA 1GT8A 2KHCA 1SQGA 2RQKA 2DNHA 5B0BA 2EFVA 2M52A 2PMZL 2DCLA 3FCVA 1YJWS 1RHMB 3M4OK 1IM6A 3FEXB 4RUAA 3QT6A 4ZLLA 5A8WA 4DV5J 4KPCA 3RRGA 3TQ1A 3S1RK 3A8EA 1F60B 1SV5B 4DFMA 3MURP 2J0XA 3IRXA 1BQNB 3GIKA 2D3O1 3FK4A 1EX8A 3AODA 3S8SA 1G2EA 4A8MP 4LK1A 3PM9A 4DQIA 1HIYA 1FJEB 2O5DA 3RYLA 1UETA 4F8RA 3MM6B 1AFIA 2ZOGA 2ALZA 3TZWA 5IYDC 3D28A 2E7VA 4F25A 1JJHA 4ZA1A 3I4NC 6FD1A 3GCWP 2UXDJ 2V8GA 1QVGR 1WJ9A 3DC2A 3MI7X 2QEXS 4J9SA 5KFZA 1KEKA 3I4HX 3HSZA 3M8RA 4PXDA 4PG7A 2HGNA 4RBVA 1ZAWA 4LF6F 1FTCA 4P75A 3M3YC 3H5SA 3BR8A 3MM6A 1NK0A 4Q0BA 5EWFA 2EFOA 3TA2A 5GAEU 4DR2J 4LF4J 3MM8A 1NJYA 2GZOA 3IWNC 4KRWA 1XPPA 4NA2A 2WONB 1IUJA 4KKOA 2BKOA 2EG1A 2FB0A 4MK8A 2NXCA 2MHEA 4F0MA 7FD1A 1MNEA 3OR1A 1IR1A 2G13A 4MTPA 1TFWA 2O5IA 3QJJA 4RJVA 3PW0A 3IS9A 3Q83A 3KLVA 2ZITA 2PA3A 4A3MK 5DDPC 1VR6A 3TJ8A 3MCMA 2AYEA 1XXBA 3S0XA 3PVXA 1ZQ1C 2Q66A 5DJBA 4Q8FA 2OPQA 3CULA 3OTCA 3I9V9 4C0OC 1B70B 2ZBRA 4F02A 2BW7A 4O3RA 2CFAA 3NWGA 4X4RA 1WDDA 3BPDA 1XNQJ 2XM3A 1XMOF 3PYEA 1N33F 3HI9A 3M6UA 4RWXA 3FKIA 1S6QB 2VQEJ 4PXEA 4ES1A 4DV0J 3IG1A 4DR6F 1UFLA 4DX6A 3HOUC 1D9AA 3CMQA 1UEVA 3HKWA 3MM7A 1L3UA 4H4KC 2X3GA 1RSCA 3CVKA 3DU5A 4JYAF 4B02A 3MMCB 3VV2B 4Q8EA 1NZ8A 3DRRB 1WTBA 4P6QA 1OPZA 1TWHC 3MCSA 4P7VA 1RTZA 4ZVOB 1VQNS 5IYDK 1D3WA 2FZCB 5HSPA 1CJTB 4WPAA 1WNEA 2G9OA 2PDAA 3KLGA 4Q45A 1OQ3A 1WSVA 4ZLJA 4WKRA 4KH0B 1Q86T 2XMMA 4Y2KA 1SH0A 1CJUB 1HMVB 4CO0A 4PG6A 4JI3J 3OREA 4C3IC 4ZVTB 2HHSA 2FJWA 1FA0A 4TN2A 2W4CA 3SQGB 3N6NA 4YFUA 1YBUA 1H2VZ 1GNKA 2B9XA 2K1RA 3V4GA 4P2SA 3KDNA 4ETXA 4C97A 3QAUA 3NGTA 4N41A 3DMJB 2KJWA 2OD6A 2RDJA 3N6MA 1FKPA 1OJ4A 3GR1A 5C42B 2VUMA 2BDPA 3MCNA 4DDQA 4EEYA 3S2HK 1WHVA 1IE0A 1WUUA 4AQYF 5A0YA 4OHWA 1FRJA 4KT0C 5B0EA 2QMXA 2CZVC 4PWWA 3UW1A 3DLEB 5LM7E 4WJBA 1XTZA 5ETTA 5HK4A 1TMJA 4HT7A 3G86A 4BDPA 1LK7A 3BSOA 2DYAA 3I32A 3VF0B 3KHRA 3RRHA 2Z57B 1K9MT 3C14A 2DXDA 2GO9A 5A2QU 2ZWOA 1KHWA 2RRAA 4ZPTR 2YKOA 2NYIA 1OY6A 1ZS6A 2MZRA 2CPFA 4URSA 1EQ0A 2XI2A 3TP2A 3LAJA 2MQNA 2ZKUA 2XCRB 1I50A 1BXNA 5BXIA 1WOSA 2W9BA 4EBDA 4P5AA 5D6GA 3FRZA 4D3GA 5IS2A 4FZVA 3R6GB 5L38A 3W3SA 1X8DA 3LAMA 1TWHK 2YWHA 3SFGA 1QTMA 2CVEA 1JQWA 4C2MK 1HHSA 3OHAA 2XQCA 3CUNA 1JJ4A 1YJ9S 3KHGA 4NCAA 4KMHA 3M2UA 1G7CB 9ATCB 1IKYB 1MWQA 1SIWB 5FLMC 4IOAQ 1VQMS 3GFHA 1OSDA 3S1QK 2KG1A 3KK1A 4MAKA 1ITPA 1X4EA 4B9TA 2OPSB 1S1TB 4WFBQ 5LMNJ 3E01A 5HANA 3J7A1 2A69A 3H20A 5JMNA 4DFJA 4JV0A 4KO0B 3D68A 1QE1A 2ZC4A 1JNZB 4C98A 3E8OA 3HOZK 1LW2A 3TVZA 3O44A 1TKXA 1T03B 1UV7A 5I3PA 3GIIA 1DURA 4L3NA 1CQMA 2HS4A 4URGA 1RE1B 4A8WA 1FDBA 1PBUA 5C25A 1DTTB 3G9CA 2R2RA 3IR6B 5F0UA 4X4OA 1VHFA 1B7FA 5KT3A 1IKVA 1JLFB 3M9OB 2VFRA 5HAOA 4DSFA 5MLCV 5F8NA 1WI6A 4X4NA 1T03A 2DNMA 3PJXA 4C3JK 4P74A 4RO0A 2KT2A 5KFTA 3VAIA 1X5TA 4NL5A 2AJ2A 2HNZB 1HQEA 3GTJC 3KLFB 1IW7A 4Y00A 2HS3A 4OQJA 4ZN1A 5H9EJ 2NVTK 2DBBA 4ZJQA 1FDDA 5EDWA 5KG3A 5K8NA 3PRVA 2IYGA 2W9CA 1RLCL 2H5IB 3US5A 1R6YA 3DHWC 1WF0A 5D3GA 4WE1B 3W1YC 1WOOA 3LP0B 2JJ4D 2D7SA 4A8SA 1TWGK 2HZAA 5IYBC 4GTLA 4DX8H 4USUA 3PX0A 2GVDB 1YJ7A 1N36J 2CIMA 1JLGA 4A3LC 2B8QA 1LEOA 1C1BA 4LRCA 3C2PA 1NK4A 2VD3A 5DO2A 5C2CA 4J9LA 4NLRA 3DOMB 3NLCA 1M5KC 4DV2F 1HWJA 1K0TA 1UPMB 3CDUA 4WILA 4IG0A 3R8YA 4A3KC 5M5XK 3VR1A 2KT3A 2LLZA 4JI8J 5LSOA 3N3YA 4BLGA 1SB6A 3GWCA 3HVAA 5CXTA 1X60A 4NI2B 1KNZA 1KD1T 2HNYA 4K59A 3HP6A 4OYIA 3A1YG 4KHPF 1O25A 4MYTA 2VUMC 3N0VA 1O24A 3FBFA 2FLNA 3GTYX 4N77A 1DLOA 4NXNJ 1VQYA 4WP8A 2MY8A 4DF8A 5E7OB 3MMAA 1UPPA 3E3XA 5EWGA 3GSIA 1S1XB 2UUBJ 3UVJA 3FVYA 5T14A 4DV6F 4NEZA 1WKJA 3C15B 4O2DA 3H40A 1WHXA 5DDQC 3TFHA 3OR2A 5HQ8A 2IHR1 2LFVA 4F3OA 4FF2A 3WC0A 4HYKA 3QT8A 4I64A 2G0CA 4ZHRB 4A3EC 1WDTA 1Z2LA 1LQ9A 4OHVA 1S97A 4CI0B 1Y11A 2B63A 1AZSA 4KDDA 2EWHA 4HACB 3CCJS 2R7VA 1OY9A 4P9SA 1NMEB 2ZH9A 2AMCB 2UXBF 1N5TA 4AE5A 1FRKA 5CHPA 1S9EB 4LOWA 1NCLA 3MPDA 4DEZA 2H1YA 2JZ5A 1V5IB 2ZWPA 4KPYA 5EGYA 1ZAXA 2B0GA 1XN9A 3NGKA 2PMZD 1RT1A 3R5JB 4PG4A 1JIHA 4C7QA 3Q8SB 1FDAA 1SJRA 2QN6B 2R42A 2X1FA 1KFSA 4W92B 2E66A 4PWDB 4X65F 4G1QB 2G2ZA 2KYXA 4LSZB 1X5SA 4LSLB 1CSJA 4EYHB 5AJ3F 4JBCA 4BS2A 5IP7K 2NXUA 1FE0A 2RD5C 2JA8C 3GFYA 3SV3A 1UMJA 3MOZA 4F2RA 4C3KA 1YJRA 2PD1A 3MMBB 1HBNB 2VQFJ 1FWPA 1N5YB 1FKAF 2B7BB 2YWGA 2DR6A 1JJ2R 2YNGB 3SMZA 2KYZA 3N6LA 3IRWP 3PACA 3AD7C 4ZVSB 2VG5B 3TUIC 1RAHB 2CQ4A 2GQ2A 2XMVA 3ITHB 4OZJA 4M1KA 2GFFA 4I68A 4XTTA 4HKQA 2BM1A 2APOA 2RILA 3K89A 3KMQA 4AXJA 1S6UA 2AV5A 2EW9A 4AFFA 4DUZF 2X1AA 2GC8A 2Y1LB 1P6TA 1PC4A 2FQQB 4ZHRA 1M1KT 3KJQB 2ASDA 4MKAA 2OFHX 1TK0A 1HQMA 3CT9A 3CO9A 2F8MA 3L7UA 4GFQA 1BMQB 4I4BA 3HSJA 1M5PC 3S14C 2Y9HA 2BJ3A 3DDIA 2I9SA 3EZUA 2LXUA 2ZZMA 3ULHA 4CO2A 5DGBA 5FDLA 1YSJA 1ZVUA 5ETSA 2DRAA 1JWWA 3KNGA 1PAUB 4TKTA 2CPIA 3HKZL 5C4XK 4BBSC 2V9KA 2E2IA 3AD8C 2VPYB 2YKNA 3LGNA 4IG3B 4IFVB 5K5MA 1Z4UA 1RAGB 3UVJB 3LPYA 3TRGA 1U1NA 4LFCJ 5J2PA 5M3MK 3MR5A 1DFDA 1M5OC 1VLYA 4DS4A 3TEGA 3HVWA 4JI1F 5DETA 3TAPA 4RLEA 4WK1A 4FVMA 1B0TA 3SV4A 1FERA 5IOSA 3D3CJ 2LCWA 4LQ3A 3NS6A 4C3MA 2IVMA 4PAAA 4Q4ZA 4KV8A 4WTYA 3M8QB 4F4ZA 4C3HK 4G0VA 3IM9A 1HR0J 3S16K 2ATLA 1VQ8S 2HBZB 3LAPA 2D9PA 2DHSA 3PEHA 1AUSL 1HHTP 4LT6A 5HVFA 4HEA9 5IQQA 4FYXB 4GTAA 4UOCA 2GVDA 5ETQA 4IO1A 3Q2SC 2WVEA 2R7WA 4KB2A 2KU7A 4LVOP 4JI2J 1DTTA 2HVZA 3RRKA 4OJ1A 3B78A 2PPBA 5C24B 2M0GB 2NXJA 3OFFA 1RISA 1CC7A 3BBCA 3UR0A 3HT0A 4BLBA 3M6WA 4JI8F 1Y5LB 1O51A 2XGQA 3DXJA 2V34A 5BR8F 5A8KB 3EZ5A 1BS2A 3O8WA 4K5SA 2OPRB 3IMQJ 4Y65A 1DAXA 2CDQA 4IDKB 4I69A 2C2OB 1YHQS 3C6UB 4GO5X 2WRMA 1NXIA 4J5OA 2JA6C 3HOYK 3GP9A 3QBCA 1M5SA 2VOPA 3GCXP 3AD9C 5CCLA 5C4XC 3LPXA 1LFWA 3BBFA 3ET6B 1V5VA 1ZTTA 4NLQA 2DB1A 1LW0B 5FIIA 5GAGU 4CH7A 2XLKA 1N5YA 3DLJA 6AT1B 1UWBA 1QUVA 4C2MA 3GTOC 1LWFA 2P6SA 4X4UA 5KFEA 2B4UA 2VUGA 2V9WA 1X0PA 4G7ZA 1VJWA 5KFUA 3PHTA 3W9JA 4PXBA 1YITS 2AYMA 5KFIA 1WHYA 4YB5A 1HYSA 2F5GA 3PCOB 3ISZA 2ASLA 3MGJA 1ZXOA 4M5JA 2PA8D 3N79A 3U7JA 3RZAA 1FESA 4X65J 1KQKA 4XIUA 4QWAA
chains in the Genus database with same CATH topology
1XZPB 1WOSA 4PABA 1WORA 2GAHC 3AD7C 1PJ7A 1WSVA 3TFIA 5L46A 3GEHA 3TFJA 3GSIA 1PJ5A 1WOPA 3ADAC 1X31C 3AD8C 3GEEA 3AD9C 4PAAA 1XZQA 3TTGA 1PJ6A 3A8KA 1XZPA 1YX2A 1WOOA 1WSRA 3GEIA 1XZQB 1VRQC 3A8IA 3TFHA 1V5VA 3GIRA 2GAGC 4P9SA 1VLOA 3A8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZP B;  1WOS A;  4PAB A;  1WOR A;  2GAH C;  3AD7 C;  1PJ7 A;  1WSV A;  3TFI A;  5L46 A;  3GEH A;  3TFJ A;  3GSI A;  1PJ5 A;  1WOP A;  3ADA C;  1X31 C;  3AD8 C;  3GEE A;  3AD9 C;  4PAA A;  1XZQ A;  3TTG A;  1PJ6 A;  3A8K A;  1XZP A;  1YX2 A;  1WOO A;  1WSR A;  3GEI A;  1XZQ B;  1VRQ C;  3A8I A;  3TFH A;  1V5V A;  3GIR A;  2GAG C;  4P9S A;  1VLO A;  3A8J A; 
#chains in the Genus database with same CATH topology
 2AJ4 A;  3QJL A;  1D0E A;  2UVW A;  5C44 K;  2VG5 A;  3N5B A;  2WK4 A;  3GYG A;  4CWB A;  3QIP B;  4LBP A;  5D0R A;  4FBT A;  3CE8 A;  3ZO7 A;  4G0U A;  1W26 A;  2VQE F;  1EHW A;  1ZM2 A;  3JSB A;  2XLI A;  3FNN A;  3M30 A;  5HL8 A;  4BBY A;  4QW8 A;  4B3M J;  1H0H B;  3T5K A;  1U8W A;  2ZE2 A;  4QBU A;  5F8H A;  3EVW A;  4CT9 A;  2CNL B;  4I2Q B;  4HDG A;  4RW4 B;  4ECU A;  2DPI A;  3SFU A;  1U6Z A;  3QZ7 A;  2FLL A;  4RUB A;  4QQB A;  2LU2 A;  2JA6 K;  4G3I A;  1CC8 A;  1Y9O A;  2LXF A;  3RUB L;  4W90 B;  4NLU A;  2RF2 A;  3D6T B;  2MQO A;  2FPH X;  2A10 A;  5C3E K;  2DKO B;  3JAM U;  5A76 A;  3HOW C;  2JLE A;  3BGO P;  3S7R A;  1RGV A;  2YQ1 A;  3VGT A;  4ER8 A;  2PI4 A;  1FX4 A;  4X62 J;  1ROF A;  2HHW A;  1RT5 A;  3BEG B;  3I5A A;  1X4A A;  2CAJ A;  4Z7Y A;  4KE5 A;  3TZX A;  4GT9 A;  3NG8 A;  1RAA B;  2NR0 A;  3HHK A;  2ASJ A;  2JVR A;  1GTH A;  2UXB J;  1HI1 A;  2COL A;  1FWK A;  3VGV A;  3GR0 A;  2OPR A;  1TMM A;  3TAQ A;  2ZDP A;  2DHH A;  3KLF A;  2R7R A;  1O2F B;  3MML B;  1AT1 B;  1KOO A;  2C42 A;  3OVA A;  2FVC A;  1N48 A;  2E5G A;  3B4M A;  4AD6 A;  4XO0 A;  1RT6 A;  2RGR A;  4NLD A;  2HRY A;  3HT3 A;  4H4O A;  3LP1 A;  1QAJ A;  1XK8 A;  2ZKT A;  3Q86 A;  4NYP A;  2G4B A;  3D66 A;  4XCH A;  2ZVI A;  2BUN A;  3M2R A;  5KFY A;  1GXT A;  4F7V A;  5E0O A;  4DU7 A;  3W5X A;  4WFY A;  2WSC C;  1IKX A;  4OYX A;  4A8F A;  5LOQ A;  2MQ8 A;  4JI7 J;  1S1V B;  3DRP B;  4ILR A;  3R1H A;  5KOW A;  4CT8 A;  3IRX B;  2HRT A;  4GMK A;  5KOX A;  4CTA B;  4XDC A;  2MQL A;  4KN7 A;  4UOG A;  2BQ3 A;  3P6Y C;  2L41 A;  4M95 A;  2HG4 A;  2UUC J;  4AYB L;  2CQD A;  3OUY A;  2WB1 D;  4PEO A;  2MKI A;  4DCO B;  3FBC A;  5HMY A;  4C45 A;  3MM9 A;  4NZ6 A;  4O3S A;  1T95 A;  2V8D A;  1S1X A;  2R7T A;  4MJK A;  4WFN Q;  1U02 A;  4DSI A;  1JXL A;  4LRF A;  5LMU F;  2V2V A;  3M8Z A;  3I9Z A;  2EEY A;  2GW8 A;  1XMQ J;  1S0N A;  2GX8 A;  4KMA A;  5C25 B;  1SJF A;  2GV1 A;  2JA6 A;  1WF2 A;  4WJ3 M;  1CBK A;  1FK9 B;  5I42 A;  3OT9 A;  3FEZ A;  5B0A A;  2Y8W A;  1UP1 A;  5D15 A;  3G96 A;  4RNF A;  4C0B A;  1FVQ A;  3VGS A;  1AA1 B;  4AL5 A;  2XUL A;  4B3M F;  2QL5 B;  5F8J A;  1KVK A;  3IP0 A;  4UW2 A;  3ZFV A;  2ZH2 A;  3MM7 B;  2Y0S D;  3GYX B;  3NY0 A;  4JI5 J;  4NLT A;  2MYF A;  2Q6B A;  3GFX A;  1K44 A;  2G1D A;  2HQD A;  3KOA A;  4LRB A;  2PN6 A;  2VKR A;  4Y2C A;  3PW4 A;  4TU8 A;  2UVV A;  3GSD A;  1YWX A;  3VAH A;  1CJK B;  1R9T C;  5LXR A;  4KY3 A;  5I3U A;  3EWG A;  1NKC A;  2GMJ A;  3GTK A;  1L3S A;  2V2K A;  4QIW L;  2N7C A;  1HNI B;  4QIG A;  1F3V A;  3GZ7 A;  3OL8 A;  1Q0N A;  3W7B A;  3A12 A;  4NCG B;  2DR8 A;  3S1N C;  2QYC A;  2QT7 A;  2AHO B;  1HFE L;  1HNX F;  5KG4 A;  4BY1 C;  1LW2 B;  2NQP A;  4K50 A;  1RT2 A;  4OJ3 A;  4KB7 A;  4FN5 A;  1JLA B;  3R2C J;  1UFK A;  2M8D B;  2C22 A;  3J7Z 5;  2HHX A;  4QJV B;  3CPW R;  1UVN A;  4Q0B B;  1UVI A;  1X5P A;  4RNH A;  4DU8 A;  3V6D B;  2FLP A;  1GXL A;  2P8I A;  2E2I C;  3WHI A;  3RZD C;  1N56 A;  2DRD A;  4ECZ A;  4XK8 C;  2J6U A;  3ENV A;  1M0S A;  3UD4 P;  3NNC A;  4WFX A;  3G4C A;  4JYA J;  2ACY A;  2GIF A;  2B56 A;  2ZVS A;  4KM9 A;  2Q6C A;  3RAM A;  2FVP A;  2W9B B;  3ZZT A;  2DHX A;  2UUT A;  1U1Q A;  2IJR A;  2AEM A;  1Q5Y A;  2GAG C;  2DNQ A;  2Y0B B;  3PX4 A;  3KDO A;  3JQJ A;  5CYQ A;  4A8K A;  3M8P B;  4HH1 A;  2GA7 A;  4M94 A;  1RHJ B;  3DLG B;  4Y28 C;  3KYL A;  3S2D K;  3CCE S;  5EGH A;  4NA1 A;  1LWX A;  1R8A A;  4C8Y A;  2DH7 A;  1VJE A;  4JUZ A;  1O28 A;  4KYZ A;  4Q2L A;  1I6J A;  1Q7L B;  2GGP A;  2FTR A;  3BGU A;  4JB8 B;  2DGU A;  3CCZ A;  4A3D C;  5F3T A;  2R2S A;  2B9W A;  3W8P A;  3BGF A;  5DLG A;  3EE3 A;  5KFD A;  2V6A A;  2MJN A;  2BAN B;  1HWK A;  3DM2 B;  4AT1 B;  3MM5 A;  3SI8 A;  1WC4 A;  3JQK A;  1JB0 C;  4ZPD A;  2QIF A;  5ITH A;  5M2R A;  2XZT B;  1HI0 P;  2CZ9 A;  1RJJ A;  1S59 A;  4CO5 A;  5DQI A;  4DFK A;  1HA1 A;  1T9T A;  3VHQ A;  5F9L A;  3PDN A;  4LRA A;  3MR6 A;  4MFB A;  1SC4 B;  1C1C A;  3S1Q C;  3SDE B;  2B9Y A;  2HFS A;  2BAN A;  4DR3 J;  1U1R A;  3W66 A;  3HOU K;  3ZZO A;  3MTJ A;  4FNH A;  3EGV A;  3M30 B;  2OJ3 A;  2WSE C;  3G8Q A;  3JTO A;  2M9K A;  1XNR F;  4EO6 A;  1R31 A;  4L6V 3;  2BJ8 A;  4ED1 A;  4UY8 T;  2E44 A;  5KG7 A;  3GLJ A;  2KM8 B;  2LKZ A;  2E2H C;  3BN7 A;  3L95 X;  4FZB A;  2KXN B;  3ERE D;  3PNI A;  1U49 A;  2E2I K;  3AAW B;  2XZD B;  2N4D A;  1HBO B;  4ERD A;  2MZJ A;  4NLS A;  2BW2 A;  1EIY B;  5IT9 Y;  2XCO A;  3I0R A;  5D4L A;  1YTY A;  4OIX A;  2QJ3 A;  3LH2 S;  5IFM A;  4ALZ A;  1CPZ A;  3GTO A;  5A8R A;  2F65 A;  4TLQ A;  2AP6 A;  2K7K A;  4QWE A;  3PKY A;  1JLQ B;  1U26 A;  1HQU A;  2V0N A;  3HHL B;  2JDJ A;  2ACM A;  2Q3P A;  4K2X A;  1EK8 A;  2YQ0 A;  2J7K A;  4F4A A;  1F5B A;  4P73 A;  4TY8 A;  4XAK A;  2EKY A;  3CIZ A;  2V5H G;  3TAR A;  3DFE A;  4A3C K;  4EFA C;  3H90 A;  2RUG A;  2CRL A;  2NVY K;  3BO4 A;  3O6Q A;  4HTJ A;  4A3I K;  4WZQ A;  2E5J A;  2C3Y A;  2EXU A;  3D54 A;  5B09 A;  3OFH A;  2Y3P A;  4C9D A;  4ZVF A;  4GTC A;  4IUF A;  4EZ6 A;  2VH7 A;  3G82 B;  3Q8R B;  5FDL B;  2CPE A;  5IWA J;  1LKZ A;  4OV1 A;  2R4F A;  1O5J A;  1MU2 B;  2YX7 A;  4WYW A;  3H3V L;  1NAQ A;  1UVK A;  4ZP9 A;  5A8W B;  5A8R B;  3P5B P;  3OEP A;  4ILM A;  5L46 A;  3S17 K;  4NE9 C;  3PY8 A;  2XWY A;  4ZVU B;  1B0P A;  5EUH A;  1XEZ A;  2JFK A;  4WU2 A;  2R93 C;  2W7P A;  1VYA A;  2BV3 A;  1Q4R A;  3FDS A;  3M1V B;  3TJA A;  1MWY A;  4MFB B;  4TNO A;  1IBC B;  1VI7 A;  2EFG A;  4QYR A;  5ETR A;  1S1V A;  4IH6 A;  1CJV A;  1RT3 A;  4WZM A;  3MUT P;  5DGA A;  2MZ1 A;  2B51 A;  2OPQ B;  1J98 A;  1NRK A;  3GU0 A;  5K8M A;  2JL9 A;  5D0G A;  3NGU A;  1TL3 B;  2D69 A;  4MIW A;  3RJM B;  1FFW B;  3NOG A;  4B9U A;  3UE2 A;  5FLX U;  1YZ6 A;  1S1U B;  3OPF A;  2IRX A;  3ISN C;  3M9M B;  1UW4 A;  1J5E F;  1RKJ A;  4YR0 A;  4NRT A;  1U47 A;  4N47 A;  3NRB A;  3O2I A;  5F0W A;  3OL9 A;  3SSR A;  4EWT A;  1S0M A;  3DRY A;  4USH A;  5DRK A;  4MT1 A;  4U8Y A;  2VG6 A;  2V68 A;  4CO3 A;  2PO4 A;  3T19 A;  4P2X A;  1VFJ A;  1NDK A;  4LFA F;  1S1W A;  2VIC A;  3KKF A;  1B7Y B;  3PW5 A;  3R5B A;  2ZBQ A;  4YEA A;  4OIR A;  2Z2L A;  1UAW A;  2KWA A;  1L3V A;  4GTF A;  3S1R C;  2XYP B;  4UQT A;  3DRX A;  2NXN A;  2XCA A;  2V2Q A;  2VG7 A;  2LA6 A;  2V8V A;  1CEZ A;  3PRD A;  1HNW J;  1IS1 A;  2IDL A;  2VB6 A;  2J9D E;  2VFT A;  4TLR A;  4CYU B;  2BEF A;  2YWK A;  3THT A;  3GTK K;  1QTN B;  2YKP A;  1ZH5 A;  2R7Z K;  3TTG A;  3HVR A;  1YBA A;  1F1B B;  4FVC A;  3NGD A;  3D1H A;  4Z7C A;  2VBW A;  3KK2 A;  4I7F A;  3BO2 A;  2DH8 A;  1LWF B;  2CJX B;  3GTM A;  3CED A;  3T6B A;  2P8T A;  1QDU B;  4CLT A;  4IOC Q;  1QSS A;  2UV8 A;  5CA5 A;  1FJG J;  2LMI A;  4LF1 A;  4Z2X A;  4A8O A;  1I94 F;  3KTQ A;  2G2Y A;  3WIV A;  4CLU A;  3CO0 P;  1UEK A;  3SXL A;  1ZET A;  3LUY A;  1BQM A;  3I0S B;  2HIY A;  2XY7 A;  1RAO A;  1Y1W C;  1VLO A;  1SC1 B;  1VQ7 S;  4ZPC A;  2KL8 A;  4ICL A;  1Q95 G;  1C1B B;  2GHV C;  3NWR A;  3HFK A;  5J1E A;  5EWE A;  1I6H K;  4G7O A;  1T9V A;  2V4J A;  4O23 A;  4G0W A;  4JI4 J;  3H2U B;  1X5O A;  2QL7 B;  2HVH A;  2HVD A;  2BYC A;  5JXS A;  1RT7 B;  2YVS A;  1NK8 A;  2ZUG A;  1X4F A;  1XZQ A;  1TUW A;  3KMS A;  4Y52 C;  4LF9 J;  3HHL C;  1CLF A;  1N33 J;  2WVB A;  2B5J B;  1SUQ A;  4BBR K;  2GAH C;  2L48 A;  2BVZ A;  1FXD A;  2Y1J A;  4FYY B;  1NND A;  5CYJ A;  4JV2 A;  3T1Y F;  1F3F A;  2CNK B;  3QGH A;  5KT5 A;  4FF3 A;  2WVC A;  4JI0 J;  2K3I A;  1K1Q A;  3GDZ A;  1OS5 A;  2A18 A;  3PX6 A;  4OJH A;  3MM9 B;  5KFA A;  4DV3 J;  3T9N A;  5CHC B;  4DQR A;  1I5O B;  3IA0 A;  5KG6 A;  5KFB A;  1RWX B;  5KFN A;  1K8A T;  4NXM J;  3ZTR A;  3SCL E;  4RNN A;  5I3Q A;  3D6M B;  5CZV A;  4DX5 A;  1Z1Z A;  2WAQ L;  1RAE B;  2E1R A;  4EK2 A;  1MMN A;  5GAD U;  3FSY A;  2XS7 A;  1HNI A;  1S0O A;  1T11 A;  3M2V B;  2HGM A;  2QLJ B;  4USM A;  2OEJ A;  4RUH A;  2LA4 A;  1K83 K;  1VQ4 S;  2LEB A;  4USV A;  1ZZN A;  2RVJ A;  1XZP A;  3KLI A;  3FOF A;  1AXQ A;  2FVR A;  2B63 K;  3S1M K;  2FJX A;  3KG4 A;  1KFD A;  5J2M A;  3C6T A;  2HBY B;  5FJ8 K;  2OEL A;  3LAL A;  3PYF A;  5JVG Q;  9RUB A;  4CLF A;  4BY7 C;  1JXE A;  5HLF B;  2Q1L A;  3BQ0 A;  1FRH A;  2E7W A;  5E3C A;  4CLS A;  3W63 A;  3S2H C;  5KG2 A;  4IO9 Q;  2L9W A;  1SJ1 A;  1NZA A;  3CCR S;  5M2P A;  4RW8 B;  3V81 A;  2A68 A;  1C4C A;  4D3H A;  4KAS A;  3F41 A;  3BYP A;  1ZBS A;  2ZJR Q;  3PXG a;  2QFJ A;  3UQS A;  2WOM B;  2FGO A;  2HUR A;  1SL1 A;  1HW8 A;  4ZCL A;  2ZH4 A;  3K8W A;  4I6A A;  4A93 C;  1IBL F;  4HI2 A;  4NCG A;  2EKN A;  5H9F J;  1JLB A;  1OMS A;  1RTJ A;  5EX3 A;  4E0D A;  4DR3 F;  2HW3 A;  5EHH A;  1M1G A;  2WVF A;  1BGW A;  4DR4 F;  1RDR A;  1DZ5 A;  1A7G E;  4ED0 A;  3OXF A;  2HQF A;  3MD3 A;  4PG8 A;  1Q8I A;  3LP1 B;  1PO6 A;  1R89 A;  5IP9 C;  3X3U A;  1UA1 A;  3TA1 A;  3R2D J;  2BJE A;  3HHD A;  3R7N B;  2FJV A;  4TXS A;  2CG8 A;  2LU1 A;  4BWJ A;  2DGS A;  1CVJ A;  4OI1 A;  4Y7N C;  2ZH7 A;  3DLH A;  1VGX A;  1O29 A;  1DY3 A;  5ETM A;  5J2N B;  1JLC B;  1HQ2 A;  5EGE A;  4GKJ F;  3HOV C;  2FZK B;  1CS4 A;  2I0X A;  2FHK A;  1TWC C;  5KAK A;  2I5J A;  3J80 Y;  1L3T A;  4ES2 A;  1VQS A;  1F9N A;  2K8G A;  1HYS B;  4V19 J;  4P5B A;  1QE1 B;  3DXS X;  3LWL A;  2LP4 A;  4J7C A;  1T05 B;  3TI0 A;  1RBO B;  3UO0 A;  2C2N A;  3TUZ C;  1EKS A;  4EBC A;  3T5H A;  1QSY A;  3AQO A;  4WII A;  3DLG A;  1J6V A;  2RSQ A;  2V69 A;  2C2R A;  4C3I K;  1UVJ A;  3BP3 A;  2IPO B;  1WF1 A;  3FFI B;  3QID A;  4YHH J;  1KP6 A;  4BHQ A;  2E1P A;  1N6Q B;  4WKY A;  2PEB A;  3LAN A;  1C4A A;  3HDS A;  4NI2 A;  4NX9 A;  3FCW A;  2AYG A;  1VQK S;  1HBO A;  5CJ9 A;  5GVQ A;  4NZ0 A;  4IOB A;  5L1J A;  4UZC A;  1CUL A;  3Q8Y A;  4DWI A;  3V6D A;  4KHM A;  1NPP A;  5DDR C;  2IJF A;  1I3Q C;  2K3K A;  3C46 A;  2YQ3 A;  3D2W A;  1R3N A;  1NJI T;  2G2O A;  2ZJP Q;  2PFF B;  1Q78 A;  1TWF K;  3GEI A;  2YH0 A;  4LR7 A;  2RDI A;  3UPF A;  1IXK A;  1F0X A;  3T1H F;  3LP0 A;  3HM9 A;  3R3T A;  2W7V A;  3RAX A;  2HQC A;  4NLX A;  4WTO B;  2YBV A;  4PQU A;  1DRZ A;  2VIH A;  2LEP A;  3X1L B;  4C4W A;  2XYG B;  2CFX A;  2D6F C;  3CDB A;  3M32 A;  4ZCM A;  4HL9 A;  2QRR A;  1NK9 A;  5K14 A;  2XSJ B;  2VOO A;  3H5X A;  3J81 j;  4NWB A;  4ZVR B;  4EBE A;  2ROG A;  3WIU A;  3MR2 A;  3VVT A;  5GAH U;  2UV8 G;  2WON A;  5KG1 A;  3W9I A;  2H5J B;  1TWG A;  3M05 A;  3OXG A;  1NSP A;  2VA2 A;  2MLX A;  2GJ2 A;  2AT1 B;  5L39 A;  1ULR A;  2IVF B;  2GO8 A;  3JTP A;  4ECY A;  5HL7 Q;  3MUV P;  3I4M C;  4K0K F;  3IGV A;  1YRT A;  1WEZ A;  4CLY A;  1SKS A;  5IM0 A;  4DZD A;  3NEK A;  2HHP A;  2DPJ A;  1LWE A;  3MR3 A;  5KFC A;  2DIS A;  4NXN F;  4ETZ A;  4LMZ A;  2R7S A;  4ZLN A;  5C44 C;  3IGN A;  3DOL A;  2YU9 K;  2DGQ A;  1R43 A;  2F9J A;  3GV5 B;  4UQG A;  1KTQ A;  4C8O A;  1TV6 A;  3OLB A;  3RG6 A;  3GJS B;  2EFN A;  2YKN B;  3TJ9 A;  5IV3 A;  5H9F K;  3GTL A;  3OV7 A;  2B6A B;  2KXH A;  3DOM A;  1SXL A;  3UFC X;  3N4W A;  3SCI E;  1YQH A;  4ZVP B;  3V2U C;  3K7A K;  4UTG A;  2FJD B;  2IAJ B;  3CCV S;  4JI7 F;  4C8M A;  3TFJ A;  2CQI A;  3T6J A;  3UCU P;  1KHV A;  1RTJ B;  3CJS A;  3BKU A;  3CCL S;  2DNN A;  3MAA B;  3VAL A;  3SYZ A;  5KFV A;  2CNO B;  2IMO A;  3GTQ K;  2DXF A;  1TWA K;  1U2F A;  3VTI A;  4RX6 A;  1IKV B;  1RBA A;  3DRP A;  3HFV A;  2J6S A;  2KJV A;  1D8Z A;  5IT9 U;  2VJU A;  3EVO A;  4ECR A;  1LOU A;  4AL6 A;  2J76 E;  2J8A A;  1T7P A;  4M1X A;  4Y2I A;  2MKJ A;  2IA0 A;  1XMO J;  3DLB A;  4PQA A;  3CD0 A;  3PO3 K;  5DG8 A;  4YFX A;  2EK1 A;  3I4N K;  1WCM K;  4DXL A;  2A2D A;  4ELT A;  1J6W A;  1NDP A;  1F7V A;  3IWX A;  3S14 K;  5B0G A;  2EC0 A;  3TUP A;  1KBR A;  2ZOM A;  3UI3 A;  2OIH A;  4XSX A;  4DSK A;  4K4U A;  3L7P A;  3TOQ A;  1F9F A;  4NPO A;  4QR0 A;  3QFH A;  4OIN A;  1FEH A;  1NEE A;  4F0H A;  1F9E B;  2UXD F;  2B5J A;  2BQR A;  2D3U A;  3QMQ A;  4QPT A;  2AJQ A;  2N3O A;  1S57 A;  1ZOT A;  4ZDN A;  4LF7 F;  3D5M A;  1TK8 A;  3M2V A;  3IBF B;  1RWU A;  2XSJ A;  1MN9 A;  1H7W A;  5AT1 B;  2C3P A;  3AHP A;  2AX1 A;  1VK3 A;  2CPH A;  3CQZ C;  1PC5 A;  1O26 A;  2QG9 B;  4UF4 A;  4DQS A;  3BBB A;  4B17 A;  3ZZZ A;  4C8N A;  1VIX A;  1KVI A;  2F9D A;  2IM3 A;  3GTP C;  2ADB A;  3C16 A;  4USI A;  2YNH B;  2IRU A;  5C7P A;  1PGZ A;  2JLG A;  1VBY A;  1OSC A;  5J2M B;  2BOP A;  1U0H A;  4CM2 A;  1VQL S;  2M88 A;  3L4K A;  3K5O A;  4A3B C;  4DQP A;  1H3D A;  3GTJ A;  4OZN A;  4OYO A;  4USW A;  2AD9 A;  2GHW A;  2DR7 A;  1JLF A;  3BR9 A;  1PCA A;  2ZOF A;  2JHE A;  4EO8 A;  2DXE A;  4MEX A;  4JI0 F;  3N0B A;  5IOL A;  1O0P A;  2QE5 A;  2XO7 A;  3GIJ A;  2HK3 A;  2J7W A;  3CNQ P;  4O4G A;  4DV2 J;  2R7U A;  1TKX B;  1FXR A;  4QZV B;  2F8H A;  1HHQ A;  3DGV A;  1FNM A;  2R8H A;  2R92 A;  4XLN A;  4Q44 A;  1T05 A;  4HHH A;  2IC3 A;  3DLK B;  3BM7 A;  4K4T A;  3DOK A;  1XC9 A;  2V8P A;  4K7Q A;  1LNQ A;  1L0W A;  4DV5 F;  4ELV A;  4NLP A;  4NLV A;  3L9Z A;  4DHV A;  2JC1 A;  2BE9 B;  4OX9 F;  4J37 A;  1OO0 B;  8ATC B;  1R0A B;  2AYB A;  1H2U X;  1CS4 B;  4Q5V A;  1OQ6 A;  1PYT A;  1Q8B A;  4ZOS A;  3H2L A;  3W5Y A;  4ILL A;  3DCA A;  3C15 A;  1BGX T;  2JA5 A;  3UWT A;  3B4D A;  2BAB A;  2JOQ A;  2RF2 B;  4ED2 A;  3ZZR A;  3T1Y J;  4ID5 B;  2PMH A;  4DR4 J;  3G6X A;  3OPK A;  3CC4 S;  1NJW A;  4I6W A;  2RU9 A;  2J6T A;  2W4D A;  3ZZU A;  4RWW A;  1YLX A;  4OL8 A;  3MED B;  5E3Q A;  4A3L K;  4BXX K;  1VC5 A;  2NXE A;  3QJP A;  3K58 A;  2DIV A;  4GVB B;  1G4C A;  1ELO A;  3IPJ A;  4F67 A;  2C3O A;  4C11 A;  3L4B C;  3FCH A;  5HRO B;  2W25 A;  4MEY A;  3IAS 9;  2GHP A;  1DCO A;  4O0N A;  4USJ C;  1USM A;  2R9L A;  1S0V A;  2K7J A;  2ROE A;  4PWD A;  1ZZF A;  3HX9 A;  1X31 C;  3H98 A;  3EMT A;  3ZNU A;  3QFW A;  3AJ1 A;  3HVT A;  4B3O B;  4DCP B;  2M8H A;  1YI2 S;  1TUG B;  3B8H A;  4MKY A;  3PFE A;  2NRE A;  4K5R A;  4WBF A;  5D78 A;  5JUM A;  4DV1 J;  2KKH A;  1S10 A;  4LIW A;  3ILJ A;  1SH3 A;  2Z0G A;  2QLX A;  1JLG B;  2Z4P A;  2IJN A;  1NH8 A;  2P9C A;  3AXM A;  1GQE A;  2RHQ B;  4CH1 A;  3P5T L;  3HXA A;  1RU2 A;  3DDN A;  3PZP A;  2XY6 A;  2HNY B;  5F41 A;  2ZZN A;  2HFV A;  1O27 A;  1SQE A;  5J1P A;  3NCP A;  2VFU A;  4S0M A;  2KZZ A;  2JH3 A;  3D1O A;  2CPZ A;  4Y0F A;  3DI6 B;  4KN4 A;  4MYU A;  1F2H A;  3P96 A;  2AZ1 A;  3JSM B;  2DO4 A;  1DTQ B;  2WB4 A;  4OLO A;  5KFW A;  4XLP A;  4HDH A;  1HBM A;  5D0H A;  3H0G C;  5BYS A;  4B3T F;  2ZEJ A;  1SC3 B;  2M5Y A;  2JX2 A;  2A1B A;  1LXN A;  4NCB A;  2KN4 A;  1F5A A;  4DR5 F;  1MN7 A;  5KT7 A;  3POT A;  3FSX A;  4YB7 A;  3VAJ A;  2CWX A;  3TA0 A;  3BF4 A;  4OZ5 A;  4X4T A;  1VBK A;  1XBW A;  4RW6 A;  3M4X A;  4M5M A;  3C19 A;  4C8K A;  2DD8 S;  2HHQ A;  3JST A;  3BH6 B;  4GKK J;  2Y1R I;  1YNN A;  2GSO A;  2IFX A;  2B7C B;  3CD7 A;  2LYV A;  2N3L A;  2ZFH A;  1RA7 A;  1LV5 A;  1U4B A;  3J7A N;  2QMU B;  5D4O A;  3JSY A;  1C0T B;  1HI8 A;  4O3P A;  3BSC A;  4M5D B;  4DPU A;  2VC0 A;  3GEH A;  1TWG C;  1JLE A;  1Y4Z B;  3M4O C;  3MPW A;  5IOT A;  1JOE A;  2JNJ A;  5CYM A;  3ZZ0 A;  3OJU A;  5AJ3 J;  4KJI A;  1TKT A;  3GMG A;  2XWX A;  2J0S D;  2VL1 A;  3G87 A;  3BB5 A;  2UXC F;  4LF8 F;  2J9C A;  3I4M K;  4JI2 F;  4JV1 A;  1S49 A;  2Z2Z A;  4XDD A;  1PJ6 A;  1R8H A;  1XJW B;  3Q0A A;  4F4Y A;  2FJA B;  4QPX A;  1T0T V;  5AXL A;  2OFG X;  4BBS K;  4NAS A;  4I7F B;  3T5L A;  3HHN B;  3NMA A;  4P72 A;  5M5Y K;  2ZDO A;  1TWC A;  3CJ0 A;  1J5O A;  1MG7 A;  4KAI A;  2BE2 B;  4OYM A;  3ZZP A;  1RU0 A;  1N88 A;  5E3R A;  1WC5 A;  5MAO A;  4RBU A;  2DHA A;  3RBD A;  1Y1W K;  4X4V A;  3V6H A;  3KK1 B;  4QIE A;  1VCT A;  5M5W K;  3TVY A;  1RTD A;  3JB9 k;  1NHV A;  3RZO C;  2OTJ S;  1RI7 A;  3EDR B;  1SFO K;  2MSS A;  1GEH A;  1MRO B;  1X9M A;  4GTB A;  4C3H C;  3MF5 A;  3M8P A;  1TKT B;  1C0U B;  1QM9 A;  1Y00 A;  2W4P A;  2IM2 A;  2QYG A;  1TL3 A;  3GTM C;  3UCZ P;  3NAH A;  4B3S F;  2HFZ A;  1GX5 A;  4CM0 A;  5LL6 d;  1SIZ A;  3R5G A;  2E5H A;  2DTJ A;  4MKB A;  1RWO B;  2F4F A;  4OI0 A;  3A4T A;  2V2Z A;  3NOC A;  2F1F A;  4ICL B;  1HLW A;  1TVR A;  1BD6 A;  1YZ7 A;  3C14 B;  2VPW B;  1WQG A;  2NVX C;  2QLB B;  3D67 A;  2XHC A;  2E5L F;  1NPK A;  4ENO A;  1X7V A;  5CYQ B;  3CDE A;  5KG0 A;  4DZ6 A;  5I3U B;  1VC0 A;  1PBA A;  3HUL A;  1AFJ A;  3GTG C;  2R8I A;  1U6F A;  1LWC A;  4DI6 A;  3AA8 A;  1JLE B;  3H0G A;  1H74 A;  1ZM4 A;  3CDA A;  4OZ1 A;  2QL9 B;  4TYA A;  2ZBI A;  3KUG A;  4PPD A;  3D0G E;  4J9P A;  4RW7 A;  2PT0 A;  2NZ4 A;  3WZ0 A;  3OSN A;  3OTD A;  3TZZ A;  1CJV B;  1RT3 B;  3J81 U;  1IBM J;  5KT4 A;  4ED3 A;  2LQB A;  4N8N A;  2D9O A;  3S1N K;  4DPW A;  4FXW A;  2JA5 K;  2V50 A;  1HWU A;  1UVL A;  2DH9 A;  3H3V D;  1UKU A;  1TKD A;  4WE1 A;  2V4R A;  1G51 A;  4FS1 A;  4BY1 K;  1XER A;  1U1O A;  2K1R B;  1ZPW X;  1SBR A;  1NDC A;  3NNH A;  2AJ0 A;  4YOE A;  4DUZ J;  1PJ5 A;  5IZH A;  4YG2 A;  2ZUE A;  1AZS B;  2MDA A;  3IG1 B;  5A6P A;  2W01 A;  3IAM 9;  1GMV A;  2MQP A;  5AE2 A;  4R25 A;  4CIO A;  3SBM A;  4J9Q A;  4F4W A;  2BX6 A;  2Z56 B;  3H7H B;  2IBO A;  3T5J A;  3OR2 B;  1V6H A;  4KGM A;  2X7I A;  3IN5 A;  2N7Y A;  2I8E A;  1VGY A;  4AUK A;  3IWL A;  2MHN A;  1VK8 A;  4OZL A;  2OP5 A;  4N56 A;  4P2F A;  2PE8 A;  3FZ2 A;  3W2V B;  2HWI A;  2AW0 A;  3IS9 B;  4DX7 A;  3ET6 A;  3DKD A;  1X4C A;  3WBZ A;  4ES3 A;  3FKI K;  1FRL A;  4NLY A;  4Y6I A;  1NSQ A;  4N8O A;  1XR5 A;  2RH3 A;  3VZH A;  2YKM A;  2UUC F;  2M70 A;  2CA9 A;  5B0C A;  2H4Y B;  5K8P A;  1KQS R;  2UU9 J;  1Y5N B;  4HR2 A;  1A0O B;  1ACM B;  1I3O B;  4CLZ A;  1EI6 A;  1PIE A;  1S7I A;  2A6O A;  3KJN B;  1GMU A;  3SIP B;  4X6A K;  3D6H B;  3V4I A;  2JRS A;  4ZIV A;  4OV6 A;  1MU2 A;  4DL4 A;  3NUH A;  2RUS A;  4L74 A;  3KJF B;  2RU3 A;  4LRD A;  3EJM A;  4G7H A;  3UDC A;  2AIR B;  3A3O B;  3VQT A;  1TL4 A;  3KJV B;  4NEY A;  2MKC A;  1HQU B;  2OI2 A;  2KDO A;  4OJG A;  1PJ7 A;  1U1K A;  1C0A A;  2CPJ A;  3PV8 A;  2FZG B;  1YGY A;  2NCK L;  2AGQ A;  4I2Q A;  1S99 A;  4J9M A;  3GE9 A;  2XC9 A;  2HLT A;  1VIS A;  3Q24 A;  3HOW K;  1PSD A;  1X9S A;  1T9X A;  2LQ9 A;  3QX3 A;  4OI2 A;  3Q2T C;  3QO9 B;  1BQN A;  2DGV A;  1YX2 A;  1FJ7 A;  4U95 A;  5AE1 A;  3ELH A;  4ZVQ B;  2PHC B;  2I1R A;  2XHW A;  5G0R B;  2YKM B;  3K5N A;  1MW7 A;  1Y1V K;  1GMW A;  1ZM9 A;  1UWA A;  3E51 A;  3B54 A;  2JEI A;  2NPI A;  4FDF A;  2J0Q D;  1WC0 A;  3U27 A;  4A3F K;  4A4J A;  5LSL A;  1GX6 A;  2NUU G;  4N5S A;  1YJU A;  2P9E A;  3HOX K;  3PYG A;  1P9Q C;  5F8G A;  2CQH A;  2UZA A;  3B82 A;  2ZC3 A;  1N8R T;  1HWI A;  1FD2 A;  3HXM A;  1VRU A;  4RMF A;  3GYN A;  4KC5 A;  3PJW A;  3EDQ B;  3UDL A;  1C0U A;  3WX8 A;  4J9V A;  4GVB A;  3ZC4 A;  3RZD K;  3AOC A;  1LWE B;  2B63 C;  3S1M C;  1PYO B;  3TQE A;  5HJY A;  3R5C A;  4DV7 J;  1RTI A;  4YQW A;  1E6Y A;  3UNG C;  1UVM A;  1NJZ A;  3FMB A;  3K59 A;  4KO0 A;  2E29 A;  3NCQ A;  5DQH A;  4C48 A;  5SZT A;  3G4A A;  2RQC A;  2BRK A;  5CQG A;  2NS1 B;  5CYM B;  2IC3 B;  2W2M P;  1O8B A;  4DF4 A;  2GS8 A;  1U1P A;  3OUY B;  1RWP B;  3NS7 B;  1I3Q A;  2OGU A;  3GON A;  1SJ3 P;  4YS2 A;  3TAM A;  2YNF A;  3EIC A;  4Y2A A;  1S5Z A;  1RCX B;  4ANC A;  2B9E A;  4K0K J;  4V1A k;  3P8B B;  1FNX H;  1CG2 A;  1UWB B;  3FMW A;  2P2C B;  4V19 X;  1K73 T;  2O1P A;  4X4Q A;  4TVA B;  2BE2 A;  4ECS A;  3SZ2 A;  1RAC B;  2ROP A;  2ZNY A;  2QV6 A;  2MXY A;  1RYS A;  3HD2 A;  5HRO A;  2HND A;  5KFQ A;  4OHY A;  1VOM A;  3DRS A;  3LOU A;  4XPE A;  1VJQ A;  4RZR A;  3GIR A;  4Y34 A;  2EFQ A;  3GFZ A;  2HLU A;  2AGO A;  2K06 A;  1QD1 A;  4J9U E;  5HJX A;  2IBK A;  2WW8 A;  3M3Y K;  3MEG A;  5J1N A;  3LP2 A;  1S4E A;  1B4B A;  1F2G A;  2AEJ A;  3ILL A;  4ZP8 A;  2QA1 A;  3V4M A;  2ZH1 A;  4OX7 A;  1S6P A;  2M2B A;  4KHR A;  1FFS B;  4KQZ A;  4ZP6 A;  1WEX A;  1S12 A;  2XMA A;  2GSU A;  4LJM A;  5AXN A;  1PAE X;  4XPC A;  2VA3 A;  1C1C B;  2V63 A;  4C8L A;  1W2B R;  5KT2 A;  2I2Y A;  3CB4 A;  1M90 T;  4NOI A;  1IQZ A;  1U0H B;  2BXJ A;  3FQL A;  2YPY A;  1VRT B;  3G8T A;  1LK5 A;  1BY9 A;  4OHX A;  1N0U A;  4R8U A;  3BH7 B;  5THW A;  4DPX A;  3QSY B;  3A8K A;  3PO2 C;  1SC6 A;  4YN3 B;  5CH7 B;  1GFW B;  4RNO A;  4WP9 A;  1YNJ A;  2RQ4 A;  4DMZ A;  3TX8 A;  3HZE A;  4ECT A;  2EG2 A;  3CGI A;  1FE4 A;  3RU0 A;  3DI6 A;  3KXD A;  3IR7 B;  2HHH F;  1D1U A;  1S4F A;  3I4P A;  1SKU B;  2MGZ A;  5LSR A;  4H4M A;  3FRY A;  1TV6 B;  1KWM A;  1R0C B;  4DR1 J;  1WC3 A;  1UA0 A;  2R7X A;  2DHG A;  2MPU A;  2KFY A;  2HMI A;  3W2W A;  3EXC X;  3NBP A;  1REV B;  2B6A A;  5F8M A;  1KON A;  2YWW A;  1EZZ B;  1NKB A;  1DQ9 A;  3FJ2 A;  1F93 A;  4WFZ A;  4WP3 A;  1QAI A;  2CQB A;  5FLX Y;  1EB0 A;  3L4J A;  5LJ5 Y;  1U1M A;  5DLF A;  2DO0 A;  2RE1 A;  3AOA A;  2C28 A;  1IWG A;  1R8C A;  4RR5 A;  1SI9 A;  3GG1 A;  2KG0 A;  4QIF A;  3RAQ A;  4JI6 J;  3S16 C;  1W7W A;  2VAS A;  1RT2 B;  1AB8 A;  3N5F A;  4NMX A;  2DCU B;  2R2T A;  4DCJ B;  2MB0 B;  2D41 A;  4DV1 F;  5E2Q A;  4IFY B;  4WWS A;  3QZ8 A;  2E9R X;  2ZH6 A;  4ID8 A;  3TZY A;  2CFA B;  3NCR A;  2O01 C;  2BE5 A;  4B3S J;  3DXB A;  2C2M B;  3K7R A;  4ID5 A;  3QWP A;  1U2R A;  1NHU A;  4WK3 A;  5KFK A;  3I5B A;  3M2R B;  1F9H A;  2WOM A;  4LQY A;  4DSL A;  3UR3 C;  3U1M A;  3MDF A;  2ABY A;  1SKW A;  1VQO S;  1EAY C;  2DNG A;  5F3Z A;  1U6B A;  2E7X A;  4CO4 A;  4IRD A;  4RW8 A;  3V81 B;  5D4N A;  2MJU A;  4DG1 B;  3EM1 A;  4LF7 J;  3CJ3 A;  2JEG A;  3LWM A;  3MEE A;  1IBK J;  2PSZ A;  4OYB A;  2O67 A;  1BE4 A;  1UJ6 A;  1Y10 A;  3ITH A;  5C2G A;  2IA6 A;  2OEM A;  4AND A;  5KFL A;  5J1E B;  4IDK A;  1GXU A;  3VAK A;  2MKY A;  1BWE A;  3H4B A;  2JC0 A;  2JA7 K;  2VKZ G;  4QOT A;  3W65 A;  2RB7 A;  2QSF A;  5J2P B;  1S76 D;  5C5J A;  3BGR B;  2JSX A;  1WQF A;  3J7Y I;  4R5P A;  1JQG A;  3ENW A;  3WDO A;  3D6F B;  3IBC B;  1YJT A;  3CCT A;  1RUS A;  3GTG A;  2DIU A;  4X66 F;  4DJB A;  3HOV K;  1WG5 A;  4EYI B;  1DCP A;  3KFW X;  2A6M A;  1P9Y A;  1SL2 A;  1B4A A;  4BKW A;  1J2V A;  3PIP Q;  1OIA A;  3H4D A;  2YWF A;  4LSN A;  1MSW D;  2CQ2 A;  2G0J A;  3GB0 A;  4I2P A;  5ETO A;  1TFY A;  4IFV A;  1W2I A;  3GPA A;  1O6X A;  4CO1 A;  5I42 B;  2HHH J;  3FKB A;  4MK7 A;  1S9G B;  2VOD A;  2D74 B;  3FZB A;  1Z2Z A;  3AJD A;  2CJK A;  4QU7 A;  2HQ3 A;  4B3O A;  3CSK A;  3ISN D;  2HEK A;  4AQY J;  1TWA A;  5HP1 B;  4EMD A;  1XNR J;  1AB4 A;  4ZLP A;  5DQG A;  4L75 A;  4DSJ A;  3D0H E;  1KQ4 A;  2QMW A;  4Y2M A;  3FBE A;  4MH8 A;  3AA9 A;  3ICL A;  1J5O B;  5J2Q A;  2F63 A;  2R7O A;  1ZA1 B;  1IQT A;  4C11 B;  4DLE A;  2W7A A;  3CCS S;  3MMA B;  4K4Y A;  2XMW A;  1NSA A;  4F2S A;  1FRX A;  2B8P A;  4F36 A;  1N6Q A;  2WB1 L;  2W9A A;  3H42 A;  3FKI C;  4MKV A;  4AYB D;  5IWA F;  1RHQ B;  2DIT A;  3UDV A;  2IYI A;  2R92 C;  2PFD A;  2XGP A;  1QAX A;  5GAD I;  4FKY A;  1HBU A;  5T41 A;  4LF4 F;  2KTQ A;  2IM1 A;  2ZJQ Q;  4G1Q A;  3HHL D;  2VHG A;  2GJI A;  5TJ3 A;  4CLK A;  4K4V A;  5IYC K;  4ZPA A;  4F0K A;  3W62 A;  4LFB J;  1EAR A;  5HQM A;  2DGX A;  4QR1 A;  2CUY A;  3PKM A;  4ZIT A;  2QA2 A;  1MML A;  1K47 A;  1KTV A;  3AFG A;  2WBM A;  4QCL A;  1RHU B;  1N0V C;  6FDR A;  3M6X A;  2CJQ A;  3BUE A;  2XEX A;  2WW4 A;  4ANE A;  1EP4 B;  5CD4 H;  4TY9 A;  5CCM A;  4HAC A;  1ZM3 A;  3LA0 A;  4RUC A;  3SCK E;  1I50 C;  4UT4 A;  4J91 A;  4RW6 B;  1OPI A;  1XNQ F;  1JKH B;  2QFI A;  1VC6 A;  4BCA A;  5K9F A;  5IYB K;  4R5P B;  4KKO B;  3Q23 A;  3MFH A;  5A8K A;  2MZT A;  2MST A;  1NPR A;  2ZHO A;  3W64 A;  1SQF A;  5SUH A;  4A3K K;  2MZS A;  5IXU A;  1RAJ A;  2LXI A;  4L73 A;  3N01 A;  1GMW D;  4EZ9 A;  4DS5 A;  2KH9 A;  2WAQ D;  4CLP A;  1RA6 A;  3C3L A;  5LMU J;  1REV A;  1HD0 A;  2ZUA A;  2CDR B;  3VA7 A;  4KC6 A;  1QVF R;  1JLB B;  3VAF A;  2JFD A;  3MHY A;  1WKL A;  1LW0 A;  1Q7Y T;  5D0E A;  1G3O A;  1U2C A;  1R9T A;  2OSR A;  3RGI A;  3GJT B;  2PMW A;  2Y3Y A;  4CLL A;  1VMB A;  1RWN B;  1XXA A;  1QUP A;  2AF6 A;  1UW9 A;  2OO4 A;  2OMO A;  1LXJ A;  1HPZ A;  1EH1 A;  4ED6 A;  5L1L A;  4LIR A;  1HW9 A;  3QGG A;  3O3L A;  1TAU A;  3LF0 A;  2DGO A;  2XY5 A;  1X4D A;  4GKK F;  3MAH A;  1VBZ A;  5KFP A;  4BWM A;  2P5V A;  3HHL A;  3OD2 A;  1VQ6 S;  2UVU A;  4LR2 A;  2HQG A;  4LFA J;  2ZUF A;  4FM9 A;  3S15 C;  4NXM F;  2KXF A;  3G6Y A;  4DL6 A;  4IH5 A;  3GTJ K;  2QO3 A;  5JVH Q;  3KUE A;  4DN0 A;  4CNZ A;  4FXV A;  2R7Z C;  2HFN A;  4CTA A;  2FC8 A;  4NOH A;  2ILZ A;  2XS5 A;  1REG X;  1IN0 A;  1S72 S;  4DV7 F;  2E2J C;  1M5H A;  2NLW A;  2MKS A;  3W2W B;  2HMI B;  5FJ4 A;  2PC6 A;  2NVQ C;  1G6B A;  1BJT A;  2FUG 9;  4DV4 F;  1XR7 A;  3VAG A;  2HWH A;  5RUB A;  2XSF A;  1AUD A;  3POT B;  3G71 S;  2GIQ A;  3PW7 A;  1Q82 T;  3OFE A;  4IR1 A;  1RLD A;  2RHS B;  3PHE A;  3H25 A;  2RT3 A;  4U6P A;  4KGZ B;  1APS A;  2QX0 A;  3GIM A;  2MMY A;  1EET A;  3UD3 P;  2R8J A;  2XNQ A;  1I6H C;  1RWV B;  2B3T B;  4UST A;  3FC9 A;  4A3G C;  4LR9 A;  4M5K A;  3GQC A;  1IKY A;  1FKP B;  5C42 A;  3CJ5 A;  1RAD B;  2BJ9 A;  3L09 A;  3ENA A;  3J7Y U;  3WC2 A;  2EBE A;  1Q53 A;  3M6V A;  1T9U A;  4QWD A;  2ZM6 J;  1IBL J;  3R7B B;  2IM0 A;  3THP A;  4LF6 J;  3H5U A;  2RQM A;  4MIA A;  2RKI A;  1S79 A;  2A6E A;  1S77 D;  1RQ0 A;  1N36 F;  1SFO A;  5DZ6 A;  4C0H A;  3AQP A;  4AL7 A;  2J7U A;  1SJQ A;  1WOR A;  1CJU A;  1KR4 A;  1DQA A;  1WHW A;  3SEO A;  2ZE2 B;  4A48 A;  1CQN A;  2AGP A;  2B4O A;  4YHH F;  3R5A A;  4LRE A;  5BYQ A;  2VFS A;  1H2T Z;  4U96 A;  3M8Q A;  5BYR A;  2DGW A;  1WOP A;  1R8P A;  5CAA A;  2VZ9 A;  4URQ U;  4J9O A;  3Q8U A;  3TO8 A;  4KHP J;  2QLW A;  1WG4 A;  1Q79 A;  1S6P B;  3DRR A;  2IY5 B;  1FJC A;  3PRB A;  2N82 B;  2IIH A;  3BN4 A;  1I51 B;  3OFG A;  4J9N A;  3P45 B;  3IM8 A;  4KSE B;  2VC1 A;  5CZX A;  2QLF B;  4OYA A;  1TL7 B;  2XZW A;  3LAK A;  8AT1 B;  1YJN S;  2RS2 A;  2CJB A;  1DQ8 A;  1USO A;  4DR1 F;  3R27 A;  3MMC A;  2FQO A;  1V3R A;  5E5N A;  3A8I A;  1HNW F;  2QC3 A;  5KFX A;  3C16 B;  1WCM A;  1HBU B;  1Y5I B;  3EYZ A;  2G1H A;  2XTJ P;  4A3J K;  3S6E A;  3THV A;  2H65 B;  3NGS A;  3G4S S;  3UN5 A;  3ZTO A;  4C8Z A;  3K5P A;  1NB2 A;  3KK2 B;  1J5E J;  2L9D A;  1VRQ C;  2XG8 A;  2PA8 L;  4ILD A;  1H7X A;  5J2Q B;  2HZV A;  2IMW P;  3V5R A;  4Y3C A;  3HK2 A;  5LJ3 Y;  4J9R A;  1N52 B;  4UOF A;  4ECV A;  3TVK A;  4JI3 F;  2Y1I A;  1INN A;  3I82 A;  1WAC A;  4YB1 P;  3GJR B;  4PG5 A;  3DN9 A;  1FRI A;  1TP7 A;  3TAM B;  2LVW A;  1TUV A;  3I6P A;  4FF1 A;  3R5D A;  3BKF A;  2RIJ A;  3B6B A;  3NP5 A;  1MMD A;  2D1C A;  4FP9 A;  3U02 A;  2BR0 A;  2CPY A;  1S9F A;  4OYP A;  2O66 A;  3EGZ A;  1A6L A;  4WFA Q;  4F04 B;  4CZC A;  3QO9 A;  1HBN A;  3MM8 B;  3CJK A;  2HGL A;  2R8G A;  4DFP A;  2ZM6 F;  1XWL A;  2DNZ A;  2RS8 A;  3MCO A;  3PW2 A;  3M8Y A;  1J6X A;  1P27 B;  2V8H A;  5IT4 A;  3T41 A;  2C3M A;  5HMX A;  1URN A;  2DNP A;  1SMY A;  3DNC A;  4NRU A;  5A0Y B;  4KAT A;  5KFR A;  2HHT A;  2V6S A;  1CUL B;  3QLH A;  4N76 A;  4RU9 A;  3QNW B;  2UUA F;  4PUO A;  1WSR A;  3W8G A;  4WXO A;  1VQ9 S;  1RT4 A;  1ZA2 B;  5IV4 A;  2P5M A;  4PPZ A;  2C2K B;  1HNV A;  5HVH A;  4M5I A;  1FD8 A;  3KG0 A;  2C2Z B;  3EX7 B;  1HQE B;  4FKX A;  4ZJL A;  1ZPV A;  2IRY A;  1SL0 A;  2ZD1 A;  3HJF A;  2F40 A;  4G6V B;  2I38 A;  3JAM Y;  3S2D C;  2ILY A;  3GTM K;  1HMV A;  4FPI A;  2FQT A;  1RTI B;  2U2F A;  1KLN A;  5E3A A;  5E3P A;  1WD6 A;  4NML A;  2F3J A;  2BRL A;  1NK6 A;  3VVU A;  5L9N A;  4E2F B;  2C2E A;  4PYD A;  4LBH A;  3DYA B;  4DV0 F;  3AY0 A;  3H0P A;  4JP8 A;  2FVQ A;  3KLI B;  1XZP B;  4KFB A;  2VPX B;  3SZZ A;  1IKW B;  1FRM A;  3TX0 A;  3DLL Q;  2ZH8 A;  1VH2 A;  1D9F A;  1KC8 T;  3QPI A;  4H4O B;  2I5J B;  1UJ4 A;  3V4I B;  3GJQ B;  2QA4 S;  2WHO A;  3IO1 A;  5L1I A;  3QWU A;  2CQP A;  2X1B A;  4H4K A;  1KSP A;  3BDE A;  3TEH B;  2XB2 D;  5HQL A;  3MTK A;  2CJA A;  1ZTW A;  1YBT A;  4ZPV R;  3RW7 A;  2KHD A;  1Y1V C;  5KFH A;  1I1G A;  2BBE A;  4UOH A;  1YJV A;  4LQ9 A;  3G6V A;  2RDD A;  4OIP A;  1NDL A;  4DR6 J;  1U24 A;  2UU9 F;  1MLA A;  1QJH A;  1WQH A;  3HCX A;  1TWC K;  2W8K A;  4YR2 A;  2X3D A;  1Q1K A;  3CJT A;  4CP5 A;  3ILO A;  2I6W A;  3HFZ B;  1YIJ S;  2GQC A;  1V9O A;  2ZBC A;  4B9L A;  4FYW B;  3CJ2 A;  4KR0 B;  3JS9 A;  1YRU A;  4OYZ A;  4O44 B;  3K2Y A;  5IC6 B;  3GG0 A;  4B3R F;  3MAQ A;  1EKR A;  4OIO A;  4OI6 A;  2NSB A;  2E1C A;  4OX6 A;  1K1S A;  3KG1 A;  4PQU B;  3FGV A;  1YDL A;  3KLH A;  4P52 A;  3IBW A;  4UY8 5;  3M1V A;  3F0N A;  4IH7 A;  3T1H J;  1WC6 A;  4DUT A;  2QSW A;  5M2U A;  4CYU A;  4FYV B;  1OYE A;  2HK2 A;  1Y3J A;  4KV8 B;  3OJS A;  3SQG A;  1S1T A;  1H73 A;  1BHN A;  4G1I A;  1XQI A;  4GZY A;  3CJ4 A;  3K5L A;  1VBX A;  5EX0 A;  3PR4 A;  1IR0 A;  4ECQ A;  1TTH B;  1TVR B;  2W8L A;  1FO1 A;  4WYL A;  3HOY C;  5HBM B;  2FVS A;  2HAI A;  4LF2 A;  1TQL A;  3HF5 A;  4QYZ J;  1JX4 A;  5H9E K;  4LF5 J;  1GAO A;  2BKN A;  3DLE A;  3P4U B;  4UUX A;  2J9E A;  2OAU A;  4GO7 X;  4F3M A;  4GC7 A;  4Q2M A;  5T7L A;  1EQR A;  4ZCI A;  2CW0 A;  2MLZ A;  4WIQ A;  3RBZ A;  5C4J C;  5IM0 B;  4P10 A;  3LO3 A;  3UD5 A;  3SCJ E;  3R1L A;  2NVT C;  3EZO A;  2ADC A;  4EI2 A;  4KB4 A;  2VBZ A;  2XYH B;  4H4M B;  1IBK F;  1O2B A;  1YKW A;  1Y0H A;  3ZZY A;  1KQF B;  3VWS A;  3CD5 A;  2L08 A;  4YDD B;  2CQ0 A;  1SCJ B;  2XCP A;  2AU0 A;  1WI8 A;  1UJ5 A;  2EVZ A;  2L3M A;  4J90 A;  3C66 A;  2J9D A;  2JWN A;  3HD1 A;  4KBI A;  2VBY A;  4A3M C;  2R93 A;  4DL5 A;  1R0A A;  4JOU A;  3MEG B;  4KGK A;  4O44 A;  3S1T A;  3I87 A;  1WTF A;  4YFK A;  1U25 A;  4A8Y A;  2DJW A;  3UCG A;  3VAM A;  4IQM A;  4U7C A;  3OXL A;  5T7L B;  2H54 B;  2OEK A;  1UZH A;  4OIQ A;  2YU9 C;  3EPI A;  1T94 A;  4JI6 F;  3MMJ A;  4F26 A;  3GTP A;  1IKW A;  2YKQ A;  2E2H K;  2F7V A;  4I1T A;  4IQX A;  4EGL A;  2WSF C;  5ETN A;  4DSE A;  3BKT A;  4B3R J;  2E1A A;  1TK5 A;  4ZP7 A;  1N32 J;  4HHJ A;  4M5L A;  3KJV A;  2YNF B;  4UUW A;  2WVD A;  2OHD A;  3CJQ A;  5DZ7 A;  1V3S A;  2E9Z A;  1UTA A;  4YUD A;  2MQQ A;  4NYZ A;  3RB3 A;  2HVE A;  1Y1V A;  1KLM B;  2FC9 A;  2CYY A;  3M7V A;  3A13 A;  2UP1 A;  1T9Y A;  4QWC A;  3BYR A;  3MAA A;  5L8R C;  3OHB A;  2FJE B;  1S6Q A;  4L76 A;  3GTQ C;  5E68 A;  4E8U A;  3EUN A;  3FOE A;  1JLQ A;  2LQJ A;  1R8B A;  3LGH A;  2JVO A;  4L3K A;  4K4X A;  1NU4 A;  5EN1 A;  5GMD A;  3UN3 A;  3CJR A;  4KGX B;  3QGI A;  3RW6 A;  1VQP S;  2A3J A;  2HAF A;  1RWM B;  3ZTQ A;  2V67 A;  2G0I A;  1FKO B;  2VQF F;  2NVY C;  2A0F B;  1RCO B;  2WTF A;  5H1S V;  2YWE A;  4CCH A;  3A3N B;  4KFB B;  4IG3 A;  3MOJ B;  4B9N A;  2HHU A;  1FK9 A;  4YP3 A;  4LK0 A;  3T01 A;  2ZHB A;  4B9M A;  2C1E B;  4RW7 B;  4NLO A;  3T1A A;  3PG9 A;  4QU6 A;  3KHL A;  2JA8 K;  3BGR A;  2ZFZ A;  5F9N A;  1LFP A;  3BQ2 A;  3NL0 A;  4OI4 A;  1HNZ F;  4I6Y A;  3I96 A;  4I0W A;  3VQS A;  5D8H B;  1JJC B;  2HHV A;  4OX9 J;  4B08 A;  5TMC A;  2HSE B;  3MZI A;  4K4W A;  3EXY A;  4OX8 A;  3MEE B;  4A3D K;  4OZ2 A;  1SV5 A;  5CAB A;  4RW9 A;  3FBB A;  1AYE A;  2YXL A;  3OR1 B;  5DM7 Q;  1IKX B;  4IR9 A;  4U9R A;  4RW4 A;  2CZ4 A;  1S48 A;  4ZS6 A;  5IOQ A;  3HMJ G;  3NAI A;  3KWM A;  4ZVG A;  3M8S A;  4F3Q A;  4DQQ A;  2MZQ A;  1RAB B;  2DNR A;  1Y3K A;  1BUX A;  2AJ1 A;  3MPY A;  2H5E A;  3K57 A;  2VFV A;  3DDK A;  1TR0 A;  2W9C B;  2E2H A;  4DV6 J;  1TKZ B;  1U1L A;  4GTE A;  4ZH4 A;  2GIR A;  3OVB A;  4B3T J;  4YME A;  3RB6 A;  1TL7 A;  3MWB A;  3CDW A;  2CG4 A;  4DR5 J;  3T3F A;  2GSN A;  2B43 A;  2BJ1 A;  2XNR A;  2JEJ A;  5DM6 Q;  2OSQ A;  2FGC A;  3QAT A;  4I56 A;  1R27 B;  5JVO A;  3F56 A;  3DLK A;  4YR3 A;  4KGV B;  2VF3 A;  2QTW A;  3HOZ C;  1TL1 A;  4X62 F;  4NLG A;  1F7U A;  4DR7 J;  1RT4 B;  2DY9 A;  4IKA A;  3G82 A;  5AE3 A;  2MY7 A;  2XMJ A;  2PI5 A;  5B0D A;  2YTC A;  3N28 A;  2Z2Y B;  1K0V A;  3UN2 A;  4A3E K;  2IVY A;  3RR8 A;  3OTO J;  3BSA A;  2YU9 A;  4R0J A;  1I3Q K;  4NA3 A;  1D8Y A;  4K4Z A;  1PYS B;  3PYD A;  3M8W A;  3BPS P;  2Y0S L;  5DS7 A;  1RU1 A;  3CQZ K;  3C8Y A;  2GVZ A;  3GTK C;  4ATN A;  2V4Q A;  3JXO A;  2LQ5 A;  1XMQ F;  5KT6 A;  2AKW B;  4A3C C;  2SXL A;  3Q8P B;  2YX4 A;  1VRT A;  4I2P B;  5BR8 J;  2KVI A;  4TU7 A;  2HRU A;  4KAR A;  1BLU A;  2Z58 B;  3KK3 A;  1X0F A;  2Z2M A;  2NPF A;  3DGP B;  5IP7 C;  3DM2 A;  3CC2 S;  1S1W B;  4CLW A;  2R3V A;  3OLA A;  3D9B A;  3R6L B;  3BP8 C;  2BKP A;  2HZC A;  1WEY A;  4QR2 A;  4NYO A;  2UXC J;  1RAI B;  5KFF A;  4DL2 A;  3CJK B;  4R0E A;  3WQP A;  1WC1 A;  1TWF C;  1JLA A;  5ETP A;  4PR6 A;  4WCE Q;  3S17 C;  2DNY A;  3RBE A;  1RTD B;  5DG7 A;  5B7W A;  1WEL A;  2DR5 A;  1N32 F;  2OUG A;  2Z30 B;  4M5N A;  3NNA A;  1TU0 B;  2KM8 C;  4YFN A;  2CQG A;  3QAE A;  2AX0 A;  1M1H A;  3R9L A;  3P3D A;  1J27 A;  4GTD A;  4M5H A;  1NJX A;  2J5A A;  4O3N A;  2WZ1 A;  3EGW B;  3QIP A;  2VPZ B;  4PYA A;  5F8I A;  5KFJ A;  4Y52 K;  3D0I E;  2HWT A;  2GNK A;  1Q8L A;  1FXL A;  2YNI B;  3FQK A;  4BBR C;  1IJE B;  3AJ2 A;  3FUY A;  3Q8Q B;  5HP1 A;  5FLM K;  5BJR A;  2KI2 A;  2U1A A;  4JV5 F;  2GVZ B;  2JLF A;  2XLJ A;  3N9U C;  4RL1 A;  2VV5 A;  4FBU A;  3EGN A;  1ZYR A;  3CMA S;  3GTL K;  4DV4 J;  2BE7 D;  3QT7 A;  3K17 A;  4QIW D;  1K83 A;  3HKZ D;  1BWV A;  4KTQ A;  1T8E A;  4J9K A;  1HR0 F;  3NGR A;  1B3T A;  2VDI A;  2OH2 A;  2F4V F;  2O5J A;  3HVT B;  1VDH A;  3CCW A;  1FHT A;  1UL3 A;  5D4P A;  3I55 S;  3CD6 S;  4LF5 F;  5KG5 A;  3TR5 A;  3Q3Q A;  1VHI A;  4LVN P;  1KKH A;  2FY8 A;  3T02 A;  3ILI A;  3PFO A;  1WIH A;  5G4D A;  2HS0 A;  2FHO B;  5J2N A;  4ELU A;  4F4X A;  2H9Z A;  3P49 B;  2EBG A;  4MIB A;  2KFN A;  5I4M A;  1Y7P A;  3R7S B;  4X4S A;  2FHJ A;  5HN0 A;  1JK9 B;  1QLN A;  2HBQ B;  4C3J C;  2P9G A;  2ZD1 B;  3AOB A;  3S01 A;  4YY3 J;  1N4L A;  2JEF A;  2MEW A;  1WKK A;  1SJ4 P;  3KLH B;  2OPS A;  3U1N A;  2H3E B;  4KIA A;  1DTQ A;  4BY7 K;  2R7Z A;  4YB6 A;  1R0B G;  5A6W A;  1IVZ A;  2FLO A;  4KH1 B;  2RML A;  3QRQ A;  4RU2 A;  1E6V A;  4P2M A;  3HJV A;  2E1M C;  3HHE A;  3BJY A;  2KO1 A;  2OPP A;  2FIU A;  1F5C A;  1T9W A;  3BRE A;  1IQ0 A;  5D77 A;  4XSZ A;  5CD4 A;  2NUH A;  2R8K A;  2EFP A;  1SKR A;  3TFI A;  1N5S A;  4OYW A;  3QQC D;  3IXQ A;  1T3O A;  1RWK B;  4ZCK A;  1M5V C;  4DBQ A;  5GMK a;  4IYQ A;  1ARO P;  1HPZ B;  4LF8 J;  4QW9 A;  1Q81 T;  3D4J A;  4JI4 F;  4JI5 F;  1RT5 B;  1FCA A;  5ETV A;  5GME A;  1EQM A;  3JYT B;  2V6T A;  2HPU A;  4CQ1 A;  4A3B K;  1NM2 A;  1AW0 A;  1DJ0 A;  1U7L A;  1U8S A;  1WG1 A;  4U7U K;  4PUO B;  4Y7N K;  1RTH A;  1NK5 A;  3MUM P;  1OWX A;  4FXD A;  3DHX A;  1ISE A;  4FF4 A;  2HBR B;  4L72 B;  1NB7 A;  3LGM A;  4A3F C;  1QAY A;  1S7H A;  3CF5 Q;  3NBP B;  3HOX C;  1UFW A;  1R9T K;  1A9N B;  4RBT A;  2F8E X;  5IOR A;  2L9N A;  4B9S A;  2W2N P;  3AXK A;  3V6K A;  1JMT A;  2DY1 A;  3Q89 A;  5DDO C;  1RT6 B;  3RZO K;  3BV8 A;  1D9D A;  4OMF G;  2XMT A;  4OHZ A;  4DPT A;  2GMH A;  3JSR A;  1V3Z A;  2DT9 A;  5AXK A;  4HHU A;  1L3K A;  2EK6 A;  4OI3 A;  2BM0 A;  2DNK A;  4NLW A;  2EBB A;  1VIO A;  3K7A C;  2LEC A;  5K20 B;  4LSN B;  2UUW A;  1TAQ A;  2GJF A;  1R6V A;  4A3J C;  2BA9 A;  5B0F A;  3MEC B;  2D3O R;  1YRX A;  5E41 A;  1OYD A;  4A46 A;  4Q5S A;  1RZM A;  1TZ0 A;  4DLG A;  3W61 A;  4P71 A;  2H51 B;  2YNI A;  3GTQ A;  1FVS A;  1IJF B;  4FYD A;  3MFI A;  3NMR A;  4W4M A;  1IWA A;  3AH6 A;  3A3P B;  5F8L A;  1IBM F;  1TEL A;  5M3F K;  2JA7 A;  1HNX J;  2AEF A;  3RB0 A;  1IBA A;  4CDI A;  1XIQ A;  4ZMM A;  3J80 U;  2X51 A;  3LW5 C;  1DLO B;  2V4J B;  3PJ9 A;  4DUY F;  3BO3 A;  4A8Q A;  2NVY A;  2E5I A;  3CC7 S;  4GC6 A;  3PTW A;  4RPF A;  1HNZ J;  3DOK B;  2CAD A;  1FT8 A;  1K83 C;  3UDE A;  4PCQ A;  2NSC A;  1LWC B;  4KM8 A;  4QJV A;  3CCM S;  1WCM C;  5DG9 A;  2UUA J;  4KMD A;  1H6K X;  3J7Z T;  1N54 B;  1RWW B;  2W1B A;  1S9G A;  1DAR A;  2ZBP A;  2XBP A;  4TQR A;  2ALY B;  4IG0 B;  4M5G A;  5ADZ A;  2JA5 C;  4X4P A;  4J3N A;  3TYT A;  2CJ9 A;  4O4G B;  2AWZ A;  3CXC R;  2KRB A;  2A2C A;  4K2J A;  2X1G A;  1MWZ A;  2DNL A;  5L1K A;  2DR9 A;  4M8L A;  5KFM A;  2A6H A;  3KK3 B;  1BDF A;  3O5T B;  3BSN A;  3MPV A;  2V94 A;  5D4D A;  3W60 A;  3TW0 A;  3NXZ A;  1UZD A;  4IRC A;  3PO5 A;  3HPO A;  4Z37 A;  2CNN B;  3TAN A;  3H8Y A;  4FS2 A;  1KVJ A;  4WU3 A;  7FDR A;  2GGP B;  1U45 A;  3BQ1 A;  3GTP K;  1VS3 A;  3L3C A;  1KDN A;  2OML A;  1N34 J;  2DRB A;  1G1X A;  3CQZ A;  1RKI A;  4A3I C;  4PKD B;  4LJZ A;  3ZTP A;  5IP9 K;  2PII A;  1FI4 A;  3Q22 A;  3K0J A;  1RT1 B;  3MD1 A;  2ERR A;  3OTB A;  2BAC A;  1RB0 A;  3FSI A;  4LF9 F;  2P6T A;  4C6A A;  3QYY A;  2WBR A;  2QGF B;  5ETK A;  1T3N A;  4C2M C;  3MPU B;  5B08 A;  5D3G B;  3QT5 A;  4YY3 F;  1DCH A;  3OTO F;  1NBE B;  4CRJ A;  4ZJO A;  2VUM K;  1NKE A;  1YCL A;  3AH5 A;  4LR8 A;  4F50 A;  1RAF B;  3C6U A;  2ZNZ A;  3V6J A;  1B4S A;  4X64 F;  1U0S A;  3H0G K;  3KHH A;  2LQ8 A;  2VBX A;  4DV3 F;  2N4C A;  1XMB A;  2POK A;  1VQ5 S;  1S1U A;  3R97 A;  1ZBT A;  5IYC C;  1P1T A;  3PO4 A;  5TMF A;  1HWL A;  1S6O A;  3E01 B;  2W24 A;  1RT7 A;  1T02 A;  2V6U A;  1U09 A;  2GCF A;  1HKA A;  1E6V B;  2OKQ A;  2YPZ A;  2MKK A;  3HSD A;  3QGP A;  2KFZ A;  2YKA A;  4DL3 A;  3CAG A;  2W2P P;  1ZAV A;  3CTR A;  3QSI A;  4DOZ A;  3GV8 B;  2RKI B;  1SUQ B;  5HO4 A;  1H38 A;  3ONQ A;  3KLE A;  4X2B A;  2EC2 A;  4A47 A;  2RJZ A;  3K8V A;  4ZVE A;  2Q79 A;  4BXX C;  1O2A A;  4AXI A;  3PO3 C;  2IDE A;  4ED5 A;  4KMU A;  3QRP A;  3OVS A;  4TU9 A;  1XXC A;  3O1L A;  2CKW A;  2PGC A;  2E5L J;  4Q7A A;  3I56 S;  1NUE A;  1Q5V A;  3LTO A;  2IAJ A;  1EET B;  3MED A;  4QYZ K;  5K8O A;  1WWH A;  3CW2 C;  2R2U A;  3KLE B;  5C24 A;  2B4P A;  3CJ8 A;  1FTR A;  4DPY A;  1RBL A;  3CIM A;  2JA7 C;  3OTE A;  4K8R A;  4A3G K;  3H5Y A;  4DR7 F;  1GH8 A;  1F6T A;  3G6E S;  3ZNJ 1;  1HD1 A;  4DDF A;  2HND B;  3CCU S;  3RTV A;  4I67 A;  2FHM A;  3HZG A;  1D09 B;  2OPP B;  3GIL A;  2FDN A;  1B64 A;  5E33 A;  2ATC B;  7AT1 B;  1EFW A;  2HIQ A;  2HFO A;  1S9E A;  5K14 B;  4ZIW A;  4TYB A;  1TL5 A;  2FJB B;  5C4J K;  1RYR A;  5KFS A;  1RP5 A;  2AZ3 A;  4BC9 A;  1HI9 A;  1SPB P;  5LT5 A;  4IFY A;  3AB4 B;  4FPR A;  1EJ7 L;  2MTL A;  2W2O P;  4HH0 A;  4O0I A;  2KB2 A;  4MK9 A;  4YDX A;  3AT1 B;  3GTL C;  2KVQ E;  4PAB A;  3UNY A;  3PR5 B;  1R7I A;  4K4S A;  2KRR A;  3MMB A;  1DBD A;  3VZI A;  3OW2 R;  1BQX A;  4WF9 Q;  5JFE A;  3NS5 A;  4P7T A;  2RRB A;  1KQG B;  5HVG A;  1IM4 A;  4DL0 C;  1KS2 A;  3QLH B;  4JI1 J;  3A8J A;  4BC7 A;  4HI1 A;  2QZ8 A;  4GRS A;  5HI7 A;  2VU5 A;  3KLG B;  3SQO P;  3F73 A;  2UUB F;  1B99 A;  3TNV A;  1XZQ B;  3MXH P;  1NSK L;  4ECW A;  1GK8 A;  1W25 A;  4LFB F;  4ED4 A;  2XMK A;  2MGZ B;  3DOL B;  3HSG A;  2LEA A;  2F4V J;  3W5Z A;  1FWL A;  1N5V A;  2AJF E;  1OY8 A;  1U48 A;  2H48 B;  2ZH3 A;  4A8X A;  4WJ4 A;  2YNH A;  4X66 J;  3LP2 B;  1JXV A;  3PEJ A;  3TUJ C;  3NKY A;  5GAE I;  3H2V E;  1P8G A;  1PG5 B;  2M3D A;  2E2J K;  4USK A;  1URR A;  2OTL S;  5FD1 A;  1HAR A;  4DN9 A;  3M9N B;  4O3Q A;  4ZVH A;  2NVX A;  1TKZ A;  1PKU A;  4EUV A;  4ZK7 M;  2ZHA A;  5C3E C;  1TWA C;  5KFO A;  5HMZ A;  3GEE A;  4DUY J;  4GVL A;  3EPG A;  2MKH A;  2XO6 A;  1MRO A;  3I31 A;  3MEC A;  5KFG A;  1EP4 A;  4DPO A;  4LBI A;  3CWJ A;  2FYX A;  2C3U A;  5AXM A;  4NZ7 A;  2D3Z A;  3W9H A;  3U1L A;  2NYH A;  4PRF A;  1FEE A;  1TWH A;  2C2D A;  2Y8Y A;  2YNG A;  2BJD A;  2LDY A;  1HL6 A;  3VGU A;  4JK1 A;  3MEK A;  1VRU B;  1ICE B;  4RNM A;  2DGT A;  1SH2 A;  4HVZ A;  3J81 Y;  3D3B J;  3ZTS A;  4GKJ J;  3ETM A;  3LPE A;  2DVI A;  2W7O A;  4LSL A;  3ZXW A;  4ECX A;  1KOH A;  4B9V A;  5HBM A;  5HLF A;  1JLC A;  2O3D A;  4ZPW R;  2DK2 A;  4PZV A;  3KNA A;  2MLY A;  2FHJ D;  2DNO A;  4EU0 A;  3ENQ A;  1FDN A;  4CH0 S;  1GTE A;  3BS9 A;  1XR6 A;  3MR7 A;  3T9Z A;  3JQM A;  3EQL A;  2MQM A;  3IR5 B;  3KUH A;  1IL2 A;  1FNO A;  1B0V A;  4QWB A;  3FFI A;  3GTO K;  4W98 A;  3E2E A;  4N7T A;  4QIV A;  4HLB A;  5KTQ A;  1JNR B;  4OLP A;  1UCN A;  3OQ2 A;  2NZC A;  4X84 A;  2FD2 A;  1HNV B;  2HVI A;  3BGL A;  2GQQ A;  1RXO B;  4U67 Q;  2UVR A;  2J8S A;  3HO1 A;  1SVD A;  4A93 K;  2CJY B;  1NH7 A;  3M2U B;  3RB4 A;  2XCQ A;  4MMO A;  1RTH B;  1NK7 A;  1FX2 A;  1FFG B;  1KRP A;  1BC6 A;  5LXY A;  4DL7 A;  2NVX K;  1IR2 A;  2B4V A;  4LUB A;  2QA4 G;  1YG0 A;  2BOA A;  4JV5 J;  3D1Q A;  1FJG F;  3T00 A;  4ITS A;  3K5M A;  4M63 A;  1CJK A;  4X64 J;  1X4B A;  2R92 K;  2M4M A;  3QRR A;  4G65 A;  2NVQ K;  2RRN A;  3C6T B;  2CXE A;  2ASY A;  3SDE A;  2CQC A;  3FEY B;  2Z8Q A;  2YY3 A;  1JVI A;  4HT5 A;  5GAH I;  4WXW A;  2GML A;  3JYT A;  3TWZ A;  1KN6 A;  1Q8K A;  3EVM A;  4IRK A;  1FKO A;  2BJ7 A;  1JKH A;  1X4H A;  1KLM A;  3IC1 A;  1DD5 A;  2EI5 A;  4MQ9 A;  2W2Q P;  3BDP A;  2ZZT A;  1X9W A;  3WOD A;  3GV7 B;  3DGP A;  2PEH A;  3Q8V A;  4TY8 B;  1YVF A;  4RKU C;  4ED7 A;  4R8U B;  2R7Q A;  3DYA A;  4F4K A;  4G1P A;  5IC4 B;  4DG1 A;  4H54 A;  5JJB A;  3N0C A;  2DEJ A;  4E98 A;  1I50 K;  3G2X A;  2H4W B;  2XI3 A;  3DRS B;  4FNI A;  4U7U D;  2LDI A;  2RNE A;  4CNY A;  3F44 A;  3D7S B;  3VCD A;  2CWK A;  5IT0 A;  2CPD A;  4PWU A;  1C2P A;  5L9X A;  4O4R A;  2XS2 A;  2VG7 B;  1I94 J;  3G8S A;  3ADA C;  2CQ1 A;  2YX1 A;  3WX4 A;  1Q16 B;  1I6V A;  4ED8 A;  4BLA A;  2HNZ A;  5HAT A;  3OBI A;  3OL6 A;  2CQ3 A;  3CME S;  2E9T A;  1Y1W A;  4Q43 A;  3I0R B;  2HFU A;  4O3O A;  3JTN A;  1FF2 A;  2VG6 B;  2WCX A;  2XMU A;  5HMW A;  4X6A C;  2KZM A;  2ZH5 A;  1RHR B;  2VJV A;  1X4G A;  4M5D A;  3DMJ A;  2EPI A;  1NLK L;  3DU6 A;  4HTI A;  1SFO C;  3HLU A;  3PIO Q;  1QSL A;  3RR7 A;  3S15 K;  1H98 A;  1CJT A;  2VDH A;  4DR2 F;  2RH6 A;  3I5C A;  5LMN F;  4U8V A;  1N34 F;  1UEU A;  4ZN3 A;  2K2P A;  1P1L A;  3SSS A;  4AH6 A;  4ZPB A;  1NHK L;  1DHM A;  1E6Y B;  3SSQ A;  1L5U A;  1RK8 A;  1C0T A;  1QY7 A;  1RHK B;  3M32 B;  3OL7 A;  1NO8 A;  3AB2 B;  2RAQ A;  3SZY A;  3BZQ A;  5U47 A;  3CCQ S;  1ZYQ A;  4ZKA A;  2VON A;  4LFC F;  2KT5 A;  2YH1 A;  2HQI A;  2BZ2 A;  3MM5 B;  4KAW X;  3PO2 K;  4UZB A;  1HBM B;  5GAG I;  1N5Q A;  3JSM A;  1TL1 B;  3FHZ A;  4OZ3 A;  2OD4 A;  3LQV A;  3RBX A;  3H59 A;  3OSP A;  2J0W A;  2OLW A;  1TWF A;  3GTG K;  2BMB A;  3IFE A;  5A2Q Y;  2R93 K;  2BQU A;  2FY1 A;  2CVI A;  4LLG A;  2Q43 A;  2AQ4 A;  8RUC A;  5G0R A;  4OZ0 A;  2HKE A;  4TQS A;  2HYI B;  4RW9 B;  1H72 C;  3L7O A;  1PIL A;  3I0S A;  1BQM B;  2M7S A;  5IQ6 A;  3ETO A;  4PXC A;  3W2V A;  1YK9 A;  2DEI A;  2CPX A;  5ETL A;  4C3L A;  1GE9 A;  4OFZ A;  1GT8 A;  2KHC A;  1SQG A;  2RQK A;  2DNH A;  5B0B A;  2EFV A;  2M52 A;  2PMZ L;  2DCL A;  3FCV A;  1YJW S;  1RHM B;  3M4O K;  1IM6 A;  3FEX B;  4RUA A;  3QT6 A;  4ZLL A;  5A8W A;  4DV5 J;  4KPC A;  3RRG A;  3TQ1 A;  3S1R K;  3A8E A;  1F60 B;  1SV5 B;  4DFM A;  3MUR P;  2J0X A;  3IRX A;  1BQN B;  3GIK A;  2D3O 1;  3FK4 A;  1EX8 A;  3AOD A;  3S8S A;  1G2E A;  4A8M P;  4LK1 A;  3PM9 A;  4DQI A;  1HIY A;  1FJE B;  2O5D A;  3RYL A;  1UET A;  4F8R A;  3MM6 B;  1AFI A;  2ZOG A;  2ALZ A;  3TZW A;  5IYD C;  3D28 A;  2E7V A;  4F25 A;  1JJH A;  4ZA1 A;  3I4N C;  6FD1 A;  3GCW P;  2UXD J;  2V8G A;  1QVG R;  1WJ9 A;  3DC2 A;  3MI7 X;  2QEX S;  4J9S A;  5KFZ A;  1KEK A;  3I4H X;  3HSZ A;  3M8R A;  4PXD A;  4PG7 A;  2HGN A;  4RBV A;  1ZAW A;  4LF6 F;  1FTC A;  4P75 A;  3M3Y C;  3H5S A;  3BR8 A;  3MM6 A;  1NK0 A;  4Q0B A;  5EWF A;  2EFO A;  3TA2 A;  5GAE U;  4DR2 J;  4LF4 J;  3MM8 A;  1NJY A;  2GZO A;  3IWN C;  4KRW A;  1XPP A;  4NA2 A;  2WON B;  1IUJ A;  4KKO A;  2BKO A;  2EG1 A;  2FB0 A;  4MK8 A;  2NXC A;  2MHE A;  4F0M A;  7FD1 A;  1MNE A;  3OR1 A;  1IR1 A;  2G13 A;  4MTP A;  1TFW A;  2O5I A;  3QJJ A;  4RJV A;  3PW0 A;  3IS9 A;  3Q83 A;  3KLV A;  2ZIT A;  2PA3 A;  4A3M K;  5DDP C;  1VR6 A;  3TJ8 A;  3MCM A;  2AYE A;  1XXB A;  3S0X A;  3PVX A;  1ZQ1 C;  2Q66 A;  5DJB A;  4Q8F A;  2OPQ A;  3CUL A;  3OTC A;  3I9V 9;  4C0O C;  1B70 B;  2ZBR A;  4F02 A;  2BW7 A;  4O3R A;  2CFA A;  3NWG A;  4X4R A;  1WDD A;  3BPD A;  1XNQ J;  2XM3 A;  1XMO F;  3PYE A;  1N33 F;  3HI9 A;  3M6U A;  4RWX A;  3FKI A;  1S6Q B;  2VQE J;  4PXE A;  4ES1 A;  4DV0 J;  3IG1 A;  4DR6 F;  1UFL A;  4DX6 A;  3HOU C;  1D9A A;  3CMQ A;  1UEV A;  3HKW A;  3MM7 A;  1L3U A;  4H4K C;  2X3G A;  1RSC A;  3CVK A;  3DU5 A;  4JYA F;  4B02 A;  3MMC B;  3VV2 B;  4Q8E A;  1NZ8 A;  3DRR B;  1WTB A;  4P6Q A;  1OPZ A;  1TWH C;  3MCS A;  4P7V A;  1RTZ A;  4ZVO B;  1VQN S;  5IYD K;  1D3W A;  2FZC B;  5HSP A;  1CJT B;  4WPA A;  1WNE A;  2G9O A;  2PDA A;  3KLG A;  4Q45 A;  1OQ3 A;  1WSV A;  4ZLJ A;  4WKR A;  4KH0 B;  1Q86 T;  2XMM A;  4Y2K A;  1SH0 A;  1CJU B;  1HMV B;  4CO0 A;  4PG6 A;  4JI3 J;  3ORE A;  4C3I C;  4ZVT B;  2HHS A;  2FJW A;  1FA0 A;  4TN2 A;  2W4C A;  3SQG B;  3N6N A;  4YFU A;  1YBU A;  1H2V Z;  1GNK A;  2B9X A;  2K1R A;  3V4G A;  4P2S A;  3KDN A;  4ETX A;  4C97 A;  3QAU A;  3NGT A;  4N41 A;  3DMJ B;  2KJW A;  2OD6 A;  2RDJ A;  3N6M A;  1FKP A;  1OJ4 A;  3GR1 A;  5C42 B;  2VUM A;  2BDP A;  3MCN A;  4DDQ A;  4EEY A;  3S2H K;  1WHV A;  1IE0 A;  1WUU A;  4AQY F;  5A0Y A;  4OHW A;  1FRJ A;  4KT0 C;  5B0E A;  2QMX A;  2CZV C;  4PWW A;  3UW1 A;  3DLE B;  5LM7 E;  4WJB A;  1XTZ A;  5ETT A;  5HK4 A;  1TMJ A;  4HT7 A;  3G86 A;  4BDP A;  1LK7 A;  3BSO A;  2DYA A;  3I32 A;  3VF0 B;  3KHR A;  3RRH A;  2Z57 B;  1K9M T;  3C14 A;  2DXD A;  2GO9 A;  5A2Q U;  2ZWO A;  1KHW A;  2RRA A;  4ZPT R;  2YKO A;  2NYI A;  1OY6 A;  1ZS6 A;  2MZR A;  2CPF A;  4URS A;  1EQ0 A;  2XI2 A;  3TP2 A;  3LAJ A;  2MQN A;  2ZKU A;  2XCR B;  1I50 A;  1BXN A;  5BXI A;  1WOS A;  2W9B A;  4EBD A;  4P5A A;  5D6G A;  3FRZ A;  4D3G A;  5IS2 A;  4FZV A;  3R6G B;  5L38 A;  3W3S A;  1X8D A;  3LAM A;  1TWH K;  2YWH A;  3SFG A;  1QTM A;  2CVE A;  1JQW A;  4C2M K;  1HHS A;  3OHA A;  2XQC A;  3CUN A;  1JJ4 A;  1YJ9 S;  3KHG A;  4NCA A;  4KMH A;  3M2U A;  1G7C B;  9ATC B;  1IKY B;  1MWQ A;  1SIW B;  5FLM C;  4IOA Q;  1VQM S;  3GFH A;  1OSD A;  3S1Q K;  2KG1 A;  3KK1 A;  4MAK A;  1ITP A;  1X4E A;  4B9T A;  2OPS B;  1S1T B;  4WFB Q;  5LMN J;  3E01 A;  5HAN A;  3J7A 1;  2A69 A;  3H20 A;  5JMN A;  4DFJ A;  4JV0 A;  4KO0 B;  3D68 A;  1QE1 A;  2ZC4 A;  1JNZ B;  4C98 A;  3E8O A;  3HOZ K;  1LW2 A;  3TVZ A;  3O44 A;  1TKX A;  1T03 B;  1UV7 A;  5I3P A;  3GII A;  1DUR A;  4L3N A;  1CQM A;  2HS4 A;  4URG A;  1RE1 B;  4A8W A;  1FDB A;  1PBU A;  5C25 A;  1DTT B;  3G9C A;  2R2R A;  3IR6 B;  5F0U A;  4X4O A;  1VHF A;  1B7F A;  5KT3 A;  1IKV A;  1JLF B;  3M9O B;  2VFR A;  5HAO A;  4DSF A;  5MLC V;  5F8N A;  1WI6 A;  4X4N A;  1T03 A;  2DNM A;  3PJX A;  4C3J K;  4P74 A;  4RO0 A;  2KT2 A;  5KFT A;  3VAI A;  1X5T A;  4NL5 A;  2AJ2 A;  2HNZ B;  1HQE A;  3GTJ C;  3KLF B;  1IW7 A;  4Y00 A;  2HS3 A;  4OQJ A;  4ZN1 A;  5H9E J;  2NVT K;  2DBB A;  4ZJQ A;  1FDD A;  5EDW A;  5KG3 A;  5K8N A;  3PRV A;  2IYG A;  2W9C A;  1RLC L;  2H5I B;  3US5 A;  1R6Y A;  3DHW C;  1WF0 A;  5D3G A;  4WE1 B;  3W1Y C;  1WOO A;  3LP0 B;  2JJ4 D;  2D7S A;  4A8S A;  1TWG K;  2HZA A;  5IYB C;  4GTL A;  4DX8 H;  4USU A;  3PX0 A;  2GVD B;  1YJ7 A;  1N36 J;  2CIM A;  1JLG A;  4A3L C;  2B8Q A;  1LEO A;  1C1B A;  4LRC A;  3C2P A;  1NK4 A;  2VD3 A;  5DO2 A;  5C2C A;  4J9L A;  4NLR A;  3DOM B;  3NLC A;  1M5K C;  4DV2 F;  1HWJ A;  1K0T A;  1UPM B;  3CDU A;  4WIL A;  4IG0 A;  3R8Y A;  4A3K C;  5M5X K;  3VR1 A;  2KT3 A;  2LLZ A;  4JI8 J;  5LSO A;  3N3Y A;  4BLG A;  1SB6 A;  3GWC A;  3HVA A;  5CXT A;  1X60 A;  4NI2 B;  1KNZ A;  1KD1 T;  2HNY A;  4K59 A;  3HP6 A;  4OYI A;  3A1Y G;  4KHP F;  1O25 A;  4MYT A;  2VUM C;  3N0V A;  1O24 A;  3FBF A;  2FLN A;  3GTY X;  4N77 A;  1DLO A;  4NXN J;  1VQY A;  4WP8 A;  2MY8 A;  4DF8 A;  5E7O B;  3MMA A;  1UPP A;  3E3X A;  5EWG A;  3GSI A;  1S1X B;  2UUB J;  3UVJ A;  3FVY A;  5T14 A;  4DV6 F;  4NEZ A;  1WKJ A;  3C15 B;  4O2D A;  3H40 A;  1WHX A;  5DDQ C;  3TFH A;  3OR2 A;  5HQ8 A;  2IHR 1;  2LFV A;  4F3O A;  4FF2 A;  3WC0 A;  4HYK A;  3QT8 A;  4I64 A;  2G0C A;  4ZHR B;  4A3E C;  1WDT A;  1Z2L A;  1LQ9 A;  4OHV A;  1S97 A;  4CI0 B;  1Y11 A;  2B63 A;  1AZS A;  4KDD A;  2EWH A;  4HAC B;  3CCJ S;  2R7V A;  1OY9 A;  4P9S A;  1NME B;  2ZH9 A;  2AMC B;  2UXB F;  1N5T A;  4AE5 A;  1FRK A;  5CHP A;  1S9E B;  4LOW A;  1NCL A;  3MPD A;  4DEZ A;  2H1Y A;  2JZ5 A;  1V5I B;  2ZWP A;  4KPY A;  5EGY A;  1ZAX A;  2B0G A;  1XN9 A;  3NGK A;  2PMZ D;  1RT1 A;  3R5J B;  4PG4 A;  1JIH A;  4C7Q A;  3Q8S B;  1FDA A;  1SJR A;  2QN6 B;  2R42 A;  2X1F A;  1KFS A;  4W92 B;  2E66 A;  4PWD B;  4X65 F;  4G1Q B;  2G2Z A;  2KYX A;  4LSZ B;  1X5S A;  4LSL B;  1CSJ A;  4EYH B;  5AJ3 F;  4JBC A;  4BS2 A;  5IP7 K;  2NXU A;  1FE0 A;  2RD5 C;  2JA8 C;  3GFY A;  3SV3 A;  1UMJ A;  3MOZ A;  4F2R A;  4C3K A;  1YJR A;  2PD1 A;  3MMB B;  1HBN B;  2VQF J;  1FWP A;  1N5Y B;  1FKA F;  2B7B B;  2YWG A;  2DR6 A;  1JJ2 R;  2YNG B;  3SMZ A;  2KYZ A;  3N6L A;  3IRW P;  3PAC A;  3AD7 C;  4ZVS B;  2VG5 B;  3TUI C;  1RAH B;  2CQ4 A;  2GQ2 A;  2XMV A;  3ITH B;  4OZJ A;  4M1K A;  2GFF A;  4I68 A;  4XTT A;  4HKQ A;  2BM1 A;  2APO A;  2RIL A;  3K89 A;  3KMQ A;  4AXJ A;  1S6U A;  2AV5 A;  2EW9 A;  4AFF A;  4DUZ F;  2X1A A;  2GC8 A;  2Y1L B;  1P6T A;  1PC4 A;  2FQQ B;  4ZHR A;  1M1K T;  3KJQ B;  2ASD A;  4MKA A;  2OFH X;  1TK0 A;  1HQM A;  3CT9 A;  3CO9 A;  2F8M A;  3L7U A;  4GFQ A;  1BMQ B;  4I4B A;  3HSJ A;  1M5P C;  3S14 C;  2Y9H A;  2BJ3 A;  3DDI A;  2I9S A;  3EZU A;  2LXU A;  2ZZM A;  3ULH A;  4CO2 A;  5DGB A;  5FDL A;  1YSJ A;  1ZVU A;  5ETS A;  2DRA A;  1JWW A;  3KNG A;  1PAU B;  4TKT A;  2CPI A;  3HKZ L;  5C4X K;  4BBS C;  2V9K A;  2E2I A;  3AD8 C;  2VPY B;  2YKN A;  3LGN A;  4IG3 B;  4IFV B;  5K5M A;  1Z4U A;  1RAG B;  3UVJ B;  3LPY A;  3TRG A;  1U1N A;  4LFC J;  5J2P A;  5M3M K;  3MR5 A;  1DFD A;  1M5O C;  1VLY A;  4DS4 A;  3TEG A;  3HVW A;  4JI1 F;  5DET A;  3TAP A;  4RLE A;  4WK1 A;  4FVM A;  1B0T A;  3SV4 A;  1FER A;  5IOS A;  3D3C J;  2LCW A;  4LQ3 A;  3NS6 A;  4C3M A;  2IVM A;  4PAA A;  4Q4Z A;  4KV8 A;  4WTY A;  3M8Q B;  4F4Z A;  4C3H K;  4G0V A;  3IM9 A;  1HR0 J;  3S16 K;  2ATL A;  1VQ8 S;  2HBZ B;  3LAP A;  2D9P A;  2DHS A;  3PEH A;  1AUS L;  1HHT P;  4LT6 A;  5HVF A;  4HEA 9;  5IQQ A;  4FYX B;  4GTA A;  4UOC A;  2GVD A;  5ETQ A;  4IO1 A;  3Q2S C;  2WVE A;  2R7W A;  4KB2 A;  2KU7 A;  4LVO P;  4JI2 J;  1DTT A;  2HVZ A;  3RRK A;  4OJ1 A;  3B78 A;  2PPB A;  5C24 B;  2M0G B;  2NXJ A;  3OFF A;  1RIS A;  1CC7 A;  3BBC A;  3UR0 A;  3HT0 A;  4BLB A;  3M6W A;  4JI8 F;  1Y5L B;  1O51 A;  2XGQ A;  3DXJ A;  2V34 A;  5BR8 F;  5A8K B;  3EZ5 A;  1BS2 A;  3O8W A;  4K5S A;  2OPR B;  3IMQ J;  4Y65 A;  1DAX A;  2CDQ A;  4IDK B;  4I69 A;  2C2O B;  1YHQ S;  3C6U B;  4GO5 X;  2WRM A;  1NXI A;  4J5O A;  2JA6 C;  3HOY K;  3GP9 A;  3QBC A;  1M5S A;  2VOP A;  3GCX P;  3AD9 C;  5CCL A;  5C4X C;  3LPX A;  1LFW A;  3BBF A;  3ET6 B;  1V5V A;  1ZTT A;  4NLQ A;  2DB1 A;  1LW0 B;  5FII A;  5GAG U;  4CH7 A;  2XLK A;  1N5Y A;  3DLJ A;  6AT1 B;  1UWB A;  1QUV A;  4C2M A;  3GTO C;  1LWF A;  2P6S A;  4X4U A;  5KFE A;  2B4U A;  2VUG A;  2V9W A;  1X0P A;  4G7Z A;  1VJW A;  5KFU A;  3PHT A;  3W9J A;  4PXB A;  1YIT S;  2AYM A;  5KFI A;  1WHY A;  4YB5 A;  1HYS A;  2F5G A;  3PCO B;  3ISZ A;  2ASL A;  3MGJ A;  1ZXO A;  4M5J A;  2PA8 D;  3N79 A;  3U7J A;  3RZA A;  1FES A;  4X65 J;  1KQK A;  4XIU A;  4QWA A; 
#chains in the Genus database with same CATH homology
 1XZP B;  1WOS A;  4PAB A;  1WOR A;  2GAH C;  3AD7 C;  1PJ7 A;  1WSV A;  3TFI A;  5L46 A;  3GEH A;  3TFJ A;  3GSI A;  1PJ5 A;  1WOP A;  3ADA C;  1X31 C;  3AD8 C;  3GEE A;  3AD9 C;  4PAA A;  1XZQ A;  3TTG A;  1PJ6 A;  3A8K A;  1XZP A;  1YX2 A;  1WOO A;  1WSR A;  3GEI A;  1XZQ B;  1VRQ C;  3A8I A;  3TFH A;  1V5V A;  3GIR A;  2GAG C;  4P9S A;  1VLO A;  3A8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...