3AD9C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 sarcosine-reduced form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
total genus 50
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad9C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad9C01
3GEEA 1VRQC 3AD9C 3ADAC 3AD8C 3GIRA 1YX2A 1PJ7A 1XZPA 1PJ6A 3A8KA 2GAGC 4P9SA 1V5VA 1VLOA 1WORA 1PJ5A 3TTGA 4PABA 1X31C 1XZQA 3GEIA 1WOSA 3GEHA 2GAHC 1WOPA 1WSVA 3TFIA 3AD7C 4PAAA 5L46A 3A8IA 1XZQB 1WOOA 3TFJA 3A8JA 3GSIA 3TFHA 1XZPB 1WSRA
chains in the Genus database with same CATH superfamily
1TV6A 4L3NA 4M95A 4QU7A 5HMZA 2BRKA 3GTGK 2DNRA 4HI2A 2VU5A 1GK8A 3CJTA 5KG5A 3E01B 1WG5A 2AKWB 3ET6B 1A0OB 1HWUA 4FN5A 2E1MC 1YLXA 3SYZA 4BLGA 3TYTA 2F40A 1RT6A 1UTAA 2PT0A 3IAM9 1NPKA 3GIMA 3UR0A 2FY8A 1K9MT 4OHYA 4B3TJ 1DLOB 2KT2A 3K5LA 2Z2ZA 2G0CA 1K0VA 3IWXA 4FNIA 3FBEA 2MHEA 3HD2A 2DCUB 2YY3A 1UFLA 2B0GA 2R7QA 3IXQA 1QLNA 1WQHA 4U7CA 4JV0A 1JLCB 4LQ9A 2LXUA 1WTFA 4J9OA 3L7PA 3C6UB 3D0HE 4CLTA 1RKJA 2BANB 2MQOA 2EK6A 2IYIA 4IG3A 1RISA 2LP4A 3KNGA 3O5TB 1U6FA 5K20B 1RP5A 4ENOA 5KFFA 3I5BA 2ROEA 4QIVA 1VQYA 2HFSA 1TWHK 1FJ7A 1P6TA 1VC6A 3SQGB 3ILOA 2H1YA 5K8PA 1KTVA 2HLUA 2ZH1A 3B8HA 3QJLA 3NEKA 4BBYA 2ABYA 1MMDA 4DX7A 1X4EA 5LXRA 5B0BA 3W9JA 4A3MC 3BSOA 4C48A 1ZM9A 4BHQA 4FS1A 1SH3A 5FDLA 1RT1A 3KLVA 2X1BA 5D6GA 1XBWA 2F4FA 1EQ0A 2VOPA 3K7AC 3PX4A 3SEOA 4OMFG 2HQGA 5KOWA 1KLMA 2QMUB 3GCWP 3I9V9 5B09A 4UT4A 4DPYA 1VLYA 1FEHA 2BACA 4IFYA 3VZHA 3LPXA 1IBKF 2CFXA 2MB0B 3I4MK 4C3HK 1O2BA 4UOHA 4WK3A 3N4WA 4QWCA 3QO9A 2LLZA 5DO2A 3PFEA 2DGWA 1UA1A 1WSRA 1ZM4A 4CYUA 3RZAA 3WBZA 2CJ9A 2J7UA 5AJ3F 2E2HC 1F2GA 2CQ4A 3K7AK 2Z4PA 2P9CA 1U2CA 2HHSA 4R5PB 2U1AA 3PW0A 4WIIA 2IY5B 3KG0A 2A6MA 2R7UA 2F4VJ 4MH8A 3DLEB 1TUWA 1OY6A 3OSNA 3BGRA 3PHEA 4EK2A 2G0JA 1RBLA 1TP7A 3PJXA 3KJQB 4IR1A 5LSLA 2HVIA 4CRJA 4E98A 2WONB 2C2EA 1U1PA 4RNHA 2UUCF 1YNJA 3MMBB 4RW6B 3D9BA 2RDJA 4LF5J 2DGOA 2NVXA 2DNMA 1HWIA 2VG5B 3QT7A 2VIHA 1W25A 3S2HC 2EI5A 2D3ZA 4IRCA 1P27B 3SQGA 4HTJA 4OHXA 3H59A 1RT2A 4M94A 2RRNA 2DISA 4O3SA 4BBRC 3NCRA 4Y2CA 5C4JK 1AZSA 3W9IA 3GTKC 1X4FA 1KNZA 1VMBA 4ANDA 1Y7PA 3IR6B 3U7JA 3UWTA 5IORA 2CNNB 2CZVC 1NJYA 1N0VC 2BYCA 3TUZC 4MQ9A 2VL1A 3DDKA 3CD5A 1SIWB 4MJKA 3GP9A 1T05B 4NXMJ 4OZ0A 5HBMA 3MPWA 3PCOB 1S1TA 4NE9C 2ZD1B 1WC4A 2VQEJ 4KR0B 3BYPA 3ISZA 2P2CB 4F0KA 1D9AA 3H5UA 4G0WA 2WK4A 4E0DA 3SDEB 1VI7A 4AL5A 4WFAQ 4X65F 4Q8FA 1D0EA 3I56S 4G65A 1J6WA 1ROFA 3H0PA 1VQPS 1LW0A 2OJ3A 4N8NA 4AYBD 4DV5J 1WELA 4HLBA 5L1JA 2RMLA 3FNNA 5LM7E 2YWKA 1U8SA 1UPPA 3IS9A 1V3ZA 4TVAB 2E7WA 4Y2KA 2WRMA 1XMQJ 3DXJA 1IBMJ 4F0HA 1FT8A 4DQRA 1BGXT 1RAHB 3PYGA 3PFOA 5RUBA 2FJEB 4ZH4A 1SKSA 3GTPA 1RT5A 2JH3A 1YJ7A 1JLGA 1S59A 3GYXB 3MD3A 1NPPA 3I82A 4K7QA 3M8ZA 3R2CJ 3T5LA 4MMOA 4OZLA 3THPA 1HWKA 1IKXA 4FPRA 3D7SB 1U7LA 2GGPA 1UL3A 1N88A 4LSLB 1N5YB 2W4DA 2M8DB 4A46A 2CQDA 1HYSA 4WPAA 3GTMA 2YKAA 1B7FA 1EJ7L 1UVJA 2E5LF 3OLBA 3DU6A 2RQKA 4DR2F 4AQYF 4K0KJ 4WZQA 4CLWA 4A3JK 3EQLA 5TMFA 1HQ2A 5F8NA 3MFIA 1CJUA 1F6TA 3NRBA 2HSEB 1RWVB 2M88A 2N82B 4ERDA 3LPEA 5KFMA 3SBMA 1NK4A 1U49A 4JI5F 4RJVA 1SKUB 1WQFA 3DXSX 1X4DA 2U2FA 1MW7A 2HEKA 1DAXA 3KHHA 2ZBIA 5H9EJ 2BJ9A 5HVHA 3VAMA 3JSMA 4FF3A 4ETXA 3MMCA 2WBMA 1UKUA 3NNCA 3IG1A 5E33A 5J1NA 1V3SA 1IL2A 2I0XA 5KFDA 4EFAC 2JSXA 1JQWA 3JS9A 1FERA 4FF2A 3I4NC 2HAIA 1QVGR 1Q4RA 4DZ6A 3RBEA 1RYSA 2UZAA 4KYZA 1B4BA 5IWAJ 1N33J 4WFNQ 2D9OA 3NY0A 2PIIA 3DXBA 1F5AA 1VQSA 2P6TA 1T94A 4A3JC 4W4MA 4B9VA 3I0SB 3PYEA 3PR5B 3TARA 2V2QA 4ED2A 1HBOB 3T1YF 4GTLA 4B9SA 3S16K 3HHDA 4DR5F 4LREA 4TQSA 4KQZA 4WBFA 2GVDA 4ZK7M 4O44A 3UDEA 4P7TA 1KP6A 2QFJA 1FK9B 3V4MA 3DGVA 2FLOA 5I42A 5F8LA 1S0NA 5I3UA 2J9EA 1IKVA 5IYCK 1N6QA 3GQCA 5HROA 2UVWA 4RW4A 4F50A 4B9LA 3CWJA 3A8JA 5KT7A 2IYGA 2OPPA 2WSEC 2V4RA 4YOEA 1JK9B 5EX3A 1JOEA 5LOQA 4PWWA 3V6JA 3PYFA 5IS2A 1P9YA 1NPRA 1Y5IB 2DO4A 1HNZJ 3DOKA 2L08A 1H72C 1TK0A 3PW2A 3ZNUA 2OPPB 1SL0A 3EGNA 5DETA 4LBIA 1QAJA 1G51A 3C6TB 1GX5A 5C42A 4RX6A 4KN4A 2B4VA 2GAHC 4GZYA 4DSKA 1U24A 4WILA 1WC1A 2OPQB 2KM8B 5A6PA 3M05A 2XM3A 3EM1A 2J7WA 4JI0F 5C2GA 4DQPA 4DV0J 2H5IB 5EX0A 1S0MA 5C3EK 4FDFA 1RTJA 3MXHP 4C3JC 5GMEA 3PM9A 1LEOA 4XSXA 4UOCA 4LK0A 2P5MA 2C1EB 1RGVA 1NSKL 2IM3A 4X4TA 1TKXA 1ZBSA 4DL5A 4Q45A 1N54B 1JXVA 4OJHA 2QX0A 3OHBA 4XLPA 1FESA 4P71A 1NDCA 1UVNA 2CJKA 3MFHA 4ELVA 4ECZA 4ILDA 5IWAF 1ZQ1C 1RUSA 1AFIA 3RRKA 3GDZA 2UV8A 1HNVA 1RAEB 4I2QA 3E2EA 5D77A 4IFYB 4KB7A 1BQXA 1DCPA 2MHNA 3LGNA 3HSZA 1XPPA 5HMYA 1VYAA 2VFSA 4K4WA 2GVDB 2BM1A 1CJUB 2R7ZA 4OI2A 2F3JA 4QIWD 3DLLQ 3FSXA 4YB1P 3JXOA 5C44C 4DPUA 3DDIA 4YR2A 4NZ0A 1MN7A 5B0GA 4NCGB 1HR0F 2QLJB 1FRIA 1UVKA 1RI7A 1S9FA 2D7SA 4I2QB 2DHAA 6FD1A 3HPOA 3S1RK 2ZE2A 2OKQA 3SZ2A 1HMVB 1T95A 2UXCJ 2P5VA 3T9ZA 1V9OA 2UUWA 3RR7A 3Q0AA 4FKYA 4NASA 3BGLA 2UUAF 1JLFA 3QGPA 4A3CC 3GV8B 4ZA1A 1YBUA 1KN6A 2DY9A 1DBDA 3BO2A 4BLBA 3R7NB 4MAKA 2FD2A 3OQ2A 3ULHA 2XSJA 2MQNA 3ENQA 3QZ7A 2M5YA 2DXFA 5E3PA 2W4PA 5BR8J 3TZYA 1HKAA 1V5IB 3QIPB 2MZQA 3TZWA 5D8HB 1TMMA 2OUGA 4XIUA 3PKMA 4AL7A 3HKWA 3ISNC 4WXOA 8AT1B 1NXIA 1S1XB 1REVA 4WFZA 1VQKS 2QSFA 5IYCC 1RTIA 2CQHA 3OFFA 2H54B 1NB7A 1S0OA 5F41A 9ATCB 2CQGA 1XNRJ 2Y3YA 4PYDA 1S5ZA 3BO3A 4MK8A 4PUOB 4ZVQB 3EGZA 4GKJF 1FNMA 4RW4B 2AGPA 1IM6A 2DNPA 5KT4A 5KT2A 2HBQB 1KD1T 5JFEA 3H98A 1REVB 1J5EF 2KVQE 4NLYA 1KR4A 2J6TA 2FYXA 4DUTA 1GH8A 2MQQA 1T3NA 2KN4A 5BJRA 1LW2B 5F0WA 4A8FA 2XTJP 5KFCA 2P6SA 3BN7A 1GXLA 2WSCC 2ZVIA 1I94F 2FZCB 3LAJA 3VAGA 2V69A 3S17C 2XSFA 3M9NB 1W7WA 3MGJA 3ZZUA 2F9DA 2UXCF 4LOWA 1YNNA 3QLHA 3SZZA 1PIEA 2XMKA 4FNHA 3GTLA 2XMUA 3CDWA 3W65A 1JWWA 4KH0B 5IOTA 1VRTB 4I4BA 1IKXB 1NO8A 4OI6A 4AT1B 4LIWA 1IVZA 4S0MA 1ZS6A 2HNYB 4I68A 3HOVC 2YNGA 3KFWX 1HNVB 4FF4A 4J9QA 1WDDA 1EX8A 3PVXA 3OXLA 1PYSB 3QATA 4OYIA 3D3BJ 4XCHA 2HNDB 4Y2AA 2FHKA 4RNOA 1N48A 3K57A 4PG6A 5DDQC 2V2ZA 1FRJA 2MEWA 3D2WA 3IAS9 4R8UB 2R93A 1P8GA 4OJ1A 1RAGB 2DGVA 3H5YA 1S1UB 1DY3A 1RAJA 4FYXB 1WORA 4RW7A 2IBOA 5KFHA 1XEZA 2X1AA 4QBUA 1OYDA 4KPYA 4G7ZA 4Y52K 2YXLA 3K8WA 4KC5A 2A6OA 5EGHA 5G4DA 2Z30B 1O8BA 3RUBL 3WQPA 4I6YA 3AH5A 4HHUA 4LF9J 3K0JA 2NREA 2D3O1 3NMRA 5D4LA 4Q8EA 2PMWA 1ZPWX 2NXJA 4RW9A 1USMA 3P96A 1HPZA 2LQ5A 3G6ES 4WYLA 1HQUB 2AWZA 2IVYA 3DMJA 4FYVB 2LKZA 2VPYB 1B0PA 4OIQA 1HBNB 1FD2A 1KEKA 4PWDB 1XNQJ 2R92K 1K83A 4LF6F 4DV3J 4Y34A 4DSIA 2I2YA 3FFIA 4M63A 1R0BG 4U96A 2LEBA 3QRRA 5HVGA 3HOYK 3LW5C 5GMDA 4F3MA 2MY8A 3I87A 3I4HX 4ZPVR 2Y0SL 1TAUA 2J76E 4O23A 4Z37A 4PG8A 1PAEX 2B4PA 2E5JA 3J7AN 2P8IA 4OZJA 3CCZA 5IT4A 5HVFA 2MKKA 4ZVRB 1S4FA 3L7UA 2V67A 2F8MA 2HIYA 2MKSA 2VJUA 4CH1A 1RAOA 1SXLA 2IA0A 3VALA 3MZIA 2OFGX 1VBXA 3S0XA 3PX6A 2C28A 3EMTA 5B7WA 5E3QA 2YKMA 5DZ7A 3PO4A 1MU2B 1KOOA 4D3HA 1EK8A 1UCNA 2XY6A 4DUYJ 1RA7A 2GS8A 5C42B 4A8QA 3J81U 2KYXA 4DCJB 1XZQA 1S9EA 4C8OA 3THVA 1TQLA 2IJFA 4LSLA 3R6GB 1C4CA 1U6ZA 3DRRA 2R93K 4PEOA 2LEPA 3CCSS 1VRQC 2C2ZB 2D41A 1LFWA 3V4GA 3MM7A 5EWFA 2FLPA 5KOXA 1H3DA 1IKYA 2KXFA 1EETB 4M5KA 3SSSA 3H4DA 3D4JA 3RB3A 3GJTB 1HBMB 1AA1B 5LSOA 3CCUS 1JMTA 5B0CA 3OFHA 2RH6A 3PJ9A 3HULA 2HIQA 4JI1J 2DXEA 2GQCA 4N76A 2UXDJ 1GMUA 3GTKA 3PZPA 3GG0A 4MKAA 1RE1B 1M90T 4LBHA 1O26A 2LVWA 2X3GA 2MYFA 4DF4A 1HBUA 2PMHA 1TL3A 3KOAA 4U7UK 5EWEA 2Z56B 2CWXA 3EICA 3IWLA 1XN9A 3DRSB 3HFKA 1QE1B 1FD8A 1U6BA 2GCFA 2UXBF 5L46A 3CCTA 2BMBA 4NWBA 4BS2A 5T41A 3MDFA 2VICA 2H4YB 2QN6B 5EUHA 1GX6A 4Q2LA 3Q89A 4DL7A 1H2UX 3MUVP 3M2VA 2KH9A 2GVZB 4O0NA 2YQ0A 5KG3A 3PIOQ 4QR0A 4OZ2A 5L1KA 1EZZB 1YGYA 5HQ8A 4WTOB 3NWRA 3H3VD 2K3IA 3N28A 4FZBA 4LF7J 4P2XA 3R9LA 2JLGA 3TFHA 2KXNB 1ZA1B 4Y52C 4Y00A 2VQFF 2R8KA 4IDKB 4NLSA 4BBSK 5M3MK 1RAFB 1KOHA 1T9XA 4C8MA 1M1HA 4NLXA 2EG1A 3US5A 1IBKJ 2ZHBA 2ASLA 2KWAA 3NUHA 4EZ6A 2JVOA 2EXUA 4LQ3A 3GTOK 1Z2ZA 5IM0A 1REGX 4KHPF 1U0HB 2W9CA 1QSLA 3HOXK 4A4JA 2IMOA 2C42A 1Q82T 5C2CA 2E9ZA 4Q7AA 3LAKA 3ZZZA 4NZ6A 3CAGA 1Q8IA 4XDDA 2B8PA 1VQLS 2VUMC 2HNDA 3D0GE 4WE1B 4DSEA 5KFKA 1DLOA 4PRFA 5B0DA 1FXLA 4QIFA 3AH6A 2DGQA 2JA8K 4RUHA 3OR1B 1VGXA 1JKHA 4YR3A 3G6VA 5IFMA 3NOCA 1FKOB 4B3MJ 2O5DA 1Q7LB 2E29A 3MM6A 4FBUA 2AJ0A 1KQKA 5KFEA 3GZ7A 4J3NA 2CQ1A 5GMKa 4YDDB 1CSJA 3FK4A 4HT7A 1UP1A 4WTYA 4ITSA 2DNGA 4I2PA 4TKTA 2YU9A 5L8RC 1M5VC 2Y3PA 3BB5A 5A8WA 1ZTWA 1L5UA 1ZYRA 2R7SA 4C3JK 2PA8D 2QLXA 3NLCA 2DEIA 2JZ5A 1QM9A 4XTTA 4L74A 4HL9A 1TMJA 1FRHA 1ZZFA 3KK1B 3RZOC 3MAHA 2VF3A 4X6AK 1SJ3P 4A47A 3C2PA 4IH6A 1SV5A 3UR3C 1T9WA 1F5BA 3TANA 5KG1A 4BCAA 1CVJA 5CQGA 2R9LA 5ETLA 5EGEA 3MMAB 4BC9A 4LF7F 1HWJA 1WIHA 3D28A 5ETTA 4U8YA 1RADB 3NKYA 4X4PA 3S1TA 3ERED 3WHIA 3Q8UA 2YQ1A 3H42A 4RMFA 2XYGB 1DQ9A 2R2TA 2CIMA 1L3KA 3HSDA 2AV5A 4QU6A 4GVBB 1HA1A 1BUXA 5KFAA 3EPIA 2X7IA 1Z4UA 2CQPA 5E2QA 3BP3A 3RTVA 4DI6A 5EDWA 3RBXA 3BEGB 1MSWD 3HSGA 5LJ5Y 3MM6B 2A3JA 4C2MA 4Q4ZA 2W24A 2LCWA 5J2PA 2MKIA 2DHXA 2MQ8A 2Z2MA 1FNXH 1I3QK 1BD6A 2XB2D 3W5XA 4NCAA 3BQ0A 5FLMC 4M5GA 3LGHA 3E01A 3EZOA 4C9DA 1VRUA 4DR1J 1PGZA 2FDNA 3F41A 1JLEB 1RXOB 2FZGB 4XDCA 1U47A 5HLFA 4RNMA 4KIAA 1HI0P 1RWUA 1I50A 1YWXA 2NZ4A 1T03B 2XYPB 4C3IC 4MIWA 4ED5A 2EK1A 3PO3K 3HHNB 4EU0A 4X66J 4WF9Q 3BM7A 4M5DB 3NGTA 3SFGA 2VA3A 4DL6A 1JLEA 2P8TA 5FD1A 1BQMA 2R7TA 2H48B 3IBFB 5CYMB 1VRUB 4Q5VA 2V9WA 2GIQA 3QGHA 1TVRB 1NDPA 1FE0A 4UZBA 3DMJB 5HN0A 1HNIA 4HT5A 3TTGA 5CHCB 4LSZB 1EAYC 3JTNA 1XXBA 4JI2J 2DRBA 3RG6A 3T1AA 5C44K 2NSCA 5K8NA 3TR5A 2B43A 3GYGA 5K5MA 5D15A 3E8OA 4DU8A 3LAMA 2Q66A 2R7RA 4O4GA 2FJXA 1OMSA 3KHLA 3D1OA 1DTTA 1UEUA 1TWFC 3A8EA 1RZMA 3MCOA 4DS4A 4I7FB 3FVYA 1F9HA 3CEDA 4XO0A 5IC4B 3TO8A 1I3QA 2AJ2A 1J5OB 5IYBK 3K5NA 4ZPTR 1FF2A 4ECSA 3JAMU 4R8UA 2UXBJ 2EKYA 3RAMA 1PC4A 1Y4ZB 2RB7A 2IJRA 4KHMA 3BKUA 2ZM6J 4KFBB 4J9MA 4HI1A 5BYRA 3K2YA 3AHPA 4P2SA 3TZZA 3GSDA 3DM2B 3KK1A 6AT1B 1S7HA 3MF5A 2GFFA 4DX6A 2V8DA 1X0FA 3FKIA 2QLFB 4PXDA 3GJRB 4IKAA 1ZPVA 2QFIA 5F0UA 4K4SA 4F26A 3JTPA 5DGBA 1WUUA 3T3FA 4OIRA 1A9NB 2GHVC 3M30B 4KO0A 3L4BC 4NXMF 3Q24A 2J6SA 3OTCA 1OPZA 2ZWPA 1TWHC 1UFKA 2VKRA 5LSRA 2QZ8A 4RU9A 1FRKA 4Y7NK 2PA3A 1NRKA 2AJ4A 5HJXA 4TY9A 2XMVA 4B3RJ 3GJQB 2IHR1 5GAHI 2QC3A 2WVEA 3M4OK 2Y8YA 4GT9A 3MPVA 2E5HA 4Q0BB 3B4MA 3RBDA 3ZTSA 3RZOK 5D3GB 1S6UA 1VOMA 3GIIA 3S01A 2AJ1A 2OPRB 3MM5A 3N0CA 3HOWC 2EWHA 5CXTA 3G6YA 3HT0A 5AXKA 4J9LA 1IUJA 2IA6A 4K4YA 3GTGC 4FS2A 1RWXB 2RKIA 4DL2A 2JVRA 4RW8B 2V34A 4DG1B 1K1SA 1UZDA 3DRPA 1JJ2R 3MUTP 1RT4B 3W64A 2JWNA 4ID5A 2PI4A 5J2NA 4OYAA 2ERRA 3VVUA 4A48A 5KFJA 1RCXB 4DV2J 3CC2S 4EZ9A 5F9NA 1TL4A 3LAPA 4JI8F 4Z7CA 2ZC4A 1APSA 2PHCB 5GAHU 4OZ3A 1FWLA 2O01C 2BUNA 3N5BA 1Z1ZA 4HH1A 1SJ1A 4I0WA 2FHJA 4USVA 3SSQA 2AEFA 4FPIA 3C14B 3CCRS 3POTB 3TUIC 4C8NA 3K5PA 2GNKA 4B9NA 4JI5J 4P75A 3U1NA 3U27A 3KLHA 4ICLA 1N36F 3WODA 4ZLJA 4U8VA 4I6WA 4FXDA 4HKQA 4X64J 2WBRA 2E2IK 2MZ1A 4DR4J 1U26A 4F4WA 2RU9A 3UNGC 3SZYA 4P5BA 5IOSA 4KGXB 1CJTA 3AY0A 2XS2A 5LL6d 3W3SA 4O3QA 4KGMA 2X1GA 1NB2A 2YH0A 3CCQS 1HR0J 1OY9A 3NGUA 4NOIA 5LMNJ 4FYYB 4KM8A 4O4RA 4NYZA 3PO5A 3OBIA 2BR0A 4L76A 4DPTA 3M2RA 2XLIA 1BWVA 3HHEA 4ILMA 3GTLC 4KASA 1O2AA 1M1KT 2XS5A 1EB0A 4QIEA 5AXNA 2BQ3A 4ECUA 4RR5A 3HOUC 5KFBA 1XC9A 2A2DA 4URGA 1EI6A 5D4NA 4OIXA 2FJWA 3K5MA 3M8QA 1JX4A 2D69A 2OPRA 3MM5B 2NVQC 4PG4A 3POTA 4F2SA 1WCMC 3HFZB 1C0UB 4A3DK 1YHQS 4NL5A 3BR9A 1JLFB 1KWMA 4DFJA 1CJVA 3DOLA 4ECVA 1X5TA 4ANEA 1KLMB 4TXSA 4BBSC 2VDIA 2XNQA 5ADZA 4NCBA 5C5JA 2CXEA 1JNZB 5IV3A 2VH7A 4MEYA 1T8EA 1WD6A 5SUHA 3KMQA 3ILLA 3UN2A 4LF4F 2R2UA 3LP2B 5F8IA 5JJBA 1ISEA 1NZ8A 2EFPA 2BJ8A 3LWMA 2VD3A 3UN3A 2PFDA 3OFGA 4ZVPB 3I9ZA 3OW2R 3DYAA 2MKHA 3QPIA 4XPCA 4JI0J 3ICLA 2ZJRQ 2ZDPA 4V19J 3SV4A 3KUEA 4LFCF 3CXCR 4JI2F 1U2RA 1NKEA 4KGKA 3VAJA 2C3YA 3M8PB 1X9MA 3ZZYA 5HMWA 1X9SA 3NOGA 2PI5A 4DQIA 3J7YI 3M9MB 4KTQA 2CPHA 5D0EA 1S76D 2NVYA 4P5AA 1YJVA 3QT6A 4I67A 2RDIA 3CCLS 3OT9A 4J91A 1WEZA 1QE1A 1PYTA 2HWHA 3C3LA 5ETKA 1GTEA 1QAIA 5I4MA 3CT9A 2EVZA 3O2IA 1BQNA 3UVJB 1T7PA 4X4OA 9RUBA 4RPFA 4G0UA 1Q53A 4F4YA 1I6HK 5KT5A 2VONA 5L1IA 1F1BB 4HH0A 3ET6A 1X5OA 5JMNA 4DZDA 4A3EK 3ZTOA 1NHUA 2UV8G 3I0RA 2QMXA 2JX2A 3GEHA 2AT1B 3TW0A 5K9FA 1HFEL 2K06A 3MD1A 4KAIA 5J1PA 4DCPB 4I56A 3OR1A 4U95A 4K5SA 5T7LB 3LALA 4OI4A 5CYQA 5JXSA 3P6YC 4LSNB 3ZZPA 2E44A 3D6TB 2HK2A 1T0TV 2GA7A 1N5VA 1YJWS 1S99A 4HR2A 2KFNA 1INNA 2HMIA 4G6VB 4BBRK 3THTA 2NZCA 4NLOA 3DOKB 4KFBA 3AB4B 4CTAB 4LFAJ 3DGPB 3BGOP 2WAQD 3WX4A 4KE5A 2F63A 3DNCA 1Q86T 5KFGA 1EHWA 5DLFA 5A8WB 1CJKB 3MWBA 5AE2A 5J2PB 3DLKB 4C0BA 3DHWC 2YVSA 4NI2B 3KK3B 5DGAA 1PAUB 1IN0A 3N0BA 3LUYA 4USKA 3UDCA 3G2XA 3KDOA 2BQRA 2POKA 2HBYB 1B99A 1WF2A 2C3PA 4QOTA 5FLMK 2ZD1A 3J7YU 3JSRA 3BGUA 1UVMA 2V8PA 2ZZTA 4A8MP 1G6BA 4Y0FA 1FVSA 1NJIT 3ENAA 4YB6A 2E1AA 3LPYA 1A6LA 4C3IK 3HSJA 3UN5A 4NLRA 1HHSA 4PG5A 3MR7A 2V5HG 2IRUA 2BA9A 2L9NA 2BJEA 2EC2A 1KHWA 3OVSA 3W2VB 1OSDA 3QNWB 3KDNA 3D6FB 4NZ7A 1YJTA 3N79A 2DH9A 4JV5F 2ZBRA 1Q95G 4DHVA 2B63K 2W7AA 4LLGA 1IW7A 3R5JB 3AJ1A 1JLAA 4A8SA 5ITHA 5EGYA 4F4KA 2KFYA 3BQ2A 1F60B 3N9UC 4R0EA 1S9GB 3TAPA 4OZNA 1C0TA 2ZH9A 5IQQA 3R6LB 2CDRB 4LIRA 2BABA 2N3OA 3KLIB 2G2ZA 3QJPA 2WW8A 3KK2B 1JQGA 2DH7A 1XWLA 2DXDA 2CPZA 2AJFE 5A8RB 3EVWA 1ZTTA 3OREA 1SV5B 4X65J 5CHPA 3IN5A 2ZJQQ 2N7CA 3B4DA 2VG6B 5HK4A 2CJAA 4USHA 4NLQA 4A93C 4FYDA 1Y1VC 1R8PA 2Q1LA 1RT5B 1Q8LA 3W8PA 4NA2A 1UZHA 1DTQB 4ZIWA 3VHQA 4IG0B 1RT7B 2HWTA 3K17A 2AYBA 2GJFA 2QA2A 3C15B 4DV6F 2LEAA 2V0NA 3OJSA 4KN7A 4OHWA 1VDHA 4M5HA 2YKPA 1B7YB 1X31C 2GMJA 2Q3PA 1X0PA 3FEZA 4MYUA 1RAIB 3DU5A 4LRCA 2M2BA 4O4GB 2A68A 2GHWA 1FK9A 2YQ3A 3CIZA 1IXKA 3IBWA 4DDFA 2AP6A 5KFRA 5F8MA 5F3TA 4H4OA 2F8HA 2LQBA 2VUMA 2X1FA 2JL9A 4ZJQA 1XXAA 2HPUA 5C25A 3I0SA 2LDIA 3CF5Q 4DL0C 1N34J 2A18A 2VZ9A 2A1BA 1R43A 1Y1VK 2G13A 2MKCA 2HQIA 3TNVA 1UWBB 2HHVA 2VUGA 3M32B 2B6AB 3V81A 3EJMA 5M5XK 4JOUA 1YBTA 3M1VB 2CQ2A 1W2BR 4WJ3M 2R4FA 4CLKA 3GPAA 2QRRA 1RT2B 2ZEJA 4K4XA 2FQOA 1SQFA 1CG2A 3E51A 2HZVA 1OIAA 4ED7A 3TJAA 5KFWA 3ENWA 4G1PA 2VBZA 3V6DB 2Y1JA 1OSCA 1YG0A 3Q8RB 3GILA 3ONQA 2X51A 3R5DA 2AJQA 1I50K 4M5NA 2RT3A 3QIPA 4CLZA 2N4DA 1K1QA 5KG0A 3S7RA 2ZH2A 4MK7A 2QIFA 2JA5K 1LXNA 4ZVSB 3SQOP 1SUQB 4O3PA 2LXFA 3Q8SB 4KHPJ 1VIOA 3P8BB 2A69A 3N5FA 2HFUA 3WC2A 2LFVA 3V6HA 4EYHB 1EFWA 3DLEA 2V50A 3GIJA 2JA6A 2NVTK 3D5MA 3C15A 1HARA 2OLWA 3VGUA 3QIDA 4M5DA 2H5JB 3M3YK 2V9KA 1A7GE 3I32A 2DD8S 3AOBA 3DRXA 3HXAA 3CE8A 4FZVA 4USWA 4G1QA 3MM7B 1XTZA 1T11A 4FP9A 3W5ZA 8RUCA 4CNYA 4LQYA 3M8QB 2B4UA 2GZOA 2HVDA 2HRTA 2PSZA 3NBPA 3K58A 1GTHA 3NCQA 3U02A 4H54A 1BMQB 3F73A 1U48A 3DKDA 4GTDA 3GFXA 5D4DA 4HTIA 4YY3J 2DNLA 2ZZMA 4C3MA 2BX6A 5J2MA 3PEJA 4ZN1A 4V19X 1UVIA 2KO1A 3CJQA 5CABA 3M6VA 1TWFA 2ROGA 1KVJA 4CO0A 4QR2A 3QLHB 1BHNA 1FA0A 1IKVB 2YX7A 3OVAA 2R42A 4YB7A 3L4JA 1HNWJ 2OI2A 2Z8QA 3HKZL 4A3BC 4HVZA 4NXNF 1Q78A 3DN9A 2HGNA 3CCES 2RS8A 2DYAA 5A2QU 3Q2SC 4L6V3 1X4GA 4A3LK 1WKKA 4HYKA 5AE3A 4USUA 3AT1B 1LWEA 2IM0A 3M6XA 2CQCA 1F0XA 2K1RB 4UOGA 1ZA2B 3TOQA 1UWAA 2H9ZA 3TUPA 2C2KB 5A8RA 2HRYA 1N0UA 3NG8A 1LQ9A 2GJIA 3GWCA 4PQAA 1DCHA 1TFYA 1HIYA 3CGIA 4ZVUB 1X5SA 1AT1B 3KLIA 3GR1A 1FRXA 3C6UA 5F8HA 4QIGA 1UEVA 4CO2A 1I94J 3GTQA 3TUJC 1CS4B 1ZETA 2K7KA 4XSZA 2O1PA 3QSIA 2FQTA 2V8VA 4LF8F 3T1HJ 4A3LC 4DCOB 4CDIA 4Y2IA 1HI9A 2OMLA 2WVDA 5A2QY 1G1XA 4UY8T 4IDKA 4IR9A 4Y2MA 4ZLNA 1R89A 4QYZK 2XHWA 4QW9A 3EYZA 2WB1D 1NEEA 3HVRA 2NYIA 4P6QA 4MFBB 1HQMA 4IQXA 4KH1B 5IYDC 2J9DA 4EI2A 2XC9A 5LXYA 3HOVK 2OPSB 5TJ3A 2APOA 3GTOC 2VBWA 2RAQA 1SJ4P 2AGQA 1N52B 1ZZNA 1HW9A 1IKYB 3VA7A 2I5JA 1UETA 1IJFB 4IRKA 1YJUA 4QJVB 2ROPA 1QD1A 1LK7A 4IG3B 2LA6A 2MZTA 4YS2A 3UD4P 3QT8A 2QEXS 5ETSA 1XXCA 2IMWP 4O3NA 4G3IA 4I69A 2J9CA 1QAYA 2ZE2B 1VQ6S 2OD6A 1WSVA 4RNNA 3I4MC 1BS2A 1RT3B 4OZ1A 3MMLB 2HVZA 3TAMB 1MNEA 2H5EA 4OYBA 2JA7K 2JLEA 4DPOA 1FO1A 2R93C 3DRYA 1TWGC 2DGSA 2YNIB 3GTOA 2EBGA 2JA5C 2AMCB 1U1NA 2I8EA 4B17A 4MKYA 2ZBQA 3QQCD 2DGTA 3AXMA 2JOQA 1FJCA 2YH1A 1SFOA 5DQHA 4ED1A 3CMAS 2EFGA 3IMQJ 3A3OB 2CNLB 4FXVA 4O3RA 2YWEA 5IP9C 4B3SF 2R7WA 4M5LA 4JI6F 1VQOS 1R0CB 3ZTQA 3B78A 3PXGa 2LMIA 1FKPA 1CS4A 2YU9K 2CVIA 1KQGB 5ETQA 2RQCA 1H7XA 2XMWA 5HP1A 5D0RA 1PBUA 1OQ3A 4IOBA 2YX4A 3R2DJ 3J80U 2W01A 4OYWA 2B6AA 1X9WA 3HK2A 2GSUA 2BKOA 2HVEA 4QZVB 5ETRA 3DRRB 1TWGK 1GNKA 4GKJJ 3QAUA 4DR7J 4GKKJ 4RBTA 2GSNA 3MR5A 2ZITA 3MCMA 4HEA9 4F3QA 4ZPWR 2WB4A 3LH2S 3TX0A 1H0HB 2O5IA 1HNXF 4ZPAA 1XR7A 3FQKA 3GTJA 3UCZP 4WIQA 1RA6A 3BDEA 2KI2A 1WOPA 4B3RF 2GMHA 2DRAA 1BXNA 1FRLA 2IJNA 1WOOA 3EUNA 4RKUC 1DZ5A 4OQJA 4LVOP 4GMKA 3GTQC 1CJVB 1Q81T 3C8YA 2Q6BA 4H4KC 4B02A 2R92C 3GLJA 1VHFA 1QUVA 3J80Y 2WVBA 4XK8C 3BKFA 5IYBC 5A6WA 2LQ9A 5IXUA 4GO5X 2DH8A 4FBTA 3EXYA 3FRYA 2E2HK 3NBPB 3HHLB 3MR2A 1YRXA 1WG1A 2MLYA 4OYXA 2R2RA 2B51A 3FBCA 3UNYA 4LFBF 2OAUA 5A76A 5HROB 1R9TC 1U45A 4JI7J 4ES1A 1HHTP 4A8YA 3G82B 3VGVA 1I3OB 3DLGB 2Y1LB 5DS7A 1TR0A 2V4JB 1U0HA 2R3VA 1YRUA 3K5OA 1F2HA 2CPJA 4PWUA 2NUHA 3FDSA 4ALZA 3MEGB 4I6AA 1WCMK 1WI6A 3J7ZT 3PYDA 4C8LA 1H6KX 1SIZA 1B0VA 1DRZA 2ZFHA 5M2UA 4IRDA 4ILLA 3C6TA 5DG7A 1NK5A 2V2KA 3BR8A 4NYOA 2G1DA 4ECTA 1NAQA 5FJ4A 4CO5A 2CRLA 4JI4J 1S1UA 2YWHA 1FDNA 4WXWA 1DCOA 3MEDB 3BSAA 2GVZA 3HVAA 3NP5A 5J2QB 4F8RA 4PKDB 2IPOB 1WI8A 3H4BA 2CJQA 1EP4B 1RKIA 4NRTA 3KG1A 1XNQF 4LF6J 3BBBA 4KMDA 3LANA 1IM4A 5K14A 3CPWR 1ULRA 3GIKA 2QA4G 5CA5A 3SCLE 5I42B 1QSYA 3J7A1 4F2RA 2QSWA 3MAAB 2XY7A 2M9KA 5IOLA 3KHGA 4JYAJ 1X7VA 2DNYA 5KG6A 4C98A 4FKXA 1TZ0A 2FVSA 3U1LA 4A3MK 2N3LA 2VJVA 2I6WA 3L4KA 3H90A 1NSPA 4DFMA 3VGSA 2BKNA 2HS3A 1PO6A 1FEEA 1VS3A 3QZ8A 3DLBA 1UW9A 4B9MA 4CIOA 3FQLA 3DLHA 2DIVA 2XCQA 3KWMA 1ZM2A 2L9WA 2FGOA 2BEFA 1MWYA 4N5SA 5T14A 3O44A 2V6AA 4TQRA 3W60A 4QQBA 3X3UA 4XAKA 3TQEA 1U25A 3VQTA 1WC6A 1FHTA 2P9EA 3D1HA 1D9DA 1K83K 2CPDA 4B3MF 3FFIB 1KDNA 1RTIB 4IH7A 1TFWA 4C3LA 2E5LJ 2EFQA 5K8OA 2VA2A 1PG5B 1E6YB 1YQHA 2F8EX 1WHYA 5DM7Q 5E7OB 2QGFB 3GTPK 1QTMA 1DARA 4RLEA 3SCIE 2KL8A 1J98A 1R8HA 3CCJS 1BC6A 1HBOA 2NS1B 3IFEA 3CCWA 2CQBA 4A8KA 5KFPA 2RIJA 2QYCA 4V1Ak 2CG8A 1OO0B 2EFNA 3BZQA 5ETNA 3RW7A 4Q43A 2E9RX 1E6VB 4A3FC 3GEEA 4B9TA 3N3YA 1IBLJ 2C2NA 1P1TA 2XZDB 3KNAA 1WOSA 3QGIA 1VIXA 3DOLB 4KRWA 2RF2A 4C11A 1QSSA 2HMIB 3H40A 2AW0A 1J27A 1RT7A 1KKHA 5LT5A 1MROB 1N33F 4QCLA 1ELOA 2UUBJ 5T7LA 1FKAF 4BLAA 3S2DK 2QL9B 2K2PA 1FX4A 3IGVA 3SV3A 1B70B 2HQFA 3W61A 4DLGA 5GAEI 2CZ9A 4OJGA 1BDFA 5M2PA 1KHVA 2UVRA 1X60A 3BPSP 3T5HA 4MFBA 2QG9B 3P3DA 4G0VA 4R0JA 4IQMA 2CAJA 3HF5A 2K8GA 4KV8B 3Q8VA 5I3PA 2CPYA 4UTGA 1Y3JA 3SDEA 1FTCA 3K59A 2KG0A 2C3OA 4K59A 2L41A 3WDOA 2XO6A 1NKBA 1HYSB 4LRDA 2NCKL 5HBMB 2YWGA 5HI7A 3I5AA 4KV8A 4OI3A 4KKOB 3EZUA 3MAAA 3OTOJ 2HWIA 2WOMA 3QAEA 4ZCMA 3CDAA 1XR5A 1W26A 3TVKA 5CCLA 3CVKA 2MJNA 1H7WA 2YWWA 4IH5A 3HOZK 1HLWA 2AIRB 5GAEU 2ZOFA 2FPHX 1JLGB 2KHDA 4WP9A 4UUWA 1HNZF 4NYPA 2CJYB 3ILJA 3NCPA 5KTQA 2F9JA 1FI4A 1U1MA 3CMQA 1NK8A 3AXKA 4TN2A 5J1EA 3CDEA 4ZJLA 3PRBA 2JFDA 3M6UA 3D1QA 2HZAA 2M52A 4PWDA 3O8WA 1X4BA 4MIBA 5G0RB 1NHKL 4EEYA 1S6QA 5IT0A 3H3VL 3AD9C 4DN0A 3KLFA 1ACMB 4RW9B 3M4OC 3OFEA 2NLWA 3HD1A 2HG4A 3UD5A 3EVOA 2XLKA 2W9AA 2PN6A 2E66A 3TRGA 4NEYA 5ETOA 2BRLA 1VQ9S 3HOWK 2YNIA 5IT9U 3NGDA 2ILZA 4P7VA 3D67A 4N8OA 1WNEA 1QY7A 1K47A 4TY8A 2JEJA 1T9VA 1U4BA 3MEEA 3IRXB 3CD6S 4ELUA 3R7BB 3BGFA 2DTJA 2JA6K 2MXYA 2DNHA 3U1MA 3OPKA 2IFXA 2B9EA 1B4SA 3JTOA 3D68A 3D6MB 2KM8C 1AYEA 2AYEA 1RWPB 4P74A 4OJ3A 3NS5A 4JI4F 4JI3J 3G4SS 2YX1A 3TFJA 1SKWA 1YK9A 4KGZB 2H65B 2OO4A 4TYAA 2YNGB 3H0GA 3VGTA 3OR2B 1F9EB 4OYZA 5FLXU 4RUBA 3I4NK 3LWLA 4YFUA 3A4TA 4X6AC 2AEJA 4URQU 2V68A 3G6XA 5TMCA 4KO0B 4DSLA 1LW0B 1LFPA 2Z57B 1S48A 3R5CA 3QRQA 2D74B 3CCMS 4YFNA 3P4UB 4HDHA 4X4UA 2E1PA 5A0YA 2RKIB 2W2NP 4A3BK 3T1YJ 1TWFK 1K44A 1PJ7A 1TTHB 1N5QA 2BDPA 4DR5J 3QJJA 2VFUA 3TZXA 4BXXC 1URNA 2FHOB 2W7VA 3QO9B 4LR7A 2XGQA 5KG7A 2ZJPQ 2R7OA 3LP0A 4ES3A 4MEXA 3MEDA 2ILYA 1PBAA 3GIRA 3LF0A 5D4PA 4J90A 2YTCA 4KJIA 4DR1F 2J0WA 5H1SV 3VAIA 3R8YA 3W9HA 3L9ZA 3CJ4A 1GMWD 2GQQA 1LWXA 3HLUA 1NNDA 3HZGA 2CWKA 3QMQA 1K0TA 2BKPA 2B9WA 2VASA 5L39A 3LP0B 3WIVA 2F4VF 1RDRA 5I3UB 2E2HA 4ZP9A 2Y8WA 3DRSA 1Y1WA 3BGRB 2OEJA 4IO9Q 4ID5B 2QE5A 4Y3CA 2AQ4A 3ZXWA 2NXUA 4ECYA 1MWZA 5K8MA 2RVJA 2B7CB 1MMLA 4ZLLA 2E5IA 1S72S 5GAGI 3TFIA 4P73A 3N6MA 3CUNA 5E3CA 4A3KK 3S1MC 1N4LA 3VF0B 1FFSB 2QV6A 5C3EC 3EDQB 2HQDA 2FVRA 1F93A 5KFXA 2VKZG 1TK8A 4QIWL 3TVZA 1M5PC 2EW9A 1RHQB 2ZKUA 3ZO7A 1I6JA 1JXLA 3M8YA 2ZUEA 3CJSA 2ALZA 2MGZB 1RAAB 2WZ1A 4UOFA 4YUDA 2QTWA 3HHLA 1SC6A 4F67A 2XCRB 5D0GA 1O28A 4C8KA 3R5AA 4KATA 2G1HA 4BY1C 3GTJK 2COLA 1O51A 4G1QB 4DV7F 3JSYA 2VBXA 2ZZNA 1SH0A 1RTHB 3OL7A 3T00A 3GV7B 3GG1A 5L9XA 4BWJA 1PSDA 3M2RB 2B5JA 1TWCA 4P9SA 2ZHAA 2JA7C 4RU2A 2B8QA 2O5JA 2YNHA 4H4MB 5CCMA 3R3TA 4Q5SA 3GTYX 2ZDOA 4ZJOA 2FGCA 2FHJD 3ZZRA 1S6OA 2B3TB 1EETA 2RH3A 1VK8A 4NLTA 2PDAA 3SXLA 2DR9A 2VFTA 2E5GA 4LR9A 1GXUA 5K14B 2MGZA 4C3KA 3CD0A 2GHPA 1OY8A 2BBEA 7FD1A 4GTFA 5KFZA 4DL3A 2NVQK 3PACA 4RWXA 3PY8A 4CM2A 3GR0A 4WYWA 4Y7NC 2NQPA 1CQMA 3PKYA 2XS7A 1QVFR 3O3LA 3QX3A 1KONA 2OSRA 2VG5A 3JB9k 5DRKA 3K8VA 5ETMA 4BWMA 2R7ZK 1R6VA 1AW0A 1WEYA 3GCXP 4M1KA 1GXTA 1HNWF 1P1LA 1NCLA 4NRUA 1XERA 2Z0GA 1ZM3A 1M1GA 3HVTA 3K7RA 1UA0A 4ZITA 1FKPB 5IM0B 3EDRB 1F3VA 1HBUB 3UO0A 3CJ3A 3OJUA 4EYIB 4DV6J 2ATCB 1S1WB 4WJBA 3KUHA 5F9LA 2XGPA 4OLPA 1FDBA 3LA0A 1JJ4A 2HFOA 4OFZA 4Y28C 1RT6B 5EHHA 3ZZ0A 1I6VA 4HHJA 4X62F 4H4OB 4EBEA 5BYQA 2DRDA 1KS2A 4ZP8A 1D1UA 2ZUGA 4F04B 5KAKA 3H20A 5L9NA 1U09A 3NS6A 1H2VZ 4KBIA 1JNRB 1U1QA 3MHYA 5HSPA 3BPDA 3LTOA 1N34F 2O66A 3CJ5A 3M2VB 2W25A 4K2XA 5CD4A 2LU2A 3BBFA 4PQUA 3GTPC 2HFNA 4M5IA 1TUVA 2JC0A 5U47A 1K8AT 4QWAA 2IIHA 3BSCA 5HL7Q 4NLDA 4XLNA 2DR6A 2KRRA 5E3RA 4WK1A 1FJEB 4C11B 2JLFA 3G4CA 1TWCK 3HP6A 2VOOA 2OSQA 1TWHA 5BYSA 3N6NA 2WOMB 3UCUP 4F4ZA 1J5EJ 2JDJA 4A3FK 3FOEA 4ZVHA 3NWGA 1KRPA 5A8KB 3M30A 2ZH7A 2J5AA 1S1WA 3R5BA 4N56A 2MQLA 4DEZA 2YKMB 3CJ8A 4C3HC 2FHMA 2IRXA 3NAIA 4WJ4A 1C1BA 1J6XA 2AU0A 3MTJA 2CUYA 3F44A 2JFKA 3VZIA 3EWGA 3AD7C 2HHUA 1NSAA 1D09B 1OWXA 2XZTB 2BXJA 2B4OA 3QWUA 2V6SA 1AUDA 1RTDB 2QL7B 1UW4A 1AZSB 3FKIK 3FMWA 4RNFA 2NSBA 4OX9F 4WKRA 2KVIA 2X3DA 3SCJE 3M1VA 1KSPA 3A13A 2MZJA 3W2VA 1I6HC 2I9SA 4DS5A 2KRBA 3CDUA 1FNOA 2OP5A 5C7PA 3VAKA 2WONA 1TL1B 2CQ3A 4ED8A 5C25B 2GAGC 1HHQA 4H4KA 3VV2B 4I2PB 5F8JA 1OYEA 4JI6J 2CQIA 5LJ3Y 2FJDB 3LGMA 3NNHA 5SZTA 5DG9A 2NVYC 3T9NA 1R27B 1F9FA 1LXJA 3D54A 3A3NB 1VQMS 3BO4A 2QL5B 2XSJB 1IBCB 5IYDK 3DHXA 3IP0A 3GTMK 1DD5A 4Q44A 2DGUA 1H74A 3KJNB 5C4JC 3S14C 1WDTA 1WC3A 3DGPA 3JSTA 1UMJA 4IG0A 1XK8A 2OD4A 2WTFA 1RLCL 1S1VB 3IO1A 4E8UA 5KFYA 2XMJA 5IZHA 3UPFA 3UCGA 2E2IA 2RE1A 5DQGA 3DFEA 2IVFB 1KBRA 2JEFA 1B64A 3AJ2A 3EVMA 1TK5A 2UUTA 3H5SA 1SQEA 1LOUA 1S57A 1VGYA 4C4WA 4FVCA 2AZ1A 4K5RA 2DO0A 2CQ0A 4DV3F 4M1XA 1WEXA 4CM0A 2GO9A 3FJ2A 4CH7A 2BQUA 4KARA 4L75A 1WHVA 4OX6A 3KYLA 4YG2A 4FVMA 1VC0A 4EMDA 3TEHB 2BVZA 1YJNS 4KSEB 3RZDC 4DR6F 4OHVA 2A6EA 2MDAA 4NMLA 2HHTA 1RHRB 1FVQA 3RR8A 2ZUFA 1RYRA 2D9PA 2HHWA 3CJ2A 1Q8BA 2BV3A 3IR5B 2ZOMA 2IAJA 3HOXC 1PYOB 3T01A 3UFCX 2ZC3A 1R8AA 1DFDA 1RSCA 2JA5A 1V5VA 2YU9C 3JAMY 1RB0A 4EBDA 2VUMK 3Q2TC 1SC1B 4PYAA 4X2BA 1DTQA 4PZVA 1KTQA 5B0AA 5J1EB 4LT6A 5J2QA 1RQ0A 1Q8KA 1NK6A 3JYTA 1GQEA 2CJBA 4WWSA 2MZRA 4AYBL 2HLTA 2HBZB 2QLWA 1UWBA 2C2RA 4B3OB 4XPEA 1YTYA 4J7CA 1S77D 1O25A 3ITHB 5KFQA 1L3TA 1VBKA 4M5JA 2HHQA 2PC6A 1RBAA 1UPMB 4O2DA 1ZXOA 1QAXA 2J7KA 2EBBA 2KJVA 2W4CA 2PGCA 4JV1A 4LF1A 1RK8A 3D3CJ 2BZ2A 5J2NB 4DBQA 4EBCA 1X4CA 3FGVA 2EC0A 2IAJB 3EPGA 3DYAB 4JB8B 4CH0S 4OIPA 1FX2A 3WIUA 2DNKA 3H2UB 1Y3KA 2DNZA 3EGVA 3PW5A 1LWCA 3B82A 3EZ5A 3NNAA 1RTHA 2FJBB 1SCJB 3L3CA 2WHOA 2HQCA 4OV6A 3J81Y 1R8BA 1G3OA 2CADA 2I38A 1TKDA 4B3SJ 2E9TA 3QT5A 3ZFVA 1HI8A 3AB2B 1U02A 2DY1A 2ASDA 4QYRA 2E2IC 2E1CA 4WU2A 1N6QB 2VG6A 5KG2A 1TWAK 3PIPQ 3NAHA 4NEZA 5HQMA 4ED3A 5AE1A 4ZLPA 4JV5J 2D6FC 2ZH6A 2BE5A 2VC1A 3MOZA 2MY7A 4ATNA 1YCLA 2FB0A 4AXIA 4JUZA 2DKOB 2OTJS 2XULA 4NA1A 1U2FA 1H2TZ 2HNZA 3L09A 4NI2A 1C0TB 6FDRA 5AXMA 3MCNA 4K4TA 3TAMA 2OHDA 3L7OA 1NZAA 2W2PP 2FUG9 1KFSA 5GADI 4I64A 1CJTB 2HHPA 3BREA 2BE2B 3H7HB 4LF2A 2ZNZA 3QYYA 2FVQA 2GSOA 3BKTA 3N6LA 3AJDA 4X66F 1SC4B 2PE8A 3FCHA 4ZOSA 5EWGA 4OI1A 1VLOA 5DG8A 4WCEQ 1GEHA 4CO4A 4C8ZA 3SCKE 4DWIA 3PTWA 4DFPA 2HS4A 2RDDA 2M7SA 5E68A 2V8GA 4ICLB 4RUCA 2Z2LA 3V6KA 1RWOB 3IC1A 2KT5A 3O6QA 3BJYA 4URSA 1I1GA 2FQQB 1WTBA 3RBZA 3P49B 4MKVA 2WVCA 1Y5LB 2BM0A 3IRXA 1N56A 3CNQP 4KKOA 5GAGU 4DSFA 3H0GK 4H4MA 1J2VA 2VV5A 2OGUA 2FY1A 2FC8A 4BY7K 1HWLA 4KT0C 4YEAA 1MU2A 2BW2A 3R7SB 5MLCV 2PMZD 2KT3A 3QSYB 1FDAA 1C1CA 2OTLS 4CLLA 4F0MA 4DMZA 3BP8C 2CJXB 3IR7B 2WB1L 2D3OR 1N32J 1HD1A 5BR8F 4ILRA 1WC5A 2BOAA 1ZOTA 4JBCA 3TWZA 3JQMA 1DHMA 3Q23A 2F5GA 3W63A 2XWYA 3EXCX 2RHQB 2NVXC 3FC9A 2R7ZC 1EKSA 3I5CA 2LECA 4CO3A 2LA4A 4K8RA 3CMES 2HNYA 3LP1A 4P10A 3R1LA 2A2CA 2PFFB 3HMJG 3A8IA 2RD5C 3PDNA 1JJHA 5DDRC 1NU4A 4KPCA 1TKTA 5LMUF 3AODA 4DUZF 2BE9B 2YNFB 1UJ6A 2HZCA 2ZNYA 2XCOA 1KQ4A 4C2MK 4ZN3A 1PKUA 1MN9A 1QTNB 3MAQA 3GTJC 3N01A 4ZCLA 1XQIA 4A3IC 1VRTA 2RHSB 3RYLA 2IRYA 3KXDA 3PV8A 4TLQA 2WSFC 1QJHA 1YDLA 2L3MA 1S1TB 1GE9A 1SL2A 4ECWA 2V8HA 1VR6A 2YNFA 1I50C 1JB0C 1HL6A 4RBVA 1S6QB 2IBKA 1Y10A 5FJ8K 4OZ5A 3FSYA 1NDLA 4ZVFA 3T5JA 2Y0SD 1AUSL 2V4QA 2EKNA 2AYGA 1EQRA 4DXLA 1SFOK 1P9QC 1KQSR 4PUOA 1XMOF 3C66A 3LOUA 2A6HA 4EO6A 2JEGA 2MJUA 1VC5A 4HACA 3RRGA 2OPSA 2EPIA 1H38A 1GAOA 3S2DC 2K3KA 2RJZA 4IFVA 5JVGQ 3JYTB 4I7FA 1LWFA 4UZCA 3OPFA 4C2MC 2KKHA 2RRBA 4KHRA 1RWWB 3R5GA 4ZHRA 4W90B 5D4OA 4RL1A 4USTA 3HKZD 1Q7YT 3S15C 3UE2A 4F25A 4CWBA 2WCXA 2ZFZA 4P52A 4A8XA 1R0AA 5CYQB 4TLRA 3VR1A 5A0YB 2G0IA 2B7BB 3PRVA 1FRMA 2XQCA 5M5WK 1H73A 4DPWA 3WX8A 1S7IA 3M2UA 3S1QK 3JQKA 2AYMA 1NHVA 4YN3B 3HOZC 5KFVA 3L95X 3G71S 1HNIB 2H3EB 1KVKA 4ER8A 2CA9A 2XI3A 3OR2A 2LYVA 3D6HB 1VJEA 1CQNA 2CPXA 3OL6A 3M8SA 2DNOA 4DJBA 3OV7A 4Z2XA 4O3OA 2XCPA 2GGPB 2WW4A 4RBUA 3UVJA 4AL6A 1NJXA 2HKEA 5HAOA 2RNEA 5DJBA 4DF8A 1Q5YA 2IDEA 3DC2A 2YKOA 2B9XA 3PG9A 3S17K 1MLAA 2KYZA 3OTEA 2XHCA 1HNXJ 5DM6Q 3BYRA 2K7JA 1VJQA 3OTBA 2B9YA 4PPDA 2DJWA 4CLSA 5CJ9A 1WG4A 2AX0A 3M8PA 4J5OA 2IDLA 4GC6A 4CLYA 4KB4A 1FCAA 1RTJB 1R8CA 2CNKB 3S8SA 1VQ7S 4UQGA 3HJVA 1BLUA 1SUQA 3GTLK 2JEIA 1TL5A 1AB8A 2C2MB 4ZCKA 1CLFA 5D0HA 4BY7C 1KC8T 4DOZA 3KLEA 4PPZA 2C3MA 3FZ2A 1Q16B 1YJ9S 4R25A 1CC7A 1D3WA 2J0XA 1D8YA 1IWAA 4EO8A 5G0RA 5HQLA 4GO7X 4L73A 4GVBA 1Y1WC 2RSQA 3UD3P 1O5JA 2HFVA 1NK7A 2Y1RI 3C46A 3ITHA 2DITA 3OTOF 3H5XA 1PCAA 3CJ0A 1KQFB 1NSQA 4Y65A 4CLUA 2DCLA 1O0PA 1SL1A 1TU0B 4P2MA 3NGKA 4B08A 3G4AA 2J8AA 1FDDA 4J9KA 4OIOA 4YQWA 3MECB 4DLEA 1J5OA 4LVNP 2MLZA 1MMNA 1FFGB 1BY9A 3F56A 2E7XA 5HJYA 3ZZTA 4LF4J 3KJVA 5E3AA 4G7OA 1WQGA 3BH7B 1IKWB 2MZSA 1I51B 2UVVA 2W9BA 3PO2K 3QBCA 4ETZA 2YKNA 3KHRA 3G8QA 3Q83A 3P45B 1SPBP 2MKJA 4HHHA 1HI1A 2VPWB 3HCXA 4YDXA 3ZC4A 1NH8A 2O67A 3I55S 3NXZA 4EUVA 3UQSA 5HATA 2OELA 1V3RA 1FWPA 2NR0A 2HHHF 3CQZK 2RRAA 1KVIA 1N32F 3LQVA 2QLBB 5M2RA 2UUCJ 1NK9A 4DN9A 3JSMB 4FM9A 3FBFA 2J9DE 4OHZA 4ZVEA 1JIHA 3CC4S 4G7HA 4WKYA 1SJRA 2MLXA 1NMEB 2L9DA 2PEBA 3OUYA 2HGMA 3IRWP 4YR0A 4G1IA 3C14A 4JI3F 1RHJB 4X64F 1SMYA 4YHHJ 4LUBA 1FJGJ 2VFVA 4LRBA 4DV1J 3B54A 1FXRA 4GTCA 4DFKA 3OL8A 2GO8A 3AQPA 4N47A 1SH2A 2Q79A 1L3VA 4O44B 4N7TA 2BE7D 3AAWB 2RUGA 3P5TL 2Y1IA 1RT4A 1RHMB 2Z58B 2ZH4A 4UQTA 2HYIB 2XMAA 3V6DA 4ZPBA 1C4AA 2R92A 4QPTA 5HL8A 2RQ4A 3BS9A 3M7VA 4C8YA 3RB0A 1QDUB 3S14K 4WP3A 1YZ7A 3KLGB 1H98A 3HOUK 4QJVA 2GQ2A 1Y11A 4F36A 4N41A 2ALYB 3IS9B 1R31A 3AOCA 1K83C 2FIUA 1IBMF 1HD0A 4DX5A 2VDHA 3ZTRA 3OVBA 1VHIA 1SJQA 4P72A 3A3PB 2VG7A 4K4ZA 1UJ4A 1C1BB 1WJ9A 4CZCA 4Y6IA 3MURP 1TL7A 2CFAB 2F1FA 4X62J 1S0VA 4A3GC 3EX7B 3BSNA 4YP3A 3SSRA 3UI3A 3UDLA 1JVIA 3CCVS 1N5YA 3MM9B 1BQMB 1RHUB 5JVHQ 1T05A 2HHHJ 2GIFA 1S49A 1SC3B 2W1BA 3Q22A 3NMAA 2E2JK 2IC3B 4Q2MA 2DT9A 1TVRA 3A12A 4PCQA 1M5SA 1T03A 2UUBF 4ELTA 1CEZA 3KJFB 1RLDA 3T6BA 4U6PA 3HHKA 3OD2A 3X1LB 4CP5A 1VBZA 1Y5NB 4B3OA 1SKRA 2DHSA 4LFCJ 1RHKB 2VC0A 1TWGA 4RZRA 4ZMMA 1I5OB 4PR6A 3KG4A 3MMJA 4J9VA 1YZ6A 3SMZA 3T5KA 1R6YA 4AE5A 4O0IA 3RW6A 1FJGF 2XG8A 3OXFA 2FLNA 1EARA 1XZPB 4C45A 3IG1B 2W9CB 3IPJA 4M8LA 3AA8A 2JA7A 5FLXY 3TVYA 1BE4A 3ZTPA 5IOQA 2FC9A 2AEMA 3MOJB 1MG7A 2DHGA 1RCOB 3S1RC 2V6UA 1S9GA 4OYPA 2MSTA 3I6PA 4DQQA 1LV5A 1M0SA 4ZS6A 1YVFA 3HHLD 4LJMA 4DU7A 3HVTB 2ZBCA 1VK3A 3FKBA 3PRDA 2W9BB 3HHLC 1T02A 5GADU 2ASJA 1VQ5S 1XMBA 3DCAA 2R2SA 1BQNB 2C3UA 1G2EA 4LRAA 2W2MP 1X4AA 4A93K 3HI9A 4KB2A 3W2WA 4ZVOB 4B9UA 4U9RA 3T6JA 3CB4A 1F5CA 2UU9J 2JA8C 3VAHA 1O29A 4CO1A 3MM8B 1WF0A 1RTDA 3MMBA 5IQ6A 3W1YC 3G96A 2MQPA 3M3YC 3KKFA 2MQMA 1UV7A 1FXDA 3BBCA 2CPEA 5C4XC 3MPDA 1DQ8A 3IGNA 1DTTB 3PO3C 1PC5A 2UVUA 2XZWA 4NLUA 1HBNA 1IR2A 1RWKB 1WWHA 1EKRA 3OLAA 4Z7YA 4DV2F 5KT3A 4TYBA 2AX1A 4LR2A 2IC3A 3F0NA 4JI8J 3ZNJ1 4NLPA 4U67Q 4ZPCA 3T41A 1IJEB 2W7OA 1DURA 1L0WA 2PPBA 3HDSA 5M5YK 5HO4A 1D8ZA 4OYMA 2ACYA 1GMVA 4NPOA 3M6WA 2ZUAA 3AQOA 4DV0F 2XMMA 3R27A 3W8GA 3OUYB 2LQJA 2NPIA 1JJCB 2ZOGA 5IP7K 5I3QA 1JLBB 2VFRA 2H51B 5KT6A 3FEXB 4BDPA 2BOPA 3V4IA 2NPFA 3CC7S 3T02A 1ZVUA 3FKIC 4OL8A 2NYHA 1NJWA 3ELHA 1YSJA 4FXWA 5B0EA 2KG1A 1FE4A 1YJRA 5KFSA 3VAFA 3PW4A 1ZAXA 4DV4F 3TI0A 1B0TA 3GYNA 3GJSB 3H25A 4MYTA 4DX8H 3W2WB 5CZXA 4ZP7A 2GV1A 2VQEF 5IV4A 4OX8A 2CNOB 5LMNF 1I3QC 2DR5A 1BJTA 5MAOA 2ASYA 2JRSA 5DDOC 1RT1B 3HT3A 5FDLB 2ZH3A 3BQ1A 1UVLA 7AT1B 4OX7A 3O1LA 2FJAB 1L3UA 1G7CB 3T19A 3H0GC 1PJ5A 5IP7C 4PG7A 2IVMA 5A8KA 4OINA 4LJZA 2YNHB 4WZMA 2GJ2A 4YFKA 4MIAA 1R0AB 1S4EA 1FKOA 2JA6C 2VG7B 1ICEB 1TWAC 1C0UA 4BXXK 3NGRA 3J81j 1S97A 1T3OA 2NUUG 2RQMA 4A3DC 1NDKA 1X8DA 3CO0P 3BH6B 3MMAA 2NXNA 2I5JB 3A8KA 3Q86A 5B0FA 3V81B 2ATLA 2YWFA 1W2IA 2CKWA 4J9RA 2PA8L 1Q79A 2K1RA 2IM2A 3ISND 4HACB 1URRA 1JLQB 3KMSA 3G8SA 1IQTA 3KTQA 3MEEB 3TJ9A 2CPIA 4K50A 3ZZOA 5F8GA 2E1RA 4GTBA 2QYGA 1OQ6A 4E2FB 3V4IB 4DR2J 2HFZA 4A8WA 1R7IA 4AQYJ 4K0KF 2J0SD 3RZDK 4NXNJ 1HQEB 3IA0A 3DDNA 2M70A 2HGLA 1IQ0A 2HAFA 5AJ3J 4JK1A 4IOCQ 4ECXA 2KU7A 1Y1WK 2C2DA 4CNZA 2KJWA 4PXEA 3S1NC 5L1LA 3GSIA 2YPYA 4A3KC 2DEJA 4OI0A 4NLGA 4GC7A 4HDGA 5THWA 5H9FJ 1JLAB 5CH7B 3DOMA 2ZHOA 4X4NA 3MR3A 3S1QC 1TUGB 2NVYK 3VWSA 1EH1A 3QFWA 4USMA 1WCMA 1EIYB 4X84A 3KJVB 4CTAA 3OXGA 4F3OA 1UFWA 1HBMA 4FYWB 2QT7A 4DQSA 3GEIA 1LKZA 1HMVA 3OHAA 1DJ0A 1NKCA 5IP9K 1R3NA 1TKXB 1RTZA 2FJVA 4USIA 3T1HF 1JXEA 1IS1A 2NXCA 1F3FA 2AF6A 3VQSA 4TU7A 1N36J 5DDPC 1JLCA 5ETVA 3M32A 1HPZB 1OPIA 2M3DA 4RUAA 2EFVA 3S1NK 5BXIA 2LU1A 2D3UA 4DR4F 3DRPB 2XYHB 3EE3A 3W7BA 4WFBQ 1VJWA 4AD6A 3G87A 4YB5A 3M9OB 4DUYF 1O27A 2HRUA 3S1MK 1Y1VA 2R8IA 3FCVA 4A8OA 2FVCA 5KFNA 4DR6J 2MSSA 5AXLA 2QO3A 1IKWA 2VPZB 4TNOA 1T9YA 3C16B 4W98A 3H2LA 2DR8A 1TWCC 5KFUA 4I1TA 2NVTC 3MR6A 2OFHX 4DL4A 3OEPA 3HJFA 1YX2A 1CULB 1RBOB 3Q8QB 2EG2A 4DV5F 3RJMB 3G8TA 2R8HA 3TX8A 2DNNA 4JI1F 3FMBA 2Y9HA 3GFYA 1YITS 3RAQA 2G4BA 2E7VA 1V6HA 2UU9F 4ZIVA 4F4XA 2CG4A 2FTRA 3HX9A 5C24B 5IT9Y 4MKBA 3S6EA 1RABB 2V63A 4ED6A 2C22A 1AXQA 1WKLA 1IBAA 2OH2A 2KZZA 1RWNB 2F65A 3CJKB 4DDQA 1B4AA 4QWBA 2XLJA 2A10A 2W8KA 1L3SA 4JP8A 4ZDNA 1KLNA 1TL3B 4NLWA 3KK3A 3GTGA 1TAQA 3PW7A 3CULA 3M2UB 3N0VA 3TP2A 2BW7A 1R9TK 4WP8A 3WC0A 3TQ1A 1LW2A 2OEKA 5E5NA 4J37A 3MPUB 1RJJA 1LWFB 4N77A 2KXHA 1VBYA 1ZYQA 2G9OA 3WZ0A 4RW7B 4UUXA 2RILA 3MMCB 3VTIA 3CO9A 2ZVSA 3CW2C 1S1VA 1FWKA 3HOYC 2YBVA 5DQIA 3I31A 1NK0A 4IYQA 1NLKL 1Q5VA 4KAWX 1S6PB 4QR1A 2V94A 1Y9OA 3Q3QA 3PJWA 5AT1B 3GTMC 4LR8A 3B6BA 1S9EB 1C1CB 3KLGA 3GFZA 3FOFA 3E3XA 3KK2A 4DV4J 2KDOA 3DI6B 2DPJA 2Q43A 5D78A 3HO1A 4LSNA 2AHOB 1D9FA 2R8GA 3PHTA 3FZBA 4DV7J 2DVIA 1IWGA 4TU9A 2AD9A 3BN4A 2V6TA 4ZPDA 2J0QD 4IOAQ 3QWPA 2RS2A 2O3DA 4LF8J 4A3EC 1XMOJ 3MEKA 2OPQA 1XJWB 3RB4A 5C24A 3HFVA 3P5BP 1UJ5A 3M8RA 2CFAA 3ETOA 2OEMA 4KMHA 2VPXB 3DLKA 2EFOA 3RU0A 3LP1B 1VQ4S 4UW2A 3R1HA 2WVFA 1O24A 4C6AA 4A3CK 2B63A 4OX9J 1ZAVA 5CZVA 2HBRB 4UF4A 2XNRA 2J6UA 1FTRA 1U1LA 5J2MB 2F7VA 3TA1A 3W66A 5HMXA 4ID8A 5HLFB 1WACA 2DB1A 1TWAA 3ENVA 3V2UC 3HM9A 4D3GA 2Z2YB 2BE2A 3CSKA 2BJ3A 2EBEA 4EGLA 1TKZA 3RGIA 4JI7F 2HURA 3CJRA 1S1XA 2GW8A 4Q0BA 2LXIA 4MK9A 2GMLA 4RW6A 3OSPA 4ZVGA 2VB6A 4YFXA 4KM9A 1Y0HA 2W2QP 2P9GA 1RU1A 3CIMA 4LFAF 3TA2A 2UP1A 4FF1A 4ED0A 2FZKB 4X4SA 1LNQA 1R9TA 1WHWA 3KUGA 5ETPA 3FSIA 3RRHA 3LO3A 3BV8A 1VISA 3Q8PB 1QUPA 2PEHA 4NMXA 2UXDF 2AGOA 3V5RA 1HQEA 2KB2A 4KC6A 3KLFB 1CPZA 1T9TA 1SJFA 1S79A 4A3GK 3LP2A 3CQZA 2XO7A 2BJDA 1XNRF 2B5JB 1U0SA 2OMOA 1TL7B 2JJ4D 1XZPA 3TAQA 1SQGA 2XY5A 2Y0BB 3QFHA 4ZCIA 4RWWA 3HVWA 4IO1A 4AH6A 4OLOA 3FCWA 2E2JC 3H8YA 4ZHRB 4ES2A 1XIQA 3S16C 5C4XK 4DR3F 3PO2C 1PILA 4GTEA 1G4CA 1ITPA 2HS0A 3M8WA 4MTPA 2PO4A 3S15K 3CDBA 2R7VA 2NVXK 1MWQA 2CYYA 2RF2B 1X5PA 1CULA 3H2VE 2KZMA 1FFWB 2WAQL 4TY8B 2G2OA 3CD7A 3I96A 1RWMB 3HZEA 1YKWA 2GX8A 3MEGA 2H4WB 3FHZA 3GU0A 1X4HA 4U7UD 2D1CA 1USOA 5L38A 4TU8A 5HANA 3PX0A 4X4RA 2LDYA 3W62A 4NCGA 4DR7F 4GKKF 3DLJA 5F3ZA 3G82A 4ECRA 1VQ8S 4ANCA 1JKHB 3PR4A 2PMZL 4QWEA 4C0HA 4A3IK 4F4AA 3W5YA 4LRFA 2CW0A 4WFXA 5KG4A 1CJKA 4IUFA 3BDPA 1ZH5A 8ATCB 3GE9A 2MPUA 1TKTB 3KLHB 4MT1A 1UAWA 1NJZA 4KMAA 4USJC 4YY3F 3M4XA 1K73T 5CAAA 4IFVB 1ZAWA 3MPYA 3SIPB 1LK5A 3NGSA 2BANA 3IM8A 1O6XA 1U1KA 1M5OC 1NH7A 1ZBTA 4CQ1A 3MTKA 1SFOC 4OYOA 3IM9A 3MECA 2B56A 2ZH8A 1BGWA 1AB4A 2RU3A 5CYJA 2OIHA 2V2VA 4PXCA 4LMZA 1YBAA 1BWEA 2UUAJ 3G9CA 3J7Z5 2QA1A 7FDRA 4LF9F 1IR1A 1TELA 2HVHA 1AFJA 3D66A 1N8RT 5EN1A 1E6VA 2HNZB 4CLFA 1RU0A 5JVOA 3ADAC 3I0RB 1GFWB 1T9UA 4B3TF 1IBLF 4RW8A 2XWXA 3KLEB 2YKNB 4K4UA 1S10A 1NUEA 1B3TA 1RT3A 3PEHA 4M5MA 3NS7B 4QYZJ 4CT8A 4CYUB 4F7VA 2XBPA 3DM2A 4JV2A 4GFQA 4WE1A 4PABA 4DR3J 1E6YA 4WFYA 3DLGA 1TKZB 2BJ1A 4C0OC 1J6VA 2YPZA 1IR0A 1GT8A 2ZM6F 5KFLA 2XEXA 4YMEA 1VH2A 2XMTA 1KFDA 3GFHA 4ECQA 4LBPA 1F7VA 1MROA 1Q0NA 1WF1A 4PQUB 2JC1A 2ADCA 5FIIA 3R97A 4ED4A 2DR7A 2W8LA 4CCHA 1OJ4A 4YHHF 1U8WA 3HXMA 4NOHA 4J9SA 1YRTA 1M5KC 1NBEB 1YI2S 2FLLA 5DZ6A 2KHCA 3EGWB 5B08A 3C16A 4DV1F 5CD4H 5JUMA 2M8HA 2M4MA 2DPIA 2W7PA 4L72B 2VODA 2ACMA 1NM2A 2RUSA 4J9UE 4GVLA 4F02A 1DQAA 3OTDA 1LWCB 1M5HA 2VBYA 2DIUA 4QWDA 4NA3A 2GC8A 2MMYA 1SBRA 3AD8C 4KMUA 3FRZA 5DLGA 3FBBA 2NXEA 3DI6A 5M3FK 3RB6A 2EEYA 4JYAF 4X4VA 2JNJA 2ZH5A 1YIJS 3AFGA 4DG1A 5H9FK 3TJ8A 1PJ6A 4K2JA 1RACB 2FVPA 4AXJA 3CQZC 4P2FA 1O2FB 3BF4A 4LK1A 3GB0A 2DHHA 2XCAA 2R8JA 2G2YA 2HQ3A 4WU3A 4OV1A 3MUMP 5H9EK 5HP1B 3GV5B 4KDDA 1JLQA 2IM1A 4KGVB 3C19A 1EP4A 1VFJA 1S6PA 2YKQA 5KFIA 1LWEB 1EQMA 2SXLA 3QGGA 3GMGA 3D0IE 3DOMB 1Z2LA 3RAXA 1VCTA 1GMWA 5E0OA 4EWTA 1JLBA 5KFTA 4ZP6A 4K4VA 1CBKA 1IQZA 3AA9A 1TL1A 2ADBA 3ILIA 3Q8YA 4J9PA 4DSJA 2KTQA 3G86A 1WKJA 1F9NA 1CC8A 1RU2A 2W2OP 2MKYA 2MTLA 1HW8A 2ZWOA 4LF5F 2XI2A 2A0FB 4J9NA 1WC0A 3MI7X 2V4JA 4KY3A 2ZBPA 4BC7A 4DPXA 1F7UA 3CJKA 4CI0B 1U1OA 2C2OB 4PXBA 1WHXA 4GRSA 3UW1A 4C7QA 1S12A 2AZ3A 2PD1A 2N4CA 2DBBA 3VCDA 1C2PA 5LMUJ 4L3KA 2Q6CA 2BJ7A 4DUZJ 1Q1KA 3JSBA 4NX9A 4X4QA 1Y00A 3QRPA 1OS5A 1XZQB 5E41A 2B63C 1N5SA 1UEKA 3UDVA 4AFFA 1HQUA 1SI9A 3TEGA 2I1RA 2VQFJ 4QW8A 3TA0A 4AUKA 1N5TA 2QA4S 1SVDA 4UY85 2ZKTA 2L48A 3MM9A 5KFOA 4PAAA 2HHXA 1XR6A 2M0GB 3VVTA 1AROP 1C0AA 4RO0A 2CDQA 2GIRA 2HW3A 1SB6A 3PNIA 5GVQA 4BY1K 2CPFA 4R5PA 3GTQK 3I4PA 3FEYB 4GTAA 3SFUA 2LQ8A 3ETMA 3NL0A 3AOAA 1XMQF 2R7XA 3A1YG 4CT9A 3BUEA 2CVEA 5CYMA 3JQJA 3FUYA 1IE0A 3IWNC 2DK2A 3K89A 4CLPA 3IBCB 4C97A 3S2HK 3OL9A 1TV6B 2J8SA 3MCSA 1U1RA 4ZVTB 5D3GA 3CTRA 1VQNS 2KFZA 4LFBJ 2QMWA 2RGRA 4W92B 2CZ4A 2DNQA 3MM8A 4ZKAA 2JHEA 3GTKK 2QJ3A 2DGXA 4NLVA 4BKWA 2N7YA 4QPXA 2HK3A 3GONA 2VHGA 3SI8A 5IC6B
chains in the Genus database with same CATH topology
3GEEA 1VRQC 3AD9C 3ADAC 3AD8C 3GIRA 1YX2A 1PJ7A 1XZPA 1PJ6A 3A8KA 2GAGC 4P9SA 1V5VA 1VLOA 1WORA 1PJ5A 3TTGA 4PABA 1X31C 1XZQA 3GEIA 1WOSA 3GEHA 2GAHC 1WOPA 1WSVA 3TFIA 3AD7C 4PAAA 5L46A 3A8IA 1XZQB 1WOOA 3TFJA 3A8JA 3GSIA 3TFHA 1XZPB 1WSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEE A;  1VRQ C;  3AD9 C;  3ADA C;  3AD8 C;  3GIR A;  1YX2 A;  1PJ7 A;  1XZP A;  1PJ6 A;  3A8K A;  2GAG C;  4P9S A;  1V5V A;  1VLO A;  1WOR A;  1PJ5 A;  3TTG A;  4PAB A;  1X31 C;  1XZQ A;  3GEI A;  1WOS A;  3GEH A;  2GAH C;  1WOP A;  1WSV A;  3TFI A;  3AD7 C;  4PAA A;  5L46 A;  3A8I A;  1XZQ B;  1WOO A;  3TFJ A;  3A8J A;  3GSI A;  3TFH A;  1XZP B;  1WSR A; 
#chains in the Genus database with same CATH topology
 1TV6 A;  4L3N A;  4M95 A;  4QU7 A;  5HMZ A;  2BRK A;  3GTG K;  2DNR A;  4HI2 A;  2VU5 A;  1GK8 A;  3CJT A;  5KG5 A;  3E01 B;  1WG5 A;  2AKW B;  3ET6 B;  1A0O B;  1HWU A;  4FN5 A;  2E1M C;  1YLX A;  3SYZ A;  4BLG A;  3TYT A;  2F40 A;  1RT6 A;  1UTA A;  2PT0 A;  3IAM 9;  1NPK A;  3GIM A;  3UR0 A;  2FY8 A;  1K9M T;  4OHY A;  4B3T J;  1DLO B;  2KT2 A;  3K5L A;  2Z2Z A;  2G0C A;  1K0V A;  3IWX A;  4FNI A;  3FBE A;  2MHE A;  3HD2 A;  2DCU B;  2YY3 A;  1UFL A;  2B0G A;  2R7Q A;  3IXQ A;  1QLN A;  1WQH A;  4U7C A;  4JV0 A;  1JLC B;  4LQ9 A;  2LXU A;  1WTF A;  4J9O A;  3L7P A;  3C6U B;  3D0H E;  4CLT A;  1RKJ A;  2BAN B;  2MQO A;  2EK6 A;  2IYI A;  4IG3 A;  1RIS A;  2LP4 A;  3KNG A;  3O5T B;  1U6F A;  5K20 B;  1RP5 A;  4ENO A;  5KFF A;  3I5B A;  2ROE A;  4QIV A;  1VQY A;  2HFS A;  1TWH K;  1FJ7 A;  1P6T A;  1VC6 A;  3SQG B;  3ILO A;  2H1Y A;  5K8P A;  1KTV A;  2HLU A;  2ZH1 A;  3B8H A;  3QJL A;  3NEK A;  4BBY A;  2ABY A;  1MMD A;  4DX7 A;  1X4E A;  5LXR A;  5B0B A;  3W9J A;  4A3M C;  3BSO A;  4C48 A;  1ZM9 A;  4BHQ A;  4FS1 A;  1SH3 A;  5FDL A;  1RT1 A;  3KLV A;  2X1B A;  5D6G A;  1XBW A;  2F4F A;  1EQ0 A;  2VOP A;  3K7A C;  3PX4 A;  3SEO A;  4OMF G;  2HQG A;  5KOW A;  1KLM A;  2QMU B;  3GCW P;  3I9V 9;  5B09 A;  4UT4 A;  4DPY A;  1VLY A;  1FEH A;  2BAC A;  4IFY A;  3VZH A;  3LPX A;  1IBK F;  2CFX A;  2MB0 B;  3I4M K;  4C3H K;  1O2B A;  4UOH A;  4WK3 A;  3N4W A;  4QWC A;  3QO9 A;  2LLZ A;  5DO2 A;  3PFE A;  2DGW A;  1UA1 A;  1WSR A;  1ZM4 A;  4CYU A;  3RZA A;  3WBZ A;  2CJ9 A;  2J7U A;  5AJ3 F;  2E2H C;  1F2G A;  2CQ4 A;  3K7A K;  2Z4P A;  2P9C A;  1U2C A;  2HHS A;  4R5P B;  2U1A A;  3PW0 A;  4WII A;  2IY5 B;  3KG0 A;  2A6M A;  2R7U A;  2F4V J;  4MH8 A;  3DLE B;  1TUW A;  1OY6 A;  3OSN A;  3BGR A;  3PHE A;  4EK2 A;  2G0J A;  1RBL A;  1TP7 A;  3PJX A;  3KJQ B;  4IR1 A;  5LSL A;  2HVI A;  4CRJ A;  4E98 A;  2WON B;  2C2E A;  1U1P A;  4RNH A;  2UUC F;  1YNJ A;  3MMB B;  4RW6 B;  3D9B A;  2RDJ A;  4LF5 J;  2DGO A;  2NVX A;  2DNM A;  1HWI A;  2VG5 B;  3QT7 A;  2VIH A;  1W25 A;  3S2H C;  2EI5 A;  2D3Z A;  4IRC A;  1P27 B;  3SQG A;  4HTJ A;  4OHX A;  3H59 A;  1RT2 A;  4M94 A;  2RRN A;  2DIS A;  4O3S A;  4BBR C;  3NCR A;  4Y2C A;  5C4J K;  1AZS A;  3W9I A;  3GTK C;  1X4F A;  1KNZ A;  1VMB A;  4AND A;  1Y7P A;  3IR6 B;  3U7J A;  3UWT A;  5IOR A;  2CNN B;  2CZV C;  1NJY A;  1N0V C;  2BYC A;  3TUZ C;  4MQ9 A;  2VL1 A;  3DDK A;  3CD5 A;  1SIW B;  4MJK A;  3GP9 A;  1T05 B;  4NXM J;  4OZ0 A;  5HBM A;  3MPW A;  3PCO B;  1S1T A;  4NE9 C;  2ZD1 B;  1WC4 A;  2VQE J;  4KR0 B;  3BYP A;  3ISZ A;  2P2C B;  4F0K A;  1D9A A;  3H5U A;  4G0W A;  2WK4 A;  4E0D A;  3SDE B;  1VI7 A;  4AL5 A;  4WFA Q;  4X65 F;  4Q8F A;  1D0E A;  3I56 S;  4G65 A;  1J6W A;  1ROF A;  3H0P A;  1VQP S;  1LW0 A;  2OJ3 A;  4N8N A;  4AYB D;  4DV5 J;  1WEL A;  4HLB A;  5L1J A;  2RML A;  3FNN A;  5LM7 E;  2YWK A;  1U8S A;  1UPP A;  3IS9 A;  1V3Z A;  4TVA B;  2E7W A;  4Y2K A;  2WRM A;  1XMQ J;  3DXJ A;  1IBM J;  4F0H A;  1FT8 A;  4DQR A;  1BGX T;  1RAH B;  3PYG A;  3PFO A;  5RUB A;  2FJE B;  4ZH4 A;  1SKS A;  3GTP A;  1RT5 A;  2JH3 A;  1YJ7 A;  1JLG A;  1S59 A;  3GYX B;  3MD3 A;  1NPP A;  3I82 A;  4K7Q A;  3M8Z A;  3R2C J;  3T5L A;  4MMO A;  4OZL A;  3THP A;  1HWK A;  1IKX A;  4FPR A;  3D7S B;  1U7L A;  2GGP A;  1UL3 A;  1N88 A;  4LSL B;  1N5Y B;  2W4D A;  2M8D B;  4A46 A;  2CQD A;  1HYS A;  4WPA A;  3GTM A;  2YKA A;  1B7F A;  1EJ7 L;  1UVJ A;  2E5L F;  3OLB A;  3DU6 A;  2RQK A;  4DR2 F;  4AQY F;  4K0K J;  4WZQ A;  4CLW A;  4A3J K;  3EQL A;  5TMF A;  1HQ2 A;  5F8N A;  3MFI A;  1CJU A;  1F6T A;  3NRB A;  2HSE B;  1RWV B;  2M88 A;  2N82 B;  4ERD A;  3LPE A;  5KFM A;  3SBM A;  1NK4 A;  1U49 A;  4JI5 F;  4RJV A;  1SKU B;  1WQF A;  3DXS X;  1X4D A;  2U2F A;  1MW7 A;  2HEK A;  1DAX A;  3KHH A;  2ZBI A;  5H9E J;  2BJ9 A;  5HVH A;  3VAM A;  3JSM A;  4FF3 A;  4ETX A;  3MMC A;  2WBM A;  1UKU A;  3NNC A;  3IG1 A;  5E33 A;  5J1N A;  1V3S A;  1IL2 A;  2I0X A;  5KFD A;  4EFA C;  2JSX A;  1JQW A;  3JS9 A;  1FER A;  4FF2 A;  3I4N C;  2HAI A;  1QVG R;  1Q4R A;  4DZ6 A;  3RBE A;  1RYS A;  2UZA A;  4KYZ A;  1B4B A;  5IWA J;  1N33 J;  4WFN Q;  2D9O A;  3NY0 A;  2PII A;  3DXB A;  1F5A A;  1VQS A;  2P6T A;  1T94 A;  4A3J C;  4W4M A;  4B9V A;  3I0S B;  3PYE A;  3PR5 B;  3TAR A;  2V2Q A;  4ED2 A;  1HBO B;  3T1Y F;  4GTL A;  4B9S A;  3S16 K;  3HHD A;  4DR5 F;  4LRE A;  4TQS A;  4KQZ A;  4WBF A;  2GVD A;  4ZK7 M;  4O44 A;  3UDE A;  4P7T A;  1KP6 A;  2QFJ A;  1FK9 B;  3V4M A;  3DGV A;  2FLO A;  5I42 A;  5F8L A;  1S0N A;  5I3U A;  2J9E A;  1IKV A;  5IYC K;  1N6Q A;  3GQC A;  5HRO A;  2UVW A;  4RW4 A;  4F50 A;  4B9L A;  3CWJ A;  3A8J A;  5KT7 A;  2IYG A;  2OPP A;  2WSE C;  2V4R A;  4YOE A;  1JK9 B;  5EX3 A;  1JOE A;  5LOQ A;  4PWW A;  3V6J A;  3PYF A;  5IS2 A;  1P9Y A;  1NPR A;  1Y5I B;  2DO4 A;  1HNZ J;  3DOK A;  2L08 A;  1H72 C;  1TK0 A;  3PW2 A;  3ZNU A;  2OPP B;  1SL0 A;  3EGN A;  5DET A;  4LBI A;  1QAJ A;  1G51 A;  3C6T B;  1GX5 A;  5C42 A;  4RX6 A;  4KN4 A;  2B4V A;  2GAH C;  4GZY A;  4DSK A;  1U24 A;  4WIL A;  1WC1 A;  2OPQ B;  2KM8 B;  5A6P A;  3M05 A;  2XM3 A;  3EM1 A;  2J7W A;  4JI0 F;  5C2G A;  4DQP A;  4DV0 J;  2H5I B;  5EX0 A;  1S0M A;  5C3E K;  4FDF A;  1RTJ A;  3MXH P;  4C3J C;  5GME A;  3PM9 A;  1LEO A;  4XSX A;  4UOC A;  4LK0 A;  2P5M A;  2C1E B;  1RGV A;  1NSK L;  2IM3 A;  4X4T A;  1TKX A;  1ZBS A;  4DL5 A;  4Q45 A;  1N54 B;  1JXV A;  4OJH A;  2QX0 A;  3OHB A;  4XLP A;  1FES A;  4P71 A;  1NDC A;  1UVN A;  2CJK A;  3MFH A;  4ELV A;  4ECZ A;  4ILD A;  5IWA F;  1ZQ1 C;  1RUS A;  1AFI A;  3RRK A;  3GDZ A;  2UV8 A;  1HNV A;  1RAE B;  4I2Q A;  3E2E A;  5D77 A;  4IFY B;  4KB7 A;  1BQX A;  1DCP A;  2MHN A;  3LGN A;  3HSZ A;  1XPP A;  5HMY A;  1VYA A;  2VFS A;  4K4W A;  2GVD B;  2BM1 A;  1CJU B;  2R7Z A;  4OI2 A;  2F3J A;  4QIW D;  3DLL Q;  3FSX A;  4YB1 P;  3JXO A;  5C44 C;  4DPU A;  3DDI A;  4YR2 A;  4NZ0 A;  1MN7 A;  5B0G A;  4NCG B;  1HR0 F;  2QLJ B;  1FRI A;  1UVK A;  1RI7 A;  1S9F A;  2D7S A;  4I2Q B;  2DHA A;  6FD1 A;  3HPO A;  3S1R K;  2ZE2 A;  2OKQ A;  3SZ2 A;  1HMV B;  1T95 A;  2UXC J;  2P5V A;  3T9Z A;  1V9O A;  2UUW A;  3RR7 A;  3Q0A A;  4FKY A;  4NAS A;  3BGL A;  2UUA F;  1JLF A;  3QGP A;  4A3C C;  3GV8 B;  4ZA1 A;  1YBU A;  1KN6 A;  2DY9 A;  1DBD A;  3BO2 A;  4BLB A;  3R7N B;  4MAK A;  2FD2 A;  3OQ2 A;  3ULH A;  2XSJ A;  2MQN A;  3ENQ A;  3QZ7 A;  2M5Y A;  2DXF A;  5E3P A;  2W4P A;  5BR8 J;  3TZY A;  1HKA A;  1V5I B;  3QIP B;  2MZQ A;  3TZW A;  5D8H B;  1TMM A;  2OUG A;  4XIU A;  3PKM A;  4AL7 A;  3HKW A;  3ISN C;  4WXO A;  8AT1 B;  1NXI A;  1S1X B;  1REV A;  4WFZ A;  1VQK S;  2QSF A;  5IYC C;  1RTI A;  2CQH A;  3OFF A;  2H54 B;  1NB7 A;  1S0O A;  5F41 A;  9ATC B;  2CQG A;  1XNR J;  2Y3Y A;  4PYD A;  1S5Z A;  3BO3 A;  4MK8 A;  4PUO B;  4ZVQ B;  3EGZ A;  4GKJ F;  1FNM A;  4RW4 B;  2AGP A;  1IM6 A;  2DNP A;  5KT4 A;  5KT2 A;  2HBQ B;  1KD1 T;  5JFE A;  3H98 A;  1REV B;  1J5E F;  2KVQ E;  4NLY A;  1KR4 A;  2J6T A;  2FYX A;  4DUT A;  1GH8 A;  2MQQ A;  1T3N A;  2KN4 A;  5BJR A;  1LW2 B;  5F0W A;  4A8F A;  2XTJ P;  5KFC A;  2P6S A;  3BN7 A;  1GXL A;  2WSC C;  2ZVI A;  1I94 F;  2FZC B;  3LAJ A;  3VAG A;  2V69 A;  3S17 C;  2XSF A;  3M9N B;  1W7W A;  3MGJ A;  3ZZU A;  2F9D A;  2UXC F;  4LOW A;  1YNN A;  3QLH A;  3SZZ A;  1PIE A;  2XMK A;  4FNH A;  3GTL A;  2XMU A;  3CDW A;  3W65 A;  1JWW A;  4KH0 B;  5IOT A;  1VRT B;  4I4B A;  1IKX B;  1NO8 A;  4OI6 A;  4AT1 B;  4LIW A;  1IVZ A;  4S0M A;  1ZS6 A;  2HNY B;  4I68 A;  3HOV C;  2YNG A;  3KFW X;  1HNV B;  4FF4 A;  4J9Q A;  1WDD A;  1EX8 A;  3PVX A;  3OXL A;  1PYS B;  3QAT A;  4OYI A;  3D3B J;  4XCH A;  2HND B;  4Y2A A;  2FHK A;  4RNO A;  1N48 A;  3K57 A;  4PG6 A;  5DDQ C;  2V2Z A;  1FRJ A;  2MEW A;  3D2W A;  3IAS 9;  4R8U B;  2R93 A;  1P8G A;  4OJ1 A;  1RAG B;  2DGV A;  3H5Y A;  1S1U B;  1DY3 A;  1RAJ A;  4FYX B;  1WOR A;  4RW7 A;  2IBO A;  5KFH A;  1XEZ A;  2X1A A;  4QBU A;  1OYD A;  4KPY A;  4G7Z A;  4Y52 K;  2YXL A;  3K8W A;  4KC5 A;  2A6O A;  5EGH A;  5G4D A;  2Z30 B;  1O8B A;  3RUB L;  3WQP A;  4I6Y A;  3AH5 A;  4HHU A;  4LF9 J;  3K0J A;  2NRE A;  2D3O 1;  3NMR A;  5D4L A;  4Q8E A;  2PMW A;  1ZPW X;  2NXJ A;  4RW9 A;  1USM A;  3P96 A;  1HPZ A;  2LQ5 A;  3G6E S;  4WYL A;  1HQU B;  2AWZ A;  2IVY A;  3DMJ A;  4FYV B;  2LKZ A;  2VPY B;  1B0P A;  4OIQ A;  1HBN B;  1FD2 A;  1KEK A;  4PWD B;  1XNQ J;  2R92 K;  1K83 A;  4LF6 F;  4DV3 J;  4Y34 A;  4DSI A;  2I2Y A;  3FFI A;  4M63 A;  1R0B G;  4U96 A;  2LEB A;  3QRR A;  5HVG A;  3HOY K;  3LW5 C;  5GMD A;  4F3M A;  2MY8 A;  3I87 A;  3I4H X;  4ZPV R;  2Y0S L;  1TAU A;  2J76 E;  4O23 A;  4Z37 A;  4PG8 A;  1PAE X;  2B4P A;  2E5J A;  3J7A N;  2P8I A;  4OZJ A;  3CCZ A;  5IT4 A;  5HVF A;  2MKK A;  4ZVR B;  1S4F A;  3L7U A;  2V67 A;  2F8M A;  2HIY A;  2MKS A;  2VJU A;  4CH1 A;  1RAO A;  1SXL A;  2IA0 A;  3VAL A;  3MZI A;  2OFG X;  1VBX A;  3S0X A;  3PX6 A;  2C28 A;  3EMT A;  5B7W A;  5E3Q A;  2YKM A;  5DZ7 A;  3PO4 A;  1MU2 B;  1KOO A;  4D3H A;  1EK8 A;  1UCN A;  2XY6 A;  4DUY J;  1RA7 A;  2GS8 A;  5C42 B;  4A8Q A;  3J81 U;  2KYX A;  4DCJ B;  1XZQ A;  1S9E A;  4C8O A;  3THV A;  1TQL A;  2IJF A;  4LSL A;  3R6G B;  1C4C A;  1U6Z A;  3DRR A;  2R93 K;  4PEO A;  2LEP A;  3CCS S;  1VRQ C;  2C2Z B;  2D41 A;  1LFW A;  3V4G A;  3MM7 A;  5EWF A;  2FLP A;  5KOX A;  1H3D A;  1IKY A;  2KXF A;  1EET B;  4M5K A;  3SSS A;  3H4D A;  3D4J A;  3RB3 A;  3GJT B;  1HBM B;  1AA1 B;  5LSO A;  3CCU S;  1JMT A;  5B0C A;  3OFH A;  2RH6 A;  3PJ9 A;  3HUL A;  2HIQ A;  4JI1 J;  2DXE A;  2GQC A;  4N76 A;  2UXD J;  1GMU A;  3GTK A;  3PZP A;  3GG0 A;  4MKA A;  1RE1 B;  1M90 T;  4LBH A;  1O26 A;  2LVW A;  2X3G A;  2MYF A;  4DF4 A;  1HBU A;  2PMH A;  1TL3 A;  3KOA A;  4U7U K;  5EWE A;  2Z56 B;  2CWX A;  3EIC A;  3IWL A;  1XN9 A;  3DRS B;  3HFK A;  1QE1 B;  1FD8 A;  1U6B A;  2GCF A;  2UXB F;  5L46 A;  3CCT A;  2BMB A;  4NWB A;  4BS2 A;  5T41 A;  3MDF A;  2VIC A;  2H4Y B;  2QN6 B;  5EUH A;  1GX6 A;  4Q2L A;  3Q89 A;  4DL7 A;  1H2U X;  3MUV P;  3M2V A;  2KH9 A;  2GVZ B;  4O0N A;  2YQ0 A;  5KG3 A;  3PIO Q;  4QR0 A;  4OZ2 A;  5L1K A;  1EZZ B;  1YGY A;  5HQ8 A;  4WTO B;  3NWR A;  3H3V D;  2K3I A;  3N28 A;  4FZB A;  4LF7 J;  4P2X A;  3R9L A;  2JLG A;  3TFH A;  2KXN B;  1ZA1 B;  4Y52 C;  4Y00 A;  2VQF F;  2R8K A;  4IDK B;  4NLS A;  4BBS K;  5M3M K;  1RAF B;  1KOH A;  1T9X A;  4C8M A;  1M1H A;  4NLX A;  2EG1 A;  3US5 A;  1IBK J;  2ZHB A;  2ASL A;  2KWA A;  3NUH A;  4EZ6 A;  2JVO A;  2EXU A;  4LQ3 A;  3GTO K;  1Z2Z A;  5IM0 A;  1REG X;  4KHP F;  1U0H B;  2W9C A;  1QSL A;  3HOX K;  4A4J A;  2IMO A;  2C42 A;  1Q82 T;  5C2C A;  2E9Z A;  4Q7A A;  3LAK A;  3ZZZ A;  4NZ6 A;  3CAG A;  1Q8I A;  4XDD A;  2B8P A;  1VQL S;  2VUM C;  2HND A;  3D0G E;  4WE1 B;  4DSE A;  5KFK A;  1DLO A;  4PRF A;  5B0D A;  1FXL A;  4QIF A;  3AH6 A;  2DGQ A;  2JA8 K;  4RUH A;  3OR1 B;  1VGX A;  1JKH A;  4YR3 A;  3G6V A;  5IFM A;  3NOC A;  1FKO B;  4B3M J;  2O5D A;  1Q7L B;  2E29 A;  3MM6 A;  4FBU A;  2AJ0 A;  1KQK A;  5KFE A;  3GZ7 A;  4J3N A;  2CQ1 A;  5GMK a;  4YDD B;  1CSJ A;  3FK4 A;  4HT7 A;  1UP1 A;  4WTY A;  4ITS A;  2DNG A;  4I2P A;  4TKT A;  2YU9 A;  5L8R C;  1M5V C;  2Y3P A;  3BB5 A;  5A8W A;  1ZTW A;  1L5U A;  1ZYR A;  2R7S A;  4C3J K;  2PA8 D;  2QLX A;  3NLC A;  2DEI A;  2JZ5 A;  1QM9 A;  4XTT A;  4L74 A;  4HL9 A;  1TMJ A;  1FRH A;  1ZZF A;  3KK1 B;  3RZO C;  3MAH A;  2VF3 A;  4X6A K;  1SJ3 P;  4A47 A;  3C2P A;  4IH6 A;  1SV5 A;  3UR3 C;  1T9W A;  1F5B A;  3TAN A;  5KG1 A;  4BCA A;  1CVJ A;  5CQG A;  2R9L A;  5ETL A;  5EGE A;  3MMA B;  4BC9 A;  4LF7 F;  1HWJ A;  1WIH A;  3D28 A;  5ETT A;  4U8Y A;  1RAD B;  3NKY A;  4X4P A;  3S1T A;  3ERE D;  3WHI A;  3Q8U A;  2YQ1 A;  3H42 A;  4RMF A;  2XYG B;  1DQ9 A;  2R2T A;  2CIM A;  1L3K A;  3HSD A;  2AV5 A;  4QU6 A;  4GVB B;  1HA1 A;  1BUX A;  5KFA A;  3EPI A;  2X7I A;  1Z4U A;  2CQP A;  5E2Q A;  3BP3 A;  3RTV A;  4DI6 A;  5EDW A;  3RBX A;  3BEG B;  1MSW D;  3HSG A;  5LJ5 Y;  3MM6 B;  2A3J A;  4C2M A;  4Q4Z A;  2W24 A;  2LCW A;  5J2P A;  2MKI A;  2DHX A;  2MQ8 A;  2Z2M A;  1FNX H;  1I3Q K;  1BD6 A;  2XB2 D;  3W5X A;  4NCA A;  3BQ0 A;  5FLM C;  4M5G A;  3LGH A;  3E01 A;  3EZO A;  4C9D A;  1VRU A;  4DR1 J;  1PGZ A;  2FDN A;  3F41 A;  1JLE B;  1RXO B;  2FZG B;  4XDC A;  1U47 A;  5HLF A;  4RNM A;  4KIA A;  1HI0 P;  1RWU A;  1I50 A;  1YWX A;  2NZ4 A;  1T03 B;  2XYP B;  4C3I C;  4MIW A;  4ED5 A;  2EK1 A;  3PO3 K;  3HHN B;  4EU0 A;  4X66 J;  4WF9 Q;  3BM7 A;  4M5D B;  3NGT A;  3SFG A;  2VA3 A;  4DL6 A;  1JLE A;  2P8T A;  5FD1 A;  1BQM A;  2R7T A;  2H48 B;  3IBF B;  5CYM B;  1VRU B;  4Q5V A;  2V9W A;  2GIQ A;  3QGH A;  1TVR B;  1NDP A;  1FE0 A;  4UZB A;  3DMJ B;  5HN0 A;  1HNI A;  4HT5 A;  3TTG A;  5CHC B;  4LSZ B;  1EAY C;  3JTN A;  1XXB A;  4JI2 J;  2DRB A;  3RG6 A;  3T1A A;  5C44 K;  2NSC A;  5K8N A;  3TR5 A;  2B43 A;  3GYG A;  5K5M A;  5D15 A;  3E8O A;  4DU8 A;  3LAM A;  2Q66 A;  2R7R A;  4O4G A;  2FJX A;  1OMS A;  3KHL A;  3D1O A;  1DTT A;  1UEU A;  1TWF C;  3A8E A;  1RZM A;  3MCO A;  4DS4 A;  4I7F B;  3FVY A;  1F9H A;  3CED A;  4XO0 A;  5IC4 B;  3TO8 A;  1I3Q A;  2AJ2 A;  1J5O B;  5IYB K;  3K5N A;  4ZPT R;  1FF2 A;  4ECS A;  3JAM U;  4R8U A;  2UXB J;  2EKY A;  3RAM A;  1PC4 A;  1Y4Z B;  2RB7 A;  2IJR A;  4KHM A;  3BKU A;  2ZM6 J;  4KFB B;  4J9M A;  4HI1 A;  5BYR A;  3K2Y A;  3AHP A;  4P2S A;  3TZZ A;  3GSD A;  3DM2 B;  3KK1 A;  6AT1 B;  1S7H A;  3MF5 A;  2GFF A;  4DX6 A;  2V8D A;  1X0F A;  3FKI A;  2QLF B;  4PXD A;  3GJR B;  4IKA A;  1ZPV A;  2QFI A;  5F0U A;  4K4S A;  4F26 A;  3JTP A;  5DGB A;  1WUU A;  3T3F A;  4OIR A;  1A9N B;  2GHV C;  3M30 B;  4KO0 A;  3L4B C;  4NXM F;  3Q24 A;  2J6S A;  3OTC A;  1OPZ A;  2ZWP A;  1TWH C;  1UFK A;  2VKR A;  5LSR A;  2QZ8 A;  4RU9 A;  1FRK A;  4Y7N K;  2PA3 A;  1NRK A;  2AJ4 A;  5HJX A;  4TY9 A;  2XMV A;  4B3R J;  3GJQ B;  2IHR 1;  5GAH I;  2QC3 A;  2WVE A;  3M4O K;  2Y8Y A;  4GT9 A;  3MPV A;  2E5H A;  4Q0B B;  3B4M A;  3RBD A;  3ZTS A;  3RZO K;  5D3G B;  1S6U A;  1VOM A;  3GII A;  3S01 A;  2AJ1 A;  2OPR B;  3MM5 A;  3N0C A;  3HOW C;  2EWH A;  5CXT A;  3G6Y A;  3HT0 A;  5AXK A;  4J9L A;  1IUJ A;  2IA6 A;  4K4Y A;  3GTG C;  4FS2 A;  1RWX B;  2RKI A;  4DL2 A;  2JVR A;  4RW8 B;  2V34 A;  4DG1 B;  1K1S A;  1UZD A;  3DRP A;  1JJ2 R;  3MUT P;  1RT4 B;  3W64 A;  2JWN A;  4ID5 A;  2PI4 A;  5J2N A;  4OYA A;  2ERR A;  3VVU A;  4A48 A;  5KFJ A;  1RCX B;  4DV2 J;  3CC2 S;  4EZ9 A;  5F9N A;  1TL4 A;  3LAP A;  4JI8 F;  4Z7C A;  2ZC4 A;  1APS A;  2PHC B;  5GAH U;  4OZ3 A;  1FWL A;  2O01 C;  2BUN A;  3N5B A;  1Z1Z A;  4HH1 A;  1SJ1 A;  4I0W A;  2FHJ A;  4USV A;  3SSQ A;  2AEF A;  4FPI A;  3C14 B;  3CCR S;  3POT B;  3TUI C;  4C8N A;  3K5P A;  2GNK A;  4B9N A;  4JI5 J;  4P75 A;  3U1N A;  3U27 A;  3KLH A;  4ICL A;  1N36 F;  3WOD A;  4ZLJ A;  4U8V A;  4I6W A;  4FXD A;  4HKQ A;  4X64 J;  2WBR A;  2E2I K;  2MZ1 A;  4DR4 J;  1U26 A;  4F4W A;  2RU9 A;  3UNG C;  3SZY A;  4P5B A;  5IOS A;  4KGX B;  1CJT A;  3AY0 A;  2XS2 A;  5LL6 d;  3W3S A;  4O3Q A;  4KGM A;  2X1G A;  1NB2 A;  2YH0 A;  3CCQ S;  1HR0 J;  1OY9 A;  3NGU A;  4NOI A;  5LMN J;  4FYY B;  4KM8 A;  4O4R A;  4NYZ A;  3PO5 A;  3OBI A;  2BR0 A;  4L76 A;  4DPT A;  3M2R A;  2XLI A;  1BWV A;  3HHE A;  4ILM A;  3GTL C;  4KAS A;  1O2A A;  1M1K T;  2XS5 A;  1EB0 A;  4QIE A;  5AXN A;  2BQ3 A;  4ECU A;  4RR5 A;  3HOU C;  5KFB A;  1XC9 A;  2A2D A;  4URG A;  1EI6 A;  5D4N A;  4OIX A;  2FJW A;  3K5M A;  3M8Q A;  1JX4 A;  2D69 A;  2OPR A;  3MM5 B;  2NVQ C;  4PG4 A;  3POT A;  4F2S A;  1WCM C;  3HFZ B;  1C0U B;  4A3D K;  1YHQ S;  4NL5 A;  3BR9 A;  1JLF B;  1KWM A;  4DFJ A;  1CJV A;  3DOL A;  4ECV A;  1X5T A;  4ANE A;  1KLM B;  4TXS A;  4BBS C;  2VDI A;  2XNQ A;  5ADZ A;  4NCB A;  5C5J A;  2CXE A;  1JNZ B;  5IV3 A;  2VH7 A;  4MEY A;  1T8E A;  1WD6 A;  5SUH A;  3KMQ A;  3ILL A;  3UN2 A;  4LF4 F;  2R2U A;  3LP2 B;  5F8I A;  5JJB A;  1ISE A;  1NZ8 A;  2EFP A;  2BJ8 A;  3LWM A;  2VD3 A;  3UN3 A;  2PFD A;  3OFG A;  4ZVP B;  3I9Z A;  3OW2 R;  3DYA A;  2MKH A;  3QPI A;  4XPC A;  4JI0 J;  3ICL A;  2ZJR Q;  2ZDP A;  4V19 J;  3SV4 A;  3KUE A;  4LFC F;  3CXC R;  4JI2 F;  1U2R A;  1NKE A;  4KGK A;  3VAJ A;  2C3Y A;  3M8P B;  1X9M A;  3ZZY A;  5HMW A;  1X9S A;  3NOG A;  2PI5 A;  4DQI A;  3J7Y I;  3M9M B;  4KTQ A;  2CPH A;  5D0E A;  1S76 D;  2NVY A;  4P5A A;  1YJV A;  3QT6 A;  4I67 A;  2RDI A;  3CCL S;  3OT9 A;  4J91 A;  1WEZ A;  1QE1 A;  1PYT A;  2HWH A;  3C3L A;  5ETK A;  1GTE A;  1QAI A;  5I4M A;  3CT9 A;  2EVZ A;  3O2I A;  1BQN A;  3UVJ B;  1T7P A;  4X4O A;  9RUB A;  4RPF A;  4G0U A;  1Q53 A;  4F4Y A;  1I6H K;  5KT5 A;  2VON A;  5L1I A;  1F1B B;  4HH0 A;  3ET6 A;  1X5O A;  5JMN A;  4DZD A;  4A3E K;  3ZTO A;  1NHU A;  2UV8 G;  3I0R A;  2QMX A;  2JX2 A;  3GEH A;  2AT1 B;  3TW0 A;  5K9F A;  1HFE L;  2K06 A;  3MD1 A;  4KAI A;  5J1P A;  4DCP B;  4I56 A;  3OR1 A;  4U95 A;  4K5S A;  5T7L B;  3LAL A;  4OI4 A;  5CYQ A;  5JXS A;  3P6Y C;  4LSN B;  3ZZP A;  2E44 A;  3D6T B;  2HK2 A;  1T0T V;  2GA7 A;  1N5V A;  1YJW S;  1S99 A;  4HR2 A;  2KFN A;  1INN A;  2HMI A;  4G6V B;  4BBR K;  3THT A;  2NZC A;  4NLO A;  3DOK B;  4KFB A;  3AB4 B;  4CTA B;  4LFA J;  3DGP B;  3BGO P;  2WAQ D;  3WX4 A;  4KE5 A;  2F63 A;  3DNC A;  1Q86 T;  5KFG A;  1EHW A;  5DLF A;  5A8W B;  1CJK B;  3MWB A;  5AE2 A;  5J2P B;  3DLK B;  4C0B A;  3DHW C;  2YVS A;  4NI2 B;  3KK3 B;  5DGA A;  1PAU B;  1IN0 A;  3N0B A;  3LUY A;  4USK A;  3UDC A;  3G2X A;  3KDO A;  2BQR A;  2POK A;  2HBY B;  1B99 A;  1WF2 A;  2C3P A;  4QOT A;  5FLM K;  2ZD1 A;  3J7Y U;  3JSR A;  3BGU A;  1UVM A;  2V8P A;  2ZZT A;  4A8M P;  1G6B A;  4Y0F A;  1FVS A;  1NJI T;  3ENA A;  4YB6 A;  2E1A A;  3LPY A;  1A6L A;  4C3I K;  3HSJ A;  3UN5 A;  4NLR A;  1HHS A;  4PG5 A;  3MR7 A;  2V5H G;  2IRU A;  2BA9 A;  2L9N A;  2BJE A;  2EC2 A;  1KHW A;  3OVS A;  3W2V B;  1OSD A;  3QNW B;  3KDN A;  3D6F B;  4NZ7 A;  1YJT A;  3N79 A;  2DH9 A;  4JV5 F;  2ZBR A;  1Q95 G;  4DHV A;  2B63 K;  2W7A A;  4LLG A;  1IW7 A;  3R5J B;  3AJ1 A;  1JLA A;  4A8S A;  5ITH A;  5EGY A;  4F4K A;  2KFY A;  3BQ2 A;  1F60 B;  3N9U C;  4R0E A;  1S9G B;  3TAP A;  4OZN A;  1C0T A;  2ZH9 A;  5IQQ A;  3R6L B;  2CDR B;  4LIR A;  2BAB A;  2N3O A;  3KLI B;  2G2Z A;  3QJP A;  2WW8 A;  3KK2 B;  1JQG A;  2DH7 A;  1XWL A;  2DXD A;  2CPZ A;  2AJF E;  5A8R B;  3EVW A;  1ZTT A;  3ORE A;  1SV5 B;  4X65 J;  5CHP A;  3IN5 A;  2ZJQ Q;  2N7C A;  3B4D A;  2VG6 B;  5HK4 A;  2CJA A;  4USH A;  4NLQ A;  4A93 C;  4FYD A;  1Y1V C;  1R8P A;  2Q1L A;  1RT5 B;  1Q8L A;  3W8P A;  4NA2 A;  1UZH A;  1DTQ B;  4ZIW A;  3VHQ A;  4IG0 B;  1RT7 B;  2HWT A;  3K17 A;  2AYB A;  2GJF A;  2QA2 A;  3C15 B;  4DV6 F;  2LEA A;  2V0N A;  3OJS A;  4KN7 A;  4OHW A;  1VDH A;  4M5H A;  2YKP A;  1B7Y B;  1X31 C;  2GMJ A;  2Q3P A;  1X0P A;  3FEZ A;  4MYU A;  1RAI B;  3DU5 A;  4LRC A;  2M2B A;  4O4G B;  2A68 A;  2GHW A;  1FK9 A;  2YQ3 A;  3CIZ A;  1IXK A;  3IBW A;  4DDF A;  2AP6 A;  5KFR A;  5F8M A;  5F3T A;  4H4O A;  2F8H A;  2LQB A;  2VUM A;  2X1F A;  2JL9 A;  4ZJQ A;  1XXA A;  2HPU A;  5C25 A;  3I0S A;  2LDI A;  3CF5 Q;  4DL0 C;  1N34 J;  2A18 A;  2VZ9 A;  2A1B A;  1R43 A;  1Y1V K;  2G13 A;  2MKC A;  2HQI A;  3TNV A;  1UWB B;  2HHV A;  2VUG A;  3M32 B;  2B6A B;  3V81 A;  3EJM A;  5M5X K;  4JOU A;  1YBT A;  3M1V B;  2CQ2 A;  1W2B R;  4WJ3 M;  2R4F A;  4CLK A;  3GPA A;  2QRR A;  1RT2 B;  2ZEJ A;  4K4X A;  2FQO A;  1SQF A;  1CG2 A;  3E51 A;  2HZV A;  1OIA A;  4ED7 A;  3TJA A;  5KFW A;  3ENW A;  4G1P A;  2VBZ A;  3V6D B;  2Y1J A;  1OSC A;  1YG0 A;  3Q8R B;  3GIL A;  3ONQ A;  2X51 A;  3R5D A;  2AJQ A;  1I50 K;  4M5N A;  2RT3 A;  3QIP A;  4CLZ A;  2N4D A;  1K1Q A;  5KG0 A;  3S7R A;  2ZH2 A;  4MK7 A;  2QIF A;  2JA5 K;  1LXN A;  4ZVS B;  3SQO P;  1SUQ B;  4O3P A;  2LXF A;  3Q8S B;  4KHP J;  1VIO A;  3P8B B;  2A69 A;  3N5F A;  2HFU A;  3WC2 A;  2LFV A;  3V6H A;  4EYH B;  1EFW A;  3DLE A;  2V50 A;  3GIJ A;  2JA6 A;  2NVT K;  3D5M A;  3C15 A;  1HAR A;  2OLW A;  3VGU A;  3QID A;  4M5D A;  2H5J B;  3M3Y K;  2V9K A;  1A7G E;  3I32 A;  2DD8 S;  3AOB A;  3DRX A;  3HXA A;  3CE8 A;  4FZV A;  4USW A;  4G1Q A;  3MM7 B;  1XTZ A;  1T11 A;  4FP9 A;  3W5Z A;  8RUC A;  4CNY A;  4LQY A;  3M8Q B;  2B4U A;  2GZO A;  2HVD A;  2HRT A;  2PSZ A;  3NBP A;  3K58 A;  1GTH A;  3NCQ A;  3U02 A;  4H54 A;  1BMQ B;  3F73 A;  1U48 A;  3DKD A;  4GTD A;  3GFX A;  5D4D A;  4HTI A;  4YY3 J;  2DNL A;  2ZZM A;  4C3M A;  2BX6 A;  5J2M A;  3PEJ A;  4ZN1 A;  4V19 X;  1UVI A;  2KO1 A;  3CJQ A;  5CAB A;  3M6V A;  1TWF A;  2ROG A;  1KVJ A;  4CO0 A;  4QR2 A;  3QLH B;  1BHN A;  1FA0 A;  1IKV B;  2YX7 A;  3OVA A;  2R42 A;  4YB7 A;  3L4J A;  1HNW J;  2OI2 A;  2Z8Q A;  3HKZ L;  4A3B C;  4HVZ A;  4NXN F;  1Q78 A;  3DN9 A;  2HGN A;  3CCE S;  2RS8 A;  2DYA A;  5A2Q U;  3Q2S C;  4L6V 3;  1X4G A;  4A3L K;  1WKK A;  4HYK A;  5AE3 A;  4USU A;  3AT1 B;  1LWE A;  2IM0 A;  3M6X A;  2CQC A;  1F0X A;  2K1R B;  4UOG A;  1ZA2 B;  3TOQ A;  1UWA A;  2H9Z A;  3TUP A;  2C2K B;  5A8R A;  2HRY A;  1N0U A;  3NG8 A;  1LQ9 A;  2GJI A;  3GWC A;  4PQA A;  1DCH A;  1TFY A;  1HIY A;  3CGI A;  4ZVU B;  1X5S A;  1AT1 B;  3KLI A;  3GR1 A;  1FRX A;  3C6U A;  5F8H A;  4QIG A;  1UEV A;  4CO2 A;  1I94 J;  3GTQ A;  3TUJ C;  1CS4 B;  1ZET A;  2K7K A;  4XSZ A;  2O1P A;  3QSI A;  2FQT A;  2V8V A;  4LF8 F;  3T1H J;  4A3L C;  4DCO B;  4CDI A;  4Y2I A;  1HI9 A;  2OML A;  2WVD A;  5A2Q Y;  1G1X A;  4UY8 T;  4IDK A;  4IR9 A;  4Y2M A;  4ZLN A;  1R89 A;  4QYZ K;  2XHW A;  4QW9 A;  3EYZ A;  2WB1 D;  1NEE A;  3HVR A;  2NYI A;  4P6Q A;  4MFB B;  1HQM A;  4IQX A;  4KH1 B;  5IYD C;  2J9D A;  4EI2 A;  2XC9 A;  5LXY A;  3HOV K;  2OPS B;  5TJ3 A;  2APO A;  3GTO C;  2VBW A;  2RAQ A;  1SJ4 P;  2AGQ A;  1N52 B;  1ZZN A;  1HW9 A;  1IKY B;  3VA7 A;  2I5J A;  1UET A;  1IJF B;  4IRK A;  1YJU A;  4QJV B;  2ROP A;  1QD1 A;  1LK7 A;  4IG3 B;  2LA6 A;  2MZT A;  4YS2 A;  3UD4 P;  3QT8 A;  2QEX S;  5ETS A;  1XXC A;  2IMW P;  4O3N A;  4G3I A;  4I69 A;  2J9C A;  1QAY A;  2ZE2 B;  1VQ6 S;  2OD6 A;  1WSV A;  4RNN A;  3I4M C;  1BS2 A;  1RT3 B;  4OZ1 A;  3MML B;  2HVZ A;  3TAM B;  1MNE A;  2H5E A;  4OYB A;  2JA7 K;  2JLE A;  4DPO A;  1FO1 A;  2R93 C;  3DRY A;  1TWG C;  2DGS A;  2YNI B;  3GTO A;  2EBG A;  2JA5 C;  2AMC B;  1U1N A;  2I8E A;  4B17 A;  4MKY A;  2ZBQ A;  3QQC D;  2DGT A;  3AXM A;  2JOQ A;  1FJC A;  2YH1 A;  1SFO A;  5DQH A;  4ED1 A;  3CMA S;  2EFG A;  3IMQ J;  3A3O B;  2CNL B;  4FXV A;  4O3R A;  2YWE A;  5IP9 C;  4B3S F;  2R7W A;  4M5L A;  4JI6 F;  1VQO S;  1R0C B;  3ZTQ A;  3B78 A;  3PXG a;  2LMI A;  1FKP A;  1CS4 A;  2YU9 K;  2CVI A;  1KQG B;  5ETQ A;  2RQC A;  1H7X A;  2XMW A;  5HP1 A;  5D0R A;  1PBU A;  1OQ3 A;  4IOB A;  2YX4 A;  3R2D J;  3J80 U;  2W01 A;  4OYW A;  2B6A A;  1X9W A;  3HK2 A;  2GSU A;  2BKO A;  2HVE A;  4QZV B;  5ETR A;  3DRR B;  1TWG K;  1GNK A;  4GKJ J;  3QAU A;  4DR7 J;  4GKK J;  4RBT A;  2GSN A;  3MR5 A;  2ZIT A;  3MCM A;  4HEA 9;  4F3Q A;  4ZPW R;  2WB4 A;  3LH2 S;  3TX0 A;  1H0H B;  2O5I A;  1HNX F;  4ZPA A;  1XR7 A;  3FQK A;  3GTJ A;  3UCZ P;  4WIQ A;  1RA6 A;  3BDE A;  2KI2 A;  1WOP A;  4B3R F;  2GMH A;  2DRA A;  1BXN A;  1FRL A;  2IJN A;  1WOO A;  3EUN A;  4RKU C;  1DZ5 A;  4OQJ A;  4LVO P;  4GMK A;  3GTQ C;  1CJV B;  1Q81 T;  3C8Y A;  2Q6B A;  4H4K C;  4B02 A;  2R92 C;  3GLJ A;  1VHF A;  1QUV A;  3J80 Y;  2WVB A;  4XK8 C;  3BKF A;  5IYB C;  5A6W A;  2LQ9 A;  5IXU A;  4GO5 X;  2DH8 A;  4FBT A;  3EXY A;  3FRY A;  2E2H K;  3NBP B;  3HHL B;  3MR2 A;  1YRX A;  1WG1 A;  2MLY A;  4OYX A;  2R2R A;  2B51 A;  3FBC A;  3UNY A;  4LFB F;  2OAU A;  5A76 A;  5HRO B;  1R9T C;  1U45 A;  4JI7 J;  4ES1 A;  1HHT P;  4A8Y A;  3G82 B;  3VGV A;  1I3O B;  3DLG B;  2Y1L B;  5DS7 A;  1TR0 A;  2V4J B;  1U0H A;  2R3V A;  1YRU A;  3K5O A;  1F2H A;  2CPJ A;  4PWU A;  2NUH A;  3FDS A;  4ALZ A;  3MEG B;  4I6A A;  1WCM K;  1WI6 A;  3J7Z T;  3PYD A;  4C8L A;  1H6K X;  1SIZ A;  1B0V A;  1DRZ A;  2ZFH A;  5M2U A;  4IRD A;  4ILL A;  3C6T A;  5DG7 A;  1NK5 A;  2V2K A;  3BR8 A;  4NYO A;  2G1D A;  4ECT A;  1NAQ A;  5FJ4 A;  4CO5 A;  2CRL A;  4JI4 J;  1S1U A;  2YWH A;  1FDN A;  4WXW A;  1DCO A;  3MED B;  3BSA A;  2GVZ A;  3HVA A;  3NP5 A;  5J2Q B;  4F8R A;  4PKD B;  2IPO B;  1WI8 A;  3H4B A;  2CJQ A;  1EP4 B;  1RKI A;  4NRT A;  3KG1 A;  1XNQ F;  4LF6 J;  3BBB A;  4KMD A;  3LAN A;  1IM4 A;  5K14 A;  3CPW R;  1ULR A;  3GIK A;  2QA4 G;  5CA5 A;  3SCL E;  5I42 B;  1QSY A;  3J7A 1;  4F2R A;  2QSW A;  3MAA B;  2XY7 A;  2M9K A;  5IOL A;  3KHG A;  4JYA J;  1X7V A;  2DNY A;  5KG6 A;  4C98 A;  4FKX A;  1TZ0 A;  2FVS A;  3U1L A;  4A3M K;  2N3L A;  2VJV A;  2I6W A;  3L4K A;  3H90 A;  1NSP A;  4DFM A;  3VGS A;  2BKN A;  2HS3 A;  1PO6 A;  1FEE A;  1VS3 A;  3QZ8 A;  3DLB A;  1UW9 A;  4B9M A;  4CIO A;  3FQL A;  3DLH A;  2DIV A;  2XCQ A;  3KWM A;  1ZM2 A;  2L9W A;  2FGO A;  2BEF A;  1MWY A;  4N5S A;  5T14 A;  3O44 A;  2V6A A;  4TQR A;  3W60 A;  4QQB A;  3X3U A;  4XAK A;  3TQE A;  1U25 A;  3VQT A;  1WC6 A;  1FHT A;  2P9E A;  3D1H A;  1D9D A;  1K83 K;  2CPD A;  4B3M F;  3FFI B;  1KDN A;  1RTI B;  4IH7 A;  1TFW A;  4C3L A;  2E5L J;  2EFQ A;  5K8O A;  2VA2 A;  1PG5 B;  1E6Y B;  1YQH A;  2F8E X;  1WHY A;  5DM7 Q;  5E7O B;  2QGF B;  3GTP K;  1QTM A;  1DAR A;  4RLE A;  3SCI E;  2KL8 A;  1J98 A;  1R8H A;  3CCJ S;  1BC6 A;  1HBO A;  2NS1 B;  3IFE A;  3CCW A;  2CQB A;  4A8K A;  5KFP A;  2RIJ A;  2QYC A;  4V1A k;  2CG8 A;  1OO0 B;  2EFN A;  3BZQ A;  5ETN A;  3RW7 A;  4Q43 A;  2E9R X;  1E6V B;  4A3F C;  3GEE A;  4B9T A;  3N3Y A;  1IBL J;  2C2N A;  1P1T A;  2XZD B;  3KNA A;  1WOS A;  3QGI A;  1VIX A;  3DOL B;  4KRW A;  2RF2 A;  4C11 A;  1QSS A;  2HMI B;  3H40 A;  2AW0 A;  1J27 A;  1RT7 A;  1KKH A;  5LT5 A;  1MRO B;  1N33 F;  4QCL A;  1ELO A;  2UUB J;  5T7L A;  1FKA F;  4BLA A;  3S2D K;  2QL9 B;  2K2P A;  1FX4 A;  3IGV A;  3SV3 A;  1B70 B;  2HQF A;  3W61 A;  4DLG A;  5GAE I;  2CZ9 A;  4OJG A;  1BDF A;  5M2P A;  1KHV A;  2UVR A;  1X60 A;  3BPS P;  3T5H A;  4MFB A;  2QG9 B;  3P3D A;  4G0V A;  4R0J A;  4IQM A;  2CAJ A;  3HF5 A;  2K8G A;  4KV8 B;  3Q8V A;  5I3P A;  2CPY A;  4UTG A;  1Y3J A;  3SDE A;  1FTC A;  3K59 A;  2KG0 A;  2C3O A;  4K59 A;  2L41 A;  3WDO A;  2XO6 A;  1NKB A;  1HYS B;  4LRD A;  2NCK L;  5HBM B;  2YWG A;  5HI7 A;  3I5A A;  4KV8 A;  4OI3 A;  4KKO B;  3EZU A;  3MAA A;  3OTO J;  2HWI A;  2WOM A;  3QAE A;  4ZCM A;  3CDA A;  1XR5 A;  1W26 A;  3TVK A;  5CCL A;  3CVK A;  2MJN A;  1H7W A;  2YWW A;  4IH5 A;  3HOZ K;  1HLW A;  2AIR B;  5GAE U;  2ZOF A;  2FPH X;  1JLG B;  2KHD A;  4WP9 A;  4UUW A;  1HNZ F;  4NYP A;  2CJY B;  3ILJ A;  3NCP A;  5KTQ A;  2F9J A;  1FI4 A;  1U1M A;  3CMQ A;  1NK8 A;  3AXK A;  4TN2 A;  5J1E A;  3CDE A;  4ZJL A;  3PRB A;  2JFD A;  3M6U A;  3D1Q A;  2HZA A;  2M52 A;  4PWD A;  3O8W A;  1X4B A;  4MIB A;  5G0R B;  1NHK L;  4EEY A;  1S6Q A;  5IT0 A;  3H3V L;  3AD9 C;  4DN0 A;  3KLF A;  1ACM B;  4RW9 B;  3M4O C;  3OFE A;  2NLW A;  3HD1 A;  2HG4 A;  3UD5 A;  3EVO A;  2XLK A;  2W9A A;  2PN6 A;  2E66 A;  3TRG A;  4NEY A;  5ETO A;  2BRL A;  1VQ9 S;  3HOW K;  2YNI A;  5IT9 U;  3NGD A;  2ILZ A;  4P7V A;  3D67 A;  4N8O A;  1WNE A;  1QY7 A;  1K47 A;  4TY8 A;  2JEJ A;  1T9V A;  1U4B A;  3MEE A;  3IRX B;  3CD6 S;  4ELU A;  3R7B B;  3BGF A;  2DTJ A;  2JA6 K;  2MXY A;  2DNH A;  3U1M A;  3OPK A;  2IFX A;  2B9E A;  1B4S A;  3JTO A;  3D68 A;  3D6M B;  2KM8 C;  1AYE A;  2AYE A;  1RWP B;  4P74 A;  4OJ3 A;  3NS5 A;  4JI4 F;  4JI3 J;  3G4S S;  2YX1 A;  3TFJ A;  1SKW A;  1YK9 A;  4KGZ B;  2H65 B;  2OO4 A;  4TYA A;  2YNG B;  3H0G A;  3VGT A;  3OR2 B;  1F9E B;  4OYZ A;  5FLX U;  4RUB A;  3I4N K;  3LWL A;  4YFU A;  3A4T A;  4X6A C;  2AEJ A;  4URQ U;  2V68 A;  3G6X A;  5TMC A;  4KO0 B;  4DSL A;  1LW0 B;  1LFP A;  2Z57 B;  1S48 A;  3R5C A;  3QRQ A;  2D74 B;  3CCM S;  4YFN A;  3P4U B;  4HDH A;  4X4U A;  2E1P A;  5A0Y A;  2RKI B;  2W2N P;  4A3B K;  3T1Y J;  1TWF K;  1K44 A;  1PJ7 A;  1TTH B;  1N5Q A;  2BDP A;  4DR5 J;  3QJJ A;  2VFU A;  3TZX A;  4BXX C;  1URN A;  2FHO B;  2W7V A;  3QO9 B;  4LR7 A;  2XGQ A;  5KG7 A;  2ZJP Q;  2R7O A;  3LP0 A;  4ES3 A;  4MEX A;  3MED A;  2ILY A;  1PBA A;  3GIR A;  3LF0 A;  5D4P A;  4J90 A;  2YTC A;  4KJI A;  4DR1 F;  2J0W A;  5H1S V;  3VAI A;  3R8Y A;  3W9H A;  3L9Z A;  3CJ4 A;  1GMW D;  2GQQ A;  1LWX A;  3HLU A;  1NND A;  3HZG A;  2CWK A;  3QMQ A;  1K0T A;  2BKP A;  2B9W A;  2VAS A;  5L39 A;  3LP0 B;  3WIV A;  2F4V F;  1RDR A;  5I3U B;  2E2H A;  4ZP9 A;  2Y8W A;  3DRS A;  1Y1W A;  3BGR B;  2OEJ A;  4IO9 Q;  4ID5 B;  2QE5 A;  4Y3C A;  2AQ4 A;  3ZXW A;  2NXU A;  4ECY A;  1MWZ A;  5K8M A;  2RVJ A;  2B7C B;  1MML A;  4ZLL A;  2E5I A;  1S72 S;  5GAG I;  3TFI A;  4P73 A;  3N6M A;  3CUN A;  5E3C A;  4A3K K;  3S1M C;  1N4L A;  3VF0 B;  1FFS B;  2QV6 A;  5C3E C;  3EDQ B;  2HQD A;  2FVR A;  1F93 A;  5KFX A;  2VKZ G;  1TK8 A;  4QIW L;  3TVZ A;  1M5P C;  2EW9 A;  1RHQ B;  2ZKU A;  3ZO7 A;  1I6J A;  1JXL A;  3M8Y A;  2ZUE A;  3CJS A;  2ALZ A;  2MGZ B;  1RAA B;  2WZ1 A;  4UOF A;  4YUD A;  2QTW A;  3HHL A;  1SC6 A;  4F67 A;  2XCR B;  5D0G A;  1O28 A;  4C8K A;  3R5A A;  4KAT A;  2G1H A;  4BY1 C;  3GTJ K;  2COL A;  1O51 A;  4G1Q B;  4DV7 F;  3JSY A;  2VBX A;  2ZZN A;  1SH0 A;  1RTH B;  3OL7 A;  3T00 A;  3GV7 B;  3GG1 A;  5L9X A;  4BWJ A;  1PSD A;  3M2R B;  2B5J A;  1TWC A;  4P9S A;  2ZHA A;  2JA7 C;  4RU2 A;  2B8Q A;  2O5J A;  2YNH A;  4H4M B;  5CCM A;  3R3T A;  4Q5S A;  3GTY X;  2ZDO A;  4ZJO A;  2FGC A;  2FHJ D;  3ZZR A;  1S6O A;  2B3T B;  1EET A;  2RH3 A;  1VK8 A;  4NLT A;  2PDA A;  3SXL A;  2DR9 A;  2VFT A;  2E5G A;  4LR9 A;  1GXU A;  5K14 B;  2MGZ A;  4C3K A;  3CD0 A;  2GHP A;  1OY8 A;  2BBE A;  7FD1 A;  4GTF A;  5KFZ A;  4DL3 A;  2NVQ K;  3PAC A;  4RWX A;  3PY8 A;  4CM2 A;  3GR0 A;  4WYW A;  4Y7N C;  2NQP A;  1CQM A;  3PKY A;  2XS7 A;  1QVF R;  3O3L A;  3QX3 A;  1KON A;  2OSR A;  2VG5 A;  3JB9 k;  5DRK A;  3K8V A;  5ETM A;  4BWM A;  2R7Z K;  1R6V A;  1AW0 A;  1WEY A;  3GCX P;  4M1K A;  1GXT A;  1HNW F;  1P1L A;  1NCL A;  4NRU A;  1XER A;  2Z0G A;  1ZM3 A;  1M1G A;  3HVT A;  3K7R A;  1UA0 A;  4ZIT A;  1FKP B;  5IM0 B;  3EDR B;  1F3V A;  1HBU B;  3UO0 A;  3CJ3 A;  3OJU A;  4EYI B;  4DV6 J;  2ATC B;  1S1W B;  4WJB A;  3KUH A;  5F9L A;  2XGP A;  4OLP A;  1FDB A;  3LA0 A;  1JJ4 A;  2HFO A;  4OFZ A;  4Y28 C;  1RT6 B;  5EHH A;  3ZZ0 A;  1I6V A;  4HHJ A;  4X62 F;  4H4O B;  4EBE A;  5BYQ A;  2DRD A;  1KS2 A;  4ZP8 A;  1D1U A;  2ZUG A;  4F04 B;  5KAK A;  3H20 A;  5L9N A;  1U09 A;  3NS6 A;  1H2V Z;  4KBI A;  1JNR B;  1U1Q A;  3MHY A;  5HSP A;  3BPD A;  3LTO A;  1N34 F;  2O66 A;  3CJ5 A;  3M2V B;  2W25 A;  4K2X A;  5CD4 A;  2LU2 A;  3BBF A;  4PQU A;  3GTP C;  2HFN A;  4M5I A;  1TUV A;  2JC0 A;  5U47 A;  1K8A T;  4QWA A;  2IIH A;  3BSC A;  5HL7 Q;  4NLD A;  4XLN A;  2DR6 A;  2KRR A;  5E3R A;  4WK1 A;  1FJE B;  4C11 B;  2JLF A;  3G4C A;  1TWC K;  3HP6 A;  2VOO A;  2OSQ A;  1TWH A;  5BYS A;  3N6N A;  2WOM B;  3UCU P;  4F4Z A;  1J5E J;  2JDJ A;  4A3F K;  3FOE A;  4ZVH A;  3NWG A;  1KRP A;  5A8K B;  3M30 A;  2ZH7 A;  2J5A A;  1S1W A;  3R5B A;  4N56 A;  2MQL A;  4DEZ A;  2YKM B;  3CJ8 A;  4C3H C;  2FHM A;  2IRX A;  3NAI A;  4WJ4 A;  1C1B A;  1J6X A;  2AU0 A;  3MTJ A;  2CUY A;  3F44 A;  2JFK A;  3VZI A;  3EWG A;  3AD7 C;  2HHU A;  1NSA A;  1D09 B;  1OWX A;  2XZT B;  2BXJ A;  2B4O A;  3QWU A;  2V6S A;  1AUD A;  1RTD B;  2QL7 B;  1UW4 A;  1AZS B;  3FKI K;  3FMW A;  4RNF A;  2NSB A;  4OX9 F;  4WKR A;  2KVI A;  2X3D A;  3SCJ E;  3M1V A;  1KSP A;  3A13 A;  2MZJ A;  3W2V A;  1I6H C;  2I9S A;  4DS5 A;  2KRB A;  3CDU A;  1FNO A;  2OP5 A;  5C7P A;  3VAK A;  2WON A;  1TL1 B;  2CQ3 A;  4ED8 A;  5C25 B;  2GAG C;  1HHQ A;  4H4K A;  3VV2 B;  4I2P B;  5F8J A;  1OYE A;  4JI6 J;  2CQI A;  5LJ3 Y;  2FJD B;  3LGM A;  3NNH A;  5SZT A;  5DG9 A;  2NVY C;  3T9N A;  1R27 B;  1F9F A;  1LXJ A;  3D54 A;  3A3N B;  1VQM S;  3BO4 A;  2QL5 B;  2XSJ B;  1IBC B;  5IYD K;  3DHX A;  3IP0 A;  3GTM K;  1DD5 A;  4Q44 A;  2DGU A;  1H74 A;  3KJN B;  5C4J C;  3S14 C;  1WDT A;  1WC3 A;  3DGP A;  3JST A;  1UMJ A;  4IG0 A;  1XK8 A;  2OD4 A;  2WTF A;  1RLC L;  1S1V B;  3IO1 A;  4E8U A;  5KFY A;  2XMJ A;  5IZH A;  3UPF A;  3UCG A;  2E2I A;  2RE1 A;  5DQG A;  3DFE A;  2IVF B;  1KBR A;  2JEF A;  1B64 A;  3AJ2 A;  3EVM A;  1TK5 A;  2UUT A;  3H5S A;  1SQE A;  1LOU A;  1S57 A;  1VGY A;  4C4W A;  4FVC A;  2AZ1 A;  4K5R A;  2DO0 A;  2CQ0 A;  4DV3 F;  4M1X A;  1WEX A;  4CM0 A;  2GO9 A;  3FJ2 A;  4CH7 A;  2BQU A;  4KAR A;  4L75 A;  1WHV A;  4OX6 A;  3KYL A;  4YG2 A;  4FVM A;  1VC0 A;  4EMD A;  3TEH B;  2BVZ A;  1YJN S;  4KSE B;  3RZD C;  4DR6 F;  4OHV A;  2A6E A;  2MDA A;  4NML A;  2HHT A;  1RHR B;  1FVQ A;  3RR8 A;  2ZUF A;  1RYR A;  2D9P A;  2HHW A;  3CJ2 A;  1Q8B A;  2BV3 A;  3IR5 B;  2ZOM A;  2IAJ A;  3HOX C;  1PYO B;  3T01 A;  3UFC X;  2ZC3 A;  1R8A A;  1DFD A;  1RSC A;  2JA5 A;  1V5V A;  2YU9 C;  3JAM Y;  1RB0 A;  4EBD A;  2VUM K;  3Q2T C;  1SC1 B;  4PYA A;  4X2B A;  1DTQ A;  4PZV A;  1KTQ A;  5B0A A;  5J1E B;  4LT6 A;  5J2Q A;  1RQ0 A;  1Q8K A;  1NK6 A;  3JYT A;  1GQE A;  2CJB A;  4WWS A;  2MZR A;  4AYB L;  2HLT A;  2HBZ B;  2QLW A;  1UWB A;  2C2R A;  4B3O B;  4XPE A;  1YTY A;  4J7C A;  1S77 D;  1O25 A;  3ITH B;  5KFQ A;  1L3T A;  1VBK A;  4M5J A;  2HHQ A;  2PC6 A;  1RBA A;  1UPM B;  4O2D A;  1ZXO A;  1QAX A;  2J7K A;  2EBB A;  2KJV A;  2W4C A;  2PGC A;  4JV1 A;  4LF1 A;  1RK8 A;  3D3C J;  2BZ2 A;  5J2N B;  4DBQ A;  4EBC A;  1X4C A;  3FGV A;  2EC0 A;  2IAJ B;  3EPG A;  3DYA B;  4JB8 B;  4CH0 S;  4OIP A;  1FX2 A;  3WIU A;  2DNK A;  3H2U B;  1Y3K A;  2DNZ A;  3EGV A;  3PW5 A;  1LWC A;  3B82 A;  3EZ5 A;  3NNA A;  1RTH A;  2FJB B;  1SCJ B;  3L3C A;  2WHO A;  2HQC A;  4OV6 A;  3J81 Y;  1R8B A;  1G3O A;  2CAD A;  2I38 A;  1TKD A;  4B3S J;  2E9T A;  3QT5 A;  3ZFV A;  1HI8 A;  3AB2 B;  1U02 A;  2DY1 A;  2ASD A;  4QYR A;  2E2I C;  2E1C A;  4WU2 A;  1N6Q B;  2VG6 A;  5KG2 A;  1TWA K;  3PIP Q;  3NAH A;  4NEZ A;  5HQM A;  4ED3 A;  5AE1 A;  4ZLP A;  4JV5 J;  2D6F C;  2ZH6 A;  2BE5 A;  2VC1 A;  3MOZ A;  2MY7 A;  4ATN A;  1YCL A;  2FB0 A;  4AXI A;  4JUZ A;  2DKO B;  2OTJ S;  2XUL A;  4NA1 A;  1U2F A;  1H2T Z;  2HNZ A;  3L09 A;  4NI2 A;  1C0T B;  6FDR A;  5AXM A;  3MCN A;  4K4T A;  3TAM A;  2OHD A;  3L7O A;  1NZA A;  2W2P P;  2FUG 9;  1KFS A;  5GAD I;  4I64 A;  1CJT B;  2HHP A;  3BRE A;  2BE2 B;  3H7H B;  4LF2 A;  2ZNZ A;  3QYY A;  2FVQ A;  2GSO A;  3BKT A;  3N6L A;  3AJD A;  4X66 F;  1SC4 B;  2PE8 A;  3FCH A;  4ZOS A;  5EWG A;  4OI1 A;  1VLO A;  5DG8 A;  4WCE Q;  1GEH A;  4CO4 A;  4C8Z A;  3SCK E;  4DWI A;  3PTW A;  4DFP A;  2HS4 A;  2RDD A;  2M7S A;  5E68 A;  2V8G A;  4ICL B;  4RUC A;  2Z2L A;  3V6K A;  1RWO B;  3IC1 A;  2KT5 A;  3O6Q A;  3BJY A;  4URS A;  1I1G A;  2FQQ B;  1WTB A;  3RBZ A;  3P49 B;  4MKV A;  2WVC A;  1Y5L B;  2BM0 A;  3IRX A;  1N56 A;  3CNQ P;  4KKO A;  5GAG U;  4DSF A;  3H0G K;  4H4M A;  1J2V A;  2VV5 A;  2OGU A;  2FY1 A;  2FC8 A;  4BY7 K;  1HWL A;  4KT0 C;  4YEA A;  1MU2 A;  2BW2 A;  3R7S B;  5MLC V;  2PMZ D;  2KT3 A;  3QSY B;  1FDA A;  1C1C A;  2OTL S;  4CLL A;  4F0M A;  4DMZ A;  3BP8 C;  2CJX B;  3IR7 B;  2WB1 L;  2D3O R;  1N32 J;  1HD1 A;  5BR8 F;  4ILR A;  1WC5 A;  2BOA A;  1ZOT A;  4JBC A;  3TWZ A;  3JQM A;  1DHM A;  3Q23 A;  2F5G A;  3W63 A;  2XWY A;  3EXC X;  2RHQ B;  2NVX C;  3FC9 A;  2R7Z C;  1EKS A;  3I5C A;  2LEC A;  4CO3 A;  2LA4 A;  4K8R A;  3CME S;  2HNY A;  3LP1 A;  4P10 A;  3R1L A;  2A2C A;  2PFF B;  3HMJ G;  3A8I A;  2RD5 C;  3PDN A;  1JJH A;  5DDR C;  1NU4 A;  4KPC A;  1TKT A;  5LMU F;  3AOD A;  4DUZ F;  2BE9 B;  2YNF B;  1UJ6 A;  2HZC A;  2ZNY A;  2XCO A;  1KQ4 A;  4C2M K;  4ZN3 A;  1PKU A;  1MN9 A;  1QTN B;  3MAQ A;  3GTJ C;  3N01 A;  4ZCL A;  1XQI A;  4A3I C;  1VRT A;  2RHS B;  3RYL A;  2IRY A;  3KXD A;  3PV8 A;  4TLQ A;  2WSF C;  1QJH A;  1YDL A;  2L3M A;  1S1T B;  1GE9 A;  1SL2 A;  4ECW A;  2V8H A;  1VR6 A;  2YNF A;  1I50 C;  1JB0 C;  1HL6 A;  4RBV A;  1S6Q B;  2IBK A;  1Y10 A;  5FJ8 K;  4OZ5 A;  3FSY A;  1NDL A;  4ZVF A;  3T5J A;  2Y0S D;  1AUS L;  2V4Q A;  2EKN A;  2AYG A;  1EQR A;  4DXL A;  1SFO K;  1P9Q C;  1KQS R;  4PUO A;  1XMO F;  3C66 A;  3LOU A;  2A6H A;  4EO6 A;  2JEG A;  2MJU A;  1VC5 A;  4HAC A;  3RRG A;  2OPS A;  2EPI A;  1H38 A;  1GAO A;  3S2D C;  2K3K A;  2RJZ A;  4IFV A;  5JVG Q;  3JYT B;  4I7F A;  1LWF A;  4UZC A;  3OPF A;  4C2M C;  2KKH A;  2RRB A;  4KHR A;  1RWW B;  3R5G A;  4ZHR A;  4W90 B;  5D4O A;  4RL1 A;  4UST A;  3HKZ D;  1Q7Y T;  3S15 C;  3UE2 A;  4F25 A;  4CWB A;  2WCX A;  2ZFZ A;  4P52 A;  4A8X A;  1R0A A;  5CYQ B;  4TLR A;  3VR1 A;  5A0Y B;  2G0I A;  2B7B B;  3PRV A;  1FRM A;  2XQC A;  5M5W K;  1H73 A;  4DPW A;  3WX8 A;  1S7I A;  3M2U A;  3S1Q K;  3JQK A;  2AYM A;  1NHV A;  4YN3 B;  3HOZ C;  5KFV A;  3L95 X;  3G71 S;  1HNI B;  2H3E B;  1KVK A;  4ER8 A;  2CA9 A;  2XI3 A;  3OR2 A;  2LYV A;  3D6H B;  1VJE A;  1CQN A;  2CPX A;  3OL6 A;  3M8S A;  2DNO A;  4DJB A;  3OV7 A;  4Z2X A;  4O3O A;  2XCP A;  2GGP B;  2WW4 A;  4RBU A;  3UVJ A;  4AL6 A;  1NJX A;  2HKE A;  5HAO A;  2RNE A;  5DJB A;  4DF8 A;  1Q5Y A;  2IDE A;  3DC2 A;  2YKO A;  2B9X A;  3PG9 A;  3S17 K;  1MLA A;  2KYZ A;  3OTE A;  2XHC A;  1HNX J;  5DM6 Q;  3BYR A;  2K7J A;  1VJQ A;  3OTB A;  2B9Y A;  4PPD A;  2DJW A;  4CLS A;  5CJ9 A;  1WG4 A;  2AX0 A;  3M8P A;  4J5O A;  2IDL A;  4GC6 A;  4CLY A;  4KB4 A;  1FCA A;  1RTJ B;  1R8C A;  2CNK B;  3S8S A;  1VQ7 S;  4UQG A;  3HJV A;  1BLU A;  1SUQ A;  3GTL K;  2JEI A;  1TL5 A;  1AB8 A;  2C2M B;  4ZCK A;  1CLF A;  5D0H A;  4BY7 C;  1KC8 T;  4DOZ A;  3KLE A;  4PPZ A;  2C3M A;  3FZ2 A;  1Q16 B;  1YJ9 S;  4R25 A;  1CC7 A;  1D3W A;  2J0X A;  1D8Y A;  1IWA A;  4EO8 A;  5G0R A;  5HQL A;  4GO7 X;  4L73 A;  4GVB A;  1Y1W C;  2RSQ A;  3UD3 P;  1O5J A;  2HFV A;  1NK7 A;  2Y1R I;  3C46 A;  3ITH A;  2DIT A;  3OTO F;  3H5X A;  1PCA A;  3CJ0 A;  1KQF B;  1NSQ A;  4Y65 A;  4CLU A;  2DCL A;  1O0P A;  1SL1 A;  1TU0 B;  4P2M A;  3NGK A;  4B08 A;  3G4A A;  2J8A A;  1FDD A;  4J9K A;  4OIO A;  4YQW A;  3MEC B;  4DLE A;  1J5O A;  4LVN P;  2MLZ A;  1MMN A;  1FFG B;  1BY9 A;  3F56 A;  2E7X A;  5HJY A;  3ZZT A;  4LF4 J;  3KJV A;  5E3A A;  4G7O A;  1WQG A;  3BH7 B;  1IKW B;  2MZS A;  1I51 B;  2UVV A;  2W9B A;  3PO2 K;  3QBC A;  4ETZ A;  2YKN A;  3KHR A;  3G8Q A;  3Q83 A;  3P45 B;  1SPB P;  2MKJ A;  4HHH A;  1HI1 A;  2VPW B;  3HCX A;  4YDX A;  3ZC4 A;  1NH8 A;  2O67 A;  3I55 S;  3NXZ A;  4EUV A;  3UQS A;  5HAT A;  2OEL A;  1V3R A;  1FWP A;  2NR0 A;  2HHH F;  3CQZ K;  2RRA A;  1KVI A;  1N32 F;  3LQV A;  2QLB B;  5M2R A;  2UUC J;  1NK9 A;  4DN9 A;  3JSM B;  4FM9 A;  3FBF A;  2J9D E;  4OHZ A;  4ZVE A;  1JIH A;  3CC4 S;  4G7H A;  4WKY A;  1SJR A;  2MLX A;  1NME B;  2L9D A;  2PEB A;  3OUY A;  2HGM A;  3IRW P;  4YR0 A;  4G1I A;  3C14 A;  4JI3 F;  1RHJ B;  4X64 F;  1SMY A;  4YHH J;  4LUB A;  1FJG J;  2VFV A;  4LRB A;  4DV1 J;  3B54 A;  1FXR A;  4GTC A;  4DFK A;  3OL8 A;  2GO8 A;  3AQP A;  4N47 A;  1SH2 A;  2Q79 A;  1L3V A;  4O44 B;  4N7T A;  2BE7 D;  3AAW B;  2RUG A;  3P5T L;  2Y1I A;  1RT4 A;  1RHM B;  2Z58 B;  2ZH4 A;  4UQT A;  2HYI B;  2XMA A;  3V6D A;  4ZPB A;  1C4A A;  2R92 A;  4QPT A;  5HL8 A;  2RQ4 A;  3BS9 A;  3M7V A;  4C8Y A;  3RB0 A;  1QDU B;  3S14 K;  4WP3 A;  1YZ7 A;  3KLG B;  1H98 A;  3HOU K;  4QJV A;  2GQ2 A;  1Y11 A;  4F36 A;  4N41 A;  2ALY B;  3IS9 B;  1R31 A;  3AOC A;  1K83 C;  2FIU A;  1IBM F;  1HD0 A;  4DX5 A;  2VDH A;  3ZTR A;  3OVB A;  1VHI A;  1SJQ A;  4P72 A;  3A3P B;  2VG7 A;  4K4Z A;  1UJ4 A;  1C1B B;  1WJ9 A;  4CZC A;  4Y6I A;  3MUR P;  1TL7 A;  2CFA B;  2F1F A;  4X62 J;  1S0V A;  4A3G C;  3EX7 B;  3BSN A;  4YP3 A;  3SSR A;  3UI3 A;  3UDL A;  1JVI A;  3CCV S;  1N5Y A;  3MM9 B;  1BQM B;  1RHU B;  5JVH Q;  1T05 A;  2HHH J;  2GIF A;  1S49 A;  1SC3 B;  2W1B A;  3Q22 A;  3NMA A;  2E2J K;  2IC3 B;  4Q2M A;  2DT9 A;  1TVR A;  3A12 A;  4PCQ A;  1M5S A;  1T03 A;  2UUB F;  4ELT A;  1CEZ A;  3KJF B;  1RLD A;  3T6B A;  4U6P A;  3HHK A;  3OD2 A;  3X1L B;  4CP5 A;  1VBZ A;  1Y5N B;  4B3O A;  1SKR A;  2DHS A;  4LFC J;  1RHK B;  2VC0 A;  1TWG A;  4RZR A;  4ZMM A;  1I5O B;  4PR6 A;  3KG4 A;  3MMJ A;  4J9V A;  1YZ6 A;  3SMZ A;  3T5K A;  1R6Y A;  4AE5 A;  4O0I A;  3RW6 A;  1FJG F;  2XG8 A;  3OXF A;  2FLN A;  1EAR A;  1XZP B;  4C45 A;  3IG1 B;  2W9C B;  3IPJ A;  4M8L A;  3AA8 A;  2JA7 A;  5FLX Y;  3TVY A;  1BE4 A;  3ZTP A;  5IOQ A;  2FC9 A;  2AEM A;  3MOJ B;  1MG7 A;  2DHG A;  1RCO B;  3S1R C;  2V6U A;  1S9G A;  4OYP A;  2MST A;  3I6P A;  4DQQ A;  1LV5 A;  1M0S A;  4ZS6 A;  1YVF A;  3HHL D;  4LJM A;  4DU7 A;  3HVT B;  2ZBC A;  1VK3 A;  3FKB A;  3PRD A;  2W9B B;  3HHL C;  1T02 A;  5GAD U;  2ASJ A;  1VQ5 S;  1XMB A;  3DCA A;  2R2S A;  1BQN B;  2C3U A;  1G2E A;  4LRA A;  2W2M P;  1X4A A;  4A93 K;  3HI9 A;  4KB2 A;  3W2W A;  4ZVO B;  4B9U A;  4U9R A;  3T6J A;  3CB4 A;  1F5C A;  2UU9 J;  2JA8 C;  3VAH A;  1O29 A;  4CO1 A;  3MM8 B;  1WF0 A;  1RTD A;  3MMB A;  5IQ6 A;  3W1Y C;  3G96 A;  2MQP A;  3M3Y C;  3KKF A;  2MQM A;  1UV7 A;  1FXD A;  3BBC A;  2CPE A;  5C4X C;  3MPD A;  1DQ8 A;  3IGN A;  1DTT B;  3PO3 C;  1PC5 A;  2UVU A;  2XZW A;  4NLU A;  1HBN A;  1IR2 A;  1RWK B;  1WWH A;  1EKR A;  3OLA A;  4Z7Y A;  4DV2 F;  5KT3 A;  4TYB A;  2AX1 A;  4LR2 A;  2IC3 A;  3F0N A;  4JI8 J;  3ZNJ 1;  4NLP A;  4U67 Q;  4ZPC A;  3T41 A;  1IJE B;  2W7O A;  1DUR A;  1L0W A;  2PPB A;  3HDS A;  5M5Y K;  5HO4 A;  1D8Z A;  4OYM A;  2ACY A;  1GMV A;  4NPO A;  3M6W A;  2ZUA A;  3AQO A;  4DV0 F;  2XMM A;  3R27 A;  3W8G A;  3OUY B;  2LQJ A;  2NPI A;  1JJC B;  2ZOG A;  5IP7 K;  5I3Q A;  1JLB B;  2VFR A;  2H51 B;  5KT6 A;  3FEX B;  4BDP A;  2BOP A;  3V4I A;  2NPF A;  3CC7 S;  3T02 A;  1ZVU A;  3FKI C;  4OL8 A;  2NYH A;  1NJW A;  3ELH A;  1YSJ A;  4FXW A;  5B0E A;  2KG1 A;  1FE4 A;  1YJR A;  5KFS A;  3VAF A;  3PW4 A;  1ZAX A;  4DV4 F;  3TI0 A;  1B0T A;  3GYN A;  3GJS B;  3H25 A;  4MYT A;  4DX8 H;  3W2W B;  5CZX A;  4ZP7 A;  2GV1 A;  2VQE F;  5IV4 A;  4OX8 A;  2CNO B;  5LMN F;  1I3Q C;  2DR5 A;  1BJT A;  5MAO A;  2ASY A;  2JRS A;  5DDO C;  1RT1 B;  3HT3 A;  5FDL B;  2ZH3 A;  3BQ1 A;  1UVL A;  7AT1 B;  4OX7 A;  3O1L A;  2FJA B;  1L3U A;  1G7C B;  3T19 A;  3H0G C;  1PJ5 A;  5IP7 C;  4PG7 A;  2IVM A;  5A8K A;  4OIN A;  4LJZ A;  2YNH B;  4WZM A;  2GJ2 A;  4YFK A;  4MIA A;  1R0A B;  1S4E A;  1FKO A;  2JA6 C;  2VG7 B;  1ICE B;  1TWA C;  1C0U A;  4BXX K;  3NGR A;  3J81 j;  1S97 A;  1T3O A;  2NUU G;  2RQM A;  4A3D C;  1NDK A;  1X8D A;  3CO0 P;  3BH6 B;  3MMA A;  2NXN A;  2I5J B;  3A8K A;  3Q86 A;  5B0F A;  3V81 B;  2ATL A;  2YWF A;  1W2I A;  2CKW A;  4J9R A;  2PA8 L;  1Q79 A;  2K1R A;  2IM2 A;  3ISN D;  4HAC B;  1URR A;  1JLQ B;  3KMS A;  3G8S A;  1IQT A;  3KTQ A;  3MEE B;  3TJ9 A;  2CPI A;  4K50 A;  3ZZO A;  5F8G A;  2E1R A;  4GTB A;  2QYG A;  1OQ6 A;  4E2F B;  3V4I B;  4DR2 J;  2HFZ A;  4A8W A;  1R7I A;  4AQY J;  4K0K F;  2J0S D;  3RZD K;  4NXN J;  1HQE B;  3IA0 A;  3DDN A;  2M70 A;  2HGL A;  1IQ0 A;  2HAF A;  5AJ3 J;  4JK1 A;  4IOC Q;  4ECX A;  2KU7 A;  1Y1W K;  2C2D A;  4CNZ A;  2KJW A;  4PXE A;  3S1N C;  5L1L A;  3GSI A;  2YPY A;  4A3K C;  2DEJ A;  4OI0 A;  4NLG A;  4GC7 A;  4HDG A;  5THW A;  5H9F J;  1JLA B;  5CH7 B;  3DOM A;  2ZHO A;  4X4N A;  3MR3 A;  3S1Q C;  1TUG B;  2NVY K;  3VWS A;  1EH1 A;  3QFW A;  4USM A;  1WCM A;  1EIY B;  4X84 A;  3KJV B;  4CTA A;  3OXG A;  4F3O A;  1UFW A;  1HBM A;  4FYW B;  2QT7 A;  4DQS A;  3GEI A;  1LKZ A;  1HMV A;  3OHA A;  1DJ0 A;  1NKC A;  5IP9 K;  1R3N A;  1TKX B;  1RTZ A;  2FJV A;  4USI A;  3T1H F;  1JXE A;  1IS1 A;  2NXC A;  1F3F A;  2AF6 A;  3VQS A;  4TU7 A;  1N36 J;  5DDP C;  1JLC A;  5ETV A;  3M32 A;  1HPZ B;  1OPI A;  2M3D A;  4RUA A;  2EFV A;  3S1N K;  5BXI A;  2LU1 A;  2D3U A;  4DR4 F;  3DRP B;  2XYH B;  3EE3 A;  3W7B A;  4WFB Q;  1VJW A;  4AD6 A;  3G87 A;  4YB5 A;  3M9O B;  4DUY F;  1O27 A;  2HRU A;  3S1M K;  1Y1V A;  2R8I A;  3FCV A;  4A8O A;  2FVC A;  5KFN A;  4DR6 J;  2MSS A;  5AXL A;  2QO3 A;  1IKW A;  2VPZ B;  4TNO A;  1T9Y A;  3C16 B;  4W98 A;  3H2L A;  2DR8 A;  1TWC C;  5KFU A;  4I1T A;  2NVT C;  3MR6 A;  2OFH X;  4DL4 A;  3OEP A;  3HJF A;  1YX2 A;  1CUL B;  1RBO B;  3Q8Q B;  2EG2 A;  4DV5 F;  3RJM B;  3G8T A;  2R8H A;  3TX8 A;  2DNN A;  4JI1 F;  3FMB A;  2Y9H A;  3GFY A;  1YIT S;  3RAQ A;  2G4B A;  2E7V A;  1V6H A;  2UU9 F;  4ZIV A;  4F4X A;  2CG4 A;  2FTR A;  3HX9 A;  5C24 B;  5IT9 Y;  4MKB A;  3S6E A;  1RAB B;  2V63 A;  4ED6 A;  2C22 A;  1AXQ A;  1WKL A;  1IBA A;  2OH2 A;  2KZZ A;  1RWN B;  2F65 A;  3CJK B;  4DDQ A;  1B4A A;  4QWB A;  2XLJ A;  2A10 A;  2W8K A;  1L3S A;  4JP8 A;  4ZDN A;  1KLN A;  1TL3 B;  4NLW A;  3KK3 A;  3GTG A;  1TAQ A;  3PW7 A;  3CUL A;  3M2U B;  3N0V A;  3TP2 A;  2BW7 A;  1R9T K;  4WP8 A;  3WC0 A;  3TQ1 A;  1LW2 A;  2OEK A;  5E5N A;  4J37 A;  3MPU B;  1RJJ A;  1LWF B;  4N77 A;  2KXH A;  1VBY A;  1ZYQ A;  2G9O A;  3WZ0 A;  4RW7 B;  4UUX A;  2RIL A;  3MMC B;  3VTI A;  3CO9 A;  2ZVS A;  3CW2 C;  1S1V A;  1FWK A;  3HOY C;  2YBV A;  5DQI A;  3I31 A;  1NK0 A;  4IYQ A;  1NLK L;  1Q5V A;  4KAW X;  1S6P B;  4QR1 A;  2V94 A;  1Y9O A;  3Q3Q A;  3PJW A;  5AT1 B;  3GTM C;  4LR8 A;  3B6B A;  1S9E B;  1C1C B;  3KLG A;  3GFZ A;  3FOF A;  3E3X A;  3KK2 A;  4DV4 J;  2KDO A;  3DI6 B;  2DPJ A;  2Q43 A;  5D78 A;  3HO1 A;  4LSN A;  2AHO B;  1D9F A;  2R8G A;  3PHT A;  3FZB A;  4DV7 J;  2DVI A;  1IWG A;  4TU9 A;  2AD9 A;  3BN4 A;  2V6T A;  4ZPD A;  2J0Q D;  4IOA Q;  3QWP A;  2RS2 A;  2O3D A;  4LF8 J;  4A3E C;  1XMO J;  3MEK A;  2OPQ A;  1XJW B;  3RB4 A;  5C24 A;  3HFV A;  3P5B P;  1UJ5 A;  3M8R A;  2CFA A;  3ETO A;  2OEM A;  4KMH A;  2VPX B;  3DLK A;  2EFO A;  3RU0 A;  3LP1 B;  1VQ4 S;  4UW2 A;  3R1H A;  2WVF A;  1O24 A;  4C6A A;  4A3C K;  2B63 A;  4OX9 J;  1ZAV A;  5CZV A;  2HBR B;  4UF4 A;  2XNR A;  2J6U A;  1FTR A;  1U1L A;  5J2M B;  2F7V A;  3TA1 A;  3W66 A;  5HMX A;  4ID8 A;  5HLF B;  1WAC A;  2DB1 A;  1TWA A;  3ENV A;  3V2U C;  3HM9 A;  4D3G A;  2Z2Y B;  2BE2 A;  3CSK A;  2BJ3 A;  2EBE A;  4EGL A;  1TKZ A;  3RGI A;  4JI7 F;  2HUR A;  3CJR A;  1S1X A;  2GW8 A;  4Q0B A;  2LXI A;  4MK9 A;  2GML A;  4RW6 A;  3OSP A;  4ZVG A;  2VB6 A;  4YFX A;  4KM9 A;  1Y0H A;  2W2Q P;  2P9G A;  1RU1 A;  3CIM A;  4LFA F;  3TA2 A;  2UP1 A;  4FF1 A;  4ED0 A;  2FZK B;  4X4S A;  1LNQ A;  1R9T A;  1WHW A;  3KUG A;  5ETP A;  3FSI A;  3RRH A;  3LO3 A;  3BV8 A;  1VIS A;  3Q8P B;  1QUP A;  2PEH A;  4NMX A;  2UXD F;  2AGO A;  3V5R A;  1HQE A;  2KB2 A;  4KC6 A;  3KLF B;  1CPZ A;  1T9T A;  1SJF A;  1S79 A;  4A3G K;  3LP2 A;  3CQZ A;  2XO7 A;  2BJD A;  1XNR F;  2B5J B;  1U0S A;  2OMO A;  1TL7 B;  2JJ4 D;  1XZP A;  3TAQ A;  1SQG A;  2XY5 A;  2Y0B B;  3QFH A;  4ZCI A;  4RWW A;  3HVW A;  4IO1 A;  4AH6 A;  4OLO A;  3FCW A;  2E2J C;  3H8Y A;  4ZHR B;  4ES2 A;  1XIQ A;  3S16 C;  5C4X K;  4DR3 F;  3PO2 C;  1PIL A;  4GTE A;  1G4C A;  1ITP A;  2HS0 A;  3M8W A;  4MTP A;  2PO4 A;  3S15 K;  3CDB A;  2R7V A;  2NVX K;  1MWQ A;  2CYY A;  2RF2 B;  1X5P A;  1CUL A;  3H2V E;  2KZM A;  1FFW B;  2WAQ L;  4TY8 B;  2G2O A;  3CD7 A;  3I96 A;  1RWM B;  3HZE A;  1YKW A;  2GX8 A;  3MEG A;  2H4W B;  3FHZ A;  3GU0 A;  1X4H A;  4U7U D;  2D1C A;  1USO A;  5L38 A;  4TU8 A;  5HAN A;  3PX0 A;  4X4R A;  2LDY A;  3W62 A;  4NCG A;  4DR7 F;  4GKK F;  3DLJ A;  5F3Z A;  3G82 A;  4ECR A;  1VQ8 S;  4ANC A;  1JKH B;  3PR4 A;  2PMZ L;  4QWE A;  4C0H A;  4A3I K;  4F4A A;  3W5Y A;  4LRF A;  2CW0 A;  4WFX A;  5KG4 A;  1CJK A;  4IUF A;  3BDP A;  1ZH5 A;  8ATC B;  3GE9 A;  2MPU A;  1TKT B;  3KLH B;  4MT1 A;  1UAW A;  1NJZ A;  4KMA A;  4USJ C;  4YY3 F;  3M4X A;  1K73 T;  5CAA A;  4IFV B;  1ZAW A;  3MPY A;  3SIP B;  1LK5 A;  3NGS A;  2BAN A;  3IM8 A;  1O6X A;  1U1K A;  1M5O C;  1NH7 A;  1ZBT A;  4CQ1 A;  3MTK A;  1SFO C;  4OYO A;  3IM9 A;  3MEC A;  2B56 A;  2ZH8 A;  1BGW A;  1AB4 A;  2RU3 A;  5CYJ A;  2OIH A;  2V2V A;  4PXC A;  4LMZ A;  1YBA A;  1BWE A;  2UUA J;  3G9C A;  3J7Z 5;  2QA1 A;  7FDR A;  4LF9 F;  1IR1 A;  1TEL A;  2HVH A;  1AFJ A;  3D66 A;  1N8R T;  5EN1 A;  1E6V A;  2HNZ B;  4CLF A;  1RU0 A;  5JVO A;  3ADA C;  3I0R B;  1GFW B;  1T9U A;  4B3T F;  1IBL F;  4RW8 A;  2XWX A;  3KLE B;  2YKN B;  4K4U A;  1S10 A;  1NUE A;  1B3T A;  1RT3 A;  3PEH A;  4M5M A;  3NS7 B;  4QYZ J;  4CT8 A;  4CYU B;  4F7V A;  2XBP A;  3DM2 A;  4JV2 A;  4GFQ A;  4WE1 A;  4PAB A;  4DR3 J;  1E6Y A;  4WFY A;  3DLG A;  1TKZ B;  2BJ1 A;  4C0O C;  1J6V A;  2YPZ A;  1IR0 A;  1GT8 A;  2ZM6 F;  5KFL A;  2XEX A;  4YME A;  1VH2 A;  2XMT A;  1KFD A;  3GFH A;  4ECQ A;  4LBP A;  1F7V A;  1MRO A;  1Q0N A;  1WF1 A;  4PQU B;  2JC1 A;  2ADC A;  5FII A;  3R97 A;  4ED4 A;  2DR7 A;  2W8L A;  4CCH A;  1OJ4 A;  4YHH F;  1U8W A;  3HXM A;  4NOH A;  4J9S A;  1YRT A;  1M5K C;  1NBE B;  1YI2 S;  2FLL A;  5DZ6 A;  2KHC A;  3EGW B;  5B08 A;  3C16 A;  4DV1 F;  5CD4 H;  5JUM A;  2M8H A;  2M4M A;  2DPI A;  2W7P A;  4L72 B;  2VOD A;  2ACM A;  1NM2 A;  2RUS A;  4J9U E;  4GVL A;  4F02 A;  1DQA A;  3OTD A;  1LWC B;  1M5H A;  2VBY A;  2DIU A;  4QWD A;  4NA3 A;  2GC8 A;  2MMY A;  1SBR A;  3AD8 C;  4KMU A;  3FRZ A;  5DLG A;  3FBB A;  2NXE A;  3DI6 A;  5M3F K;  3RB6 A;  2EEY A;  4JYA F;  4X4V A;  2JNJ A;  2ZH5 A;  1YIJ S;  3AFG A;  4DG1 A;  5H9F K;  3TJ8 A;  1PJ6 A;  4K2J A;  1RAC B;  2FVP A;  4AXJ A;  3CQZ C;  4P2F A;  1O2F B;  3BF4 A;  4LK1 A;  3GB0 A;  2DHH A;  2XCA A;  2R8J A;  2G2Y A;  2HQ3 A;  4WU3 A;  4OV1 A;  3MUM P;  5H9E K;  5HP1 B;  3GV5 B;  4KDD A;  1JLQ A;  2IM1 A;  4KGV B;  3C19 A;  1EP4 A;  1VFJ A;  1S6P A;  2YKQ A;  5KFI A;  1LWE B;  1EQM A;  2SXL A;  3QGG A;  3GMG A;  3D0I E;  3DOM B;  1Z2L A;  3RAX A;  1VCT A;  1GMW A;  5E0O A;  4EWT A;  1JLB A;  5KFT A;  4ZP6 A;  4K4V A;  1CBK A;  1IQZ A;  3AA9 A;  1TL1 A;  2ADB A;  3ILI A;  3Q8Y A;  4J9P A;  4DSJ A;  2KTQ A;  3G86 A;  1WKJ A;  1F9N A;  1CC8 A;  1RU2 A;  2W2O P;  2MKY A;  2MTL A;  1HW8 A;  2ZWO A;  4LF5 F;  2XI2 A;  2A0F B;  4J9N A;  1WC0 A;  3MI7 X;  2V4J A;  4KY3 A;  2ZBP A;  4BC7 A;  4DPX A;  1F7U A;  3CJK A;  4CI0 B;  1U1O A;  2C2O B;  4PXB A;  1WHX A;  4GRS A;  3UW1 A;  4C7Q A;  1S12 A;  2AZ3 A;  2PD1 A;  2N4C A;  2DBB A;  3VCD A;  1C2P A;  5LMU J;  4L3K A;  2Q6C A;  2BJ7 A;  4DUZ J;  1Q1K A;  3JSB A;  4NX9 A;  4X4Q A;  1Y00 A;  3QRP A;  1OS5 A;  1XZQ B;  5E41 A;  2B63 C;  1N5S A;  1UEK A;  3UDV A;  4AFF A;  1HQU A;  1SI9 A;  3TEG A;  2I1R A;  2VQF J;  4QW8 A;  3TA0 A;  4AUK A;  1N5T A;  2QA4 S;  1SVD A;  4UY8 5;  2ZKT A;  2L48 A;  3MM9 A;  5KFO A;  4PAA A;  2HHX A;  1XR6 A;  2M0G B;  3VVT A;  1ARO P;  1C0A A;  4RO0 A;  2CDQ A;  2GIR A;  2HW3 A;  1SB6 A;  3PNI A;  5GVQ A;  4BY1 K;  2CPF A;  4R5P A;  3GTQ K;  3I4P A;  3FEY B;  4GTA A;  3SFU A;  2LQ8 A;  3ETM A;  3NL0 A;  3AOA A;  1XMQ F;  2R7X A;  3A1Y G;  4CT9 A;  3BUE A;  2CVE A;  5CYM A;  3JQJ A;  3FUY A;  1IE0 A;  3IWN C;  2DK2 A;  3K89 A;  4CLP A;  3IBC B;  4C97 A;  3S2H K;  3OL9 A;  1TV6 B;  2J8S A;  3MCS A;  1U1R A;  4ZVT B;  5D3G A;  3CTR A;  1VQN S;  2KFZ A;  4LFB J;  2QMW A;  2RGR A;  4W92 B;  2CZ4 A;  2DNQ A;  3MM8 A;  4ZKA A;  2JHE A;  3GTK K;  2QJ3 A;  2DGX A;  4NLV A;  4BKW A;  2N7Y A;  4QPX A;  2HK3 A;  3GON A;  2VHG A;  3SI8 A;  5IC6 B; 
#chains in the Genus database with same CATH homology
 3GEE A;  1VRQ C;  3AD9 C;  3ADA C;  3AD8 C;  3GIR A;  1YX2 A;  1PJ7 A;  1XZP A;  1PJ6 A;  3A8K A;  2GAG C;  4P9S A;  1V5V A;  1VLO A;  1WOR A;  1PJ5 A;  3TTG A;  4PAB A;  1X31 C;  1XZQ A;  3GEI A;  1WOS A;  3GEH A;  2GAH C;  1WOP A;  1WSV A;  3TFI A;  3AD7 C;  4PAA A;  5L46 A;  3A8I A;  1XZQ B;  1WOO A;  3TFJ A;  3A8J A;  3GSI A;  3TFH A;  1XZP B;  1WSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...