3ADBA

Crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 1)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
b'HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENKNKNNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
publication title Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3adbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adbA01
2W00A 1AK2A 2ZI6A 2IX3A 1XP8A 2QU8A 1NBMA 3LV8A 5FOUA 5J5CA 4MYCA 2G1KA 5FPSA 5HE9A 3EC1A 1W44A 2QSYA 3MGCA 3WP0A 4B44A 4NCJA 5P21A 1MV5A 5KTYA 2J7PD 3C8UA 2CL7X 4B75A 2ZM5A 1JQJC 1KTVA 3LBHA 3ZDQA 4L8GA 1SVSA 2P6UA 4F91B 4BWYA 1QHNA 3IDQA 2QG6A 4MYHA 4UNNA 1ZIOA 2WWHA 2CJWA 4JL5A 4FCTA 4V0NA 5KDLA 2EW1A 3CX6A 1RRCA 1F2UA 3IO5A 4LHXA 5KDOA 3EARA 3TH5A 2V6JA 4BGDA 1NSFA 4DLTA 2QEQA 5E7JA 2RB4A 1ZNZA 2NTYC 3ZLJA 1DAMA 4DIDA 2P2LA 4Z8XA 4XWOA 1XRJA 3AUXA 2Q9BA 1M8PA 3VHLB 2HYIC 1FL9A 1GL6A 2AFIE 3QF4B 3SE0A 3SJCA 2JLZA 2IYSA 3V4FA 1E1RD 2W58A 3PEUA 4BFUA 3EC2A 5IDVA 2REOA 3SJZA 2AK2A 4W5JA 1R0XA 5JHGB 5K8UA 4IKEA 1E98A 2YWGA 3WP1B 4KITB 3MRSA 2Z83A 5LBIA 3BORA 2ATXA 4TYPA 4LBYA 1BKDR 3A6PC 1J2JA 1KO7A 4EFLA 5FPTA 3K0FA 3NBZC 3QKRA 3THOA 1XPOA 1HQYE 1N5LA 1Z0IA 5FOTA 2J0SA 2L0XA 1F2TB 3CW2A 2WVJA 2IHYA 1TQ6A 2QAGC 3SFZA 1IJFA 4LHVA 4JLAA 1ZNYA 2A5GA 4MGYR 3EASA 5HPYB 5IK2A 3CO5A 3FMOB 2JLQA 3K9LA 2ZJ5A 2ZYWX 3CPJB 1XTSA 2OESA 1G5PA 2ZS8A 4HZUA 2J9RA 4PZYA 4LJYA 5G3YA 2FMXA 3T34A 1M7BA 4XD7A 4D0GA 2R6CA 4DEXA 1C1YA 3LX5A 2IF2A 1EFCA 4HAXA 4PHFA 2KI5A 4M9XA 2EVWX 1TU4A 2GXAA 4N0DA 2WWYA 1PVOA 4PQRA 2IWHA 5AJVB 4BQSA 2V7QD 1D2MA 2VP9A 1WBBA 1U8ZA 3SJBA 1COWD 4M1TA 1EK0A 1L2TA 3EIEA 4FN5A 2AWNA 5A4JA 1U0JA 2HF9A 4G3XA 1Z0AA 4H1UA 2XSZD 5D3MA 2OO7A 4CDGA 4NP6A 3THXB 4DCTA 2WBLC 3VR1A 2RGGA 4CT5A 2OCPA 3K0EA 3LBIA 3GEEA 5FTJA 1QRAA 4WBSA 1NG9A 4P4TA 1ZW6A 2ZRFA 3U3OA 1D6JA 1RKBA 2WJVA 4ITRC 4Y0AA 1AQUA 1JAIA 1OFTA 3OEHA 1TU3A 3W90A 3RWMB 1FQJA 1GP2A 2WJJA 1UEIA 3NEJA 3VAAA 5J4VA 2IHBA 3BERA 4JS0A 3F3YA 1HQCA 1BMFA 4B3XA 4ZV4A 1G6HA 2FFAA 5CDFE 2BBWA 3LNCA 2MMCA 2CHVA 1P60A 1QG2A 1W36C 1E79D 1ZIPA 2CJWB 2KB0A 3KUCA 3OF5A 1LY1A 1KMQA 2ZRLA 2GBLC 2ZI4A 1S9HA 1CF4A 1W5SA 2WM9B 1LV7A 3QPVA 3UPUA 1ANKA 2CNWD 4TTQA 5FOWA 2CL0X 1H8ED 1KAOA 3KTAA 3BGWA 4M1YA 2J7PA 3DOFA 3WHKA 1G8GA 1UKYA 3D8BA 3EAQA 3EZ7A 2YJTD 2I3BA 4M9SA 5BWMA 1WDTA 3K70D 1XXHA 2I1VB 1N6NA 4DLSA 2QBYA 1V5WA 1GUAA 1YZQA 3ZVRA 1TAGA 3BE4A 1YKSA 3K0CA 2ZR9A 1RZ3A 3EIQA 4MH0R 4DC9A 3U4QA 3QENA 2WSSD 2F3RA 4GMXA 1R8QA 2ZAMA 1GG2A 2ZI7A 4M53A 3U7FB 1N6KA 1QHSA 3LXXA 2DFLA 3UMSA 1E2DA 2VP2A 5FI1B 4URVR 2HT1A 2AR7A 2ONKA 4JT2A 4O2LA 4TN1A 1KO4A 1PZNA 3B1VA 4D80A 3SJAA 4RZUA 3THWB 4QGFA 3R9WA 4QJ4A 1WXQA 1R5BA 3K0FB 4JLKA 1SQ5A 4DB2A 3WYAA 1HT1E 4A1FA 4MRNA 1U81A 5KHOC 1X8KA 4TT3A 4KSBA 1G3RA 2JATA 5JECA 3P20A 5EJEA 4NL4H 2AKYA 1UEJA 3FB4A 3KL4A 3RRNA 4LJ9A 1Y3AA 4NBSA 1E9EA 3IGFA 1RPZA 1CEEA 3QVVA 3TIFA 3PJRA 4TMVA 4BFXA 1Q1ZA 2JIZD 1EXMA 4HZUB 3GFTA 2BEJA 2WPDD 2VP5A 1KI3A 5CITA 2ZJ8A 3ADDA 1NIJA 1YRBA 2V1UA 5C2JB 2OFWA 1LS6A 5J4HA 2OE2A 1EFRD 1U8AA 3C5CA 1UBEA 5FTKA 4F92B 4R71A 3A4LA 1CBUA 1AGRA 5FOSA 2QP9X 2J5XA 1TUIA 3KFXA 4DLVA 1OH5A 1R0YA 5CYPA 3KX2A 3DHWC 4NU0A 4TMZA 5JEEA 1WQ1R 1E2KA 3VR3A 5D3MB 5LD2B 3U2QA 4B3GA 4DXAA 4NYMR 2QTVB 3GCGA 3MJHA 2FFHA 3BRWD 3SQXA 3LWNA 3MWLA 2DYKA 3L8ZA 4MDFA 1XCMA 4IDOA 4Q1AA 1NKTA 1CU1A 2P6NA 2V7QA 1TMKA 4PQFA 1NJFA 1COWA 3QG1A 4O3MA 2C99A 4RFVA 4Q9LA 3FVQA 4V03A 2JA1A 5JJLA 3G82C 1DTSA 1K8RA 5LPNA 4CEHA 2JLWA 2GJSA 4EPRA 2ZJOA 2C5LA 3KKMA 1SHKA 2XSZA 3H2YA 4B6FA 2XGJA 3NDPA 1KY2A 3TQCA 5KU1A 3QQ5A 2C03A 4DCVA 1MKYA 5D3QA 1KO1A 2BMDA 2IYUA 2ZSBA 1TF5A 2SHKA 4HB2A 4KLNA 3PENA 1KJYA 3TJZA 2OV2A 3GJ6A 1W5TA 2VHTA 2PJZA 1P5ZB 2BCGY 1UM8A 2ZRJA 4CVNA 3B78A 4HEJA 2QE7D 3KTAB 5EE9A 5J4KA 3THYA 1OXSC 1AJEA 1RW4A 4DT1A 4Z1MA 5G41A 1JJ7A 3SHWA 2GETA 1XXHB 3NH9A 1GSIA 4TMTA 2QBYB 1X6VA 2GXSA 2W2XA 4KYUA 1ZNXA 1FMLA 1T0JB 4R9UC 2C77A 4PHHA 3U4QB 4B48A 2HV8A 4POAA 4FCVA 4RD1A 3SYLA 3BJIC 4L4UA 1F48A 1Q1EA 2RMKA 4FINA 4RKFA 2Q9AA 2FX3A 2AFHE 1EWRA 2W2VA 3E70C 3PUWA 3N2IA 4LHWA 3KQKA 3CPEA 2CNWA 1G4UR 2GF9A 4TWZA 4IVRA 4QRHA 4MKIA 3FE2A 4Q18A 4PSKA 4P32A 2MMGA 1E0AA 2G0NA 1XCGB 2N46A 4Q1FA 2WOOA 1F6BA 5JI2E 1II0A 5AUOB 1Q21A 2V4ZA 3RYTC 2O8CA 1LW7A 4A8JC 1QZXA 1VKJA 4B3FX 2YWHA 2WSSA 5E7IA 1OE0A 1ELOA 2H17A 3AVUA 2V6IA 4UNPA 3ICQB 4LI0A 4C0SA 5M04A 1XX6A 1QVAA 4ACAA 3VMFA 4HDCA 3I1FA 2AK3A 1KMHA 4IVPA 2KBEA 2IA5A 3TAUA 2B21A 2C96A 3BOSA 3QUSA 1YE8A 2ODEA 4O25A 4N0EA 1IN7A 4GMDA 4E07A 2RGBA 1DAFA 3VKWA 3WMFA 1IN5A 1N0UA 3K09C 1OH7A 1Z07A 4KFUA 5GJVC 1G291 1OFHA 1S96A 2F43A 5JHHB 3WRYC 4NE2A 3UG7A 3GJXC 1UBCA 1ZCAA 3ZS8A 1JR6A 2XNDD 2J87A 1KDPA 4OHZA 1ZM3A 2WZQA 2CXXA 4AYXA 3PVSA 3QE0A 3SOPA 3DZ8A 1Z2CA 2E1RA 3GD7A 2O8DA 1PUIA 4EFMA 3UKDA 1CLUA 2JJ1A 2CCGA 3QI2A 1WMSA 4EAQA 2FOLA 2FFQA 1NN0A 3K9GA 3AP2A 1G8HA 1S8FA 2I1QA 3CUEF 5DSZA 5A5GA 1IBRA 1R2QA 1VYTA 2RGNA 4ZCLA 3ZH9B 1N6OA 3B82A 3KJGA 1KI6A 2H18A 3KKQA 4DWJA 4PO9A 4RD0A 4NYIQ 3EIHA 1OYWA 2XEXA 1S3GA 2A5FA 2OXRA 3FKQA 3IKJA 4KSCA 1W2HA 3ZQ6A 4DB4A 4JKIA 2WKQA 2FZLA 3EXAA 4K81B 3TMKA 2V54A 3MFYA 2PLFA 1NN5A 2ODWA 4D81A 2DR3A 4CEHB 3CZQA 1N6LA 1W4BA 2ZJAA 1IOZA 2ECKA 3FMIA 5LB2A 3B8HA 1E2IA 1SZPA 2G0TA 2ZRAA 3HP1A 2DY1A 2A5YB 1FFHA 3JVVA 4N3NA 2IBMA 2VPPA 4OL0A 4BECA 1KKLA 2GAAA 1C9KA 1NBME 4JLMA 4OI4A 1OT3A 3PCRB 2UZ3A 3SNHA 1IN4A 3FPAA 3FHCB 5KDDA 3KFVA 3JVUA 2A3RA 3AVQA 5H8WA 3TLXA 2FZ4A 4B3CA 3AVWA 2PEYA 1A2KC 3THYB 2WWWA 4JLVA 4DT1B 1A7JA 1E96A 1HE8B 1MT0A 3P4YA 1KI8A 1AQYA 3BFKA 5LB4A 1KGDA 3BD9A 1J8YF 4CRWB 4GFDA 1ZD1A 1JR3E 2OXCA 4NH0A 2FEOA 2ZVPX 2O52A 3WHLA 4F4IA 2VHQA 2QMHA 5JCPA 1W36B 3QXXA 4GSYA 3TW4A 4RD6A 1G8FA 2KE5A 4LHYA 4OBEA 4QJ3A 4Z51A 4TYNA 1NJGA 3U60B 2P65A 3ZS9A 4G01B 2ZRBA 2C04A 3RS4A 4JT4A 5HKKA 2FE4A 3EG5A 5DN6A 4BFWA 3QG5A 4C3ZA 3QOFA 3K70B 5HZKA 3WBJA 3W34A 3I92A 2O8CB 3L0SA 4DLUA 1ZYUA 1LFDB 1EFHA 2O0HA 1JQLB 4P33A 1XD2A 4Q02A 2D3WA 2JGNA 4BFVA 4GZMA 1Z29A 4XVRA 1KMHB 2NMVA 2WSMA 2WWIA 3I5YA 1ODFA 2GJ9A 1SVOA 1OKKD 3R9IA 4OYHA 3EPJA 2IYYA 2BBTA 1DAGA 2GDJA 3OAAD 3T5GA 2F43B 1GIAA 5L3SB 1DG3A 1OIWA 4FIDA 2G88A 4XTCS 1XJ0A 1UAAA 1ZMXA 2NPFA 3LLMA 1MR3F 1D8TA 2ZUCA 4KO8A 2G6BA 4MUBA 2FGKA 1FUUA 1GNRA 1KI2A 1OLOA 3X1ZA 4RD4A 1IN8A 1JXOA 2O8DB 3CPHA 1NMYA 4A2PA 2N1BA 4JLPA 4EPVA 4QNRA 3PUXA 4M9QA 1IXRC 3RS3A 3KZ1E 2ZXUA 5AUPB 4XVQA 3IIJA 1XTQA 1GKIA 1KI6B 3P1JA 5F9FA 2XNDA 1P73A 5FR1A 3OIWA 2NIPA 4CZ2A 1DAIA 2W6JA 3NBYC 3BIFA 1E99A 4CEIB 2OEPA 4W5WA 1NY6A 1GM5A 5JZVA 3AF2A 2A5DA 2F9MA 4FMBB 1ZM2A 2PT5A 621PA 4E5UA 1G5TA 2XOKD 1FP6A 1N5IA 2VP4A 1OV4A 3GJ3A 4M22A 3O8CA 1CJVC 5JI3E 4OHYA 4MGIR 4P31A 2YZ2A 3A4NA 2GZDA 1SXJE 4Q4HA 2QROA 1Z83A 2PZGA 4S2EA 3SYNA 1NLFA 4EKDA 3R8FA 5G3ZA 3PEVA 4ASUD 1XCPA 3BWDD 3H0KA 3IBYA 1VHLA 1L4YA 4RZ2A 4EJSA 4PC6A 3AGQA 2FNAA 3QJYA 3VQTA 4KV9A 5CB6A 3FTQA 4V0MA 1Z06A 1AZTA 3GFOA 5KSYA 2XJ4A 1ZNWA 2GJKA 3IPYA 2FPKA 4IJMA 1GL9B 2RGAA 4WXPA 4M1KA 2YINC 4C0BA 1E2GA 1PUJA 3WMEA 4TL9A 3PUYA 3RNLA 3K0SA 4QGGA 3R9XA 5JFGA 1E94E 2JLYA 1ZC3A 4XH9B 5FR2A 3TAHA 3HDTA 2DCUA 5CIWA 2ZSAA 4D26A 2IYLD 5CM8B 3B1XA 1B23P 3CRQA 1G18A 3AQ4A 3CF0A 2HCBA 3CONA 1FZQA 1Z47A 2W6ID 5KNCA 1QVRA 2BKEA 1CTQA 1II8A 1U2RA 4IVQA 3QPUA 3KUDA 3OFND 3WYFA 2ZS9A 3AM1A 2FWRA 1XD2B 3GPLA 4I81A 3GP8A 3DEFA 4IOJA 4PANA 3PEYA 1VHTA 1E32A 3MJRA 4IDHA 4WXRA 3TE6A 4ERNA 1W0KA 2G83A 5JJKA 1T8TA 721PA 4M0LA 5IHPA 2GZAA 2UKDA 3KXLA 1KJZA 1G7RA 1PJRA 4W7SA 3I62A 4BZXA 2CCJA 5FBLB 4C30A 2FG5A 3EX7C 2HJVA 4KVAA 4DIEA 3C5HA 4A2WA 2ZSFA 1DVRA 4PSVA 5E95A 1XMSA 4JIMA 1IHUA 1JEDA 2HF8A 3OIUA 1OIXA 4A8JB 5J4YA 4HLCA 2OILA 5EXSA 1H65A 2F7SA 3NKVA 2QPTA 4F7WA 4XWAA 3U7EB 5CIQA 4QBFA 1R8SA 5EP2A 1CR0A 3WNCA 2OM2A 3UATA 2IYWA 2QNRA 4D82A 4UNRA 3TW8B 2J3EA 3KKOA 1E2LA 1KK3A 1E69A 2A30A 4TQ9A 4CGZA 2B6HA 4LJ8A 3F5FA 1VIYA 1XEXA 3B85A 2Y8EA 3Q5DA 4OK5A 3U3JA 4TSFA 2PCLA 1YZKA 1KK2A 2R9VA 2ZROA 5FPKA 3MAAC 3ZZTA 3AP1A 3K1JA 1YHNA 1G3QA 4LUCA 4QBHA 3AEZA 4NHOA 5B2ZA 1W49A 1I4LD 2NO7A 3TBKA 4B32A 2D74A 4M21A 3M0EA 5TARA 4EQ6A 1KI4A 3K0CC 4LPSA 1AKYA 4PSAA 2WOJA 4ZDKA 1V43A 4NONA 1YZUA 4V0LA 3KXIA 1JR3A 1OIVA 2KJQA 2NOAA 1TADA 3LVQE 2QL6A 3OEED 3SBEA 4IDNA 3LQRA 4Q4HB 2JDIA 1GKYA 1KOFA 2QMUA 2RKOA 3EW9A 1N6PA 1AS3A 2VSFA 3GJ8A 2JJ8A 3AVYA 4ZDIA 4NCHA 3PV0A 4AURA 4EJSB 4YMTA 3DZDA 2FJUA 2ZEJA 1KAGA 421PA 2O8FA 1KYIA 3QNUA 2OUKA 4NPHA 2VA8A 1G7CA 3FKSD 2XOKA 4D6PA 5J4LA 2G1JA 4Q9IA 3T5DA 1LF5A 4UNQA 2YOFA 3DMDA 3B7GA 3B60A 2XZPA 1E1QD 3KJHA 4Q9HA 4BLSA 3CF6R 3IQWA 2BM0A 1E4VA 3ASZA 5HZHA 2EFGA 1XPUA 5JS8A 2QN6A 3NIBA 2ODNA 1HH4A 3ZIAD 3W6OA 1D9XA 5B58C 5BN5A 2FN4A 4TQAA 4KLZA 1II8B 2PCJA 4QM6A 1Z6GA 4GNKA 1VCMA 3W3AA 4M8NE 2WIAA 2WMNB 4FCWA 2IS6A 3EZ6A 3FWYA 1SVLA 4F4JA 1SGWA 3KXKA 4D4LA 3AGPA 4LK2A 3VKGA 1OW3B 1MRSA 3ADBA 3DVLA 4XOIA 4DUGD 4IOMA 4F38A 3SC3A 4Q47A 2IS1A 1WP9A 3QXSA 3BB4A 2UZIR 1NNEA 4JSYA 2W6IA 3F0TA 4AKEA 1M1YE 3RWOA 3UK6A 1QF9A 2ZIAA 3OFNA 1I4TD 1KK1A 2QPAA 3AVOA 2HLDA 4OHWA 1CJKC 1A5TA 2QQEA 3B1WA 1RYFA 3ICEA 2V9PA 1XFAA 1RFLA 3HR7A 5EE0A 2EFEB 4V0OA 4AI6A 1C4OA 2PH1A 4NCKA 1F3OA 1CIPA 4IFEA 4DCNA 3HWSA 2HDNB 1KDOA 1XEXB 1OFUX 4B2IA 1O3YA 1U99A 4NCNA 4A0GA 521PA 1IY0A 3B13B 5KNBA 1NL3A 1SXJA 3ZZ0A 1Z63A 4C0KA 1EX6A 3TSWA 1JB1A 4NTZA 1TF2A 2QM7A 2RHDA 2R6AA 4JVNA 4UJ3A 3IEUA 4EQ6B 1VCOA 4DSUA 3AVXA 2W2TA 1JEEA 2V1XA 4AK9A 2R8RA 2B8WA 1B0UA 1GILA 1P7CA 4X8MA 1ZAKA 4AYWA 3LBNA 2VBCA 4I1SA 1E9AA 4PHTA 4TQUS 3VR4A 1F2UB 3B9PA 1DAKA 4NYIR 1UFQA 1T0HB 3H84A 2GAOA 2CLDX 2EFDB 5FOXA 2XXAA 4GOJA 4QOSA 1A1VA 1QHHA 1L7VC 5JEDA 2O5VA 2C2HA 3T1VA 4WVFA 2ZU0C 3L0IB 4B74A 3K70C 1G41A 1OF1A 1RJ9A 2O8FB 1E9FA 4RSGA 2ZETA 4HATA 3NVAA 3BB3A 4R2HA 4B6EA 1YRAA 3ZD7A 2DWPA 3AH8A 4JMPA 3K53A 3RS7A 2GVZC 5FI0B 2WWXA 3P27A 3GEHA 3L8YA 4LJ5A 1WCV1 2XTMA 3ZGXA 4HYYA 6Q21A 3P32A 4PPQA 3DO6A 4UKDA 1XTJA 5JRJA 3TSZA 4MKGA 5DISB 2Z0MA 4QJ5A 3PUVA 2ORVA 1MO6A 2OBMA 4KFRA 2XJ9A 4TTPA 3RRZA 3GLIA 1JI0A 1R10A 1NN3A 1RYHA 1W2GA 2QTHA 2FV8A 4HB3A 3WYGA 3CRVA 1G64A 4BZQA 1SVKA 1EX7A 2OG2A 3QKRB 1XEWY 3T06B 3HYTA 2DHRA 2F3TA 1MH1A 3T12A 1NRJB 2QRNA 4Q7MB 1IXZA 1E1RA 3AVVA 1Y63A 2R65A 2JCSA 2VIIA 1NVWQ 3Q3JB 4HLUC 4X8LA 1NVUQ 1G5RA 3A37A 1OXTA 1I4DD 3NH6A 5FPYA 3UMRA 5E7MA 5A0FA 2W83A 3H86A 2GK6A 2ZI5A 5C18A 5KNDA 4X8OA 1HUQA 2Q3MA 2AN9A 2HEIA 3AKCA 3C15C 4US2R 2GXQA 2F6RA 1IY1A 2RGNC 3RS0A 1Q57A 3U6BA 2P6RA 4QHSA 4KI0A 4URXR 3KJIA 3T1TA 2O8EA 1VCNA 1VYUA 2QP4A 3IIMA 4XSGA 4D4JA 2CE7A 2ZJBA 3A1VA 2IS2A 1GZSA 4BLRA 3S1AA 4J0QA 2PJRA 5F9HA 4AD8A 5DLQC 5JBQA 3DKPA 5CLLA 1W0JD 2F9LA 2XTZA 3NEYA 3EZ2A 3BC1A 2QGZA 3MG9A 4RCZA 2IWRA 4Q4AA 2ORIA 1TTTA 4EFNA 2OCAA 4DUGA 1Z8FA 3V9PA 3LQQA 3QPWA 4U5XA 4URWR 4Z54A 5FBVB 1FX0A 4B33A 2R62A 4LJ6A 2ZVQX 4PZZA 5FTNA 4B73A 1KY3A 1R4AA 4MQBA 1P2UA 3AF0A 2IC5A 2RAPA 3LDAA 1SXJB 5GADl 3I32A 1HE1C 4BFZA 4DSTA 5C4MA 2HYDA 5FBRB 5SZKB 2VRWA 2JJ2D 2KBFA 2ZRPA 2GEUA 3NC1C 4PXAA 4ZI2A 1T3SA 1E2HA 1EFTA 3W5IA 1GRNA 2VHUA 2WWGA 3BXZA 4YC7A 3T1QA 3EZ9A 2PBRA 1G19A 2ZSEA 1JECA 1ZJ6A 2JEOA 1X3SA 2E9SA 3DM5A 5TDHA 3W8NA 4BLPA 2XXAB 821PA 2ZUBA 1QHHB 3KJEA 2DFNA 3EWAA 3L0OA 5KO2A 3NXSA 2CE2X 2W0MA 2ZRDA 3KQLA 4TL8A 2YOHA 3ND8A 1YQTA 3DOEA 3OIYA 5G53C 3W6NA 4D0LB 3OE7D 4Q1CA 1BOFA 1W47A 3MUFA 4DSNA 4TTRA 1VG9B 2WJHA 4IHQA 1E79A 2GXUA 4M9ZA 1U9IC 2H16A 2PEZA 2WWFA 3Q72A 4JYCA 3CWZA 3GLHE 4JYBA 2LCFA 5DYIA 4W9MC 1G8PA 3CF2A 5AJYA 4B47A 1VDZA 4ZCMA 4ZPXA 2CLCX 1G3IA 2F1HA 5AJZA 4DKXA 1D2NA 3HR8A 4TMWA 4BFTA 1H8EA 4A82A 3T35A 2IYVA 4MGZR 1VMAA 1T91A 4V0ME 5L8VA 3GLIB 2CL6X 4F93B 5FL3A 4DLRA 2RGDA 2GILA 1ZU4A 1XMJA 3ETLA 2GCOA 1CRPA 2XB4A 1E0SA 1Z6XA 3BS4A 1VIAA 2ZRIA 1J7KA 3D7MA 3M4YA 4HAWA 4RD2A 1FOEB 5EUQB 1NLYA 1OXUA 1QHYA 4R98A 2ZUDA 4FD2A 1KK0A 3MWKA 3AF3A 5GJWC 1RC8A 4ESHA 3U44A 2V55B 3G5UA 3EZFA 2YV5A 2BC9A 4XTRA 1N5JA 2ATVA 3GMTA 5FPHA 1IY2A 1YU9A 3QSYA 2ZE7A 4OI1A 1PLJA 2H7VA 1Q1BA 3B6EA 3S1AB 1K6MA 1OH8A 3MMPA 2Q9CA 2IUUA 1T8UA 1ZM7A 4DLXA 3T1OA 4LOAA 4P4UA 1YR7A 4HLUA 4C0AC 2VSOA 3DDCA 1SKQA 2AD5A 3CR8A 3QXHA 3T61A 3UWOA 5CB8A 5TMPA 4Q4AB 4FMCB 1KO8A 2EQBA 3AKDA 5AR1A 4D2IA 2IYQA 4TMKA 2Q21A 2JIZA 3LA6A 2J0VA 5GVRA 4C0LA 4GP6A 2WPDA 3ECCA 2X1VA 3KKNA 3KDSE 2H5EA 1FQKA 1IXSB 4PC2A 2VSXA 1E2PA 1EG7A 4R7ZA 1XDBA 1G6OA 1GRQA 3V00A 2AXNA 4RD3A 1EFRA 1TPZA 4KXFB 4HAUA 1VG8A 5CK4A 1JNYA 3A8TA 1DO2A 4TYYA 4EJSC 4IXMA 3U6KA 2PX0A 3R7WA 1Z22A 1X8JA 2ZI3A 2ZREA 4PX9A 1XJCA 2EWWA 3PQCA 1XF9A 4V0KA 2GWHA 2A9KA 4G5RA 3Q9LA 1XWIA 5JMTA 5ELXA 3AVPA 2QTFA 4H9GA 3TUJC 3A1WA 4DBLC 1M34E 1NF3A 5H68A 1CP2A 3CNNA 3Q8XB 3X1WA 4JBWA 3NHAA 1FW6A 4TZ6A 5AJWA 4LGMA 4Y0VA 2ERYA 1DS6A 3GJ4A 5JLJA 1KO5A 4MA4A 1E2MA 4IDPA 5BYJA 2XX3A 1NLZA 2AD1A 5CYOA 1TF7A 1KJWA 1UKZA 5H1YA 3BFVA 2IEYA 4HUQA 2FDCA 2GVDC 1FTNA 3VR2A 1G9XA 2H1LA 4HB4A 5L3RA 3WBKA 1NVVR 3GLFA 5JWHA 2GTPA 3TVTA 1GWNA 1ZUIA 2ZJYA 3MD0A 3VX3A 2A7QA 2BMEA 1J70A 4OHXA 1Z0KA 1Q1QA 4LJ4A 8OHMA 1AKEA 1SULA 4A4DA 3ZQJA 2E87A 2ZRMA 1LTQA 1UDWA 3AF4A 4B2LA 4JSTA 3REGA 2X2FA 1CS4C 3D6TB 4UJ5A 2QE7A 1I2DA 1XMVA 3ZYCA 4FMCF 2WTUA 1P72A 4LZZA 1KSHA 5AUQA 3PXGA 1DPFA 2F55A 1G20E 3FMPB 1GAJA 5B64A 4TLCA 3SDZA 3SN6A 2MSEB 5F3WB 1YZNA 3NTUA 1QDEA 4KU4A 1T4GA 2D7DA 1LB1B 1IQPA 1DADA 2GCOB 4HZIA 1XMIA 1XBTA 4PAQA 5HTKA 1Z2AA 4RCYA 4GZLA 4LDJA 4QGAA 5JWRA 1E9BA 1GRRA 1U9IA 1KSFX 3B1ZA 3DKVA 3KQNA 2F1RA 4PC1A 2VF8A 4FWTA 3E1SA 3NG1A 3QY0A 2VF7A 3FOZA 1SKYB 2YC2C 1CR2A 4BE7B 1E2EA 1FP7A 4MRPA 5IT5A 5EP3A 3O8RA 5EUMA 4WA7A 1GVNB 3DL0A 3WNBA 3RRYA 4GOKA 4QM7A 4E09A 3GFPA 1P61B 3U44B 1ESMA 1U98A 4PPGA 2AL7A 4OQXA 2Q3FA 1UF9A 2IYTA 4LHZA 4G1UC 2CK3D 3N2EA 2C78A 1VECA 4YMWA 1P75A 3CRW1 4URZR 4BPBA 1YR6A 2GHIA 3B1YA 3MWJA 2GA8A 4YXWD 4O0MA 1J8MF 1SVMA 1X1RA 2AX4A 3SBDA 2C9OA 2ZU6A 2G3YA 4OI2A 2QT0A 2IT1A 4QBIA 2PL3A 4C9BA 4FI3C 1N6HA 3CX8A 4KYIB 5DHFA 4YMSA 4CEJA 1R0WA 2HT6A 3WNDA 1BYUA 1ZINA 5L3VA 2CVFA 2ZAOA 1MOZA 4D4MA 2QMEA 4I99A 2J0UA 5FOVA 4CW7A 1HA3A 4QHYA 5IRCD 3ADCA 1YJ5A 3SHFA 3OZXA 1AS0A 3R7WB 2VO1A 3KQHA 2CHQA 1KNQA 1N2CE 3KQUA 1UKVY 4IFBA 4PHGA 4OQMA 3VNUA 1TUEA 1E3MA 3N70A 5FH9A 5JSZA 5G40A 3ZZUA 2IYXA 4KVGA 4L15A 4UQOA 2Z43A 4D4KA 3SU8A 4G5SA 3ZVNA 4CYMA 5JS7A 1RRPA 1PLKA 1CJTC 3C4JA 1T9HA 2D62A 1TQDA 2X19A 3GLHA 2BBOA 1E4YA 4BRUA 2WJIA 4WAUA 4W5HA 4S35A 3RHFA 4YMUA 3OIVA 4LC1A 4JZKA 2VEDA 4M1WA 4HUQB 2IXGA 2WAYA 4IDQA 1IJEA 1ZC4A 2QMOA 1FNNA 3K9NA 2YHSA 2IUTA 2QENA 5SZJA 3L2OB 3QBVA 1K5DA 3LFUA 4US1R 1VYVA 3PUZA 5DI3A 4AYTA 3HU2A 4HDQB 4Q7LA 4JLNA 4JVMA 2ORWA 1Q3TA 3VHXA 4G5GA 4MDEA 2RGXA 5JWOA 3LD9A 1KKMA 1M2OB 2D2FA 4JKYA 4TMXA 5FUXA 2QM8A 2Q6TA 1GKUB 3QEJA 2JAQA 3I73A 4IOLA 4B35A 2MSDB 1G3MA 1UPTA 2QORA 4PQYA 5GVSA 2GNOA 1OPXA 5JCZA 1JJVA 3C7KA 4NMMA 5TY0A 4DLWA 5EZ6B 5B30A 1MO5A 5IK2D 1ZVQA 2ANCA 3FGNA 2P67A 3UANA 3VNVA 1GDDA 1N6RA 3NHBA 2B7CA 4EPYA 4HB0A 2OBNA 3RSOA 2ZR0A 5HR5A 2RGCA 1Q44A 3BK7A 1T3HA 3GLIE 2BM1A 4PAMA 1P6XA 4QKQA 5BW8A 2VP6A 4GP7A 4XD7D 2ZS7A 3PG5A 3CRRA 4EPTA 4XVUA 4OQLA 4ACBA 3RSLA 3LH5A 2O0KA 1RIFA 1SXJC 4QG7A 4AKIA 3NC0C 4A2QA 3TKLA 3TSOA 4F4CA 4Q4JA 1U94A 4PPNA 1Z3IX 3RC3A 1M7HA 2JASA 3WY9A 2BJWA 5AK0A 4TYQA 4ZIRA 1GL7A 1SVWA 2IXFA 1OKKA 4LC0A 2XITA 1HEIA 5DH9A 5BQ5A 3SZRA 3K0AA 4JBYA 4ESVA 3OAAA 1VG0B 2W0SA 4CEJB 3UIEA 1ZU5A 1S4QA 4GT1A 3L82B 2CK3A 1KI1A 1E2QA 2NO0A 4XSHA 1EGAA 1LVGA 4AIIA 4K8OA 4M4SA 1A4RA 1G21E 1DAEA 4P3YA 4DRZA 2J0UB 1UDXA 3L43A 2FPLA 2I4IA 3CH5A 2JLSA 1Z6YA 3BAFA 4KHZA 4OQFA 2FU5C 1J99A 3R8CA 1FTSA 4KFTA 3WMGA 1OXXK 1Q20A 4LCBA 1NVVQ 2WHXA 3F8TA 1BMFD 4NYJQ 2JLXA 2BOVA 3PIRA 4TL6A 5JSZB 2EFHB 2OAP1 4LWZA 3REFA 2ODBA 4M1OA 3SI7A 3U3MA 4QBGB 4MRSA 2NO9A 4OHVA 2YNMA 4EUNA 221PA 3CNOA 4YONB 3GLHB 2YVUA 1E6CA 1UBFA 1W46A 3I3SR 3MWYW 3QKSA 4C0JA 1OXVA 1HT2E 4B34A 2WKPA 1A2BA 2XAUA 1XZQA 2DBYA 1JALA 2K5UA 3VX4A 1GTVA 2IXEA 3EA5A 4RVCA 2RCNA 2Q0HA 1G16A 1NKSA 2PT7A 2ZR7A 4ZO4A 1CRQA 1E9CA 1KZGB 1Z0FA 1ESNA 4RFSA 5DI3B 1M6NA 4UXHA 3VFDA 4DLZA 4P0TA 1II9A 1MO4A 5KPJA 3OHMA 1W4CA 4ASUA 5FFMA 1NG1A 1OYYA 4IOKA 1JXMA 2OFXA 1KI9A 4IRUB 1HTWA 3AP3A 1US8A 1KHTA 2IK8A 1VPLA 3W6PA 4A92A 3I5XA 3LRPA 3GLGE 4IW3B 4TT3D 2D7CA 1AM4D 4LY6A 5TV2A 1AZSC 4U02A 3M6AA 4DZZA 5KUTA 2ANBA 2DWQA 4G5OA 4I1UA 5FBWB 4A0HA 1A82A 3IILA 3VU9A 4WZ6A 3IHWA 1HURA 3TK1A 2H8KA 2KSQA 4C4PA 2QRZA 3QBTA 5FUWA 4L5BA 4DDVA 4JLJA 3CWQA 3THWA 1CULC 3RABA 3FMFA 5TB5A 4WIAA 1RE0A 1XTKA 1OSNA 2QUZA 2OBLA 4ARZA 3I8SA 5HCNA 1EESA 1NVXQ 2QQ0A 1S0UA 1AA9A 3TQFA 1E9RA 4KJZA 2VHCA 3B9QA 1CR4A 1JPNA 1SKYE 4LYJA 4Q4JB 1GOTA 2J1LA 2BHRA 1UJ2A 2ZYVX 2RHMA 3RDPA 1Z5ZA 1IM2A 2X77A 2IEZA 3DM9B 5L3QA 4ZIRB 4URUR 4MITA 1ONBA 2NZJA 1S3SA 4UXJA 3K0AB 2ERXA 1QG4A 3PITA 5FTMA 4CIDA 1OB5A 2IUSA 4GRAA 5C4GB 3TUIC 5DNYB 2VL7A 4ZDWA 3CIOA 1YR8A 1DARA 4Q7KA 3U7HB 2H92A 1D9ZA 1R6BX 2NQ2C 4AC9A 5K8IA 3QKTA 2LKCA 4M1MA 2GRJA 1P2VA 2HXYA 1NIPA 4B2PA 1J90A 4Q7JB 5E3HA 1G8YA 1LF0A 3EWSA 3CB4A 4O2RA 4N1AA 1KZ7B 4AKHA 1L4UA 3RRMA 3ND9A 1P2SA 2GEDA 2O0JA 3IUYA 4GOXA 1E9DA 4RZ3A 3O8BA 3FHOA 1HY3A 3LVRE 1KDTA 1DO0A 5K8LA 3SQWA 3G0HA 3QKSB 1UKEA 2GK7A 4ZKDA 2FFBA 1I2MA 3W3ZB 4JJKA 3RAPR 2ZANA 2R6DA 4Z1MD 4Q19A 4RZXA 1ZP6A 3SR0A 3N5CA 4P4SA 1E2FA 2Z4RA 2FA9A 4HAVA 1P9NA 1S1MA 3LY5A 4LV5B 4GPTA 1W36D 3VTKA 1G4AE 4RFSB 5CK5A 2O8BA 1N6IA 4B3DA 1CJUC 3OEEA 3P4XA 4QGHA 4Z8YA 4CT4B 1JBKA 3CX7A 3UWKA 4EIWA 1WRBA 3KB1A 1OJLA 2GJAA 2VQSA 1T6NA 4WW0A 3GLFE 1DG1G 5DO9A 3ASYA 1N5KA 5FL7D 4BLQA 1US8B 4C0QC 2GKSA 4IXNA 2ZJZA 2WMOB 2C8VA 3FKSA 2ONJA 1GNQA 5EE5B 2HJGA 5ANRB 3AV0B 2FPMA 1YZLA 2REXB 2ZI9A 5F2EA 4DEYA 1E1QA 3VU9B 3H1TA 3IIKA 4LPKA 4A0FA 4ILEA 4DHEA 2J0QA 4V02A 1CR1A 3A1UA 4DJTA 2NG1A 2D4HA 2DFTA 2XZLA 2AWOA 4TLDA 3EPLA 3P26A 4PO1A 5F98A 3ZIAA 4I1VA 4ARZB 2BVNA 3FDIA 2CHGA 4OK3A 2REBA 3IHLA 4JLBA 3RS5A 5KSPA 4Q21A 1OH6A 3QVUA 3UXMA 5EQTA 4MYUA 2DFKB 3TUZC 1X1SA 2YKGA 1WA5A 3ZD6A 1G1MA 2OLJA 1FMJA 5AWFC 3JZAA 2JJ1D 4BFSA 2VP0A 4E03A 2A5JA 5L3QB 4NCIA 3DMNA 4PTLA 2NO6A 5BN3A 2NPIA 4I1OA 2Z6VA 2GZHA 2VH5R 4IEIA 5BYKA 4Q4LA 1YZGA 1F5NA 1E9SA 3M1IA 5KOYA 2A78A 1OHHD 4JJZA 3B5JA 1XEWX 2QAGA 1VG1A 4Q66C 2CLSA 3W8RA 1FPMA 2GJ8A 1UADA 2ASEA 2IF0A 3Q7QA 4BLOA 2J41A 1S1CA 4URYR 3Q5EA 4HAZA 3TVDA 5KYKA 1ZM4A 2UVQA 4OJQA 5KSZA 4GL2A 1DBSA 1WE2A 1YZTA 4LBZA 4TL7A 5SZHB 1DE0A 2GCPA 3HPQA 2WV9A 3Q7PA 2Q3HA 4NZYA 1U0HC 2NO1A 2ZE8A 3U3RA 4R2IA 2N42A 4AG6A 4C2UA 4ABYA 5BN4A 1BIFA 1R5OA 3QIAA 4G5QA 2VTKA 4DDTA 1W4AA 4BFYA 1S2MA 3CLVA 2BJVA 2WIBA 1IONA 1PV4A 4LV8B 2FSIA 4PFSA 3RLFA 4US0R 1RJ9B 3TGPA 4KCGA 4P4SB 5C46F 2F1IA 3K8YA 2EYUA 2BMFA 4HI0E 2C9YA 3IPXA 1PLLA 1E2NA 3NBXX 3GLGA 4EPWA 4AY2A 4A9AA 1AS2A 3CZPA 3T15A 2CBZA 4A36A 2IS4A 2Z5FA 2O8BB 3VR6A 5DHAA 3GEIA 4CF7A 4TLAA 5EXTA 1E0KA 5AJXA 4HDOB 5HKKD 5TXGA 1LNZA 1BYIA 3AB3A 2G77B 4BEJA 2B7BA 2ZRGA 5DN6D 2BBSA 1XTRA 3UMFA 1ZD9A 3TRFA 2QPOA 4YDHB 1AGPA 1M7GA 4Q5IA 5CLQA 5TVKA 1W48A 5EE1A 2IL1A 4MYTA 1OB2A 1BS1A 1QHXA 1MABA 4KAXA 3TNFA 4DLYA 2MSCB 1S9DA 1ZD8A 2D06A 2P0EA 2GBLA 4JBXA 4PZLA 1G7SA 2QA5A 2PZFA 2YWFA 1JAHA 5EP1A 3TR5A 3HYRA 4OJKA 3QXJA 4KBGA 2BMJA 3IQXA 1SVIA 5FL7A 2DPXA 2WAXA 3CBQA 3E2IA 4Q01A 2CCKA 4LYAA 2O8EB 2NZ8A 1U8YA 1P3JA 3RANA 2CDNA 2KWIA 3LXRA 4NKRA 2OFOA 3RS2A 1G3UA 3QXCA 4Q00A 4U00A 4LBVA 4HLDA 2FF7A 1DOAA 2BKUA 3U61B 4EPXA 3U7GA 4D0NA 3FHTA 2F1JA 4QC2A 1T3LA 1VTKA 3MLEA 3A1TA 1NY5A 1AIPA 3D3QA 4PC7A 3BH7A 5EE3A 5L3SA 1FX0B 2Z4SA 4B71A 5J40A 1CKEA 4NDZA 2PX3A 4LJ7A 2C98A 4BRWA 4B3BA 2PLRA 1BO6A 1WBDA 2QAGB 2J59A 5LDDC 1WF3A 2W6JD 1YR9A 2WKRA 2ZRCA 1MRNA 1T5IA 1KI7A 1W0JA 1Z28A 1ZRHA 2HCJB 4QL3A 4LSGA 3GQBA 1ZUHA 2ZE5A 2JLUA 1ZCBA 1NP6A 1Z6TA 3B2EA 5DE3A 2GCNA 4DDUA 2XZOA 3DPUA 5CDFA 4YLGA 3TR0A 1FNMA 3ZJYA 3GJ0A 3RC8A 2PZEA 1P2TA 2D2EA 3U3KA 3EA0A 121PA 1XU4A 4MUAA 3C41J 2FSHA 1OHHA 4L9SA 4TYWA 3J81k 5J47A 1MO3A 2ZRNA 1P9WA 2EWVA 1EFUA 4LV6A 4DCSA 4MRVA 5C1BA 4CEIA 4II7A 3WRXC 3X2SA 1H8HD 5KSOA 4C7OA 2JJ2A 2QSZA 4LYFA 3EPKA 4NYJR 4A6PA 1R0ZA 4G0NA 2R44A 3VKHA 2X8AA 1DEKA 1P9RA 1DELA 2LWIA 3GLGB 2H57A 1QBKC 2A2ZA 4DCUA 4LBWA 4FWIB 1IN6A 1TX4B 1T5LA 4JLDA 3ADKA 1E2JA 4HLQB 1W7AA 3A36A 3BB1A 4QHTA 5GJCA 3CR7A 1N0VC 4C0HA 1LS1A 1E0JA 3NBFA 4E22A 1RRGA 4Q48A 3I61A 4KFSA 4AKGA 5FUYA 3PR1A 2EYQA 2YC4C 1UBGA 5FUVA 5H70A 2AXPA 3GJ7A 3OE7A 1P62B 4A0RA 2HXSA 4MKFA 2VYFA 4UNSA 3R20A 2QP3A 4QFMA 1QHIA 2B92A 1KDRA 1N25A 4LJAA 5EZ5A 1GITA 2HUPA 2WJGA 1MABB 2J46A 2JLRA 1F60A 5KPDA 2J45A 1W0KD 3BBPA 5JRZA 1BH2A 3X1DA 4AWXA 4XWKA 3RVBA 2DWOA 4BZPA 3IO3A 3LLUA 1HYQA 1XNJA 3CRMA 4YQFA 1KNXA 2EU8A 1JPJA 2OT3B 2R6FA 2YYZA 4TZ0A 4ZCIA 3Q85A 4GDFA 4MGKR 3IBGA 4A15A 1NN1A 2ZRKA 1SHZA 2OHFA 3BFXA 2IW3A 2VHJA 3SS8A 1X86B 4HAYA 4PO8A 4Q1DA 1R7RA 1D5CA 5JJIA 2BIFA 1P4SA 3HU3A 2QGNA 3HPRA 5AUNB 4B43A 1OFIA 2BEKA 4FMDB 1ETUA 2BCJQ 2QAJA 2OCYC 1L8QA 2IYZA 2V8OA 3I72A 4WZBE 1W1WA 2FGJA 2X2EA 3FFAA 4WZAE 1QHGA 1R5NA 4NYMQ 2VLIA 2XNSA 2ZQ5A 2AHOA 2ZRHA 4TLEA 1XB2A 3PFIA 2ZPTX 5CM9C 2DB3A 4TSFD 1XTIA 3X1XA 2AKAB 4DDWA 1NBMD 4A8JA 2PMDA 4D25A 5UKDA 3ONWA 3O8DA 4RKEA 3LW7A 4YDSA 4XIGS 4BUJA 1Z0JA 4PC3A 2BWJA 4GBMA 1Z6AA 2OZEA 3V4RA 3CH4B 2YOGA 2FSFA 4JL6A 4Q9KA 1XEFA 3C14C 3BH6A 3D31A 4XJXA 5DGXA 1Z08A 1NMZA 3L0PA 4K46A 4U7DA 4Q1BA 3K09A 2NGRA 4BLTA 3A1SA 3CKLA 1JR3D 2GF0A 4PAOA 2TMKA 4MRRA 3LAWA 4YMVA 3AVTA 1Q12A 1KIMA 1O87A 2JDID 3W9YA 3SEAA 3QKUA 2FH5B 1ZUNB 3MSXA 4ZKEA 4OQNA 4X8HA 5CJPA 5B57C 5EXPA 1Q0UA 4JVLA 4C7OB 1Q22A 1NMXA 1IAQA 4L16A 3GLFB 1RVDA 4M1SA 3SFVA 2C95A 5EP4A 1TEVA 2ZTSA 3CM0A 4QXAA 2BDTA 4A6XA 5HE8A 2GEVA 4OK6A 5FBQB 1KSJA 2WJYA 4Q03A 4GI7A 2R2AA 2RH5A 4ON9A 3ZVMA 4FMDF 5DI9A 2C9CA 2QY9A 3WXMA 2PMKA 4AG5A 4BASA 3BH0A 1M74A 2LKDA 3PEWA 4TLBA 3LX8A 1H8HA 4H1VA 1TQ2A 2YWEA 3C16C 3O47A 2ZSDA 4LYHA 1KSGA 4EDHA 2GESA 3LO5A 1RRFA 3QF4A 3VR5A 5GJBA 1HV8A 1XD9A 4PPFA 4RJLA 4RY2A 3QF7A 1TNDA 3H4MA 4JL8A 4HUTA 1X8LA 5DIFA 3OESA 3I4LA 4KODA 1AN0A 2G9NA 4I4LA 1XZPA 3E5HA 4IEEA 1GNPA 4B76A 2EFCB 3ZVLA 4OKSA 3AF1A 3IEVA 1CXZA 2CEAA 1XD8A 5BXQC 3CNLA 2R6GA 3K9HA 3U5ZB 1VCIA 2ZJ2A 3A4MA 1ZBDA 3EPHA 1XXHE 2RGEA 4OI0A 1TEXA 3I8XA 1WB9A 4LRWA 2IYRA 5HCIA 4BEBA 3HU1A 1D2EA 2WICA 3GJ5A 5E4FA 2B8TA 3NDBB 5CJ2A 1NI3A 3SYKA 1FUKA 1F2TA 2OSBA 3AKEA 1NSTA 4C2TA 1TL7C 4DVGA 5FTLA 3FFBA 4KBFA 1ZM9A 4ZI3A 3A58B 2HLDD 4LX0A 1W4RA 2QI9C 2QT1A 3FYHA 3MCAA 3QEOA 2CMKA 4FW9A 4L9WA 4Q1EA 2FSGA 1XJQA 1N3BA 5LD2C 5IF9A 1U90A 4JVSB 4WOPA 1Z0DA 3LW8A 5DYGA 4PR0A 3UG6A 1Q3HA 4FXPA 1N0WA 3KB2A 2ZYTX 1GFIA 3X1YA 3AUYA 1G17A 2P5TB 1CJMA 4QNMA 5EXXA 4M2LA 2JLVA 2ZYUX 5SZIA 2ZE6A 1SXJD 3NWJA 4HSEA 4JLOA 4MKHA 3OEHD 2FEMA 2V3CC 4YXWA 1EWQA 1G7TA 4UXIA 4ZDJA 2ZITA 1XPRA 2P5SA 1K5GA 3AKYA 3W5JA 1TQ4A 2OAQ1 2BV3A 3HJNA 2QZ4A 1YVDA 2XB2A 3JZMA 5K8TA 2XTNA 2CVHA 3KKPA 4Q9JA 1DAHA 2J7KA 4DSOA 3THXA 2OLKA 1U0LA 2P3SA 2OCBA
chains in the Genus database with same CATH superfamily
3IVCA 3PZKA 1BN7A 2CEKA 1H94A 2ZI6A 4KTTE 3DD5A 4LISA 4M8IA 1NBMA 5FOUA 3TPZA 2XHZA 3B3GA 2G1KA 2ZYAA 4MYCA 3WLJA 3HYCA 1W44A 4MJXA 5ILGA 2C3YA 2B1JA 4MCIA 3DWEX 4NCJA 4CM4B 1ADBA 3S2IA 3EB9A 4ID9A 3C8UA 3HA2A 3P19A 1M6VB 1JQJC 4Y2UA 5G4KA 2ZM5A 4JXKA 5BT9A 1XKQA 5J1SB 5CH5A 4GMFA 4MQ6A 4JCOA 5CX1A 3CVVA 4OGFA 2VSYA 3IDQA 4F4HA 1MRZA 1HOXA 1ZIOA 3I39X 3BEOA 3ER6A 1QAOA 4O0LA 4BNXA 4LECA 4V0NA 4FC7A 5L4NA 5EIEA 1AXRA 3CX6A 1D6MA 1R88A 1PFGA 1MT3A 3IO5A 3CS3A 3UXEA 4FGSA 4R5MA 2DRIA 4BGDA 2QD2A 3ENKA 5E7JA 2RB4A 1ZNZA 1G9SA 2O3UA 4N6GA 2NV0A 2PT9A 3MQ4A 3QFSA 3L7CA 1KIAA 1Q1AA 4QRIA 4ZHQA 2O4CA 1M8PA 5EZYA 3C5WP 3IV9A 3QF4B 4J0DA 3SJCA 5IULC 3N75A 1PL0A 2JGRA 1M6HA 1NVTA 3V4FA 3RIEA 4BFUA 5IDVA 2C5BA 5BSHA 2QV0A 4OA8A 4G5XA 4P38A 4P6VF 1T4CA 4F5EA 3ROZA 5GY7A 4PLTA 4KITB 3RJTA 1Y4SA 4JB2A 4BNDA 2GD1O 5ALEA 3B48A 1QRSA 4RK0A 2NXNA 2VDLB 4LBYA 3A6KA 4BB9A 5AVWA 1J2JA 2MR5A 1KO7A 2EBWA 4JMLA 3KE9A 5G0SA 2ZAYA 4WD3A 1J09A 3KOWA 3PKJA 1AQIA 1Y3DE 3LRTA 3THOA 6YASA 1NX6A 2ODQA 1Z0IA 3GUCA 1PZMA 2G9RA 1VJTA 1OWMA 2FETA 2WVJA 4HDMB 4JUIA 5EAIA 3JD0A 1TQ6A 2QAGC 2OLEA 3TBHA 3VPHA 4XDGA 3OWXA 1ZNYA 4H1TA 5AM0A 2DFVA 2B37A 1TVMA 3D8SA 1ORRA 2C2WA 3HNRA 4ZOQI 4G4GA 2JLQA 3K9LA 2ZYWX 4JT8A 3RJZA 3ZHQA 1CUSA 2P1ZA 3V8MA 3GI1A 2NU6B 4OUKX 5AD1A 3J80A 4O4LF 2Y1XA 2ZS8A 3H1AA 4NNPA 3UJAA 4PZYA 1X7GA 2NT3A 3FBWA 1XKXA 2AYZA 2VHVA 2WFZA 4D0GA 1RM4A 3TRDA 1T43A 3EVEA 2KI5A 4Z0TA 5H81A 4D02A 2VRCD 1LLFA 3HG7A 4FOOA 1DKPA 1QFMA 1SIBE 2VK8A 4IFTA 4LY3A 3P9NA 4PQRA 2C2XA 2JH8A 1BHO1 2V7QD 4U2KA 4XSVA 5AJVB 5J5AA 2DQKA 2QUIA 2P2ZA 5DGHA 2OZLA 3TLGA 1PFVA 1RI2A 3EIEA 3BDIA 4D4GA 1J0DA 3VDMA 4INAA 1USIA 5F2OA 1Y1TA 2H0RA 1U0JA 1V8DA 3U3ZA 1Z0AA 3HVHA 4H1UA 1ES9A 5D3MA 2FMKA 1RJWA 3K8QA 4FOTA 1VA5A 3DEJA 4CDGA 2POCA 4GBED 4NP6A 4E7OA 5JIBA 3THXB 3UWDA 3AHDA 4CE6A 4BLWA 4CT5A 5AW9A 3LBIA 2OP1A 2F8LA 3NONA 2QNBA 4YMIA 4P4TA 1D6JA 2J3IA 1CPYA 2NT4A 2R8XA 1AQUA 1T3ZA 4H59A 1OFTA 3EXEA 5KOJA 1TU3A 3B38A 3TM4A 3V3KA 1GP2A 3P5SA 2KW5A 1VL5A 1JB9A 3HCPA 2FKNA 4M0PA 3AI2A 4P98A 1MQ9A 1ESZA 2Y0CA 3WLTA 4YRLA 1IZ9A 4JS0A 3F3YA 4R8SA 4UULA 4DAOA 1HQCA 1BMFA 1RIIA 2YUTA 4CHGA 1G6HA 2FFAA 1BRMA 4K6HA 4ZV4A 5CDFE 4TMFA 1RYYA 1P60A 2HMUA 4R2XA 2O2IA 5C34B 5BO5A 1XZLA 5IG2A 1K7XB 4DMHA 2ZATA 3LLSA 3TTXA 1WL8A 3DEIA 4DADA 4ALLA 4FDMA 1KR5A 5I9LA 3ET4A 2ZI4A 4ZYVA 1CF4A 2AJTA 2D1TA 3QEBZ 1MJHA 2WM9B 3UPUA 3EXFA 3S2ZA 2I6QA 1TJYA 3ZE1B 5FOWA 3UK1A 2PZLA 1ECFA 1I3OA 2J7PA 3BJEA 1DIRA 1B2RA 1FVFA 1UKYA 3D8BA 3DOFA 3EAQA 5DNWA 4M9SA 3WHKA 3D0OA 4R3WA 5L95A 3NFYA 3KUKA 4TV8F 3UAYA 5EWJB 5CD1A 3A11A 4DMGA 2XQFA 3FGZA 3PB3A 2ZR9A 4R2MA 4BYGA 3QENA 2HR1A 2WSSD 4GMXA 1J0AA 4GGPA 4N8DA 2JFUA 4ENPA 1HG0A 4DCCA 4I9FA 2DFLA 4RIEA 1QFXA 2PA0A 2HT1A 2OG1A 3QBJA 1NR7A 4X20A 4ZZ3A 4AM8A 5EWMB 2W93A 4KYVA 5LXTA 1XZHA 1T3TA 1N8KA 2IX9A 2LE0A 3ABRB 3K2QA 3NS7A 4Q24A 4R1PA 3HDJA 3WMRA 1PZNA 4MWCA 1TK2A 2C5GA 2P2DA 2YS6A 3IUMA 3K3PA 1UKBA 5EMKA 3U7JA 1WUHS 1WXQA 3IT0A 3R9WA 2NXWA 4GE3A 4MV9A 1U81A 3M83A 4NOLA 1N77A 1X8KA 1Z37A 2KYRA 3ROQA 4YO8A 4LDZA 5JECA 4R84A 2ODAA 3EXIB 5F1PA 1FA9A 2Q2NA 1KQFA 5B1YA 1UEJA 4ZQEA 3KHSA 3KL4A 2J3HA 4ADSG 1J6UA 3DLIA 4FKBA 1N2ZA 1Z38A 2C9ZA 3MTDA 3QVVA 1YFLA 1VJ5A 4PIVA 3C7AA 1EXMA 2AMYA 4FYIA 3RFVA 2JGEA 1NGSA 3MTAA 4IO0A 3RHSA 1XQ1A 2QN7A 3ZOKA 1M0EA 2GPYA 3M3PA 1NIJA 1YRBA 3B6KA 2ZBGA 3LK6A 1JDTA 2WJAA 4JBHA 4Q3LA 4WRRA 5C2JB 1HE4A 1WB4A 1CB7A 4UTOA 1P9LA 1U8AA 2J6BA 3C5CA 4KIUA 4LF6B 1HLFA 4BV2A 3IPLA 4F92B 5TS3A 2BTQA 5BSEA 1M1NB 2HBZA 3NBMA 5BWMA 5JZBA 1AGRA 1RHUA 3EH2A 3KZCA 4I1PA 4ISBA 1IBSA 1Q1NA 1WZ8A 2HA4A 3C6BA 3EISA 4DLVA 4LWPA 4H27A 4RC9A 5CYPA 4UARA 2YJNA 4ZHQF 2OGSA 3L0DA 4X62B 4ND7A 4IQFA 1WQ1R 3GFGA 3NHZA 4WT7A 5EZYF 3UK0A 5DTIA 1E2KA 1SKUA 1V6CA 1XG5A 2ZB7A 3I5MA 5LD2B 5DEIA 5I8PA 3AMVA 4OX9B 3GCGA 1T5BA 1UL1X 3RFCA 1ST3A 2YCBA 3KAJA 3EPRA 5F2KA 4TTAA 5F73A 4C89A 3LP6A 2C84A 3PHBE 1ZSYA 1XCMA 4RIFA 2WF7A 5KCMA 1MQSA 1RXEA 1NKTA 1GQ2A 4QREA 1H2YA 2VLBA 3RT1A 3JX9A 6CHYA 1COWA 1TZJA 2C99A 3JQDA 4IMIB 3CLUC 4L3OA 4RFVA 4V03A 4Q9LA 4JYAB 5JJLA 4CM8B 4YS6A 5LPNA 3I9NA 4UMFA 2F2TA 3IRBA 2P75A 3DE4X 2GJSA 4MWSA 5ARBA 4CEHA 2H0QA 1QMGA 1ZR2A 1K2VN 2WPNA 3F73A 3NDPA 3D0KA 1KY2A 1YMUA 2AOTB 2C03A 4DCVA 1MKYA 5WRFA 1PJSA 4JOBA 4ZVRA 2OYRA 2BFNA 5CJJA 3TJZA 4AT1A 4XFDA 1GTL1 2RCYA 1KJ8A 2I2DA 2X4DA 1DIGA 3ETNA 2B8NA 3ZCXA 4TKZA 2J9FB 4M1ZA 2H65A 1J8QA 1UM8A 1M8JA 2QE7D 1M54A 5EE9A 4WCZA 3PE3A 2DX7A 2H2AA 1KDYA 1JKIA 3IMCA 3TO5A 3THYA 5T41A 4EB6B 2PWPA 5G41A 1LBIA 4I6EA 4Z9YA 1FU4A 2B4TO 1XXHB 1GSIA 3HJRA 1F8YA 1XDDA 1X6VA 2VYND 3NH9A 1JKMA 4FGKA 5HA5A 1ZNXA 2ZDGA 1FMLA 2M6LA 3EDOA 2Y1KA 3IP5A 4R9UC 4RMJA 4BIMA 3IE1A 1T1IA 2QRGA 4LWOA 1AV6A 4FCVA 3SYLA 1Q0RA 1T4BA 2C1ZA 3VM6A 2RMKA 4FINA 2C7PA 4KLRA 2FP3A 2NAPA 2Q9AA 3CC8A 3OURA 4NE7A 1EWRA 5T8KA 4F3TA 3PUWA 4DV4B 2VPQA 3SPXA 4LHWA 2FPSA 3NTRA 4UHCA 1Y3CE 3UJ7A 3BHJA 2VJPA 3SWXA 3CPEA 1WV0A 4L57A 3K9FC 3OZFA 1NMEA 2GVNA 3FE2A 4WBNB 4ZOEA 1JQ5A 1F12A 4B3RB 4MVJE 1LQ2A 2MMGA 3FYUC 3FROA 4GLJA 4NG4A 2E4WA 1XROA 3RVKA 4D57A 4RTMA 2PD3A 3CNHA 3Q7RA 1Z8DA 1J5EB 1Z4JA 4ODIA 5AUOB 3RYTC 4OREX 1RT9A 4MS3B 1G4HA 5IT4A 4I2VA 5LVAA 1ZZEA 3ZCVA 2YWHA 1UC8A 3L49A 1B14A 3RW9A 3GRZA 2DGDA 2XXBA 1M6YA 1XX6A 4FT2A 5A6SA 1QGZA 2AK3A 4KP7A 4ZPJA 2XVXA 2DG2A 4HXEB 5KBYA 1OQAA 3S3TA 2G67A 3BYZA 3T4XA 2A4MA 4JP1A 4M9CA 4O25A 3W5AA 4GMDA 2HJWA 2V03A 1N8SA 2PRIA 1UXIA 3AESA 1A8HA 2R48A 1K3FA 1BX1A 1E5DA 2RGBA 1BWPA 3EZNA 3JZFA 3MK31 3HB5X 4W6ZA 1UJ6A 4KFUA 2HRZA 2PWYA 1XOIA 1JN0A 1PWYE 4YI3A 3C3JA 2F43A 2FEKA 4HC4A 3WRYC 5JHHB 4C6TB 4ZARA 3ZGLA 4BBAA 5AVSA 3GJXC 2KM1A 3HDYA 3PDJA 1C0PA 1TKBA 2XNDD 3L7JA 3C8MA 1RMYA 2AEMA 3DAOA 1EVKA 4LMPA 1L5VA 1UCFA 2CWWA 1X70A 2VPWA 3CG0A 5B3JA 4AYXA 3TE7A 3C45A 3DTNA 3SOPA 2EJTA 1Z2CA 2D8AA 2FMHA 3DCJA 4KR2A 3HKBB 2GHQA 3UKDA 1FDTA 2JJ1A 2CCGA 2IHJA 1WMSA 3QI2A 3SC2A 4EAQA 2DR2A 1PZEA 2FFQA 4CIVA 3K9GA 3AP2A 1G8HA 4KRFA 1A4IA 2J8ZA 3JPYA 3ZBPA 5A5GA 4Y1FA 3Q8WA 4QXOA 3G9XA 3O8QA 3QOXA 5ES3A 1ZCJA 5IJZA 3DR3A 4ZVSA 5AW6A 4IS2A 3WA6A 4RD0A 3ZI0A 3WAKA 1OYWA 2QTBA 2W8BB 3LLCA 1B7GO 2XEXA 2OXRA 3FKQA 5ERYA 3NTOA 4PU0A 4JKIA 4D3SA 1Z33A 3NC4A 4K81B 4CM7A 2V54A 5LXTF 3MFYA 3UMGA 2FN9A 3IUBA 3IR7A 1WLYA 2JVKA 4LKOA 4XQ0A 4D81A 1VLLA 3CZQA 3KOMA 3UFXB 3DJFA 2ZJAA 1IOZA 3DE6X 1D4AA 2VHYA 3FMIA 2GN9A 5HBGA 1OC2A 2ZRAA 3SVZA 3HP1A 1E7SA 5LOVF 2A94A 3MUEA 2DY1A 4Z2YA 2PXXA 1FFHA 5AVZA 2C58A 2OHJA 2X5KO 3JVVA 4QDZA 2VPPA 4CTJA 2GAAA 4Q34A 2OCIA 2YN0A 1Z4IA 3VV3A 3FPCA 2A3RA 2NVOA 1XMPA 4B3CA 4YUWA 3DG9A 3L4SO 1A2KC 1E8MA 4DW8A 4QICA 3V1MA 3ITDA 1E3LA 3NTXA 3OLWA 5HDBB 4E33A 1KVUA 1HE8B 3P4YA 2Y68A 3FFXA 3BKXA 4TQGA 2XT6A 1AQYA 1QK5A 3AJ8A 1KGDA 2AH5A 3BD9A 4JB8A 4CRWB 1E18A 1OGYA 1QDUA 1NDHA 2FEOA 3GIDA 5JD5A 4CG0A 1LI5A 1U7HA 3JZIA 1H2AS 3KT0A 4N82A 4Z51A 3U60B 4OBEA 3AU9A 1LBHA 3OZ7A 4QJ3A 1SB8A 2IPLA 3G59A 1EIZA 1DXOA 2Z3WA 3R3ZA 4FZJA 2RHLA 4G01B 2QSJA 2X9NA 5I8ZA 2C04A 3R4CA 5DP1A 3R6WA 3VVBA 3COWA 2F00A 4G23A 1SUSA 4HQFA 2FE4A 1GGMA 2I80A 1F0PA 2WU1A 3QG5A 4C3ZA 2PPYA 2JHFA 1CYDA 3QOFA 4RDIA 2CLMB 4OGLA 4RXTA 3RVPA 3K70B 3EUFA 2DHDA 1ZJWA 4WJKB 1LDMA 1V3VA 2A9RA 2BF4A 2QRVB 3KJQA 4DUPA 2OMEA 2QZSA 1FSPA 3AWIA 1C0EA 2OKGA 4DLUA 4EHJA 1U28C 2LBPA 1ODLA 1R3UA 5C1PA 1LFDB 1EFHA 3DONA 3GLRA 4ZRMA 3SY8A 4BDTA 5HZMA 1XD2A 3LE8A 3MPUA 4Q02A 2G36A 2QV7A 3QXGA 5BV0A 3W5CA 1Z29A 3GGSA 2DPGA 2WWIA 1ZVJA 1W94A 2BMAA 5AJUA 3C7CB 2UXBB 5HKOA 1EWTA 4J7CA 3GFSA 3EGWA 4JODA 1AHIA 5K0ZA 4JI2B 1QGED 3R9IA 5CT5A 2J33A 3QUBA 4OYHA 3T5GA 1DAGA 2GDJA 5IDYA 1S2OA 3R7FA 4BLUA 3EEIA 3MS7A 2PUJA 3UFBA 2I22A 2PU5A 1VE6A 3DB1A 2CNDA 3RAGA 2VNSA 2PWZA 2PJDA 3OCZA 5LUBA 3LDUA 3NOVA 2G6BA 5CB4A 3NRBA 4CKEA 4XUEA 1GNRA 2YJ3A 3EOZA 4U8GA 2XT0A 1NLUA 2WZDA 4XD2A 1IN8A 5ALHA 1ENZA 1SQFA 5ER6A 1FIUA 2O8DB 3V80A 2DFDA 4JLPA 1YQEA 1I4OA 4LWQA 3ZU6A 4UTRA 1NOKA 3JATB 4HNHA 2Z6AA 2H1RA 2CXSA 3BRSA 2X8WA 3K20A 1QTQA 3UCEA 2FCRA 2ZXUA 4O33A 3NTQA 2B4YA 1XDGA 4BUZA 3IIJA 4OD0A 4CL2A 1E4EA 3A9WA 1GKIA 1QYIA 4RZQA 3STHA 4CQMD 2PYIA 4D8VA 2J4CA 5FR1A 1MBZA 2LW7A 3I76A 2B0CA 4M0DA 3T3MB 5A5EA 5LP6B 3GHHA 3BT7A 1Q83A 1W29A 1H5NA 2OCGA 4N4AA 1W85B 4YQZA 5FD8A 4GLLA 4CZ2A 1S3IA 5CFNA 4J6FA 1BHJA 3BIFA 3JARB 4FFPA 3GAZA 1PTJC 1E99A 2BMVA 3H9UA 4FFLA 1GQSA 1KFKB 2OEPA 3N8IA 3OE1A 4WN9B 2P79A 1EJ0A 1PL8A 4K9SA 4O4JA 5E6UA 3BCRA 2A5DA 2F9MA 5EJ8A 4FMBB 3VTZA 4R3UC 1DWOA 4BKQA 1RWXA 4PN3A 621PA 5ADWA 2XOKD 2VP4A 2D1FA 4C0XA 5LQUA 1Y48E 3NWBA 3O8CA 1GQQA 1VPWA 1C14A 1MPTA 1JHXA 1ISRA 4MGIR 3CZ4A 4P31A 3W4IA 3MOSA 2PQMA 5FBKA 3TRRA 1Z83A 2DZDA 2AA3A 2X76A 3C6KA 3R5TA 1NLFA 3GL9A 4S2EA 1F2DA 5CMLA 2VJMA 3PEVA 5G3ZA 4CNBA 1KC1A 4Y2XA 4HVLA 3IBYA 4DXDA 5CNJA 4EJSA 1XEAA 3PNMA 2MTBA 4G4JA 4PPYA 3ZWYA 5BSUA 3QJYA 4E5VA 5JS6A 5LQNA 4Y67A 2WT4A 1V11B 3SK0A 4CLHA 5B3KA 2CXUA 1RTKA 1VBMA 2ZIXB 4QYIA 4DA0A 5JXJA 3LC2O 3O3CA 4MICA 4P22A 4EI9A 4F1KA 4M1KA 3JD1A 2QE6A 1OXKB 4LGVA 4C0BA 1E5VA 3IOMA 3Q1TA 3FRHA 3OCUA 5FWYB 5JFGA 3OX4A 2FJPA 1GTG1 2P9YA 2YHIB 1ZC3A 1LDYA 1SZDA 3HB7A 3SSNA 2Q2QA 2ENWA 5CM8B 3WGQA 3NV9A 1L6RA 2CZGA 3T94A 3VNAA 3QMVA 3VVCA 5JYCA 1G18A 3V2HA 3T9BA 2FUCA 3AQ4A 5GZ1A 1L7AA 2AN5A 2HCBA 3CONA 3GGOA 1FZQA 1WSBA 1Z47A 5HUHA 1A72A 2W6ID 2OZKA 2BKEA 4GPZA 3T7RA 4KZPA 4WCDA 2YYAA 3Q8MA 3QPUA 3KUDA 4JGBA 5A6VA 3V8PA 5KU7A 2CNKA 4UQLA 2RGYA 5C8YA 4I81A 3GVXA 4IOJA 4MO9A 4PANA 3T52A 1E8NA 1NNUA 3QKIA 4WXRA 3TE6A 3PEYA 5JJKA 5E0OA 1JQKA 3ECSA 3E0QA 1C9MA 2EHJA 3HNOA 1E7MA 2ZQRA 1JILA 1VYHA 2W2OA 4N47A 5YASA 2GZAA 5FI5A 1J9GA 1Q6ZA 3NBUA 3I62A 3V8NA 2CCJA 1CY7A 1CE8A 2B20A 4HYTA 5FBLB 5IVIA 2FG5A 3IP7A 1VBKA 2CXQA 4MV4A 1NYRA 2H7CA 4PICA 4R1QA 4RPHA 1GAXA 1WABA 4KGVA 1DVRA 4PSVA 3CUKA 2VDMB 4Z4QA 3ELWA 1Q52A 5F23A 1Y34E 1ZOLA 3OZAA 4ZAXA 1AKTA 2HF8A 3R40A 4YAFA 3PXDA 3SS9X 4AMYA 5J4YA 4DR3B 1GTMA 1EH5A 1H65A 1QH0A 2I6FA 3N28A 1OWLA 1IWOA 4GXTA 5DGCA 5C3UA 2R86A 3WNCA 4Y2SA 4AKSA 2OM2A 2B6NA 5EXEA 1T3GA 1T4MA 2QNRA 3UATA 1TK3A 2PMCA 4B4KA 1E2LA 1NNI1 4O29A 4CMGA 1H2HA 1PL7A 3DW3X 2A0XA 1C1HA 3C1AA 2VKTA 1VIYA 2GUGA 3I8OA 3V7WA 1LPNA 2ACEA 2AUNA 4K9MA 1KXZA 1W93A 1CY6A 3CKMA 2B99A 3PHLA 1UXGA 3E48A 4TSFA 3B6MA 1DXHA 1E62A 4S1TA 5B37A 4UAJA 4E5YA 5IBRA 4N48A 5FPKA 2RGRA 3MAAC 1GT91 2ONYA 3AP1A 3K1JA 4RLSA 1CR6A 1YHNA 3IV7A 4LUCA 4FB5A 5HM6A 3LUPA 1RP1A 1Z25A 3HA3A 2PYDA 4BO1A 2Q07A 5LZ2A 2D74A 4G1BA 2WSBA 2QN3A 4M21A 4M36A 3M0EA 4O3FA 3L8EA 5TARA 3TWOA 1KI4A 2Z4TA 4EQ6A 1QKKA 1YJAA 3MQ2A 1ABBA 1TC2A 2WNIA 1LJUA 1MAVA 4CR7A 4XAQA 1PTKA 4WESA 4B84A 3LGXA 3BZBA 1MC4A 1JR3A 1HF3A 1OIVA 1BMQA 3LVQE 2NOAA 1TPYA 3ORHA 2QL6A 4G0XA 1C4KA 4KQXA 3SBEA 3G0BA 3HFGA 1PGNA 4IDNA 1RABA 4UM7A 1GKYA 2GZSA 3RSQA 2MYUA 4U1RA 1N6PA 4JLWA 2AJBA 2O3QA 3ENVA 4E30A 3GJ8A 2JJ8A 4KGXA 2DF8A 4NCHA 3OQ1A 2NSHA 3U26A 3NAQA 3EW7A 2ZEJA 2Y0BA 1Q92A 4QVKA 4WHMA 3I0MA 1C8BA 4CN8A 5IAAA 1Z8HA 2H1FA 2W6CX 1AF4A 3FNEA 3MINA 4BNJA 4E88A 1G7CA 1JQBA 1KJQA 1SOWA 3A4IA 4MP6A 4DIFA 4EY5A 5K0CA 4ZT3A 4KREA 3RUHA 3MRTA 4HJRA 2BP7B 4J7XA 2D1YA 4Q9IA 1YJXA 3CJRA 2DM6A 3P0JA 2J07A 4UREA 5K03A 3TZEA 4DV5B 4REQA 1T0UA 3L7DA 5CB4F 3O74A 1E1QD 4GSKA 4UU8A 1UAGA 1NUTA 1Y8AA 1J0CA 1DKOA 3ORYA 4BLSA 3IQWA 1QIKA 5HZHA 5KNDD 4I9NA 4ZVUA 3UKJA 2PZKA 2YVLA 5A02A 3AOGA 4E2ZA 2AUTA 2V8BA 4IH9A 4WKGA 2KLBA 3BGSA 1HH4A 3ZIAD 2ZJFA 1D9XA 2Q0SA 4LHSA 3TTUA 3W6OA 2R5NA 1AMOA 4B3MB 5BN5A 3SIRA 4IZHA 4I9UA 1MW8X 2FN4A 3P0EA 1QU2A 1ZGBA 4JROA 4FJ0A 4IIXA 5EHXA 1II8B 4QM6A 1VCMA 3W3AA 1GADO 2IS6A 4TRMA 3ZDYB 2O2ZA 4JJFA 2WQZA 1Z5VA 4Y6PA 4YV1A 2VXYA 3FWYA 2Q6VA 5EEGA 3AGPA 3HUUA 1EE9A 3OC0A 4GPIB 4WCVA 3OCJA 4D4LA 4H6WA 2IXDA 1OW3B 3HACA 3O9ZA 1MG0A 2FRDC 3ADBA 2BELA 4O4JF 3OQOA 3NBQA 4YO7A 1I1OA 1NE2A 1F6DA 4JEIA 4IOMA 3WYNA 4F38A 4Q47A 2FMUA 2IS1A 4ZOCA 5E6RA 3QXSA 3ZI7A 5BQ3A 1SCNE 2YHAA 1ZN2A 2J08A 3F0TA 4QATA 1F1BA 2QLMA 1TDJA 2QMQA 4ER0A 2NPOA 2ZIAA 5C7LO 5I9SA 3GC6A 5A9SB 3L6UA 5P8WA 4M38A 2GFIA 3F6EX 4XQ9A 1A0OA 2ZTHA 2MR6A 4L74A 2C4HA 5HS6A 4FFBA 1QYDA 1RYFA 4W4TA 3FLMA 1MPXA 4YI5A 1RFLA 4CIWA 2V7XA 4RH0A 5EE0A 4A16A 2WYHA 1C4OA 1ZK4A 2PH1A 5GONA 4YYZA 5HIIA 2XKKA 4AI6A 2ZRQA 3GOQA 2XF8A 1FS5A 1HL3A 1SXIA 2FI1A 2RC6A 4IUCS 4F8YA 1WW2A 3HWSA 3LUJA 5ER9A 5BMVA 1XEXB 4X3PA 1VIDA 4YV7A 3DFIA 4B2IA 2EDAA 2LIPA 1NR1A 4FDAA 3P9PA 3NLLA 5BUSA 3DVAB 3UT0A 4EMLA 2O05A 1ONOA 4R1SA 3E3NA 3H9CA 4IILA 3ZZ0A 3DMTC 3BUSA 4C0KA 3Q0GA 3AT1A 4YJDA 3T4PA 1QLHA 3WLOA 2CZQA 4UQPA 1RLJA 4J90A 3LL4A 1JWLA 2QM7A 3GFQA 2R6AA 4NRDA 2R7LA 3CEHA 3IEUA 5TSDA 4I4ZA 4BNGA 4AK9A 5J3JA 1UP6A 2PKXA 4X8MA 1UBJS 1DOHA 1YRHA 1ZAKA 2FQWA 4HMQA 4HQ6A 4U0JA 3RASA 1E9AA 4EHKA 4LQCA 4GLOA 2CLKB 3VR6D 1SHTX 1DAKA 2GTIA 1T0HB 3IMKA 2R00C 3H84A 1FU8A 2CLDX 5C8YF 5L53A 5EESA 5JYBA 5LKAA 3QU9A 4GOJA 1QHHA 2YZ7A 2B78A 3RRFA 1U9ZA 4CMBA 3I9OA 4GBJA 4QRDA 3T1VA 3ZOZA 2ZU0C 3F67A 2BD0A 3PNPA 2ETXA 3R6LA 3MOGA 1HMPA 2YCLA 5EZYB 3W1VA 1XYYA 2LXNA 3GRFA 4C7KA 4C2BA 3NVAA 1LPBB 4R2HA 1YRAA 5M29A 1B16A 2BHSA 4FSDA 4I3GA 4WL0A 4JI5B 1QYVA 3BSYA 3K53A 1XQVA 2GVZC 5IWAB 4M1EA 5FI0B 1N8TA 3HZZA 4LJ5A 1WCV1 2XTMA 3ZGXA 4MAMA 1OC4A 4ARIA 4N12A 3ADPA 1XTJA 5JRJA 3DBRB 5DISB 2QZJA 3IA2A 4QJ5A 5U4XA 2XODA 3ZXUB 2PGXA 4KFRA 3TN7A 4L5JA 3RC9A 1YA4A 2IVZA 2JFYA 1LPSA 3N0WA 3GLIA 1JI0A 2QTHA 1NN3A 3WI7A 3OH8A 4PZEA 3WWEA 3WYGA 4BV3A 2XDAA 2MYNA 4BZQA 3VSDA 2QX7A 2PY6A 1ORHA 4O2BB 1PUXA 1MOQA 1PX2A 1YE5A 2F3TA 2G4VA 2XPCA 4Q7MB 2CFTA 1E1RA 2Z2YA 3IDOA 4DRXA 1VSBA 3I01A 4X8LA 1X0XA 3Q3JB 4DWOA 3O1IC 1UX5A 3PHHA 4ZVMA 1K3TA 3A37A 3SYRA 3C43A 4YCMA 3NH6A 5FPYA 1JXQA 5E7MA 2OORA 4DARA 3E7FA 3H86A 1U8XX 2HHAA 2ZI5A 4NIMA 4XGKA 1DQNA 4E0BA 1W36B 3HC7A 3STYA 3O4VA 2A92A 4US2R 3C6ZA 2YXDA 1BSVA 1TZ2A 4DLBA 2PGDA 3KV3O 1W59A 4AECA 3MXTA 6REQB 2O5RA 1YQXA 4JT9A 4BVFA 1NXWA 3EJWA 2CE7A 1TYEB 3A1VA 5K99A 2IS2A 3IDFA 1RLTA 3TLCA 2PYZA 1X7ZA 1IDN1 3PF9A 4LFAB 3HLYA 1IBMB 3WLFA 2Y92A 4ELXA 5H16A 5DLQC 4RMHA 3DKPA 4KO1S 1R6TA 2XTZA 3DS8A 3PXEA 5DBEX 3RODA 3FCSB 5TRTA 1GAQA 4Z4HA 4G0WA 1I51A 1C41A 2GPTA 3N2LA 3FR7A 1TTTA 2OCAA 4DUGA 2R8PA 3QE4A 1T9KA 3CLRC 3LQQA 4OHCA 3A6EA 4URWR 1JU4A 3HJAA 3V1YA 2PH7A 4Z54A 5FBVB 3GGJA 4OMDA 2Q5FA 4RXMA 1YVEI 4B73A 3F3MA 3EGDB 3TD9A 5LQRA 4MQBA 1CG6A 2K2QB 4JUDX 4P0PB 1W4ZA 5BWBA 2NTVA 2RAPA 5CW2A 1JEOA 4MI1A 3UJBA 5GADl 4GC9A 5EKDA 4IIHA 4MVJH 3ER8A 2HYDA 3NOQA 3A05A 3UAVA 5CGZA 4F2GA 5IU6A 2KBFA 3PC6A 2C8KA 1ECGA 2GA9A 2GEUA 2LIVA 3NC1C 4BX9A 1T3SA 1GEGA 2QRMA 3PQ6A 3M6MD 3W5IA 1NFRA 1ZXLA 4B9AA 4YC7A 4MKZA 4B3IA 1EVEA 4PY2A 4YX9A 2RAFA 1USKA 1Q50A 1C8KA 2ZYDA 5HW0A 2JGAA 3L4BC 2CV0A 1H2ZA 3CLSC 5AK3A 5TDHA 5B5SA 4MW0A 1UBHS 2AZMA 2PG3A 3EXFB 3KJEA 5DX0A 1KETA 3M70A 2VDPB 1AHPA 1PYDA 2ZRDA 2D0OB 3NIGB 4ES6A 2B5WA 5JZ9A 3AR9A 3BX1A 1ZMRA 4G67A 4BO0A 3K6RA 3C6YA 5KTNA 4D0LB 1QK3A 3PXBA 3W6NA 3G89A 5FT9A 1W47A 4KN9S 5BVGA 1C29B 1NYLA 1VG9B 5FDFA 3H5RA 4M9ZA 3ZE8A 1U9IC 1P0MA 2HJHA 2PEZA 2WWFA 3O3NB 3Q72A 4JYCA 4Q39A 3C3BA 3X1YA 4AUMA 1DJNA 4TVSA 2HWYA 4JYBA 3ESQA 4RENA 4BX0A 3LOQA 3G02A 2G5CA 4YH1A 4B47A 4ZCMA 1J5PA 4D41A 2EP7A 1G3IA 2Q4TA 3HCAA 4X20B 1M2HA 3A1EA 1OBHA 4DVJA 2NZVG 4DV3B 2XRYA 1U5BB 1VMAA 3W0LB 2V6BA 4XDYA 5FL3A 1PG0A 3QFCA 2OK7A 1XZGA 2WU3A 3B89A 3MXOA 3TFQA 5BMVF 2K87A 3L0ZA 4P3OA 1CVLA 4XASA 1E0SA 2ODTX 1M1YA 3BS4A 2O8VA 2NUBA 1GU1A 1VIAA 3BRQA 1PR0A 4FLEA 2C7VA 3USCS 2OCDA 3GGCA 2UZ0A 4RIIA 1I30A 1J0EA 1NLYA 5EJ7A 5EYPA 1QHYA 4J16A 2B83A 4FD2A 1F6WA 5KNLA 3MOYA 3DEYX 4EX7A 4R41A 1XZMA 5D87A 5LIPA 3GGGA 3AF5A 1P4RA 4KAJA 4QBTA 4AMUA 3U44A 3LPNA 3G6KA 5H3LA 1A8UA 4DIUA 5FUMA 2WF8A 5DIZA 3TEJA 2HA7A 2ZP1A 1N2GA 4XQCA 4QYXA 5FPHA 3QFHA 4H3SA 3PGLA 4OI1A 4AJHA 5ABPA 3JTEA 1GGEA 5EMMA 3B6EA 3P2IA 5B7PA 3DWGA 1OH8A 1ESEA 1L1QA 1VM6A 2D3TA 4BJ6A 1CUIA 1WU7A 2BTQB 1T8UA 2OB1A 3CBGA 3MJEA 4P4UA 4HLUA 1RZRD 2CSXA 3HJFA 3K9WA 2AD5A 1C7ZA 2B61A 3PVCA 3T61A 3V1NA 5CB8A 5T67A 5LZ9A 3WGJA 4Q4AB 3AKDA 2EQBA 1A8SA 4M49A 3GU3A 2DP4E 1D5WA 2P63A 4C0LA 3H2IA 4GP6A 1W88B 3KKNA 2CVOA 3I2GA 4LRTB 3DBLA 3FETA 5AM2A 5EEHA 1MG5A 4L95C 1E2PA 4DQDA 1EG7A 3Q7TA 4J1SA 2ZGVA 5CEJA 5KWJA 3OHSX 2UDPA 1EFRA 3HY3A 1MLDA 2QUKA 4HAUA 5E6SA 4WY5A 5KEIA 3EEBA 1DO2A 2CVQA 1MHTA 3KXDA 1HE5A 2AE1A 3CZ9A 4DSAA 3COJA 2PBZA 1F4VA 2BKLA 2A8YA 3R7WA 4N6OA 5EQFA 4EYSA 3H5WA 1DMRA 5FXMA 2NSJA 3PGXA 3V46A 2EP5A 5ELXA 3AVPA 1M34E 1NF3A 2WR8A 2GF2A 3RR2A 2ECPA 5LN1A 3CNNA 1C1DA 3Q8XB 3K1AA 4KQ1A 2V96A 5JV5A 5AJWA 4LGMA 4TZ6A 5BYAA 3EVFA 3LYAA 2ERYA 3FUVA 3GJ4A 4RHXA 4BNZA 1U6IA 3R7LA 4S1OA 1QHEA 2UZAA 2NWQA 1KBQA 3WDSA 5BRAA 4MQ4A 3UJDA 3LDHA 2QQ5A 5FORA 1FYFA 2D54A 1JIUA 1KJWA 2P6OA 3SQLA 4EH1A 1EBUA 5AW4A 2IEYA 1VJ1A 3AR6A 3H83A 2H1LA 4HB4A 4O8ZA 1O9BA 3NYIA 3VR2A 3GLFA 4IMJB 5LIRA 3B3AA 5B36A 3OJXA 5DXAA 4MS1B 2A7QA 3DF7A 4S2UA 5FNVA 1J70A 1P1RA 2GO7A 3AC0A 2I4TA 1Q1QA 3ZV3A 3I05A 3D6HA 1ECBA 1POXA 2X7JA 4A4DA 5ENVA 3AUAA 1TM5E 5CVVA 1I5RA 5EVCA 4ENRA 1LTQA 3AF4A 4JSTA 3DJYA 5EHZA 2XUFA 5KSWB 4FGZA 4R9SA 4FMCF 3ZYCA 4MIYA 1KSHA 5EMLA 5HKLA 3O0TA 4YJ3A 5M7EA 2ZUSA 3HVKA 5HF8A 1G20E 1NUUA 1USVA 2H1VA 5M34A 1O96A 3KELA 3SDZA 2G28A 3JD2A 3HO6A 3IXLA 4ZODA 2BTOA 3SN6A 5LQCA 3NTUA 5F3WB 1KMNA 1LB1B 4HZIA 4PAQA 2GCOB 3UMSA 1XMIA 1DP4A 1XBTA 4FX5A 4GZLA 3ELBA 3K5HA 4Q12A 3B1ZA 1EZZA 2F1RA 1GN9A 3I9FA 1HOTA 3AFOA 4ICIA 2JRCA 4DQXA 4FWTA 3O4RA 5A6SB 3TQHA 2VF7A 1RZVA 2XNJA 1HORA 3ZK9A 4PYOA 4Q3BA 3RC2A 4MRPA 2EKQA 4E31A 4LZAA 5IT5A 4ND3A 4DBVO 4C30A 4YT4A 1KVQA 3M5DA 3UK7A 3VNQA 1QTRA 4W9NC 4W5RA 2QLLA 5HCUA 1KHHA 1M2FA 3MT0A 3QSGA 2UXCB 4C3OB 4PPGA 4I55A 3C7TA 3IHKA 4OQXA 4QLAA 2DJIA 3OO1A 5B55A 5I5GA 2Q3FA 2QYOA 3DKKA 2IYTA 4AUKA 3RTGA 1E6LA 1ORWA 1SUBA 3N2EA 2C78A 4AWBA 4RE5A 4BV8A 2G17A 3CE9A 1XSEA 3ROMA 4OQYA 2I66A 2GHIA 4EOGA 3EWNA 3QWBA 4IIBA 2IU0A 4NESA