3ADBA

Crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 1)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENKNKNNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3adbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adbA01
4PZZA 4HDCA 1GILA 1MABA 3IIJA 4MITA 1JEEA 1AZTA 2RAPA 3RS0A 1SVIA 3AP2A 1H65A 4D0GA 3ICEA 4M4SA 2Q9CA 1DO2A 2WWFA 1H8HD 4IEEA 1R5OA 1U8ZA 2DWQA 4HUQB 1KI6A 2CDNA 2GEDA 4F91B 5JECA 5EXPA 3T12A 2ODBA 3F0TA 2VP2A 1IY1A 1ZAKA 2WMNB 4L4UA 4OBEA 4HI0E 4EFLA 4D81A 2V4ZA 1QRAA 3SOPA 1YR8A 2G6BA 4M1YA 2BMFA 3VX4A 3X1ZA 1EFTA 4BFSA 1II0A 1W1WA 2FMXA 4JLMA 1ZU5A 2ZVQX 4TN1A 3WBKA 4NCIA 2XX3A 4I81A 1E1RD 2IYTA 2IS6A 2PLRA 3NEYA 2G9NA 3LAWA 1OFTA 3KB2A 3KFVA 2C2HA 4NYJR 5JHGB 4NL4H 1ZW6A 3CKLA 3CWZA 2QTHA 4FMDB 4LCBA 2J1LA 3K8YA 3WHKA 3FOZA 2GZAA 3MWKA 2G3YA 4JBWA 2OBMA 3KXLA 2V1XA 2J0UB 3QKSA 4WOPA 4AKEA 3U5ZB 4KSCA 2D4HA 4TMVA 1SKYB 4UJ5A 5AUQA 1OH8A 1NN5A 1VHTA 1XU4A 1WA5A 3LFUA 2BIFA 2P6NA 2CLCX 2WVJA 3CR7A 2P2LA 821PA 2FWRA 4FMCB 4A92A 5JCZA 4I1OA 1G3QA 4RD2A 1XXHA 2F9MA 3CNOA 1R0WA 1VKJA 3ECCA 4QOSA 3W6NA 5JZVA 2H1LA 4MRNA 2RGGA 4DLUA 4BFYA 2A5YB 2N46A 2YNMA 3FDIA 1EGAA 4CEJB 2PZEA 2HT6A 5B58C 5FOVA 3KQKA 4DIDA 1SXJC 3C4JA 2GXUA 3WXMA 1N0VC 4Q47A 1Q1QA 2ASEA 4S35A 2IEZA 4XWOA 3JVUA 3P20A 1G41A 1CIPA 1BO6A 4B75A 3VMFA 5FPYA 4P3YA 2JAQA 3NBXX 3REFA 2ATVA 3L8ZA 3TK1A 1VYVA 2JDIA 3D6TB 2DFTA 4A2WA 4O0MA 4MYUA 1CJTC 2OAP1 3VNUA 4O2LA 1E2KA 4FWTA 1Z08A 3QF7A 4G5RA 3KKQA 2H16A 3LQQA 2IYRA 4IFBA 2WWXA 4JS0A 3CO5A 3QPWA 1G4UR 4ZIRB 3EA5A 2J87A 4KVAA 3OFND 3GLGA 1XDBA 4IOMA 4CW7A 4BZPA 4PAQA 5DE3A 4B33A 2NOAA 1JJVA 5C18A 4PAMA 4EPTA 4R98A 2R6DA 3FHCB 4KHZA 4M9SA 4KXFB 1KAOA 4Q4HA 4OHXA 4E03A 3PQCA 4R2HA 2R8RA 1G291 2ZJ8A 4ZKEA 4AYTA 5JSZB 1ONBA 2NG1A 1DAFA 1JI0A 4L15A 2YOGA 4FCWA 4GDFA 3MRSA 4Y0VA 2F43B 4CEIA 2CLSA 5A5GA 2O8FB 1JNYA 1G3RA 1E9CA 3UANA 1EFUA 1W0KD 2OM2A 1KK1A 1YZTA 5L3SA 1FMLA 3HDTA 1MT0A 2P5TB 2OAQ1 4HB4A 3K0AB 5IHPA 2ZRKA 3IHWA 3BE4A 3QBVA 2QMOA 2BJWA 4LGMA 3C8UA 2RHDA 3QJYA 4PX9A 4Q7MB 5L3VA 4ITRC 4TQAA 2A30A 3W5JA 4C2TA 3MLEA 1FUKA 3KUCA 1OKKA 1DG1G 4BWYA 1ESMA 2GA8A 2ZI6A 2C95A 1D2EA 3ZVLA 2CBZA 4NDZA 4A1FA 2CMKA 4TZ0A 4PHTA 2PJZA 1GOTA 4HUTA 4MA4A 4JJKA 4TYYA 4URYR 1F48A 1PLLA 2F1RA 4OQMA 1KI8A 2Z6VA 2WJVA 2RGNC 4IFEA 5LDDC 3R9IA 5GADl 2ZS8A 2G0NA 4R7ZA 3Q85A 5J47A 3VKWA 4QJ3A 1G4AE 1G8FA 1KY2A 5BN4A 5K8UA 2FH5B 2KI5A 2FE4A 2GETA 3H2YA 1T3SA 1G8GA 2FU5C 1KDRA 4ZI2A 1KKMA 1ZM4A 2RGCA 5IDVA 1XJCA 4FIDA 1TF7A 2V1UA 4LJ6A 5HKKA 3IDQA 2PZGA 3AP3A 1IN6A 3FYHA 2IW3A 1NSFA 3VTKA 4GL2A 4JLBA 3NBYC 2BVNA 4JLPA 3CUEF 5B30A 1SVSA 1VCNA 1G21E 4QM6A 2CLDX 2AWNA 2CK3A 2W83A 4US0R 4XIGS 4Q1FA 5EZ5A 2AD1A 3TAUA 1M2OB 1XTRA 2REXB 4RFSA 2BJVA 5CB8A 4DEXA 2DFKB 5EE9A 3E70C 1G8YA 4DSOA 3ADBA 1E9EA 1Z83A 3NC0C 4A36A 1M74A 3Q7PA 4US1R 1Z0JA 3LWNA 4WXRA 4U02A 2NO6A 3CNLA 1Q20A 1OYWA 2X2EA 3AF3A 1OB5A 1N6NA 2WZQA 1JQLB 4Q7JB 2QAGB 2F3RA 3NH9A 3K09A 4YDSA 2X77A 2B8TA 1ZIOA 2ZRMA 2XSZD 3CPEA 3QG1A 3ICQB 3DZ8A 1AQUA 3IBYA 3Q5EA 2GJ8A 4QGHA 3CR8A 2Q21A 2QSYA 3MD0A 5CJPA 4V0OA 2BHRA 3OEEA 2W6JA 2QM8A 2PCLA 3DVLA 5JS8A 3QKUA 1ZM3A 2BC9A 1MRNA 5CM8B 1FMJA 1US8B 1E96A 2ZI4A 3IIMA 1AKYA 4B76A 1C1YA 3R20A 4BFUA 4OI0A 4BEBA 2ZYWX 5F3WB 3IQWA 2W6ID 4BZQA 4ASUD 1G20E 3B7GA 1BOFA 3MSXA 3T1QA 4Q02A 1O3YA 1Z8FA 5AJYA 4QHYA 1AIPA 3RWOA 2AR7A 4Q1AA 3THYB 1WE2A 2NPIA 3QKTA 3SBEA 3B1ZA 3Q3JB 1T5IA 5D3MB 3B8HA 2FGJA 4PSAA 4ERNA 3RANA 1ESNA 1P2SA 4JL5A 4LBYA 1UDWA 3LY5A 3ASZA 3U7HB 3DOEA 4HDQB 2XB2A 2YWFA 1JPJA 1DAKA 5TV2A 2D7CA 2AFHE 4I1SA 2G1KA 4E22A 1E79D 4LJAA 4A0FA 4H1VA 3OEED 1LY1A 1PJRA 2PT7A 2YINC 1E99A 4LHXA 1F2TA 1R5BA 1C4OA 2H7VA 2AKAB 2ZYUX 5GJCA 3KQNA 3FTQA 4D2IA 5CK4A 5M04A 4V03A 1S9DA 1EX6A 3H84A 4U5XA 2E9SA 4ZDKA 3WBJA 1GDDA 2IYSA 2ZRHA 3V00A 5EE0A 1TPZA 5FTMA 5KDDA 4KO8A 2NIPA 4M9XA 1BYUA 3T35A 4PQYA 4D4JA 3OF5A 1CBUA 2ZPTX 1RRCA 3OEHD 2A5FA 2O5VA 4JKYA 3GP8A 2FNAA 3N2IA 1FQJA 1MV5A 3L82B 4MKFA 1YZNA 3CB4A 3UWOA 5AUPB 2GZHA 3X1DA 1G18A 5G41A 3C5HA 4M53A 4LBZA 4DLXA 1GSIA 1G7CA 2IC5A 2B7BA 4WBSA 2WOOA 4B73A 3SNHA 3HPQA 1W2HA 2BKUA 1JB1A 1NLFA 3PUVA 2HXYA 4URUR 2NO9A 2HJGA 3G82C 3P4YA 1LNZA 2C9YA 4GOXA 4Q9IA 2GILA 1Z0DA 2G0TA 1P73A 1U2RA 2TMKA 1E4YA 2IYQA 3VKHA 4UNQA 4OK3A 1XD9A 2OCPA 3PUXA 3TW4A 4CEIB 4HLUC 1N6OA 1E2DA 3RVBA 4KYIB 4QXAA 4D6PA 1OE0A 2CE7A 1OIVA 4TLEA 1IXRC 2GAAA 3MJRA 5AJWA 3C41J 5L3SB 4ZV4A 4M9ZA 4Q5IA 2JATA 2YC2C 2PMDA 4Q7LA 1HT2E 3L43A 2R65A 3W6PA 4B32A 4JVLA 3Q7QA 3CRRA 2ONJA 3F3YA 1XEXA 1JAHA 1GRNA 2NTYC 1QHGA 1F2UA 2GF0A 1D2MA 1DOAA 2W2TA 4G5GA 1TEXA 2X8AA 4HAUA 2QROA 4Q4AA 1WP9A 3G5UA 1TQ4A 3V4RA 2DWOA 4OQNA 4NCKA 1IXSB 2GEUA 5FOWA 1QHIA 3N5CA 1FOEB 1DEKA 1OIWA 4ZCMA 3WHLA 3BXZA 2H18A 3EPKA 3K70B 5UKDA 4CVNA 2VP4A 5J4LA 1D6JA 1SXJE 2ZJBA 3EZ6A 3I73A 4G0NA 3U3RA 4Z1MA 4U00A 1IJFA 2UKDA 4DLVA 4EFNA 1SXJA 1GIAA 3CX8A 4YDHB 2VHTA 4TLCA 1H8HA 3ZVNA 2QZ4A 2OILA 1EFHA 2EVWX 4JBYA 3GLGE 2O8DA 3UIEA 4RKFA 5H8WA 4FI3C 1T3HA 3B1WA 3I5XA 3KQUA 1GRQA 4N1AA 4C7OA 3HWSA 1HY3A 1VCMA 3AEZA 2VL7A 5KU1A 3GEEA 1OXXK 3GLHA 2VF7A 1QVAA 3SEAA 1HT1E 3CONA 3BGWA 4PQRA 2DHRA 1NLZA 4UXHA 3TR5A 2QRZA 1Z6GA 1NBMD 1XMIA 2ZR7A 2IXEA 2L0XA 3LH5A 1GVNB 3W90A 3A37A 3KKMA 3NHBA 3NVAA 3NKVA 4HB0A 3QXHA 3VHLB 4BLTA 1KO7A 2QAGA 3AF4A 1U9IA 4V02A 4Z1MD 3SQWA 1ZUHA 2WKPA 1KJYA 3BH6A 5J4HA 2ZANA 2JLUA 2CHGA 2ZVPX 4DSNA 4LHYA 4P33A 1NSTA 5CLQA 2OCAA 2RB4A 4PO8A 4UKDA 4MDEA 2OE2A 4RCYA 2I4IA 2VSXA 4W5JA 2BDTA 2JLYA 3TAHA 2BMEA 2FFQA 3LV8A 4OQLA 2XJ9A 3PEVA 1L8QA 4YXWD 1TQDA 2WWGA 4IOLA 1KI2A 1BH2A 3LNCA 5FTLA 2WOJA 1IAQA 1KOFA 1S9HA 3SN6A 3RRYA 4DT1B 3IILA 3FKSD 1QG4A 2X19A 3GFOA 4BLQA 2RKOA 1DE0A 1VCIA 4MUBA 4TYPA 1II8B 3KTAB 1VTKA 1MO5A 4QGGA 4A6PA 2V3CC 2ZTSA 4Z8XA 2O52A 1F6BA 1OYYA 4JJZA 3EPLA 2P65A 4YC7A 1Z0FA 1P9NA 3B13B 2GCNA 1VIAA 4FXPA 5J40A 2QI9C 2JJ2D 1HURA 3U7EB 1U0HC 3RRNA 1ZD9A 2CXXA 4TYNA 2HYDA 3KXIA 4LYHA 2GJSA 3AH8A 3LVQE 1RYHA 3P32A 3NXSA 5DN6A 4GNKA 2C9OA 4MYHA 4LBWA 4A15A 1U94A 1ZYUA 4JMPA 4XD7A 3QVUA 4DCUA 1U8AA 4PTLA 1NVVQ 4DB2A 1ZIPA 4URZR 1G6HA 4K46A 2CHQA 4B2IA 1J2JA 2J5XA 5DHAA 3AVYA 4EUNA 2XJ4A 2CVHA 1RRGA 3KKNA 4GP7A 3KX2A 2GDJA 1WQ1R 3H1TA 5FL3A 1R0YA 3Q8XB 3VR3A 1T4GA 4GZLA 3GLGB 2EFDB 1E9BA 1UBFA 3CF2A 5E7MA 3W8RA 5F98A 2HF8A 4QNRA 1G3IA 1HQYE 2VH5R 1Y3AA 2C98A 3EZ2A 2PX0A 3H86A 4HZUB 5GJVC 1ZUIA 4AKIA 1Q3TA 4NBSA 3UWKA 4RCZA 3PG5A 5FFMA 3VR1A 1G9XA 2WJIA 4M21A 2QG6A 1P7CA 1UFQA 2Q9BA 1JECA 1QDEA 3TBKA 1MOZA 2GRJA 1Q1EA 1LS6A 2OCYC 1VIYA 2OXCA 3DMDA 4IXMA 5DNYB 5FBWB 2ZYVX 1UBGA 2MMGA 5JEEA 1G8HA 1VPLA 2PL3A 3AGQA 3AGPA 2JCSA 1F60A 2ZS7A 5E4FA 2IWHA 4KFUA 4TMZA 4CGZA 1FFHA 1OT3A 3B1YA 4QBGB 2RH5A 1TMKA 2WJYA 4G5SA 2X2FA 5ELXA 4C7OB 1I2MA 2I1QA 4KYUA 1J99A 2IBMA 4NU0A 1KK3A 1AA9A 2Z0MA 3GJ0A 5BN3A 4LC1A 3I5YA 4PPNA 1Z07A 3EARA 1G7RA 3BWDD 5FOXA 3AVPA 4ASUA 4UNRA 4IDQA 1A4RA 5JLJA 3OE7A 5FUWA 2FEMA 4BLRA 3B82A 2JIZA 2WWIA 4PSVA 2R62A 4BASA 3BERA 3SYLA 1E9AA 1VYUA 2V6JA 1XTKA 2W00A 2A7QA 4JVNA 1IN8A 1TNDA 4MUAA 3RRMA 4NE2A 5FBLB 2YOFA 2XOKD 4BFTA 1GNPA 3CM0A 1V5WA 2GBLA 5DGXA 3O8DA 3T15A 3MCAA 4HUQA 4Q9KA 3BB1A 4DSTA 3FHOA 4C0KA 5GVRA 4JSTA 3BORA 4KBGA 5HE9A 3ZQ6A 1KDPA 1Q1BA 5EUMA 2ZUDA 1GL6A 4TWZA 1XCGB 2E87A 5BYKA 1TQ2A 3GPLA 1X1SA 4QHSA 2QPOA 5JEDA 1RC8A 4AG5A 1CJVC 1OXTA 1A7JA 4OK5A 4L5BA 5AUOB 2H17A 2WTUA 5KSZA 1XEFA 4I1UA 4Q1DA 2O0JA 2HCJB 1NBMA 4BZXA 4C0SA 4FW9A 4DRZA 3OESA 3UMRA 1N6IA 2R6FA 1A5TA 3SHFA 3SZRA 3ND8A 1ZM9A 1W36B 3EASA 1DAGA 4IEIA 3ADCA 4KFRA 3OEHA 4AYWA 4LI0A 3MWJA 4QGFA 4AKGA 2GJKA 1RVDA 1E2NA 2QMUA 4WXPA 2IXFA 4RSGA 1E2FA 4ZCIA 1TF2A 1Z0AA 2FFAA 2P3SA 4TLBA 4WZBE 4F4CA 2YC4C 2AD5A 4LSGA 1G5RA 1FP6A 3O47A 3SE0A 5KYKA 3K9HA 2FV8A 3TW8B 2XXAA 1XXHB 5AJVB 3THYA 1UJ2A 3BFKA 4JLKA 3QEOA 4NYJQ 3SI7A 5KUTA 3RWMB 2QTFA 1NMYA 1Z2CA 4JLNA 4DCVA 1TTTA 4XWKA 5FTKA 4LWZA 1RJ9B 1UKVY 3U3JA 5GVSA 1XFAA 3C5CA 2IXGA 4W5HA 1E79A 3RS4A 2ZRAA 3GJ3A 5KSOA 4A8JA 1P60A 1NF3A 2DYKA 4JSYA 1C9KA 1XWIA 3EG5A 2QMHA 3AKEA 1NMZA 1ZCAA 1COWA 3T5GA 2QE7A 4HZUA 4D0LB 5JS7A 2HYIC 3L8YA 1GL7A 1SVWA 1SGWA 3FKQA 2NO1A 4EKDA 2G77B 3Q9LA 4TLDA 3RS3A 4UXIA 3D3QA 4BRWA 1MO4A 2GEVA 4URWR 1QHHB 4QG7A 4AWXA 4A8JC 5KO2A 2AXNA 2CCGA 1CR2A 4HAYA 3QY0A 1RW4A 4EQ6A 1DAMA 2ZRFA 5DH9A 4YQFA 4MGIR 2J0SA 4Q1EA 3E5HA 4DLRA 3Q5DA 4NH0A 2ZR9A 1Z2AA 4A9AA 2BBWA 2PBRA 3M1IA 4C2UA 4LV6A 1N25A 4LDJA 4B43A 4DLSA 2JJ1A 3TMKA 3DKVA 6Q21A 4B2PA 1TADA 1XX6A 3WNCA 4DSUA 3LW8A 3U3OA 2IYXA 2ZJAA 5E95A 1NLYA 1G3MA 2EU8A 2KWIA 4F93B 5J4KA 1W46A 1G5PA 3SHWA 2IL1A 2GKSA 1RFLA 3VQTA 2VRWA 1OPXA 2E1RA 3A58B 4AI6A 1QVRA 3BIFA 3QNUA 1SXJD 3KB1A 5LB4A 4PPGA 2J3EA 2PZFA 3I61A 2DPXA 4AYXA 2ANCA 4LZZA 2JDID 4LHWA 4NKRA 4WW0A 2BMJA 4IDPA 1UDXA 1KNQA 1G64A 2B8WA 4POAA 5TMPA 3RHFA 3I4LA 1R6BX 4WIAA 4CDGA 1N5KA 1SVLA 4CT5A 3GFPA 1N6LA 3G0HA 1XD2A 1KAGA 4B3DA 1GL9B 1YZGA 3F8TA 1FP7A 4GPTA 2OFWA 4NPHA 3DOFA 3D8BA 3T06B 3X1WA 1OH7A 4Q1CA 3U44A 1CJKC 1PV4A 4R9UC 3SYKA 3UK6A 5FOUA 3A4LA 3ZZ0A 2LCFA 1UADA 1FTSA 1R0ZA 4HZIA 2LKDA 4OK6A 4QJ4A 4RVCA 2F1JA 2WKRA 1GITA 2J7KA 2QAGC 2BOVA 4XSGA 1SQ5A 4E5UA 5H70A 3PCRB 2DY1A 4M2LA 3UPUA 1YHNA 3A1VA 4C0BA 1E69A 2F9LA 3SJBA 4ACAA 2QTVB 2J7PD 2CCKA 3M4YA 3UMSA 2W0SA 4B44A 2J0VA 4FCTA 4L8GA 4E09A 2V54A 2VQSA 4LV8B 4BEJA 2YJTD 2YWHA 4Q4AB 3F5FA 2OESA 3IUYA 3IGFA 4RZXA 3IKJA 1U98A 221PA 5HZHA 3THXB 2Z5FA 4XVQA 4WA7A 2RGEA 4LYJA 4KLZA 4YMVA 2WJHA 4C0QC 1HUQA 1KDTA 4Y0AA 4B34A 2I3BA 3WP0A 5L3QA 4JL8A 2WPDD 4RZUA 4ABYA 2IA5A 4IVQA 2UZIR 2IYYA 1HV8A 5AWFC 3QPVA 1KI3A 3WNBA 4F38A 4TT3D 4OHWA 3BJIC 3GJXC 3H4MA 2AKYA 2ZRBA 2ZSAA 4Q66C 3GLFE 3ZVMA 1W0JA 2DBYA 2QN6A 3KKPA 2OUKA 4ZDIA 2ERYA 1YR9A 4A0GA 1M6NA 2F3TA 4PC1A 2DR3A 5DI3A 1XJ0A 3FE2A 2NPFA 5JI3E 3B78A 3CRW1 4P4UA 2FPLA 3B1VA 1DO0A 3CX6A 3SS8A 1ZNWA 1Z22A 2ZYTX 2CNWA 2IUTA 3BFVA 3ZIAD 5BW8A 2GWHA 2ZJ5A 3ETLA 2ECKA 4GFDA 1U90A 2GXQA 1FL9A 3DEFA 2C99A 3MAAC 1J70A 3AP1A 1FUUA 4QHTA 1YU9A 2HT1A 2DFLA 2ZE5A 4JT4A 2HLDA 1Z3IX 1VCOA 3CLVA 1NN0A 3S1AB 5K8LA 1N5LA 4CRWB 1Z5ZA 1L2TA 2P6UA 2X1VA 4DDWA 3SBDA 1A2BA 4LC0A 1E2QA 1W48A 2OFXA 4EPRA 1KK0A 4HYYA 4F4IA 4A2PA 3I92A 3SYNA 5D3QA 2NMVA 4OHZA 5L3RA 1QBKC 1VG1A 5EXTA 1ZM7A 2WWHA 3R7WB 2ZE7A 3AV0B 3A1TA 4C0JA 2EFCB 2AL7A 1KSGA 3TIFA 3MMPA 5TB5A 3L0IB 4UNNA 1CS4C 3LXRA 3GCGA 2XSZA 2AWOA 4NTZA 4BPBA 2ZIAA 3TH5A 2UVQA 4EPYA 5E7JA 4OL0A 1MRSA 1ZP6A 3TJZA 2QU8A 2EFEB 3RSOA 3P4XA 1X1RA 2SHKA 1NKTA 3ADKA 4LHZA 4P31A 2G88A 1W47A 1R0XA 2C96A 2ZJZA 2CVFA 1KTVA 5C4MA 4I99A 5EJEA 3B1XA 1FQKA 1LVGA 5FPHA 1SVMA 2RGBA 3B60A 2JGNA 5HR5A 4LHVA 2ZI9A 1S3GA 5C1BA 1VHLA 5KPJA 2D7DA 4OI2A 1NI3A 1HE1C 1E2MA 1T8TA 1XB2A 3GLIA 3NDBB 1GRRA 4ILEA 4LPKA 4DDUA 3WMEA 4XTRA 3J81k 3ZS9A 1JALA 1S1CA 4AG6A 1ZNYA 3EZ9A 3GLIE 3E2IA 4MYTA 1WBBA 1CKEA 4ZO4A 2FX3A 1BMFA 1MO3A 3CRVA 1SZPA 1Z0KA 5LB2A 4B35A 1F5NA 4XTCS 1LTQA 1G5TA 1W0KA 1NIPA 1BYIA 3GLFA 2YOHA 5GJBA 4Q48A 4DDTA 1ZMXA 5EXXA 3D31A 4I4LA 4QL3A 4JLOA 4D0NA 4MH0R 3OZXA 3TSWA 2WICA 3C15C 1OKKD 2AHOA 2IK8A 1WXQA 2AXPA 4HLQB 1J8MF 4JIMA 2O8BA 1M7HA 2F7SA 3B6EA 4RY2A 3JZMA 2GJ9A 2GVZC 5TDHA 4G5QA 3L0PA 2F55A 2W2XA 1GNRA 4GMDA 4DZZA 4B3GA 1P75A 1PLJA 3A1WA 2OLKA 1KMHA 4PAOA 1A1VA 1GUAA 4B3XA 4KJZA 1L7VC 4FN5A 1E0KA 4LJ8A 3VR2A 1IY2A 2ODNA 5DSZA 3L0SA 2REBA 4M1MA 4KLNA 4PHGA 3WYGA 1R2QA 5L8VA 1ZJ6A 4HAVA 2Z4RA 2ZRNA 3GEHA 2KBFA 4Z8YA 4L9WA 5HKKD 2XNDD 1YZLA 3EIEA 5GJWC 5G3ZA 1Z06A 5KNCA 3UMFA 1XCMA 1ZD8A 2XAUA 4IDHA 1TQ6A 1HE8B 1KO1A 2HCBA 3DM5A 2GBLC 4RJLA 1XPRA 1G3UA 3U4QA 1OFHA 3V9PA 3PEUA 3OE7D 4CEJA 3LLUA 3VU9B 2VHCA 3TGPA 4P4SA 2MSEB 3BB3A 3ADDA 3GLHE 3U7FB 1H8EA 3HU1A 2O8FA 2GCOB 4TZ6A 4DBLC 1ZINA 5DIFA 4B47A 3GJ8A 3IIKA 5KPDA 1QHNA 2O0HA 3LBNA 1T3LA 4LPSA 3VR6A 5B64A 2IT1A 2WKQA 2ZRGA 1YJ5A 1TX4B 3QBTA 1Q44A 1E0JA 1CR0A 5DHFA 3BB4A 2WAXA 2F1HA 2ZU6A 3SJCA 2Q3FA 2XITA 1RJ9A 1R8SA 2ZAMA 3TE6A 5JMTA 1E1QD 1LFDB 2J0UA 3QKSB 1KI1A 4AD8A 2GXSA 5J4VA 1DAEA 4MQBA 4QBFA 2OG2A 4Q7KA 1KZ7B 2P0EA 1GAJA 3WY9A 1P72A 4YMTA 3U2QA 1UEIA 3PV0A 2RGXA 4IXNA 5CITA 2ZJYA 2ZSFA 5IRCD 2KB0A 2IYZA 5AK0A 3GJ6A 4Q21A 2ANBA 2BM1A 1NP6A 1OF1A 5EE3A 1YR6A 2C04A 2WSSD 4IHQA 4IVPA 4YMWA 4OYHA 3X1XA 1TF5A 2R44A 2RGNA 5EE5B 3VHXA 4LJ5A 4LX0A 5AJXA 1EXMA 2BCJQ 1FZQA 3CW2A 1YZUA 3ND9A 2W2VA 3T34A 1KHTA 3OIYA 3X1YA 1XNJA 4AIIA 1QHXA 4Q9HA 5DI3B 2BBTA 2IYWA 1X3SA 3P1JA 4B71A 2B92A 2OBLA 4HLDA 4G1UC 2V7QA 1E1QA 1UPTA 2JLQA 2ZRDA 5FBQB 2JLXA 3I62A 5LD2B 4JLDA 5H68A 1WF3A 3NBFA 1P6XA 2PLFA 4GI7A 2CHVA 1Z28A 1CXZA 1ZC3A 3S1AA 3RRZA 2PJRA 1GNQA 5TVKA 2PX3A 3EW9A 3QE0A 2QMEA 4UXJA 1P3JA 3ZYCA 1GFIA 1E2LA 1CLUA 2YVUA 2R2AA 4KFTA 4ZKDA 3AF1A 4NCHA 4O25A 3LW7A 5HE8A 2DB3A 2F1IA 621PA 4PFSA 1S8FA 4DXAA 3DZDA 2ZETA 1L4YA 1J7KA 2ZREA 4UJ3A 3SDZA 3DL0A 4LOAA 4XVUA 1Q22A 2O8EB 3TVTA 3DMNA 1KO8A 2ZI5A 4R71A 2YKGA 4XOIA 5CYOA 2J46A 3SR0A 4B6FA 4LK2A 1R7RA 2C5LA 4XVRA 3GQBA 3ZLJA 4M1OA 1Z47A 2C9CA 1NBME 1XTSA 1EK0A 4JL6A 2WJGA 3WRXC 1DELA 3KDSE 3CF6R 4Z54A 1T8UA 3AVQA 4FMCF 1MR3F 4EJSC 4BRUA 4RKEA 1K6MA 1UEJA 4EQ6B 2FPMA 1L4UA 4FWIB 4W9MC 1QHSA 4TYWA 1QZXA 1RKBA 4DIEA 2HXSA 2OT3B 2XZOA 1YE8A 3WYFA 5ANRB 4A6XA 3KFXA 2PEYA 2V55B 4KAXA 3WRYC 4D80A 3E1SA 1NG1A 5SZIA 1GWNA 4X8HA 4ESVA 4QM7A 4QNMA 1ANKA 4N3NA 1KO4A 4X8MA 2GK7A 2R9VA 4PZYA 5A4JA 2BEJA 2QGNA 2XB4A 1Z6YA 1W4BA 3BD9A 1NVWQ 3O8CA 1AGPA 1F2UB 4TTRA 3A6PC 2O8BB 4NP6A 3QXJA 1U8YA 4V0KA 5L3QB 1EWRA 3W8NA 5LBIA 1JPNA 3CWQA 3KJHA 2AFIE 3ONWA 5KNBA 5JJIA 3NDPA 1X8LA 1MABB 2ZI7A 3B5JA 121PA 1OJLA 1XD2B 1M7GA 1T0HB 3EA0A 3M6AA 3RS7A 4YLGA 4MGZR 2JIZD 1XMVA 4K8OA 1I4DD 4NONA 2FPKA 5AUNB 1AZSC 2MSDB 2XNSA 1LW7A 1T91A 2GF9A 2VYFA 4LUCA 5F9HA 2ZAOA 5KDOA 1II9A 2WWWA 1R5NA 5AJZA 5FR2A 1XEWX 4QBHA 1SKQA 2WIBA 2QGZA 3TKLA 1N0WA 1KSFX 4JKIA 5CB6A 2N42A 5C2JB 3MUFA 1DTSA 3CH5A 4KITB 1ETUA 3GJ7A 4NMMA 4HB2A 3PXGA 2OHFA 1W4AA 1XTIA 4KBFA 4Q03A 1N3BA 3N70A 4ZIRA 2XZLA 1UBEA 3AUXA 3THWA 4TSFA 2JASA 1B0UA 3K9LA 3LQRA 5G3YA 2P67A 2YV5A 1JJ7A 3R9WA 5FUYA 1YRAA 3VKGA 3VNVA 2XTZA 4Q01A 1IQPA 1DBSA 3MJHA 4TT3A 5HPYB 1IM2A 3LBHA 1Q0UA 1NMXA 2IEYA 5JI2E 3AM1A 1G1MA 2BBSA 2HUPA 3NC1C 4O2RA 3SJZA 2Q3HA 3EAQA 3K9NA 4PC7A 4ON9A 1NJFA 2EWVA 2FZLA 2OBNA 2FFHA 1YQTA 2FSIA 2D2EA 4W7SA 1JEDA 4M0LA 3B2EA 4HLUA 4PO1A 3EXAA 1ZUNB 4GBMA 1OH6A 4B3FX 4TL8A 2IYLD 3ZS8A 1J90A 4EPXA 1U9IC 2RCNA 3LDAA 3AF2A 4IKEA 4F92B 5FI0B 5KOYA 2R6GA 1D9XA 2WSSA 4YXWA 1IOZA 2HLDD 2FF7A 3C16C 1KDOA 1TUEA 1YVDA 2DCUA 5FUXA 4LY6A 4DUGA 3R8CA 1IHUA 1E2GA 4H1UA 4DLWA 2WSMA 3VR4A 3QIAA 4FMDF 2G83A 3EC1A 5B2ZA 3KJIA 1CTQA 4RFSB 4IDOA 4RD3A 5IT5A 1NN1A 4M1TA 3PJRA 1NN3A 1RZ3A 4OI1A 4FCVA 3QSYA 3PENA 4BFXA 2JLZA 2XGJA 2EYUA 4DDVA 3EZFA 1D9ZA 5J4YA 4Z51A 4C0AC 2O8DB 1E32A 2W6IA 3CBQA 2Z43A 3SU8A 4A8JB 2NO7A 2JLRA 5DN6D 4LJ9A 3WP1B 3HPRA 1DAHA 4TTPA 1G17A 2WJJA 4OHVA 4QGAA 2B21A 4B6EA 1M34E 1DADA 1B23P 1XZQA 3MG9A 3TSOA 2VIIA 1UF9A 2A5JA 4CIDA 3TVDA 1RRFA 2EQBA 5EQTA 4R2IA 3WYAA 2ODEA 3HYRA 3TNFA 4OQFA 1KMQA 2JJ8A 3WMFA 5IF9A 1JR6A 2FFBA 3K0CC 1EWQA 3ZD7A 1EESA 1LB1B 3EIQA 2JJ1D 1OLOA 2KE5A 1BKDR 3QENA 2XTMA 2WMOB 4GOKA 4HB3A 4PANA 4TMTA 4DLYA 4GT1A 2IS2A 2CL7X 5D3MA 3K0SA 3RABA 3RNLA 4FINA 4UQOA 3HJNA 4BFZA 1E6CA 1GTVA 2OSBA 3HP1A 2OXRA 4DCTA 1WRBA 2RMKA 5E7IA 5EXSA 1GZSA 3SQXA 2J9RA 1E3MA 3IBGA 4JYCA 2IUSA 2RGDA 1P2VA 1OFIA 2GJAA 5G53C 4EJSA 2RGAA 1A2KC 3LRPA 5K8TA 4WZAE 5DO9A 2PH1A 2ZSDA 2O8EA 1NVVR 3BH7A 2Q3MA 3BOSA 1JR3A 3IPXA 1ELOA 4QBIA 4TL9A 1EX7A 3CPHA 3CZQA 4P4SB 1KI9A 3GLFB 1OXSC 3I32A 3AVUA 2BV3A 3GEIA 4EPWA 5F9FA 3M0EA 4IJMA 4PPQA 4BGDA 2V8OA 4L16A 4AK9A 2EFHB 3T1OA 4F4JA 5C46F 2YYZA 2QEQA 2BCGY 3K70D 4LJ7A 2PT5A 4E07A 3LX8A 2VA8A 1MH1A 3FFBA 1TU4A 2GZDA 2QP3A 4HATA 4TMWA 2HJVA 1N5IA 3CZPA 4BLSA 1CP2A 2KBEA 4DCSA 1XJQA 3FFAA 1NRJB 1AJEA 2BBOA 4V0MA 1WMSA 3FWYA 3HR7A 1DG3A 4V0NA 5KSPA 1XBTA 3QI2A 4TYQA 1S4QA 2B7CA 1KSHA 2F6RA 2FGKA 3H0KA 4PHHA 4XH9B 4TL6A 4BFWA 4HLCA 3U44B 1UKYA 4OHYA 2CEAA 1E9SA 2XNDA 3EPJA 4BQSA 1G19A 1W4RA 2GESA 3KJEA 4RD1A 4RD4A 2LKCA 3W6OA 1AKEA 1DVRA 4C3ZA 2ZI3A 4HEJA 4PXAA 1R10A 1XCPA 5LD2C 2VLIA 1VDZA 1HTWA 2AK3A 2AX4A 4QRHA 3HR8A 5J5CA 3KTAA 5G40A 3LO5A 1E2IA 2QUZA 1BS1A 1XP8A 5BXQC 3AVXA 3SFZA 4TTQA 3KJGA 1N5JA 1R8QA 3OAAD 4W5WA 3UKDA 4Q1BA 1VG9B 4ZI3A 4HSEA 3LD9A 3I1FA 3PFIA 5B57C 2QPTA 2NGRA 3A8TA 1W0JD 4WAUA 3RLFA 1KI7A 2CJWA 1N0UA 5JWHA 4A2QA 3U4QB 1WDTA 2H57A 3BH0A 1EG7A 3GLHB 1X86B 2VSOA 3TQFA 1K5GA 1OV4A 2R6AA 2VBCA 3FHTA 4PHFA 4PZLA 1GKYA 3C7KA 1EFCA 5K8IA 4DLTA 2ZSEA 5A0FA 2J0QA 3IHLA 1V43A 2ZU0C 1E9FA 2FEOA 4QC2A 5FR1A 1I4TD 4CF7A 5LPNA 1G7SA 2VP0A 3A4NA 2J59A 3AQ4A 1YKSA 2VP9A 3OFNA 4JVMA 5BYJA 1Q1ZA 1XEWY 3W9YA 1P9RA 1ZRHA 4UNSA 5DYGA 4KI0A 4RD0A 1I2DA 1SULA 4LRWA 3T1TA 2ZEJA 1DAIA 3AVWA 1VG0B 5FBRB 1FNNA 1Z6XA 5KSYA 1WCV1 5TXGA 3NEJA 1HYQA 3K70C 3MGCA 1GKIA 2V6IA 3NBZC 1Q21A 4LBVA 5HZKA 1G7TA 4KVGA 1HA3A 1N6HA 5IK2A 1UAAA 3FVQA 3MWLA 4PSKA 5FL7D 1D8TA 5P21A 1W5TA 2IF0A 3U6KA 1KO5A 4N0DA 4B48A 3GJ4A 2W0MA 3W34A 1NIJA 3A1SA 3SJAA 1M7BA 1LS1A 1RE0A 4JYBA 2VPPA 3V4FA 3BBPA 1OXVA 1F2TB 3I3SR 4YMUA 3ZH9B 1KYIA 3REGA 5H1YA 2REOA 2WPDA 2ORIA 4QJ5A 3I8XA 5EUQB 3C14C 3LXXA 2C8VA 2ZITA 4GSYA 5AR1A 4NYMR 4YONB 3TLXA 2V7QD 3FMPB 2QNRA 2JLVA 1COWD 1KGDA 3R8FA 1JXMA 3BFXA 4ARZB 3TUIC 2GXAA 1AM4D 4AY2A 3SFVA 5CK5A 2AN9A 1KY3A 521PA 2Q0HA 1UBCA 5JRZA 4EIWA 1E9RA 3BAFA 2IS1A 2ERXA 2VHJA 3LX5A 2CNWD 4FMBB 3ZZUA 1KI4A 3QXCA 5KTYA 1IN5A 2DFNA 4D4MA 2ZS9A 1T0JB 3AKYA 4HAZA 2MMCA 1JXOA 1XRJA 3A4MA 4QFMA 4IDNA 1U81A 3A1UA 1YZQA 1VYTA 2QL6A 3D7MA 3K0FA 5KDLA 4MKHA 1KIMA 3T61A 3K0AA 2O0KA 8OHMA 4C0HA 2CL6X 5CJ2A 3KL4A 4Q4LA 2HEIA 1CF4A 1NVUQ 1E2PA 1N6PA 1N2CE 1D2NA 1DS6A 3PR1A 3QPUA 4Q19A 2QAJA 3WNDA 2WBLC 2OV2A 4GOJA 3FMFA 4K81B 2JJ2A 5BQ5A 3FMIA 2VP5A 2D2FA 5JJKA 1OHHD 1GKUB 3PITA 3ZZTA 3IPYA 3DM9B 4PO9A 5CLLA 4MYCA 2IX3A 3K09C 2A9KA 1G6OA 3PVSA 1NVXQ 4BLPA 5CIWA 1W49A 4EDHA 4BUJA 3GD7A 4PC2A 4LV5B 3EWSA 1AS0A 3K0FB 1X8KA 3LVRE 5SZHB 3RYTC 1E0AA 4DCNA 2Y8EA 4GMXA 3NG1A 3RC8A 3L2OB 2FSFA 3IO3A 2XOKA 5CDFE 1ODFA 4IOKA 4TSFD 4M8NE 3T5DA 1OH5A 1S2MA 4IOJA 2FJUA 2J41A 2GNOA 2NO0A 4B2LA 1CULC 4EJSB 3K53A 3P27A 2B6HA 3GJ5A 1XMSA 3THWB 5DYIA 1JQJC 2QENA 4I1VA 5FPKA 5JSZA 5JJLA 1FX0B 1TEVA 1NY5A 1Y63A 3IEUA 3ZGXA 1XPOA 5JBQA 1AGRA 3AVTA 1N6KA 1HQCA 5JCPA 2FZ4A 3EC2A 2ZUCA 2LWIA 2ORWA 3GFTA 3HYTA 1AS3A 2ZRCA 4DJTA 3U60B 1IJEA 1AK2A 3DHWC 2O8CB 1TL7C 1FW6A 4S2EA 4B3CA 4O3MA 1CRQA 4C9BA 2QP9X 1SXJB 2NZJA 2A5GA 2KSQA 2CL0X 4V0ME 1T9HA 4BFVA 1E2HA 3PIRA 2BMDA 1UM8A 4OKSA 2QY9A 4DUGD 1ZC4A 2ZJ2A 1IBRA 2QQ0A 2BKEA 4M1SA 1W44A 4A4DA 3MFYA 721PA 1PZNA 3VU9A 4LJ4A 1E1RA 2DWPA 3KXKA 3LBIA 2VF8A 3K1JA 1X6VA 3OIUA 1JR3E 4KODA 2GK6A 2ZUBA 1KZGB 3QG5A 5DI9A 1MKYA 3MWYW 1KNXA 1P9WA 1VMAA 3O8RA 2IYUA 2IHYA 3K9GA 1GP2A 3B85A 3N2EA 2FSGA 3QVVA 1GM5A 1P4SA 5EZ6B 1ZBDA 4Q18A 4ZDWA 5E3HA 1NKSA 2OO7A 3QEJA 2D06A 1U99A 1ZCBA 3UG7A 4C4PA 4Q00A 1I4LD 1QG2A 2KJQA 3RC3A 3VX3A 3ZIAA 2ZRJA 1E94E 2PCJA 4ESHA 1YZKA 4KV9A 3QKRA 4Q9LA 1EFRD 4YMSA 2FOLA 2HV8A 5FOTA 1CJUC 3KQLA 1K8RA 2VHQA 4B3BA 4EPVA 2K5UA 2JA1A 5TY0A 1DARA 2FDCA 2ZM5A 1KI6B 3UXMA 2QP4A 4B74A 3LA6A 5JWRA 1TUIA 4TL7A 2OEPA 2QA5A 1SHKA 4BE7B 3T1VA 1RRPA 3RAPR 2XXAB 2OFOA 3AB3A 3W3AA 2OLJA 1KKLA 4JLJA 4HDOB 2QQEA 2GVDC 1OW3B 4PC3A 2Z83A 1XF9A 2ZRLA 4NYIR 4D26A 1MO6A 4P4TA 4M1KA 4IRUB 2ZXUA 1K5DA 3PUYA 5F2EA 2C77A 1II8A 4LYAA 4DC9A 4U7DA 2ONKA 1NY6A 1M1YE 3LLMA 2MSCB 1M8PA 2A5DA 3JVVA 2VO1A 5CM9C 2QT1A 5HTKA 3BRWD 4C0LA 2FN4A 4CZ2A 1JBKA 4II7A 5TARA 2ZJOA 1EFRA 2ZROA 1ZM2A 2YZ2A 3U61B 3A36A 3UATA 3PUZA 1XZPA 2D3WA 3DO6A 2W58A 2EYQA 3K0CA 3U3KA 1XTJA 2GCPA 2JEOA 5JHHB 1E4VA 4P32A 1XTQA 3KUDA 2WHXA 4JLAA 5EP4A 3QF4A 4DHEA 1G16A 2RHMA 1AQYA 4TQ9A 4D82A 3GLIB 1Q57A 5FPSA 4DKXA 2ZRPA 3PEWA 1RPZA 2WAYA 4XD7D 4BECA 3QXXA 5EP2A 1ZD1A 2IWRA 2QT0A 1NNEA 4M1WA 1XD8A 1Q3HA 4CYMA 3UG6A 4CEHA 4ARZA 1PUIA 1E2EA 1FNMA 3NHAA 4L9SA 4EFMA 1Z63A 4MKIA 4TQUS 3RS2A 2GAOA 1IXZA 1UKZA 1IY0A 3EIHA 3VR5A 3KQHA 3IEVA 2BM0A 5DLQC 4PQFA 1W36C 2FA9A 1TAGA 3I8SA 2C78A 2QE7D 4JZKA 2WIAA 1J8YF 1KK2A 3O8BA 1CEEA 2QBYA 2H92A 4US2R 2V9PA 4D25A 4GP6A 3QOFA 1X8JA 3BK7A 1N6RA 4MGYR 2ORVA 1PVOA 3THOA 1XEXB 2HF9A 2P6RA 4OJKA 1CR4A 3HU3A 4URXR 1LF5A 3CIOA 1R4AA 4TMKA 2ZQ5A 3DKPA 1CR1A 1E0SA 4MDFA 3ZQJA 2HDNB 3OAAA 3EWAA 4CT4B 3CF0A 4MRSA 4M22A 4A0RA 1TU3A 2ZE6A 3TR0A 1SHZA 3WMGA 3RSLA 1LV7A 1XXHE 2D62A 3GMTA 4GRAA 2VP6A 1Z0IA 1E98A 1SVOA 5BN5A 4KCGA 4X8LA 4J0QA 1QHHA 2I1VB 3VFDA 5JWOA 1E9DA 3JZAA 2FSHA 3NIBA 4AC9A 3QQ5A 1GG2A 1LF0A 4KU4A 5FUVA 3ZVRA 2F43A 3NWJA 3W3ZB 4EAQA 4H9GA 1PLKA 2D74A 4A0HA 4WVFA 1P62B 2IUUA 4PR0A 1ZNXA 3TUJC 1NJGA 2IHBA 2R6CA 5SZJA 3U6BA 2CK3D 2UZ3A 2EFGA 1RYFA 4WZ6A 3CPJB 2H5EA 2VHUA 1Z6TA 3BS4A 1E2JA 4NZYA 1Z29A 3FGNA 3X2SA 1AS2A 1FX0A 3BC1A 4DEYA 3U7GA 4XWAA 3QKRB 5IK2D 5CYPA 1IN4A 1AN0A 1IONA 1H8ED 1S0UA 4OI4A 4NCNA 3KKOA 2QSZA 4OJQA 2OZEA 4IVRA 3THXA 4MGKR 3ZD6A 4G3XA 1W4CA 2XZPA 1VECA 3FPAA 5FI1B 1OIXA 3OHMA 4KFSA 4LYFA 4ZPXA 5JRJA 1W5SA 4AKHA 3OIVA 2O8CA 1ZNZA 3FKSA 4C30A 1BIFA 2H8KA 3CX7A 2GCOA 3I72A 1CJMA 3EX7C 4NYMQ 421PA 3B9QA 1T6NA 2VEDA 2W6JD 4MKGA 5FPTA 2NZ8A 4HAWA 4RFVA 4DLZA 4DB4A 4UNPA 4TMXA 2CCJA 1KJZA 1SKYE 4Q4JB 2Z4SA 4JLVA 4HAXA 5SZKB 5EP1A 3AVVA 1QF9A 2G1JA 2WWYA 3W5IA 1A82A 5DISB 4XJXA 1CU1A 2J7PA 2FG5A 1U0JA 3B9PA 4ZCLA 1W36D 3AVOA 1CRPA 2NQ2C 3CH4B 2N1BA 4N0EA 2BEKA 2XTNA 4GZMA 2VTKA 3AF0A 2ODWA 4DWJA 2P5SA 3HU2A 2C03A 2YWEA 3CRQA 2EWWA 4QKQA 1VG8A 2WV9A 2IYVA 2J45A 4DT1A 1PUJA 3K0EA 3P26A 4KSBA 4NYIQ 4Q4JA 3DPUA 3AKCA 1UKEA 5FTJA 1RIFA 3R7WA 3RDPA 3TQCA 5FL7A 4RZ2A 4F7WA 2IF2A 4PPFA 5BWMA 4IW3B 1NG9A 3R9XA 5JFGA 4P0TA 5FH9A 3FB4A 4AURA 3DDCA 5FBVB 4ACBA 4D4KA 1OHHA 3AUYA 3EPHA 1OXUA 2ZSBA 4NCJA 4Q4HB 1WB9A 3PEYA 2A78A 2QPAA 4URVR 2QORA 3VAAA 4RZ3A 1US8A 4MRVA 3KZ1E 3U3MA 2WM9B 1P2UA 3ASYA 1XMJA 2XEXA 4NHOA 2QBYB 2A3RA 5CIQA 5FTNA 5HCNA 4A82A 1P2TA 4JT2A 3NH6A 1OSNA 4X8OA 2VSFA 1F3OA 2Q9AA 2ZR0A 2YWGA 3L0OA 2JLWA 5KHOC 3TRFA 3CRMA 1P5ZB 1ZU4A 2AK2A 3PUWA 2BWJA 3TUZC 4V0LA 1HEIA 3EZ7A 2YHSA 4RD6A 3FMOB 3IO5A 1G8PA 4G01B 1U0LA 2CE2X 3OIWA 5FOSA 1W7AA 2EW1A 4LJYA 3CNNA 4MRPA 2OCBA 1S1MA 4OQXA 1HH4A 4MRRA 2IS4A 1FTNA 1DPFA 1OB2A 4PC6A 3QF4B 1QHYA 3RS5A 5C4GB 1W2GA 1JR3D 3TSZA 3ZJYA 1XPUA 1P61B 4CEHB 2ATXA 2QM7A 1KJWA 2JLSA 1T5LA 1FPMA 4Q9JA 3AKDA 4TLAA 4D4LA 3ZDQA 1YRBA 4JVSB 3QXSA 1SVKA 4JBXA 4FD2A 1D5CA 3Q72A 1KSJA 4XSHA 5KNDA 1JAIA 5EE1A 1IN7A 1ZVQA 2PMKA 1NL3A 3SC3A 2GHIA 2QRNA 2ZE8A 2Q6TA 1KMHB 1S3SA 1Q12A 1YR7A 4M9QA 2CJWB 1BMFD 1OFUX 2PEZA 4ZDJA 1Z6AA 4BLOA 1O87A 3IQXA 4DVGA 5HCIA 5CDFA 3QUSA 4G5OA 2A2ZA 2ZRIA 1WBDA 2GTPA 1S96A 3NTUA 5EP3A
chains in the Genus database with same CATH superfamily
4PZZA 4HDCA 1J42A 1H1LA 2B4KA 1GPMA 5MGBA 3IIJA 5HJEA 2B4YA 2RAPA 2VJNA 3L0YA 2AZTA 2I66A 3RS0A 2WZCA 2IFTA 1E7WA 1W1IA 1LWOA 5IM5A 2FB9A 4AQ7A 4MZXA 1H8HD 3NQ41 4QOGA 2ZZNA 1L4KA 1A50B 3IDSA 4IEEA 1R5OA 1F9AA 1M2HA 4LGYA 2SCUA 3RVPA 4I2NA 4QQFA 3E3AA 3E84A 5JECA 4XI9A 3T12A 1BX1A 3ITNA 2VPIA 3DE7X 3KEQA 1UAYA 3IOYA 1DEHA 1JDBC 1PGQA 2E5FA 3CMCO 4R1QA 5BN1A 3THRA 5DTEA 4LMBA 3L6DA 4RVHA 5AI0A 1QRAA 3Q3VA 1YR8A 4M1YA 2CDRA 4LJLA 3X1ZA 4EHLA 1VB5A 4OQQA 4S24A 1RQXA 1X77A 4UDXX 1AU9A 4KWHA 4TN1A 5E9JA 2GTIA 3RRBA 1NQAO 2POQX 2XX3A 2H65A 2GM5A 2N3ZA 2IYTA 2KS6A 4KXMA 2G9NA 4BCDA 5JXIA 2IS6A 4WXEA 5ECWA 2HD4A 3TMYA 4YJGB 4NYJR 1W8DA 2R68A 3QVWA 5A9TA 1R0LA 3FRIA 3FZEA 4NL4H 1V1MA 1ZW6A 1NURA 3CWZA 3R0JA 2QTHA 4Y1RB 4EYGA 3WHKA 2J1LA 1MG5A 5A4MS 4X94A 3IHTA 2VK2A 4JBWA 2QVLA 3C6KA 1HDXA 4LNUB 2J0UB 4WL0A 4BO5A 4DR4B 1A2OA 2R00C 4R0VA 2VN8A 4PAGA 3JZFA 2PKEA 2QG9A 5CW2A 1SKYB 4AFNA 2N75A 2XQGA 1MAVA 3I58A 3KPYA 1JVBA 5AUQA 5ADWA 3OZSA 3OP4A 1K5HA 1W93A 1XRRA 2H7YA 2NO4A 1KIFA 1EGHA 2HUNA 2JKZA 4C7JA 1CW2B 4K1LA 4NMXB 1P0FA 3OC6A 2CLCX 1XMQB 5DHPA 2J32A 821PA 2FWRA 4FMCB 3Q98A 2XWBF 3B3FA 1KDZA 2YWDA 3QHPA 1G3QA 1XXHA 3TPZA 1YQUA 4MVJI 2GNPA 3RK1A 2EG9A 3G8CA 3PIIA 2LP4Y 3C7TA 3NBUA 4JSRA 4X85A 3R6GA 4XJVA 2RGGA 2YCBA 2GF2A 1FNBA 2ZTLA 2XMZA 3T7CA 3JATA 3HJGA 4DIDA 4FSDA 4FWBA 3KFLA 3EULA 3AXSA 4Q6WA 1JQKA 3QVGA 1CIPA 3EBLA 4ROTA 3VMFA 4ARBA 4ENPA 3K1AB 3REFA 2ATVA 3GG2A 5AP9A 1LPNA 1VGRA 1I3LA 1VYVA 3G7UA 4HXYA 5FWYA 1SR8A 5IT0A 5DPMA 1LXCA 4U6QA 2PV7A 1Q0SA 2DFTA 2VPZA 3G49A 4X92A 2JBAA 5ALYA 2OAP1 1TJPB 4BX8A 3AO0B 4Y67A 1UZMA 3DAYA 4XIFA 5HQ3A 2O8NA 1Z08A 2HAEA 4G5RA 3KKQA 3WI7A 2I2XB 3ZGNA 2IYRA 4N0MA 1FFBA 3CO5A 2GD6A 4KIUA 2J87A 1EE2A 3HEBA 1UEXC 3GVIA 3NDJA 4IOMA 3K9CA 3M5CA 4CW7A 3GJQA 4NJMB 1OBHA 3GEMA 4EY6A 2NOAA 2VAPA 3GPCA 3OIGA 3H9GA 1O54A 3ODPA 1TB4A 1UJ5A 4BZZA 2IBSA 4F6RA 4EPTA 5A1JA 2CZGA 1Y1TA 3FHCB 4M9SA 1Z4KA 1I24A 1V47A 5F76A 4KWIA 2X8WA 2HNBA 2FMKA 1GL3A 1QFMA 3EMVA 3KV3O 2GGSA 5AIAA 4TRRA 1AKUA 1JI0A 1U9YA 1ZRMA 4ELSA 2XKJE 3I34X 2F43B 4CEIA 4E2ZA 4JUAA 2XTJA 2C3PA 2O8FB 1BU5A 2EF0A 3F1LA 4Y2UA 4EP1A 4M76B 1EFUA 1RD4A 5L3SA 1YZTA 3KIPA 1QNFA 3GI1A 1C3VA 1M2JA 1RXUA 2OAQ1 4GI5A 3SEQA 4DMFA 4EWLA 5BRAA 1MNAA 1SHJA 3DCYA 2QMOA 3QBVA 1C9NA 5M34A 4YCBA 4GX0A 4DA4A 2QQGA 3KPUA 5DOZA 4BDSA 1P0CA 2Q0SA 3GPIA 5A7GA 5LZ2A 4BNNA 4C2TA 1QCZA 1FSFA 1FUKA 4FJ1A 1NZYA 1ENYA 2FZVA 4BWYA 3BPSA 3MPUA 1PJLA 2R8EA 1ESMA 4UDNA 3W9UA 3VHRA 5BOVA 2D8AA 2ZI6A 4JJIA 3M4ZA 2C95A 1D2EA 1T10A 2F67A 3ZVLA 2B8NA 1WPXA 2JD0A 3AFOA 4C2AA 2WW8A 2IOYA 3HCPA 1KFJB 4UD2A 4F11A 2PJZA 4HUTA 1JJIA 5KNDH 4K26A 2Q2VA 1EQ2A 1B41A 4G9EA 1PLLA 3CKMA 2XKKA 4YRJA 4CR7A 2A8YA 1SBZA 1ATIA 2F3PA 3WLRA 5LDDC 5IVKA 4NCAA 3I39X 2ZS8A 1ZZEA 2YY5A 3I1YA 3VKWA 1G8FA 2WILA 1M6HA 5B7PA 4Z0PA 3ON5A 2ACEA 2P9EA 5U4XA 5BOSA 1A7AA 3FNGA 4Q16A 3WKCA 1DEAA 1OC4A 3WGMA 3RBXA 4FDTA 1JJAA 2FU5C 3OLVA 3ORQA 4FQ8A 4E5KA 1LPBB 4LRYA 4FIDA 1TF7A 2A1UA 2A0KA 3ST7A 2RARA 3M5WA 5GQSA 5K3SA 1O7JA 3D3WB 4FZVA 3BE8A 2VPTA 3DZGA 3FYHA 2XHZA 2PO7A 4KPUB 3HLYA 4M99A 3DFMA 3FGPA 3CUEF 3KEGA 5B1SA 5LZ4A 3JWPA 3L7OA 1ZISA 3CG0A 3ZZ1A 4DN6A 4YUZA 1Z88A 4QA9A 4DWOA 3PGMA 4DMKA 5G4KA 4QM6A 2AWNA 5EJ4A 3HA7A 2I9KA 4LY3A 5MN4A 3HJTA 3S70A 4Q1FA 4FEYA 2QR5A 4B82A 1FIUA 4BLUA 2DQZA 5BSKA 4PRKA 1K7SN 1M2OB 1QP8A 1XTRA 4O02B 3GT3A 4WGFA 1YDHA 3KQYA 1EVLA 3JS5A 2DFKB 5EE9A 5AKXA 3ADBA 3NC0C 5TPWB 5KIAA 1SUSA 1OLSB 3G8YA 4ALMA 5BWOA 1Z0JA 3UUGA 1VLLA 1ISJA 4U02A 3IQGX 4JI6B 1OYWA 5IJ9A 3QW2A 4Q3DA 1BRMA 4IVNA 5JQWA 3AJAA 4KDFA 3NH9A 3HNPA 4K9OA 1Y6ZA 4E70A 4YDSA 2X77A 4K5QA 3WIEA 3G5LA 3QG1A 3Q5EA 5F5LA 5AHKA 5JMPA 3Q88A 1SC6A 2NYRA 2PZ8A 4V3BA 3MD0A 3CISA 4U1RA 5JD3A 1VJGA 1EVEA 2R8BA 4YJ2F 2W6JA 4MR9A 1NF9A 4Q37A 5JS8A 4AF8A 1ZM3A 1MRNA 1FMJA 4JEMA 5EWJA 3UM9A 3D6AA 1AKYA 4N6OA 4MHSA 1C1YA 4Y2TA 4S1VA 5F3WB 1ZXBA 5FLYA 3LDGA 4ZTZB 3JY6A 2IZ5A 3MHTA 3V6LA 3MJFA 3HVUA 4CU5A 2CHEA 1O3YA 4ZA2A 1E6KA 1AIPA 3RBAA 1OREA 3RWOA 2AR7A 3THYB 4RIEA 1KEEA 4S3MA 2TMGA 4TV8A 2C9DA 4KQIA 3B1ZA 2HQBA 4B8WA 5J2TF 1T5IA 4PSAA 4FLFA 1PFQA 4MVJA 2O54A 1OA0A 2B9EA 3ZHYA 5DWQA 4CQLB 4N01A 2BLNA 4JR0A 3ASZA 1FW8A 4AJ9A 1NW3A 1PR1A 3V42A 1KAEA 2A9VA 2YWFA 1SBNE 5CNKA 4JMLA 3RHTA 2H1FA 2P9ZA 2TECE 3A11A 3DS8A 1C9YA 3RTAA 5B4TA 5HJ5A 5GOTA 4I1SA 3K5HA 1FYFA 3ABQB 4C6TA 3QW4B 4Q82A 2RHHA 3L05A 2ASVA 2RJNA 3HFGA 4BRSA 3EXIA 2IITA 5KX5B 5LQUA 4JWTA 1KQOA 2PXHA 2V6BA 1F2TA 2FMHA 5CURA 3TLMA 5I48A 1C4OA 2H2WA 5GJCA 3RIXA 3ROXA 5CK4A 1NMQA 3PXEA 1LBTA 3OKPA 1EX6A 4MMXB 1QIDA 1NXPA 4AMUA 4JJ4A 4ML3A 3C8ZA 4QT0A 3OPVA 4TZTA 5EE0A 1BA3A 5AW4A 3WA6A 3FRHA 3DMYA 2UZ4A 1S2NA 5EI5A 3IELA 1XA0A 3GLVA 4WNYA 4D9MA 5HRUA 1BYUA 1C14A 1N1GA 1EUDA 2G4LA 1QS0B 2ZJ6A 4OVKA 3T35A 4EI7A 3OF5A 1SHLA 1YJXA 2Z9DA 2ZPTX 3K31A 1QIJA 2DU8A 3R0IA 2JRCA 4LOIA 5DT9A 2MYNA 2YV1A 1XRPA 2V7EA 5HF9A 1MV5A 3L82B 2C97A 4IIEA 3R7DA 3LQKA 5IULC 5DHSA 3CPSA 5SICE 2AN3A 1FXWA 4LBZA 3RSFA 4GX2A 4P4GA 1IZYA 2IPMA 2JH8A 3S68A 4ZGWA 3CLUC 1HMPA 4W4TA 4WBSA 3EE6A 4J7XA 3W77A 3F49S 3IOEA 4YYZA 3SNHA 3HPQA 1W2HA 4NDNE 4KR7A 2IP2A 3PUVA 4K3VA 2DGDA 2HXYA 3NTRA 4XXHA 3WQQA 4E2YA 4URUR 3P4YA 4ND6A 9GPBA 1DCTA 4Q9IA 2GILA 4HTFA 4R84A 2AYXA 2PD3A 3ITKA 1YBMA 4NFHA 2G0TA 2D0IA 3JQFC 3LLCA 3NRBA 4FFLA 2JLBA 5LBUA 3WFIA 3PBKA 5EMNA 3V2IA 2Q0XA 3DBVO 3L6CA 3OTQA 4YAUA 1UBLS 1K3UB 2HJRA 1B8UA 2C5BA 3AIKA 3ROZA 2GBPA 2O4UX 1RZUA 2RHOA 3N8IA 3VKHA 4RSHA 3PHBE 4EBFA 3DV0B 2JFUA 1H9CA 1BVHA 3PJEA 1Y8RB 4EW6A 4EI8A 3Q10A 3E3NA 2PA3A 3NP9A 1E2DA 3WK5A 3I04A 3ZBPA 2CE7A 5IARA 3RYHB 1LLUA 5L3SB 5ICGA 5LMNB 4ZV4A 4M9ZA 3RSIA 3SQNA 2RSLA 1IEWA 2CY0A 2ZCUA 3KR9A 3L43A 1WF6A 2QRVA 3L1KA 3N6VA 4LW8A 3W6PA 3FMVA 3OSUA 2EATA 3L7CA 2QJTA 1RHMA 2QUAA 2W2TA 1DOAA 1CUCA 2X8AA 3DE3X 4L5CA 4K6MA 1ZUD1 4NPAA 5T8KC 4YHBA 3RUCA 4B1FA 4BJHB 3EZNA 2Z09A 1ZR2A 4EJ0A 1WP9A 4DE5A 1PNTA 2UXDB 1WMBA 1M8GA 5K3BA 4MS1B 4OMFG 1KY5A 3ZWYA 4HQRA 4LGVA 4PG5A 3FLAA 5FOWA 3PEFA 1QHIA 3DLHA 1ZQ1A 3BBLA 3EGOA 1OIWA 4BNUA 4WXHA 4OIMA 2RHCA 2WZBA 3HVJA 4PE5B 2H18A 1X7WA 1XQWA 4UM5A 4D3SA 4RVDA 3CGGA 2VP4A 1TYAE 4Z86A 1RWQA 1DWQA 4M0MA 2ORED 3I73A 4E0BA 3WHIA 5DCYA 3FWNA 3TGLA 1AQJA 4Z1MA 3D1JA 1PE0A 4HYTA 4U00A 4Y6RA 4ZCSA 2E7ZA 3WYBA 2WF8A 2FZKA 2CV2A 1SXJA 3A1DA 1U8CB 4YDHB 4I5FA 2QM0A 4U3JA 1L5KA 4RS4A 2BFCB 1H6BA 1JZTA 2OILA 4JBYA 3P9ZA 4E3WA 1UPAA 4YVFA 5DTRA 5JYBA 5K99A 5CJJA 5IT4A 3KQUA 5ECDA 1PF7E 1PFVA 2I2AA 5EESA 2H29A 4F56A 1GRQA 2ZDQA 3G7NA 1RMQA 4UVEA 4C7OA 1PWYE 2XVXA 3KHUA 1QV6A 2C0PA 5FWAA 4NZPA 3TOXA 4MUEA 4PCVA 1VCMA 3GDWA 5CTAA 4C7VA 4OGGA 3COJA 1PFYA 3GEEA 1MJGA 3QRWA 5CT6A 1ZPDA 2BN4A 1VOTA 1IFXA 1DCMA 2P9GA 3I2YX 3M5PA 3MTBA 2VF7A 3PPVA 4TRNA 5DNEA 4BCCA 1Y6FA 1VHJA 3AEUB 4GEGA 4DPLA 1SU7A 3B53X 4PQRA 1HM5A 3RNOA 1NLZA 2ZYGA 4UXHA 2C2KA 1Z6GA 3QUQA 3UXYA 1NBMD 3AOEC 4D45A 4D3XA 2Q7DA 2ZR7A 1P4RA 2D0DA 2BH2A 2L0XA 1JNXX 4UBKA 2D0PB 4HH1A 1HLFA 1BTOA 3F46A 3NVAA 2HSDA 3DMRA 3QXHA 4HB0A 4PM4A 4TS3A 4HS4A 3UW1A 1KO7A 4NNQA 2QAGA 3AF4A 4V02A 3UC5A 1O97D 3BICA 1FU7A 3W5AA 4C21A 3ONNA 4FHFA 2ZANA 1L4MA 3O93A 3W9BA 3VAZA 1ZVJA 1JHMA 4LHYA 4LMPA 2ICAA 4P33A 1NSTA 4PO8A 3ZLTA 3V97A 5KTRA 5IKMA 2I4IA 3V34A 1V26A 4HGOA 4C4RA 4YREA 3ZU2A 1TA4A 2QUIA 4W5JA 2BDTA 5TQ2A 5D5QA 1AZLA 5LP1A 3LV8A 4GOMD 4OQLA 3OZRA 3ELBA 3VZQA 3PEVA 5AW3A 1TQDA 4W8HA 3TI9A 2WWGA 1BH2A 1IBCA 1Q19A 4XDHA 5FTLA 1MX5A 2WOJA 1IAQA 1S9HA 4MVCA 3SN6A 4K6HA 1EB9A 5A3JA 4DT1B 2DHCA 2HTEA 4OUKX 5BW5A 4BLQA 2RKOA 1DE0A 1PS8A 4TYPA 1II8B 3UO8B 4AG3A 4E2WA 2V3CC 5HWSA 1FNCA 2F1KA 4EELA 4HVCA 4WWHA 5KHLB 1WMAA 5FQOA 4J2OA 2XF8A 1F6BA 3TTUA 2HKIA 4CKYA 2HU2A 1JYEA 2P65A 4QTZA 2WG0A 3SQLA 3X44A 6LDHA 2G4CA 3B13B 2GCNA 2LTAA 4FXPA 4YI5A 4TYNA 3PQ7A 2GLTA 2BGLA 1FBTA 1UJ6A 3DXFA 3PUJA 5FYQA 1B0PA 5A4KA 4WNAB 4L4ZA 1T0BA 4LYHA 1T5SA 1RYHA 3P32A 1WPQA 5DN6A 4GNKA 2ST1A 3IIIA 4INJA 4LBWA 4LXUA 4X00A 1E6UA 3MRXA 3G5MA 4WVLA 1QSGA 2AOUB 4DCUA 3QVUA 5FBZA 1NVVQ 1Y4SA 4DB2A 2PGJA 3S40A 1G6HA 1E8MA 1Q84A 3MT8A 4D3YA 1QM5A 3U40A 3DVAA 3AVYA 4EUNA 2ZQYA 2DP4E 3DNPA 3WC4A 3A06A 5CB4A 1XF1A 2OO5C 1EGQA 1LDBA 3EEQA 2QZ9A 3DKRA 1WQ1R 4HNQA 3OCWA 3Q8XB 4JA0A 2J31A 1FRQA 1QFJA 1O9BA 2X40A 3DR5A 3H99A 4GZLA 1YBHA 4N7RA 3VSBA 1U2EA 1UBFA 2PLWA 4Q3BA 3W8RA 1DBPA 2FUEA 3A4VA 2G5TA 2QY6A 3ILXA 5EL0A 1HQYE 1AX9A 1EQAA 5GY7A 4O4LB 2C98A 2VWPA 4FUTA 3OQBA 4DQLA 2H63A 3ZTWA 2PX4A 1XJ5A 1RWKA 4FYIA 3H86A 4ZZ0A 5HDBB 2O2SA 3QBJA 3LHIA 4DA8A 4AKIA 1ZK0A 2GERA 3F7TA 3IT3A 3EDYA 2QVYX 4NBSA 5I9IA 2CB0A 5FFMA 3MGBA 3KJZA 4GYWA 1CFJA 2SCUB 3QWBA 2HBZA 4HPXB 3FUVA 4S2UA 1J7JA 3INNA 1Q1EA 1LS6A 7REQA 1QVWA 1VL5A 2WVHA 4OV6B 3WLNA 2CVPA 4MTLA 2BSXA 4WERA 4JUBA 4L08A 5IMSA 3C39A 4FHZA 2G8NA 5D51S 2GOYA 4LYGA 3ANNA 3NALA 5BVHB 3MTGA 2IBTA 1SUAA 1MV8A 3AJDA 3KLBA 4LZPA 4ZO8A 2C0CA 2GYVA 4D79A 1FMTA 5E4FA 1JHPA 3FTNA 3FY4A 2IWHA 3JARB 2JHCA 4TMZA 3IAM1 1UQUA 4UBJA 4CGZA 3WAKA 5HBRA 5IANA 4F86A 3REQA 2RBEA 4G5SA 1T6XA 1I2MA 2FR8C 4Y2YA 1VLVA 2I1QA 3U7JA 3I8OA 4R3WA 4MNTA 1GHTA 2F1OA 3GJ0A 2D13A 1XRQA 5BN3A 4LC1A 3I5YA 3MELA 4ZEXA 3VPFA 3MIZA 3H9BA 3EARA 1G7RA 1T4BA 2C2XA 3QZUA 3DVRX 1PS0A 4FNMA 4LE0A 5EJ9A 2OV3A 3E9DA 1PR0A 3F2IA 4EI9A 3RG2A 4DCCA 3SR4A 1I30A 2HTFA 1T2UA 4J03A 1XHEA 3PD7A 4U2FA 2GK3A 1GGEA 3KV1A 1A4RA 2A35A 3L18A 2R8OA 3KD2A 1KZHA 4BLRA 1HDYA 2BEVB 3NHZA 1JDSA 4MPRA 4O1MA 4PSVA 4RDHA 4FW8A 4XUEA 5HKLA 2GB4A 3SCZA 1KEZA 1N0HA 1VYUA 2V6JA 2W2KB 3CT6A 4OH1A 1N9GB 5FNVB 1IM5A 3KAJA 4YI3A 2NU7A 3SX2A 1KS9A 2A1UB 3DLTA 4MUAA 4GRDA 4LX8A 3GL9A 3RRMA 1KJJA 1XUOA 4HWKA 4GPBA 4DSZA 4BFTA 1GNPA 2UZFA 3CV3A 1JKJB 3ANLA 4IBOA 4W9NC 2B4TO 5LP6F 1P31A 5ICMA 1XNQB 2AOWA 2OENG 3O8DA 3MCAA 2B2XA 5ALNA 1FSSA 3H2HA 4PTZA 2FQYA 3WGNA 3ESXA 3ILVA 1VL2A 4RDIA 5B55A 5JALA 3DMPA 4KBGA 3OWXA 2LVBA 1EP9A 1X74A 2C2GA 5EUMA 1TYBE 3MC1A 3V2UA 5KMGA 2XA2A 4Y6GB 1TEZA 4HZGA 2HMSA 1V4NA 1X1SA 3WZMA 3AR2A 4KE8A 2C59A 5K8JB 5THKA 5IC5A 4OK5A 2A0XA 4P3OA 5B1DA 2OR3A 4DUYB 5KX5A 1A04A 4K87A 4LXHA 4HDNB 4Q1DA 5JS1A 1VQ1A 2NXWA 4EHAA 5AMXA 3S99A 2YQZA 1MB2A 3LY8A 3NRCA 4TXJA 4XUCA 3B6JA 4X3OA 4FGLA 3OESA 2NPOA 1GNTA 4R1OA 1SCDA 1A5TA 5BNZA 4F0JA 1I3CA 2W6CX 3IMEA 1PV2A 4QXMA 1QH1B 2PX5A 4WGGA 2XF2A 2GT1A 1Z2NX 1MIOA 1QGUB 2BCEA 4XX1A 4JB2A 1F8XA 1KAMA 2ZB2A 4RH3A 1M66A 2QMUA 1E2FA 4TOIA 5REQB 4TTIA 4A73A 3BXOA 3SLKA 1X7YB 2WHPA 4FZ3A 2FFAA 1BD4A 1E64A 2MIIA 4TLBA 1BZYA 1BWQA 3KQOA 4F4CA 3H75A 4AZ0A 1H9BA 3D1LA 1G5RA 1N5MA 3RH0A 2HA2A 5B3LA 3SE0A 1EFLA 1QLJA 3K9HA 2X5OA 5K51A 5A05A 3WTBA 1XXHB 5AJVB 2AJTA 1USKA 3LT0A 4N0QA 2IDMA 3HKDA 3WK4A 5KUTA 4TTAA 3RWMB 4MJLA 4JLNA 1DB3A 2FAXA 4HDKA 4N7BA 4RPHA 5SV2A 1L5GB 4AN0A 4E12A 1UKVY 2W37A 3CEHA 1DQRA 3CRNA 3U3JA 1XFAA 5GVSA 1I6MA 3STTA 1P1IA 2I3GA 1B0ZA 4E5YA 2XQFA 1KGSA 4TUYF 5IXJA 1W34A 3ZWWA 3ZUGA 3CVVA 4MINA 4L78A 4RKRA 5TMBA 2MSLA 1LU9A 1ZCAA 2IPXA 1TTTA 3DWGA 3QE2A 3T5GA 6REQA 2OB1A 2AW5A 4HZUA 5JS7A 3PRHA 1H4SA 3KHKA 5AW0A 2N9UA 4TX1A 1QGAA 2DFDA 2GKOA 3CZ9A 3TXAA 1MAAA 1TMGE 3SHTA 3VV3A 4BO0A 5LYJB 1GCAA 1RAAA 4BMCA 2G77B 3RS3A 4OAOA 1MO4A 2GEVA 2FLVA 1QHHB 3PWSA 5JTUA 4G4SP 2WYWA 3GGCA 3Q87B 1N92A 3KWJA 4HAYA 4DBVO 3NHSA 4QTUB 5EPOA 3O1IC 4QPZA 1KEVA 2ZRFA 3JD3A 3EEBA 4F3TA 4AN1A 4CHTA 4CIVA 4MGIR 2QZJA 5KJFA 4M46A 1WEHA 1UJCA 4NH0A 3O2NA 1QHEA 4LS3A 4MWEA 2PBRA 2B1RA 2XNKA 5F12A 1YR3A 5IASA 5CFLA 2JHGA 4J0HA 4H2DA 1TJNA 5BXYA 2B82A 3DKVA 1AE1A 3ZXIA 4B2PA 1CR6A 1RACA 1JR4A 1TADA 2PSFA 2Z8YM 3D8UA 3KWMA 4RHXA 1XZ8A 2Z1DA 3S4YA 3U3OA 3WNCA 4CM7A 3SD7A 1NLYA 2EU8A 2P91A 2WAAA 2EL7A 3VVMA 1W46A 1G5PA 4PAWA 2IL1A 4ND2A 2RCYA 1B8VA 1SELA 3ULKA 4I8XA 1LK5A 3A58B 3IT0A 1QVRA 2XGOA 4TXHA 1SXJD 5LB4A 2PO5A 2Q6OA 4R9VA 1CS0B 3WHPA 2J3EA 1TFUA 2PZFA 3NWBA 4PNPA 1T5OA 4YH1A 4GMGA 2NU8A 2BFEB 3WGJA 2YXPX 2JDID 4WW0A 4CDNA 1YUBA 1Y3HA 2FR8A 1X0VA 2W2NA 3EMBA 2IW1A 3RYCA 4ALLA 3R6WA 4LWPA 1I32A 5ES3A 1G64A 5DK6A 1XMPA 3DZKA 4N65A 4NRDA 1YS7A 1EUYA 2IQ5A 4L74A 1G1AA 4OMUA 2NO5A 4QTXA 4FZWC 2YBDA 3U37A 4CDGA 1YVEI 1SVLA 2RH4A 2B30A 1N6LA 4RA6B 4WCFA 1P2DA 4GKVA 3QI7A 4G1CA 3VR2D 3G0HA 5AKZA 4UBLA 2QL9A 3F8TA 4BB6A 1FP7A 5FHQA 1T5HX 3JQEA 2OFWA 3EJWA 3GMDA 4NPHA 4Z1OA 1DRUA 3RUIA 3S2ZA 2YZKA 2A9PA 3FKJA 4Y3UA 4C4XA 1RQNA 2WSIA 5JQGF 2EC5A 2EX4A 2QMYA 1OBOA 3EQ2A 1M2EA 1JQ5A 4R9UC 1I2AA 3AETB 3SYKA 2DWUA 2QJWA 3WSWA 2AKEA 1ZK2A 3WB1A 1GLVA 2HLNA 2G9UA 4J4HA 5C32A 2PV0A 2XUPA 1L7MA 1RWBA 4QJ4A 4I55F 2F1JA 3CKYA 2J7KA 3DOHA 5E3JA 5SY4A 3T1NA 1JHVA 3PCRB 2DY1A 4RKWA 1VLQA 1J1ZA 4M2LA 5DYTA 3UCFA 2P9YA 3A1VA 4DMCA 3L6EA 2DPMA 3FAZA 4CKZA 4GAEA 2J7PD 3D3JA 3O1HB 1BWPA 1T8PA 3M4YA 2OWDA 5DTQA 5EKDA 2ZT6A 3R0OA 2V54A 4D1YA 4LV8B 3SNKA 4UM7A 4Q3NA 1A8HA 2HSJA 2YWHA 1JSZA 1OI7A 5FUBA 1H9AA 1ZW1A 2OESA 3EGXB 3KQSA 4N12A 1PYDA 3IKJA 4INPA 2NVUB 3U7QB 5HZHA 4D3FA 2FP4B 3THXB 2H8GA 1M1UA 2YHBA 2G1AA 1E4OA 1GY8A 1I3MA 1MIOB 1P7YA 2EHDA 2HWWA 3GHHA 4FNAA 4FEGA 4AX4A 4CM6A 3AY0A 2E37A 1X94A 2W71A 3CUKA 2Q4EA 4R16A 2P6MA 3HXMA 2Q6KA 4BXOB 2QYHA 2YL2A 3L79A 4NU8X 1A8UA 2I3BA 2P4EA 3ZNNA 2ID8A 3UW3A 1A8SA 1OU4A 2X9NA 2JGAA 1WUYA 3VYTB 1VPDA 1HV8A 4Y2JA 4DW8A 1L6RA 4PPYA 8LDHA 2FZWA 4QEDA 5K20A 5LP6B 2AKYA 2ZRBA 3IOCA 3L40A 1KVUA 4Q66C 4BX0A 5CW1A 4UE2A 2X9QA 2VYVD 3HJAA 1W4LA 2ZBFA 5AW5A 3FZQA 4H7IA 1A9SA 4ZDIA 1FVOA 2CLFB 5LUBA 4C7XA 2P75A 1DC8A 2DR3A 3M2TA 1K92A 2BL4A 3B78A 4OU5A 2NPFA 2YJ4A 1NF8A 3CX6A 2WTXA 3CNHA 2RJOA 4JEIA 4ND4A 1Z16A 2IHTA 2IUTA 3ME5A 3U4GA 2GWHA 1RWPA 3ETLA 4OQEA 1P3Y1 1RS0A 1U90A 2GXQA 3D59A 1RTTA 3AHDA 5F1YA 1J70A 3L06A 2ISQA 3RTEA 1VRVA 3GARA 3LLSA 4GOLD 2HT1A 1KKUA 2D1YA 1D5WA 1CF9A 2XE4A 3EVEA 4LMRA 2HLDA 1L5QA 2F8SA 1K4YA 4CWAA 1TVCA 1W85A 1N36B 3E35A 3EDQA 4CRWB 1Z5ZA 4DDWA 3SBDA 2OFXA 4EPRA 4F4IA 1SOVA 3EGEA 2AOTB 4A2PA 1CERA 5D3QA 1LZLA 3BK1A 3C6QA 3JRWA 1U0GA 2QQ3A 2JVJA 4H7JA 4NNOA 4RVOA 3TZCA 5EXTA 1VG1A 1X1TA 5HTOA 1DFIA 1HYGA 2Z9CA 1PL6A 1QH0A 3P19A 3A1TA 4HNVA 2RI0A 1UMBA 2LGJA 1MMFB 2AL7A 4QZVA 4ND8B 1H1DA 3TIFA 4BS9A 1XROA 3IAS6 3L77A 4I9NA 1S89A 4UNNA 1L1EA 3LXRA 1WXFA 1XVVA 3RUDA 3UH0A 2W42A 1J0DA 2P4HX 2GPNA 2QMZA 2XXBA 5IDQA 3W5HA 4CIBA 1PD0A 4QYIB 1YK0A 2E0IA 3R7SA 4XWTA 1HG0A 3PHLA 2YHUA 4H4EA 2SHKA 2O7QA 4DQXA 2XLCA 1MGOA 3RSSA 1FYWA 3HG7A 4HDKB 2G88A 1W47A 1TFRA 1XLTA 2RHBA 3EQ8A 4ETNA 4I99A 1V2GA 1V5IA 1FQKA 2ETVA 4GQIA 2A1TR 2RGBA 5HR5A 2JGNA 1RT9A 5AHXA 1S3GA 2WG2A 1VHLA 5HQ3B 3HCRA 1NI3A 1HE1C 2GPYA 1T8TA 1B16A 1XB2A 4PF1A 2PD6A 2VAXA 4JUFA 4DDUA 3PFCA 3TNJA 4BB9A 3OX3A 1JALA 1SC9A 4MJXA 4Y1RA 3ZS9A 4F3KA 1ZNYA 1QIHA 1ZJ4A 5D1HA 1M2WA 3G02A 3NOQA 2C8LA 3OF2A 1BWSA 4GSKA 4V1CA 3ZTYA 1V8FA 5I3CA 1YBVA 4JJ8A 3RTCA 5L95A 3NJ8A 4F12A 4WNAA 2DQSA 4X7MA 3A4YA 5LB2A 4U19A 4B35A 1PVVA 3DLIA 3AKZA 2DUWA 4HG2A 4WRRA 3W04A 2HFJA 5B58T 3HHPA 1FDSA 3GLFA 1XZJA 1ZMXA 5EXXA 1KVRA 4PGHA 3U1TA 3OZXA 4G1EB 3RFVA 1CDDA 3S27A 1A8IA 1E5VA 2G25A 2IK8A 3D6VA 4KN9S 5ALGA 4LF5B 2F7SA 5K0TA 3DYBA 2ZKLA 2GJ9A 1NOIA 3JZMA 1B74A 3WBBA 4U8HA 4DIFA 5A5EA 3G9XA 3L0PA 4OYYA 1WUHS 1MQAA 3H17A 3A1FA 3NBQA 3NWEA 5T57A 3TNLA 4C29A 1IHPA 1GNRA 4GMDA 1Y7PA 4WNCA 1OZGA 2GCEA 4XRGA 4PYIA 3UT0A 1GUAA 4KE9A 3BVPA 2VQ3A 3GQBB 3LI2A 3GK3A 3MCUA 4LECA 4KN6A 3LP8A 1SKMA 2JFNA 3DULA 4LJ8A 3D5QA 1IY2A 5AK6A 3VR2A 2P6PA 1U9CA 2EAUA 1T9GS 3G8DA 1M1ZA 4B6SA 4TXMA 3SLLA 3FB1A 2I6UA 3M89A 4KDEA 4E32A 1L4FA 3WYGA 3HTXA 1ZJ6A 4Y8VA 2ZRNA 1X92A 3TL2A 1VI6A 2KBFA 2ZVJA 3HZRA 4QUAA 4WK6A 1UQTA 5EZYB 3SF0A 3IVAA 2XH8A 4JHLA 4MVYA 4AJ1A 3WIDA 2VXYA 3P9QA 4QASA 3I9JA 1P1HA 2VZEA 4HS9A 5GJWC 5G3ZA 1YUNA 3C1OA 1SUEA 3UJBA 3SICE 2OQRA 3E1KA 3P2OA 3PPIA 3UQZA 2ZBGA 4XD2A 2HCBA 1EKXA 2ERCA 1IJKA 4GF5A 1RJNA 4D02A 3FHLA 4WCFB 4PLZA 5EINA 1XPRA 1HX7A 2R6ZA 4IHAA 2DUMA 2RI1A 2BFAA 1Q7CA 4U7FA 3O2SB 2QTCA 3QYAA 2ZZKA 1KOLA 3RHZA 4CEJA 4G1BA 1OGIA 1NUUA 4FYYA 3VZBA 3BF8A 3EPRA 3LCUA 4DGQA 3GLHE 5ETJA 1VJ1A 4LQCA 3R5KA 3JWJA 4MRAA 2J5BA 2JAWA 1Q77A 2GZ3A 2IXDA 3EZXA 5DF1A 1ZGHA 2I76A 2GCOB 2J3IA 4MV9A 5AKLA 5HG0A 4TZ6A 2FCAA 1ZINA 3GJ8A 4A8HA 1NM5A 4FT4A 3M7IA 4X0EA 3GA5A 4Z7NB 2E49A 5B64A 2WU1A 1RLJA 1H93A 2XXJA 1IYZA 3PLRA 4N7JA 4DV6B 3WGHA 3D4PA 1Q44A 3IVMA 3U4IA 1E0JA 3HKDB 3C8MA 4Z7JA 5DHFA 5FFFA 4B84A 4ID3A 4HDRB 2F1HA 4E08A 2ZAMA 3MBIA 1BFDA 2J3LA 3IUSA 4Q7KA 1RJEA 1KZ7B 1UWLA 4BBAA 4G1VA 1P72A 1Y89A 3ZU3A 1O95D 1P4HA 4KGVA 2RGXA 2B35A 4GM0A 4MIKA 4LOLA 3AILA 2ZSFA 2B5VA 2AG6A 4RX1A 3ZK9A 1PSDA 2HRRA 3AUKA 5EHGA 2IGBA 3FVRA 3I9NA 3PD0A 4IYJA 4KAAA 1OF1A 1C7RA 3D43A 5EE3A 3CUVA 2W4MA 4I3HA 1ML4A 3ZHXA 1T1RA 2WSSD 3C3XA 1F4PA 2DE0X 3D9QX 4YMWA 3PDJA 2WC1A 3R75A 5LOVB 1ZGAA 3E22A 2FYTA 4LX0A 2BCJQ 2Q5LA 1FZQA 3CW2A 3ND9A 5A4AA 1U1IA 4IHJF 3WG9A 5ITVA 1KHTA 2QTNA 3D6JA 4MQ6A 1ZIYA 4WKBA 5DX0A 4Z2YA 4EMBA 1THGA 1XNJA 3GGOA 4AIIA 1QHXA 3ISVA 5DI3B 1CRZA 2IYWA 4FGJA 3OG9A 4B71A 3K16A 4DRYA 2B92A 2QD1A 4G1UC 2CSXA 1E1QA 1UPTA 3KSRA 3P8ZA 4IMRA 1KEWA 5FBQB 4F8EA 2JLXA 4JLDA 2CF6A 4IIBA 3ENZA 5ERGB 3D3KA 3BK2A 3DWFA 2W98A 3H5AA 3TECE 1FYEA 3DD1A 3WADA 1SIOA 1VM6A 2V6MA 4U6SA 1UINA 4QEKA 1T0IA 1MJFA 4IEFB 4X6YA 4YV1A 2TMDA 2PX3A 1ZSNA 3EW9A 4GOOD 4UXJA 4PWYA 4RDXA 1PGJA 1R0BA 1GFIA 3OQHA 2EBFX 1H5NA 1FNSA 4FZRA 4OLAA 4IHKA 1J6UA 1XAGA 2J9FA 2P4QA 3LKBA 3GBVA 4A6DA 4EHIA 3NHYA 2W93A 3UTCA 1J8DA 3ZBTA 1CRLA 1NFRA 2JFYA 4Y30A 1UFVA 3AJMA 1OAAA 2GLUA 1E9VA 3WK6A 4N40A 3IIEA 4L6IA 3L0CA 1L4YA 1ISPA 3N7AA 3SDZA 2CDCA 5JH7F 1BFKA 4RGBA 2BMAA 3D6MA 1KO8A 2ZI5A 3JQAA 4Q3LA 5FH9A 2BKVA 2YKGA 1K3TA 3HS3A 3L41A 3P5BA 1QQTA 1OI3A 2E4AA 1R7RA 2PFSA 3GQBA 3O7WA 3I0ZA 4PLYA 1GQSA 1JAYA 1Z47A 1W5BA 1GPH1 3GVHA 2I7TA 3KSBC 1XTSA 2PYIA 1C8KA 3C4VA 3PC6A 3PXCX 4CM5A 4ZV7A 1OVGA 5FUMA 3N59A 3ACDA 3NGLA 3MYYA 3O3MB 1DOZA 3VUFA 1TO1E 3AVQA 4QOJA 3X0DA 3L01A 4BRUA 4RKEA 5J2UA 4HC4A 1WR8A 1K6MA 4UE6A 4YCS