3ADDA

Crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 3)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
251
structure length
251
Chain Sequence
HHHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENKNKNNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
publication title Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 83
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3addA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3addA01
2XNSA 2PZEA 3AKEA 4LYFA 2G77B 1TF5A 2DY1A 3HR7A 1R8QA 3L0SA 2CCJA 2J7PA 2QGZA 3IKJA 3KXIA 4JKIA 4UJ3A 1WB9A 1NNEA 2WZQA 3U7HB 3IBGA 4DT1A 1BIFA 1IM2A 2P5SA 1E9SA 2Q3FA 4CZ2A 1Z2AA 4MKGA 2BEJA 3GLFB 3QBTA 4HUQB 5EP3A 2CL0X 1GAJA 4A9AA 4YXWD 2F7SA 1SVOA 1TX4B 4MUAA 5FPYA 5KNCA 2GCNA 3AF2A 3BFXA 1F5NA 3K70C 1RRFA 1VYTA 4B71A 2HJGA 3AVVA 2VHQA 5KSPA 1D5CA 1NN1A 1K8RA 4RZUA 2J7PD 1TAGA 4Q1CA 1UDWA 1GRNA 1T5IA 1JQLB 2ZAMA 3ASZA 3NEJA 4N0EA 2IEZA 1R2QA 2RGGA 3L0IB 2HCBA 4P31A 5KNDA 1RJ9A 4OK6A 1DPFA 1X1SA 4JL6A 2FH5B 1UBEA 2BDTA 5AWFC 1N5IA 1YZUA 2ZSEA 1HT2E 2VHTA 1XPOA 1KO7A 2REOA 2ZM5A 3LLUA 3MWLA 4A36A 6Q21A 3IILA 5EUMA 1XJQA 3P4YA 4XTCS 1RVDA 4Q5IA 1FZQA 1UDXA 3AF1A 4C0SA 1OH7A 5FTJA 3DMDA 1GKUB 3EWSA 4HEJA 1DELA 1YR9A 3OE7D 3KKMA 4TZ0A 1KKMA 4Y0AA 1SKQA 2K5UA 3AP1A 5AUOB 3MG9A 3QENA 2C98A 3CF0A 3K0AB 2BBTA 5JZVA 2O52A 4MYUA 1K5GA 4BLSA 4TL8A 2VF8A 2ZJ8A 2RHDA 1W5SA 4PHTA 1NIPA 4TL9A 2G6BA 5L3QB 2GK6A 1UFQA 1T0HB 1CKEA 4GZMA 4F38A 3WYFA 2F3RA 3U7FB 5EXPA 1CJUC 1QHNA 1N6RA 1P4SA 4LY6A 1FL9A 1ZAKA 1RYFA 3KB2A 2PH1A 4JYCA 4HLQB 4FWTA 1I4LD 2AWOA 4GP7A 1E98A 1COWD 2GZHA 2WBLC 1YZQA 2ZSFA 3D31A 3GLHB 1HA3A 2QROA 1RC8A 3R9WA 3JZMA 4C7OB 4B6EA 5C1BA 3GFTA 3OFND 4WW0A 4IDNA 3ZZ0A 3TUZC 3GLIA 2FSIA 4R71A 4HZIA 1P9RA 5G53C 3RDPA 3WMEA 4GI7A 4O3MA 1RKBA 5JWRA 1UM8A 1KSFX 3LY5A 4HZUA 1E1RD 2CK3A 1FUUA 2F1RA 3EXAA 4GPTA 5J47A 2HLDD 2IS1A 1FP7A 5CM9C 2YVUA 3NVAA 3REFA 1VCOA 1XMVA 2GNOA 2GKSA 2ONJA 1FNNA 3VX3A 1DAEA 1PLLA 4QFMA 4TLEA 1QRAA 3TKLA 3IPYA 2BBSA 3Q85A 1EWRA 4M0LA 1F2UA 2JLVA 2W58A 4DVGA 2R8RA 3MCAA 1ZP6A 4ON9A 2KBEA 2ZI4A 1XF9A 3UXMA 1JJ7A 4QHSA 1EX6A 2J0UA 2ZRNA 3QUSA 2QPAA 5KSYA 4JBWA 3NC0C 2CK3D 2IUTA 5JBQA 5TMPA 1WCV1 1E9EA 1E2FA 4NYJQ 4M1MA 1W0JD 5TB5A 2D74A 4H9GA 4GL2A 4BEBA 1IY2A 3UMSA 1IONA 2XEXA 3HDTA 3VU9A 2Q6TA 2OLKA 1U0LA 2ZYTX 3PUXA 4PZYA 4AI6A 1M7BA 5FL3A 3QXSA 1FMJA 3C8UA 2ZRMA 1UJ2A 1S9HA 1Z22A 4TL6A 4JLDA 3D7MA 2QAJA 1KIMA 4MGKR 5E95A 4WZBE 2ZTSA 3L43A 3R9IA 2IBMA 3QY0A 1SVWA 2DPXA 1QG4A 3K70D 1L7VC 4ZPXA 4HDQB 5E4FA 3FHCB 2XB2A 2AN9A 3A37A 2DFTA 1AKEA 3KUDA 1KI4A 4WZ6A 1XU4A 1AS2A 4A8JC 1GKIA 3A1TA 1R7RA 4G3XA 1U8ZA 5IHPA 1VDZA 2JJ1A 3SOPA 4JVNA 5JLJA 5DI9A 4E03A 4ZDIA 2PBRA 1IXRC 4D4KA 3BXZA 2C77A 2QI9C 4N3NA 5DLQC 3QPUA 2H7VA 2FG5A 3FKSA 3LX5A 2QU8A 3A36A 4ILEA 1Z2CA 2G0TA 2QRZA 2OUKA 4HB4A 4NZYA 2WVJA 4K81B 3W9YA 1Z0FA 2E1RA 1MKYA 4Q47A 1TF7A 2REBA 3CWZA 3TR5A 5DHFA 4K8OA 3I72A 3WY9A 3FFAA 4P4SB 1VCMA 4WOPA 1KY2A 3F0TA 1G7RA 5FBLB 3WYAA 4CEIA 1N6HA 5H1YA 4Q7LA 3B6EA 2J45A 1NBMD 5A5GA 1OXVA 1G64A 5CK5A 4AIIA 1NP6A 2NQ2C 1H65A 2CCGA 2OSBA 4G5GA 4HB2A 1CF4A 2H1LA 5BQ5A 5B30A 3L82B 1XMIA 2QM8A 2V4ZA 4NTZA 1H8ED 4TLBA 3FKSD 4MRSA 2ZRKA 1Z6XA 4KVAA 4DLVA 1PUJA 2VIIA 4DCNA 3AV0B 1PVOA 5A4JA 1IY0A 1CR0A 5JSZA 4AKIA 4UJ5A 2OAQ1 2J87A 1W46A 4C0AC 3A58B 5DE3A 4EPXA 3EZFA 4KCGA 3O47A 3UK6A 2PL3A 2ZYUX 2J41A 1GUAA 4D81A 1RIFA 4JSTA 2AKYA 1KTVA 3IIJA 4XD7D 2YC2C 1S2MA 1FX0A 4LSGA 1SVIA 3LBHA 3RRZA 1XTQA 1ZINA 2XTMA 1YZLA 4IRUB 2JASA 2DFKB 4PO8A 4LC1A 3S1AA 5JECA 3EASA 2FU5C 4LC0A 2QBYA 1MOZA 2WTUA 2NG1A 1E9FA 1NKSA 4JL5A 1XMJA 2C2HA 2IYXA 4MGZR 5FUWA 3QKSB 4DLZA 3KXKA 1W0KA 4HYYA 2ZJ2A 2DB3A 4DUGA 1D2NA 2WMNB 2GILA 1X8KA 4NPHA 4A0GA 4LWZA 5DN6A 2ZJAA 1IJEA 3GEEA 5EE0A 4H1VA 2FA9A 1LNZA 3PEWA 3QOFA 1U99A 5GVRA 1DAHA 2R2AA 2OCYC 3QVVA 4RD0A 1Z6YA 1T3LA 4TL7A 3AP3A 1NKTA 1E79A 4HAYA 3Q8XB 4FMDF 3BBPA 3W6OA 1E2DA 1L8QA 1RRPA 1TPZA 1VG0B 5JRJA 2G0NA 1ANKA 1I2MA 2ZUDA 1OH6A 3EPJA 2YNMA 3MGCA 3T1TA 3LQRA 2WWIA 1W0KD 3PXGA 4OQMA 3SFVA 2GBLA 1N6PA 1OV4A 2MMGA 4GSYA 3I5YA 1JJVA 4A8JA 2WJYA 4KFSA 4QGAA 3MMPA 4AKHA 2B92A 2GCOB 4PFSA 2EFDB 2FFHA 4BLOA 1QHHA 2IS2A 3JVUA 3HR8A 1SXJB 4DCVA 2A78A 5B58C 1D8TA 3I1FA 2D7DA 2GVDC 4GT1A 1BH2A 5KU1A 2GDJA 1RE0A 3AGQA 3WMFA 1J70A 4Q4HA 1N0WA 4DLRA 2FPMA 3CPJB 1XXHA 3KZ1E 1ODFA 2JJ8A 2X19A 2ZE7A 3EZ2A 4YMWA 2NMVA 2IXFA 1TUEA 1KJYA 2H92A 4B44A 721PA 1JALA 2BOVA 1R0YA 1UKYA 3KL4A 4NYMQ 1A7JA 1N5JA 4A0HA 3ZVNA 5JWOA 5IK2A 1TUIA 4LJYA 4E07A 4XVUA 3BORA 3VKWA 1OHHA 3OEHD 2P3SA 5HCIA 4G5OA 2RAPA 4IXMA 2P6UA 5JHGB 2EFEB 3WP0A 2WOJA 1CJTC 3GQBA 1PUIA 3IQXA 1M7GA 1XFAA 4DT1B 3C16C 1GOTA 2XNDD 4LJ7A 5GADl 3L2OB 1JI0A 2KSQA 3ZS9A 2IS4A 1MO4A 2QRNA 4RD1A 3TAUA 2FF7A 2VEDA 4ACAA 2BMEA 4IW3B 2OCPA 3EZ6A 4HB0A 1XD9A 1KSJA 4DDUA 2B8TA 3LW8A 4LYHA 4MRRA 4MUBA 1E2HA 4LV8B 2I4IA 4RD2A 5H68A 5J40A 2ZI5A 1Q57A 2FDCA 2F9MA 1ZD8A 3QG1A 3GEHA 4POAA 4ZKEA 4AWXA 3NWJA 1E2KA 3GEIA 4FMCF 4D0LB 3AKCA 5AR1A 4Q1DA 1MO3A 4JLVA 4L4UA 2V6JA 3GJ7A 3AUYA 4M9SA 4II7A 1CJKC 1R8SA 2ZI7A 3PIRA 4B6FA 3SJCA 2B7CA 3U7EB 3W3AA 1KK0A 1RJ9B 1WDTA 4L16A 3NHAA 3X1YA 2ZE5A 3AM1A 3IGFA 5B64A 4WIAA 1KI2A 5CB6A 3MD0A 2KWIA 4RJLA 1NLZA 2TMKA 4D2IA 1YZNA 1TF2A 3A1VA 1AM4D 4IOLA 1NF3A 4X8HA 3LWNA 4Y0VA 3LBNA 4Z8XA 2CLCX 2HXSA 1XTKA 5C46F 5E7IA 3ZJYA 2C9YA 2IW3A 3QNUA 3AF0A 2ZRAA 2OFOA 2J0VA 1G7SA 4NMMA 3GLGA 2GF9A 2YYZA 3HPQA 2QMEA 1P2SA 2EYQA 2EFCB 5KHOC 2CLSA 4BPBA 3DOEA 4M1YA 1AJEA 1E0JA 3CH4B 1ZM4A 3GJXC 4LJ9A 1XPRA 4URYR 4A4DA 5FI1B 1F6BA 1CS4C 1LFDB 4C4PA 3BS4A 1YRBA 3TR0A 3PFIA 4DJTA 3THOA 3DKVA 3V9PA 5AJZA 3J81k 1Z3IX 3WBJA 2LKDA 1P5ZB 1V5WA 3OAAA 1RPZA 2Q9CA 2ZE8A 5HKKD 1ZVQA 2C8VA 4P4UA 4Q1EA 3SYKA 3NBZC 1G6OA 2ZRBA 2R6CA 1P9NA 1YU9A 4NU0A 3R8CA 1W48A 2WJJA 3L0PA 2LWIA 2BBWA 5JFGA 2N42A 4LHVA 5B57C 2ZRFA 2UZIR 3EA5A 1M2OB 4Q18A 4QC2A 2ZVPX 1Q1BA 3VFDA 2W0MA 2QTVB 2G3YA 3GLIB 3BJIC 1VKJA 3RYTC 1A82A 2MSCB 4LOAA 3KJEA 3RVBA 4U7DA 1VYVA 3ADBA 2LCFA 3VNVA 4HZUB 2O8CB 2ZITA 2XXAB 2IK8A 1WP9A 1E32A 3SBDA 1A5TA 1DAGA 1N5KA 2ZJYA 2FGKA 4HLCA 4PC3A 5K8UA 2VO1A 3ADKA 4NCJA 3TH5A 1ZIPA 4KLZA 1ZCAA 4X8LA 5J4LA 4B33A 4IDPA 3BB1A 2E87A 1OXTA 1LW7A 4RD6A 1P62B 3B82A 1F2UB 3VR5A 5KPJA 3K09C 4PPQA 1R4AA 3QKTA 2W00A 5AJVB 1RFLA 4IVQA 3TBKA 4ITRC 4D0GA 3AVWA 4M53A 2H16A 5FOUA 5BWMA 3EPLA 3OEEA 3FOZA 1Q44A 2A3RA 4Q7KA 2ZS9A 3UPUA 4Q9HA 2O8BA 2GEUA 2WJHA 4B3BA 3IEUA 5FOTA 1DBSA 3B8HA 3BFKA 3OESA 4DZZA 2AXNA 3VMFA 2JDID 3D3QA 2A5GA 2OO7A 1U8AA 4N0DA 5JEEA 5KSOA 4HAUA 3VU9B 2RGBA 1HEIA 5FL7A 1Z6AA 4M1KA 3X1XA 1PLJA 1SZPA 1QHYA 4PZLA 2AKAB 3Q5EA 4GOXA 1KI6A 1OIXA 4W5JA 4QJ3A 3N70A 5LDDC 4NYIQ 4Z1MA 1X8JA 4Q00A 4RCZA 4TQAA 1U81A 3ZQJA 1KO1A 1NVVQ 2QE7A 4GP6A 2O8FB 3ONWA 1SGWA 4XWKA 3RC3A 4B75A 3H2YA 4PHFA 2QMUA 1ZIOA 4KBFA 5EQTA 2WV9A 3X1DA 2OBMA 5L3RA 1OPXA 3A4LA 2UKDA 3AVPA 4LJAA 5IT5A 2FFAA 4OI0A 3THYA 5DO9A 4XIGS 2CE7A 4KI0A 3LO5A 5DISB 3F5FA 1ZM2A 1G4UR 1GITA 3K0FB 1G20E 1JEDA 1T3SA 2GAAA 2ZXUA 1OB5A 4B48A 3CUEF 2QA5A 4ZCLA 1G4AE 4AYTA 4BFTA 2GRJA 2GWHA 1KZGB 4C0KA 3QKUA 4HATA 4OI4A 3RRNA 5D3QA 2OT3B 2NPIA 3QEJA 5DYGA 3RLFA 3Q5DA 4OI2A 2EU8A 4HDCA 1JEEA 3X1ZA 4XJXA 4W5HA 4CEIB 1DG1G 1LB1B 5TXGA 1XD2A 2OG2A 3WHLA 5CIWA 1P6XA 2GJKA 1E9RA 2J59A 4JVMA 4OJQA 4MRVA 2GEDA 5JCZA 2H17A 2NO6A 3B60A 3CM0A 4A15A 1OT3A 5CK4A 3WRYC 2OZEA 2R6FA 2UVQA 5EP2A 5JI3E 2BKEA 4Q4AA 4I81A 5F2EA 1CR1A 1NMYA 2ZI9A 1IXSB 1JBKA 2VSXA 4F7WA 1AZSC 2ORVA 1CP2A 2QMHA 3LBIA 4OHYA 4QGHA 1UBFA 3LXRA 1WE2A 4H1UA 3IIKA 2FV8A 1OFIA 1HE8B 5J5CA 3TSOA 1OYWA 4AURA 5HZHA 4YXWA 3KTAB 3CWQA 4JVLA 5CJPA 1UKEA 2F1JA 1TEXA 5DHAA 5EP1A 3QBVA 3KKOA 8OHMA 1Q20A 3EARA 1PV4A 1XB2A 2PMDA 1KK1A 2VHJA 3LH5A 2ATXA 5BXQC 3K09A 3ICQB 3CRRA 4C30A 3FDIA 4V0LA 4OQXA 3DL0A 3DKPA 5GJBA 1P72A 3JVVA 1XTJA 1EFTA 2JLRA 1HH4A 2Z43A 3BAFA 3N2IA 1TQDA 4QM6A 3S1AB 4UXHA 3MAAC 3LW7A 121PA 2D06A 2QQEA 3PV0A 2WAXA 5K8TA 2NZJA 4KO8A 4I4LA 4OQNA 4ACBA 3FB4A 1KSGA 1WF3A 4F93B 2B7BA 5CJ2A 5KPDA 1XDBA 4LCBA 4V0OA 4BECA 3E5HA 3AVYA 4URXR 2G1JA 3HU3A 1X86B 1ESNA 3NC1C 4QJ4A 2W0SA 3CB4A 4DLUA 1GVNB 1JB1A 5FBRB 5TY0A 5KDDA 1US8B 3AKDA 3FFBA 2IHBA 5JWHA 1EFCA 4US0R 2BKUA 2KE5A 1ELOA 3OE7A 4QM7A 4ESHA 3K0CC 2QT1A 3CONA 1W4AA 4A2PA 2GXAA 2RH5A 3EZ7A 4XTRA 2A7QA 3EPKA 2WKRA 2AK3A 4J0QA 1N6LA 3CNOA 4JJKA 3BH7A 4A1FA 3UG6A 3ZDQA 3I61A 5A0FA 2IXGA 3BD9A 5K8LA 1XP8A 2CJWA 2ZETA 4JSYA 1Z0JA 3KXLA 4DEXA 1KO4A 1W2HA 1PJRA 3F8TA 1IN5A 1XTSA 2CVFA 2CXXA 4FINA 2XSZD 4CW7A 2OAP1 2WAYA 3CKLA 1Q0UA 2YOFA 4EQ6A 3AVTA 2D4HA 4RFVA 2OBNA 3EW9A 3Q9LA 3FVQA 4WVFA 3CH5A 2VHCA 5FTKA 2BMDA 2R6GA 4Q4HB 3QSYA 1COWA 1GNQA 3C41J 1CXZA 4Q66C 1NLYA 3AEZA 4NCNA 1S0UA 2J1LA 1ZBDA 1ETUA 3DPUA 4KFTA 2GJ9A 1YKSA 2ZRHA 3RS4A 3OFNA 3PENA 1U98A 4PTLA 2KB0A 1NN5A 1T8UA 2GF0A 4TYPA 3RHFA 1OW3B 3SHFA 1Z0KA 2ANCA 3ETLA 4CF7A 2QG6A 2HJVA 5M04A 2QTFA 3MJRA 3QXHA 2QENA 1G291 3ZVLA 4UKDA 4QJ5A 1OH5A 1E1RA 2QORA 2ZJ5A 1D9XA 1E6CA 3DOFA 2HLDA 3K9NA 1W44A 4QG7A 4ASUD 3I73A 4HB3A 2BWJA 2QMOA 1KI8A 4B3DA 4W9MC 1W5TA 3F3YA 1N6KA 2MSEB 3W5JA 3MWKA 1J90A 4Q48A 3KQKA 5LD2C 2PX0A 3WXMA 1ZUHA 4YDHB 4YONB 3TLXA 1YZGA 2GZAA 1S96A 3CF2A 1U2RA 5DI3A 4QBFA 1BYUA 4BLTA 2FWRA 1OKKD 2G9NA 1KDPA 1ZNYA 1OE0A 1CLUA 2Z5FA 2V8OA 1NVWQ 4PQFA 3BB3A 4CT4B 3AVUA 1UEIA 4EJSC 5EE9A 1FQKA 4EPRA 4YMUA 5AUPB 3RC8A 1TU3A 2CCKA 4L9SA 1E2PA 3SU8A 1U9IC 2PLRA 3TSWA 1M74A 4QOSA 2NO1A 4KFUA 1W0JA 2O5VA 4FCWA 3SC3A 3GJ3A 5FH9A 5G3ZA 4C0HA 1W36B 4TMZA 5D3MA 4AG5A 4ZCIA 3EWAA 3R8FA 2HYIC 1BYIA 1VMAA 2ODNA 1UBCA 2QZ4A 4CEJA 3GJ0A 1YZKA 4PQRA 5JCPA 5TARA 5AK0A 1Z6TA 1Z8FA 4DLTA 1ZM7A 2IYVA 5FTMA 1J8YF 4JLNA 1NL3A 3GLGB 2EFGA 1XTIA 2V6IA 4B2PA 4TMVA 3SJZA 4M21A 1Q12A 2QUZA 4LHZA 3QI2A 3T1QA 3GJ4A 3CO5A 2ZSBA 4Q19A 5K8IA 2YHSA 2VA8A 5HZKA 1OFTA 3QF7A 1ZD1A 3EC1A 5H8WA 4BFVA 1S4QA 2FSGA 3KJGA 2AD1A 5SZJA 3H86A 4TLCA 5LBIA 3RANA 4PSKA 5EE1A 2F9LA 1PLKA 1IAQA 2FEOA 4CT5A 1RRGA 4PSAA 1KMHA 4HAWA 4WA7A 2WWHA 4HAVA 3ND8A 5CM8B 1Q1ZA 1E9DA 4Q01A 1YVDA 4X8MA 3U3MA 2V3CC 2P65A 1E99A 2V54A 4AKEA 621PA 3LV8A 3THWA 2C99A 3IDQA 1CR4A 1L4UA 3X1WA 3QVUA 2YKGA 2A30A 4LZZA 4K46A 1ZC4A 3CBQA 3DZDA 3NBFA 2AHOA 3KQLA 4F4JA 4AYXA 1ZM9A 4A2QA 1NBMA 4P3YA 2GCPA 4OK3A 1CTQA 2PLFA 4NYJR 1YE8A 2PCLA 1E9CA 1L4YA 2FX3A 2JLXA 1E1QD 1E0AA 3EIHA 1QG2A 5IDVA 4B3XA 3NEYA 3NBYC 2FOLA 3AQ4A 4CRWB 1H8EA 1RZ3A 2QM7A 3QE0A 3VR6A 3GFOA 2ODWA 1HYQA 4YC7A 1DAKA 2YV5A 1Z08A 3ASYA 3VR4A 5GJVC 2D7CA 4WZAE 3AH8A 2VPPA 5HE9A 1XEXA 1E2MA 3A4NA 2AR7A 5EE3A 2DCUA 3KUCA 5L3SB 3U44A 5DH9A 2PMKA 3KJHA 2R65A 1UEJA 1J99A 3PUVA 4Q7MB 2OXRA 1ZRHA 3U4QA 1VIYA 3DEFA 1E9BA 1NBME 3KFVA 1AS0A 1AGPA 4XD7A 2HT6A 4DWJA 1LF5A 3JZAA 1WMSA 2O8BB 3PUZA 3EZ9A 5LB2A 3T5DA 5J4KA 2WIAA 4EJSA 1LVGA 4NONA 4UXJA 3ZIAD 2GVZC 4JVSB 4DB4A 1AGRA 4FN5A 4KSCA 3KX2A 3W6NA 4ZV4A 4B3GA 1U9IA 2WJVA 4DSUA 1TQ4A 3SJBA 2GJSA 4DB2A 4MKHA 4NCKA 4DCTA 3B1YA 5KOYA 4KLNA 2PX3A 4B74A 5FBQB 3IEVA 5CDFE 1W4CA 2XJ4A 4W5WA 5KSZA 1BOFA 1IBRA 5G41A 4XWOA 2HDNB 4PR0A 1E2LA 3NDPA 3U6KA 1CJMA 1G8FA 1N6OA 2N1BA 4LBYA 4M2LA 2ZR7A 4S35A 4F91B 4YMSA 2G88A 1N2CE 1EXMA 1ZYUA 1I2DA 5CLQA 3NBXX 4OQFA 2FPKA 1OJLA 4MITA 4OQLA 3W8NA 1AZTA 3P32A 3RS7A 3QF4A 2OCAA 4Z8YA 2DR3A 1JNYA 3TJZA 1XNJA 1ZNWA 1R5BA 4LJ5A 1Z06A 1SKYE 4TMXA 1G7TA 1T9HA 1ZUNB 1G3UA 1ZNZA 3THYB 4YQFA 1U90A 1EGAA 1SVSA 4BRUA 2MSDB 4C3ZA 4LJ4A 4Q4JA 3AVQA 4KV9A 4LYJA 4BLRA 4RD3A 4GRAA 1OF1A 1ZM3A 2JJ2D 2NPFA 1G8GA 2Z83A 5L8VA 1LV7A 3THXB 3OIYA 3QKRB 4D82A 4WXPA 4TYQA 5GJWC 4E22A 5BN4A 2ZYWX 4ZI2A 1IOZA 1HY3A 1NJFA 3T12A 4D6PA 4AKGA 4AY2A 3LFUA 1Z0DA 2OESA 2QPTA 4PPFA 4DDWA 2ZYVX 5G40A 3ZD6A 4IOJA 4M4SA 4LYAA 3RABA 1G21E 1ZMXA 2GK7A 5E7MA 1IJFA 1G16A 1XD2B 2HCJB 3AF3A 1E94E 1Q1EA 1O87A 4HUQA 3B1VA 2X77A 2QSYA 1EK0A 3OEHA 3EA0A 3ZS8A 2FN4A 2VL7A 3IO3A 3NTUA 4RZ2A 4LPSA 3AP2A 1DARA 1YR8A 821PA 1E2IA 3FMIA 1G3MA 4Q4AB 5TDHA 4C9BA 3I4LA 2ZEJA 2XNDA 2OE2A 5JRZA 4BRWA 1DAFA 3W6PA 2CNWD 4A6XA 2RGDA 1SVLA 3CW2A 3M0EA 5ANRB 1Z6GA 2WM9B 3LD9A 1E2EA 1R0WA 2Z6VA 3CR8A 4QBIA 2R44A 5B2ZA 5E3HA 1ZU5A 2J0SA 3UIEA 2CMKA 3IO5A 4LBZA 1FQJA 3KQUA 3ZVRA 3UWKA 3GLFE 3L8ZA 2R9VA 2IYYA 3KDSE 2DWQA 5FPHA 2NGRA 1ZD9A 5FTLA 5F9FA 4BFSA 3T1VA 3UMRA 1NN0A 4GMXA 1XWIA 3EG5A 2J3EA 4TQUS 4MYHA 1UKZA 4KODA 5LPNA 1KAOA 1QBKC 1AS3A 3EPHA 3DM5A 4PHGA 2WPDD 1JR3E 3NXSA 4U5XA 3LNCA 1NVXQ 1JR3D 4OYHA 3RAPR 3IIMA 4MYCA 2VH5R 2CHQA 4AG6A 1QVRA 1GL7A 1CULC 2QL6A 2QGNA 4V02A 4XH9B 4EFMA 4KYUA 1W7AA 4BUJA 4TWZA 1IQPA 4CDGA 5L3QA 3SQWA 1X8LA 2GA8A 1G1MA 5HPYB 2PJRA 4URUR 2W6ID 3BK7A 2VP6A 1VCNA 1FW6A 1VHLA 4X8OA 2C03A 2G1KA 2I1QA 2OBLA 2GEVA 3W5IA 4Q02A 4DLSA 1TNDA 1KAGA 4G5QA 4U00A 4XSHA 4NH0A 1GL6A 3FWYA 3N2EA 1XBTA 3FMOB 3KKNA 1OIVA 2VQSA 1Z83A 3TIFA 3IHWA 3H1TA 1FPMA 3G82C 1NG9A 1TADA 2FJUA 4P33A 4MRNA 3EIQA 3PQCA 4L15A 4O2RA 1W49A 3I5XA 4JIMA 3RWMB 3I62A 2ZUCA 3P26A 1E4YA 2ZRPA 3GJ8A 3WYGA 5HKKA 2QN6A 1ZC3A 2VP5A 3KJIA 3ZGXA 3E1SA 3LVRE 4OHXA 1MO5A 2JLWA 4EQ6B 4BZXA 2QP3A 4JBXA 2IYTA 4S2EA 3RRYA 2OEPA 4JLJA 2DWPA 1E3MA 2JEOA 1F2TA 2WSMA 2XX3A 2IC5A 2G83A 2HEIA 4M1OA 3WHKA 1KYIA 2BCJQ 1P7CA 4C0QC 3FHOA 5AJYA 1EESA 2YWHA 2QAGC 1EFUA 2WIBA 3WBKA 2P5TB 3LA6A 1D9ZA 2FSHA 4LUCA 2AX4A 2QY9A 1TQ2A 1DOAA 3GLHE 2D2EA 2XOKD 3N5CA 1MRNA 1T8TA 3DZ8A 4V0ME 5CYPA 2FEMA 3REGA 2F1HA 4TN1A 4BEJA 4Z51A 1IXZA 2P6RA 1LS1A 1MT0A 3WNCA 1G3RA 3K53A 1BO6A 1EFHA 4R98A 4URVR 1P9WA 1JECA 3NIBA 4PAQA 1R5NA 1GG2A 2V7QD 3A1SA 2CVHA 2E9SA 2XTZA 4QBGB 4DXAA 2HF9A 4KXFB 4RY2A 2OM2A 2A5DA 3SR0A 5C2JB 1XX6A 1IN7A 1G6HA 1AIPA 2IWRA 1XEWX 1XCPA 4LHWA 4EPYA 2IL1A 5P21A 1G5RA 2FFBA 2CDNA 4HDOB 5F98A 2IYUA 2X2FA 3CPHA 2GAOA 2FSFA 3AVOA 3U6BA 2ZANA 3DDCA 2C9OA 3MUFA 1SHKA 1W1WA 3C7KA 3PG5A 3KQHA 2IYSA 5FBWB 3SYNA 3EC2A 1KI7A 2ECKA 4PANA 2HUPA 4YLGA 1CEEA 2WICA 1AA9A 3DHWC 2IUSA 1NSTA 2VSFA 4D0NA 3AVXA 1M1YE 2EFHB 2JDIA 4UXIA 4OI1A 1E4VA 2QT0A 5KUTA 3CX7A 1Z5ZA 1HV8A 1NSFA 3VR1A 1BKDR 2YINC 2QSZA 4B34A 4DIDA 4CEJB 2VLIA 2ODBA 2KBFA 1CIPA 1FNMA 4HAZA 1OB2A 3OHMA 1DEKA 4HAXA 2O8DA 3P27A 1EX7A 2J0UB 4LK2A 4Q7JB 5KNBA 2GXQA 3K70B 1KHTA 4PC7A 3B5JA 2ZVQX 3ADCA 3GD7A 1V43A 4FWIB 4LBVA 3UWOA 3PEYA 2OHFA 2V9PA 4MQBA 2IS6A 2W2XA 4DLXA 2OLJA 3LDAA 3OIVA 4QL3A 1GSIA 3HWSA 3CNLA 4UNRA 2PZGA 3K0EA 3UATA 4QRHA 1ZU4A 2PZFA 5FUXA 3TQFA 3SEAA 1KMHB 1Z63A 5SZIA 2CE2X 2GXUA 2AD5A 2ZJOA 4TYNA 4URWR 4US2R 2YC4C 3RSOA 4LJ8A 1FUKA 2GJ8A 4RFSA 2PEZA 4OHVA 3KQNA 1NY5A 2ATVA 3W34A 1OH8A 3C4JA 2FZLA 2GETA 1E9AA 2P6NA 4G5SA 3T1OA 3TSZA 3RS3A 4IOMA 1ZJ6A 5AJWA 5FOVA 2BBOA 2QAGA 4ZO4A 5FI0B 3OIWA 2XITA 5KDLA 4BLPA 4IDOA 2IT1A 4UNSA 2IX3A 1D2EA 3TQCA 4Q4LA 1W2GA 4IEEA 4NL4H 3B9QA 3ZZTA 3SN6A 2CL7X 1N5LA 2IEYA 4EPWA 3L8YA 2LKCA 3PEUA 4M22A 4DLYA 4BLQA 1G8HA 1VYUA 1XEXB 2HXYA 1TEVA 4XOIA 1GRQA 4QGGA 4NCIA 5EE5B 4BFXA 3QKSA 3U44B 4JJZA 3TW4A 3U4QB 2RMKA 3B2EA 4PSVA 3SS8A 3VR3A 1CRPA 1HQCA 1QVAA 4A82A 3U7GA 3TUJC 2DHRA 4MKIA 4TLAA 2YOGA 3WP1B 5J4HA 4DDVA 4TZ6A 1X6VA 4EDHA 4TT3D 1GNPA 1NVUQ 4EUNA 2Z4SA 4GNKA 4Q1AA 1JXOA 1KY3A 1E0KA 1NN3A 3NDBB 2DYKA 3D8BA 4I99A 5BYKA 4HUTA 1R10A 4EJSB 4MYTA 4ABYA 3G0HA 3D6TB 3LQQA 2QP9X 3KB1A 5JJIA 2CEAA 2EWWA 2HF8A 2WSSD 1LF0A 3TRFA 3PUWA 4ZDWA 4B76A 4E09A 3K8YA 4DIEA 2W6JD 2FMXA 3SYLA 3ZH9B 5JSZB 4ZKDA 2ZAOA 4NP6A 421PA 1U0HC 3MWYW 4M9ZA 1PZNA 4NDZA 4PAOA 1E2JA 1SULA 4ZDJA 1DAIA 4RZ3A 2NZ8A 2Q0HA 2KI5A 1P61B 1U94A 2ASEA 2H18A 2WJIA 3M1IA 4AYWA 2ZS8A 2VP4A 2Q21A 2GCOA 3NH6A 1WQ1R 1R6BX 4DEYA 1FX0B 3LX8A 4D25A 3C14C 3QF4B 2L0XA 2VYFA 1YZTA 3CZQA 1KNQA 2PJZA 1FTNA 3I8XA 2QBYB 1XZPA 3FMPB 1Z0IA 3Q7QA 2IYLD 4JLMA 5F9HA 1E69A 1JXMA 2R62A 3T06B 4F92B 2GHIA 2IF2A 3PUYA 2IXEA 4TMWA 4ZCMA 1G19A 3HYTA 3BOSA 4UNQA 4DKXA 4FI3C 4GBMA 1P3JA 2BC9A 3GJ6A 2ZRCA 4OBEA 4C2TA 2F6RA 1YR6A 2XSZA 2D2FA 4TTQA 5E7JA 3IUYA 4B43A 4RSGA 4Q9JA 4NE2A 2WOOA 2EWVA 2NTYC 1P73A 1SXJE 5FR2A 2WKQA 5EZ6B 1I4TD 1SXJD 1P2TA 4RVCA 5IF9A 4DCUA 1XPUA 1NRJB 4B73A 1VPLA 2AWNA 3GPLA 1XZQA 4JLBA 2SHKA 3W3ZB 1T5LA 3QIAA 3OIUA 1EFRD 2ZJZA 3CF6R 3O8RA 3RWOA 2A5JA 1X1RA 4A8JB 3R7WA 3PITA 4Z54A 2UZ3A 1II8A 1ZW6A 1M8PA 3CRW1 3QXXA 1QHHB 5JJKA 2A5YB 4ASUA 4L5BA 4M1TA 4PPGA 5BN5A 1CRQA 4BE7B 1H8HA 5CB8A 2RGCA 4LBWA 4QNMA 2FPLA 4EAQA 2WHXA 5FFMA 1R5OA 5JI2E 5GJCA 1AQYA 2ZU0C 4V0NA 1XXHB 2Y8EA 4M8NE 4B2IA 4MDEA 2BM1A 2VP2A 4M1SA 5SZKB 2WWWA 3ND9A 3L0OA 1OKKA 4JZKA 3VHXA 1P75A 3GFPA 3SZRA 1T4GA 5KTYA 4U02A 1MV5A 1S3GA 5TVKA 2OFWA 4HI0E 5TV2A 1JAIA 1HT1E 2CLDX 1N0UA 2ZRJA 2ZUBA 4LJ6A 4BGDA 2JIZA 2YZ2A 3H0KA 3Q3JB 5FUYA 1KOFA 221PA 2GTPA 1GILA 1T3HA 4CIDA 2O8EA 1H8HD 3OZXA 2C96A 4FD2A 4A92A 2A2ZA 3K9GA 1VG1A 4HSEA 1FOEB 1ZNXA 3TGPA 3VKGA 1LTQA 2RKOA 4JLAA 3CZPA 4PPNA 4LV6A 3QPVA 3M4YA 5DGXA 4ARZA 1MABA 5CYOA 3TAHA 1G9XA 4Q9KA 1VTKA 1IY1A 1BS1A 1O3YA 1HURA 1WRBA 3BE4A 4KAXA 4R9UC 5H70A 2C5LA 4B32A 4V0KA 2Q3HA 4LDJA 2ZROA 1F3OA 2X2EA 4R2HA 4DC9A 2BMJA 3FE2A 1G7CA 2JIZD 1SVKA 3DMNA 3BRWD 3ZLJA 1G3QA 1A2BA 1NLFA 4CEHA 1GIAA 3LAWA 2HV8A 1MR3F 1YRAA 2VHUA 1IHUA 2JATA 2IF0A 3MFYA 2OCBA 1E0SA 4TMKA 1S1CA 1AN0A 3DM9B 2ODEA 3VTKA 5HTKA 4D4JA 1FP6A 1X3SA 1DG3A 2ZU6A 2AL7A 3CR7A 3Q7PA 3SDZA 1E2NA 3VQTA 1F2TB 2O8CA 4HLDA 2XXAA 4MH0R 3G5UA 2O0JA 3K9HA 5FR1A 2A5FA 4PZZA 3PJRA 4TMTA 4D80A 4RD4A 2R6DA 2F1IA 2NOAA 3K0CA 1Z29A 1L2TA 4TSFA 4BASA 1TMKA 2PCJA 4TLDA 1Q3TA 1C1YA 2W2VA 5AUQA 4WAUA 4E5UA 1R0XA 3VKHA 3UG7A 3AB3A 4G1UC 1KO8A 3FGNA 3CRMA 3GLIE 2QNRA 2FZ4A 1E1QA 4C0BA 3HU2A 1N25A 2PT5A 4FCVA 4OHWA 5HR5A 1WBDA 3B85A 4GFDA 1AQUA 3CX6A 4GOKA 1BMFA 3AF4A 2YOHA 3R20A 4LHXA 2YWEA 3P20A 3I92A 3NHBA 3V00A 2ORWA 4A2WA 3SI7A 3HPRA 3VX4A 4ZIRA 4I1OA 4QHTA 4EFNA 3U61B 3B7GA 3IQWA 4TSFD 4IXNA 1CU1A 1KDTA 2PT7A 3GP8A 1RYHA 2F43A 1KI1A 2RGNC 2JLZA 4Q1FA 1J7KA 3T15A 2IYQA 3X2SA 2JLUA 2J9RA 1G18A 4Q9LA 1U0JA 2EVWX 3SJAA 4NHOA 5EXTA 5JS8A 4PX9A 3K1JA 3A4MA 2O8FA 3ZIAA 3U3RA 1DO0A 2ERXA 4P0TA 2IYZA 5ELXA 1KNXA 1C9KA 1BMFD 2D62A 1CR2A 5EXSA 2GBLC 4XVQA 5SZHB 1VIAA 2RGXA 3VR2A 2NO7A 2FE4A 1GRRA 1D2MA 5CITA 5BW8A 5FUVA 1G5PA 3PCRB 2O8DB 4A6PA 4PC2A 3OF5A 5IRCD 3NG1A 1IN6A 3K0FA 4IDHA 3FPAA 2XZLA 3I3SR 5DYIA 4F4CA 4RZXA 1XEFA 2GJAA 4DSNA 2JAQA 2QPOA 3P1JA 4JS0A 3K0SA 4C0LA 2HT1A 4M9QA 3LVQE 1S9DA 2ZI3A 4YMVA 1N6NA 2B6HA 2NO9A 1AKYA 1UKVY 4IOKA 3T35A 2P67A 2ZRDA 1SHZA 3NH9A 3SHWA 1XRJA 2DFLA 3ZD7A 3PR1A 2JJ2A 2BJVA 2I1VB 1FTSA 4F4IA 2V1UA 1DE0A 1KI6B 2H8KA 1N3BA 2IA5A 1F48A 3B78A 4JBYA 2VRWA 3U60B 1LY1A 2JJ1D 5EXXA 4D4LA 4N1AA 1GDDA 1W47A 5JMTA 4ZDKA 5DSZA 3TMKA 4RFSB 3SBEA 1M34E 5EZ5A 1TTTA 2EW1A 4NBSA 1S1MA 2XB4A 2VBCA 3WRXC 4G0NA 2C04A 3A6PC 4IEIA 1Q22A 2ONKA 2WWYA 1KI9A 2QAGB 2IYWA 2WWFA 1OFHA 1HQYE 3IBYA 3W8RA 5JHHB 2ZS7A 4KU4A 1HTWA 4TTPA 3KTAA 1XCGB 4MRPA 4BWYA 3AKYA 1G41A 4KBGA 3RRMA 2F3TA 3RNLA 5CLLA 4XSGA 1ESMA 2Z4RA 3RSLA 2H5EA 3QPWA 3WNBA 1I4DD 2CNWA 1ONBA 2WWXA 1J2JA 4YMTA 1OXSC 2ZRIA 1W36C 2ZQ5A 1W4RA 2D3WA 4CVNA 2FNAA 2VF7A 4IHQA 3U2QA 2FFQA 3O8BA 2GXSA 1DO2A 3ZVMA 3VAAA 3CPEA 3GLFA 1XCMA 4IFBA 3Q72A 1P2UA 1XMSA 3KKPA 1SVMA 4DHEA 5JJLA 3A1WA 1IN4A 1KZ7B 2P0EA 1QZXA 2RGNA 3GCGA 4YDSA 1US8A 1A4RA 5C18A 1VG9B 1YJ5A 3HYRA 4EIWA 5CDFA 3EAQA 521PA 3VNUA 3BB4A 4R2IA 4Q1BA 2ORIA 2WPDA 4P4TA 1HUQA 2RGAA 1QHGA 1GZSA 4AK9A 1JR3A 4JMPA 4NKRA 2BEKA 2CBZA 3FKQA 1P2VA 4MDFA 4AC9A 2BMFA 1M7HA 2CL6X 3U3OA 3TE6A 4R7ZA 5HE8A 1KMQA 1S3SA 1B23P 1G3IA 3BWDD 3CX8A 4DUGD 2W6IA 1GWNA 4JLKA 1GP2A 1JAHA 3E70C 4LV5B 4QNRA 5DN6D 2AXPA 1G8YA 4B35A 1KK2A 2C78A 3SE0A 1QHIA 2XJ9A 4JL8A 1A2KC 5FOWA 2XAUA 1WA5A 4JT2A 3IHLA 4RCYA 2ZI6A 1E79D 1VECA 1VCIA 1NMZA 3I32A 1GTVA 2N46A 4LX0A 3TK1A 3M6AA 4TYYA 2O0HA 2AFIE 1OYYA 4LPKA 4KYIB 3BGWA 3NKVA 1T91A 3K0AA 2VP0A 1T6NA 4BFWA 1E96A 1QHXA 2JA1A 2C95A 4US1R 2ZSDA 4BFUA 2NIPA 2IWHA 3C5CA 3RS5A 4I1SA 1W4BA 4I1UA 1RRCA 4BZQA 4FIDA 2Q3MA 1JPJA 4DDTA 4RKFA 4D4MA 4NYMR 2XTNA 2AFHE 1VHTA 3MLEA 3QEOA 3FTQA 2OFXA 1GNRA 2ZJBA 3UMFA 4Q21A 5CIQA 2QTHA 4D26A 1OLOA 3ADDA 1QF9A 3BH0A 4O2LA 1XXHE 3CRVA 2J7KA 2XOKA 2CJWB 3TUIC 4BFYA 5FPKA 1M6NA 2Q9BA 3GLHA 1N0VC 1UF9A 4C7OA 3C15C 3R7WB 4BFZA 3O8CA 1II8B 4V0MA 3CNNA 5IK2D 2BCGY 2HYDA 3T34A 3TVTA 2R6AA 3U3KA 1OHHD 2O0KA 4IKEA 3R9XA 3TW8B 4KJZA 3A8TA 2QEQA 2CHVA 4JYBA 4B2LA 2ZPTX 2V7QA 2ZR9A 2EYUA 4Q9IA 4O0MA 2FGJA 3V4RA 4LGMA 4TTRA 2XZPA 3BC1A 4QXAA 5GVSA 1E2GA 1NIJA 4QGFA 2J46A 4I1VA 1DADA 2AK2A 4RKEA 3T5GA 2OV2A 1NG1A 3AGPA 2XGJA 4PAMA 1UPTA 1DVRA 4PQYA 3ZQ6A 3B1WA 1MO6A 5J4VA 3O8DA 4IVRA 5AJXA 4BZPA 1II9A 2WKPA 5EP4A 4XVRA 3B1XA 3KFXA 4MA4A 1GL9B 3ZZUA 4KITB 4GDFA 4EPVA 2BIFA 3W90A 2O8EB 1KGDA 2W2TA 3HJNA 2WJGA 4OJKA 4M9XA 4V03A 3WNDA 1II0A 2JLYA 3FYHA 4Q03A 3V4FA 2JLQA 3P4XA 4L9WA 4XWAA 1UAAA 1MRSA 1RW4A 4OKSA 1KDRA 5DI3B 1W36D 4GZLA 2W83A 4LHYA 3U5ZB 5F3WB 4OHZA 2ZRLA 4FMBB 1MABB 1K5DA 2EQBA 2YJTD 4JLPA 4ARZB 3E2IA 1KJWA 5JS7A 4FCTA 1GKYA 1C4OA 3RS0A 2NO0A 4M1WA 4EFLA 2V1XA 4LI0A 4C2UA 3GLGE 4PHHA 4DSOA 4G5RA 4CEHB 1KK3A 2A9KA 3IPXA 4C0JA 4DCSA 1KDOA 3EX7C 5KYKA 2V55B 1NMXA 3GMTA 1LS6A 3QG5A 1DTSA 5D3MB 1WXQA 2DFNA 5G3YA 4DSTA 4GMDA 5KDOA 3KKQA 4EKDA 1P60A 1QDEA 5EJEA 1K6MA 4KVGA 2REXB 4MKFA 1KI3A 2VP9A 4URZR 5FPSA 1XD8A 1WBBA 1B0UA 1GFIA 3LXXA 1NY6A 3LLMA 2X1VA 3B13B 1Z47A 3MWJA 3QQ5A 4LRWA 2F55A 1SXJC 4IJMA 4HLUC 3OAAD 4W7SA 1UADA 4DBLC 4A0FA 2VSOA 2X8AA 5DNYB 1Z07A 3HU1A 2ZE6A 4DRZA 1G8PA 1FMLA 3B1ZA 5AUNB 5JEDA 1A1VA 2JGNA 1FFHA 5KO2A 2GESA 3TNFA 3MJHA 1EWQA 4MGIR 3FHTA 1DAMA 2YWFA 5BYJA 1IN8A 2QQ0A 2BM0A 3A1UA 3AUXA 1DS6A 4MGYR 2KJQA 3PEVA 5L3SA 3TVDA 1S8FA 5J4YA 4P4SA 4GOJA 1ZUIA 2BVNA 2WWGA 2JLSA 4NCHA 5UKDA 2IHYA 3FMFA 2IYRA 1JR6A 2Z0MA 5C4GB 2XZOA 2BHRA 4P32A 4CGZA 2ZRGA 2YWGA 5EUQB 4FMDB 1YR7A 3QJYA 5LB4A 5HCNA 4O25A 1XJCA 4WXRA 2PEYA 3THWB 1NI3A 5FOXA 1Y3AA 4ZIRB 2OXCA 5DIFA 1TQ6A 5L3VA 4QBHA 2QP4A 2F43B 1F60A 2DBYA 4L8GA 1N6IA 3SQXA 4TT3A 5FTNA 4KFRA 4B3FX 1G17A 3SNHA 1HE1C 2BJWA 3CIOA 5FOSA 1CBUA 3BIFA 4UQOA 5BN3A 2VTKA 3QXJA 4AD8A 5FBVB 2J0QA 2ANBA 3OEED 4UNPA 1G5TA 2C9CA 3B9PA 1T0JB 2I3BA 4B3CA 2J5XA 2WSSA 1XEWY 2H57A 4JLOA 3UANA 2P2LA 4NYIR 3MRSA 3MSXA 2W6JA 4OL0A 3RS2A 2ZR0A 2WMOB 3DVLA 1TL7C 4ESVA 4QHYA 1NVVR 4BQSA 3ZYCA 2ZIAA 1OFUX 3H4MA 4PC1A 5LD2B 1CJVC 1KSHA 3I8SA 3QXCA 5FL7D 2JCSA 4WBSA 4FXPA 4KHZA 2IUUA 3WMGA 1KKLA 2B21A 1KJZA 1QHSA 2RHMA 4KSBA 3THXA 3QKRA 4IVPA 4ERNA 2CHGA 1J8MF 3DO6A 3CRQA 4JKYA 1AK2A 4Z1MD 1ZCBA 4G01B 1TU4A 1UBGA 1Q21A 3U3JA 2OILA 2QE7D 3VHLB 3BFVA 2GZDA 1SKYB 1VG8A 4OK5A 4CYMA 2Q9AA 2ZREA 3BH6A 4QKQA 1YHNA 4TYWA 3CLVA 4UNNA 1NJGA 3BERA 2DWOA 1OIWA 4PO1A 3EIEA 1EG7A 5FPTA 3HP1A 2BV3A 3SFZA 2MMCA 5C4MA 1OXUA 1SQ5A 2ERYA 2B8WA 3UKDA 4FMCB 4TQ9A 4EPTA 3H84A 3K9LA 2ZSAA 1OSNA 1YQTA 1Q3HA 1XTRA 2RB4A 3C5HA 3PVSA 4PXAA 4IDQA 3LRPA 1SXJA 3ECCA 3GJ5A 4HLUA 1GM5A 1XJ0A 1Q1QA 1JPNA 1E2QA 4A0RA 2RGEA 4FW9A 4DLWA 4B47A 3ICEA 1KO5A 3T61A 1OXXK 1MH1A 1Z28A 4JT4A 1D6JA 1Y63A 4ZI3A 1JQJC 1Z0AA 1R0ZA 4PC6A 1EFRA 2RCNA 4PO9A 4Q4JB 4IFEA 1U8YA
chains in the Genus database with same CATH superfamily
1UBKS 4YX9A 4MUHA 3OBIA 1A4IA 3NU1A 1ICIA 2PR2A 3FGOA 1TF5A 3VO8A 1R8QA 5EMJA 1E1LA 1EEXB 3N5KA 4KK3A 3OUUA 2J7PA 3IKJA 4MWZA 3I9V6 4TWAA 4W1PA 4NEQA 1UWCA 1I3KA 4KNVA 4EG6A 3C8HA 2WZQA 4PFQA 3TO5A 2XUGA 3HKEA 5DV9A 5ELLA 4BVKA 1N57A 2FPIB 4R5MA 1IM2A 5I7VA 4TMFA 4KAJA 1X80B 2C88A 4JA0A 4Q24A 4XYGA 4FYXA 4OBBA 1JU3A 3RVLA 3PWZA 3C6QA 2V65A 4CZ2A 3HJGA 1ZL0A 3JYOA 4MKGA 5G4KB 2P9EA 3INRA 3Q88A 3AWIA 2JB9A 4N03A 1ZAYA 2BHTA 3T3GA 2JFWA 1M0TA 4W7IA 3W8FA 1Q95A 2H7CA 5KOIA 4Z4HA 5IM4F 1VSUA 4YXWD 2F7SA 3U19A 1L4MA 4MUAA 5KNCA 2GCNA 4PWZA 4Q05A 4F4FA 2PL1A 4EKYA 1IJKA 1D2RA 5E2BA 5C32A 3LPNA 2XVMA 4BRZA 4BNFA 3ZDCA 2W2NA 3EF3A 4PZCA 2EF0A 5T3UA 4FDVA 1K8RA 3HEAA 4RZUA 3BN3A 1UDWA 4MUJA 4HDKB 2GNAA 4YQEA 1JQLB 1AD2A 3FSRA 4N0EA 5THQA 2IEZA 4WQMA 2HCBA 1CWUA 3IR5A 4P31A 4OXXA 3LT0A 4PNPA 3T38A 3UGQA 3GRZA 3VYRB 4EATA 2QWXA 2GPAA 2R0QC 1XRPA 4X1KB 1OJ7A 1X1SA 4LX8A 4FC7A 4S1WA 3T3NA 1UPAA 2WT8A 1UBEA 3PA8A 2GD6A 2AYYA 4GU5A 2QD2A 3ZBTA 1KARA 5F3DA 1KDYA 1WTAA 2AVDA 2Y99A 3PXDA 3SIRA 5IZCA 4KXXA 6Q21A 3IILA 2ZATA 3STXA 1GARA 3BTOA 3D3NA 4Q93A 1Y3DE 4AY3A 3FJYA 3AF1A 4BTEA 2E6UX 4QAJA 1WETA 3LQ1A 1OH7A 2FEXA 3ED5A 3DMDA 5AOAA 1GKUB 5FTJA 3RVQA 1L7EA 2G36A 3OE7D 4DXDA 4ZGBA 2QM0A 1EVJA 1E7YA 1XFDA 3HN2A 4HL6A 4IH9A 4Y0AA 4YRRA 5DLPA 4PYLA 4YV7A 1BWSA 2J3KA 5K0ZA 3EF1A 1WF6A 4OHRA 5LBUA 1UC4B 1WZ8A 3UGKA 5KVVA 4Z4EA 2Q8NA 1OC2A 1XXLA 2YQZA 1ESDA 5F33A 1I9GA 1H6CA 4BY9E 2ZJ8A 3H1GA 2ORYA 2D6FA 1WVGA 4TL9A 5L3QB 3ZHBA 3AB8A 4GKJB 3N75A 5JPCA 2HK8A 3N2ZB 2BFFA 2ZVJA 1YDEA 4KKXB 2OQ2A 3ZUGA 3H5LA 1J33A 2AE1A 3DFUA 4KGZA 3TCXB 3U7FB 3ZNNA 1YE5A 4LY6A 1J7JA 3JD1A 1ZAKA 1BQEA 4M0PA 4QUJA 3FB1A 4DHWA 3M4NA 1J21A 1D6MA 4HLQB 5DNCA 1DZ3A 1ISFA 1I4LD 1S2GA 2AWOA 1NI5A 4GP7A 2ST1A 4PYQA 4PLGA 3D31A 3HRHA 1CV2A 4KN6A 4LK3A 3GGSA 3L05A 2QROA 3D7SA 4HX5A 3ZEIA 3JZMA 3VDQA 5DCUA 1JKMA 4CIAA 2JG3A 4UTOA 1V8OA 4JYLA 4P9NA 3SIXA 3QUBA 2ON6A 3VVBA 3NR2A 1V5GA 4WW0A 2DPHA 3TUZC 2FSIA 5IVPA 3GLIA 1P9RA 4QOGA 3O9ZA 2YV4A 1CNFA 2AT1A 5JWRA 2HSGA 2X8WA 1KSFX 3ZDRA 3ETNA 4EB6A 5B4VA 1X7YA 2CK3A 3DZCA 4JYAB 5LKRA 3FDZA 4U9UA 2DUUA 3RTBA 4P7BA 2HM7A 2HLDD 1FP7A 5CM9C 2D1SA 2YVUA 4Z0PA 3ZJUA 2HNAA 3W8EA 3I58A 2GKSA 2C7GA 3ET4A 4S1VA 1FNNA 2ONJA 5KYYA 3MJFA 5LMNB 2ODQA 3F1LA 4OX9B 3PNBA 1DAEA 4INZA 4BX3A 5A9RA 4QFMA 3L46A 2PU5A 2ZB4A 3DP9A 3B2NA 3ZDBA 2ACKA 2BBSA 2KQUA 3Q85A 4GZ3A 3I9NA 2OFFA 1RMTA 1CJBA 4X00A 4EW3A 4A91A 3LPCA 4DVGA 3MXTA 1C7RA 1ZP6A 1HF3A 3JQPA 3H0CA 1M8GA 8GPBA 3UXMA 2NXJA 1Z2EA 1RLTA 5ULLA 1SHJA 1YZFA 1KTIA 3DDSA 1JJ7A 3PFKA 1PS9A 2J0UA 4N8SA 4UMEA 3ZWWA 5CD9A 1THTA 2A67A 4OHCA 3WMRA 2QPAA 4K87A 2LDXA 1RWNA 4EG8A 5E4JA 3CNQS 3KYDA 4XVCA 1J24A 2IUTA 2MYPA 1W5BA 3JVIA 1QYDA 3OWXA 4HDMB 5TMPA 5IJ9B 1X7ZB 3SKVA 3WRVA 1WSAA 2XYRA 4A0QA 3QX9A 4DLNA 1JZSA 5DNAA 1M66A 1F9EA 1M2NA 2D74A 4I5FA 3VPXA 4DV7B 4GM0A 1ZSVA 1U3TA 2EAUA 2VUHB 2ODAA 4J91A 1SD1A 2ECPA 2QVCA 4IFTA 3R0XA 1WV0A 2PNJA 2NUBA 5TPWA 3VU9A 5GWXA 1U0LA 3IUJA 4QU9A 1V5EA 2JFUA 4PZYA 1LK0A 3UYKA 4UU0A 4FR2A 4EY7A 4AI6A 2XQGA 1RRKA 5MHTA 4NBUA 3DWFA 2ADOA 3C8MA 1NVAA 2GFQA 4TL6A 5E95A 5TQ0B 1FJGB 4LHSA 2ZTSA 3N3BC 2NV2B 1T8PA 2I66A 3QPAA 2AV6A 4LNUA 4LMRA 3P9KA 5FEUA 3HEMA 4CG0A 3ZWQA 1YQ9A 1NMEA 4FEAA 2QN8A 4FNOA 1O94D 1JZQA 2DPLA 1AB6A 3P2MA 4RXUA 1C5KA 4BVGA 5K0FA 4MWCA 3FHCB 2XB2A 4IIEA 4ZAVA 2QQGA 1AKEA 1PJCA 4PTYA 2HBQA 1NHGA 2OMKA 4WZ6A 4QWWA 3TZKA 4CKCA 3SCZA 2HQSA 1GKIA 4WNAB 4MWOA 3U4IA 1MQAA 3H1BA 1V4VA 4XZ3A 5HHTA 1VDZA 2JJ1A 4CKYA 3ECSA 5JLJA 2OGSA 4ZDIA 5KOJA 1JFFA 1YB7A 1UM9A 1SH7A 1XQ6A 4D4KA 5EMKA 7GPBA 1MJGA 2QI9C 3PHBE 3FYCA 3KOXA 3NIWA 4KPUA 4N3NA 1BDIA 3U39A 3QPUA 4X1IB 3SWXA 1JAXA 2ENWA 1DL5A 2JFQA 1UWKA 2IIPA 4B45A 3H81A 2G0TA 2Z4TA 2CHEA 2H2DA 5M29A 3K4PA 4I50A 2WVJA 4TXJA 2R1VA 5ALMA 1Z0FA 3W9YA 3N6XA 2ZUSA 1VZ3A 2Q99A 4Q47A 1B6GA 2PRJA 3ITEA 5BSTA 4WY2A 4ZVQA 5DHFA 4KXYA 1NJ8A 1ZKMA 1X9GA 3A1EA 4M76B 4Z86A 2MSNA 1G7RA 5IKXA 4KL8S 1REQB 4RY0A 4BMXA 1PFWA 3HKBB 5DM4A 5FNVB 1KPGA 4R84A 5FWXB 4MQ4A 4G1EB 3HM9A 1LDEA 1OXVA 4CHGA 4XB1A 2FZGA 4HB2A 1J39A 1K7FB 1CF4A 5E9QA 3IOMA 3HUFA 5HSGA 2H1LA 2NACA 4G89A 3PLAE 3VR6D 2ZSHA 2XMQA 3IMFA 4DG5A 1GXSB 3FKSD 4MI3A 3PE6A 2GCGA 2OCXA 3F90A 1QYRA 5G0UA 4DLVA 1K8XB 3KIPA 3G64A 1X94A 1DRWA 2YXDA 4TVSA 1RZVA 1IY0A 2G9UA 3IMCA 3KLOA 3N05A 4BMVA 4UJ5A 1U1GA 1D03A 2FR8A 1Z2OX 3PT9A 4GKBA 1T9DA 4EPXA 3MTJA 1B3BA 2AOUA 2OZPA 3BSSA 1PT6A 2W8BA 4KCGA 2PL3A 1QZUA 1TYCA 1U8EA 2BFDB 1P3DA 2HF2A 2IEAA 4YRJA 3DAPA 4ZQIA 1GUAA 5CU7A 3WMWA 2P2GA 2PSJA 4YQZA 4E5YA 3IV7A 4UTNA 3Q1TA 1KTVA 2J9GA 1WJGA 4KX5A 4BC1A 5CDGA 1FX0A 3RRZA 3LBHA 3TCNA 1XTQA 1ZINA 2VDJA 4IRUB 2HMWA 2WQ7A 1IQUA 1D4ZA 2FF5A 3S1AA 4XDZA 3SQDA 4ED9A 3LG2A 1MOZA 5I3ZA 3AONB 2NG1A 1NKSA 3ABRB 1VJCA 4JL5A 1H05A 1HEYA 2A5LA 2IYXA 1QQTA 3DEJA 5BRNA 5ICCA 4P92A 1GAEO 3INGA 4OYLA 2C58A 2ZCUA 4JGGA 3VZPA 3IALA 3RS8A 4LGYA 1SNYA 3O5AA 2ACWA 3ZGOA 4DUGA 3UPDA 5BMOA 2DB3A 1D2NA 2WFLB 2AI2A 3HN7A 2WZCA 3C3PA 4MVCA 4BWFB 5BR4A 5DN6A 1IJEA 3H13A 3AXSA 1WD5A 2QF7A 4YASA 4C04A 4BWVA 1AQNA 1M6WA 3JQAA 4K2AA 4CI9A 1GT91 2R2AA 1UPUA 2R11A 4CNBA 1T3LA 1U2ZA 3AP3A 4BDTA 1NKTA 3LUJA 4HAYA 3H05A 1E3JA 4DNOA 3RU7A 2C3PA 3KE8A 1RRPA 1TPZA 3E9MA 1ITZA 1VG0B 3PB3A 3D5QA 1W5EA 4P82A 4BMOB 1VCHA 1I2MA 3L8GA 2ZUDA 2HGSA 5B3KA 2IPOA 2H2AA 4GVPA 3EPJA 2YNMA 3ADPA 1J97A 2WWIA 4FNGA 4JITA 4OY3A 4U3JB 1BFDA 1E6KA 3W1EA 2P62A 5KKCA 4R3NA 4D99A 3ST7A 4OQMA 3G85A 3SFVA 5F35A 2HWKA 1N6PA 2MMGA 3PTAA 4N48A 1A9YA 4NU6A 2P9BA 2F90A 4KWEA 3GIWA 1YRYE 4AKHA 4ZEOA 1NXXA 3O4XE 1TKAA 2OBXA 4H0CA 3HR8A 4P3PA 2G09A 1DWPA 2A78A 3B3AA 3RK1A 3RU2A 4RSMA 9MHTA 2AFHA 4HXEB 3HBMA 4NICA 2GVDC 3WJAA 5KU1A 1UJCA 4GPIB 1AUOA 1RE0A 4BC0A 4YRZA 2IGTA 4G0QA 1YHZA 1QIFA 4Q4HA 1N0WA 3UUWA 4EAAA 4LYGA 5A5FA 4F4DA 1K7YA 3CPJB 1HM5A 1NRXA 2JJ8A 2X19A 3KZ1E 2QRHA 4UU8A 1QK5A 4I19A 5KYWA 3BUSA 2NMVA 3K20A 1KJYA 3BRSA 4LTNA 5LN1A 3QNMA 1UKYA 3ZVNA 4Y1EA 3VDXA 5JWOA 2FWIA 4RHFA 5IK2A 5IYZF 1TUIA 4EA7A 5LKAA 1IAVA 4DKJA 3VKWA 1EBFA 1OHHA 5FRDA 3KYIB 4HPXB 3DJYA 4PM4A 4L5IA 4ADSG 5AM3A 3HA3A 1NFFA 3P94A 5JHGB 3HR4A 3I6BA 1WUYA 3WP0A 3KEOA 4KVZA 3UPTA 1RADA 1NW7A 4FHZA 1CJTC 1AB5A 3GH1A 3U80A 3D6UA 2QZSA 3IQXA 4E5DA 2GPSA 1GSOA 2J4DA 4MEAA 3C16C 3ND6A 2XNDD 3IV6A 1W87A 4LJ7A 1MJ3A 2INGX 4MEJA 2ZIFA 4LWOA 3ZS9A 5EG5A 3TQSA 3DEIA 4AO8A 3TAUA 2FF7A 2VEDA 2FSSA 1WCIB 1Y7PA 3OHSX 5HIJA 4YEDA 2EHJA 5KNCH 2QLTA 3WRXA 3IKLA 1UX4A 3ZR4B 3FOBA 1W73A 3ZY4A 3DTVD 4MRRA 1ZY2A 1R9GA 2JGMA 3CUWA 1E2HA 4LV8B 3IPAA 4MUBA 1PN3A 2BF7A 3GNQA 5F1KA 5B55A 4BS9A 5LUAA 4FSXA 1U3FA 5J2TB 1ZD8A 2QX4A 3GEHA 1O9GA 4AWXA 1MC8A 3NWJA 2VJQA 3HE3A 4KACA 4BQRA 1EY3A 4MPPA 4DIBA 4ZT4A 3TX6A 2HU5A 3ANLA 2ZAIA 2WJPA 3VZBA 3AUYA 4M9SA 1BFUA 4II7A 4QDJA 1BU8A 5B2EA 1CJKC 2HHAA 2ZI7A 4AY4A 2XMRA 4CM4B 4RTKA 3T9EA 3DG9A 2CNKA 1RJ9B 2M6RA 5EMNA 5IVDA 4RVFA 3SX2A 4LG1A 4L16A 3WGNA 2FCAA 3X1YA 1CJCA 4ND4A 1U2DC 4NEGA 4KUGA 4RQTA 3AM1A 5FO0A 1IL0A 4FYPA 1KI2A 4BNNA 1N7IA 2TMKA 5M3BA 3OLQA 4Y2VA 4PGGA 1GA1A 1U8UA 4NENA 4YJHB 1QCCA 4XYEA 4DM7A 5GZ1A 3SKXA 3ZVKA 4FFBB 3CUUA 2ZWOA 3I01A 3UJPA 1XTKA 1U5BB 1YI0A 1L8OA 5C46F 3JASA 2C9YA 3C3CA 4YK7A 1OT5A 3OPVA 3AF0A 1TC2A 4N3AA 4YCAA 3GLGA 2W4MA 5E6UA 5FA5A 3N1UA 5IAJA 3OC0A 2EFCB 2PZAA 4RF5A 2EP8A 2Q4EA 5KCZA 4Q34A 1CB0A 1HOTA 4ZTBA 1BN7A 3K71B 4ZOLA 4YJ2A 1P31A 4URYR 4A4DA 3GDGA 5A0TA 4F9GA 2CSXA 4BKMA 1OX4A 5K3DA 3K1ZA 3WK5A 3P9SA 1K4MA 2CC2A 2P3QA 5CX4A 2OZVA 1ZH6A 2X2PA 5J43A 3NUZA 5CW2A 1JYFA 3IR7A 3PFIA 1H4QA 3L79A 1HYBA 4M6WB 3ECAA 3QX3A 5LVAA 3WBJA 4YAOA 3PC2A 4QU5A 2Y71A 3HCWA 3V46A 1RPZA 4D9BA 3A9UA 4RBNA 1ZVQA 4P4UA 5D3ZA 3G0IA 1G6OA 1Z5VA 2ZRBA 3T5BA 9ATCA 4NU0A 1ZK0A 2POCA 4TS4A 1PDVA 5B36A 3COYA 2LWIA 3D7KA 3L0PA 4TXNA 4XX0B 1DUVG 3IBTA 4I7EA 2W70A 4BGEA 3T5AA 2WDZA 1EGVB 2PNFA 2ZRFA 1H9CA 2ZIWB 3LJKA 2UZIR 2J5RA 3L06A 2C2BA 2AOWA 5AVUA 5IDYA 3VKFA 1Q83A 2ZVPX 4H4EA 1RCTE 1Q1BA 1V1MA 4WK0B 3L4EA 2LW7A 2Q8QA 4MUMA 2XMPA 2G7MC 4MV5A 4PNZA 2GTIA 2EKDA 2PJDA 3HB5X 3RYTC 1A82A 3UB3A 5IAKA 5BW4A 1JX6A 1ONNA 3OU6A 4HGNA 3M6IA 4G8CA 4HUJA 3WOVA 1NXQA 3P0FA 1XNRB 2P2YA 4I55A 1Q6ZA 4WBXC 2LCFA 3W5AA 1XWFA 3BMOB 4H7PA 3L9WA 2O8CB 2ZRQA 3ZUPA 1CUJA 3TZBA 4AP9A 1N5DA 1WP9A 4F2WA 1DAGA 1NW3A 1N5KA 3W5DA 3DZFA 3KO8A 4G65A 2VO1A 5GGXA 2O3SA 1Y9AA 3TH5A 3ZWCA 2QN1A 4IIJF 1GRCA 1OXMA 2W4IA 3I04M 4B33A 2EFJA 4V24A 2VN8A 3PWSA 4LSMA 3HYCA 3ZHQA 2J31A 4D79A 5JJBA 3E3OA 4HY3A 4X3CA 3M5WA 4Q6BA 3BGSA 3M83A 3UK0A 4B4UA 1EHYA 4OLQA 3A6FA 1T8YA 3NBUA 4ITRC 2H16A 5BWMA 1PS8A 3OEEA 4MW5A 1P4GA 3L02A 1ENYA 2A3RA 4Q7KA 5JASA 2GYYA 1EAMA 3G6WA 2W11A 2GEUA 2WJHA 4UCXA 3H3JA 1SC3A 3IEUA 3U49A 3T8AA 3B8HA 4L7QA 2OC4A 3BFKA 4XVHA 2WF5A 4DYHA 5C8ZA 3DZIA 1K6EA 1PQYA 2ADFA 2AXNA 2B5OA 1S5PA 2YICA 1H0SA 2P6PA 1CW2B 2A5GA 5I4KA 3DNFA 1VZ2A 1K4YA 4FDLA 3C7CB 1Z7GA 1C14A 1HEIA 3I34X 3IPRA 4Y9DA 1ACJA 3MJVA 4M1KA 5FL7A 3B5EA 1PLJA 5JNTA 1BKYA 3G8CA 4EHLA 1SCJA 2I4TA 1QHYA 2V0CA 4PZLA 5E9AA 5MDHA 4GOXA 1MPTA 3ZDDA 5FADA 2AVNA 1R3DA 1L5NA 4YGYA 3ZHTA 1W19A 4JT8A 1X8JA 4DPMA 3CH6A 4Q37A 3P2JA 1M33A 3CVOA 3SQMA 4FYIA 2O8FB 3RVOA 4WLFA 2EFYA 2DUNA 2PGLA 3H2YA 4A8PA 2BEUB 4LDPA 1Z7YA 2OBMA 3CJTA 1XZFA 2C4UA 3HZHA 3NB0A 4XARA 4XWGA 3U1BA 1WMFA 2UKDA 3W2GA 4RXMA 5IT5A 2I3AA 2DGDA 3V2UA 4CU5A 3THYA 1YS9A 2ZDQA 5EHNA 2FVYA 1D4FA 3NDRA 4HS4A 2H1FA 5FUBA 5LOVA 4KH0A 3UT0A 5K0TA 3VC2A 2IP2A 4FHGA 4JB3A 5FCDA 4EHDA 1QFYA 4LOHA 3VGPA 3T9AA 1GTJ1 2F64A 5LLDA 4QQFA 1AKQA 1G20E 3EYWA 4OSOA 2GAAA 4RKYA 1GQFA 4GVXA 4Y2YA 2ZXUA 1OB5A 3AL0C 4KC0A 3O8QA 2J32A 1UK7A 3VR4H 5LZ7A 4B48A 3CUEF 4Z7NB 1QHFA 2EATA 4J1TA 3ZZNA 3MAJA 2BGKA 1CY6A 1B16A 3MBIA 1G4AE 4AYTA 2GRJA 3SMQA 4Y9TA 5DX1A 2Q7XA 4HATA 3HY3A 3M5DA 3RK0A 3TM4A 1W75A 2VPIA 3L8JA 2Y0CA 4MVYA 3RRNA 3MPOA 4REQB 5AK6A 5DYGA 1EGMB 1QKJA 1DOHA 3Q5DA 1L1RA 1Z74A 4WFKA 3RW9A 4M0KA 3K35A 4DC1A 3E81A 2QQ3A 3CX3A 5C8DA 4NBRA 4XLZA 4MPRA 3WHLA 3LY9A 3S8EA 1P6XA 4DV2B 2PR7A 4ISBA 1J0BA 5CVVA 4XPIA 1J4AA 5C80A 2H00A 2J59A 2VCYA 4JVMA 4DMKA 3CW9A 4HG2A 2LR0A 5JCZA 2H17A 5KTNA 2NO6A 3COJA 2FPPA 4FUTA 3M5PA 4OQQA 4E13A 4A15A 3WRYC 3PE3A 5BT9A 4BVJA 2TS1A 2UVQA 3AIOA 5EP2A 4RCVA 3MWEB 3JQQA 2DKNA 4I81A 1CR1A 4OH7A 5AI4A 5F2EA 1K3FA 1Y4UA 5B1DA 3ZE2B 3OEWA 1ODSA 4F7WA 1PDOA 3F7TA 3OF2A 4RTMA 4UHEA 4G1BA 1F0KA 1DB3A 2XUKA 3LXRA 4QE3A 4H1UA 3IIKA 2JFHA 2FV8A 3ESYA 3CBGA 2VG8A 3OURA 3PYLA 3KQSA 4M46A 3KTAB 3CWQA 1TUBA 4XB6B 2G67A 5KJ6A 4MV7A 5JQWA 3QBVA 3IOBA 4ZYUA 3S40A 3EARA 5D7BA 3V7FA 4BO9A 3ZK9A 2PMDA 1IM5A 1KK1A 1JLHA 1N7HA 2ATXA 3OM9A 3OZDA 3RUAA 3T9CA 2R4TA 5EL0A 5HUQA 9ABPA 4CR7A 4W1RA 2VSYA 4V0LA 2CSUA 4OQXA 5GJBA 3DKPA 2R00A 3JVVA 1ADGA 1XTJA 5AW2A 1BDHA 1RDFA 2VDWB 4GLFA 4C4RA 1CNEA 4AZWA 2QIPA 2HWYA 5BY2A 3OVMA 3TTWA 1YE3A 2XE8A 3OJEA 4AS2A 5BUQA 1U3VA 1H2YA 1SA0B 3PV0A 3WY9A 1L5YA 1Z9BA 2NZJA 3CVJA 4F12A 1PG0A 1Z0UA 1FDTA 1XUOA 2D54A 1WF3A 2HLHA 3MF4A 1KSGA 1U8XX 3WTCA 4F93B 5KPDA 3HDQA 1N36B 4BECA 2B35A 5LWQA 4AF7A 3AVYA 5TPZA 2H5LA 1T5HX 2JFFA 2Q5IA 1K9SA 5I7SA 4YT4A 2WWRA 4QJ4A 2WVAA 2I2AA 4BO8A 2VSQA 3OX4A 5FBRB 3T7SA 5TY0A 1GSAA 2BM9A 1NA5A 4MYSA 5AICA 3W7AA 2QJFA 4KEAA 5JWHA 3B3FA 1O94C 5F77A 2RI6A 1B42A 3IJRA 2CXSA 1HG1A 1YIAA 3ZHVA 4JOCA 4TS9A 4ESHA 3TX2A 3LY8A 1DBQA 3EXIB 1W4AA 4TS3A 5KWSA 2AK3A 3R0JA 3AC0A 4KE7A 4O2BF 4K6FA 5EWMB 1FNCA 3RC9A 2V0GA 1WZEA 3KELA 1J42A 3ZDQA 1RQLA 2FFRA 5A0FA 1GGNA 1A4UA 1M2VA 1U65A 2CJWA 1SJ9A 1IE3A 1NBEA 2L19A 1FS4A 1Z0JA 3Q87B 2CJXA 1EF9A 4NIMA 2A0KA 1P29A 3EUEA 4LY0A 1RAGA 4YP5A 4OXRA 5EJMA 1UOPA 4J2TA 1EXWA 5H3HA 2BM8A 2CVFA 1PW7A 3K30A 4YIKA 5AVOA 1DKRA 3DLTA 3FWHA 4JEIA 3RJZA 2WPNA 3TW8A 3OM1A 4RVUA 5G0SA 4CW7A 4XA8A 2WAYA 4XUDA 4WMLA 4B87A 3AFMA 3KC2A 3AIKA 4RFVA 3Q9LA 3FVQA 5CXQA 3I5MA 3CH5A 2R6GA 2AMJA 4H1TA 3PVCA 1M1NB 4PLVA 1Y7IA 2XVZA 4BV8A 3AEZA 1GQYA 2ZDHA 1DJNA 1D8AA 1YRLA 4IJQA 1R4NB 1FFAA 3EF0A 3Q98A 4KFTA 4Y8VA 2J9ZB 3HI6A 4U7PB 5FORA 2GN6A 2XCUA 3UWSA 5IFLA 3LSTA 3OFNA 3PC8A 4PTLA 5H3CA 3SR3A 5A1JA 4K9NA 1NN5A 1T8UA 4PE5B 1S2DA 4C5CA 2IELA 3F6EX 2REQB 3N8HA 4D1YA 1Z0KA 3ETLA 3ZZ1A 3RVNA 2QG6A 4GMHA 3ILSA 4QT4A 3T95A 3PFNA 2AEMA 1J0DA 4QJ5A 2VBFA 3GDWA 1E1RA 2MYUA 1ZICA 3EG9B 4ND8B 3HFRA 1D9XA 1KGSA 3AR4A 1E6CA 4ASUD 4Z0TA 4G85A 2FWAA 4QG7A 5ENZA 1Z26A 3I73A 3V97A 3KS9A 5K3EA 1C7JA 2QMOA 3R2JA 3F3YA 1PHPA 1J90A 4MQFA 4Q48A 1YA6A 5LD2C 2IIBA 2RK6A 3WXMA 1ZUHA 4D8WA 2AJCA 3S4YA 1YZGA 3QIVA 2V7WA 3ACCA 2D0DA 1OKKD 2XZDA 3W9BA 2G9NA 3SEQA 1RJFA 4GZ5A 3IUBA 5F1YA 4NBVA 2EJBA 5TJ9A 2RSLA 2GD0A 4CT4B 2YTZA 3N7AA 4IX9A 1UEIA 1ZR2A 4M87A 4EPRA 2WUWE 1C9EA 3EBPA 3L7MA 4G26A 2ZJ1A 1ATZA 4MARA 5IDQA 1C7ZA 1E2PA 3M3PA 1FDIA 2PLRA 3BJZA 3IEXA 1M74A 4RDIA 3TSWA 2O5VA 3FAKA 5AO9A 1OYVA 5G3ZA 5BNZA 1ZGBA 2H4YA 3KT0A 1VKZA 4QPNA 4TMZA 4XUGB 3WIOA 4REMA 2HIHA 2J3LA 2ODNA 3IP9A 4PF1A 1RKVA 4LHEA 3UW3A 3T3HA 3FTPA 5ICSA 3G1TA 5JCPA 3L6CA 2OC9A 1DFIA 2XDAA 1Z6TA 4XB2A 1HOXA 3BXEA 1ZM7A 4GLLA 1SD5A 2WWTA 3N53A 3JWGA 5AM0A 3H1EA 2OGWA 1XTIA 2I2WA 2AUNA 2V6IA 4TMVA 3OQHA 3FVWA 2ZULA 3BREA 1KS9A 4KSYA 1PD1A 1QGUB 2PMBA 4RV4A 5C1PA 2QUZA 2OZLB 3BT7A 3QI2A 4RVDA 2O7SA 4EZIA 3T1QA 1DTWB 3S2GA 1GAXA 2ZSBA 3VHQA 5KINB 5K8IA 1WCWA 4XQEA 4BCCA 5CDFE 2IXBA 3DULA 1C9YA 2JNWA 3QF7A 3L18A 4BFVA 2PKYX 2VHEA 1X77A 3AU8A 4C0XA 1KVSA 1LDGA 1SCBA 2GERA 2RH8A 3AY0A 3EXG1 1PWXA 3GUCA 3CV3A 3H86A 5LBIA 5SZJA 5T4HA 2H5JA 1JA9A 3WL8A 4X62B 1P5HA 1YMQA 1U7WA 1IAQA 5LQCA 4CT5A 3E48A 3QWBA 5KHAA 5JXIA 4C7KA 1T5OA 3HXOA 2A84A 4WA7A 1MB2A 4QXOA 2R2GA 4BQQA 4MTLA 1KA9H 1YVDA 3EIFA 3NAZA 2I0FA 2P65A 3ZTWA 3F4BA 1PD0A 2V54A 1XZLA 1ZN9A 3ZCXA 3LV8A 3M4XA 2OO5A 3PFGA 3S2EA 3ZE9A 4H7HA 3WB1A 2XE4A 3KSUA 4H60A 1PQUA 3X1WA 2YKGA 3IC5A 2A30A 3LXUX 3P0HA 4TWBA 2Q7OE 2VRCD 1ZC4A 4BBAA 3DZDA 5ABPA 3VYSB 4CV3A 4UD2A 2YFHA 4PV7A 4WXEA 1NBMA 3IVMA 4OK3A 1XO1A 3USZA 4NYJR 4BLVA 2BD0A 2FX3A 4HK4A 1N3YA 4HGQA 5J59A 3EIHA 1E5VA 1HLPA 4RLFA 3TIGA 3MMXA 1MEOA 4B3XA 3NGMA 4CRWB 1TK9A 2GPYA 1UMKA 3G17A 3NRBA 1I1QB 2NZXA 5AKLA 3RT7A 4NZMA 3WKCA 2YV5A 3CVXA 3PCTA 5GJVC 3TFQA 4JKOA 1FRQA 2D7CA 2Y1WA 2ZPAA 4E33A 3ICPA 5CLHA 1KOGA 5HMMA 4JXXA 1UPCA 3JS5A 2IU0A 1JSLA 4MCHA 3IULA 1I7QB 3T0FA 4KQ1A 2EJTA 3QWFA 4Q7MB 2WTXA 1UBHS 4R5HA 3FLMA 3DEFA 2ES4A 5AH0A 2WWVD 1NBME 4HEHA 1P4HA 1EQAA 5AXCA 3S7ZA 3LI2A 1WMEA 1XHFA 1AS0A 3CJRA 4TV8A 1WMSA 2VC2B 3WYNA 2XF8A 3EZGA 3H3FA 4EA9A 3Q8LA 1EGHA 1SUFA 3H87A 3MMSA 2OAGA 4L8LA 4ZVVA 2WIAA 5REQA 4EJSA 4WFIA 4H6XA 1S7CA 2BPOA 2CJYA 4UXJA 2IQ5A 1QYCA 3V8BA 4RTRA 4FN5A 2B4QA 1YCFA 2C82A 3NDIA 4B3GA 3OZFA 2HW5A 3H5IA 4DM4A 2CNDA 1TI7A 5CD1A 1YAHA 2QZPA 3EZNA 5L6MB 2PX3A 4XWWA 5FBQB 3IEVA 4Y6QA 3JAKA 1YJAA 1W4CA 4UM9D 1IQRA 1V41E 3FJ1A 3L5OA 2Q2VA 1CUXA 1Z3CA 1NQXA 3AFHA 1KEEB 1G8FA 1N6OA 3NDPA 3RBZA 4V1CI 4NJOA 4HRAA 1T15A 3N2GB 4LWPA 3O21A 4JP2A 1FVFA 1XALA 1AY0A 4C4AA 4EEXA 1I2DA 1PJLA 4LS3A 5IDWA 4DMMA 4MITA 2CDAA 2XQJA 1OFVA 1DDIA 3OICA 3P32A 4FK8A 3PVZA 3ANMA 5FBKA 3QE3A 4ZHQF 3OQJA 4QYTA 4R0MA 4QDKA 1XNJA 1R5BA 4RE6A 3CHYA 1Z06A 3O1JC 5LCXA 3TSAA 1ZUNB 4M0FA 1NXTA 1Z4IA 3E27A 3VDMA 1E3WB 4QBTA 1ZNZA 1I7LA 1RMQA 3DAYA 4B6RA 1U90A 1EGAA 4OLFA 4QVKA 1SVSA 4YQFA 3ITDA 5LYJB 4UCFA 4C3ZA 5BPFA 1UKAA 4Q4JA 2PE5A 1QV9A 4GRAA 1OF1A 1FTQA 2FPXA 2A1UB 3DJFA 3CEPB 2CZCA 2J48A 2UUPA 3FVVA 3QKRB 4B4VA 3PFWO 4D82A 5GJWC 4V38A 1Z5GA 3IVXA 4IDDA 4ZI2A 4QBKA 1HDRA 1HY3A 2P2CA 3OOHA 1ODJA 2X22A 4RC9A 4D6PA 4CTOA 3PDIB 2H07A 3GT3A 4G23A 1AQJA 4AY2A 3EBOA 1KY4A 2V59A 3GR6A 4PPFA 4DDWA 1RHQA 4MKRA 3IAS1 2ZYVX 4CLOB 5KX5F 1OI3A 1R8XA 4IOJA 4LYAA 4MJ7A 1FSGA 2AI3A 4FNAA 4RL4A 1IUPA 3OOSA 2Q5JA 2GK7A 2ONZA 2XWSA 1Y3CE 1L8AA 1NQOA 2HCJB 3AF3A 1Q1EA 1O87A 3B1VA 2X77A 2QSYA 3C98A 3RUEA 1JLLB 2QRUA 3BPSA 3OEHA 3P0RA 4BGVA 3EZLA 4N49A 2FN4A 1HNWB 1MJFA 3COSA 1C0KA 3AP2A 1CUZA 1DARA 1IIBA 2V7TA 1QNLA 3D81A 2WI8A 1QOPB 1WLSA 3EEBA 3PGMA 4BL5A 4Q4AB 2QVZX 4C9BA 2GD2A 2ZEJA 4YROA 4NZOA 1ZXBA 1NONA 4HRVA 3W6PA 4FZVA 4X6XA 3PFFA 4MR8B 4ZQHA 1DIHA 3RARA 4HDKA 1ATIA 2YFYA 3LD9A 3ICOA 4GUAA 4IJ5A 4C7VA 3CR8A 1IDN1 3RVSA 5B2ZA 1HDOA 4KR3A 5E8JA 1I1OA 1K6XA 1F06A 4I8DA 3IO5A 1BVHA 3R75A 4E5VA 5HBRA 2XRYA 4X1KA 5HGJA 3UWKA 3ZVRA 3QV2A 2HSJA 1ML3A 4QDUA 5B3JC 4DDKA 4UVGA 1Y64B 1DMSA 3RJMA 2NGRA 3BM5A 1ZD9A 5ITZB 5F9FA 3L4BC 3EMKA 1SU6A 4IXTA 1D6NA 5CM2Z 3T1VA 4IQ4A 4OSPA 3VU1A 5JIBA 4MWEA 4OSEA 2O7QA 2XUJA 4MULA 2IY7A 2QLLA 3E1KA 1XWIA 4BKQA 2P0YA 1M6EX 4JQZA 4K9LA 3WIEA 1K98A 2PKQP 3OZVA 3SGLA 5LWHA 1W4LA 2TMYA 3RFFA 3HRKA 1O77A 3NXSA 1JR3E 4E3WA 2YXLA 3DMYA 3KZXA 3LNCA 3ZKWA 4KQEA 4OYHA 2W6MA 2B5WA 2VH5R 4KQIA 2CLKB 4B83A 2IYFA 1QVRA 5HYVA 1CULC 1A88A 1MDFA 4K9SA 1YL6A 1TJNA 3ZCVA 1SBIA 4I4CA 2E48A 2NP7A 1W7AA 1C3EA 5L3QA 4J7XA 1XN4A 3EGXB 1G1MA 4AJOA 4RK5A 2W6ID 5DB4A 3BK7A 4WK4B 1VCNA 4C4ZA 3CRZA 2P2DA 4HEQA 1QJ4A 1VHLA 2OBLA 4DLSA 3DXYA 2GEVA 2QX8A 1JW9B 4GOMD 1CY8A 1VJ0A 3C48A 4U00A 4XSHA 2DRIA 3CWCA 4WCDA 4NCAA 1ZI6A 1U1CA 3KAJA 4NH0A 2PRIA 3A3YA 2UDPA 4F46A 2I65A 2J3MA 2XVYA 2Q4TA 3EDYA 3H1TA 1K27A 2ZYIA 2Z9BA 3LDGA 1TADA 3IKVA 2XUZA 4COKA 3DBRB 1JDBB 5J2UF 1K8QA 1O57A 2FJUA 4OFXA 4P33A 2HPAA 3MQ2A 3PQCA 1ZMBA 4O2RA 4RY8A 2DM6A 3I62A 2ZUCA 4ER6A 3JYPA 3GJ8A 2AOTA 1NJ2A 5A6VA 3QLTA 5HKKA 1UK8A 3L5KA 3HYLA 1BNCA 2FEWB 2HF7A 4RHXA 3IQIX 3AY7A 4AXBA 1MO5A 2JLWA 3AUKA 5BOSA 4BZXA 3L84A 2JBAB 3RRYA 1O96B 4RMNA 2JEOA 3NNNA 5GV7A 2B7LA 5K51A 1DKNA 3OT1B 4ER0A 1B0ZA 4M1OA 2C5EA 1ABBA 1C3JA 1I2CA 3KZNA 1DINA 1USIA 2NU7B 3DV0B 4HQ6A 2UV8A 1FXWA 2QAGC 3DF7A 5ESDA 2WIBA 2HUNA 3A2MA 2QYTA 3RSHA 5B12A 5DDIP 4MB0A 3RQEA 1PNOA 3JQGA 3UWDA 2H54A 3R9TA 1DOAA 5CTAA 1GDTA 1NF8A 3N5CA 3I2FA 1T8TA 3S7TA 2B4AA 2V03A 2RHOA 3QTBA 4JEHA 1GSHA 3EWNA 4A3SA 2OHGA 4Z51A 1IXZA 1LNSA 1W29A 1LS1A 3WNCA 4E94A 1EFHA 1AKMA 1Y34E 2Y0EA 3OFSA 1JECA 2FN8A 4PAQA