3ADKA

Refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of porcine cytosolic adenylate kinase at 2.1 A resolution.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Transferase(phosphotransferase)
molecule keywords ADENYLATE KINASE
total genus 59
structure length 194
sequence length 194
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1987-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adkA00
1NBME 1SVSA 1PV4A 4MA4A 2EW1A 4MYCA 5CIQA 2F3RA 3K0FB 5DH9A 2JIZD 4OBEA 1JJVA 1VMAA 1YE8A 3WYGA 5BN4A 5C1BA 2W2VA 3TMKA 4EJSB 3VX3A 1FZQA 2V6JA 4EFLA 2VO1A 2V54A 3Q5DA 1E9CA 1RYHA 4LJ9A 5EJEA 5KYKA 3OEED 3RS5A 5CDFA 2E87A 1X8JA 2IUSA 1Z6GA 3LV8A 3QIAA 2HUPA 4GZLA 4BE7B 1OE0A 2Z4SA 1R7RA 4G1UC 4KXFB 1FNNA 3CR8A 3PG5A 5DI3B 1YZLA 3EZ6A 3CPHA 1HUQA 3QKSB 3NHBA 3U3JA 1QZXA 1RZ3A 4AYWA 3DMDA 3JZMA 3P20A 4PC3A 1M1YE 4D6PA 2XSZA 4GRAA 1Z06A 3LW8A 5D3QA 1ZCBA 1WP9A 3AF2A 3GD7A 3ADKA 5JHGB 4LRWA 2GXSA 4IVRA 1XCMA 1XCGB 4UJ3A 1Z2CA 1T3LA 5CJ2A 5F2EA 1EFUA 3EWAA 3B7GA 1UBEA 2YYZA 1Q57A 2ZU0C 4ARZB 1TF5A 2FZ4A 1KY2A 5JS7A 3BB4A 3SN6A 4JKIA 4B3FX 3TSWA 2D2FA 1FPMA 1N2CE 5HE8A 3LLMA 4GOKA 1IN4A 5FUWA 5B57C 3Q8XB 1P9WA 2EFGA 1XD2A 4G5QA 4YONB 1A4RA 2IS4A 1O87A 3TR5A 1IJEA 1MABA 3VMFA 2NO9A 5KOYA 4TMXA 1T3HA 1II8A 1IJFA 2RCNA 1OSNA 1HT1E 3R8CA 3TJZA 3PEWA 2XJ9A 4LV6A 3PJRA 2WWHA 4I1VA 4Z8YA 4GT1A 3TBKA 3G0HA 1T8UA 1N0UA 1CLUA 4OQFA 1JEEA 4NYJQ 4NCKA 2HF9A 4XD7A 1P75A 3Q85A 3B1ZA 1E69A 4JKYA 4KBGA 4L16A 2YJTD 2VHQA 2WJVA 1GNQA 1P6XA 3GEHA 5J40A 1FQKA 1QF9A 2IEZA 4JVNA 4IXMA 4ZKDA 1RKBA 1OFIA 4Q9IA 4MYUA 3REFA 621PA 4F93B 3MWLA 1IOZA 1AN0A 1CIPA 4A8JB 4EPYA 4C0LA 1G291 1XPRA 3DKVA 4TT3D 3RS4A 3AVUA 1E9RA 4GNKA 2WJHA 1KMHB 2AX4A 1GVNB 3K0EA 1G41A 1KI8A 3ZQJA 3OIUA 2VSXA 1GRRA 4MRSA 4XWOA 3CBQA 1IAQA 3QY0A 3NEYA 4KV9A 4M9ZA 4IKEA 4AKHA 5C4GB 1ZM4A 2XTNA 4PAMA 4AKEA 2FSFA 2ONJA 1E1QD 2XGJA 2HJVA 2EU8A 1E0KA 5LPNA 3BH0A 1BOFA 4FWIB 2PCJA 3QXCA 1MKYA 2RGGA 3GJ8A 2BMDA 4HAWA 5AUNB 1A2KC 4OHWA 4DDUA 2NMVA 2ANCA 4Q1EA 1FTNA 3T35A 4DLTA 2KB0A 5KSZA 3U7EB 4PQFA 4LX0A 3N2EA 1D9ZA 4IVPA 2VRWA 1EFHA 4B74A 3TKLA 4G5OA 1YZQA 4LJAA 3PENA 1W47A 3OAAD 5FBQB 3FFAA 4RCYA 1WCV1 5KNCA 1M74A 4FD2A 3FHOA 3VQTA 3UANA 4TQUS 4A6PA 2ZE8A 2V4ZA 2BMEA 5HKKD 5C4MA 4KSBA 4BZXA 4HZIA 2QSZA 5D3MB 1ZNYA 2GETA 3OFND 4LCBA 4TQAA 2VSOA 1OB2A 1FL9A 3QENA 4Q1CA 5FOWA 2OFOA 4ZIRA 1CJVC 3ICQB 1SGWA 1MABB 4QKQA 4Q19A 5JEDA 2OUKA 1RJ9B 2F43A 4RD3A 3K1JA 4URZR 5KSOA 3QOFA 3ETLA 2P0EA 3I72A 5KSYA 4LYHA 4CEHA 1I4TD 5KDOA 2GJ8A 3B78A 2IS2A 1VG8A 2XAUA 3QKRA 3TNFA 1CKEA 1CR4A 4LJ8A 3ZLJA 4JLVA 4DVGA 4U5XA 3KUDA 4U02A 3HYRA 3NEJA 3O47A 1HA3A 1EX6A 1WF3A 1E2NA 2GTPA 2HCBA 3A8TA 4HB2A 4M21A 3RWOA 1ZD9A 1NN3A 2QRNA 3I3SR 1XU4A 1R8QA 1J8YF 4HUQA 5IF9A 2F1RA 2VLIA 1E2MA 4PO8A 2V1XA 3ADBA 1W0JD 2IHBA 4P32A 4X8MA 3ZDQA 1KSGA 5AJVB 1FTSA 2YNMA 3LD9A 2MSDB 4GPTA 4DCSA 1YZGA 4M0LA 3CRRA 1US8B 2XITA 3CRQA 4LV5B 1JBKA 4GL2A 2CCJA 5HR5A 1UJ2A 2QAGC 3EZ7A 1QHIA 5DI3A 3WXMA 1EG7A 3TGPA 5IRCD 5GVSA 2QE7D 3SBEA 1LS6A 2FPLA 2JDIA 4TTRA 1IY0A 1IONA 4WZAE 4WZBE 3SHWA 1J8MF 4LC1A 4DSUA 2O8BA 1I4DD 5FPTA 4OQLA 5JFGA 1SVMA 3UKDA 2CCKA 1KKLA 4P3YA 1W0KD 4HAYA 1A7JA 2FNAA 2G1JA 4Q1AA 4TLCA 3ZYCA 1CEEA 1S1MA 3X2SA 1I4LD 1GNRA 4U00A 1HQYE 2W00A 2ZS8A 3C16C 1P61B 4C0JA 5DI9A 1W4BA 1N5IA 2ZRJA 3TE6A 1IY2A 4Q48A 3EIQA 2PLFA 4LBWA 3UWOA 1G17A 1KO5A 1T4GA 2WSSA 4QGAA 1G6HA 4ASUA 4F38A 4TMZA 3CKLA 2BIFA 3KXKA 1KI1A 3VNUA 4GFDA 4OHXA 5EE9A 1W2HA 5DYIA 3B1YA 3OEHD 3U4QB 3HU2A 4ILEA 2OO7A 4OJKA 5LD2C 1EFRD 4UNQA 1T0JB 5DHAA 3SEAA 4DZZA 2FGJA 1IN7A 1R10A 2OFXA 4BECA 4TL9A 4RSGA 2HXYA 2BMFA 2AXNA 2X2EA 4JLJA 3TVTA 3VU9A 4BFVA 5CJPA 2DB3A 3NBXX 4PHFA 2XOKA 4YC7A 4QRHA 3DPUA 2XB2A 2ZI6A 4Q4HB 821PA 1ZUHA 2IHYA 2G88A 1KI7A 5H68A 1YR7A 3WMGA 1QDEA 2WTUA 1HV8A 4HUQB 5ELXA 1F3OA 4URUR 1KI6B 4WVFA 2ZYUX 1CP2A 1KI6A 1E94E 2CE7A 3KQNA 2WOOA 1WQ1R 1VKJA 2IEYA 2QEQA 3HU3A 3QSYA 5EP2A 2VPPA 1WRBA 2VSFA 1OXXK 3KTAA 1RIFA 1P3JA 2PMKA 3R8FA 2VP4A 4W5WA 4JT2A 2JLVA 4M9QA 1N5LA 3PUYA 1M8PA 2NGRA 4TZ0A 1IY1A 3ADCA 1XMVA 1AS0A 2GRJA 1RVDA 1Q20A 4Q4AB 521PA 4US0R 1Z63A 4M53A 3I5XA 5FTNA 1AA9A 2HEIA 1XEXA 2GZHA 3BWDD 2NO7A 2QM8A 3FMFA 3TLXA 2FU5C 1E79D 4QHYA 4P4SA 1UADA 3L8ZA 4BGDA 3IKJA 1DAEA 5JSZB 1W2GA 3KQKA 2VBCA 4A15A 3LX8A 2DFKB 4HLUA 2FEMA 1TF2A 2Q9CA 4HDCA 4Z51A 4URYR 1W0JA 2NO0A 4Q03A 2JJ2D 4E22A 4IDQA 1QG2A 4PC1A 4M4SA 1N6LA 4JLBA 2NO6A 3LO5A 2OAQ1 2IL1A 2ANBA 2KI5A 2CLSA 3DM9B 2OBLA 2ZUCA 4M9XA 5DIFA 3W5IA 4KITB 3AVQA 3KQHA 4BLTA 5L3QA 3UATA 4ZKEA 2WJJA 4OK5A 5EE0A 1OPXA 1UFQA 1XP8A 3VR1A 3TRFA 2H1LA 1F2TB 1GITA 4QC2A 1PUIA 3TW8B 2QU8A 5FOSA 1NRJB 4OKSA 2F1HA 2GZAA 1D2MA 3CB4A 3BAFA 3RAPR 5EUQB 4DC9A 1U9IC 1SXJC 3ZH9B 1F5NA 2OAP1 1UKEA 3SNHA 4A8JC 1LV7A 2QGNA 2QP3A 3VNVA 1BYUA 4M1WA 4A82A 2VF7A 2J7PA 1SVOA 2H17A 1TU3A 4XTCS 4NKRA 3OF5A 4TMKA 2FFHA 2XZLA 2BKEA 1XB2A 2R8RA 4PO1A 4XTRA 2B8TA 1S2MA 4NCNA 3MG9A 3E1SA 5M04A 4PX9A 3MJRA 4HB0A 1VG1A 3L8YA 1U0JA 3RLFA 4OHVA 4LK2A 2QE7A 2RGDA 3MD0A 4R7ZA 1UBFA 2IYTA 2KE5A 1N0WA 2ZJAA 3D31A 4JSYA 4N3NA 3LH5A 4OL0A 4YDSA 3SE0A 1GRNA 2W0MA 2ZR9A 4FCTA 5HPYB 1E1RD 1FOEB 4EPVA 1P2SA 1UM8A 1IN6A 1PVOA 4UXIA 1GIAA 2IA5A 1N6RA 4MRPA 5GJVC 3X1DA 4PC7A 2QT1A 5HCNA 721PA 5L3SA 4URWR 3BS4A 1LF0A 3OAAA 3KKNA 2IF0A 3SQXA 3IDQA 5JEEA 4JSTA 2BKUA 4UNSA 4DUGA 3B1WA 2ZYWX 2X19A 4BFYA 1PLJA 1T0HB 3DZ8A 4H1VA 1AQYA 2D4HA 1G21E 4OQXA 5FOUA 4NL4H 1OB5A 2QI9C 1OF1A 2VYFA 1GDDA 2OCYC 4HLCA 1FNMA 4P0TA 3ASYA 3I8XA 5C2JB 3NBZC 2JLRA 1ZD1A 4EPRA 2ZS9A 4DB2A 3IILA 2LCFA 1XBTA 4KHZA 4D4LA 2FA9A 1E9FA 1G7SA 4R2HA 4TZ6A 2V9PA 5J4YA 4GSYA 2RKOA 3C15C 2GAAA 2GF0A 1OT3A 2ZSAA 1O3YA 3WRXC 3THXB 1E2GA 2ZAMA 5J4LA 1G3UA 2IYLD 1ZIPA 2QTFA 2XOKD 3KXLA 4RKFA 4DWJA 4RZXA 5G40A 5J47A 1CJKC 1KNXA 1DAFA 3GFOA 2OG2A 3B13B 3RS0A 4NH0A 1GL6A 2REBA 3V9PA 1Z22A 3HJNA 4FMCB 2HJGA 1EWQA 3WHKA 4BLOA 1Z6AA 4LGMA 4BFXA 3Q3JB 2RGXA 2GBLA 4UQOA 5F9FA 5EE3A 3QKRB 3T5GA 1S3SA 1Z07A 3A6PC 2C9OA 2MMGA 2OILA 3OIWA 1WBDA 1VIAA 2YWFA 1RRCA 4C0BA 1KDOA 2CEAA 4LHZA 3I92A 3ZZUA 5HZHA 1U90A 4URVR 2IK8A 2G83A 3AVPA 2ZS7A 2NPIA 4CW7A 2D3WA 4E5UA 3KKOA 2AN9A 2VP5A 2AL7A 2QNRA 1SXJA 4CEIA 5AUOB 2W0SA 4NHOA 1P4SA 2DFLA 5L3VA 2ZRBA 3CF0A 2R6GA 4Q66C 2JASA 5A0FA 2B92A 4JJZA 4JL6A 4DLRA 2WZQA 2CK3D 2GJSA 1NKTA 2NQ2C 1CS4C 1YR6A 1LNZA 4ZDJA 2W6ID 1XEXB 1D2EA 3THYA 4LI0A 3B1XA 3KJIA 2GJ9A 1LY1A 1EK0A 3AP3A 3GQBA 2QENA 5J4VA 3X1WA 2ZI7A 2GHIA 2F1JA 2ZETA 4UXJA 3EARA 1OXSC 1R0XA 4I99A 2G3YA 4ACAA 4EFNA 1ZYUA 3K0CC 2WIBA 4MKGA 2PX0A 2FSHA 3TUIC 221PA 4QHSA 3PFIA 1RPZA 1Z0AA 1JR3A 4QBFA 3QKUA 1QBKC 2XJ4A 5BYJA 3I73A 4WXRA 2ODBA 4NP6A 2EVWX 2QQ0A 3O8BA 3P32A 2CE2X 4X8LA 3HU1A 1L7VC 1RJ9A 2VA8A 4EDHA 1L4UA 5L3RA 3OIVA 1EWRA 1HH4A 5FPYA 2YOHA 3JZAA 4CYMA 4Q01A 2YHSA 1QVRA 4B2PA 2D7CA 1FMJA 4TYNA 4MKIA 1OXTA 3ZD7A 2C95A 1JALA 3EPJA 1XTQA 3RANA 6Q21A 3THYB 5FI1B 1IXRC 4QM7A 5JWHA 5K8TA 1QG4A 3LY5A 3LDAA 4ZPXA 1OFHA 2FX3A 1ZM9A 4D81A 2VH5R 5FPKA 2QUZA 3QG1A 3BC1A 3DHWC 4WZ6A 2ZRCA 4MITA 4BRUA 1G3RA 4KVAA 3TK1A 1KSFX 1SXJB 1T9HA 1U94A 3R20A 1HQCA 1OXVA 1CR2A 1XJ0A 3K53A 4CF7A 3CW2A 3KDSE 2QZ4A 1TNDA 5JLJA 2BM1A 2J0VA 3ZS8A 1MO6A 3TW4A 4A2WA 1F60A 1UDXA 1W7AA 1KDTA 1D9XA 1LF5A 2XNDA 3A1WA 4JYBA 1G20E 1V5WA 2QL6A 4DCVA 4OI1A 3RDPA 1LTQA 1NY6A 1XXHB 3EZ9A 3TUZC 2DWQA 1U8ZA 1NJGA 4V0OA 3DO6A 1NIPA 4B3XA 1DVRA 5JCPA 5EP4A 4PO9A 1AGRA 3U7GA 1AK2A 1E2PA 1VYVA 4RD1A 4DLYA 4A2QA 1NSFA 4DLUA 1AGPA 4IFBA 2J87A 4V0KA 4EQ6A 2WWYA 5J5CA 5EXPA 2GVDC 1RRFA 3OHMA 3DDCA 4EQ6B 2JIZA 2BOVA 2CCGA 3LA6A 5JCZA 1SKQA 2GCNA 4HYYA 1JAHA 4DEYA 4OI2A 1T91A 2J59A 4M8NE 1D2NA 1TAGA 2IF2A 2CXXA 3GLHA 3IO5A 1D5CA 1YRAA 2VP0A 3TSOA 2V6IA 4QFMA 5DNYB 3RS3A 1X1SA 4QHTA 2R62A 1W5SA 2XZPA 4QBGB 3VHXA 4JT4A 4PHGA 3WMFA 3ZIAD 3QF7A 1GM5A 2B8WA 1G4AE 2GEVA 1NP6A 1AIPA 1CULC 2YWEA 3V4FA 4DUGD 3M1IA 1E3MA 2YV5A 2KJQA 2X77A 2Z83A 3A4LA 4Q9LA 2X2FA 4PPGA 4A0GA 4OK3A 3Q72A 2GVZC 1KJYA 1MRNA 3QXSA 5G53C 1G3QA 4JVSB 4PPNA 1RW4A 4HB3A 3RRZA 4XWKA 1B23P 2F9MA 1KHTA 4DCUA 1VCMA 2BWJA 3TR0A 3MLEA 1CRQA 2HLDD 3GJ3A 3NIBA 4XOIA 1NBMA 4JIMA 4XWAA 3EX7C 1G8FA 1RFLA 3CZQA 3RWMB 4B76A 3H86A 4D4KA 5F98A 3R9XA 1DG3A 1R0WA 1G1MA 2GEUA 2G0NA 2ZSFA 3ZZ0A 1ZBDA 2ZU6A 3H2YA 2Z0MA 1W36D 3EIHA 3QVUA 3T15A 4BFZA 3QG5A 3SQWA 2JLYA 3BFVA 3QKTA 1FFHA 4D0LB 4MRRA 2WWGA 3EXAA 1T8TA 3W6OA 4B3DA 2VP9A 3NTUA 1KGDA 2HCJB 2ZE6A 3SJAA 4YXWA 1JB1A 4UNPA 3Q5EA 1P72A 3VR6A 4LWZA 3IBGA 1XF9A 4KLZA 4A36A 1G5PA 1G8YA 1LW7A 4Q9KA 2WWFA 1J70A 4Q9JA 5ANRB 3LBNA 1DPFA 1GAJA 2OCAA 4A0RA 4XIGS 4UNNA 3CONA 4MDFA 3BGWA 4TL8A 3MSXA 4MYTA 1F2TA 1WBBA 3PR1A 2WIAA 3BERA 2BBSA 3S1AB 3SDZA 2QP4A 5SZJA 5KUTA 1E2HA 3OZXA 5AUQA 5B64A 1RYFA 2ZUDA 1QHNA 3QBVA 3BK7A 1P73A 2E1RA 3GJ4A 2WWXA 1PJRA 2WBLC 3JVUA 1XD8A 3Q7PA 2JJ1D 3O8CA 2I1QA 3D8BA 1JPJA 3SI7A 5DN6D 4M2LA 4NYJR 2W2TA 2Z5FA 1YZTA 4ESHA 4BFTA 4OI4A 3ZVLA 2ONKA 4GMDA 4IFEA 1DTSA 3MWJA 4LBVA 4LZZA 1W5TA 2A9KA 3QBTA 2AK2A 2R6DA 3L82B 1OH8A 3RSOA 1T3SA 2NZ8A 4KYIB 3MJHA 5EZ6B 3EZ2A 3U60B 4IVQA 2DYKA 4CDGA 2JEOA 4NBSA 1H8HD 4NU0A 2Z4RA 4LYJA 2PX3A 3DZDA 3GJ5A 3T1VA 4V0NA 2F3TA 2V7QA 2WKQA 3F0TA 1KDPA 2OFWA 3ONWA 4RZ3A 3M0EA 5AJZA 2ZXUA 3MUFA 5C46F 1W48A 2J5XA 3KXIA 1XTJA 4TMTA 4FXPA 2FGKA 2A5FA 2J46A 1XEFA 4Y0VA 4IJMA 1CTQA 4PZZA 4BLQA 5IK2D 2IXEA 1N5JA 2HYDA 1GKYA 2FH5B 1YU9A 1G8PA 1E0JA 4KFUA 2GBLC 2PEYA 3OFNA 1QHHA 3BJIC 1DS6A 3REGA 5JMTA 5EE5B 5FTLA 2D2EA 4TN1A 2J7PD 1G8HA 3WP1B 1N6HA 4ON9A 1KAGA 4B2IA 3K0SA 1E2DA 2ASEA 4CZ2A 4GI7A 5P21A 1ONBA 4QBHA 3U3RA 4B43A 4KAXA 2A5GA 2WAYA 2ZRHA 4HAZA 3KJHA 3NKVA 2BJWA 1XMSA 2HXSA 1DADA 3FB4A 3W90A 2HT1A 1ESMA 4A6XA 2OCPA 4HDOB 2N46A 2ZRMA 4DRZA 3U4QA 4PFSA 1TF7A 1U2RA 3K70C 4W7SA 3QEJA 4IOJA 1G5TA 4JLPA 1U0LA 4P4TA 2YINC 2QPTA 1DAMA 3UG7A 2PT5A 4JYCA 2BV3A 3AKEA 2C5LA 4A2PA 2JGNA 2ODWA 1MH1A 1EXMA 2A7QA 1XX6A 3C41J 5EE1A 4CRWB 4MGIR 3VU9B 2P5TB 2J41A 2CDNA 2Q0HA 5E3HA 4DDWA 3MGCA 5JBQA 3N70A 5BW8A 2PEZA 1X8LA 2C2HA 2QQEA 5FI0B 2H8KA 4Q5IA 1P2VA 4AURA 1KIMA 4AIIA 1W4CA 2PLRA 1VCIA 3ASZA 4O25A 4Q4JA 3SU8A 1ZD8A 4G01B 3CRW1 4TT3A 3IEUA 4PC2A 4L8GA 4C0SA 5LDDC 4F4IA 3UPUA 1UKVY 2GESA 3SS8A 3RHFA 4EKDA 2FOLA 1ZIOA 5B30A 1S96A 4QJ5A 1KYIA 4AKGA 4DBLC 1IM2A 1ZUNB 3QF4A 4AG6A 1KSJA 2QAJA 2AKYA 1E0SA 3EIEA 2QPOA 2ZYTX 1VCOA 3CPEA 2BCJQ 1E32A 1XJQA 2C9YA 1E2JA 3LLUA 3RC8A 1CR1A 4QOSA 1ELOA 1FQJA 4W9MC 1MO4A 3NHAA 3W34A 1E2KA 5FOVA 4D2IA 5JS8A 3KX2A 2Y8EA 2IS1A 1DBSA 1Z0JA 1FW6A 2AR7A 2CVHA 3AV0B 5GJBA 1Q1EA 3LRPA 2GK6A 2ZR7A 2NZJA 3AP2A 2P2LA 2P67A 3LQRA 2ZRAA 3QXXA 1TL7C 4LJ7A 3I62A 4MKFA 3FMPB 1RC8A 2OXRA 3T12A 1KSHA 1P60A 3UK6A 1KMHA 3VX4A 4ABYA 3ICEA 2A30A 3AQ4A 1DAGA 3AGQA 1TQ2A 1KI9A 4QGGA 1BMFD 1T5LA 4ACBA 4LY6A 3IO3A 3K0AB 3A36A 1W46A 1Q1ZA 1OYYA 2ZRIA 3LBHA 4Q4AA 3R9IA 5F9HA 3VKHA 2F9LA 1Z0IA 2PJRA 3T1TA 4YMSA 1S9DA 4UJ5A 4Q47A 2ZJ5A 1YJ5A 2DR3A 3U5ZB 4FIDA 4ZCIA 1ANKA 2AKAB 4LBZA 5SZHB 1R4AA 3C4JA 3QEOA 2YKGA 2ZJZA 4HDQB 4G0NA 4X8OA 4C9BA 1YVDA 2FFQA 1JPNA 1A5TA 3DOFA 4ZIRB 3H0KA 1TX4B 1AQUA 1YQTA 4FCVA 3GLFB 3NH6A 4JS0A 3GLGA 2KWIA 3SJBA 3GEIA 3B6EA 2AXPA 4RD2A 3WP0A 3B2EA 2GCOA 1Z28A 2QRZA 1BS1A 3ZQ6A 3THXA 4LHVA 2ZJOA 2BBOA 5CK5A 1BIFA 4YLGA 3PUXA 2A3RA 3LQQA 3JVVA 3X1ZA 3GP8A 1DO0A 5EZ5A 2JLUA 5KPDA 5KDLA 1Z6TA 2ZVQX 1G3IA 2BEKA 2ZEJA 4JL5A 2RB4A 5FOXA 2GXUA 2CLDX 3W8RA 2WICA 4I1OA 1Q1QA 5D3MA 3I32A 3CX6A 4O2RA 4HUTA 1JJ7A 1SXJE 2ZAOA 3DEFA 1VYTA 1F6BA 1VPLA 1ZP6A 3GCGA 3TVDA 4A92A 1KJZA 3ND8A 4KLNA 4M22A 4DLXA 3BB3A 1XRJA 4ZCMA 3AVWA 5E7IA 3GJXC 3OIYA 4TL6A 3O8RA 4XSGA 4B33A 4JBYA 4LYFA 4WXPA 2EQBA 1ZNXA 2WOJA 2PZGA 2JCSA 4QGHA 1VG9B 3E5HA 1NMXA 3SOPA 1NLYA 3B8HA 1JNYA 1GL9B 4B3CA 2Q3MA 1FX0B 2H57A 3RS2A 2J3EA 3P1JA 4WA7A 4JJKA 1KJWA 1AZSC 3EPLA 1DO2A 1CJUC 4MYHA 5FL7D 1ZNZA 3AUXA 1TPZA 4IXNA 3N2IA 1I2DA 1KKMA 1NBMD 3J81k 2QTHA 2WSMA 2YOFA 3EAQA 2QMOA 2GNOA 3GJ7A 1ZM2A 2WMNB 3LFUA 3LVRE 2AWNA 4K8OA 4MGZR 1A2BA 1KK1A 1R8SA 3KKQA 2KSQA 2ZIAA 3RVBA 1EFCA 4KI0A 5FUXA 2P6RA 2IYUA 4HZUB 4JBWA 4CIDA 1NVWQ 3K70B 4G5GA 1P5ZB 5B58C 3RABA 4L5BA 4TSFD 1VTKA 3W9YA 3P4XA 5GVRA 1C9KA 1N6PA 4TSFA 3VKWA 4MRNA 1DE0A 1DARA 4GMXA 4D0NA 4NYMR 2GXQA 3U6BA 4JL8A 4F92B 4DHEA 4F4JA 3X1YA 5GJWC 4YMTA 1NIJA 5G3YA 3AKDA 1C1YA 4ZDWA 3RRYA 1S1CA 3ZVRA 3FFBA 4O2LA 1TEXA 2EFEB 3BFXA 3FKSD 1DAIA 1NLZA 4RFSA 4BWYA 2ZJYA 4DLVA 3QPUA 2O8FB 1OIVA 2VHJA 2ECKA 2RGNA 2IXGA 2JLQA 3H1TA 2G9NA 4DSOA 3SFZA 1XTIA 3SR0A 2ZI4A 1JI0A 2XTMA 1EGAA 1COWA 1T5IA 3A58B 2J9RA 5G3ZA 2JLZA 5KHOC 1FX0A 1E96A 1US8A 2VTKA 2OBMA 2UVQA 2YZ2A 2ZJ8A 1U98A 3EZFA 3DL0A 3A1SA 5FBRB 4BFSA 4OYHA 2XXAA 1B0UA 1WMSA 3UIEA 1P2UA 2JLSA 3WHLA 1K8RA 4B3BA 2ATXA 4Q4HA 3VR5A 4ZI3A 5JECA 2MSEB 1NG9A 2PBRA 2WKPA 1DEKA 2XNDD 2ZE7A 3SFVA 3LNCA 5EXSA 3AVXA 3GJ0A 4FCWA 2OESA 3RYTC 4E03A 1XZQA 3TH5A 4C3ZA 1A82A 1M2OB 4ZDIA 4Q7LA 3U3MA 1NVXQ 2GKSA 4JVMA 4RY2A 2TMKA 4V0ME 4O0MA 4DT1A 1R5BA 2AFHE 1PLKA 1N6NA 4NPHA 1E1QA 1WB9A 3FMIA 2VHCA 4MGYR 4A1FA 1VIYA 2GF9A 5JI2E 1FMLA 4PHTA 1QHSA 1KNQA 4FN5A 4JZKA 1WA5A 3A1VA 2MMCA 5E4FA 3ECCA 4NMMA 3CWZA 2AD5A 4RJLA 3Q7QA 4Q1FA 3SYNA 3RS7A 3I1FA 3EG5A 4P33A 5C18A 1IQPA 4NYMQ 4EJSA 3QE0A 2YWGA 2ZQ5A 1E9EA 2CBZA 1BKDR 5FBWB 4M1MA 3THWB 1GP2A 4UKDA 1LS1A 4AD8A 4G5SA 1Q44A 1KZGB 2I1VB 4NTZA 4TLEA 4II7A 2DFNA 3SYKA 1E2FA 1W1WA 1E6CA 1P2TA 4Z1MD 1F48A 3HR7A 2LKCA 2ZE5A 4E09A 4J0QA 5AK0A 2RHDA 1IN5A 2ZRLA 1YHNA 1Z0DA 4DIEA 1FUUA 1KO7A 1G6OA 2BDTA 2O0KA 3PVSA 4IHQA 5IT5A 1Y63A 5KNDA 1XD9A 2QAGA 3W5JA 1F2UA 1I2MA 4KYUA 2GZDA 4DEXA 2Q6TA 3VKGA 4C0AC 2HDNB 2ORVA 2R44A 4Q4LA 4FINA 5FR2A 4LHWA 4ZV4A 3WNCA 2R2AA 3ZGXA 1G3MA 1L4YA 3AEZA 2GK7A 3PIRA 4GOXA 2V55B 1IN8A 2QM7A 2VIIA 1KDRA 2D7DA 3NC0C 2FDCA 2REOA 1X86B 4BASA 1OYWA 3AVTA 4WAUA 3AUYA 3PCRB 1SXJD 5KNBA 2QBYB 4R71A 3CH4B 4HLQB 1XEWY 2BHRA 2XTZA 4EAQA 1E2LA 5JRJA 4TMWA 5DSZA 2QT0A 2WV9A 5H8WA 1UEIA 4FW9A 4JBXA 1GWNA 4LOAA 4RD0A 4C0KA 5FOTA 2EWWA 4DLSA 1TQ6A 4YMUA 5KO2A 1JR6A 1GOTA 4BEJA 2BM0A 2IT1A 3U7FB 3QKSA 1G7RA 1UEJA 2XEXA 2IXFA 3GJ6A 2W2XA 3PEVA 4HB4A 3CX8A 1JR3E 5A4JA 2KBFA 4I4LA 4US2R 3L43A 2ZI3A 3WNBA 2ZRGA 2O0JA 1SULA 1KOFA 1M6NA 2JAQA 2CL6X 3QJYA 4D4MA 4EUNA 4YXWD 5EXXA 1MO5A 1UBGA 2OBNA 1OH5A 4PSAA 1NN1A 2O8FA 1HT2E 1AS3A 1G9XA 1HE1C 4KBFA 3D6TB 1N0VC 5DHFA 1D8TA 1EFTA 3PUZA 5DISB 5EXTA 4CEIB 4TYYA 1YR9A 3K0FA 5GADl 1X1RA 3L0IB 2BJVA 2WPDD 3UXMA 2WM9B 1QHYA 2J0UA 4XVQA 4HZUA 4CT5A 3KJGA 1G64A 1W0KA 1XD2B 1SHKA 1XMIA 1E2EA 4B2LA 4WBSA 2R6AA 3ZJYA 2RGAA 3HR8A 3TQCA 2XXAB 1TUEA 4IOLA 2BMJA 4QXAA 4NYIQ 1XEWX 3T1QA 2JJ2A 1E4VA 1BO6A 3WRYC 5CK4A 3LBIA 3TUJC 2RAPA 4OHZA 5KU1A 1MOZA 3CIOA 1UKZA 4DCTA 1CU1A 2OHFA 1NMZA 2CJWA 4G3XA 4NE2A 4M1OA 1IXZA 4LHXA 4Q21A 4C4PA 2V7QD 4B6FA 2RH5A 4AKIA 1V43A 2NO1A 1E79A 3D7MA 3ADDA 3FTQA 3BRWD 5AJYA 3GLIB 4FMCF 3AGPA 1YZUA 4LJYA 2RHMA 3L0SA 5FBLB 3P4YA 2A78A 1OKKA 4AG5A 2X1VA 1KK3A 5JI3E 2ZRDA 1E99A 4XSHA 4RFVA 4BZQA 4C2TA 2F1IA 4V0MA 3T5DA 1Z83A 2FFAA 1J99A 2H18A 2L0XA 3QPVA 4V02A 4ZO4A 3W6PA 3BIFA 2H7VA 1JQJC 1JECA 1HTWA 1SZPA 1XCPA 3IHWA 5AJXA 3U3KA 5DN6A 1H8EA 4XVUA 2FSGA 1OHHD 1ZU4A 1GNPA 4CGZA 5FBVB 4Y0AA 4H1UA 1HURA 5GJCA 1WE2A 2IYXA 3PITA 2FSIA 1GL7A 3EC2A 3O8DA 1TEVA 2CNWA 1K5GA 2XB4A 1N6IA 4EFMA 4LV8B 3C7KA 3GLIA 1XTRA 2GCOB 2BVNA 3OESA 2V3CC 2YC4C 3A1UA 1XTKA 3AKCA 4RD6A 3M6AA 3RRNA 1PLLA 2XNSA 2D74A 1NVVQ 8OHMA 3BB1A 1OXUA 3IHLA 2BCGY 4RFSB 1Z6YA 3SYLA 5BN3A 4BFUA 4BRWA 4A8JA 1JQLB 1H8ED 3VR2A 4JLKA 4EPWA 1OLOA 1K5DA 2GWHA 2QSYA 2WSSD 4M1TA 1KAOA 2ERYA 4LJ5A 2PL3A 4X8HA 3RC3A 3VAAA 4DLWA 1UAAA 4URXR 3B60A 3AP1A 5LB2A 3K0AA 5DO9A 1VHTA 3DMNA 3H84A 1UKYA 4WIAA 5TDHA 3SJCA 2QY9A 2J7KA 1MRSA 1W36C 3WNDA 4P31A 4LJ4A 2R6CA 2RGNC 2FE4A 2QAGB 4QBIA 1Z0FA 4W5HA 5TVKA 3X1XA 1Y3AA 2O8DA 4K81B 2H5EA 1AS2A 2Z6VA 2V8OA 1ETUA 4KU4A 1ZC4A 4I1SA 3OE7D 4YDHB 3FPAA 3F3YA 1DELA 3B9PA 4XJXA 2Q3FA 3B85A 2O8CB 1Z2AA 1FUKA 1NY5A 2OCBA 3BBPA 4S35A 2ZTSA 5CLQA 4BZPA 3G5UA 3TAUA 4OK6A 1MT0A 3CM0A 3THWA 1C4OA 3L0PA 2IX3A 1NN0A 4KFRA 4B44A 3IIMA 4F91B 5FH9A 2ZR0A 2BBWA 1FP7A 2VHTA 4V03A 3HP1A 1KZ7B 2ZSDA 4POAA 3C5HA 3F5FA 5CB8A 1CJMA 3U44B 4IOKA 4C0QC 5K8LA 2PJZA 1AJEA 1TTTA 2ORIA 1T6NA 2BEJA 3A4NA 2XX3A 1GSIA 3Q9LA 3WY9A 1XNJA 1VCNA 1E98A 4HAXA 4B6EA 1LVGA 5TV2A 1TQDA 5IDVA 1NVUQ 1N3BA 4M1YA 1NVVR 3LXXA 3CNLA 1NSTA 1G8GA 4MUBA 2C98A 5DYGA 5E95A 2CK3A 4D0GA 4KO8A 5CDFE 1E9BA 3QF4B 2WJIA 4HEJA 1NJFA 4PSKA 5DLQC 4DXAA 2CMKA 5KPJA 5CYOA 4RVCA 2BBTA 4ERNA 1P9RA 3AVVA 2P65A 2CHGA 2C99A 4YQFA 3MRSA 2J0QA 2B7BA 3WBJA 2G1KA 3R7WB 1AKYA 4MUAA 4PPQA 4D80A 1CF4A 4BPBA 1J2JA 2IYWA 1GILA 1RRGA 2WMOB 2FG5A 3LAWA 4BLPA 2ERXA 2PZEA 4LDJA 5JRZA 2VEDA 3FGNA 3U3OA 4IDNA 4PSVA 2QMHA 3GLFA 4DSTA 5BWMA 4A4DA 4OHYA 2GILA 3NC1C 3TSZA 5HE9A 4LC0A 5SZIA 4FWTA 2QBYA 2BC9A 1TUIA 3LXRA 2O52A 4AWXA 1DOAA 4MQBA 4AC9A 2N42A 3UWKA 3QI2A 3S1AA 4NCHA 2ZI9A 1WXQA 4IW3B 4B75A 4RZUA 1DAHA 1UDWA 2H16A 2HT6A 3VHLB 1E9AA 3HYTA 1XFAA 5G41A 3CF6R 3BH6A 3CH5A 2C8VA 3RSLA 3BOSA 3IQWA 5FTKA 1SHZA 2C03A 1HEIA 2ZSBA 2UZ3A 1M7BA 3ZZTA 4ZDKA 4AY2A 2ZITA 2OE2A 4H9GA 5CLLA 4ZI2A 3TAHA 1AM4D 2B6HA 4S2EA 2IWHA 1XDBA 3GLIE 4Q7JB 3VTKA 5A5GA 3U2QA 2W6JD 5KSPA 2FN4A 1TQ4A 3FOZA 3N5CA 3A37A 4CEHB 2PCLA 4R2IA 3IQXA 4PTLA 2HYIC 3B9QA 2E9SA 5AR1A 2PZFA 1OFTA 2QP9X 4AYTA 3IIJA 4LSGA 2XZOA 3FDIA 3QUSA 2UZIR 4QJ4A 4UXHA 1N5KA 1GTVA 3BFKA 4G5RA 5KTYA 1KK0A 3EC1A 3CX7A 3I61A 2ODNA 2F7SA 3EASA 4K46A 3R7WA 4HI0E 4B47A 4Z54A 4KSCA 1LB1B 5IHPA 2W83A 3G82C 4PQYA 4Q1BA 4P4SB 4JLAA 4MGKR 4FMBB 2VL7A 1X6VA 4N0EA 1Q0UA 3CLVA 4YMWA 2IUUA 1NL3A 2FFBA 3AF4A 4Q4JB 4NZYA 1ZNWA 4A0HA 4EPTA 5JJIA 2J1LA 3VR4A 3KTAB 3KFXA 3NDBB 5HKKA 5CIWA 1GRQA 4R98A 4B3GA 4GZMA 4A0FA 2JATA 4HLUC 1SQ5A 1SVLA 2O8EA 4B35A 1XZPA 2P6NA 4JLNA 1DG1G 2EFDB 1NN5A 1HE8B 3IPXA 4AI6A 1MV5A 1UPTA 2AHOA 3BD9A 2DFTA 1KO1A 1Z29A 2QN6A 3DOEA 4BUJA 2FF7A 2A5JA 3NBYC 4XVRA 2XSZD 4CEJA 4YMVA 1GKIA 1Z0KA 1ZINA 4I81A 4Q1DA 4B32A 3KZ1E 2IYVA 4AK9A 3UMRA 1OV4A 1S3GA 2OM2A 5EUMA 2FEOA 3FKSA 4EIWA 3WBKA 3SC3A 1KTVA 3IPYA 2W6IA 4HLDA 4DT1B 1NMYA 3AKYA 3KKPA 2JJ8A 5KDDA 4C0HA 1Q3TA 2IYRA 3OEEA 4LJ6A 3WYAA 3CF2A 5SZKB 3W3ZB 5L8VA 1ZRHA 2A2ZA 4GBMA 3THOA 1KY3A 3H4MA 1G7TA 3DKPA 2CJWB 2J45A 4D26A 4L9SA 5L3QB 1JR3D 2ZREA 1Z5ZA 3A4MA 1SKYB 2CL7X 3NBFA 5TMPA 4TL7A 2ZVPX 1EESA 4BFWA 2OSBA 4DCNA 1QVAA 2Q3HA 3V4RA 1Z47A 3T1OA 3PUWA 2OLKA 2ZI5A 2GAOA 4Z8XA 5DE3A 4B73A 3BXZA 4MH0R 1PZNA 2ZRPA 1W49A 1E4YA 2ZSEA 4NDZA 3AB3A 1N6KA 3K09C 1E9SA 1Q3HA 4RZ2A 5JJLA 4Q00A 5L3SB 1MO3A 3GLHB 5LD2B 2X8AA 1N6OA 1II8B 4NONA 4TTQA 2DPXA 2IUTA 2CL0X 3GLFE 2O8CA 4FMDF 4HSEA 3PEYA 5FPHA 2ZJBA 3TQFA 2Q9BA 1Z8FA 2IS6A 2OXCA 3TIFA 2ORWA 5FTJA 1XXHE 4DB4A 2D62A 1E1RA 3QVVA 4LUCA 3I5YA 2ZYVX 4FI3C 1P7CA 5CITA 1R5NA 1NKSA 1A1VA 4C7OA 1Z6XA 1YZNA 4I1UA 1P9NA 4PAQA 4IRUB 4C7OB 1GKUB 1JAIA 1VHLA 1U99A 3QXJA 1Q21A 121PA 3LWNA 4NYIR 3I4LA 2WJGA 2PMDA 5K8UA 4B34A 4QM6A 4DIDA 1CR0A 4EPXA 1DAKA 4MRVA 2OLJA 2EFCB 1ZCAA 1SVKA 3B82A 1RE0A 4IDHA 3MWYW 4FMDB 2NTYC 2QORA 1VDZA 2QMEA 4IDOA 2AFIE 1COWD 4LYAA 5AWFC 4E07A 4D4JA 1RRPA 1F2UB 5AJWA 1Z3IX 2P3SA 2CNWD 4XH9B 3T61A 5H70A 5JSZA 1II9A 3T06B 3E70C 1ZW6A 4WOPA 2EYQA 5CYPA 3DM5A 4UNRA 1K6MA 1SKYE 1R0YA 2EWVA 2N1BA 2K5UA 4TYQA 3T34A 1OHHA 2WVJA 2G6BA 5JWRA 1CBUA 5J4KA 1XTSA 2W58A 5DGXA 4WW0A 1ODFA 4P4UA 1ZMXA 2RMKA 2Q9AA 3U6KA 4LHYA 3W3AA 3MCAA 4RCZA 2FJUA 2J0SA 4QGFA 4HAVA 2J0UB 3E2IA 2FMXA 4OQMA 2ATVA 1G18A 2B7CA 4QL3A 5K8IA 3AF0A 4ZCLA 4B48A 4EJSC 1N25A 3ZVMA 4TWZA 421PA 3KQLA 4PAOA 2JDID 4PPFA 1R6BX 4PZLA 3ZS9A 5CB6A 1BMFA 1G16A 3NVAA 5TARA 1EX7A 2WJYA 2IWRA 3W6NA 2VQSA 3OE7A 2CHVA 3IEVA 2C77A 4LPKA 3AF3A 4AYXA 4TQ9A 4TYPA 3HDTA 1QHGA 1IHUA 4QJ3A 2IYQA 2ZRKA 3AF1A 2QROA 3KUCA 1X8KA 3A1TA 5BN5A 5BYKA 1KI4A 4LPSA 2NPFA 4KFSA 4DSNA 4C2UA 1S8FA 1XXHA 5CM8B 3LW7A 3MWKA 4PC6A 4TLDA 3QPWA 3C8UA 3K09A 4PR0A 2HF8A 5TY0A 2VP2A 1R5OA 3FE2A 2R6FA 4IEEA 4OQNA 3CNOA 1VYUA 5LBIA 1OH7A 3FKQA 5TXGA 2JLWA 1W36B 2OT3B 4KCGA 4DJTA 1KK2A 1L2TA 1S4QA 5IK2A 5TB5A 4DDTA 4M1KA 3PQCA 3ND9A 3U44A 2ZRFA 2GXAA 3UG6A 1VG0B 2DBYA 3SHFA 3KQUA 1IBRA 1YRBA 1G7CA 4W5JA 1ZVQA 2NOAA 3L2OB 2DCUA 3FHCB 1IXSB 2REXB 1UF9A 1AZTA 1TMKA 3R9WA 1GUAA 2D06A 2GA8A 4KFTA 3FMOB 1OFUX 3EW9A 2ZUBA 3VR3A 4BLSA 5BXQC 3C5CA 5CM9C 4O3MA 4ESVA 2A5DA 3EPKA 2O0HA 1JXOA 1OW3B 2C96A 1YKSA 2AD1A 2QMUA 3B5JA 3IUYA 4IOMA 4L15A 4M1SA 5E7JA 3UMFA 3QQ5A 2RGCA 2ZPTX 4DKXA 4TLBA 5FR1A 1KI3A 4Q7MB 1E9DA 2I4IA 4ARZA 3K70D 1U9IA 3CRMA 1KO8A 4BQSA 4BEBA 1ZM3A 1S9HA 3K9LA 2AK3A 4QNMA 4ASUD 4CVNA 4C30A 2PT7A 4KJZA 3B1VA 5HZKA 3WMEA 3MAAC 2DWOA 1Q12A 3CZPA 5HCIA 2ZM5A 2QTVB 4D82A 2ZROA 2Q21A 5FFMA 1P62B 5B2ZA 1II0A 2VP6A 5FTMA 3FVQA 2IYZA 2GDJA 5FUYA 2V1UA 5LB4A 4F7WA 1OIWA 4U7DA 2R65A 3CRVA 1ZC3A 2UKDA 3IGFA 1H8HA 4OJQA 2F43B 3SZRA 2FPMA 3IIKA 4CEJB 1R0ZA 2QG6A 4IEIA 1JEDA 5J4HA 2O8DB 4MKHA 2HV8A 2WKRA 1TADA 3FHTA 1R2QA 5EP3A 3GFPA 3GMTA 4PANA 3BORA 5FUVA 3KL4A 1EFRA 1W44A 1CXZA 3DVLA 5JHHB 2GJAA 1Q22A 3AH8A 3OEHA 3EWSA 3FWYA 1GG2A 2WAXA 2FPKA 3HPQA 2RGBA 3CNNA 4N1AA 1HY3A 5UKDA 3F8TA 4OI0A 4Q02A 1QHXA 2ZJ2A 4QNRA 4A9AA 2IBMA 2VF8A 2FZLA 4M9SA 2JJ1A 3SBDA 3K8YA 3KKMA 4N0DA 1J90A 3IBYA 1M7GA 2WPDA 2LWIA 2YVUA 1D6JA 4L9WA 2MSCB 1OH6A 2CHQA 1G4UR 3V00A 1JXMA 2IW3A 3UMSA 3MFYA 3M4YA 3W8NA 2O8EB 4IDPA 2PH1A 1W4RA 2VHUA 2O8BB 1H65A 3BE4A 3HPRA 2DHRA 2OEPA 1UBCA 2QPAA 2IYSA 3CO5A 1QRAA 5AUPB 1NI3A 4TTPA 4DLZA 1NNEA 4Q9HA 1NG1A 2JLXA 2DY1A 3L0OA 3ZVNA 1SVWA 1ZJ6A 3QNUA 1ZM7A 5F3WB 2C04A 2R9VA 2SHKA 4PZYA 5FPSA 3U61B 3GPLA 1HYQA 3EA5A 3I8SA 2ZRNA 4JLDA 2NG1A 4BLRA 3PXGA 4B71A 3AM1A 4GP7A 3RNLA 2EFHB 2EYUA 3VFDA 1XJCA 2AWOA 4PQRA 3U7HB 3CWQA 2G77B 1ZU5A 3MMPA 4D25A 3P26A 1ZAKA 2GCPA 4DDVA 1G5RA 2B21A 5FL3A 5H1YA 2CVFA 4Q7KA 5EQTA 5E7MA 4JMPA 2FV8A 4RKEA 1XPUA 2IC5A 5JZVA 4PHHA 2QGZA 1M34E 3NG1A 4RD4A 1OIXA 1E2QA 2DWPA 2OV2A 1YR8A 3BH7A 2IYYA 4TLAA 3PV0A 3GEEA 1WDTA 3CPJB 4F4CA 3ZD6A 4L4UA 2WHXA 2CLCX 2WWIA 2LKDA 3EPHA 3WYFA 1KMQA 2KBEA 2RGEA 4NCIA 3HWSA 3LVQE 1KI2A 3AVOA 1GZSA 1OKKD 5JJKA 3NXSA 3CUEF 2FWRA 2WWWA 1KO4A 3GLGE 3KFVA 2ZANA 4CT4B 1PUJA 3KJEA 4Z1MA 1QHHB 4QG7A 3KB1A 3D3QA 2G0TA 5EP1A 1VECA 1U8AA 2P6UA 2P5SA 1TU4A 3P27A 4JLMA 1FP6A 1J7KA 1U81A 4HATA 3ZIAA 3EA0A 3K9GA 2GEDA 3K9NA 2YWHA 4GOJA 1XPOA 1L8QA 1GFIA 2NIPA 2I3BA 4JLOA 1G19A 4R9UC 3CR7A 1ZUIA 3LX5A 4TMVA 2C9CA 3AVYA 1BYIA 1BH2A 1SVIA 4KODA 3K9HA 4V0LA 3NDPA 3RRMA 3GFTA 1LFDB 4PXAA 1X3SA 1W4AA 1MR3F 1S0UA 2HLDA 4XD7D 2C78A 2JA1A 2YOGA 4US1R 5FL7A 2F55A 2Z43A 3FYHA 1Q1BA 2A5YB 3GLHE 3C14C 2ODEA 3K0CA 3QXHA 4GP6A 1YZKA 1U0HC 1CJTC 1ESNA 1M7HA 3KB2A 1U8YA 3NWJA 4Q18A 2QA5A 2GJKA 5HTKA 3SJZA 4ITRC 3GLGB 2F6RA 3PEUA 2YC2C 4KVGA 2O5VA 1NLFA 2W6JA 1AKEA 1XWIA 4NCJA 3NH9A 4HAUA 5JWOA 1XMJA 4LBYA 2OZEA 4TYWA 5BQ5A 2H92A 1E2IA 1NF3A 4GDFA 4MDEA 1OJLA 1E0AA 1CRPA 1Z08A 4JVLA 3PUVA
chains in the Genus database with same CATH superfamily
1V7QA 2YRWA 3DAYA 2C20A 4D3SA 2YWJA 2EFJA 3WYGA 2JIZD 1JJVA 4EMBA 3Q2OA 4UREA 1L5NA 2OFFA 2P2GA 2V6JA 3OX1A 1PT5A 2IIBA 2W9XA 2GT1A 2W6ZA 3AESB 3NOQA 4RKYA 5AM4A 5J9FA 2V54A 1JNXX 2H51A 5KYKA 2ZSKA 5CFNA 1VI2A 1EP9A 5HILA 1H5NA 3LV8A 4GZLA 5H4HA 4DQ0A 1ZEMA 2XCUA 3VZBA 1UOOA 3QX3A 1UJ5A 1C8LA 2Z4SA 1WMFA 4G1UC 4YRJA 2Y1DA 3PG5A 1O94A 3NIGB 3ED1A 3R6GA 4NPCA 5DI3B 3WL6A 5DCLA 4RJTA 5CDHA 3H2SA 2CNLA 3P9XA 2OP0A 2D7JA 3KQTA 1JSLA 3QKSB 3U3JA 1RZ3A 1SHUX 2JW5A 3DMDA 3RFXA 1M1YE 1WVIA 3KSRA 4GRAA 4E32A 4MRMA 1ZCBA 2YH2A 2P68A 2B1RA 1Q6ZA 4FE4A 3U4CA 4LRWA 4QYWA 1QWSA 1Z2CA 1T3LA 4KWEA 1B6GA 5EMNA 1EFUA 1UBUS 2YYZA 3QNMA 3HEBA 2FZ4A 5DBIA 1ZOOA 1ZI8A 5E3JA 2XIQA 4NDNE 4X7RA 5JS7A 1U9ZA 3TSWA 3TLAA 3WO1A 2ERCA 2NO5A 1Q16A 3DZBA 4L5JA 4GOKA 4DTIA 2H0QA 5FUWA 3Q8XB 3HZZA 1P9WA 4KQHA 1ONSA 4YONB 3W78A 2EFYA 2IS4A 1R0KA 3T3HA 1IMOA 2WAMA 3FR7A 5FAXA 2G07A 2Q4TA 2NO9A 2JBWA 3BD7A 4KK3A 1Q0SA 3I5MA 1ZRSA 3L77A 1AF4A 1II8A 4LVUA 2RCNA 3EAGA 1FU7A 1OSNA 2IUEA 4ZQEA 3U62A 1ZO8A 3UK0A 1NPDA 3BFPA 5LM3A 3PEWA 1UODA 1WXHA 2PUEA 5A0TA 1AOXA 2XJ9A 4LV6A 2WWHA 3PJRA 2Q7XA 4OBXA 4WK0B 3WAKA 5FLYA 1BRMA 4JLSA 4F5WA 4GT1A 4KEAA 3P96A 1T8UA 3NTRA 3MJTA 1F7VA 4KWIA 1N0UA 1CLUA 4IEFB 4MDYA 2BHNA 3MRTA 1Z74A 4NYJQ 4XD7A 1F51E 2HF9A 1H2XA 1WTAA 4EHAA 2AS0A 1KH2A 2AI1A 3B1ZA 1RNLA 3CUKA 5K0LA 2WJVA 1GNQA 1P6XA 3NALA 3TFQA 1FQKA 1O0CA 4D02A 1YXMA 4OAPA 3AB8A 4ZKDA 3REFA 4R0MA 1Y80A 4WFQA 4ZP1A 3Q7SA 3MWLA 1U1IA 1IOZA 4MO9A 1NVDA 1NBHA 4UPEA 2AHRA 4C4YA 1XPRA 1LSSA 3DKVA 3RS4A 4IJ5A 3AVUA 2IHZA 1BXZA 1FSFA 1OCEA 2D3TA 1V47A 3K2EA 3L0BA 2HHCA 4GNKA 1LFAA 2WILA 4HADA 4CCWA 4CMEA 1KYVA 2D1TA 1G38A 1W73A 2AX4A 5DVZA 4UBMA 3OIUA 1HNWB 3KT8A 3LPAA 1W2WB 4MRSA 3A7EA 3AY0A 3OP4A 4X20A 4C4XA 3I53A 2B37A 5TLSA 1JSRA 2W2PA 4AKHA 5C4GB 5AK4A 1ZM4A 3KJQA 3PXBA 1GUYA 3TRDA 2ONJA 5AI4A 4LWPA 1RBYA 4ICIA 2PD6A 4A9AA 2PS0A 2XNHA 5B58T 2XEDA 1E0KA 1P31A 1BOFA 2P62A 4FWIB 5H9VA 4ER7A 1V4NA 3FDZA 1JYFA 2OCDA 3QXCA 4P3KA 4WESA 5TX7A 2JGMA 1CQJB 2JZCA 2W8BB 5EIBD 4HAWA 4QTTB 2OC9A 2O2IA 2AFHB 3BN3A 4XM1A 3WADA 1RVV1 4OHWA 3WJ7A 5HJ5A 2G9ZA 4DLTA 3T35A 4MJLA 3BDIA 3IBTA 3WHPA 1I2AA 4PQFA 4LX0A 2OZKA 1VSVA 3ZEAA 4MCAA 3HNRA 3SOZA 2E4WA 5JROA 2VRWA 3OC6A 5LYJA 3D6UA 4YVFA 1CY0A 3RVLA 4IIUA 3TTTA 3F7TA 4B74A 1MHTA 4G5OA 5AKXA 4QYSA 5KCZA 1JMYA 2CYCA 2DOKA 1FDOA 1Y7IA 1EVEA 2WJWA 5FBQB 4BE9A 5CDSA 3ES9A 1AV7A 2AYYA 3OECA 2ONZA 1JKMA 4TLLB 4E6PA 2VJBA 3I09A 4A6PA 3G7UA 4AJHA 4P2GA 3CT6A 2AUNA 4ZEOA 1TLLA 5C4MA 4DGSA 2QSZA 4RPJA 4R5MA 5D3MB 3TS1A 5JUWA 3E3NA 4EITA 4N8DA 2VSQA 3OFND 4LCBA 4PFJA 5CCBA 2PBLA 2XPCA 3QENA 1J0CA 3PE6A 1CJVC 3Q3GE 4IQFA 1QNFA 3TTWA 4MV7A 3DXZA 1SGWA 1Y1QA 2G28A 2QLJA 4FWBA 4DYDA 1C30A 3FBTA 5CVDA 1MLDA 2M6RA 3H5OA 2OUKA 4HQNA 1RJ9B 2F43A 3VDNB 5BP7A 1Y6RA 1ADGA 2P0EA 5KSYA 1IJBA 1JAXA 1A98A 1EBUA 1OYVA 4J9VA 1UDAA 3GHYA 2GJ8A 4IXDA 4KUGA 3RNOA 4N40A 3VC3A 1R0RE 2PGNA 4QUKA 5K20A 3KSAC 1CKEA 1PN3A 4P3NA 4R01A 3PHLA 4E6EA 1PHRA 1JVSA 4JLVA 5IVIA 3KUDA 2ZJ0A 3O47A 2N75A 3QBJA 3H5TA 4Z3OA 2GTPA 3A8TA 2FWPA 2YDXA 3ROKA 3WRWA 2IYOA 1N5RA 1ZD9A 2GA9A 3KB6A 1D4AA 1J8YF 2F1RA 1ULZA 16PKA 2IHBA 5BVGB 5T7BA 4CWAA 3EGOA 4KG7A 1FTSA 5JSFA 4EMSA 1ZRMA 4ZARA 2Z9DA 1NNLA 1C29B 3ZJVA 1DJMA 5CHYA 1XN1A 2A92A 4LV5B 2I6GA 3CRQA 1O0SA 7REQA 4F6LA 1RHRA 2QAGC 3EZ7A 2OBFA 3NHKA 4RTOA 5DI3A 4Z9XA 3WXMA 5F7OA 5IDWA 1Q83A 4HTFA 3D0OA 3KELA 3TGPA 3GFRA 5GVSA 5KB3A 2QKYA 4DV1B 3LT5A 2EW8A 2X2PA 5ALJA 2FPLA 1D04A 4TTRA 1IY0A 3A4TA 1IONA 4M1EA 5JU6A 4P86A 1QOPB 5B6PA 1J0AA 1I4DD 3FZYA 5IJAA 2O8BA 4OQLA 3LUAA 4JEMA 1TK2A 3UKDA 4ACBA 2HX1A 4KP7A 3T54A 4WERA 2GK4A 1CEEA 1SD1A 3ZW7A 3E35A 1TZKA 4C6TA 1SOVA 2FUCA 2QRVA 1HQYE 1LDEA 1BFKA 2WM8A 3DFMA 1DC5A 3TEFA 4QU5A 2R8PA 3A7DA 1U28C 3C16C 3W2GA 4AS2A 2P4QA 5CYGA 4JHLA 2AYZA 2CWWA 3P0IA 4PG4A 5DI9A 2FRDA 4DG9A 1DJOA 3EIQA 2PLFA 4INZA 5EZYB 3UWOA 2APJA 2BMWA 3NBMA 1U2SA 4QGAA 1HI9A 4TMZA 5EIWA 4IGFA 2QD4A 3EEOA 2VP3A 3BHMA 1V7CA 3TRIA 3KEFA 3AEUA 2H2HA 1L0BA 5DYWA 4BNWA 3HU2A 4ILEA 3L4BA 1ZK3A 1FVFA 5LD2C 3KZNA 1OAAA 2MSLA 3SEAA 2VNHA 1A7KA 1C9MA 1Y33E 3NYQA 3TDNA 4CKWB 4BECA 2OD2A 3I9NA 2FMIA 2VAWA 3I5UA 3LLSA 4RSGA 4G56A 3BWYA 1DDGA 1U3FA 4FQ7A 4JLJA 3TVTA 2R6JA 3O3CA 3G1TA 5CJPA 3WNQA 8MHTA 4XOUA 2IW1A 4O4IA 4UVGA 2VC2B 3C3BA 1S3FA 2PBZA 3KZKA 1QDEA 1QGDA 2C31A 3OJLA 1PAUA 4WCFA 2P78A 3STTA 2ECQA 2F1KA 2IJGX 4ISBA 4LSZA 4Y6OA 1KBOA 2B0CA 2QR2A 5EJAA 1TVCA 2I91A 3VNAA 3GIDA 1F4LA 5JTUA 1BW9B 2QEQA 3FTPA 3WA6A 2Y0EA 4K05A 4LRTB 3PI6A 3O1LA 1THGA 1OXXK 4U6SA 1EJ2A 1L5OA 1GTMA 3KTAA 1EUDA 3GA5A 1UIMA 1W75A 4I6JA 1C3JA 2JLVA 5FT9A 1RYDA 4M9QA 1P7YA 4DUYB 4EAAA 2VYCA 3MWDB 2NGRA 2NSYA 4TRRA 1IY1A 2Q3BA 4G1BA 3ZY6A 1JSZA 2BGGA 1PFQA 2JCBA 2HPHA 521PA 1X80A 4US0R 4DMKA 1DRVA 1L7EA 5FTNA 2QL5A 3ZV5A 5AVWA 2ZXFA 5LSAA 1HSOA 3HJRA 3GG9A 1S5PA 3PHBE 5CT4A 2BW0A 4DM4A 2BTOA 1P2DA 4RPLA 5DLYA 5FADA 5TR9A 4BGDA 1W2GA 1WZ2A 1I2ZA 2BGTA 4ZAYA 3WKEA 1F9EA 4FDMA 2VWPA 2ZIWB 1K6EA 1JEQB 1NXVA 4RY8A 5JD3A 4YPOA 1QDUA 5DK4A 4MEJA 1UANA 2PL5A 4YT5A 2IV3A 3ETGA 3U3XA 1KZ9A 4MWCA 4DSZA 2RONA 4E22A 4Q6WA 3BILA 2DT5A 1QG2A 3ZW8A 4PC1A 3I01M 2XOXA 4JLBA 4OP3A 1PT8A 4ZOCA 4ERXA 3KS9A 2JGLA 1U1DA 3WK5A 4ZJUA 1S8AA 3AY7A 2VT2A 2ZUCA 1OXBB 5EIOA 1XELA 4E5DA 4KITB 4BMVA 4BNGA 2AC4A 1WU7A 1WZIA 3G0BA 4CMBA 5MGBA 4EGQA 1H0KA 3A70A 4PTZA 1KQGA 5E6UB 3N0TA 4BIMA 1RC1A 3L1VA 2WJJA 3OZTA 4ZKEA 2FG6C 4GD3Q 4OLHA 3RO7A 5CMLA 3T7TA 3T3EA 2UYCA 2H08A 4UDNA 2PE5A 4ZOLF 2Z5LA 3DB1A 1OPXA 3ZY5A 1U9YA 1PKEA 4DQUA 4ZJZA 2KLBA 3AZQA 4KZKA 1BN6A 1OT5A 3U1VA 2Q5JA 4QXOA 1QQAA 5K4HA 1N1DA 3DYBA 2EZTA 2I6UA 2JH9A 2YRXA 3D3JA 4DC9A 1U9IC 5T8KC 3VR6D 2QD3A 3SNHA 2OAP1 3ZH9B 4DCPA 1CVRA 4CCYA 5CNJA 2EP7A 1BYUA 1QIFA 1Y0BA 2EX4A 3PPWA 1FIUA 2CHEA 1UPCA 2H17A 2MOKA 1RP7A 1M0TA 3BULA 3JYPA 3OF5A 4HQKA 4NATA 1OBCA 2XBUA 3KQMA 5JH7B 4JBHA 1TT7A 4BBPA 3BSWA 1FP1D 3ST7A 1ESCA 5COAA 3B3FA 3D4NA 3LECA 3UPDA 3RLFA 2UZ4A 1BKSB 1DB3A 5J2TF 1KKUA 1O94C 1Z56C 2RGDA 4HGQA 4YHBA 1X92A 4YJHB 4FZRA 4RHXA 3CJRA 3D31A 4N3NA 4JSYA 3JALB 4HGPA 2AEJA 1AKNA 1H2BA 5HPYB 5CW1A 4EPVA 3T5AA 1P2SA 2CEKA 1DQZA 1RE1A 1JE1A 1IN6A 3GCWA 4YYZA 3LA8A 1J1ZA 3NTOA 4MGEA 5LZ4A 3AONB 3TRKA 3SM3A 1OXKB 1RJGA 1L8OA 2L42A 4G1VA 3A3KA 3S2YA 2I7XA 1RJEA 1QGUB 2I2CA 2ZPAA 3L3BA 1VI6A 4L08A 3H19A 3HCBA 4LG1A 1P7ZA 4UNSA 2BKUA 3D64A 3KPVA 4TYMA 4W5NA 2ZYWX 3T0IA 4ZO8A 4AULA 4BP8A 2W8ZA 1E3EA 3B8EA 3DZ8A 3F96A 4H1VA 1YS1X 1Z9BA 5FYDA 1GR0A 4C43A 4CLRA 4L74A 4GZ6A 4IQ0A 2NT3A 2GNPA 1OF1A 2JARA 2YUIA 4L8VA 5HRCA 4B46A 3R3SA 2OCYC 4HLCA 1FNMA 1Y6GA 1XJ5A 4JJEA 4FSDA 2G72A 1BNCA 4L72A 1ORHA 1SC9A 2GBIA 2O2ZA 1L4KA 2JLRA 3HFGA 3K4QA 2ZS9A 3S28A 1MV8A 1KJJA 1Z4OA 3KAJA 2LCFA 1XBTA 3GNTA 3K6RA 3KEMA 3L8FA 4ENUA 1G7SA 2YWBA 3KIPA 3IAM6 2V9PA 3ITEA 3BM5A 4GSYA 4ZO9A 1XYGA 2GAAA 2Q5OA 5E1OA 1N0IA 1CFJA 2G04A 4JI8B 4L28A 5J4LA 2IYLD 1QQ5A 1ACMA 4RKFA 2QR5A 3O31A 2JC3A 2WABA 3H4TA 3OCYA 4RZXA 1CJKC 4Z9YA 5G40A 3V4PB 3ZIUA 5K3OA 5JY6A 1KIAA 1W9HA 1BMQA 4HNQA 3TMYA 2YHIB 3NOXA 3R3VA 2C4VA 3O3NB 4ID9A 4R3NA 4BO0A 5C8ZA 4OTZA 1Z22A 4KHPB 1OZFA 1T9BA 4FMCB 4ENSA 3ZE7A 4RIIA 4DR6B 3AIIA 1JHRA 1QJ4A 3ZGYA 4BFXA 2PKRA 3DEYX 1X7YA 3ML1A 3Q3JB 5HQJA 5C3UA 4Y2PA 2RGXA 1A9RA 3ASUA 4F84A 5EE3A 3QKRB 4YRRA 1WDKA 2Q4BA 3NB0A 1S3SA 2C3PA 4H08A 4NZOA 5BWCA 2WG0A 1HBJA 4YAGA 2CD7A 3K9WA 4FNOA 3DCIA 4N6OA 1VZ3A 4E4RA 5AW3A 1RRCA 3ZZUA 4RQUA 3I92A 1NUQA 1G2PA 4URVR 2IK8A 2XZDA 4B84A 1P0QA 4G4IA 2D3WA 2O2XA 4M6WB 3UHPA 2V6MA 5KWJA 1MB2A 2QNRA 2V4MA 4KIUA 5L3VA 1JPUA 3LE8A 5JH7F 1HE2A 5LCXA 2ZRBA 5AW4A 3EWIA 1H69A 2YJ4A 3W2HA 1QXSA 1SAYA 3T7CA 3ZWVA 4KLCA 1Z13A 3H1PA 4MWEA 1DX6A 4JJZA 4JL6A 4DLRA 4OP1A 1JHPA 3REQB 4EWLA 4HTFB 5KAMA 1SQSA 3L7LA 1U5CA 5CFPA 2NQ2C 3TFWA 1CS4C 4Q3KA 3BMCB 2PWZA 3DO5A 2DGDA 1A2OA 1Y5IA 3DQQA 3NM4A 3E22A 1J97A 4MV5A 2G40A 1YMUA 3UMCA 4TXLA 1LJ8A 1MIOB 3EH1A 3S5JA 1LY1A 5J4VA 2QENA 2ZI7A 2Z2JA 4OHCA 3G8DA 4UXJA 4CM4A 3EARA 3K2IA 1M1ZA 1R0XA 4EFNA 4OP2A 4OV6B 5DGTA 3TQQA 1AQJA 3PXCX 2XMDA 1Z4IA 1SXGA 3T3OA 2JI8A 3LQFA 5BSEA 2GN1A 2I3ZA 3OZIA 4AM8A 1KJ9A 2F90A 1RPZA 1Z0AA 3QKUA 2FRXA 1ISIA 2F9FA 2NVBA 3LHIA 3VO1A 3VYWA 4EJ2A 3I73A 3EVAA 3PJDA 5L7YA 2ODBA 2R0QC 2IEBA 1E60A 3QWHA 4HFRA 1L7VC 1CW2B 1RJ9A 1V3VA 3JQAA 1JHMA 3OIVA 1N2JA 5FPYA 1C1XB 2IPAB 1F1JA 2BP7B 1QVRA 2OORA 3GRFA 3OKFA 3WLMA 1N32B 1B74A 4MKIA 3ZD7A 1I3LA 3P52A 3RANA 4F9EA 3ZBUA 5T3YA 9LDTA 5JWHA 2Y0PA 1QG4A 3HXKA 4ZPXA 1UFRA 3HUDA 1FBTA 1SKBA 1V95A 3ZCQA 1ZM9A 5I5GA 4OHKA 3RU9A 5JDIA 3H8JA 1OLXA 1N9KA 3C3JA 3STHA 4LYEA 2D5CA 5KKAA 4MITA 1SG0A 2O1EA 3AR8A 4HQOA 2B20A 1RLUA 3IELA 3ZWWA 1KSFX 1QRRA 1T9HA 4NDAA 2WRZA 3FJOA 4H0NA 3UWSA 3HDYA 4JH0A 3L7DA 4K9SA 4UBIA 4WDQA 2FPPA 1OXVA 1CR2A 3OPYA 2XF8A 3S99A 1L7XA 3CW2A 3GVCA 5GV8A 3KDSE 2CWDA 1TNDA 1P33A 1AQNA 1TUBB 1YUBA 4XIJA 5JLJA 1U65A 1RMQA 2JI9A 1MO6A 3ZS8A 4INAA 5CUQA 1YB1A 2WUVA 3GELA 3A1WA 1D9XA 1LF5A 1H42A 2BONA 1V5WA 4TTSA 3KXPA 2AR9A 2OYCA 3OURA 3OZ7A 4OI1A 2BZSA 4LX8A 2DWQA 1YRHA 3DUFA 1NIPA 1SCKA 3RC9A 4CBVA 3LOQA 3H9EO 3S27A 3GRPA 2EKPA 1DBQA 4HNUA 4OQQA 1Y8RA 2CLLB 1T36A 1BXRB 1X7ZA 1AK2A 3HFSA 4DE5A 4GR9A 4XPZA 4MS1A 5DK6A 4RK4A 1O5OA 5FORA 1K88A 4MP6A 5LZ8A 3AF5A 4IFBA 3WFZA 4EK9A 5C8XA 2J87A 3VZQA 1NV8A 2BGUA 1T2DA 3PEEA 3FRHA 1DSSG 4RX1A 4HP8A 3E7XA 3CVVA 3I4CA 3ZVKA 4G09A 3ZU5A 3WI7A 5G4KA 4KPFC 5HFJA 3PT5A 2GCNA 1PJZA 3T9DA 3A6GA 2QXTA 1RAIA 1UJCA 2OHOA 4XASA 2VHVA 4ZVLA 3HCAA 3UJDA 5HM8A 4Q24A 4M8NE 1BS9A 1RMYA 3GMIA 3LBFA 2H3HA 4Y7DA 3R7BA 1KOJA 2CXXA 3ZDEA 2W6CX 3GLHA 3IO5A 2VP0A 2V6IA 4PLTA 4AY6A 3KLNA 2GLUA 3L4EA 5KWEA 1W5SA 2XZPA 1UEXC 3EGVA 4QBGB 4YUXA 2R86A 2XVXA 3WMFA 3SIWA 3MAJA 5B4VA 2B8WA 5C0OE 3V4FA 1E3MA 2V7XA 1LTKA 2CW5A 2BGMA 2DTDA 2H65A 2YV5A 3F4KA 1JF8A 1NSYA 3M1IA 1KP9A 2FQ1A 2IE8A 3PZBA 4LFBB 3DMTC 2NUAB 1X7XB 4RJIA 4EBBA 4Q7QA 2PV0A 2Y2UA 2DZDA 3W8EA 4EY6A 4ZYZA 5KYYB 1JMVA 1KJYA 2EF1A 2RBKA 4GMGA 3STWA 4UUPA 1K3FA 3LYHA 2XUFA 2FN8A 2FQYA 4PLHA 4AN0A 4KRFA 3RRZA 4IDFA 4AJLA 1ZISA 2DPMA 3OJOA 2ZFUA 3AYXB 4L22A 2BWJA 1YA4A 3MLEA 3NIBA 5DP1A 1RFLA 1POXA 3CZQA 4I0WB 1F4PA 1GRVA 1R9MA 2CFRA 4HDKA 1DG3A 1R0WA 1C8VB 1C7ZA 3JAKA 3CVJA 2QX6A 3RUEA 4TVKA 2C92A 1QH8A 1SVNA 4DIKA 1MA0A 3MQFA 3SBXA 1KH1A 4DA9A 1UZUA 1R5JA 2O48X 3EIHA 1UDRA 3HYLA 5J5AA 3T15A 1BJRE 3HJFA 5AH0A 3VNSA 2GHTA 3KR1A 3SQWA 2JLYA 1XROA 4IUCS 1PG2A 2A0FA 2JLBA 2HB6A 1F20A 1MC4A 3WQQA 2QJTA 5LA6F 4MRRA 2WWGA 3C3PA 1JFLA 1I3OA 4RA6B 4UUBA 3HR4A 3PICA 4I1IA 4W8HA 1ZK4A 1AMOA 4B3JA 2PU5A 1M6HA 3TLBA 5DTMA 1OXMA 2XW6A 1GAWA 3BEOA 1K2WA 2QL7A 1XVLA 1RKXA 4OJYA 5C37A 1P72A 2VJLA 3GJZA 4LWZA 3VR6A 3IBGA 5B6IA 4PGGA 1XF9A 4P82A 2VTBB 3H18A 4KLZA 1BMTA 2FZCA 1LW7A 3NWOA 2FTKE 1S8OA 1S2GA 2WWFA 1J70A 4Q9KA 3NWBA 4Q9JA 4A0RA 1YJBA 5C34B 4YMIA 3TXYA 1GGHA 1PJAA 1QZTA 3PK0A 4KAFA 1MOPA 2AI2A 4RVSA 2XNCA 4UNNA 4UZSA 5CHEA 1PEYA 1RBMA 2Q1UA 3WGVA 3MSXA 1R6UA 1W1IA 1DRJA 2ZUWA 4L3VA 4U7HA 3RIYA 4S12A 3SS9X 3OM9A 3VV2A 4D3ZA 5F33A 2J0EA 3S1AB 3BZUA 2QP4A 5SZJA 3ZWCA 1E2HA 1W8IA 2RHRA 3L6CA 2E49A 3IJPA 4LZWA 2CXNA 5AHWA 4RJJA 2OV1A 3I1JA 3IS3A 6GPBA 1M2OA 1V8PA 2OBYA 2PUTA 5T64A 4KBYA 3OX4A 3TLKA 2E1RA 3LLCA 3LUCA 5BSHA 1IIRA 2JJ1D 2ZYIA 3SHTA 4QLOA 4MWGA 2FP4B 1ENPA 4EGCB 2FP4A 2GERA 3DZKA 5DN6D 3D1VA 4IVNA 4M2LA 4CNBA 1Z35A 2DR0A 2V03A 4BGUA 4K5QA 4ZOAA 4BVLA 1ONNA 3O03A 2H4HA 3NR2A 3W1EA 1DQSA 1RXUA 3B1KA 3OZGA 3L0ZA 2OCIA 2X41A 2HTEA 3MWJA 4LMBA 2VPXA 2FRDC 3G5AA 3KHUA 4G4SO 3INNA 3TMAA 3QBTA 4G0XA 1JVNA 4BV2A 1EVJA 4ZZ3A 5ESXA 3GZNA 2P7IA 3RSOA 1HOTA 1U9CA 4E2YA 1Z7WA 1OC2A 4FJ2A 4HDMA 4B0PA 5IULC 4P3XA 3FX2A 4QPNA 2ZBPA 2DYKA 4CDGA 3KUKA 4DR3B 2UYQA 3PFNA 2PX3A 3KBOA 3OCJA 4RXTA 4QECA 3RREA 1ZLYA 5BSRA 4V0NA 1VE9A 1ONOA 3TIIA 3EDMA 3SZGA 1SUCA 4RZ3A 1KDPA 2OFWA 3ONWA 3NX4A 3Q41A 3OF2A 3U3DA 2ZXUA 3EH2A 3MUFA 3QVJA 4Z4HA 5REQB 1POWA 1LC3A 2C07A 1Z5PA 1QSGA 1Z7YA 2J46A 4Y0VA 3LKZA 3P4UA 3C7CB 2CMGA 1WG8A 4BLQA 2WHYA 1OBFO 2IXEA 2ZJFA 3ZWBA 2V6FA 3F7MA 1EAYA 2WJAA 1GKYA 1TD9A 1IBCA 5CH5A 4HNVA 1IDOA 2RGYA 2YZNA 1WNFA 3F6YA 5HP4A 3W5VA 2BEUB 1ZJJA 2WJ6A 4COOA 1VJ1A 5DW3A 1VMKA 3EIOA 1T2AA 2YIMA 5EMLA 1QHHA 1E1CA 1U0OC 3Q40A 5U1PA 5KX5B 5EE5B 1SXPA 4EB3A 1N6HA 3SHQA 3IAEA 2J3KA 5IC5A 3HGMA 4K9LA 3VR3D 1A1SA 1YL5A 5EKSA 4B2IA 1MQ9A 3K0SA 5J1SB 4GI7A 3HRKA 4LXGA 5ALHA 2VRCA 1FXWF 5TQJA 3K9CA 3NOOA 5P21A 1KZYC 4QBHA 4Z0HO 5L51A 1H1DA 5BNFA 5DASA 4KAXA 3OTGA 2HCRA 2WAYA 1FP4A 1W34A 1WV1A 3NKVA 2JD2A 4HAZA 4HO1X 3ZXIA 5CB4B 2QRQA 3FB4A 4A6XA 4H4DA 2G9VA 2OCPA 1FRVA 4E0BA 4DRZA 1R6VA 3IP8A 1U2RA 4XDZA 2X1MA 1K66A 1GQOA 2HTFA 5HF6A 4BMSA 4WADA 3U7RA 4D3YA 4ETMA 1DKRA 4JJFA 4JLPA 5KVSA 3WK7A 4FNMA 4MV6A 3RQIA 2CT8A 2IH5A 3CIFA 2YINC 1UBMS 1XRQA 3PQEA 4HN9A 1DAMA 1XDDA 4MRAA 3TZLA 3A0UA 3WTBA 3GJYA 4OX9B 4GKKB 2BV3A 3V2HA 3DC2A 1QLHA 2BGIA 2H4WA 4YROA 5A9RA 2BEWA 1OD6A 2FEAA 1GQFA 1UZMA 5MN5A 4U3JA 1FRNA 2BFEA 2CDNA 5E8JA 5EIHA 3WK8A 1Y6JA 5E3HA 1HQDA 5CEEA 4QDZA 5BW8A 1SD2A 2HZBA 4IZOA 2NVOA 4NFLA 4Q5IA 1P2VA 3BK1A 1LDBA 4AMZA 2XQKA 2C83A 4CMKA 1DHRA 3IULA 3NP9A 1MAAA 1ECCA 3M9WA 4DVJA 4OOFA 5E1DA 4Q4JA 3SU8A 3BMOB 2E5WA 2HWWA 2OHJA 2OHHA 1Z5NA 3G9XA 4RF4A 3V7WA 1EWYA 5CB0A 1UOPA 4BCBA 5ILGA 2Q3LA 3BMCA 3EG9B 4B80A 1UKVY 1X7WB 2GESA 4C4OA 3RHFA 4QZVA 4FXOA 5B30A 2RHJA 1G9TA 3Q1KA 2NO4A 3B38A 5LQRA 4M55A 1K6IA 3QF4A 3E3AA 1QM5A 4DR5B 3O73A 1NE2A 1KSJA 2Q9UA 1WW3A 3V1YA 2C00A 3OQVA 2CL5A 4QO7A 2Q27A 2A1TR 2JHFA 2XADA 2XRFA 2C9YA 3AW9A 3CPEA 3N0VA 1E2JA 3ORSA 4GNRA 4CTOA 2WF6A 4XX0B 1CR1A 4LQ4A 1GLNA 1VGVA 1HDCA 1FQJA 4AO6A 5EJ8A 1A0OA 3NHAA 4XIFA 3A6LA 3IKMB 1E2KA 3E03A 1A95A 1DBIA 3FETA 5MGNA 3DDWA 1H2FA 1B1AA 5DRYA 1MJGA 4PRLA 2VYND 1C3OA 3NCHA 5GIPE 1OUMA 2ODTX 3WWZA 2IS1A 5LZ5A 1Z0JA 1IH8A 1XZAA 2AR7A 2R60A 2BFNA 1DU4A 7REQB 2GK6A 3GF4A 1TECE 1U11A 4MS1B 4N5IX 4QPCA 2HXGA 2P67A 3LQRA 2ZRAA 4B4WA 4YRAA 4LJ7A 5AVRA 3I62A 2FCAA 2P3LA 2NX2A 1NQ5A 2R6R1 3FZEA 1MPTA 3G2LA 1RC8A 4YQEA 3RHSA 3UK6A 5TQ2B 5G1NA 1LQUA 1DTWA 1NUSA 4ZU1X 3AQ4A 4MHOA 2GZMA 4HCJA 2HBQA 1T5LA 2O20A 2ATCA 1QMGA 3JD0A 1I32A 3IO3A 4LY6A 3SSMA 4EH1A 1ILWA 3LBHA 4RVOA 2AEFA 2C7QA 4RHUA 4WKNA 5EFZA 2F9LA 3VKHA 2G9QA 4KSYA 3HCOA 4IIGA 1K0UA 1SIOA 2WM2A 3B51X 3OPNA 4NU8X 3ZV6A 6REQB 3FOEC 2JNWA 5DXAA 2WUWE 4ZCIA 4LF4B 2C4HA 4CR6A 4LBZA 3HHEA 1R4AA 3QEOA 4WKGA 4UM7A 3S1SA 1YVDA 4Y3UA 2FFQA 1V96A 1JPNA 1TM4E 4OB8A 4AAYA 4I4IA 1JU4A 2CB9A 1AQUA 1YQTA 4L7VA 3W6ZA 5TJHA 1DFIA 3R76A 3WJAA 5EMJA 1RP1A 3RWBA 2VPWA 4TRMA 1V4VA 4YHHB 1X13A 2QQ5A 2LZ0A 3B2EA 1KYWA 2B3DA 3LI2A 3LKVA 3OMWA 3UKOA 4DIMA 2WYOA 2P0YA 2WIJA 4PRYA 3UOWA 3KT3A 3MINB 2AN1A 1ATZA 2ZAIA 2A3RA 1WF6A 3BQ9A 3X1ZA 5CRIA 2JLUA 4MUGA 5G0TA 4AZVA 1YFKA 3ADOA 2JIRA 1W29A 1G3IA 2BEKA 5B6JA 5K8CA 4KI7A 1XU7A 1EK5A 3DDNA 5IZCA 1XE3A 1O6CA 4CFYA 5JVDF 4N3GA 1XZEA 1Q1QA 2CXOA 2HY7A 1HYHA 2C4WA 8AT1A 3G7NA 3M5PA 3AI2A 5D2CA 4HUTA 3DEFA 3NFYA 1VPLA 3TPZA 3TVDA 4A92A 4BN0A 5C52B 5A1TA 4M49A 5AVJA 1BCSA 4WGGA 2C1EA 3L6DA 4FLMA 4D8UA 3HXTA 3F2IA 4TL6A 1FPQA 3LRXA 4X24A 4L3WA 1KQ3A 4Y7CA 2CZQA 1WU8A 3UNXA 4JBYA 4LYFA 3EK2A 1JHUA 3PCTA 1LWOA 4TV9F 2HA4A 4WXPA 3WQBA 2BKVA 2JCSA 3DNFA 4L78A 4F11A 4POOA 3SOPA 3QVOA 3U19A 3V4ZA 4OPMA 1FX0B 1Y3HA 2FP3A 5DTIA 1RM4A 1YV9A 2J3EA 2PIAA 2PY6A 3P1JA 4FGUA 4WA7A 1A97A 1P9OA 3NKFA 3AV3A 4M36A 1E3WB 4RK1A 5LMZA 2DUJA 5LP1A 1JR2A 4BGIA 4XGRA 4HTAA 3F5QA 3P9SA 3CVWA 3AUXA 2YHBA 2HM7A 3D1JA 5BW6B 3DAGA 4NOLA 4CM1A 2VBFA 1DKOA 4TWBA 1R8JA 4MW7A 4UEQA 2GS9A 3W0LB 1T0PA 1ZVMA 2XMPA 2QTHA 2YOFA 4MPRA 4PYRA 2DWCA 4EYSA 5IEJA 1PTJA 4MGZR 3LFUA 2Q5IA 2WHQA 3LVRE 1A69A 4K8OA 1YDFA 4ZVRA 3KKQA 3LG2A 2KSQA 2YJGA 5IXYA 4KI0A 4C6RA 2IYUA 4HZUB 2ST1A 2ZTVA 3MYRA 3RFVA 3VGPA 1ULBA 4G5GA 4LHSA 4X6UA 4DA6A 2G25A 4HDSA 1J8FA 2HF2A 4YH1A 2AA3A 2F3SA 3W9YA 2J48A 3ZQKA 1KVRA 3IQHX 2OD7A 1NJSA 3FOAA 3P4XA 3IODA 1C9KA 2HRCA 5DGIA 4AY3A 3VKWA 4MRNA 1RQNA 1PFUA 4NYMR 1DXYA 2GXQA 2HJSA 3IV7A 4MS4B 4JQOA 1LH0A 3U6BA 1DPGA 1XT6A 4D9HA 3FJ1A 3OD1A 5AKIA 5GJWC 4Y9UA 5G3YA 5SY6A 3CYFA 1HG1A 2AFIA 1Z62A 1EGMB 4TSRA 2EKQA 1UQRA 4P7BA 4Y2RA 5AIAA 3TW8A 5B7GA 4ZA2A 3OM8A 3QWAA 3ZZMA 1XMPA 4KIFA 3LUBA 1R8XA 2EFEB 2ZLBA 3FKSD 3PNLA 1M76A 1DAIA 3ORFA 1OX4B 4MJ3A 1N2SA 5DX0A 3QPAA 2M32A 4BWYA 1SU6A 2OGTA 1QP7A 2B5WA 1AB5A 2C3UA 1DEXA 4ZOQI 5KTKA 2G9NA 2CKMA 2WM3A 3QFHA 1W9MA 4BKRA 1OTHA 3P9YA 2AFVA 4PTYA 1XTIA 1QAMA 2P1ZA 3A2MA 4UW9A 1VL6A 3TXAA 3VU0A 5GOTA 3KKKA 5A5VA 4HNTA 4O4LA 2A9RA 3FZNA 2QUJA 4PSUA 5G3ZA 5B1DA 1UCFA 2JLZA 4PLYA 2DETA 1FX0A 1E96A 4LOIA 1EYZA 1U98A 3DL0A 5ESWA 2R4UA 3PF9A 1PV2A 1WB6A 3CS3A 1SBHA 2X6RA 1P2UA 3AEKA 3II6X 2YYYA 1HMPA 1RYEA 3ROPA 5LOVA 2BFWA 2ESRA 1DEKA 4BQNA 2HSWA 2VG8A 2POCA 1A8QA 3K9FC 1JEQA 5BWBA 4EG0A 3UQYS 4EFKA 4RHTA 1FS4A 4QPZA 4YFVA 3JTMA 4E14A 4G2NA 1YT5A 3K4PA 4ZDIA 3PXXA 1C9NA 4JVMA 2BCEA 1ORRA 1U0GA 2O3UA 2XWBF 4KE7A 4O0MA 3T7EA 4DT1A 3IKTA 1R5BA 2AFHE 1U1CA 1DUVG 3KTOA 4K2AA 2VAPA 1T1GA 4OXYA 4QRDA 2Q7DA 1LPMA 3BRSA 3FMIA 3HZHA 5AT1A 5IW8A 4A1FA 4DDMA 1VIYA 2OR3A 4O1IA 2VQEB 4DV6B 3AM3A 2AEEA 1IRIA 2VJKA 1QHSA 5HKLA 1ITZA 2P9QA 4FN5A 2AN4A 1NUUA 3A1VA 5E4FA 3WOVA 4R81A 3HRIA 3CWZA 4PYLA 1YGYA 2AD5A 3Q7QA 3HBMA 4LSWA 4MS4A 1FE8A 4G07A 1DQNA 2QRKA 3SYNA 4OOEA 4DC1A 4EL5A 3G49A 3I1FA 4BMYA 3KQWA 1WD7A 4EJSA 1GEEA 2ZQ5A 4M8LA 1BKDR 1J5PA 3PD7A 2Y27A 4M1MA 3CVUA 3DOCA 3W2FA 4ZZ0A 1EFKA 2PNFA 2QVZX 1THTA 4G5SA 1Q44A 4K6KA 1KZGB 2I1VB 4NTZA 4WLNA 4ZV7A 3JD3A 4W7HA 1Z5WA 2GB4A 3U4AA 1ZUWA 3DEHA 2ZJ6A 5L9AA 1P2TA 1BXKA 3DW3X 3DW1X 4AN1A 3GPIA 1KQFA 5A0VA 5DM4A 1CPYA 3HR7A 5JQWA 1X9HA 3CE6A 4FONA 1TGYA 1G2QA 4HYEA 2XLBA 5A9TA 4E3WA 1YHNA 4TN5A 2V96A 1DV1A 4M98A 3C7AA 4DIEA 2WFAA 4CKXA 5IT5A 1JJFA 3C0KA 1Y63A 3MMNA 2CMHA 6YASA 2XA2A 2WPNA 1PVVA 1F2UA 4IDGA 1I2MA 5DBHX 4AMBA 5K09A 4NEGA 1Y5NA 4RTMA 2XQIA 2Q6TA 1VLHA 2R1TA 4CT0A