3ADKA

Refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of porcine cytosolic adenylate kinase at 2.1 A resolution.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Transferase(phosphotransferase)
molecule keywords ADENYLATE KINASE
total genus 59
structure length 194
sequence length 194
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1987-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adkA00
4JZKA 3IIMA 2F1HA 4NL4H 4GL2A 4V02A 1MO4A 4II7A 4C3ZA 1F2TA 1UADA 1YZQA 3WY9A 3AB3A 2GRJA 1S4QA 1FTSA 4FMDB 3GD7A 4OQXA 4DDUA 1HURA 2CMKA 3RSLA 5BQ5A 4TMWA 5H1YA 1AN0A 3WNDA 3ZIAA 4BUJA 4XTCS 2AKYA 2KJQA 3QI2A 3LBNA 2CEAA 1WDTA 2IEYA 1RC8A 3RC3A 3PEYA 2O0HA 2OESA 4GOKA 5D3QA 2HYIC 1Q0UA 2GETA 2F3RA 2BM0A 2EW1A 2WV9A 1G3RA 4E5UA 3CF6R 2QP9X 4R7ZA 1XEWX 1ZC4A 4GFDA 6Q21A 5KNBA 2BMEA 2QTHA 2HV8A 3ZVLA 4ILEA 1VG0B 4XJXA 1N3BA 3CNNA 1MABA 1EX6A 2ODWA 3DOFA 5DISB 1NRJB 2IT1A 5CIWA 1QHSA 1N6OA 3ZYCA 4AC9A 1ZAKA 4HLUC 2O8EA 3K9GA 3NBZC 5L3QA 3QE0A 1QG2A 3U3MA 1UM8A 3BFVA 5GJVC 3G82C 2F1JA 1YZKA 3I62A 3TW4A 3BB1A 1R0XA 1UKEA 2QNRA 3GEEA 4PAQA 2QPTA 3ZVRA 2QAGC 4JVLA 2BMFA 3GJ0A 4M9XA 4A4DA 5KSOA 2ZTSA 1KO4A 3R9XA 3W5JA 3QENA 2GBLA 1ZD8A 1E9EA 4KYUA 3CRMA 3K9LA 4KBGA 3K70C 3ADCA 3UWOA 3LW8A 2I4IA 4O2RA 1G5RA 4Q4HA 1FW6A 4TL8A 2CCGA 3C7KA 4O0MA 2FFQA 3CR8A 2GKSA 3CNLA 1JECA 1YZLA 5J40A 4DXAA 3Q8XB 3MJHA 1AZSC 3V00A 4Q9IA 5BYKA 1B23P 3QF4A 3IEVA 4PHTA 1NLFA 2IYUA 3AVXA 3EXAA 2IS4A 3P4YA 4JLNA 3PV0A 4HDOB 2QL6A 2G3YA 3FHTA 3NVAA 4DWJA 3CF0A 1KI4A 2IXEA 2QAGB 1KAOA 1FNMA 2C8VA 4BFUA 1W1WA 1W5SA 2CBZA 5JCPA 4QGFA 3TUZC 5DSZA 2B8WA 4WA7A 2ZE8A 4PFSA 3WRXC 3QSYA 3T1VA 3ND9A 4KXFB 2O0JA 1AA9A 1JXOA 2QP3A 1GL6A 4NCJA 4LUCA 2FSHA 1I4LD 1IN5A 1AK2A 3A36A 4WAUA 3VNVA 1R4AA 3SFVA 1L4UA 3KKNA 5HE8A 2HDNB 1Z6GA 2O8DB 2VTKA 2VQSA 1KI9A 2XOKA 1E2NA 2C9OA 3CONA 3F3YA 1Z0FA 2FG5A 1TNDA 2IUSA 2ZVQX 3TRFA 3QOFA 1XJCA 2FFAA 2ZIAA 4JLMA 4YMWA 5FUXA 3DM9B 3U2QA 4B3CA 4DKXA 4PQFA 3KXLA 4LRWA 2YNMA 1E2JA 2VP6A 1UDWA 3MWJA 4CRWB 4JLAA 2BKUA 3K0AB 1JI0A 2OXCA 2B7CA 5DI9A 1NIPA 1ZM2A 5HCNA 1KK3A 2CVHA 4D82A 2GZDA 4S2EA 1Q57A 3VNUA 4X8OA 1YJ5A 4NCNA 5CYPA 1V43A 4HZUA 2YVUA 3LBHA 3Q85A 1SVSA 1XTIA 3EA0A 1S1CA 1ETUA 3BH6A 3BAFA 4B32A 1Z08A 3ZZTA 5AJVB 3OEEA 4DLXA 1N6LA 1MABB 2A5GA 3HPQA 1CKEA 1E98A 4IDOA 3VKGA 4QBGB 2QN6A 2RGXA 2KBFA 3CKLA 1A4RA 2JLYA 1XCGB 3A58B 2WZQA 2QBYB 1EFCA 1LS6A 1F2UA 2OBNA 3C15C 4US2R 4RKFA 1N5KA 2DY1A 4C2UA 1OHHA 2IA5A 3UG7A 2MMCA 521PA 2EWVA 3GLGE 1G6OA 2GCPA 2IXGA 2XB4A 4OYHA 1GNPA 2UVQA 4OL0A 1CRPA 1KK0A 1DELA 4C7OA 1CJMA 3IPYA 4DJTA 3M4YA 1XMVA 4Q1EA 4A82A 3KTAB 3T1QA 2X2EA 1WE2A 3IO3A 3VR6A 1OV4A 1XRJA 3SQWA 3AF3A 2IW3A 4IOJA 2FSGA 5KNDA 1N6HA 4BRUA 4NYMQ 1T9HA 2J7PA 2XZOA 3N2IA 4HB0A 2WJJA 4HAYA 1U90A 4XSGA 1H8HA 5B2ZA 4Z1MA 1Q1ZA 1R8SA 1XXHA 4BECA 1G8HA 5SZKB 1W4AA 2RAPA 2EFHB 2JASA 4DRZA 2EFDB 3D7MA 1T91A 2D7DA 2ORIA 3PUZA 1P9WA 2EWWA 3LQQA 4P32A 3BIFA 3DKPA 4UNQA 1MO3A 2PJZA 4OBEA 3SQXA 1VDZA 4MITA 4MGYR 5JJIA 2J87A 4DB4A 2YC2C 3UKDA 4LGMA 4LWZA 1DG1G 4MRVA 5J4KA 3BC1A 4M2LA 3B60A 1AIPA 5JHHB 3BB4A 4EDHA 1T6NA 4Q03A 2P3SA 3NDPA 4AK9A 1NN5A 4CEIB 1Z6TA 1KJWA 1P2UA 5E7MA 1QRAA 2X19A 1P75A 1U0JA 2PCJA 3FTQA 3GJ4A 4PSKA 4QHTA 4BFSA 1EFUA 4A9AA 4NONA 2ZE6A 5JLJA 2FX3A 2I1VB 3HDTA 3PENA 1SVWA 2KE5A 4KLNA 1UAAA 4E09A 1GP2A 3CLVA 1TEVA 3J81k 1N6KA 1OH7A 2WWHA 5FL3A 3IQWA 2H5EA 2WHXA 2O8BB 2QSYA 2XX3A 1IONA 3TW8B 3B6EA 5J47A 5M04A 3K8YA 2VF7A 1N6RA 1DAHA 1W2GA 1XD2B 1JEEA 3DEFA 3RWOA 3NXSA 1P2SA 4KVAA 2N1BA 4L4UA 1S9HA 3DMDA 3U7HB 1PVOA 2VA8A 2PEZA 4G5OA 4UXHA 1ESNA 4DLUA 4HB4A 1BYIA 5L3QB 3ZIAD 1E4YA 5EXPA 3T34A 5JMTA 1E6CA 2C77A 3SNHA 4BE7B 2H1LA 1S0UA 2OUKA 2AXPA 3OAAA 1ZIPA 3BS4A 2O8FB 1IN8A 2DFKB 1BS1A 4HAXA 2F3TA 1A2BA 1YR6A 4XWKA 2ZS7A 4WOPA 4IDQA 3MSXA 2V3CC 3UIEA 4G5GA 1NI3A 5FPSA 1GL9B 2WKQA 2A2ZA 4BLSA 3GPLA 2ZSBA 4CT4B 5FBVB 1VG8A 5L3SB 2FGKA 1UBEA 3BH7A 3AH8A 2IHYA 4C2TA 3QBVA 5CB6A 2ZRJA 3QY0A 4LHVA 3B1WA 1G8FA 1E9CA 4DSTA 4LYFA 3GLFB 2NZ8A 1WQ1R 1M8PA 1ZINA 2ZRPA 4D25A 3NH6A 2HT1A 3N2EA 3VKHA 4BPBA 4ZI3A 3TGPA 1UBGA 4P4TA 1FFHA 1XP8A 1D9XA 1SVKA 2V54A 4Q1DA 2ZI3A 3LAWA 5LDDC 4IOMA 1TQDA 1VCMA 1DE0A 4LY6A 1DO0A 1UJ2A 3AF4A 1W36C 4ASUD 4UNNA 2CK3D 1DARA 4NZYA 2W0MA 1E1QD 4M4SA 4Q66C 3FKSD 2IXFA 2ZR0A 1E9SA 4TLEA 3Q3JB 1RPZA 1OYYA 5EP3A 4XD7A 1KI2A 5TARA 4MKGA 5GJBA 1E0AA 3WYAA 4UNSA 4LJAA 1JEDA 3NBFA 4BRWA 1OFHA 3B13B 4TMZA 2CHQA 4Q5IA 5HKKA 1IBRA 3ZVMA 2QQEA 2C96A 4NYIQ 4BFZA 2J59A 4Q4AB 3T1OA 4LJYA 1QVAA 1H8HD 1WP9A 5JCZA 3FGNA 1E1QA 3T1TA 2WKRA 4W5JA 1CR4A 2CK3A 4AD8A 4B3DA 3TLXA 2W2TA 5AJZA 4KCGA 4JYCA 3FVQA 5C4GB 5E3HA 4DSNA 5KPJA 2OILA 1OSNA 1N25A 1GDDA 3LW7A 2DWQA 1NBME 1YRAA 4MUAA 3QPWA 3U6KA 4V0OA 4DDWA 3TE6A 2A5YB 1M7BA 5JHGB 1N5IA 1CS4C 2ATXA 2EFEB 4I1UA 4F4IA 3ADBA 3RYTC 1E9DA 1FZQA 3HYTA 4CVNA 3THXA 1YR9A 4DB2A 1KOFA 1W36D 3IHLA 3U4QB 4W7SA 2ZYVX 4EQ6A 3MG9A 3U4QA 3OIWA 3A4MA 1N0UA 4A8JC 3PR1A 1G7CA 3AEZA 5D3MA 1L4YA 3FMPB 4JSTA 4Q7JB 4RFSA 1ZBDA 1T3LA 2NO1A 3VU9A 2FPMA 2OEPA 1L7VC 3PUYA 3QKUA 3ZZUA 4YMTA 5A5GA 2SHKA 3OF5A 1Y63A 3SYNA 1E2FA 2A9KA 2R8RA 2G6BA 3FDIA 1V5WA 4ASUA 3THWA 3I3SR 3KJGA 4L16A 4L8GA 1SXJC 1TEXA 5EUQB 1O87A 4XOIA 4LBWA 1DAEA 2NO9A 2AWOA 1G8PA 2Z43A 2DFTA 2FDCA 1MRSA 3U3KA 4DLVA 2DYKA 4G1UC 1ZC3A 4NP6A 1KK1A 2JDIA 1RYHA 1G20E 1LV7A 3BORA 4HAZA 1M34E 2ZANA 1W2HA 4URVR 4FCWA 3E1SA 4MGKR 3PUWA 3WP0A 3A6PC 1RZ3A 1T5LA 4Q1CA 3VQTA 3AUXA 2OZEA 2WBLC 3WYGA 2AX4A 3X2SA 3KQKA 1BH2A 4XH9B 1LTQA 4Y0AA 4EPYA 1NBMD 2C95A 2ZM5A 2O52A 2P6RA 4CEJA 4IEEA 1KZGB 4QM6A 1KYIA 3LA6A 2ZJ2A 3DM5A 4K8OA 2PZEA 5LBIA 5KYKA 4I1SA 3D3QA 4QRHA 1P2VA 1XCPA 4PHFA 3KQLA 5KU1A 1HT1E 1PUJA 1OW3B 2CXXA 4PZYA 5JS7A 4TL9A 2IF2A 2FE4A 4IHQA 3EW9A 4TL6A 1EK0A 3C16C 4JBXA 4A6PA 4WVFA 4CGZA 1EG7A 1SXJE 1QG4A 2WWIA 5BN3A 3SYKA 4KFTA 3RS5A 4RD1A 2CNWD 3FMIA 2F9LA 5LB4A 2DR3A 2OLKA 1TUIA 4HZIA 4L15A 4NYJR 2G9NA 2AK2A 4DHEA 1BO6A 1GKYA 2PT5A 4I99A 2XZLA 1RKBA 2YWHA 3MRSA 4HZUB 4QHYA 2WIAA 1OXSC 4D0NA 4IXMA 5JRZA 2OFXA 1Q1QA 2G1KA 3CZQA 3PEUA 2YOFA 3CW2A 4QBFA 1WBBA 1ZU5A 1W0JA 1ESMA 1KSHA 2PCLA 1G17A 3AKYA 5KO2A 1FMLA 2OAQ1 2ONJA 4LZZA 1LF5A 5F2EA 1NY5A 4KV9A 1ONBA 1NSTA 1XF9A 4MH0R 5P21A 2H7VA 4YXWA 3VFDA 4DLTA 3K53A 3L8YA 4KFSA 1CXZA 2IS2A 2ZRHA 3OFND 1AS0A 1II0A 1EXMA 2ODNA 1WRBA 2REOA 2FSFA 1E94E 2KB0A 1OIWA 2ZI5A 4H1VA 1JXMA 2GAAA 4M1TA 4TMXA 1QBKC 5EE5B 1U98A 2DWOA 1G21E 1RRGA 1JJVA 1R8QA 3RSOA 1NNEA 2WVJA 3WHLA 3AF0A 1N0WA 4ABYA 5EXSA 2WOJA 3Q7PA 5FOSA 4B3BA 3AKDA 1E2KA 4JIMA 1A5TA 4C4PA 2K5UA 1QHXA 4CEIA 1GWNA 3GLGA 1XZPA 1NJGA 3BGWA 3RRYA 2J0SA 4Q48A 2JLUA 1E79D 2QQ0A 1G7SA 3AKEA 2FWRA 1MOZA 4ZKEA 4D2IA 2VEDA 4GT1A 4LYJA 4TTRA 1R5NA 4FW9A 3WYFA 4BEJA 2QRZA 5L3RA 3W8RA 5HR5A 1OH8A 4A2WA 4FWIB 3THYB 1OHHD 4PSAA 4HSEA 1ZM9A 5JEEA 1R0WA 4IFBA 5LPNA 1EESA 1ZM7A 1AQUA 1LW7A 1Y3AA 1E0SA 3AV0B 4RJLA 3QKRB 3PITA 1DO2A 1MH1A 4Q00A 2QM7A 4OJQA 2UZIR 2V55B 1LVGA 4JLBA 5AR1A 4DLSA 1AM4D 4LV6A 1Z5ZA 4ZDWA 4KU4A 1D8TA 2FJUA 4Q1AA 3MD0A 2Q9BA 2HLDD 1GZSA 2QT1A 4WXPA 1CR2A 2WJVA 2EFCB 2I1QA 4UJ5A 4XTRA 2WICA 1G5TA 4AKHA 2X2FA 3OIYA 4D6PA 4XVUA 5JJKA 4GDFA 3GLHE 3SU8A 4KSBA 1YKSA 2IYYA 3GFOA 4BFYA 3PJRA 3OESA 2ZRNA 1A2KC 1Z0AA 2V1UA 5FTLA 4EPTA 4RKEA 3QEJA 2JA1A 2REXB 4YLGA 1M2OB 4QJ4A 2ZJZA 2XTNA 4MRRA 4BZQA 3TVDA 5AUNB 2FA9A 1KI8A 2FV8A 2GZAA 5DNYB 5CITA 3LLMA 1NJFA 1OH6A 3GJXC 4B74A 2IEZA 1XZQA 3EARA 3MUFA 5HZKA 2GK6A 3QBTA 5CM8B 5B30A 1JR6A 2FOLA 3TBKA 1X1RA 3Q5EA 5AUOB 1ZU4A 2PZGA 4ZI2A 5FUVA 3QQ5A 4JT2A 4Q7KA 5FOWA 3CH4B 2A78A 2ODEA 3RNLA 1CJVC 1Q3TA 4ZIRA 5EE0A 2FPLA 2QT0A 4PC7A 3U44B 1DTSA 1W44A 1P9NA 4P4UA 4MA4A 1U8AA 1VHTA 2OO7A 3RANA 2QROA 3B85A 4ZKDA 4RD6A 1HQCA 4RY2A 2CJWB 2LKDA 4P4SB 1E96A 4Q4LA 1KMQA 3B82A 3L82B 5TXGA 4WW0A 4B47A 2BMDA 2B92A 1TF2A 2AHOA 1JR3E 4DLRA 1J99A 2ERYA 1H65A 4XVRA 3AKCA 3SZRA 5BN5A 2RGEA 3K9NA 3U7GA 3ZD7A 1W0KA 3CPJB 5K8LA 3LVRE 1DS6A 1LY1A 3EIEA 3TNFA 4MDFA 2AR7A 3R7WA 3DL0A 5CB8A 1X8JA 1KJZA 4NTZA 1BKDR 4TZ6A 3F0TA 4BFWA 4L9SA 4OI4A 4POAA 8OHMA 4RD3A 1VCIA 4PQYA 2NMVA 4NYJQ 1DADA 2KBEA 2FH5B 3SFZA 4IKEA 1IY1A 3CRRA 3F5FA 4HI0E 3LWNA 421PA 4B33A 3RS4A 3PEWA 4IFEA 4AI6A 2OFWA 2WJGA 2ZRFA 3IKJA 3D31A 4CDGA 2FEMA 2ZRMA 1ZRHA 3VTKA 4GP7A 3T15A 3AVYA 1VCNA 5EXXA 1B0UA 2XJ4A 2GJAA 1J70A 2OSBA 2DB3A 1ZIOA 1HT2E 3EZFA 4GPTA 2NG1A 3UMRA 4Q4JB 5DGXA 4KVGA 1NVXQ 2BBOA 3HWSA 3RDPA 3C5HA 4TQAA 1Z0KA 4UJ3A 4OHVA 5FI1B 4E22A 3KQNA 1YR7A 2WOOA 2ZYTX 4AKGA 5JSZB 2OV2A 3R9WA 1ZCAA 4PXAA 1ZD1A 4Q4JA 2YINC 4IRUB 1SVLA 1NVWQ 4U7DA 2AWNA 2JGNA 3IBYA 2YJTD 4FMCF 4B2PA 2W58A 4EJSC 3SR0A 2PT7A 2BEKA 4NBSA 4CEHA 5SZJA 2H92A 3R8FA 3CIOA 1CLUA 3RRMA 2VHJA 3TR5A 1M7GA 3RS0A 3K0SA 4R71A 1FNNA 2HLDA 1PLLA 2JIZD 2GHIA 2P6NA 4D0GA 1KKMA 2D4HA 3AVQA 2PZFA 4P33A 2REBA 1YZTA 3R7WB 1YZGA 1GIAA 1P72A 2YKGA 1DG3A 4MDEA 1XTKA 4PR0A 3RHFA 4A92A 2WAYA 3E5HA 3O8BA 4GMXA 3UMSA 2ECKA 2VSOA 2VF8A 3W6OA 4PO8A 1NKSA 1NVVQ 1XEFA 3H2YA 3SBEA 2ATVA 1RJ9A 4ACAA 4F38A 1P9RA 2Z0MA 3I73A 3ZGXA 3QF7A 3AVUA 2CJWA 4G0NA 4HEJA 1G3UA 4EKDA 1HEIA 5KHOC 2RB4A 3B7GA 4RCZA 4PZLA 5CLLA 1TQ2A 1JNYA 1VG1A 1L2TA 1D6JA 1U94A 3LNCA 1JR3A 1FQJA 2YZ2A 3FE2A 3OZXA 5G41A 1RJ9B 2ZJ5A 3T35A 1HH4A 1AGPA 4UXJA 3KB2A 1F2TB 4FMCB 3TVTA 2R62A 2Z6VA 2D74A 4AKIA 1QVRA 3LH5A 1KNQA 3IHWA 3Q7QA 3B78A 4KODA 3TUJC 5SZHB 2OBLA 4QXAA 4YDSA 4MGZR 4EJSA 1CIPA 2F43A 4OHWA 1WXQA 3C14C 2BWJA 1YVDA 1E1RD 2W6JD 4RZ2A 4A6XA 1P5ZB 4LJ7A 2P65A 1KO8A 3L8ZA 1D2NA 4W9MC 4M1MA 2F55A 4UXIA 3MGCA 1MO6A 4DCNA 3GFTA 2GA8A 1T0HB 1W0JD 3BE4A 4TTQA 1OKKA 1YU9A 4URYR 5FPHA 4IW3B 2BCGY 1AS3A 5KDLA 4PO1A 3THWB 1ZW6A 2RGNA 3X1YA 4RVCA 2GXUA 3AQ4A 1EFRA 1KNXA 2H17A 4GZMA 4M8NE 4Q18A 4DC9A 1VYUA 2D06A 1F3OA 5EE3A 1R5BA 2QEQA 3ONWA 4BZXA 1A7JA 3FPAA 3GQBA 4B3XA 3MCAA 4V0NA 4K46A 1XPUA 3RABA 1G9XA 4RFSB 5DH9A 4B6FA 4KITB 1XD2A 4BLOA 2RGDA 4KO8A 5EZ5A 2ZAMA 4DT1B 4EQ6B 1IQPA 3I5YA 2VLIA 1KSGA 3SN6A 3OEED 5JWRA 2VP9A 4Q9HA 3EZ2A 3QVUA 4GOJA 4BFXA 1Z22A 3R8CA 3S1AB 1KI1A 1KKLA 3VMFA 4DLZA 1OFTA 1YZUA 1Z2AA 1T3HA 2O0KA 3B1VA 2MSCB 3GJ6A 1G19A 2XNSA 3CM0A 4XWAA 5GVRA 5CDFA 1CF4A 2Q3HA 1OE0A 4QBIA 1IXRC 3K1JA 5FBLB 3KB1A 5JWHA 1KI7A 4PQRA 5FFMA 3MAAC 4IVPA 3GLGB 2VRWA 1N6NA 1QHNA 1UEIA 2ZITA 1LFDB 1RYFA 4IDHA 1JALA 2OM2A 1CR0A 2P2LA 4Q4AA 1XXHB 3U5ZB 4QGGA 4WBSA 1XXHE 1Z0JA 2GBLC 2GWHA 1C9KA 4D26A 3TK1A 2G0TA 2RGNC 1AKEA 1NG9A 4A0FA 3IIKA 4A8JB 4B3GA 3B1YA 3QXSA 1OFIA 3D8BA 4DCUA 1EFTA 1CJKC 2V4ZA 4RFVA 1KY2A 2R6FA 2Z83A 2NPFA 4B34A 4TL7A 2ZSDA 2OXRA 1G3QA 4TYYA 1Q44A 4EPVA 4RSGA 5DHFA 3IBGA 2B21A 4V0LA 5BWMA 2F6RA 3GMTA 3Q9LA 4Z8XA 2ANBA 1VKJA 1IN4A 3HJNA 1N5JA 2O8CB 2HT6A 3JVVA 4ACBA 3IGFA 3KKOA 2BMJA 4XIGS 4HAWA 2J0QA 3EAQA 5G3YA 1K5GA 2O5VA 3SEAA 5FUWA 5E95A 1XJQA 2ZROA 1PUIA 2D2FA 4QG7A 721PA 5HCIA 3FKQA 1FOEB 4LOAA 2W00A 1XB2A 2CL7X 1IY2A 1T4GA 2J0UA 3WBJA 4QL3A 1Q20A 1OT3A 3NWJA 5HE9A 2V6IA 4ZCMA 2W6IA 4AY2A 1CRQA 1S2MA 4B76A 4RZUA 2QBYA 1II8B 4I1OA 2F1IA 2ZR9A 4UKDA 4DCSA 2IYRA 2HF8A 4ZCIA 4FWTA 4YXWD 2XAUA 1D5CA 3FHOA 4OK6A 1E2IA 1Z6XA 4JL8A 4Q1BA 1W4RA 2V7QA 3WNCA 2QE7D 4PSVA 2J7KA 2GJ8A 4PANA 1W49A 3AM1A 3SHFA 2IWRA 1Z29A 3TUIC 2D2EA 2V6JA 1SVIA 1RRPA 2PH1A 1ZNWA 4CF7A 1WBDA 5F98A 1PZNA 1GOTA 5KPDA 4QGHA 3FMFA 2J9RA 4JLVA 2R6GA 3O8DA 4EPWA 1QZXA 2FU5C 3T12A 5B57C 1W48A 3IPXA 4FMBB 1FX0B 4AYTA 4QM7A 2W2XA 3NIBA 5DI3B 3A1UA 3DO6A 3MJRA 5CYOA 5J4LA 1X86B 3P26A 3WBKA 4AG6A 4PC1A 3BB3A 2O8DA 4JBYA 1GRQA 4WXRA 4IEIA 3KZ1E 2ZR7A 2DHRA 3AF2A 5B58C 2DBYA 2Q6TA 2CVFA 4PTLA 2HJGA 3CRW1 1Z3IX 3AVPA 4KAXA 1AS2A 1XEXB 5DYGA 3ADDA 4OQMA 1G7RA 3WRYC 5FL7A 2BHRA 1QHHA 2R9VA 2FGJA 2V9PA 4C30A 1E99A 1T8TA 4LYHA 4O3MA 3REGA 4OI0A 5TV2A 1S96A 2ANCA 4PHHA 4TLBA 2IS6A 3THYA 2P0EA 1JQJC 5JJLA 1C1YA 2WKPA 2VH5R 3ZJYA 4RD4A 1AZTA 4DLWA 3R9IA 2VBCA 3K0FB 4IJMA 2F7SA 2R2AA 5J4YA 1UF9A 3L0PA 2NQ2C 3EPHA 4MQBA 1GG2A 3U6BA 1LF0A 2XNDD 3DOEA 3WXMA 1ODFA 3VR1A 4QHSA 4G01B 4KBFA 2Q0HA 2IHBA 2W0SA 3LXXA 3TKLA 1RRCA 3V4FA 3LY5A 4TMVA 2QORA 5FPYA 4CW7A 1F48A 5ANRB 4R2HA 2MMGA 5BW8A 1ZP6A 2TMKA 2ZRBA 2J0VA 4Z51A 1ZNXA 3U7EB 5JS8A 1Z47A 2BC9A 3L0IB 4N0EA 1NN3A 4HYYA 2I3BA 1YE8A 3SI7A 1DAGA 3EPKA 1NSFA 3JZAA 5BYJA 5AK0A 2ZI7A 1IHUA 4M9SA 1N5LA 3SS8A 1OB5A 4B73A 4FCVA 3I8XA 2Q21A 3GEIA 4B2IA 1T0JB 1UPTA 2VP0A 4J0QA 2YC4C 1FTNA 1R6BX 3PXGA 3CRQA 5ELXA 5FTMA 5AUPB 3NC1C 1OLOA 3CZPA 3NEYA 2XNDA 2GCOA 1R0ZA 3AP3A 1VCOA 4F93B 4EIWA 2ZVPX 1VYVA 1NVUQ 4A2PA 2RGCA 3QXJA 3ETLA 2WSSD 2X1VA 2AD1A 2GF0A 4GSYA 2F43B 4PPGA 1NP6A 3SE0A 2WSSA 2QPOA 3VX4A 2XEXA 2VHUA 1SGWA 4MRNA 4QOSA 1YR8A 5CK5A 4ZPXA 3RAPR 4ESVA 3MFYA 1GNRA 5IK2D 2Q9CA 2PMDA 3QXHA 4M1SA 4MYUA 4OHZA 1Q12A 2G0NA 2ZUBA 3X1XA 3GEHA 3BERA 5HTKA 4URWR 3EG5A 2HUPA 4OK5A 2DCUA 2R6CA 4G5QA 5DE3A 2GZHA 2FSIA 1QHIA 3U60B 5EE9A 3RS2A 1OXXK 2J0UB 4CT5A 2JJ2D 2J41A 5L8VA 2FF7A 4TYWA 1YQTA 3H4MA 4Q9KA 3A8TA 2ZSEA 2BM1A 1TX4B 3AP2A 3SYLA 2W2VA 3SJAA 1OF1A 4Q02A 1RIFA 1GVNB 1SXJA 2YWFA 3NBXX 1I2MA 4B48A 1M74A 2IF0A 3DZ8A 1Z07A 5IF9A 4OI1A 1KY3A 2RKOA 5BN4A 4N0DA 3A4NA 2ZU0C 3TMKA 1BMFA 3QXCA 4R2IA 2Z4SA 4Q1FA 3A1VA 3U3JA 4BGDA 2C78A 3SC3A 2WSMA 2RHMA 1RE0A 1OXVA 2GJKA 5H70A 3KXKA 4F92B 3GLFE 4YMUA 2WJIA 4R98A 4PX9A 2WPDD 4A8JA 1W0KD 2C5LA 1GRRA 2BEJA 3CRVA 4GNKA 4HAVA 1M7HA 3N70A 1A1VA 5HPYB 4FN5A 2BVNA 2EU8A 1E2QA 2OCYC 2WJHA 1KI6A 3NC0C 2IYVA 4BLPA 1K6MA 2XTMA 2MSDB 3PUVA 1DVRA 4FXPA 1OPXA 2ORVA 3KKQA 4HUQA 2XXAB 4YONB 4BWYA 2IUUA 5EUMA 1TQ4A 1Z83A 2JLVA 5D3MB 4QC2A 4TYQA 1JJ7A 4GBMA 3IIJA 3JVUA 2QMOA 4P0TA 1L8QA 2VL7A 4BLTA 1DAMA 3QF4B 4JVSB 4UQOA 4GMDA 4ERNA 5C1BA 1VIYA 4C0LA 4GOXA 4YDHB 1TQ6A 1HE8B 3DDCA 3ICQB 2WWGA 1KO1A 1WA5A 2WJYA 1E2GA 3EIQA 4B35A 4M22A 1KTVA 2JLQA 3C41J 4RD0A 2YOGA 2C04A 4MYTA 1DBSA 1OXUA 4NCKA 1UBFA 1HTWA 4V0KA 4C0KA 3UATA 3OE7D 3DVLA 3HU3A 4F4CA 1E9BA 5FTJA 4CYMA 2Y8EA 4YQFA 1Z2CA 3VR2A 1MV5A 3WMEA 4W5WA 4RD2A 4YMVA 4QGAA 2JLZA 5G40A 4HUQB 2JLRA 1R5OA 1Z8FA 3GJ3A 3I5XA 2YWEA 3E70C 3EIHA 3W3ZB 1KK2A 1KAGA 1YHNA 1W4CA 2ZREA 2A5FA 1MR3F 4C9BA 2HXSA 3GLIB 3LRPA 1KIMA 4BQSA 2WTUA 2IYTA 1JQLB 4DCTA 5EXTA 3CO5A 1W36B 4JSYA 2ZJOA 3SHWA 4D80A 4F7WA 4G5SA 2GTPA 1SHKA 1T8UA 3KTAA 1COWD 3VR3A 1P73A 5KSZA 1MO5A 2ZI9A 2GJ9A 4NKRA 4W5HA 4NU0A 3DKVA 1P7CA 1KDOA 2IYLD 3LV8A 4Q9JA 5FR2A 5A4JA 1OFUX 5EQTA 3IUYA 3P1JA 1GRNA 1SXJB 3H86A 3IILA 2F1RA 1OYWA 2NO0A 3IEUA 4NCIA 1EGAA 2QAJA 3RLFA 4DUGD 1KDPA 4A0HA 5K8TA 2E1RA 4JYBA 1EFRD 3KQUA 2BBSA 4M0LA 3U3OA 3B2EA 1HQYE 5LD2C 2QTFA 2J7PD 1VHLA 4DCVA 3GLFA 1II8A 4US0R 5E4FA 3NDBB 1XTQA 1G8YA 5C18A 1OKKD 4ARZA 2WAXA 4QKQA 5IRCD 4PPQA 1TAGA 4C0HA 4JKIA 1TPZA 1XDBA 1XMJA 2RCNA 2O8FA 3BD9A 2OE2A 1E2HA 2D62A 2PMKA 3AUYA 3GLIA 3GFPA 5HZHA 3UG6A 4KI0A 2L0XA 4DIDA 4PC3A 1ZNYA 1TU4A 4IDNA 1OB2A 1X6VA 2HF9A 4HB3A 2GXQA 4D81A 2Z4RA 1CR1A 2LKCA 4WIAA 3VAAA 4B6EA 2GCOB 4AIIA 4FD2A 2F9MA 3CWZA 3QVVA 3NG1A 1XEWY 1E2EA 4D4KA 1GUAA 3A37A 3GCGA 1SVOA 3QG1A 2O8BA 2EVWX 4CEHB 2BIFA 4TT3D 3MLEA 1NN0A 1PV4A 1S9DA 2VPPA 3CB4A 5IT5A 2WMOB 2PLFA 4A36A 3HU2A 2ODBA 3L43A 2G88A 3OIVA 4TN1A 3A1WA 2QP4A 2FNAA 3B1ZA 2GDJA 3CWQA 2EFGA 1XWIA 2J5XA 4IXNA 4WZBE 5JWOA 2CLSA 5FL7D 1UDXA 4S35A 3EX7C 1FPMA 1J8MF 2ASEA 4OQLA 3L0SA 5BXQC 1CJUC 2QPAA 2VP5A 2CDNA 1FMJA 1ELOA 1R0YA 2AK3A 3KXIA 2BDTA 1KZ7B 1IXZA 1DOAA 1VG9B 2BBTA 2UKDA 1NKTA 4QJ5A 1R7RA 5AUQA 3NEJA 2IL1A 1NVVR 2B7BA 4CZ2A 5HKKD 1EWQA 4LJ6A 3OAAD 2ZJBA 3ICEA 1VMAA 1I2DA 4BASA 2YWGA 3ZH9B 2CLDX 1MT0A 2PJRA 4YMSA 3RWMB 1P2TA 2QA5A 1Q1EA 1NMZA 1TF5A 4LHYA 2C9CA 2NIPA 4B75A 5KSYA 4I4LA 1KJYA 4JS0A 4QBHA 3DHWC 4IOLA 4JJZA 2P67A 2P6UA 2ZUCA 3MMPA 5IDVA 2GEVA 3FKSA 2XOKD 4B3FX 2OHFA 2V1XA 4KFRA 3K0EA 4JMPA 4DSUA 1OIXA 3M6AA 3RVBA 1XEXA 5DI3A 4ZDIA 3WP1B 2QU8A 3FMOB 4LI0A 1UKVY 1KDRA 4PC6A 1XD9A 3ZS9A 3QKSB 4CEJB 1SKYB 2ZYUX 3I72A 3CX7A 4JLPA 2NTYC 3ECCA 2KSQA 4C0BA 1CBUA 4P4SA 3KFVA 2BBWA 3O8CA 1AGRA 3G0HA 2JAQA 3ZVNA 5FH9A 3B1XA 3P32A 2JLWA 3QNUA 4LC0A 2GVZC 4HUTA 1GM5A 5TDHA 3X1ZA 4ZIRB 1MKYA 5DO9A 4LCBA 2GEUA 4PZZA 5FOUA 2FEOA 4TQ9A 3LDAA 2JJ8A 4N3NA 4LJ5A 4ARZB 1XTSA 3W9YA 4PPNA 1H8EA 2R65A 4TSFA 2JIZA 2H8KA 1XPOA 4X8HA 4C0SA 2ZJAA 4LK2A 3AP1A 4MKHA 2IYXA 2Q3MA 5EP2A 3BK7A 5AJXA 2QY9A 4CIDA 4Z1MD 3UK6A 3EPLA 1XBTA 1NN1A 3CX6A 3GJ7A 1QHGA 4I81A 4HLDA 5FOVA 4GZLA 1WF3A 5DYIA 1XPRA 3KKPA 3CUEF 1NL3A 2QUZA 3W6NA 1DAIA 3PFIA 2VIIA 4Z8YA 3WHKA 2ZEJA 1U9IA 3K0AA 3HYRA 3FB4A 4EFMA 3A4LA 2PEYA 1CJTC 1QHYA 3WMGA 3BBPA 4HDCA 2X77A 1P4SA 3ADKA 3ZQJA 4OK3A 5C2JB 5EE1A 1CP2A 5H68A 4EUNA 2IUTA 3BJIC 3E2IA 4G5RA 4GP6A 3LD9A 2C03A 4JLKA 2NO7A 2HCBA 4M1OA 2UZ3A 1U2RA 2ZRGA 3TH5A 2R6DA 1LNZA 1BYUA 2QENA 1A82A 3LLUA 4C0QC 4DIEA 4KSCA 3L2OB 3KL4A 3SDZA 1D2MA 2ZRAA 5FTNA 2XGJA 5G3ZA 4G3XA 5B64A 1IJFA 3K9HA 4D0LB 2IYWA 4DEXA 1P60A 5KDOA 1J8YF 3LBIA 2BKEA 3K0CA 4H9GA 1IJEA 3U7FB 3U3RA 1M6NA 1E1RA 2QZ4A 2W6JA 2MSEB 4MKIA 5IK2A 2FFHA 2ZRCA 4DLYA 1IN6A 3K70B 121PA 4N1AA 4OKSA 1RFLA 4U5XA 2CCJA 2PBRA 1Z0DA 1WCV1 3TQFA 3LFUA 2VHTA 2IWHA 4AURA 3EASA 3S1AA 3PEVA 4BZPA 2QAGA 2IYSA 3FFBA 3IQXA 221PA 2QGNA 3RS7A 3TQCA 4KLZA 2OT3B 4D4LA 1QHHB 3H0KA 5JSZA 5GADl 4OI2A 2IYZA 4TZ0A 4TWZA 3VX3A 4HLUA 4MRPA 4TTPA 1G41A 2B8TA 5TMPA 3LX8A 3C4JA 2ZRDA 3PCRB 4FIDA 4BFVA 2LWIA 3MWKA 1PJRA 3T61A 4Q19A 5E7JA 4MRSA 1KSFX 1ZUIA 1COWA 1FP7A 4LPKA 1S8FA 1JBKA 3CF2A 3K0CC 5FBRB 1ZCBA 5GVSA 4DSOA 2B6HA 1F6BA 4A2QA 1EFHA 1E2PA 4F91B 3CNOA 1G3MA 3I32A 4FMDF 4RZ3A 2EQBA 2KI5A 1Q3HA 4KJZA 1T3SA 4A15A 5FBWB 3REFA 4IVQA 5J5CA 3W8NA 3CH5A 3W3AA 4X8LA 4NYMR 3ZS8A 2CL0X 3OHMA 3LX5A 1TU3A 5K8UA 2AD5A 2ZSAA 1W7AA 1VIAA 4PAOA 3K70D 2XJ9A 3A1TA 4HATA 4MUBA 2CHGA 3LVQE 3EC2A 4O2LA 2GCNA 4X8MA 1F5NA 5EZ6B 1CEEA 3CBQA 3SOPA 2W83A 3NTUA 1D2EA 1U9IC 4M1KA 2ZE7A 4BLRA 2AFIE 4EJSB 3BH0A 2XITA 4EFNA 2JEOA 4Q21A 1I4TD 4EPXA 3DPUA 3JZMA 4LX0A 4TQUS 4Y0VA 1AKYA 1Z28A 1IN7A 2VSFA 2RH5A 1CTQA 3HR8A 5JRJA 3GLHA 2AKAB 2EYQA 2WWXA 1ZNZA 5CJPA 1ANKA 1HY3A 1UKZA 1KSJA 1KI3A 2JLXA 2ZYWX 4DVGA 3QG5A 1U0LA 2DFLA 3UWKA 3AVOA 3EZ6A 4LJ9A 2DPXA 2N46A 4LC1A 1FQKA 3N5CA 5AJYA 5K8IA 3I92A 3VR5A 5JI2E 1NMYA 5GJWC 5FOXA 1M1YE 3AF1A 2FMXA 4Q47A 4B43A 4NMMA 2D3WA 1Z63A 4M21A 2C9YA 2J45A 5L3SA 2H18A 4PO9A 4TYPA 2PX3A 2OG2A 4WZ6A 1II9A 3AVWA 2W6ID 2P5TB 5TY0A 2J1LA 1PLJA 1UEJA 5FUYA 1G8GA 3SJZA 4BFTA 3BXZA 2IYQA 2QM8A 2WM9B 4A0GA 2BJVA 4B2LA 1FUUA 3FHCB 4QJ3A 1JAIA 3VHXA 5JBQA 1SXJD 2VSXA 2RHDA 1G4AE 5G53C 4URZR 1XMIA 1YRBA 4JL6A 5A0FA 1HE1C 4M53A 1KO5A 1G3IA 3M0EA 3PG5A 4IVRA 3QPVA 1H8ED 1E9FA 1OIVA 4TSFD 4V0MA 5DIFA 5FR1A 4JLJA 5JFGA 2WWYA 2ZXUA 4NHOA 2HJVA 1E4VA 3KJHA 2RMKA 2YOHA 4EPRA 1AQYA 4DT1A 1DEKA 5CDFE 3THXB 4RCYA 1D9ZA 2OCPA 4JLOA 1KHTA 4DZZA 4I1VA 2XXAA 4HB2A 2ZSFA 2ZS8A 2GF9A 3K0FA 3W5IA 1P61B 4URUR 2VP2A 5GJCA 1XX6A 5CM9C 2VHQA 5FOTA 5DHAA 4NDZA 2JATA 1S3SA 1HA3A 1SHZA 4PAMA 2WIBA 3KFXA 4MKFA 2PX0A 3ZD6A 2ZPTX 1JPJA 2HXYA 1KI6B 3OEHA 1KMHA 2FN4A 4UNRA 1ZYUA 4OHXA 3KJEA 5DN6A 2JJ2A 3K09C 1E2LA 3I1FA 5CIQA 1DAFA 1G18A 3UXMA 4JKYA 5KDDA 2DWPA 1EWRA 3ASYA 5EP4A 1LS1A 1E69A 1K5DA 2CLCX 5KSPA 3CPEA 1G5PA 3TIFA 1VPLA 3H84A 2R44A 2ZJ8A 3THOA 1X1SA 3ZZ0A 3H1TA 4NYIR 4ON9A 2IC5A 2NO6A 3QPUA 2VP4A 4QNRA 3KQHA 2EYUA 5JECA 1Q1BA 2NPIA 3TAUA 1IY0A 5F9FA 2ZRLA 3W90A 1N6PA 1N0VC 1U0HC 1US8B 5C4MA 3AVTA 1F60A 5KTYA 5JZVA 3U44A 1NLZA 2VYFA 4TLCA 3BOSA 2XSZD 1SZPA 2NZJA 2YYZA 5F3WB 2A30A 1E9AA 1VTKA 2GILA 3EZ7A 3GLHB 1XJ0A 4MYHA 3UANA 3VR4A 4ZDKA 1ZMXA 2ZU6A 4LDJA 3W34A 1Q22A 1GKIA 2AXNA 3QEOA 3GLIE 4EAQA 4NCHA 1VECA 5FPTA 4Z54A 1SKYE 4DEYA 3ND8A 2GXSA 1NLYA 1W4BA 3RC8A 2WWWA 3EA5A 4LBYA 1E3MA 5EP1A 1F2UB 4P31A 1P6XA 2JJ1A 4K81B 4KYIB 3TJZA 3OFNA 1WB9A 2ZQ5A 3QIAA 2ONKA 4Q01A 821PA 5CLQA 4L9WA 2IS1A 1OXTA 2QI9C 4JL5A 1GAJA 3QKTA 2BV3A 4JJKA 1BIFA 3T06B 1GITA 4FINA 4UNPA 3QXXA 1E9RA 4LBZA 1O3YA 3FFAA 3MWLA 3PIRA 2ZI6A 1T5IA 2G83A 1ZVQA 2RGAA 1P62B 3RRZA 3I61A 4HAUA 1E32A 4HLCA 4LV8B 1G16A 1XTJA 5SZIA 1G64A 2QMEA 1G291 1FUKA 1JAHA 1OJLA 2IBMA 2AL7A 4DUGA 4DBLC 1EX7A 2C99A 3U61B 2ORWA 1GNQA 2CE2X 1UKYA 3C5CA 4A1FA 1ZUNB 2GJSA 2JJ1D 4TT3A 3Q5DA 3QKSA 4ZDJA 2ZJYA 3NBYC 3QUSA 4US1R 3WNBA 2HYDA 4M9ZA 3KUCA 1XU4A 2CE7A 4YC7A 3TAHA 2WMNB 1X8KA 3LXRA 2VO1A 3ASZA 1KMHB 3B9PA 4PC2A 1OH5A 3ZLJA 2FZ4A 1KO7A 2D7CA 5KUTA 3KDSE 1U99A 1BMFD 2H16A 2ZS9A 3BRWD 3P27A 1FL9A 3V4RA 2BJWA 2XSZA 5AJWA 2A7QA 1ZM4A 2DFNA 3HPRA 3D6TB 3ZQ6A 2GAOA 1NG1A 5F9HA 1NMXA 1SQ5A 2J46A 4URXR 3QJYA 1E2DA 1I4DD 1RW4A 2HEIA 4D4JA 2XTZA 3B8HA 1JPNA 2CHVA 1NF3A 5JI3E 4RZXA 4OQFA 2P5SA 1E0KA 2QE7A 1N6IA 2FPKA 4PHGA 4TLAA 3P4XA 1DAKA 1R10A 3KX2A 4Q4HB 3O47A 5J4HA 3DZDA 1XCMA 1Q21A 5FPKA 3A1SA 4JLDA 2GNOA 2FZLA 4FI3C 2PL3A 4LYAA 3HP1A 4R9UC 3NKVA 3ZDQA 3Q72A 4Q9LA 4NH0A 4JVNA 5UKDA 4AG5A 2PLRA 3WMFA 2ZI4A 2OFOA 2R6AA 5L3VA 1U8ZA 2N42A 4JBWA 1XTRA 4TYNA 3F8TA 1P3JA 1ZJ6A 1ZM3A 2HCJB 2ZETA 2QGZA 3TSOA 1FX0A 1TMKA 1C4OA 4E03A 4C7OB 5FTKA 2CL6X 5KOYA 4TMTA 4DDVA 3UPUA 2C98A 5KNCA 5JEDA 1GSIA 1HYQA 1FP6A 4GRAA 1XFAA 2QMHA 3OE7A 4NE2A 3V9PA 5DLQC 2XB2A 2O8EB 1S3GA 5LB2A 2GVDC 4C0JA 4HDQB 4B71A 2A3RA 3CX8A 621PA 3I4LA 1GFIA 1TTTA 1G4UR 2AFHE 2V8OA 3PUXA 3T5DA 3T5GA 2RGBA 1Z6YA 1IOZA 4LJ4A 1QF9A 1X8LA 1E2MA 2ZAOA 3HR7A 2XZPA 3MWYW 4TMKA 4MGIR 2RGGA 5TVKA 3X1WA 1KGDA 2GK7A 1SKQA 2G77B 1TF7A 3I8SA 3AVVA 2ZUDA 3G5UA 2IX3A 4LV5B 1XMSA 2J3EA 2A5JA 4U02A 4V03A 3FOZA 2WPDA 3GJ8A 1NY6A 3R20A 4E07A 4PPFA 5EJEA 4JVMA 1KDTA 1UBCA 4Q7LA 2AN9A 1JB1A 4BEBA 5J4VA 5IHPA 3M1IA 2YV5A 1VYTA 2JDID 2O8CA 2X8AA 3GJ5A 1TL7C 2GXAA 3K09A 1US8A 3AGQA 3KKMA 4LHXA 1NIJA 3HU1A 1GILA 5FI0B 4ESHA 4M1WA 5LD2B 1J7KA 4QFMA 1XD8A 4DDTA 1U81A 3BWDD 4KFUA 4LSGA 2NGRA 3KUDA 3P20A 1LB1B 4D4MA 1E0JA 1Z6AA 2OAP1 4LHZA 2KWIA 4AKEA 3RRNA 4A0RA 4F4JA 3C8UA 3PVSA 4LBVA 4AYWA 5AWFC 3SJCA 1IM2A 2ERXA 3LO5A 1J90A 2BCJQ 2OCAA 4BLQA 3IO5A 2ZRIA 3NH9A 5E7IA 4EFLA 4LPSA 2GEDA 4QNMA 2LCFA 3PQCA 1G1MA 3QKRA 3SJBA 4ITRC 1XNJA 2QG6A 4LHWA 1GL7A 2OBMA 3IDQA 1W47A 2H57A 3B5JA 3FYHA 4H1UA 1CULC 4M1YA 3EWAA 5C46F 2ZRKA 2CCKA 4Q7MB 3RS3A 4M9QA 1HV8A 1ZD9A 4XD7D 3BFKA 1DPFA 1K8RA 2BOVA 4ZO4A 2V7QD 1QDEA 3VU9B 2E87A 4LJ8A 1UFQA 1HUQA 4HLQB 4ZV4A 3OIUA 3O8RA 1RVDA 4GI7A 4WZAE 3NHBA 4KHZA 1JR3D 1X3SA 5FBQB 1CU1A 3EC1A 4U00A 3EPJA 3NHAA 3B9QA 1BOFA 1WMSA 2VHCA 3TR0A 3DMNA 2JLSA 3BFXA 3FWYA 2E9SA 3CR7A 1Z06A 4C0AC 1IXSB 2QMUA 3VKWA 2CNWA 1G6HA 1RRFA 1S1MA 1R2QA 2FFBA 4TLDA 1N2CE 1Z0IA 1NBMA 3X1DA 3AGPA 3CPHA 4AYXA 4XSHA 4IOKA 4XWOA 5CJ2A 1U8YA 4OJKA 1YZNA 2IK8A 2QTVB 2ZE5A 2G1JA 1PLKA 1IAQA 3EZ9A 3W6PA 4OQNA 2A5DA 3EWSA 3UMFA 4XVQA 5CK4A 5DN6D 3OEHD 1GKUB 2QRNA 3TSZA 5TB5A 4NPHA 2NOAA 2OLJA 4ZCLA 1G7TA 1SULA 1SVMA 4V0ME 4AWXA 2Q9AA 2Z5FA 1W46A 1AJEA 4JT4A 2QSZA 2JCSA 5H8WA 1E79A 1GTVA 3SBDA 2GESA 3GP8A 2Q3FA 4P3YA 1TUEA 4IDPA 3TSWA 4B44A 3LQRA 4L5BA 1J2JA 3L0OA 4MYCA 2WWFA 4OHYA 1MRNA 4FCTA 3KJIA 4O25A 1TADA 1ZUHA 2C2HA 2OCBA 1W5TA 3VHLB 2YHSA
chains in the Genus database with same CATH superfamily
3E18A 1EFKA 3OFSA 2PUVA 3AR5A 3FD8A 4W1RA 5ICEA 2I1LA 3WNZA 3IA2A 4II7A 4DNOA 3AL2A 1YZQA 4GMGA 2GD6A 3AB3A 2ZJ6A 4IZHA 3HADA 4DDUA 2AYYA 3QLVC 4OQXA 1PTKA 3N53A 3NPAA 4G07A 4UAJA 4J03A 4TMWA 5BQ5A 1AN0A 2SCUA 5ITWA 1MQSA 1UBJS 1BXRB 3G17A 3Q6NA 4U7FA 3ZLVA 2Y1WA 3ZY2A 3BCHA 3QI2A 1DRJA 2GK3A 3RC3A 4GOKA 4WEOA 4FMPA 1DTWA 1FXSA 2WKWA 2XZTA 3FSEA 5JAHA 2F3RA 2BM9A 2BM0A 2C4VA 3GF4A 1G3RA 3QW4B 4E5UA 1JP7A 1RJGA 3L6CA 1XEWX 4IIGA 4PLWA 1DHRA 1NW3A 3ZVLA 1KU6A 2H07A 3KAKA 4L0MA 4XJXA 1BWSA 1JMKC 1UIMA 1N4DA 2QS9A 6NULA 1A9XA 3BGIA 2ODWA 4F3KA 2ZPUA 3HACA 4LFBB 5E0KB 3ZQ4A 1NRJB 1RYMA 4G63A 4LSMA 5CIWA 5DCWA 3TTTA 3LNTA 3WXBA 4BNMA 5JS6A 4N8EA 2L82A 4HLUC 3ZU6A 2O8EA 2GMWA 3EF1A 3NBZC 3GDHA 5KC8A 4R1QA 2CHUA 1VBFA 1MMFB 1GPUA 3Q3EA 4PLZA 4WRRA 5F1YA 1R74A 1QP7A 3D7SA 1DJMA 2EERA 4IWNA 1YZKA 4JDUA 3LDUA 3E8SA 3BB1A 1AE1A 2QNRA 3PEEA 4XAQA 2QPTA 1Y7PA 4D1YA 3AILA 4GKBA 5HK9A 1XNRB 2DUMA 2ALJA 2PT6A 1I1HA 4AT1A 4E15A 4LF8B 1FFAA 1LSUA 1T26A 1ZR2A 4AICA 4WSOA 4A4DA 2HB6A 1JLSA 2ZATA 2ZTSA 4UEWA 5B7QA 4DYHA 4UUMA 1EWKA 1OTHA 2Q3JA 3R9XA 2Z58A 2XT0A 3PSHA 2GBLA 1J9GA 2NWQA 2DKOA 3K9LA 2PKQO 5CB0A 2WIGA 4E30A 2XUPA 2HIMA 1D1PA 4E4TA 4O2RA 4DA6A 1FW6A 4ARAA 1BFUA 1YRLA 3KUXA 4J3JA 4TL8A 4O0MA 1N8TA 3NB0A 4HN4B 4XYEA 5K3DA 5T4FA 5ITZA 4BVFA 1M34A 1JECA 1MD9A 4DXAA 1U0BB 4CQMB 3DDZX 4O3FA 3H18A 3QF4A 1IHDA 2P78A 3EXAA 2PUWA 2QIOA 3EVNA 3QU2A 4WD3A 2IS4A 2VJLA 2GSWA 3R4VA 2VDRB 2G3YA 3PDIB 3UV3A 1NBOA 2QV0A 3RFCA 2FSVC 1GSHA 1IZ7A 1UL1X 3DEJA 3CF0A 2IXEA 4Q15A 1OU4A 3NJ8A 1SZJG 1C2YA 1FDIA 3ZCSA 5BP7A 1FNMA 1GGVA 1QU3A 2FP4A 1VPVA 3PC6A 2V5UA 4AZSA 3ANNA 3D4NA 3SEQA 3HHEA 3U80A 4WA7A 4E88A 1L7DA 3WRXC 3QSYA 4FD3A 2GRUA 1TIPA 4F3RA 4KXFB 1TEHA 4RU1A 1JXOA 3ESBA 1KKUA 4Q6WA 4NCJA 2CXUA 3SP1A 4HVLA 3BWEA 4JXJA 3EGWA 1LFAA 3CPSA 4PINA 1IN5A 1G8KA 4XGQA 3W9SA 3VNVA 1R4AA 3KKNA 4D45A 3G9ZA 2FLVA 3CONA 4ZO9A 3RYIA 5SYMA 5TE9A 1X92A 1YS1X 5HQTA 4L4XA 4UFPA 4NAHA 2OYRA 3DFKA 3I01A 3GXBA 3TRFA 1LDGA 4IICA 3C7TA 1XJCA 1ORDA 4JLMA 4F06A 4H6PA 4CNQA 2XWSA 2GYYA 4LRWA 4WN3A 4QIHA 5DLYA 5A7FA 4L5YA 1UDWA 4FFDA 2QVBA 1Z2NX 3TOZA 4CL8A 3ESDA 5CD1A 1Q0SA 1XNQB 2CXHA 4IAOA 5AOBA 4CCWA 1ZM2A 4MTLA 3DT8A 2CVHA 1Q57A 5IW8A 1V8PA 1QV9A 1YB1A 1I8TA 3MQFA 2P9TA 3PHBE 3KB6A 4X8OA 1N2GA 3PFFA 1DJOA 4KAAA 2B35A 1M10A 4HZUA 3QEBZ 3LBHA 2CXSA 1E66A 3EA0A 1FP4A 3LVFO 1B4DA 5BR8B 1GZVA 1Z08A 4BVBA 5AJVB 4R0NA 3MT0A 3TQQA 1WXDA 1RXVA 2XUKA 4G8DA 1N6LA 1MABB 1UODA 2R3SA 3X1JA 1BE6A 1NR5A 2PO5A 3MUNA 2CD7A 3H75A 1BXGB 1P0QA 2PBFA 3HPQA 2C5GA 1E98A 4IDOA 3W3ZB 4DNXA 5JQGA 4Y1RB 3GLVA 3QBJA 1DC4A 2ZJ3A 2AZTA 2PBLA 1K6IA 3CKLA 4BUZA 5BR1A 5A0VA 2ZOSA 1ND6A 3TNYA 4O2BB 3ZDCA 2PQ0A 5KKCA 4XB6B 1SUIA 4F97A 4N5NA 2UUPA 1LS6A 1F2UA 1YV9A 5C3MA 1NBHA 3TEFA 4CETA 3KJNA 3QKIA 4K0KB 1N5KA 1NW5A 1GN8A 4C2UA 1SD5A 2H2HA 3RGGA 1C0EA 1VKZA 4HGNA 4EA8A 1DGQA 1R66A 2BUAA 2QX8A 2O1WA 3NYQA 2P2SA 2W4QA 4PONA 521PA 2EWVA 3R5TA 1KYYA 3WLNA 3KO8A 1G6OA 2IXGA 3N2KA 4GX0A 3T0GA 1U7ZA 2ZLBA 5I9MA 4O2AF 1KK0A 2JH8A 4ZOEA 1QGED 3LRTA 5TMDA 4DJTA 2KW5A 1SB9A 1YSCA 5C53B 1EBBA 2Q8NA 3DMFA 2I6TA 4AJ2A 3KTAB 3N8DA 1U7UA 3WR5A 4HTFB 3Q6MA 4TRRA 3SQWA 1EXNA 2IW3A 4QEDA 5K3CA 2DPGA 1N6HA 4NYMQ 4ND8A 2HA0A 2J07A 1QPBA 2FWBA 3A6FA 2HRQA 4K6OA 4G4SP 2QR5A 1UK9A 4HB0A 5K3SA 3RRFA 2J9GA 4HAYA 4KX5A 2VQFB 2Z98A 2A0XA 3CN7A 1GV1A 4OBBA 2BPOA 1R8JA 2DOKA 3HO8A 1W4AA 4AZ0B 1YFLA 3VM6A 2D7DA 1NC1A 1JJBA 2EFDB 5IU6A 2ORIA 1P9WA 3R7NA 4I9UA 3LQQA 5LA6A 4P32A 2ECPA 1WUYA 1JTFA 4FP9A 4OFZA 2N3ZA 1GAWA 1PR6A 3NORA 3O4HA 4NG5A 1R3DA 1U2DC 5AMXA 3VKUA 3TD6A 4MITA 2O5EA 4HVAA 5HIJA 5JJIA 3G49A 3JW8A 4N18A 4IHJF 4DB4A 4DAOA 2GWRA 3LQ2A 5EHZA 4EELA 2XQFA 4MRVA 2JAPA 3B60A 1RYZA 2FK8A 2H11A 4EDHA 1SQFA 1XTTA 1T6NA 1VRCA 1YB7A 2WC1A 2FR8C 2P3SA 4MZDA 2JHPA 4RS4A 3NDPA 4Y7CA 5ECGC 3JR3A 3OOJA 6ABPA 2A9RA 5AW9A 4Z0HO 2UYYA 5E7MA 1O6ZA 4D8VA 1P1KA 3A6JA 1AQIA 1NM5A 3KD2A 4BFSA 2PT9A 2FX3A 1FSGA 3HDTA 1EYZA 1OXKB 3FMGA 3LWBA 3VDQA 4M60A 1TEVA 2OHOA 3UENA 4JB2A 4URHA 4PLHA 4EKEA 3O38A 1FQOA 1VCHA 3WGUA 4EGFA 1SIBE 4FFWA 1CUCA 3C6ZA 5DHTA 3VYVA 3G0OA 3KHTA 2X0EA 1CHNA 2NYUA 4JEIA 4D56A 2CJXA 2DBQA 2VF7A 3KEQA 3NV7A 3L4KA 2JFPA 2G06A 4GGPA 4RLFA 3OC6A 1O5IA 2P3OA 4KVAA 2N1BA 1NZJA 3O0TA 4P08A 4C6TB 4ARCA 5LDGA 1XQWA 3DTVD 2G6TA 5BSRA 2OR3A 3ICPA 4UXHA 4Y9UA 5MDHA 1YVPA 1W4LA 4PS1A 3CLTD 1RAGA 1EAYA 3VH2A 1Z4JA 1JA0A 3MJTA 4IPTA 4N4AA 5EJ7A 3EJWA 4J0DA 4CDNA 2XOXA 2FDXA 1E6CA 2YR0A 3V3TA 5IWAB 2O7QA 3CF4A 4CG2A 3UM9A 5FWYA 1H0RA 2AEJA 3N6XA 4C7JA 1Z7WA 1ZD4A 2OUKA 2SKEA 1NFFA 1FYFA 3K8QA 3E2MA 3OAAA 3UGKA 3WFZA 5L53A 1BS1A 3PPYA 2NADA 1O6GA 2YJ4A 2X76A 2ZS7A 1WHSB 3H8VA 4ZZ3A 2HF7A 4EGCB 1HQDA 4IDQA 3U4DA 3WOVA 4EJ6A 2V3CC 3F46A 1J24A 2G5TA 3I9V1 2X8BA 2ZSBA 1YIOA 5DP2A 3HJTA 5FBVB 2VQEB 1VG8A 2Q1TA 3BRWA 4OH1A 5L3SB 1ZHOA 1V41E 1X1EA 3BH7A 3LGSA 3TL3A 3OLVA 3AR2A 3E9RA 3QBVA 2J32A 2BONA 2JIRA 4KLAA 3SOZA 3OZRA 1JIUA 1E9CA 1KEWA 1M2EA 1O1YA 4LYFA 2IIQA 2WFZA 1M8PA 3PPVA 3FYUC 2X0DA 4ETMA 2HLPA 4CHGA 3QE3A 4L9RA 4WJKB 3V9AA 5BXYA 4ZI3A 3VKHA 5EQDA 3C85A 2X7XA 2DBVO 2GBPA 5EUBA 3TM4A 1D2HA 1D9XA 4DV0B 2ABWA 2V54A 5FDFA 3EFOB 2QVGA 4G84A 3I6YA 1DE0A 4LY6A 1UJ2A 1R00A 2R6HA 1W36C 2C92A 5CDSA 3J80A 4HGOA 2WTNA 4TLMB 1DARA 2YXPX 3C70A 4TTIA 4ZVPA 3PD0A 4YALA 4CR8A 4QBKA 4D0RA 3WB1A 3FKSD 4UEJA 2FW9A 2WD7A 3RYFB 3V8NA 2CZCA 1RPZA 4XD7A 3ROFA 4ED9A 1QBGA 4P5EA 4ETNA 5IEBA 2PRKA 2P2DA 3WYAA 3OPVA 3U81A 1IWOA 3TCNA 2VDPB 5AKEA 3MS2A 3O3CA 3H42B 4RTJA 1EVLA 1OFHA 4EI2A 2BE9A 2P9GA 3MJDA 2C84A 4IDDA 2Q4DA 3FNFA 4J49A 4OJMX 2QQEA 4ZO8A 5T6MA 1YJCA 1PW7A 4Z9XA 5DKFA 2J59A 2NSJA 3NBUA 3OVMA 1CG6A 3QPAA 2P62A 4LJYA 4RJ2A 3DBLA 1EDOA 2PGIA 2B6NA 4MR8A 1ZW1A 1IY9A 4UVGA 5EHQA 3M4JA 1NR7A 3WSWA 3HYLA 1E1QA 1WDLA 4W5JA 3QM1A 5GZ6A 1CR4A 3WJ2A 4AD8A 4B3DA 5C4GB 3LO8A 4KK3A 5KPJA 4DOMA 1Q84A 3PWKA 4YVFA 3GC6A 2DWQA 4Y2QA 1NBME 1YRAA 1SQ6A 1ZUWA 2FFJA 3QPWA 4MUAA 4R1PA 4V0OA 3NBQA 3S2ZA 3PTZA 4NPCA 4L5CA 3RK1A 2ATXA 3ADBA 1NW9B 2Y0CA 3DCNA 4CV2A 1E9DA 5F2NA 1XHFA 1Z88A 3THXA 1YR9A 3P0IA 1BU5A 1W36D 1ZI6A 4X71A 1HNXB 4FFPA 3U4QB 2ZYVX 3N0WA 1ST3A 5HS6A 2NYVA 4YI3A 4DKJA 5A4KA 1HETA 4S0XA 3FMPB 3HYCA 4JSTA 1MOPA 1I1QB 3DR5A 2C20A 2EJCA 2PH7A 3ND5A 1SKAA 4DQLA 3RUDA 1M66A 3PC8A 1L7VC 3B38A 1QC5B 4UC0A 4XA8A 5A9SA 1MXFA 5B3JA 4AY6A 2P4UA 4MHTA 3SYNA 2A9KA 4X6UA 4YCDA 5EMLA 2NU9B 2R8RA 2BFCA 5H59A 2MHCA 2G6BA 3I0NA 4WLFA 3THWA 4BO5A 3I3SR 5A7GA 4AY4A 3A9RA 3KJGA 4L16A 3T3OA 3KAPA 3NKLA 3ETHA 2XCIA 1O87A 1B42A 4L8GA 4XOIA 1DAEA 1F14A 2AWOA 3PJDA 4U9HS 2Y0PA 2LW7A 3KHKA 5IBRA 5KZMB 3U3KA 1DDOA 3GFRA 1FFCA 2DYKA 2PZLA 1Y8RB 4TWBA 1ODKA 3FTEA 1HORA 2X5JO 4MHOA 3ZH2A 3KZOA 1KK1A 1RYHA 3BORA 3QFCA 3NBAA 5K5EA 2CYCA 4EM6A 2XUGA 4AJJA 3W7BA 2RD2A 3S27A 5CA0B 1U2QA 1SA0A 1KEPA 1RWBA 1MLDA 1U8UA 2G70A 4MRMB 3GNTA 4JK3A 2EF1A 3QUQA 4MKZA 4B3TB 3HWRA 4Q1CA 1PI3A 1C29B 3AUXA 2OZEA 3NOVA 3VAYA 1MJFA 1H05A 1WU8A 3X2SA 1NXPA 1P2GA 1R8XA 1Z7GA 1Z82A 3RQSA 2YZNA 3KQKA 3LIPA 3OWXA 2C95A 1K8QA 2A4KA 4NSNA 2YJGA 4DA4A 1I6KA 2D4AA 1QYXA 4UDXX 3MT9A 2P6RA 3WMRA 5IJ0A 1FP2A 2ZJ7A 5ECWA 1QG0A 1OPRA 4IMIB 3ZJ5A 2F3PA 1WXEA 1R6XA 2ZJ2A 3FVVA 4K8OA 4MVJG 4R2JA 1RBMA 2OHXA 3D3QA 4P3OA 3ZBUA 1VJCA 2Y9MB 3ZK8A 3LUJA 3O8OB 4BLUA 3EMKA 1M2KA 3BFJA 4NH4A 5KU1A 1TCVA 2CXXA 3GV0A 3VI4B 5JS7A 2P6MA 3JQDA 2IF2A 4LDAA 4YCJA 3EW9A 3PJEA 3Q6IA 1CUFA 1C3JA 3PQ8A 1J2RA 4CGZA 1OZAA 1SXJE 4IV0A 1C8KA 4OHBA 1KQNA 3NVMB 3VV3A 3D8TA 4RD1A 2GEFA 3FMIA 5LB4A 2F9LA 1A2QA 1X7XA 3F47A 2A1UA 2BFMA 5IN5A 1XTVA 1EM6A 1TUIA 2G9NA 5CFQA 5EZYB 1NXWA 3IERA 3MWDA 2YWHA 2B69A 2ZYRA 1VP3A 2OA0A 1FNCA 4D0NA 4MS4B 5JRZA 4ER3A 2AF4C 2RHJA 1UP7A 1ULTA 2D13A 2YOFA 3PEUA 5HX7A 1YOBA 5FWNA 5M29A 1QORA 2XMZA 3AYXB 1KSHA 4N6GA 5KO2A 2OAQ1 3AR6A 5IG2A 1LF5A 3GVCA 1I7QB 4LDQA 5C1IA 1B0PA 1NY5A 1GTG1 4KV9A 1NSTA 3T3NA 1XF9A 2OXFA 3JQFA 3OEWA 2H7VA 2MSLA 3K53A 5EMNA 1K7YA 3DONA 4QUIA 4YRKA 3OU6A 1AS0A 1II0A 2ODNA 1WRBA 3AEQA 3GDFA 4HK4A 3ZNPA 2BHSA 2KB0A 1XDUA 1JXMA 2GAAA 3TPFA 3ZW8A 2ATEA 1UBMS 2DQKA 3H5OA 1E3EA 3JYQA 3AIKA 1RRGA 2GZ2A 3PF8A 1NNUA 1YB2A 3OMXA 2JD2A 3IUJA 1QO9A 4BMZA 3MD9A 1XL1A 5FX2A 4QYIB 2C5FA 2PLWA 3GVPA 4S1TA 1BDMA 3AF0A 4YRJA 5EXSA 2WOJA 1C4WA 1XDZA 3OIGA 3Q7PA 1AKUA 3VSEA 4IQ4A 2AYZA 2DBRA 1BCSB 2E5WA 3AKDA 1A5TA 4ENSA 4CKCB 3OJXA 2J0SA 3QMMA 1GWNA 2IHTA 1K06A 1PNRA 5FB3A 1V47A 2I4LA 1E79D 3GGJA 4J0EA 5EHGA 4R05A 4HAIA 2HA5A 3TO5A 3HWX1 4TTRA 1GTJ1 4ZEVA 1PR1A 1NZFA 5BORA 4G9EA 1HGXA 4BEJA 2B5OA 1PHPA 2QGFA 4WFKA 1F6DA 5ILGA 4I66A 5DWVA 2F8MA 3RK0A 4HNTA 3A7EA 1FMCA 3BXOA 2EFYA 1D0IA 1P5FA 2ZBDA 3LPMA 4WLVA 1AMUA 4IFBA 2ID9A 2R11A 1ZM7A 1PFWA 2VDMB 1Y3AA 4BKMA 4D79A 4PG8A 1E0SA 1T5OA 4I5DA 3ZW7A 3QKRB 1J2EA 1AQ6A 1MH1A 4DN6A 1ZUNA 4BS9A 4IKPA 4TQGA 2EX0A 1V8BA 1SUSA 4IV8A 1KVRA 1Z5ZA 4LV6A 4RLQA 3V8BA 3WADA 4DHWA 1D8TA 4U7PB 2HL6A 1V9LA 2Q9BA 4A3SA 1Q7GA 1Z5PA 3B1FA 5FA5A 2FUG6 4HQOA 1F4LA 4GF5A 5EQFA 3Q15C 1GZSA 2QT1A 1LPAB 1XGKA 1NUPA 4N8SA 5KYUB 1E8NA 2VN8A 1M2WA 1U28A 1A5AB 5KOHA 2RJOA 2IPNA 2AZ4A 5EWJA 1G5TA 5TF0A 1OILA 3DWIA 3P9PA 4YAOA 3V6LA 1R50A 1LSSA 2AC4A 3K96A 5LYJF 4BFYA 4H7HA 1LSJA 3QTLA 1M1YB 3QVMA 4HP8A 1UDBA 1Z0AA 3R9KA 4ETIA 1L7XA 4DXDA 5LVAA 2P1RA 5JXWA 1E20A 1QK4A 3PQ6A 1BCRA 3IOCA 2FPRA 3LK6A 4HDNA 3QEJA 4LNUA 2NPOA 4UDOA 4YLYA 4GX1A 1NRIA 4QJ4A 2XTNA 3H1FA 3NS7A 2HWKA 3IMKA 1HNZB 2E82A 5E4YA 1KI8A 3EGDB 3OPYI 1RS0A 1ESZA 4A03A 3LLMA 3CSUA 2D5BA 5HZKA 3QBTA 5CM8B 3PFBA 3TBKA 3W2HA 5IPFA 3LLVA 1H4VB 3B6JA 5AUOB 1N2HA 2B20A 2GNAA 4P3PA 3JQ7B 1JR4A 2QD1A 4MP8A 1XKTA 4ZHQB 2HC9A 4P3KA 3DGFC 3CH4B 5FOWA 4O4LB 4L8YA 2H2IA 1WUTA 5BO5A 3W1WA 2FPLA 4W9RA 3IQIX 1O96A 1L5MA 4G0OA 1YMVA 3LG2A 3FWNA 3R44A 3ZE1B 1DTSA 1W44A 2IH4A 4OYLA 1U3GA 1VHTA 2OO7A 4TRNA 3IMGA 5JVDA 1HQCA 4FUQA 4MARA 4RY2A 4MCHA 1K68A 2LKDA 3EH1A 3QU5A 3VU0A 5K8JB 1JFSA 3AHIA 1XSEA 1NUAA 1HMPA 4WW0A 1F0YA 3MSCA 5COQA 2VWHA 3PP8A 2D54A 3RRJA 3WGLA 2SKCA 4JP1A 1DDIA 3MW8A 4YAFA 4DLRA 5BVHA 3BX1A 3ASUA 1YONA 4F2DA 3HK2A 1PS9A 1TU0A 4C7MA 1U3CA 5C4IA 1Z2EA 2I7XA 3ZD7A 1W88B 4MDYA 3CPJB 3BHJA 1E6MA 3C43A 3VKFA 3ZOKA 3EIEA 3TNFA 5TPZD 3LMKA 3GP3A 4L27A 2BGLA 3M6IA 4ZZ2A 2FHPA 4MDFA 3R7WA 3QA9A 4MRAA 4PU0A 2BR5A 1KJZA 5AVRA 1Z2OX 2QN9A 3OQOA 4BFWA 1VJGA 5EMJA 2VJPA 4RD3A 2FWNA 3GFVA 3M2TA 2NMVA 1QIEA 1BD4A 1DADA 1JWAB 1EBUA 1QH8B 2KBEA 4K05A 1IY1A 1XZEA 1YCGA 3JAWB 3QVWA 3RS4A 1T36B 4TV8F 421PA 3PEWA 1RHJA 4WNCA 2XVMA 1P7VA 1Z4IA 2PQMA 1CETA 3ILHA 3O4FA 5D7NA 5LDHA 4BNJA 1F1BA 3V8VA 2QYTA 4EFKA 5E1BA 4BNNA 1O8BA 3G2MA 1WBJB 2XJ4A 4WVLA 2GJAA 1OWPA 2OSBA 1X7WA 4FE3A 1UT6A 4TVOA 2HD4A 1EVYA 2WE7A 3AYZB 3ZV5A 4C1NA 3UAOA 1NRWA 4KVGA 5KNCD 4QTUB 2HK9A 2BBOA 4PRYA 3C5HA 2Q7XA 3OOEA 4TQAA 3EGIA 4E22A 3GJRA 5AI4A 4DJFC 5CB4A 2WOOA 3U13A 3E0QA 3SVZA 3NFYA 3NC4A 1DIHA 4IZIA 1TK3A 3ZGVA 4E5DA 2VTBA 4AZ3A 3OJ0A 3OJLA 4Q4JA 4RCVA 2EKQA 4KUGA 2CJFA 5I6DA 4BQRA 3HHPA 1SVLA 2P7HA 1P33A 1AD2A 3IBYA 3PYXA 4BC0A 3CCBA 5HG0A 3DMTA 3AEQB 2BE7A 3SR0A 2PT7A 4LGCA 5CVCA 2MU1A 3DL4A 2VP3A 3H2HA 3IDAA 8GPBA 2BEKA 1U0OC 4CEHA 3BVPA 2XF2A 2H92A 3DBLB 3MTDA 4M0MA 4LE2A 5SZJA 4NBUA 5CLLA 3RRMA 3HTXA 3MT7A 4CKWB 1EFPA 4I5GA 1FEZA 2FWPA 5K3FB 3OPMA 4YPVA 5B3AA 4P4LA 1M7GA 3IP8A 2VDWB 3RWBA 3WK5A 3K0SA 1BAPA 1PZHA 1FNNA 2WAMA 2BL4A 1DIRA 1MDFA 2HLDA 3UGQA 1WZ2A 4L73A 5K0ZA 4WN9A 4DMRA 1GCAA 5FYDA 2IOYA 3IT3A 3VZCA 2WJ4A 4IXWA 1QCZA 1Y3DE 2PZFA 3FX2A 3UJ6A 4FPXA 1XZNA 3MBOA 2OOSA 5BUCA 4GLLA 1CR6A 1A69A 4M8IA 5A5FA 3DV0B 5HUHA 3D3EA 1AVTA 4PR0A 2QJFA 3QU4A 4G9GA 4CLDA 1I7DA 3BMOA 2QTMA 2AB0A 4JKOA 3N6RA 1L4BA 3E5HA 1E59A 1JMYA 1VLVA 1IEQA 2ECKA 2P9HA 3NIGB 3UMSA 1PFGA 1GZDA 2ORYA 3CISA 4KJXA 4PGFA 3H2YA 3EBLA 1XA0A 1MORA 3SBEA 3DBVO 1Q92A 2A33A 2ATVA 1RJ9A 3K2BA 3TRIA 1E3WB 4DMFA 2YMMA 3AOGA 4V0RA 2R86A 3OZFA 1IBLB 3E3OA 2EP7A 3GZNA 1HEIA 4WCFA 4EKDA 1HE5A 2F4VB 1I2ZA 2RB4A 4AB1A 4RCZA 1OWNA 1XALA 4FNMA 2I55A 3RRBA 2NV2B 1TM7E 3R6TA 2Y0BA 2JAOA 2WVAA 3CZMA 3T35A 1SMKA 2X1MA 3ML1A 3RC2A 5JBIA 5KTNA 4UXJA 5F1KA 4ZHSA 1AV7A 3PKJA 2QZPA 2E85A 4FMCB 2R62A 1BJRE 1ZONA 4O8ZA 1VPEA 4AKIA 4AJOA 1U1EA 1QVRA 1OA0A 4RX1A 2XRYA 2HWYA 4EKGA 3IHWA 4ZT2A 2IYOA 4KODA 1NF9A 4X54A 1B0ZA 2VSQA 5SYNA 1LDYA 1T35A 2UUCB 3U4MA 1KPIA 1CIPA 4PYJA 2F43A 2JIBA 2PYIA 3K5HA 4D9EA 2BWJA 4KPEC 1LA2A 1SZCA 2OM6A 3ORYA 4F5EA 1P5ZB 4LJ7A 1HLPA 1BQEA 3L8ZA 4MQFA 2IXTA 4FFBA 4RDHA 3ZV6A 1PNOA 2Y77A 3I1JA 4YMIA 5ALLA 4GKJB 3OJWA 3PHIA 2TS1A 2I54A 5CNKA 4DR7B 4JJ6A 1PBNA 1Y8RA 3I2KA 1L4GA 3MGCA 3Q88A 4MVJF 3ZQKA 1YVRA 3H5RA 3GFTA 1T0HB 3BE4A 3K0BA 2FG7C 3HXKA 4AMUA 4URYR 4XQ0A 1VFNA 4IIJB 1AS3A 3HKEB 1EP9A 1M1NB 1UQTA 4PO1A 3PDJA 3PXCX 3THWB 1ZW6A 1GQ2A 3JY6A 5IANA 3JALB 4Y67A 2GXUA 4BNGA 1KNXA 2X58A 4Q18A 4MW5A 5IVKA 2QRGA 3H87A 3CH7A 3OT1B 4F71A 5EE3A 1F3OA 2WR8A 5CA1F 5A9SB 3ONWA 1WZEA 2WUWE 4MO2A 4BZXA 4RTNA 1A7JA 2F8LA 4JX8A 4YAKA 4F72A 3E15A 4LZAA 4R8SA 4PGMA 2B8JA 3STWA 3MJVA 2DZDA 4BLOA 4XR4A 3GFFA 4U4AA 2YY6A 3HUEA 2QRPA 3OQVA 3PLNA 1UXKA 2ZAMA 1E7RA 4LOJA 5EZ5A 1SXPA 2EJVA 3L6RA 4KXWA 5IUNC 1AKWA 1SVNA 2ZJFA 3OQ6A 3R7AA 3QIVA 4YP6A 4TPKA 5JWRA 4J7UA 4L28A 4LS3A 3U09A 4W5QA 1YQUA 2OZVA 2CNKA 3HP7A 3B3JA 3AY6A 3DA8A 4EEZA 4AY3A 4EYSA 4X6YA 1BGWA 1ES9A 3GJ6A 3C24A 4N5LA 1KBOA 3TJMA 3CM0A 3UUFA 2ZG6A 1AKRA 4KGXA 2JVKA 3INRA 1E1KA 1QM5A 1OE0A 1Q3KA 1IXRC 1KS9A 2HMUA 3EXHA 3IKVA 5EWMA 1KYTA 2NUBA 1QZZA 1X7ZA 1KI7A 2P9FA 3I6ZA 5FFMA 4IVPA 4ZVUA 3UW3A 5BPHA 3GLGB 2ZITA 1KY5A 1R8YA 1LFDB 3OH8A 1C4KA 4IDHA 4P53A 5D1NA 3U31A 1CR0A 1D2AA 2CSUA 3WVNA 5BQPA 4CV1A 3U5ZB 3HJFA 4WBSA 1XXHE 4OB7A 1Z0JA 1XDDA 2QDKA 1RI2A 4XEUA 3GUYA 4KGDA 4XFJA 4A0FA 1MC4A 3VC3A 1SU6A 3G7NA 4RVSA 5HFJA 2UDPA 1KQFA 1DWPA 5MN4A 3DBOB 3PJGA 5AW3A 1JWBB 1OFIA 3QXSA 4RGVA 4Q1EA 4N01A 3AJ8A 4M37A 3V34A 1JKIA 4WCVA 5A3RA 2V7UA 2VAMA 1VC2A 3N2LA 4ZVMA 3FCCA 2UYHA 1CJKC 2WLSA 3BYZA 3PT9A 4RFVA 4BQQA 4D41A 4JB0A 4JP8A 5JU6A 3LF2A 1NUQA 4EPVA 1Q7BA 1A9ZA 1U2DA 1YDFA 2B21A 3MTGA 4V0LA 4CM9D 2J85A 2B25A 1MNAA 3QX8A 4DC0A 5BWMA 4B09A 1SCDA 1VKJA 3K5IA 2KM1A 1S2NA 2WA1A 4EY5A 2AFIB 4ACBA 4CKEB 1XRNA 3IGFA 3KKOA 1OY1A 3UYKA 3ONDA 5G3YA 2OV3A 3TZ6A 1IN1A 2O8VA 4Q3CA 5E4TA 2EBHX 5AHKA 4C5CA 4EF6A 2NM0A 1PUIA 2D2FA 4QG7A 2CV1A 1JAZA 4LOAA 5FULA 3D2BA 2O2DA 5G4KA 4HFRA 1L4FA 5IVDA 1T4GA 4BO0A 3UV6A 3WBJA 2VHZA 2QJWA 3FFWA 2V59A 1XLTC 4O8CA 1CZHA 3ELYA 5TT0A 2GBFA 2V6IA 5DK6A 4ALNA 5FV7A 1JWLA 1CRQA 4CMAA 3PDWA 4RZUA 5HIIA 5K4AA 2QBYA 1L7MA 3EGVA 2W6OA 5TJHA 3VUEA 4U2EA 3NATA 4TOIA 2IYRA 2HF8A 3GG2A 4GP9A 4YXWD 3ZTTA 5A5DA 1D5CA 1ZZGA 3FHOA 3PB3A 3FYSA 4FGWA 2E48A 4JUAA 4NU8X 4Z4QA 2D8AA 4JL8A 4PSDA 3MN1A 1IEWA 2P5UA 2V7QA 4Q1BA 3WNCA 3WLMA 5KOIA 2J7KA 3IXMA 4NU5A 1HT0A 3SMQA 3SHFA 3UA4A 4RPCA 2LTAA 5LP6F 1NNLA 2QUKA 3FWPA 3EDYA 1PWYE 2C3PA 4UM9D 5B55A 1ZNWA 4S04A 3SZGA 5KPDA 5L4NA 4X95A 1YVEI 3FMFA 5EIOA 3BGOS 3NHMA 4F4UA 1QZXA 3FF4A 4OAPA 3DLPX 3F7MA 4KDFA 1DFHA 3IPXA 4QM7A 2W6MA 1EE9A 3NIBA 4CM8B 1EQ2A 2GRAA 4ZC8A 4D97A 2OYSA 4M55A 4AG6A 3P26A 3WBKA 4M0DA 2BMWA 3D5TA 4H59A 1GRQA 1L9KA 1TC1A 1TK9A 4GI5A 1Y9ZA 3KZ1E 2DHRA 3IODA 1ZK3A 2PRZA 4H27A 4HN2A 5C81A 1VIDA 2DBYA 2CVFA 2QZJA 4YIKA 5DXFA 1IZ9A 5KNBD 2AOVA 1RLTA 1KIAA 4J0GA 1Q83A 1ZOLA 3DZKA 4X1KA 3TSCA 4CIAA 1XEXB 5DYGA 3ZV7A 4OQMA 3EXEB 1G7RA 3WRYC 4HMOA 2WV7A 1QHHA 2R9VA 5D5HA 4BNHA 5KVCA 5LMUB 1RZRA 2VF4X 4WZAA 5LL6P 4MP3A 3REGA 4OI0A 3IR6A 3UCXA 1S96A 3OJCA 1M1ZA 1VE5A 3THYA 2PFSA 5AP9A 1TUGA 1R6UA 3PXDA 4DNPA 2A9JA 3C5VA 1WCXA 2WKPA 3E3NA 1JSLA 4X1OA 2W2OA 1AUQA 3T3PB 2XRZA 2H4HA 4QO7A 2EQ5A 2F7SA 2R2AA 4AXBA 4QELA 1T0IA 1VMKA 1Q1GA 3L0PA 3TMYA 2NQ2C 3B48A 3VNRA 3D7RA 4YJ2B 5L95A 3EPHA 4MQBA 1ZWLA 2WUFA 3U6BA 1LF0A 1R6TA 4O6VA 5AD1A 3DOEA 1AHHA 2J5BA 3HXMA 1T5DX 2D00A 1HPLA 1EKXA 2ZDHA 4GMFA 1LK7A 2IHBA 4I2NA 5C5EA 3QJGA 3TKLA 3X3HA 1RRCA 4GDMA 2OB2A 4LA4A 3FZGA 2QORA 4NNPA 5AO9A 4CW7A 1M8JA 5BW8A 2YJ5A 1PS8A 3UTDA 1SG6A 1TXGA 4CKZA 2TRSB 4EARA 4Z51A 5DHSA 5A5VA 4F5YA 3U26A 4BTEA 3BHIA 3RVLA 1NPDA 5JS8A 3E5NA 1NN3A 4UBMA 2GEBA 4JB8A 5KNCH 2I3BA 1YE8A 2H1VA 3IUNA 1XVAA 3Q8WA 3A6ZA 3TQHA 2P77A 3JZAA 4JCOA 5BYJA 5AK0A 2ZI7A 4Y2XA 2ISQA 3SS8A 1ESCA 3WIOA 2WHPB 5JTUA 4PGHA 1COZA 1MB2A 4FCVA 2Q21A 3AFIA 3DTVA 1T0JB 4Y9RA 5FNVA 4CE6A 1FTGA 5AUPB 2WQ6A 3H4IA 4EHFA 1G5QA 4I5FA 1K6XA 1XUOA 2GCOA 4MW0A 1XYVA 4F93B 4BEVA 4WQMA 3FLAA 3HJCA 5KYYB 2ZVPX 1VYVA 5CEEA 4FFNA 3HUFA 4D3FA 2X1VA 5ED4A 4OV6B 2GF0A 3KWJA 3IL2A 2HZ7A 1RYBA 3SE0A 5JY6A 2QPOA 3BE8A 2VHUA 4MRNA 2BZ1A 2XCRB 5CK5A 1T8PA 1YI8A 3RAPR 5M5BA 3DBRA 3LK7A 4ESVA 4L7QA 2Q9CA 2PMDA 4HKTA 4TKVA 1EK6A 5GPBA 1RM4A 2OO5C 4M1SA 4OHZA 3PGVA 4MNTA 3LPLA 1DTWB 1ONPA 3GEHA 5E6RA 3K9CA 1TQHA 1P0MA 2PQ6A 2HUPA 3LOUA 1RXEA 4XLTA 1AXEA 1EIWA 4ZJUA 2GZHA 2SCUB 2W2KB 3ZK9A 5EE9A 4CT5A 2J41A 2W90A 1MC8A 2FF7A 2ZBUA 4TYWA 4JYMA 4D99A 4C6RA 5FADA 1RCTE 2HDOA 3A8TA 5ARDA 2BM1A 4G1CA 2E37A 1UBSB 4XX1A 1PIWA 2AVNA 4Z0PA 2PGLA 3NBXX 5IH3A 3R24A 4HQLA 1CFZA 2FMTA 1UANA 1GZHB 1A77A 5GGXA 1JKFA 3TPZA 2B9VA 3GZNB 4RMNA 4EI7A 2OCIA 1SKMA 1Q16A 1GJRA 3E5RA 3QXCA 4K3UA 2OKGA 4R2IA 5J1SB 1RNLA 5G2OA 2NYRA 3O3NB 1K5PA 2C78A 1Z26A 4FSXA 3SC3A 1H6CA 2RHMA 1RE0A 1Y4DE 2XIJA 3FVWA 4W82A 2GJKA 4YQEA 5H70A 4F92B 1PWHA 1ZKMA 1MB4A 3V4PB 4YMUA 3P9XA 1LLUA 2QRKA 5ICSA 4Z4EA 3QLVA 5DX8A 4F2HA 3DDHA 3V5NA 3N70A 5LP6A 1BKSB 5LOVB 1X42A 3K32A 4U3JA 4EZIA 2WJ3A 2DPMA 4I1RA 1OWMA 3ZWAA 4C08A 2BVNA 3RSGA 1UIRA 1KI6A 3GGSA 3NC0C 4BLPA 3WLEA 1Z7EA 1OFGA 2V9CA 3PUVA 4PQGA 1XIVA 5SV2A 4X44A 1AZWA 1GUBA 4HUQA 4AL4A 1WS6A 1WMAA 2ZIUB 3LC1O 3LQYA 3D2AA 2IUUA 5EUMA 1PZMA 1XTZA 3MC1A 3VPDA 3N3BC 3ZI7A 2VATA 4QC2A 4TYQA 2X9LA 4I8IA 1RWNA 2RKBA 4YV7A 2BRUA 2OK8A 3VV2A 2Z9BA 3DZIA 2ZB8A 4P0TA 5CCDA 3PE6A 3ZKAA 2RONA 5BQ3A 3I9JA 3DYIA 4JDPA 3SVLA 2H54A 4MEJA 1YFJA 4GI2A 3QF4B 4JVSB 4UQOA 4ERNA 4WK6A 1GRCA 1C50A