3ADKA

Refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
b'MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Refined structure of porcine cytosolic adenylate kinase at 2.1 A resolution.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Transferase(phosphotransferase)
total genus 59
structure length 194
sequence length 194
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1987-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adkA00
1UDXA 2QGNA 3WMEA 5CITA 2V3CC 3SE0A 3NBFA 2J7KA 4LHWA 4LRWA 5HTKA 1VCIA 1GL9B 4DBLC 1KAGA 1G6OA 1TF7A 1Z0DA 1N5JA 2AHOA 1NN5A 2O5VA 3OE7D 221PA 3ZZ0A 1WDTA 5HR5A 1KNQA 4MITA 1SKYB 2ZRKA 4URYR 2HXYA 4XSHA 2ZEJA 2CLCX 4BEJA 1FP7A 4A0FA 2GHIA 1N6RA 4IDHA 4WZAE 2YVUA 4ITRC 421PA 1ZD8A 3EC1A 3AVVA 2A5FA 3QENA 1VG9B 2OG2A 5FH9A 3PUZA 4V03A 1U81A 2BBWA 2JIZD 4JL5A 2PX0A 4LC1A 3H2YA 2A9KA 1KJYA 2N1BA 4DLYA 1TNDA 5B58C 2GEDA 4Z1MA 4IDPA 1FMLA 5KPDA 4QHYA 4QGAA 3B78A 2REOA 3SR0A 2XZOA 4FCVA 4DIEA 4HDOB 4PC7A 3KUCA 1EFRA 1V43A 1Z6TA 1G8YA 4G0NA 2ZETA 2J7PD 2B7BA 2FZ4A 4DXAA 4BLRA 4A8JC 4DLTA 3O8CA 5DNYB 3U5ZB 4B44A 1Z3IX 2W2XA 2QI9C 2P6UA 3L43A 2RCNA 3L0IB 1KDRA 2Z0MA 1GL6A 3B13B 5AUOB 1OE0A 5JRZA 3QBTA 3W8RA 1E2LA 4DSOA 1XPRA 3DDCA 1G19A 1D2NA 4Q9IA 1TF2A 2FOLA 1DAMA 3HR8A 2HYDA 5HE9A 1SULA 3IGFA 5FTJA 5FI0B 1Z28A 1P62B 1NF3A 4L9WA 4C0AC 1D5CA 4XTCS 2JLSA 4DLSA 2ANBA 4MGZR 1ZNXA 2JDIA 2QTHA 2FE4A 2ZRIA 1CJKC 3THYA 3KQUA 1G5RA 3QF4B 1FUUA 4QL3A 5E95A 3FVQA 2IYUA 4IDQA 2XXAB 4Q7JB 2GEVA 4Q19A 4GOXA 1YZGA 3EAQA 4LJ5A 4V0ME 3I8SA 4XD7D 1ZCAA 3VNVA 2QAJA 3QG5A 2IT1A 1ODFA 1OFUX 2JLRA 2QT0A 2C98A 4UJ3A 2VF7A 4Q1DA 2CBZA 5AR1A 1CU1A 2ZRMA 4B3CA 5JSZA 2P5TB 4ZI3A 4IJMA 1NY6A 2GCNA 4GRAA 5C4GB 2ZE6A 1KK2A 3DZDA 4I99A 1Q1QA 1XEFA 1HH4A 3BB3A 4P3YA 3GLIB 1E6CA 3CF2A 2HT1A 1T3SA 3M1IA 3WHLA 2DWPA 1A82A 3QVUA 2EFCB 2Z4RA 4ZKEA 2MSEB 3EARA 3SJAA 1XFAA 2F1RA 2F1IA 1YVDA 1KZGB 3WYAA 1XTKA 4DKXA 2YWHA 1F48A 4LYFA 4URUR 1NBME 5KNCA 1P9NA 1RVDA 4JT4A 3T35A 1YKSA 3W8NA 5JJLA 1W0KA 4URVR 2R65A 621PA 4OQMA 3O8DA 2FGJA 4EPWA 2C9CA 5JRJA 1FTSA 1CJMA 1DVRA 1KI9A 3CF0A 4OHXA 5JFGA 3UPUA 1TQ2A 3B1VA 3OAAD 5E3HA 2R9VA 1G17A 4KI0A 3CPHA 4MUBA 1W49A 4TYPA 1WF3A 5AJZA 2C5LA 2OCYC 4F4JA 1WRBA 4JLKA 1RYFA 5JEDA 2FGKA 2WSSA 3HYRA 1XDBA 4N3NA 4QKQA 4B3XA 3G82C 1W0JA 2XB4A 1QHSA 4FD2A 4A2WA 1EK0A 1KDPA 4DVGA 2E1RA 4K8OA 2FFHA 4IVPA 1II8A 1WBBA 2E9SA 3PVSA 2J5XA 4ERNA 3FYHA 1L8QA 4OQNA 2CL6X 1E2PA 3AVQA 3UANA 4G5RA 3REFA 3MMPA 2V6IA 3MWLA 4EPTA 4QNRA 3ZVLA 1F6BA 2ZJYA 1YZTA 1OB2A 1KKMA 5KNBA 3CZPA 4IFBA 5BN4A 4TWZA 3NBYC 1YE8A 1GIAA 1U9IA 4JLNA 4BFTA 1HUQA 3TMKA 2VA8A 3QY0A 1GOTA 1ETUA 1NJGA 2YNMA 3KKPA 2FX3A 3VMFA 3TAHA 1SVIA 3K0AB 2ZU0C 1E1QA 1DEKA 1N5KA 3GJ0A 4TMKA 1FUKA 1S8FA 3VR1A 4YONB 1MRNA 1S9HA 4BLSA 3MD0A 3WY9A 1DPFA 4AKEA 5EZ6B 4BFYA 1XPOA 1Q44A 3QXJA 1P2TA 2IBMA 3C5HA 4PC3A 2LCFA 3LQRA 1NNEA 1LS6A 1QVAA 1FQKA 4M9XA 3GEHA 4HAVA 1US8A 4HEJA 3R7WB 5FBVB 3PXGA 1HY3A 2XB2A 3SQXA 4LJ6A 1W44A 1XZQA 4K46A 2QORA 2XOKD 4B3GA 2WSMA 3QBVA 2OFXA 4TLEA 2OE2A 3OEHD 5EP2A 2WAXA 3L2OB 4RVCA 1CJVC 4HLUC 1G8HA 4JYBA 2D62A 3TH5A 1QHNA 2QE7A 4EJSA 2C8VA 2ZYTX 5KUTA 1VMAA 2QBYA 1TEXA 2FFQA 2GXUA 4HUQA 4NP6A 5FUWA 3QEOA 1NIPA 1T9HA 1EFCA 1KOFA 1N6OA 2EFEB 3ZS8A 3BB4A 4OI4A 3D3QA 4AYTA 3BB1A 2XX3A 3PITA 1JR6A 4LC0A 2ZUDA 1ZC4A 3I32A 3E70C 4CDGA 1R10A 1NSTA 1YR7A 1H8HD 4L5BA 2QT1A 4GPTA 3AVYA 1R0ZA 4HAUA 1SXJA 5FR1A 1ZNWA 4MYTA 1MR3F 1VTKA 1ZU4A 2C96A 1TAGA 3BC1A 4TLCA 2AD5A 2ONKA 4NPHA 3W90A 1OV4A 2QP9X 3GLIA 1DAEA 4DCSA 2ZR7A 1S3SA 3Q8XB 3LDAA 5CB8A 3PUVA 4DZZA 4EQ6B 4KJZA 4YMUA 4M1KA 1G16A 2CK3A 4BQSA 2ZRLA 1KI6A 4GDFA 4HI0E 3RRNA 3ZD6A 1W4BA 4IVRA 2HXSA 1JXOA 1JPNA 1QDEA 3BXZA 4JLOA 2L0XA 3FKSA 3ADCA 1EFUA 1Z0IA 3GEEA 1AQUA 3TJZA 2OM2A 2IXFA 2I1QA 1DAKA 1GNPA 2YOHA 1F2UA 2YZ2A 1NVVR 3A1UA 4LJ8A 2NPFA 1DOAA 2IXEA 5DISB 1CLUA 5SZJA 2IYXA 2AKAB 3EIHA 2J0SA 2NO0A 1YJ5A 1KDOA 4Q4AB 1HT2E 2A2ZA 1E99A 4L8GA 2QG6A 4M1WA 4Z1MD 1E2KA 4JL6A 2RAPA 1JR3E 2JEOA 1XX6A 4KODA 1BYIA 1TU3A 3OIUA 1ZUHA 1EFRD 2A30A 1DAGA 1YRBA 1XCGB 1ZINA 3PEUA 3KJIA 3NBZC 3QI2A 5C18A 5G53C 4IEEA 1UKYA 2XITA 1VCOA 3AF0A 4LX0A 3LQQA 2FFAA 2W6IA 3CRRA 1G7RA 3CBQA 4PPGA 1AS2A 3RRMA 4QBHA 4QXAA 4NYJR 3KJEA 2R6GA 3U6KA 2CHQA 1UBGA 3KUDA 4LJ4A 2B8TA 1OIWA 2W2TA 3B1WA 4I4LA 2O8CA 2QPAA 3T1VA 1XTIA 2FSHA 2EYQA 2AR7A 2OESA 3U7HB 2EW1A 4M1SA 1ZM3A 1TTTA 1NMXA 2NPIA 4KFTA 4AK9A 3EIQA 3I3SR 4XWOA 1T0JB 1E9SA 1CKEA 4NH0A 4P4SB 2ZRFA 2ORWA 1XRJA 2CCJA 1ZUIA 2JDID 1R2QA 1SVSA 2WWFA 5BXQC 5FPTA 2I3BA 1U0JA 1SXJE 2BJWA 2WIBA 3OE7A 3ETLA 4BUJA 1IOZA 3OHMA 4HB3A 2G88A 4WXRA 2J1LA 5ANRB 4DDVA 1II9A 2CLDX 4MKIA 1LB1B 4TMVA 2LKCA 3RYTC 2CCKA 1L4UA 1SVOA 3ADKA 3EA0A 3CLVA 2H7VA 3FKQA 3GQBA 4V0KA 3SN6A 3IO5A 3EIEA 3AUYA 4MRVA 1NSFA 4HB4A 4ABYA 1KNXA 3F0TA 1TADA 2IX3A 1VKJA 1XCMA 1KI2A 2ZTSA 1G3UA 4I81A 3U7GA 1GITA 3NH6A 2J0UB 4Y0AA 1TUIA 2WJGA 3WMGA 5IRCD 2C77A 3K70B 2BV3A 3P27A 1G41A 2BEKA 5FL3A 2FSIA 4JBWA 4FN5A 2ZSAA 2G77B 1U98A 2ZE8A 2H17A 3QVVA 3I62A 3H1TA 1NP6A 4C7OA 3BBPA 1OYWA 1W48A 1BYUA 1JQJC 1I2MA 1KO7A 4PSAA 1RZ3A 3GLHE 1CR2A 4M9SA 4ARZB 1BKDR 2HF8A 5EE1A 5JCPA 2MMCA 4ON9A 4RD0A 4NONA 2XEXA 3R8CA 2O8DB 4DSNA 2JLWA 1S96A 1E0SA 1S4QA 4PO1A 4BLPA 3AH8A 4IEIA 1FFHA 1KTVA 1IN7A 1KO4A 2IF2A 1C9KA 5J47A 5FTLA 4B2IA 1FX0B 2VPPA 3KFXA 1AZTA 1CULC 3BERA 5EXPA 3V00A 1N3BA 2JLQA 3BS4A 1XTJA 2WSSD 1G20E 4CEIB 2QAGC 2FEOA 1U94A 1K5GA 1XMJA 4AIIA 4ZIRB 1W0JD 4JS0A 2X2FA 4YXWA 1N6HA 4FCWA 1CRPA 2BMFA 3A1WA 4POAA 4EAQA 3EZFA 3LW8A 2IXGA 4B43A 5LB4A 1JAIA 1GWNA 1OIVA 1VHLA 1Z2AA 3H4MA 4CIDA 4YMVA 2GTPA 1HEIA 1JEEA 2FMXA 4LJAA 121PA 3B85A 1DS6A 3Q72A 4G3XA 4IOLA 4PQRA 3I73A 5J4KA 3I5YA 1T8UA 1Z0FA 1HA3A 1OH5A 4M1YA 4KYUA 1DE0A 2G1KA 2ZSBA 4ESHA 1FMJA 1OKKD 4NL4H 4Q00A 1OFTA 3BRWD 3K09C 2V1XA 1NLFA 3RS5A 2CHGA 2AFIE 1E1QD 2QU8A 4IHQA 2YWEA 3THXA 3U3OA 4PC2A 4AG6A 2ZSDA 2ECKA 2GVZC 3KXKA 1XTRA 4O2RA 4YLGA 1G5PA 5FOSA 3VNUA 3FMFA 3R9XA 2A5JA 3NDBB 3K9GA 3TVDA 2WHXA 2R8RA 4GI7A 4C2UA 2GRJA 3RLFA 4MKHA 1GDDA 2LKDA 3TSWA 4B32A 3NWJA 5HZHA 3NVAA 3PUWA 4LHYA 3M6AA 3ZYCA 2HJGA 2QM8A 2NZJA 5KSZA 4LUCA 1OSNA 5EXXA 4Q7KA 2FF7A 3FPAA 4BFSA 2QE7D 4DLUA 3GJXC 4AD8A 2OAP1 2ZR9A 3ZS9A 4OKSA 2YINC 2YHSA 2IEZA 1Z47A 2FWRA 4P4SA 2C9OA 2CXXA 1VECA 3NBXX 2BEJA 3QKUA 1NLZA 1BH2A 1MO6A 1ZIOA 2IYSA 3K9LA 2QP4A 5KDDA 1PLLA 3K8YA 3MWKA 5EZ5A 5HCNA 2LWIA 2WWWA 1OW3B 4Z8XA 3K70C 4W7SA 3RS3A 4PHTA 3VTKA 4C0KA 3TUIC 5GJBA 2CMKA 4GP6A 5CYOA 1SXJD 2X19A 4M2LA 3QJYA 4RFSA 3AF3A 1VYUA 4M1MA 3UATA 2ZE7A 5EXSA 3SYNA 5J5CA 2GCOA 2XJ4A 1T3LA 4BWYA 2DHRA 3G5UA 4B76A 4TSFA 2D7DA 4G5OA 1Z5ZA 4DJTA 2GBLA 4NCHA 4IW3B 3GLFE 5L8VA 3I92A 4A8JB 2JLYA 4D26A 2BJVA 4OHVA 1IHUA 4PFSA 4NCNA 2QPTA 3AP2A 2FEMA 2CK3D 3BH7A 5KHOC 1R6BX 2GILA 2J45A 2O52A 1SVMA 1IN8A 4M9QA 1RIFA 1LTQA 2OBLA 4PZYA 2ZXUA 3TKLA 3FKSD 4B71A 3EA5A 4EKDA 4AURA 1H65A 4Q4HB 4XVUA 3KB2A 2XZPA 2QM7A 3SYKA 5F3WB 2ZJ2A 4PXAA 2AL7A 4DCUA 2D06A 4L16A 1Q22A 4R98A 5JI2E 5HE8A 4QNMA 3H84A 3PEWA 2ORVA 1JECA 2HCBA 3KX2A 4RD1A 3KKOA 1SQ5A 1RRFA 1XD2B 1ZVQA 3IUYA 2JA1A 1G3QA 2QMOA 3FHTA 1RJ9A 1N6PA 1CJTC 2VEDA 4NE2A 1CR1A 3CH5A 2MSCB 3L0OA 2WM9B 4IDOA 1TUEA 4FMBB 5CLLA 4A2QA 4YC7A 4C0HA 1QVRA 2JJ8A 3FMPB 1XXHA 4S35A 2Q3HA 2OCAA 4JLJA 1AM4D 4RD2A 3NTUA 1XEWY 3A1VA 3NH9A 2Q3FA 4KLZA 4RY2A 3GJ5A 3B1YA 4ACAA 2HEIA 4TYNA 3B82A 3FMIA 4FWTA 2W6ID 2Y8EA 4CEHB 1UBCA 4QJ4A 1AGPA 4ZDKA 5EP1A 2C99A 2JLZA 1M74A 3W9YA 4BLTA 1NKTA 2G3YA 3C7KA 4NCJA 3WHKA 3CO5A 3I8XA 4FXPA 3B1XA 2WOJA 1G9XA 1G291 4LCBA 1ZCBA 3I4LA 5AJWA 1TQ4A 2ZAMA 2GXSA 5FBLB 3AF2A 1ESMA 2P3SA 1P73A 3FE2A 4Q03A 4YDSA 3KL4A 4RCZA 3AM1A 1YZKA 3VU9B 4C2TA 3F5FA 4KVGA 4NYIR 2FH5B 4MYUA 3VHLB 1KSJA 4P0TA 1QHHA 1HQYE 5TARA 3MJRA 4AKGA 1BIFA 3EZ7A 2AK3A 2GK7A 3SJZA 2WTUA 1E2MA 2OSBA 2RGBA 5L3QA 2DWQA 3AEZA 1NIJA 4URXR 4LI0A 1NN0A 2BWJA 1S2MA 2EFGA 2Z83A 4LSGA 3MFYA 5CYPA 5DI3A 3THOA 2A7QA 4MUAA 4E22A 2WWGA 2Q9AA 3TVTA 1QBKC 3C4JA 1ZUNB 4C0SA 2HDNB 1K5DA 4URZR 4EFNA 2ODBA 1FW6A 2D2EA 1A1VA 1O3YA 4M21A 4DDTA 3K0EA 2JAQA 4EUNA 1J90A 4D0GA 3QSYA 3C5CA 3RS7A 2ZRBA 3R20A 3T12A 1Z08A 3Q9LA 4IOMA 5D3MA 1GSIA 4H9GA 5DLQC 3U3RA 1ZW6A 4UNRA 3LA6A 3ASZA 2ZYUX 3IPYA 4LY6A 4QM6A 2W6JA 3GLGE 1OH8A 1UKEA 5A0FA 3X1WA 1W2HA 2IYZA 1J70A 1G4AE 2XTZA 1E3MA 4JKYA 2JATA 1W36D 3WNBA 4QFMA 3VFDA 3B9QA 4A4DA 3SQWA 2QA5A 4O2LA 2ZIAA 3ZIAA 4Q66C 3RAPR 5TDHA 1JQLB 1IM2A 3AUXA 1XEXB 2XNDA 3IQXA 2DFTA 3AP3A 1OXUA 2NO7A 1P75A 4DWJA 3RRZA 4A8JA 1HE1C 3L8YA 1E94E 2GZHA 4ZCLA 4MDFA 1RRCA 2DYKA 3QKSA 1KK1A 5KDLA 3SZRA 3EPHA 1E9FA 1W4AA 5JEEA 3Q7QA 4Q1AA 1KMHA 4TYYA 4RKEA 5C46F 1ZNZA 4DSUA 4YXWD 3QKRA 3CNLA 2CJWA 2PEYA 4M22A 1GL7A 2X1VA 3IPXA 1R5OA 1YR9A 2FG5A 5DO9A 2WKPA 2YC2C 1W46A 4JVSB 4P32A 1Q57A 4BRWA 4YMWA 4UXIA 1CR0A 4DIDA 8OHMA 5EQTA 3NIBA 1AN0A 1RRGA 2HYIC 2FZLA 1RPZA 2PZEA 2GETA 2IL1A 1HTWA 2QMEA 4WZ6A 4NTZA 4RZ2A 5EE0A 4NCIA 2O8BB 3A4LA 3WYFA 3T34A 4DRZA 4BFZA 2QNRA 1E2FA 2WIAA 4CEJA 3LNCA 2XJ9A 3T61A 4D6PA 1T4GA 1MV5A 2VHCA 3VX3A 1T5LA 1EWRA 2JASA 3B9PA 3DOEA 3U3KA 4E5UA 5JWRA 1KO8A 1DELA 5JMTA 1R0WA 3UG6A 2WJJA 1YQTA 2C9YA 4LV5B 4BFXA 1E9AA 1JPJA 2IHBA 3S1AA 5JCZA 2GJ9A 1Q3HA 4A1FA 1NMZA 3BH0A 1TQDA 5FOVA 3GEIA 1VHTA 4RZUA 4KHZA 1OFHA 1CF4A 4HDCA 1XMIA 4QJ3A 5A5GA 4HYYA 1N6KA 3RVBA 1N25A 3HYTA 1B23P 2KE5A 3GJ7A 2PL3A 4JLAA 2WZQA 2B21A 1F2TA 4M1OA 1MOZA 4OJQA 3U4QB 3EPKA 5KO2A 1E0KA 4Q1CA 5KDOA 4G1UC 3UIEA 1F5NA 1PUIA 1KO5A 3KFVA 3THWB 4C4PA 3JZMA 4Q48A 5GJCA 1AKYA 4GZLA 1XU4A 2OFOA 3LX5A 1S1MA 2BOVA 4MGYR 2VQSA 3EZ2A 3TBKA 2RGAA 4B33A 5FOUA 4GNKA 1KK0A 4Y0VA 3DKPA 2C04A 4J0QA 4DUGA 1P4SA 3CIOA 4PHGA 3MG9A 5FBWB 2UZIR 5TY0A 2OXRA 1X8JA 3ZZTA 5C1BA 2FPMA 3LVRE 4C0LA 3R8FA 3HU1A 3GLHB 1EGAA 2C2HA 2WVJA 2EFHB 2ZANA 3PR1A 2J0VA 2PCLA 4PZZA 1IN6A 4FMCB 3K0CC 2FPKA 2OHFA 2XNSA 3AP1A 4MKFA 3I1FA 4DT1B 1G8PA 2VSOA 4TSFD 1VYVA 4AYWA 1HE8B 5C2JB 4WXPA 2G9NA 4OHYA 1FTNA 1P3JA 3P4XA 1OKKA 2YC4C 2WPDA 4CT5A 5AJXA 1ZP6A 3QPWA 2G83A 3SFZA 4R9UC 3GJ8A 2VP5A 2WOOA 1KI1A 2GNOA 4ESVA 2PX3A 1T6NA 3C8UA 3ZVMA 1WCV1 1FNMA 1P5ZB 1MH1A 2RGNC 1Z29A 2H16A 2F3RA 2UZ3A 4FMDB 4P4TA 4BZQA 4LPSA 5JHHB 4PPFA 3X1DA 3M0EA 4Q01A 1P2VA 4RFVA 5GADl 1ZM7A 4Q5IA 2RMKA 4KSBA 4Z8YA 5TXGA 4TL8A 2VLIA 4TQAA 1U0LA 3QF7A 3WBJA 1HURA 2GJSA 2O0HA 3UG7A 5KU1A 3SBDA 3NXSA 1IBRA 4Q1BA 2V1UA 3KQNA 1M6NA 3AKCA 1LF5A 4KFUA 1Z6GA 4HB0A 1ZM4A 5BYKA 4GMDA 1XEXA 2ERXA 1G4UR 5L3SB 1P2UA 4NBSA 3V9PA 5HZKA 1Y3AA 5EJEA 4G01B 4A36A 4TYQA 4V0OA 3VKHA 4RJLA 4Q9HA 1CXZA 2JLVA 1BO6A 3BJIC 1EX6A 1UADA 2VHJA 4GMXA 1E2DA 2AKYA 3QF4A 5CM9C 4W5HA 4KSCA 4GOKA 4Q4JB 4Q4LA 2XXAA 1E4YA 1D8TA 4NU0A 1OH7A 5H70A 4DLWA 2Z4SA 1L4YA 1Z6XA 4FI3C 4B3FX 5JLJA 2MMGA 2W0MA 1OXTA 4A82A 521PA 1D2MA 3ZH9B 4A92A 4MQBA 4JMPA 1S1CA 1LF0A 1W4RA 2O8DA 3K0FB 3AV0B 1PV4A 2VH5R 1G8GA 2ZRHA 3GCGA 3CRQA 3K9HA 3QPUA 2CDNA 3GJ6A 1L7VC 4TZ6A 3QQ5A 1R0YA 3CR8A 4C30A 4ASUA 3LY5A 5DIFA 4EPRA 3RABA 4AWXA 4LV8B 4QC2A 4CEJB 1O87A 5BQ5A 1FPMA 2YYZA 2V54A 2H18A 5LPNA 4UKDA 4QHSA 1XBTA 2F3TA 2DB3A 4DB4A 2GKSA 4JJKA 2WMNB 3WMFA 2PCJA 4M4SA 2YV5A 3CR7A 4R2HA 2C78A 5J40A 1AS3A 4MRPA 3IO3A 1GNQA 2VP6A 1A2KC 3ADBA 1G7SA 1E9BA 4PC1A 3B7GA 1KMQA 1J8MF 1VDZA 1M34E 2QQEA 4BFWA 1PUJA 3DVLA 2IHYA 3GFOA 2IUSA 2DFNA 3A1TA 2BMEA 3THWA 3AF1A 4HDQB 2ODEA 3T15A 2QAGB 1JALA 2ZJAA 4LYHA 2OO7A 4D0LB 1MABB 3A8TA 1R5NA 2R6DA 3ECCA 2WWHA 2P6NA 3GLFB 1XMSA 4LBYA 1IN4A 5IDVA 3IHLA 3KTAB 4X8MA 1X1RA 2ZI4A 2KI5A 3SEAA 4PAOA 3GPLA 1NJFA 3HDTA 3B6EA 3JVUA 4EPVA 3OFNA 2ZJ5A 2RHMA 4GSYA 4ZDWA 1E9EA 2CL0X 3ZD7A 3WP0A 2W6JD 4HLCA 4OK6A 4Q47A 2AWOA 4OQLA 1ZM2A 4WOPA 2ATVA 2ZUBA 4IDNA 3RWMB 1B0UA 3TSZA 4Z51A 4BGDA 3H0KA 4I1SA 1W7AA 4Q1EA 5M04A 5L3RA 4M53A 3SHFA 2P65A 3L82B 3Q85A 3W34A 3SHWA 4F7WA 3A1SA 5CK5A 4KO8A 2EWWA 3ZIAD 2GF9A 4OL0A 1WE2A 5BW8A 2IS6A 5E7IA 3UK6A 3CWZA 3CF6R 5DYGA 3RHFA 2XNDD 2QTFA 2YWFA 2P2LA 3NC0C 2QGZA 5F2EA 1QF9A 4U02A 3K0AA 1ESNA 1I4LD 2JJ2A 2HV8A 2JLUA 1A4RA 1OHHA 2WBLC 721PA 1NG1A 5A4JA 3IBYA 3K1JA 3L0SA 3WYGA 1NVVQ 3TNFA 3LBHA 4R71A 2AFHE 3SNHA 5JJKA 3LRPA 4UJ5A 3DHWC 3RSOA 4JSYA 3ZLJA 4IXNA 3R7WA 3LFUA 2A78A 1KSHA 2O0KA 3PG5A 1IY0A 4GOJA 1ZU5A 4DDUA 2NMVA 1XF9A 3GLIE 4RZXA 1J8YF 3QOFA 4JVNA 2EVWX 2WAYA 5EE9A 3LXXA 4US1R 3LWNA 4WW0A 1E79A 1NMYA 2Q9BA 4NYMR 2VHQA 4HLDA 1UEIA 2ORIA 3W6NA 2A5DA 3A4NA 1AA9A 2RH5A 1E2NA 5G3ZA 4QGHA 2V4ZA 3GFTA 2PJZA 1VG1A 3W5IA 1GKIA 5K8IA 2FNAA 3CUEF 3Q3JB 4NYJQ 4X8OA 3BGWA 1GG2A 1QHYA 2H5EA 2IUTA 2W58A 1KK3A 3PJRA 1LNZA 4DCTA 3CPJB 2BBOA 5FTKA 2VO1A 4LWZA 4BLQA 4C0JA 4Q4JA 4JBYA 2KSQA 4D80A 2ZVQX 4LGMA 3IBGA 1GTVA 2QSZA 4TTRA 1CTQA 5D3QA 3AVPA 3B2EA 4AKIA 2QPOA 2ZJBA 4F91B 3J81k 4QM7A 3BWDD 5KSYA 4PQFA 1KKLA 1CS4C 2REBA 3AVOA 3K0FA 5EP4A 2Z6VA 4B3BA 1Z0JA 4LBVA 5EE5B 5BN3A 3N2EA 1QG4A 4Q1FA 4LYJA 4OK5A 3WNDA 5GJVC 4BZPA 2IS4A 2VF8A 4EQ6A 4D25A 3NDPA 2F7SA 5UKDA 4KVAA 1RW4A 3MRSA 4DUGD 4HSEA 4IOJA 1UPTA 2IYVA 2IWHA 3ZVNA 4DSTA 2CVHA 3FMOB 3D31A 4D4JA 3EC2A 4DHEA 1WQ1R 4PR0A 5DI9A 2H57A 2O0JA 3GLGB 1W47A 4I1OA 2VHUA 3DPUA 5AK0A 5CM8B 3RS4A 3EW9A 2WMOB 4LJ9A 2ONJA 3QNUA 3FHCB 2BM0A 3T1OA 2XGJA 2FSFA 4A0GA 4NDZA 3Q5EA 5JI3E 4Q4AA 3M4YA 5JWHA 5AUNB 4HZUB 2WPDD 4R2IA 4HAYA 5K8UA 3C41J 2A5YB 4WVFA 2PBRA 3DOFA 2IYYA 2VTKA 1Q0UA 4KYIB 4KAXA 3ND9A 1COWA 3FWYA 3P4YA 4M9ZA 2Z5FA 2RGDA 3DEFA 3OESA 3TR0A 1UDWA 4D81A 1VPLA 1E9CA 3A58B 3BK7A 2XTMA 3HU2A 5L3VA 4Q18A 4ZO4A 4RCYA 5LBIA 5IF9A 2HLDD 3CPEA 3E5HA 1DADA 1TMKA 4MA4A 3QXXA 1N6NA 4TL9A 2I1VB 4Q7MB 3U3MA 3K09A 3SBEA 4B74A 1LY1A 3X1YA 1Y63A 4V02A 4BFVA 4D4KA 5SZHB 3GMTA 5JBQA 1EX7A 3EPJA 1E2HA 5GVRA 2NO9A 4AI6A 1E9RA 4LJYA 1E2QA 4FCTA 5FPYA 2OAQ1 2GWHA 3R9WA 1Z06A 1J7KA 2DPXA 3GD7A 4GZMA 4BRUA 2YJTD 4QHTA 4ZDJA 2D7CA 1Z6AA 3VQTA 2FPLA 1KAOA 2O8FB 4OHZA 3TSOA 3WXMA 2FU5C 2E87A 2RGXA 1KI8A 2ZJZA 1U8YA 4TMWA 3AKDA 4MGKR 2FSGA 2DFLA 1SVKA 1E2EA 3VR3A 1EG7A 1GRNA 1XEWX 4BASA 2GJ8A 1WMSA 2C95A 1S9DA 3KJHA 4QBGB 5FL7A 3W6PA 1XB2A 2VSXA 4JSTA 4XH9B 5TMPA 4PSVA 4PQYA 4V0NA 2WV9A 2IYWA 1OLOA 2Q6TA 2ZR0A 2V7QD 4FINA 5CIQA 4EDHA 5KYKA 1ZYUA 3HJNA 1ZRHA 3K9NA 5TV2A 2GVDC 2IK8A 3GJ4A 1G7CA 2GESA 5JWOA 2IEYA 4KFSA 4GP7A 2IYRA 2WKQA 1P9RA 3EZ6A 4HLQB 4UXJA 1UEJA 1N0VC 3A4MA 2F9LA 4JLDA 4ASUD 2J0UA 3CB4A 1OT3A 4KXFB 2BBTA 2OZEA 2W00A 4QGGA 3EX7C 4KCGA 2R6CA 1OXXK 4HZIA 4JKIA 4IVQA 2EWVA 4RD6A 4D4MA 2ZRNA 4F92B 4Q9JA 1X8KA 4MH0R 3OIYA 2ZRGA 3MCAA 4US0R 1N5IA 2BKUA 1IAQA 2FA9A 4CYMA 3TIFA 3P1JA 4G5QA 1OPXA 1OXSC 1N5LA 4MRRA 2Q21A 4YQFA 4PHHA 3UMSA 4AG5A 3VX4A 4ARZA 3DMDA 4ZPXA 5TVKA 4ZV4A 1DO2A 2IWRA 3LLMA 5ELXA 3Q7PA 1SZPA 1A2BA 2R6AA 2W83A 2NIPA 5IK2A 5DE3A 3H86A 3P32A 2MSDB 1H8EA 1E98A 1DAIA 1QHXA 3CWQA 3RWOA 3TAUA 3VHXA 4BLOA 3EWSA 2P0EA 1GUAA 1MT0A 2OEPA 1FX0A 2PLFA 3THYB 2WJYA 3PIRA 2GZDA 2AXPA 3P26A 5AJVB 1M1YE 3AVUA 2BMJA 4P33A 2VIIA 2QROA 4CEIA 1G8FA 3UWKA 3CKLA 2VRWA 3OFND 4ZIRA 4TTQA 2ZSFA 3SDZA 2VP9A 4OHWA 4DLXA 1ZJ6A 4B48A 1E69A 2KB0A 1KO1A 2R6FA 2XSZA 1GKUB 3SU8A 2RB4A 1JXMA 2DR3A 3CZQA 3ICEA 1GILA 2OUKA 3ADDA 2V6JA 4XWAA 1PVOA 1T0HB 3AVWA 5JSZB 5DHAA 2JLXA 1ANKA 1PZNA 2J46A 1KHTA 2HUPA 1PLJA 2ZVPX 4C0BA 1F3OA 3D6TB 4KLNA 2GK6A 3BAFA 1UFQA 5KSPA 4JLPA 4MYHA 1UBEA 5G3YA 1VIAA 3VAAA 5JJIA 4OJKA 2GAAA 4ZCMA 5KSOA 3NEJA 2BCJQ 2ZYWX 1IN5A 5DN6A 1QG2A 4B3DA 1ZIPA 5DHFA 2VP2A 4B34A 3I61A 4TMXA 1Q12A 2JJ2D 4OQXA 3KKQA 1KSGA 1OHHD 2ZI9A 2QQ0A 5KPJA 4S2EA 1XJQA 3VR4A 2NQ2C 1KY2A 2F6RA 2NO6A 3VKWA 2QMHA 3U60B 1FOEB 4A15A 4FW9A 3KDSE 5FBRB 1DBSA 1JNYA 1UJ2A 2KBEA 4RKFA 4TLBA 3RNLA 2JGNA 3TUZC 3QKTA 1YR8A 4UNPA 2IYQA 2QN6A 1Q1BA 1XMVA 1CBUA 5E7MA 4V0MA 4IRUB 4AC9A 4OI0A 2IS1A 2HJVA 5H68A 1W2GA 2GZAA 2R62A 1OXVA 1FP6A 3ZZUA 1Q1ZA 4B2PA 1E9DA 2YKGA 3BFKA 4UQOA 1QHIA 1YU9A 4A6PA 1E79D 5HCIA 3TW4A 5F98A 4B35A 4WZBE 4BFUA 1MKYA 2ZYVX 3PCRB 3NHAA 4B75A 4LHZA 1LS1A 4M0LA 4F4IA 1JAHA 1U99A 2O8FA 2NGRA 1II8B 4UNNA 4Q7LA 5DGXA 2DWOA 1BS1A 1XJ0A 3U7EB 5AWFC 3UMFA 4M8NE 4XOIA 1XZPA 2G0TA 2GXQA 2WJVA 4XJXA 1G3MA 1NBMA 4TN1A 3WBKA 3X2SA 1NG9A 1J2JA 1GZSA 5IHPA 2H92A 5CB6A 3LBNA 1HQCA 4DB2A 4BE7B 2JJ1A 3QXHA 4NYIQ 3CRW1 3GJ3A 4TQ9A 1UF9A 1LFDB 4IKEA 3LO5A 1KI4A 3WP1B 4WBSA 5F9HA 1SVLA 1XXHE 4NZYA 3A6PC 1FL9A 4II7A 4JVLA 3FOZA 1MO5A 2EYUA 2EU8A 4MKGA 2J87A 4XSGA 3SYLA 4RSGA 1LV7A 4LPKA 3JVVA 4M1TA 1KJWA 2AX4A 2NTYC 2VL7A 1JEDA 1JI0A 2TMKA 3B8HA 1KIMA 1US8B 3CONA 3GFPA 4PSKA 2KJQA 5BYJA 4G5SA 1Z0AA 3SOPA 3TK1A 2GDJA 3L8ZA 3PENA 1YZNA 1XNJA 2SHKA 4YDHB 3LH5A 4PAQA 1X86B 3CNOA 1YZUA 3DM5A 4Q4HA 2B8WA 3CNNA 3W3ZB 1UKZA 1SHZA 1M7HA 4KBFA 4EJSB 4TL6A 4PTLA 1G3IA 1U8ZA 2QBYB 1AGRA 1CJUC 5G40A 1IY2A 2ZE5A 3ZDQA 3HPRA 4HAXA 4HUQB 4C3ZA 2IYLD 1XD2A 2BKEA 5K8LA 2CVFA 1UBFA 2VP4A 1Z83A 2DY1A 2IUUA 2OLJA 4X8LA 1X3SA 1W5TA 2QRZA 2W2VA 1IJEA 1COWD 4PANA 2GA8A 4I1VA 4H1VA 2D4HA 5CK4A 2G6BA 1R7RA 1G7TA 4FWIB 4IFEA 1G5TA 1SXJB 4C9BA 5J4HA 5HKKA 1JB1A 4L4UA 1FNNA 4CEHA 2ZRPA 4RZ3A 3HWSA 3PEVA 1SKQA 2VSFA 2FV8A 3KXLA 3BORA 3CX8A 1XD8A 3WRYC 2J59A 1KSFX 1YZLA 2O8EB 1GP2A 1I2DA 3FB4A 3HP1A 4ILEA 3RSLA 1N0UA 4QJ5A 1Z63A 4XVQA 3ZQJA 4O25A 5GVSA 1GRQA 2PEZA 1RFLA 4R7ZA 1KI6B 4A0RA 3SJCA 3VU9A 4OBEA 1LW7A 3BD9A 2IA5A 4Z54A 3NHBA 2IW3A 4LYAA 3BOSA 2Q3MA 3RC3A 5BN5A 4ZDIA 3K0SA 5FR2A 3ZJYA 3PEYA 3NC1C 2IC5A 3V4RA 3DM9B 1HYQA 3C14C 2YOFA 3KJGA 3IHWA 2CLSA 3VR6A 4Q02A 1F2UB 5FL7D 2DBYA 5J4VA 2BC9A 3MJHA 1CRQA 2PZFA 3RRYA 2ZRDA 1AS0A 1N2CE 1I4TD 1SHKA 4EFMA 3LW7A 1N0WA 2ZS9A 1KGDA 2OFWA 2J41A 3ICQB 1KY3A 1E1RA 1GVNB 1F60A 1U9IC 5GJWC 3UMRA 2OCBA 2KBFA 2ZRCA 3WRXC 4Q21A 1ZD9A 1E96A 5CJ2A 3CRMA 3TE6A 1AKEA 3I72A 3KQKA 1U8AA 4P4UA 3K70D 1Q21A 1X8LA 1Z22A 3OIWA 1M8PA 4YMTA 5B57C 3D7MA 3QXSA 4QBIA 5KOYA 2FDCA 1IXRC 2ZS7A 3IIMA 4JVMA 3VR5A 3UWOA 2CNWA 1SVWA 2WKRA 4TT3A 3K0CA 1E32A 1P9WA 5LD2B 2CE7A 4LBWA 2O8CB 2BBSA 1KYIA 1ZD1A 1JBKA 1HT1E 4AKHA 2HLDA 2F1HA 4HAZA 2ZRJA 4B6EA 3TGPA 3HPQA 1NI3A 2QENA 5IK2D 1T91A 4TLDA 5IT5A 2BCGY 4DEYA 3OZXA 3LXRA 1H8ED 4PO8A 1AZSC 3VKGA 5AUPB 5FPKA 2ZAOA 4CVNA 4MYCA 3IIJA 1ONBA 2OV2A 2RGNA 1JR3A 3DMNA 4EJSC 1C1YA 2X2EA 2F55A 4D4LA 1IXZA 1ZM9A 2QZ4A 4V0LA 4DEXA 2UKDA 4G5GA 1R4AA 1R5BA 1G18A 3N5CA 1IJFA 2XSZD 1RC8A 1FZQA 1NVXQ 4U5XA 4PHFA 1II0A 1NKSA 2ZUCA 1ZMXA 2NO1A 3RDPA 3T1QA 4HLUA 5BWMA 1R8QA 2VYFA 2GXAA 1AK2A 2ZI6A 3MAAC 5FPHA 2IS2A 1YR6A 1MO3A 1SXJC 1KI3A 2V7QA 4QOSA 2O8BA 1J99A 2QRNA 4JJZA 2B7CA 4UNQA 4PO9A 4LBZA 3TW8B 1T3HA 2BHRA 4DLRA 5DN6D 4N0DA 1TL7C 4PAMA 1AJEA 4N1AA 2VBCA 3FTQA 1Q1EA 3OEEA 1QRAA 4C7OB 5AUQA 3REGA 4DC9A 1SKYE 1XP8A 3U61B 4OI1A 1MO4A 3QG1A 1W36B 3LD9A 3PFIA 1A7JA 2PT5A 1OH6A 3RS0A 3UKDA 1Q3TA 2AK2A 1M2OB 3ZQ6A 3AVTA 5P21A 4MRNA 5JZVA 2X77A 2CE2X 4TTPA 3R9IA 5H1YA 2IF0A 3NG1A 4EPXA 4HB2A 3IEUA 4I1UA 2PLRA 2V55B 3U4QA 2CL7X 2P6RA 3RC8A 5JHGB 2ZROA 4LHXA 4PPNA 2ANCA 2NZ8A 2V8OA 3KB1A 2O8EA 1K6MA 1P61B 4C0QC 1AIPA 2AD1A 3AB3A 3VR2A 2J0QA 3SJBA 3QIAA 1DARA 2V9PA 1BMFA 3BE4A 1M7GA 1NLYA 2G0NA 3EPLA 3AGQA 5E4FA 2OCPA 1G6HA 2RGEA 1DG1G 3FFAA 3KKMA 4JLVA 5EXTA 2RKOA 5KNDA 5EP3A 2OILA 3U7FB 1P2SA 1G64A 4PZLA 4XWKA 4XTRA 4ZI2A 2NG1A 4UXHA 1NBMD 4NKRA 3QE0A 3X1XA 3GLHA 4YMSA 3TLXA 1RE0A 1K8RA 4PC6A 4D82A 3ONWA 4BPBA 4NCKA 1XCPA 1E0AA 1NN3A 2JJ1D 2B6HA 1S0UA 2VHTA 1JJ7A 2REXB 3LAWA 3SS8A 5LD2C 1L2TA 4Q9LA 4CRWB 3OIVA 4AYXA 4DT1A 1GKYA 3PUYA 1WXQA 1YZQA 3THXB 2PJRA 2QTVB 1E4VA 4US2R 3AQ4A 5J4YA 4W9MC 2QP3A 2PMDA 3DKVA 4HATA 2WWIA 3MUFA 3O47A 1W1WA 4W5JA 1R8SA 3IDQA 4JBXA 4QG7A 4W5WA 2WWYA 1W4CA 2AWNA 3U2QA 4B73A 3U6BA 1NVUQ 1U0HC 4TMZA 4CZ2A 3GP8A 1XJCA 2FFBA 3TRFA 3WNCA 3KXIA 2B92A 2I4IA 1OYYA 4L15A 1IONA 4F93B 1X6VA 2QY9A 2DCUA 2XAUA 1C4OA 3C15C 3TQFA 5JS8A 2Q9CA 1RKBA 2GF0A 3N2IA 2KWIA 1N6IA 3IKJA 2OXCA 2QEQA 4QBFA 3Q5DA 5FPSA 2BVNA 2BM1A 2W0SA 1E2GA 5L3SA 3PV0A 5DSZA 2ATXA 4EPYA 1NVWQ 2K5UA 4WA7A 3HR7A 1I4DD 3EASA 3N70A 1ELOA 3AGPA 3U3JA 2ZPTX 1WP9A 4ZKDA 2XTNA 1G3RA 1Z6YA 2QL6A 2Z43A 4OK3A 2XZLA 1VCNA 1WBDA 1EWQA 3IEVA 2CHVA 3TQCA 3RANA 2AN9A 1GAJA 1NY5A 1WA5A 4JLMA 1E0JA 2ERYA 2ZJ8A 3EZ9A 1ZAKA 1A5TA 3D8BA 4CGZA 4KFRA 5DH9A 1GRRA 1P6XA 1IXSB 4RFSB 2P5SA 5HKKD 2BDTA 2ODWA 1T8TA 2RGCA 2JIZA 4IOKA 2GCOB 2WICA 2ZI7A 3P20A 3X1ZA 1VYTA 1W36C 3AKYA 1Z07A 3V4FA 4JZKA 3KQLA 3MWYW 4GFDA 5EUMA 2OLKA 2NOAA 2H8KA 4O3MA 1WB9A 2HCJB 4MRSA 1RRPA 5FOTA 4GT1A 1DG3A 3EG5A 1EESA 3RS2A 2PT7A 4OI2A 1NRJB 5CIWA 5EUQB 1QZXA 1P72A 1HV8A 2D74A 2J9RA 1N6LA 4A2PA 2J7PA 1D9ZA 1UM8A 3LVQE 1PJRA 4U7DA 2WJHA 1NN1A 1D9XA 4LDJA 2ZQ5A 1OF1A 3B60A 4O0MA 4URWR 4WIAA 3EXAA 1U2RA 1OJLA 5FI1B 3T06B 4KU4A 3G0HA 1W0KD 1M7BA 3NKVA 2F1JA 4LV6A 4QGFA 3MWJA 4ZCIA 4FIDA 4GL2A 1XPUA 4QRHA 821PA 5KTYA 4NYMQ 1TQ6A 5B2ZA 2QUZA 1GFIA 4U00A 3F3YA 4Q9KA 4E09A 1GM5A 1RJ9B 6Q21A 1G1MA 1VCMA 1KDTA 3E2IA 1E1RD 4MDEA 2WWXA 2CEAA 5G41A 4DCVA 4A0HA 2QAGA 3HU3A 4JL8A 5CLQA 1VG0B 3W3AA 1XXHB 5B64A 1MABA 2A5GA 3QUSA 4WAUA 4BECA 5LDDC 1KZ7B 3GLFA 3O8BA 1QHGA 1E2JA 4UNSA 4AY2A 4RD4A 3KTAA 4K81B 2F43B 2GJAA 4B2LA 1X1SA 4LOAA 5E7JA 5FOXA 2ZU6A 2HF9A 4TLAA 4OYHA 5HPYB 4D2IA 2CNWD 2RGGA 4TT3D 4JT2A 5CJPA 4XD7A 5JECA 3QXCA 2GCPA 5CDFA 4KBGA 3B1ZA 1DTSA 4X8HA 5AJYA 2GAOA 3LX8A 4E07A 1ZBDA 1EXMA 2PZGA 1S3GA 1D6JA 1CP2A 1DO0A 1IQPA 3UXMA 4NMMA 3PUXA 1TEVA 3CW2A 1VIYA 2R44A 3U44B 1AQYA 3JZAA 5TB5A 2D2FA 4OQFA 4XVRA 4B6FA 4CT4B 3LBIA 3QEJA 1V5WA 1CR4A 1P60A 4EIWA 1QHHB 1U90A 1JR3D 4LHVA 1NL3A 5C4MA 2UVQA 2G1JA 2ZSEA 1RYHA 1UAAA 4LJ7A 3QPVA 4PPQA 3KQHA 2ODNA 3IIKA 2C03A 2A3RA 1KJZA 2Q0HA 5L3QB 4CW7A 2YWGA 1R0XA 3SFVA 4D0NA 3IILA 5DI3B 4EFLA 3DZ8A 3T1TA 1EFHA 3FFBA 3ASYA 2ASEA 3IQWA 1ZNYA 4IXMA 3F8TA 3OAAA 1CEEA 3T5GA 5FOWA 5LB2A 3L0PA 1XD9A 4F4CA 5FBQB 3SC3A 2HT6A 3ZVRA 1SGWA 1OB5A 3BH6A 2FJUA 3BFXA 4JLBA 1W5SA 1IY1A 3KZ1E 5D3MB 2RHDA 3CX7A 4DDWA 4PX9A 1DAHA 4DCNA 2OBNA 3MSXA 3C16C 2GBLC 1Z2CA 1JJVA 4KITB 3AVXA 2X8AA 3OEED 1XTSA 1D2EA 1CIPA 1Z0KA 2ZI3A 2H1LA 4A6XA 1E2IA 5SZIA 3DL0A 5FTMA 4B47A 2N46A 2P67A 2F9MA 3BIFA 4TYWA 1KI7A 3TUJC 1VG8A 2ZREA 2VP0A 3DO6A 1LVGA 1YHNA 2ZM5A 2GJKA 3TR5A 4KV9A 5F9FA 1EFTA 1T5IA 2ZJOA 2QMUA 4BZXA 4TQUS 3I5XA 3AF4A 3KKNA 2BIFA 4E03A 3QKSB 2YOGA 4JYCA 4LZZA 4TL7A 2CCGA 4NHOA 1BOFA 5SZKB 1KMHB 1FQJA 3CH4B 1GNRA 1G21E 3W5JA 1PLKA 2ZS8A 3T5DA 3QKRB 2QSYA 1BMFD 3NEYA 2CJWB 1Z8FA 4RD3A 5FTNA 3W6OA 4DLZA 4CF7A 3CRVA 5CDFE 3MLEA 4DLVA 1TF5A 1UKVY 2OBMA 3B5JA 5J4LA 4FMCF 3LV8A 3MGCA 2OT3B 5FUYA 1TU4A 4L9SA 4F38A 3GLGA 2XOKA 3OF5A 3ZGXA 3OEHA 3CM0A 1YRAA 1OFIA 1OIXA 4BEBA 4P31A 1TPZA 4HUTA 3A36A 3ND8A 3FDIA 3SI7A 3LLUA 1Q20A 3E1SA 1ZC3A 2ZI5A 4JIMA 5FFMA 2EFDB 5EE3A 4TMTA 2D3WA 4HZUA 4FMDF 4GBMA 3S1AB 5JS7A 3EWAA 5FUXA 4TZ0A 3FHOA 4XIGS 2J3EA 3CX6A 2IYTA 1XTQA 2N42A 2PMKA 2GEUA 4MGIR 5DYIA 2F43A 4N0EA 4LK2A 4HAWA 5B30A 2JCSA 1P7CA 1H8HA 2R2AA 2ZRAA 2ZITA 2EQBA 5K8TA 3FGNA 3K53A 2FN4A 3A37A 3BFVA 1F2TB 3AKEA 1MRSA 4A9AA 1XWIA 4H1UA 5FUVA 1DAFA 2WJIA 5H8WA 2BMDA 2PH1A 1TX4B 4ACBA 3O8RA 2DFKB 3U44A 3PQCA 2AXNA
chains in the Genus database with same CATH superfamily
1OREA 2IZ7A 2X1HA 3IFSA 3NBFA 3WA6A 1EU1A 4LHWA 4A7PA 3JQFC 2MYPA 4B3TB 1Q2UA 3N07A 3I39X 3B70A 4H08A 1Z0DA 2NT3A 3T4XA 1L7DA 2HMTA 2PRIA 3AJ9A 3V7FA 5HFJA 5JMWA 2BZ1A 1NN5A 4DV6B 3UMGA 5JRJA 2YN2A 1SKYB 4DWVA 2HXYA 2RH4A 4XSHA 2A1IA 1OX6A 3L7CA 2GHIA 3KD2A 5B3LA 1CUWA 1CD5A 3BL8A 3ESXA 5DYYA 1N6RA 4YRAA 1H4QA 2NVWA 2PZ8A 3D6JA 3AVVA 1ZD8A 3PFNA 1RM4A 2P1DA 1Z26A 5EINA 3ZLUA 4PX3A 1PGQA 2XXJA 2BBWA 2JIZD 4YN3A 2AS0A 3CT4A 4LC1A 2XCTB 2EZ4A 2JW5A 2IHJA 3RUCA 1S2DA 2GFIA 5HKBA 3D4OA 1DT5A 2B5WA 4DV5B 2HRCA 2XZTA 4Z1MA 5IJ9A 5KPDA 5B4VA 1I7DA 1B8PA 3CPSA 1SCKA 5I8ZA 1GTG1 1XHEA 2O3SA 5LQAA 2AZMA 2N0SA 2XZOA 2PUEA 4HDOB 2DPGA 3AHHA 3OEWA 5DPMA 5AQ1A 4XLLA 1V43A 2YZGA 2ESRA 4QDTA 2J3DA 4Z3DA 1RLOA 1ITZA 3QVWA 1YZYA 3SHVA 1XN1A 2FZ4A 2YFKA 3FUWA 5C3UA 4DXAA 2VAPA 1NOJA 3O8CA 4OQQA 2UYCA 3GPIA 3VDXA 3H8WA 3FFXA 4B84A 3B3QA 3NASA 5E2AA 1V5GA 2FFJA 3L43A 5ITVA 2BEWB 1SIOA 2X8LA 3IVMA 4ZALA 1DG9A 2WHPA 5JALA 1T24A 4MVJG 4WBXC 1OE0A 3BJZA 5JRZA 5AJTA 1VBNA 3OQNA 3LTEA 4IX1A 4RIHA 4D9KA 1OBHA 4GQIA 4DSOA 3P9SA 1AGXA 1G19A 1UT8A 4Q9IA 1TF2A 1ENOA 2YL2A 3BMOB 4YMGA 5IN4A 5L53A 3HR8A 4EG1A 1CUCA 5KNBH 3IGFA 2W2QA 5FTJA 1O9GA 1VFNA 1JKXA 2QX8A 2WWRA 3DZHA 3QKWA 2GZSA 3TCNA 1C4KA 4JB2A 1DEOA 1D5CA 1CUZA 4GZ3A 2A0FA 4XTCS 2RSLA 2H2DA 4DLSA 2ANBA 2C4VA 3W7BA 1UOEA 5B4UA 1G59A 3BKWA 2VKQA 2VUUA 1U3WA 3I37X 2FW0A 2PBZA 4BB0A 3JWPA 1JFFA 3UHOA 4DC0A 1JH9A 4FDMA 1E6MA 4MB2A 4LSMA 3GPCA 5GONB 3FVQA 1YC5A 2IYUA 4Q7JB 1ULBA 2O9JA 2GEVA 1HLFA 3G2IA 3W9UA 4ALKA 4O4JB 1SQ0A 4ZEMA 3UHFA 1P5FA 3CO0S 1YZGA 3G6WA 5KCMA 4I55B 1L9KA 4V0ME 4XD7D 3N7AA 4IRXA 2P4SA 2QAJA 3WWYA 1LRKA 4AXBA 3EQ7A 2IT1A 1OFUX 1DQRA 2JLRA 4WCDA 2C98A 5JSZA 4B3CA 3V5NA 2ZRMA 1DL5A 1UT5A 3L49A 2ADOA 5KTOA 4NMHA 4Y6QA 1Q7TA 4EZEA 1W34A 3OCYA 4GRAA 2ZE6A 3NHJA 4BE4A 3QELB 3DZDA 4DMRA 5E6RA 1XPJA 2HSZA 1XEFA 3MLAA 3Q3HA 1E6CA 2C2GA 3PXDA 3NU1A 3FHJA 1KFBB 2OTCA 1QSGA 3QVUA 4MRMB 2V74B 3U0BA 2VT2A 2MSEB 1ECCA 1XJ5A 4KPUA 1XFAA 5J59A 2IIBA 4AY3A 4XEHA 3OJOA 2X4DA 4NC9A 1SKBA 5HP4A 4DKXA 4CLDA 2YWHA 1F48A 3BMQA 4LYFA 3AESA 4A0SA 4H3VA 3N6VA 5ICGA 2OK8A 3WGQA 5DX1A 2DJ5A 4PLWA 5DRTA 3HS3A 5L4SA 4XGRA 1QPZA 1EB9A 2R65A 4WY8A 2B1JA 3O8DA 2I78A 4KXWA 4JB3A 5KKNB 2FGJA 1LSUA 4LHSA 2P30A 2JH3A 3KWFA 3D1JA 5ENVA 2OXTA 1UMCB 1MG0A 2W6ZA 2EWMA 3UPUA 3CVUA 1FMTA 3X1MA 5E8JA 5E3HA 1WOMA 4GAEA 3HYNA 4TZTA 5HZGA 1MOSA 4L78A 1DC8A 3U37A 5LU9A 4P3OA 2W93A 4NMLA 2FUG1 3NWEA 1WRBA 2C5BA 4F72A 2VNHA 2VKTA 3HN6A 1TJYA 4X9XA 2ALJA 2IE8A 2TMYA 4HX5A 4NBLA 3VTZA 3ZKWB 4ITUA 2FOIA 4PTZA 5IXSA 1KORA 3UAOA 2XB4A 3FKJA 4IG9A 1GZ4A 1QHSA 3EFOA 4O2AB 4FFBB 3ENZA 3GLSA 3RAJA 3UB2A 3G0IA 4IVPA 3GD5A 2E9SA 3PVSA 4MHTA 4ERNA 2JFNA 4PBRA 3EYAA 2FZCA 1CY8A 3PJGA 2CL6X 2DR2A 2IQIA 4UUPA 1NYTA 1WZUA 1Z8DA 3X1JA 1FNSA 2C88A 1SQSA 1YZTA 5CA0B 3LC2O 1OB2A 3SVLA 3GZTB 3IKVA 3JSAA 3BM5A 4TWZA 2OFFA 4MUIA 4ZYVA 1U9IA 3E9DA 2Z8YM 4JJEA 3NHFA 5U4QA 1Z56C 5HIKA 3TMKA 3HN2A 2AMFA 2BGNA 3OURA 4DJ5X 1H0KA 1I2ZA 1BCRB 1OT5A 3HKCA 3VMFA 1WXXA 4NU5A 1Y5NA 3OPXA 2ZTLA 4UHDA 1EE9A 3BJEA 1E1QA 3BIJA 1N5KA 3HUDA 1S8FA 3VR1A 5KQLA 1POWA 4YONB 4ES6A 1FU4A 4MARA 2YVLA 2WE8A 1THGA 3MD0A 1V1MA 3V7YA 4EQZA 4AKEA 1XPOA 5EZ6B 3GJRA 1Q44A 3BRSA 3ZGVA 3DGEC 3PT9A 3LQRA 5GM1A 1NNEA 2AQ8A 2QY6A 3IPCA 3HCPA 3GEHA 1YB5A 5I9SA 3R7WB 4C4OA 4EGJA 3GG2A 2G17A 2ZJ7A 5FBVB 3PXGA 4F84A 1R4MB 3JV7A 2G9VA 4DIMA 1JHUA 4B3GA 4RWEA 4N01A 3OZAA 2VJNA 4HNSA 5EP2A 4W6QA 2WAXA 1SU4A 4DLLA 4RSHA 3AR5A 4L5CA 3WNVA 1RZUA 2J6CA 1EFKA 3MMNA 4OFZA 4UMFA 2AOTB 4C04A 5L6LB 1JILA 1QIGA 4CU5A 4O8ZA 3FCSB 1PBNA 3EBPA 5HF8A 5IKEA 3NI2A 2B20A 4HUQA 1L7RA 3KHKA 3DR3A 4WFIA 5EJFA 3QEOA 3SLRA 2EFEB 3B1JA 1NT4A 2W8ZA 4B2YA 4D9IA 5EUBA 3K92A 3K5WA 3LUCA 4EEZA 1TIBA 1P19A 3RYHB 2WYUA 2KLBA 4BWFB 1QYCA 3RC2A 3DEAA 3RGWS 1LZLA 1E61A 4DMLA 4DZRA 1NSTA 1H8HD 1RAIA 1Q3KA 1KQPA 2QT1A 4GPTA 5FEMA 3NHRA 4R68A 3RW9A 1R0ZA 4HAUA 1VXRA 3SDBA 1Z0SA 4WBNB 2AFHA 2CFOA 3BEDA 1RBMA 2VDWB 1WIWA 1V41E 1QGUB 3DT9A 3PX3A 1ZD2P 2C96A 1NQWA 1SUSA 3ANSA 3PK0A 2AD5A 4XRRA 4CHGA 3I9NA 3ZBUA 4C2AA 2WSYB 1DRUA 1NU6A 1DKOA 1ONPA 4JJ7A 4ZO9A 1QB8A 2WTAA 4DCSA 2HTFA 1NR5A 1KFCB 3E3AA 3LDAA 3PUVA 5HM8A 2CDBA 1F51E 4KVFA 3BILA 4PAWA 3ELDA 2OHGA 5HNKA 5DBGA 1E92A 1T5DX 3T94A 1IZZA 2CK3A 4M1KA 5BQ3A 3C98A 2GEJA 4MVXA 2ZRLA 3U49A 2O2YA 4QSMA 5DNCA 3PQ5A 10MHA 1RWQA 1KYXA 2CEKA 1ECLA 1MDBA 4R2XA 2VN8A 3HUFA 4EKNB 3AEYA 1W19A 3GAFA 4YDQA 2HL6A 4ZYZA 4Q12A 2L0XA 1L5OA 1PAUA 1Z0IA 2X15A 2JGKA 2VTVA 5CLGA 3TJZA 2X0DA 3VAZA 4WI1A 4D9GA 1XXLA 2B8JA 3T3IA 2YOHA 4LJ8A 3H3XA 3CXUA 3IIIA 1NVVR 1R27A 2CXPA 2NPFA 4BRZA 1K6IA 4JV5B 2OHXA 3QPBA 4E4TA 1MTOA 1XSEA 2E48A 1KVRA 3EIHA 4P9NA 1TM1E 3TTVA 4UEWA 2XQIA 4Z7OB 2WVHA 5F1KA 5JS2A 4KWTA 1UL1X 1T4DA 2AN4A 2W70A 3RWBA 2B69A 1TO6A 2B2XA 2Z3WA 1XX6A 4KODA 3AETA 4RKWA 2C4TA 1EFRD 2A30A 2C20A 2AOXA 3C2QA 1ZINA 1TT5B 4IJUA 4TRJA 3ROEA 3QI2A 2GBGA 2WJWA 4OJTA 5A02A 4YCCA 2P2GA 2PKYX 4MKZA 1UKYA 1CRWG 3OD1A 1Q0SA 4CM8B 2I7CA 3FX2A 3WLHA 1P1KA 2QVXX 3R24A 2B1QA 4KH0A 5I7OA 2ZIEA 3P0IA 1MORA 2H85A 5GV8A 3U6KA 3R0XA 1HFJA 2X3FA 2O2DA 4PQEA 3GHHA 1AB5A 1DJQA 1UR5A 4LZNA 2W2TA 1OXMA 4I4LA 3B1WA 4M54A 4ZO8A 1HZZA 1DCKA 2JGDB 1HM5A 2NYRA 1P81A 1PK7A 2AR7A 3U7HB 3FMGA 4FJ2A 1NMXA 2R1TA 3LKDA 3OY7A 2NPIA 4KK3A 5E3IA 3SYMA 1H6DA 4E5DA 1TLLA 3FDZB 4LQCA 4A73A 3OQOA 3EE6A 4M0CA 3P9IA 1ZVVA 4K88A 3E1GA 2AC2A 2HA5A 4P4SB 2RJ3A 2C0PA 2ZRFA 2NU6A 2ORWA 1C14A 1EZ1A 1QYDA 4QAJA 2JDID 1R2QA 2PZBA 3DMHA 3IV6A 4N54A 4UBMA 3VPAA 4DLPA 2B4TO 1E3JA 1SXJE 1ZISA 3FCEA 4W7HA 4X95A 1TQ8A 5K4AA 2WIBA 3MGBA 3L4BC 2DCMA 5IZCC 1IOZA 1O54A 4HB3A 2VJDA 1SZJG 3H5AA 4X71A 2JK0A 3NYIA 2EEPA 1L4FA 1WLSA 1GZ7A 4MKIA 2VJKA 3HFSA 1AKUA 1MQAA 2LKCA 4F11A 2O8FB 4ZPJA 1L4UA 3ADKA 3ZHSA 1U04A 3GQBA 4DAOA 3MW8A 1SB9A 1CUIA 1RNLA 3HV2A 1X9HA 5LLTA 3M1YA 4MB0A 5JNLA 4NMWA 5BWCA 1QANA 2QD5A 2GBCA 3OO0A 2IX3A 3TLAA 4N3CA 2HC9A 4I81A 2JZOA 3AHGA 1GITA 3NH6A 3RARA 3TDMA 3IE1A 4Y0AA 3EVGA 4P0QB 3HABA 3VYWA 4L8YA 3K70B 5CRIA 1QCCA 1P4JA 4WZBB 4UBKA 2QLJA 1G41A 1Q1NA 2QIPA 4HX9A 4UTXA 4ETNA 4EVIA 1K75A 2XW6A 5BOSA 4GGOA 1B6RA 1SBIA 3B53X 4FN5A 1E1CB 4O33A 3SX4A 2B2NA 3OETA 2G77B 2QZPA 4HVTA 2ZE8A 2JG3A 2H17A 3I62A 2Q9UA 2HBQA 3KLNA 1W48A 5AM2A 3QNMA 3ZHXA 1HFKA 4E32A 1E5DA 1GR0A 5KNCD 3ZLTA 1JIUA 1F7UA 3ZY6A 4NONA 2XEXA 3MYRA 3J81k 1QRRA 4J3JA 4GWGA 2W48A 2JLWA 1S96A 1E0SA 3ZWAA 2ZIXB 4PO1A 3KJNA 1FFHA 2R2GA 1BFUA 1UIRA 1KO4A 1TO1E 1UWCA 3QVGB 1HDEA 1XNHA 1C9KA 4MCAA 4N5HX 4DLNA 4QQKA 2VPPA 3KFXA 5EXPA 3TG8A 2FK8A 5T4HA 2JLQA 4M55A 3M3PA 1XTJA 2VJQA 1G20E 4QXRA 2F62A 2FEOA 4RPLA 3K6KA 4XB2A 1K5GA 3F98A 3GAZA 1W0JD 3OVMA 2FETA 4LG1A 2LP4Y 1ZBQA 1D3AA 1OI4A 2J85A 4RMHA 1IM8A 3A1WA 3HLTA 2LGJA 4MO9A 5KYVA 3U81A 5I4CA 4FZ5A 3EZFA 3F49S 1BVYF 1TKRA 2YRFA 5A7HA 3FBWA 1GWNA 1OIVA 3H4MA 5CW1A 4YMVA 3AILA 3OIGA 1HEIA 1M9NA 3FBTA 4MS3B 3ZQ4A 4X1KA 1DS6A 1C0KA 5F77A 4MR7B 5KNBD 3I5YA 4X93A 3HCAA 2G1PA 3EZNA 3VO1A 1SWWA 1TEHA 3HBNA 1HA3A 5AW3A 5IG2A 1GCAA 5EHXA 2MSWA 2JGLA 1NXOA 4AZ0A 4CF4A 1DE0A 1XRLA 2K6GA 5ERYA 2PMEA 1R0LA 4D8YA 1EFVA 1MX1A 2J9FB 1MN6A 2V1XA 3BRWD 3VVMA 3W5SA 3G8YA 3RS5A 2WUVA 5K0JA 1IBKB 2CHGA 2IHNA 4OLAA 2I4MA 4OUDB 5DK6A 2Z1DA 4BQFA 1NAIA 1AOXA 2REQB 4LDRA 1GGEA 4IHQA 2YWEA 2W2KA 3N2ZB 2XCOA 4IIJB 4ENTA 4Z4HA 3THXA 2NXEA 3FYCA 3N0XA 3PXBA 3TLZA 1SBCA 2VI5A 2ZSDA 3IPLA 5I8WA 5U9CA 1RJDA 3RVNA 1GCOA 1M8FA 1G5PA 1H1DA 3WFIA 4CMKA 3FMFA 3R9XA 2A5JA 3NDBB 4FPXA 4FTWA 5BNZA 4C2UA 1ODCA 3PD7A 2GRJA 3RLFA 2BZ0A 1JFTA 4QUHA 3UJ3X 2B25A 3I58A 2A67A 4P38A 3C45A 1NQTA 2V6MA 4L6CA 4MAFA 3V4SA 1E6UA 1SCQA 2V6FA 2Y05A 3H87A 3CKMA 3QFCA 3LCJA 1K1EA 4AY5A 1CETA 1Z6QA 2WSIA 4LHYA 1JHZA 4XB6B 1SA0B 4KR6A 2VF4X 3N0VA 3NR2A 3U19A 3I52A 2BE7A 2MINA 2YHUA 2FF7A 3UEOA 3FPAA 4BFSA 2YXNA 2AI2A 1PR3A 1QAOA 2QE7D 3GJXC 4KN8A 4YP9A 3E2PA 5F73A 3AOGA 3PU6A 3Q9UA 1T4BA 2YHSA 4MV4A 4C0XA 2IEZA 3QV2A 3EEBA 3PFKA 5HQ3A 2C9OA 2CXXA 3DHEA 4YPFA 5JDCC 4JI4B 3RUIA 4ZYUA 1RYMA 1MO6A 2H2WA 5DHRA 3SVZA 4B82A 2QP4A 4DZTA 4XEUA 5KDDA 4JEIA 2WAOA 2ODTX 4NI5A 4O2BB 4REMA 1PLLA 4QOJA 3V2GA 5LQNA 3DEJA 1WMDA 3TL3A 1ZXLA 4RTLA 1DQNA 3O4IA 2WWWA 3QBDA 5HIAA 1XTPA 2H1OA 3FLMA 5GV7A 1P4GA 2A1UB 4U6NA 4C0KA 3TUIC 1ZSNA 5GJBA 1IC6A 4TTJA 3G0CA 4RVFA 1IN1A 4JOSA 1ZOIA 4BLVA 5LIRA 2RGYA 3Q2KA 2CMKA 5CYOA 5HKLA 4M2LA 2X19A 4IJ6A 3N8KA 3NHPA 3LFTA 4E15A 1WU7A 3QJYA 1VYUA 2I4LA 3GL9A 2X4GA 2HK9A 3J80A 3E84A 1NFQA 5J5CA 5KWSA 2DJIA 3INRA 4ZGBA 1QGED 3NRCA 3ILHA 2UUPA 4Y6SA 3FUVA 5FBHA 2GCEA 4MS4B 3WGYA 2QRKA 2GBLA 1L5LA 3OJLA 1OJ7A 1KRWA 5IC5A 1SD5A 4ENSA 5BVGB 3J81A 3G8AA 1QJ4A 4RS4A 3JYLA 3UK0A 2BMVA 3EOAI 3T5MA 2FEMA 2Z2XA 4IGKA 1CY6A 4XCXA 3IJPA 1CZRA 4YPVA 1EMDA 2GILA 1XZDA 1C1XB 4JOQA 2HIGA 1IN8A 2I99A 1P6UA 4M9QA 4M9CA 5HMMA 1C8LA 2JGIA 4ARIA 4F2GA 4PZYA 4DR1B 5JZMA 4H6VA 1FMFA 3EA5A 2OECA 2FB9A 3IQDB 3L7IA 5JSFA 5K3EA 4RQTA 4Q4HB 4F6LA 1T6BY 3N0RA 2DHCA 3KSAC 1OXKB 1QLHA 5KAPA 1E8MA 2OCDA 1QH8B 5E9QA 2ZJ2A 4PXAA 1R00A 1OFGA 4DCUA 1ADCA 5JI2E 1R18A 2YYAA 2XQFA 3K5IA 3GRZA 3O94A 1EFPB 4QNMA 3L4SO 5KWVA 2MYNA 4D4GA 1K63A 3R5XA 4RD1A 1Y7LA 1NI4A 3JU3A 4QICA 3AU9A 1ZVQA 4W4TA 4OLJA 2QMOA 6NULA 3FHTA 4DBVO 1ORTA 4M1QA 1AMOA 2H9IA 2Z2KA 1RYBA 1Q14A 4DA8A 2WM9B 3AI7A 4FMBB 2TMDA 3ICWA 4IDOA 4C0HA 4V0RA 4H59A 4YC7A 2ETXA 2Q3HA 3P2OA 4FNOA 4YFVA 4PLTA 4JLJA 2BH9A 1F4LA 5A5VA 3NTUA 1XEWY 1J7JA 3K3PA 4WMLA 4ZYYA 2HQ1A 3NH9A 4KLZA 1Q7GA 4YRSA 6AT1A 2PRJA 3B1YA 3MD9A 1NW9B 4K9QA 3B82A 2R8YA 2W6ID 4HWKA 4KTTE 2Y8EA 4IYJA 4CEHB 2NM0A 5ENZA 2YH2A 1NATA 4ZDKA 4UVIA 1RI1A 1YS2X 2DQ4A 5F2OA 4G2TA 3ZKWA 4NCJA 1K6EA 2PUWA 3PDJA 4PICA 4R6XA 3EZYA 1T5BA 1X39A 3CO5A 3D7SA 3WHKA 5C4IA 2IXDA 3EMKA 1G291 3TIIA 1FTGA 1ZCBA 3SKXA 4JJFA 3DT8A 3MT7A 3QRWA 2SNIE 5AJWA 3SVTA 5JXHA 1U6IA 1ESMA 1RRKA 2RHJA 3AM1A 3KL4A 3GA5A 2LIVA 3R41A 4MYUA 5KYXB 1AXGA 1ZH4A 1KSJA 2QUIA 3C39A 2LPMA 4D3SA 3UOAB 2GF2A 1AXRA 3IR6A 9ABPA 1P2BA 1RCTE 2ZWAA 3TQIA 3SJZA 1JSXA 4ECAA 1L7XA 3FMVA 2HLHA 2PA3A 1E2MA 4XIFA 3MRXA 4F5DA 1FU8A 5L3QA 4O1HA 5E2IA 1TVKA 2YZ7A 4ZVSA 1OX4A 2IBTA 1S2MA 3NVMB 3V34A 3THOA 2HHAA 2Y0BA 2WWGA 4GEGA 3UJPA 1ECJA 1RLMA 1RKVA 3C4JA 2PZMA 5AK4A 4MV5A 4URZR 4WESA 4AY6A 1FW6A 3G2PA 3MBOA 5LOVA 1O3YA 3E58A 4ENPA 3S8YA 2CV0A 2O6HA 3R3JA 5JBNA 5ALDA 2NUAA 1EUCA 1JQBA 4HUQB 3F74A 4XM0A 4MRAA 2DEUA 2G70A 1B8NA 4OGKA 4PS1A 2ZRBA 3RS7A 4J16A 2IOYA 3OJ0A 3UGKA 5AXAA 2Q1XA 5DLQC 4CMAA 4CGYA 3U3RA 3WK8A 3U4DA 3LPNA 2PWAA 1WXEA 1ZJJA 3WQHA 3MMZA 3ASZA 1LLDA 2WHQA 4MO2A 1Z7BA 3WGKA 4PZ0A 4QM6A 2WP0A 4XIIA 3GLGE 1WETA 1UKEA 4AJJA 3W8EA 1WCWA 3DLIA 3TZCA 5C1DA 3BL5A 4UHEA 2W98A 3K70D 1W36D 1FDTA 2WZDA 3FPLA 1YQ9A 1Y34E 1I0LA 3B9QA 3QPAA 1QO9A 1J5EB 2OGUA 4R5MA 1NXVA 3UUGA 4OP1A 3O4VA 1YB6A 3PKIA 4NICA 2ZWIA 1SNYA 3ZIAA 4Q66C 1GSAA 5TDHA 2X1MA 4HEQA 5DSXA 1IM2A 2C97A 3QV1A 1XEXB 5IVPA 1GV1A 2XNDA 1JIJA 4RM3A 5FF9A 3WMXA 3BSFA 1OXUA 2NO7A 1SIUA 4ZQCB 3CJRA 4HMQA 3A1CA 4MDFA 2GZHA 3KUXA 3UH0A 2R87A 3V8BA 3U16A 1NVBA 1XE3A 3SSAA 1QHFA 3LWDA 1E9FA 1SRRA 3IUSA 1RHRA 4C3OB 3MYYA 4CU2A 4FYXA 1FDIA 3VBCA 5C46F 3RG8A 2PEYA 5C5DA 1D4AA 2WKPA 2WLTA 4GQAA 1IHDA 2IXBA 3PWTA 3ADOA 4UXIA 4PO3X 3O6VA 2FZLA 2GETA 1HTWA 4YK7A 3DKIA 1MXHA 1E7QA 4M6WA 4YDRA 2VTBA 1THMA 3KNZA 1U0EA 2GNPA 5KVSA 1YASA 2XLBA 3WKBA 4BV8A 4DRZA 1SHLA 5COBA 5DLPA 1QU3A 2G08A 3UYLA 4A91A 3QJGA 2XJ9A 2Y68A 2FQYA 3OT5A 1T4GA 1V6CA 3MN1A 4HJRA 1T5LA 3RSFA 1X74A 1VSUA 3A05A 2JASA 4E5UA 2FSVA 2RG7A 5JWRA 1KO8A 4OXNA 2G9ZA 1W85A 2GPBA 5JMTA 2A9RA 5T6MA 1UPBA 3G1UA 1ZI6A 5DU2A 2C9YA 4YCJA 1E9AA 5ADWA 2IHBA 3URMA 3CUTA 3WISA 4ZQEA 2CLHB 2L19A 2GJ9A 1S8OA 1Q3HA 1YOVA 2WVAA 3WADA 4AQDA 4BKOA 4BNGA 3BH0A 4CI0B 5M34A 3U09A 3CY6A 5JG7A 1TYZA 3CNHA 3GEIA 1LDEA 1E3TA 3FYTA 4Q37A 4PF1A 4B6QA 1XMIA 3A28A 3OLQA 3DL7A 1SB8A 1UBNA 5A5GA 1D04A 5B12A 2KX7A 4WNYA 1F2TA 2QNIA 2E4VA 4HNAA 3ZW8A 4C3VA 3EBLA 4M0EA 1E0KA 4Q1CA 5KDOA 3UIEA 2YWCA 1FTYA 3CLUC 2PUAA 3K8QA 4BQQA 3EF0A 4ZEXA 3JZMA 1U8CB 4OAPA 1S1MA 1W4ZA 2VQSA 2PXXA 3OT4A 1EWKA 3EG9B 4RENA 3TBKA 4W5RA 5DN9A 1N9GB 1LK0A 4JK3A 2EFYA 3A27A 3NAQA 2XNCA 3NHSA 4Y0VA 4F21A 5LM3A 3PXCX 1SXGA 4XYEA 3CIOA 3HXKA 1GAEO 2J9XB 2J5QA 2IEIA 2UZIR 4Y67A 3W5UA 1VKNA 1ZSVA 5EJIA 4BVHA 1H5NA 4G56A 5CFMA 3KXDA 2P9YA 5C1BA 1DUSA 3DEZA 4IV8A 2LRHA 1RXYA 3HU1A 3D64A 3OO1A 4TX1A 2C2HA 2Q4DA 2ZANA 3DF9A 4P2BA 1I0ZA 2PCLA 4OATA 4FMCB 5FDFA 3SIRA 2XNSA 1CCWA 3QEBZ 3AP1A 2PUBA 4DT1B 4TSFD 1VYVA 3MCTA 3NIDB 4OHYA 4U2BA 2H9YA 4NOJA 3F3SA 3IHTA 1M34A 2G9NA 1P3JA 1N5RA 5L51A 2YIJA 5AJXA 1J0XO 2G83A 3PTAA 2PMFA 1CS0B 2VPZA 3CA8A 3GJ8A 1LTHR 1QH1B 1KI1A 4S1NA 4X63A 1OGJA 2KHZA 4M7RA 4ESVA 3HYCA 2OBYA 3HEMA 3Q6MA 3RRXA 3FG9A 3H7IA 3TECE 1MH1A 4PCAA 4RPCA 2Y6UA 4LPSA 3R5FA 3PGMA 3X1DA 1B26A 4Q01A 5IM5A 5TXGA 5A5DA 4KSBA 5KNDH 2WSLA 2PL5A 2VLIA 4TL8A 4TQAA 3DP9A 4I3FA 4PM4A 2QRQA 3OG9A 4ESEA 4F5ZA 1JUDA 3NONA 2V1UA 1RWWA 3QWHA 2LD4A 4FP9A 2IS4A 3I04M 2ZJ1A 3AKCA 3FNRA 3LGSA 3TLGA 4B8YA 2ZVJA 3D1LA 1ZM4A 1DCFA 5AD1A 1GUFA 2ERXA 5L3SB 4ISCA 1SEPA 2YIDA 1EDEA 1E3EA 1P2UA 3V7WA 3O2NA 4NBSA 1U3FA 2N9UA 1Y3AA 5HZKA 3VYRB 4G01B 5EJEA 4R1QA 2ZATA 1IVYA 4P22A 5F7OA 3VVCA 3VKHA 1XQXA 2IFTA 5AM1A 2ATEA 4RJLA 2Q0QA 2ZSKA 4B9AA 1XC7A 1FFXB 3VKFA 2EATA 3PF8A 3X3HA 2JLVA 1VBMA 1R88A 4K5QA 2HD4A 4D6YA 4BMDA 4DQUA 1FBNA 1E2DA 2V45A 4JGBA 4X65B 1JJIA 1BEZA 3QF4A 4UAVA 5CM9C 1XU7A 3IBSA 5K9ZA 2Q0SA 3A4IA 1O6ZA 4MV7A 4Q4LA 3WYNA 2XXAA 2YWRA 2Z4SA 4W5QA 2YDXA 4FI3C 2CNOA 1I3LA 2MMGA 3FPFA 1OXTA 4CN9A 521PA 2R5WA 3ZH9B 1TYDE 3BE5A 4JMPA 4MQBA 2H8GA 1IUKA 1RAHA 2H4WA 3LWZA 4WECA 3D0RA 4RQUA 4JEUA 4RF3A 4DV0B 1DKQA 3EVEA 2BKAA 3KWMA 5EWJA 5EXDA 5IX8A 3GCGA 1I2BA 1VL5A 2HA7A 1LBTA 4QQFA 1L7VC 2X58A 4EKGA 4F7DA 3TRDA 4KFCA 1CY1A 4HDRA 4NOKA 1R0YA 1U3VA 1HZJA 1A9QA 5GIOE 4C30A 2X2PA 1FXWA 5DEIA 1V8DA 2JZCA 2NW6A 3LXUX 1FPMA 2YYZA 4KLRA 3OJEA 5AHRA 2VDOB 2F3TA 2G06A 3UN1A 3NDRA 3MWDA 2EG5A 3HH8A 4B0PA 3ZKAA 4WOBA 4OLBA 4ME6A 3BF7A 4HV4A 3MCWA 4J0DA 2BGJA 1AS3A 4MRPA 5AVSA 4G1FA 4LI3X 2WTNA 4PS0A 4X66B 1B4DA 1E9BA 3KR2A 3R4VA 4PC1A 3U48A 3KCQA 4XX1A 1KMQA 3NIFB 4RMIA 4JR0A 4HT3B 2XV1A 4KO1S 1PUJA 3U31A 4HVAA 5DSTA 1BWSA 2C57A 2PV0A 2IUSA 3ABRB 4HVLA 5AKYA 1ADJA 3EGXB 3AF1A 3BYZA 2ODEA 4HDQB 1IDN1 1A96A 2ZJAA 3BCHA 4LYHA 2HMUA 1ZLXA 4WACA 3T15A 3UT5B 3A8TA 3ECCA 3TTYA 2R6DA 2BFEB 2P6NA 3EVBA 3FNFA 4BNUA 2ZBDA 3WVNA 2OC9A 4QZVA 4X8MA 2O7QA 3ZD9A 3EY4A 2EQ5A 4FYHA 4MUNA 4WLEA 3GPLA 3KU1A 5L3ZA 2BFWA 1FRVA 3JVUA 4INAA 4E0BA 4OGFA 1D6SA 2RHMA 2FQXA 2VH2A 4P4GA 4RK0A 5EMKA 3CLRD 5HMLA 2BE9A 3OPYA 2IVZA 4E5SA 1PJ4A 1NF9A 3U7JA 5EQJB 3FRIA 2X3YA 3RWMB 1B0UA 1IEWA 1MZPA 4MUJA 3H0KA 1CUSA 5IN5A 4Q1EA 1RPNA 5D85A 2DH6A 4B80A 5L3RA 4BP1A 2CKMA 2Y2VA 3RFUA 1ACLA 4D4HA 1UDCA 1H2YA 2AMYA 2VJYA 2X9QA 1NJ6A 3Q40A 4F7WA 3KO8A 4KO8A 2GF9A 1WE2A 1YNOA 2VQDA 1M0TA 3F9RA 5EFZA 2Y0DA 4ZVQA 2R3SA 3RHFA 3G2MA 2JCBA 4TXMA 4C6TA 4KAAA 3BWVA 3WIBA 3KTDA 1S4MA 3VV2A 1QF9A 2NZYA 4JT9A 1JW9B 2RAVA 3KYJB 1SEVA 1P2FA 3ASVA 2OORA 1HT3A 1RLTA 4YI3A 4Y6OA 4O4HF 3LT0A 5D7NA 3L6EA 3WYGA 1AKNA 1NVVQ 5KEIA 4V2UA 1Z38A 3LBHA 4A27A 4R71A 2C7VA 2D00A 3ELUA 1NDHA 4EY5A 4YJFA 4UJ5A 3DHWC 3ZLJA 5CFQA 1FJGB 5ALVA 4ER7A 3NORA 4CQMD 1YJCA 1PEKE 1E77A 2GCGA 2O0KA 3LC1O 4KQ2A 3O4FA 1WW8A 2A33A 2WYVA 3I9OA 5SY9A 3MOSA 2FP4B 1C81A 5HJ7A 2HJSA 2I3AA 4RZXA 3QOFA 4JVNA 4ARSA 2IP1A 3WL3A 2H4JA 3FETA 2TMGA 3M6VA 4FN4A 5L45A 2DUUA 1OAOA 3UCXA 1MEOA 2ORIA 1TKCA 3PEEA 1YJQA 5AESA 3HV0A 5IWAB 3M6IA 3NRJA 1TCBA 1TMGE 4GXQA 3UBMA 1PSDA 1UPUA 4I9FA 5ELMA 2OYCA 4XJVA 4TKMA 5H3HA 3L18A 3IQEA 1RHMA 3GRAA 1JQEA 2G76A 3DNMA 3GFTA 4QGHA 1VG1A 4Q3AA 1GKIA 2QPLA 1JR2A 4K9RA 3V7NA 1TAUA 1Z6ZA 1GG2A 4GS5A 2H5EA 3MRVA 4HNRA 4ZOAA 1H69A 5DYTA 4BTVA 2W58A 3W78A 3PJRA 4I66A 2H4XA 3CPJB 1U2PA 3A2MA 4BLQA 1VBKA 4WNIA 4P1ZA 1UZAA 1K3TA 4JBYA 2Y1EA 5DYNA 3VHRA 5KINB 2A9OA 5AK6A 2B8NA 4R9RA 3AFGA 4F6RB 1W581 3FNQA 4UBNA 1BW9B 2R4TA 3EODA 3IBGA 3TW0A 3MB5A 2QSZA 4TTRA 3WLKX 4CUZA 5J58A 3DZKA 5D3QA 3MTIA 3N39C 4E2WA 1F0YA 3UJ6A 4AKIA 4IIFA 2B78A 4KVZA 5ALWA 3G5MA 1X1CA 4EA9A 2FWAA 2WUFA 2ZBEA 1KKLA 4YJ3F 5EZYF 3V6LA 4L73A 5AHKA 3VSDA 4B3BA 1FSGA 1QIFA 2BF4A 1KDVA 5BN3A 2WB2A 1QG4A 1O96B 2BEUB 2FHSA 4N5NA 2G67A 4Z4QA 4OK5A 4HDKB 3WNDA 1NNLA 3O83A 2VHZA 2QUBA 3ESZA 4F4UA 4FFDA 1MIHA 3WKDA 4CUKA 2J5KA 4MW5A 3K9BA 2WD8A 1BRTA 4XE5A 1X0VA 2F7SA 4KW7A 4P7FA 5UKDA 4F5YA 4BNHA 4KVAA 4IXWA 4ZOLA 4HSEA 3EUAA 2BELA 2I65A 2QHXA 2HHCA 5DT9A 3KWJA 2IWHA 1K98A 5E9AA 3TZKA 4DSTA 2CVHA 4ZHQB 2GX6A 2R86A 3D31A 3RSHA 4DHEA 4PR0A 2CWDA 2H57A 2O0JA 2P69A 4MOWA 3DLTA 3STHA 1W47A 3CG4A 2QZZA 1YL5A 3DC7A 1O8BA 5BPHA 1JS1X 2H54A 3HSKA 1IMJA 2I80A 3IDOA 1N8KA 3HM2A 3IVGA 5LYJB 3QNUA 3FHCB 1EUDA 2OMKA 4IUDS 1TIPA 2NAPA 3HL0A 3Q5EA 1XK6A 2CXSA 2H6EA 2YV1A 1U2GA 3TQTA 1EFAA 2AQHA 4Q4AA 3M4YA 5CAEB 3HB5X 3ZQKA 3LTNC 2JH9A 3V8VA 1KYTA 1JJBA 2QTZA 3UVEA 1J5XA 2LVBA 4IXTA 2GM5A 2XUFA 4R2IA 2PHZA 3RK0A 2A5YB 5JZBA 3DOFA 2PFSA 1L7EA 4H1WA 3PQ8A 3FWYA 5KMGA 4AXXA 5KQPA 2R0QC 1OWMA 1RKQA 1G21A 2P68A 3AEQA 3ZE8A 3TR0A 5BW4A 1ZSYA 1N2OA 3ANTA 5D1HA 4D81A 1E9CA 3HU2A 2Q6KA 2VCYA 5L3VA 1WHSB 5KC9A 4XWWA 1ARZA 4KUGA 5IF9A 1LVHA 3FTFA 1F4VA 5F5LA 3R75A 5EWLA 1R64A 1ZD5A 3E5HA 3OTQA 1DADA 1WMEA 1RRMA 4LJSA 1L5VA 4AJ9A 2XH8A 3GT7A 1WPGA 5CA1A 5HRCA 4J43A 4MVYA 4B74A 3T41A 1QUFA 5TQ0A 2B82A 2JJMA 1G5QA 1N9KA 1PR4A 2G7ZA 2JAOA 1EX7A 4BP8A 1YK0A 4MWGA 4EJ6A 5GVRA 5KJEA 3EPJA 4WLOA 4AI6A 5DNDA 1E9RA 3ND6A 2X4IA 1OAAA 1T9GR 4FCTA 4HS4A 2VRCD 5CXXA 2JI7A 2NO4A 3GD7A 4F9FA 1YUNA 1K9SA 1ZWKA 4I6JA 2DFVA 4LYYA 4RXUA 4CCYA 1P8JA 4ZDJA 2D7CA 1VKRA 2NXCA 4MW4A 1KAOA 2OZLA 4AW9A 1JDVA 1FUIA 2VK4A 4MMYB 1YAHA 2ZJZA 3WLIA 2GLXA 1U8YA 2P27A 2X6TA 2PL9A 3BXXA 4K2AA 1EPUA 2VYNA 1ICEA 1VP9A 1Y1SA 2OHJA 1GRNA 2V5VA 3CLHA 4OF4A 4QU8A 1RJGA 1DAOA 1T9AA 5FL7A 3PZBA