3ADKA

Refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(phosphotransferase)
molecule keywords ADENYLATE KINASE
publication title Refined structure of porcine cytosolic adenylate kinase at 2.1 A resolution.
pubmed doi rcsb
source organism Sus scrofa
total genus 59
structure length 194
sequence length 194
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1987-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adkA00
4BLRA 1NMYA 2AD5A 2JATA 2QM8A 4HI0E 1X1RA 3BWDD 5EE9A 1O87A 5FPYA 4B34A 1JALA 4LJAA 1NKTA 4AYWA 1XMSA 4IDPA 1M74A 5FUXA 1E9DA 2XEXA 1NSTA 1OXVA 4FCWA 1UEIA 4LJ5A 3TQFA 1VCIA 2XNDD 3AB3A 4G5OA 4Q9KA 2F43A 3EWSA 4G0NA 1RE0A 2CL0X 4UNPA 1OH8A 5TXGA 4BRWA 5AK0A 2H5EA 4XSGA 5B2ZA 4LI0A 2XITA 2WJGA 3CWQA 3FTQA 1KI6A 1OLOA 1QRAA 1W44A 1ZM4A 2X2EA 5CIWA 3Q5DA 4WIAA 1UEJA 5DI3A 1T5LA 2FSIA 1U99A 3TNFA 4POAA 2Y8EA 3LQRA 2DWPA 3LX5A 1KZGB 2RHMA 1TQ6A 1KKLA 1RFLA 4DSNA 4UXHA 2YV5A 1R2QA 5LDDC 5F2EA 1G5TA 4NMMA 4ZDIA 4ACAA 1XFAA 5KPDA 3HPRA 1ZNXA 4U5XA 2OG2A 2VO1A 3RLFA 2OZEA 3DDCA 3DM9B 3SNHA 2IX3A 3EZ7A 1XD9A 2FN4A 4QGFA 1YRBA 1QG2A 3C5CA 3T34A 3BJIC 3ADBA 2CHQA 4HZUB 4MKIA 4DEYA 1HTWA 3CPEA 1ZP6A 3RS3A 3DKPA 4CYMA 4AI6A 1E2LA 1I2DA 4MDEA 2D06A 1NJGA 3RNLA 1R0XA 2ZYTX 1C4OA 2H92A 1I4LD 1Z6XA 3QKSB 2OCPA 2YOHA 1IXSB 2CVHA 1XTJA 1FQKA 1K5DA 2REBA 3HU2A 3DPUA 4D4KA 3AGPA 1OH6A 1HT2E 2DFNA 3OIUA 5FBWB 4BFTA 4GRAA 4N3NA 4NYIR 3RVBA 3HPQA 4P4SA 4ERNA 2QRNA 3GLFA 1SQ5A 3OIWA 3CM0A 1YKSA 1E1RA 2ANCA 2H57A 1Z22A 2G0TA 3ZLJA 2YVUA 1P2SA 5AUNB 2ZYWX 4PC6A 3U3RA 5E7IA 1ZC3A 1T4GA 1N0VC 4WBSA 2PX3A 1Q1ZA 2AR7A 2C9CA 1XJCA 4M1WA 3MMPA 4II7A 1N25A 2ONJA 1G3IA 1HE1C 4ZKDA 1JQJC 2BMDA 3IPYA 3W8RA 1VECA 621PA 3QKTA 1SVKA 3EPHA 4PZZA 1Q1BA 2A5DA 1VIAA 3QXSA 1XMVA 5JI2E 1XCMA 4DLYA 2E9SA 3KXIA 1AM4D 3N5CA 1IN5A 3O8BA 4G5SA 2EFHB 4TL7A 1NVUQ 3D7MA 2CK3D 4A0RA 2VP5A 3LVRE 4RFVA 5DHFA 5L8VA 4KLZA 3PXGA 2D62A 3WYFA 2YC2C 2ERXA 2XOKD 1D9XA 2OILA 3KUCA 4B6EA 2R6AA 2ZANA 4B48A 3RSLA 4CT5A 4OHYA 1E3MA 1P5ZB 1YZUA 1KK0A 4NDZA 4TTQA 5FL3A 4B33A 1CR1A 1TU3A 5DIFA 2XSZD 1FTSA 1P6XA 1R0WA 3NKVA 1CRPA 3QOFA 4UNNA 3SJZA 3TJZA 2C78A 1OF1A 2WWHA 2A9KA 2ODWA 4EIWA 1F2TB 5E3HA 4DUGA 3LDAA 3BIFA 2B6HA 3T5GA 3JVUA 1S1CA 2QTFA 2X1VA 4LJ4A 3AVXA 5EE0A 4TN1A 1RYHA 2NO0A 4MUAA 4NYJQ 2NO6A 1E0JA 3BORA 2B7CA 1AS3A 3MWYW 4PQYA 3SHWA 1KJWA 1CRQA 2A7QA 4IKEA 2R9VA 2QG6A 1JPNA 1XMIA 2EQBA 3SN6A 4FWIB 3O8DA 4MKGA 3IKJA 4DC9A 4OQNA 4QNMA 5FH9A 5L3QB 4OI0A 4UKDA 2IXGA 1C1YA 4QGAA 4CZ2A 4ZI3A 1E9SA 2WOJA 4A15A 2CL7X 4A8JA 3VQTA 1J99A 1TQ4A 3FGNA 1LB1B 3SOPA 2JLSA 2OT3B 4UQOA 4KI0A 1VYTA 2JGNA 2WMNB 4DWJA 4C0JA 1ZNZA 3ZVLA 3UPUA 1OHHD 3CX7A 2OHFA 2QPTA 2WJJA 1FP7A 1K5GA 1Z0FA 2BCJQ 3IIJA 2IS6A 5EXTA 2WAXA 2TMKA 2PBRA 1JJ7A 5EZ6B 4B3FX 3VU9B 4EJSA 2XNSA 3WYGA 3CONA 3CX6A 2WJIA 2ZRDA 1OH5A 4CW7A 1WP9A 3MJRA 1X1SA 3X1XA 3WXMA 4E5UA 2J7PD 1EFRA 1GFIA 2C98A 3K09C 4TMKA 5CK5A 3PUWA 3SHFA 3L0IB 2W2XA 1ZD8A 3LH5A 4TT3A 1L7VC 1KKMA 1N6PA 3U6BA 3EA5A 1DE0A 2CHGA 1ZUNB 2BJVA 5FOWA 4ITRC 3G5UA 4GP6A 2WSSA 2F3RA 3SU8A 3TUZC 1JNYA 2LKDA 4LBVA 4M1KA 3W3AA 1K8RA 3J81k 1VHLA 3CZPA 3QPVA 1GUAA 4H1UA 3SJCA 4ABYA 4L5BA 1Z6TA 2WIBA 4I99A 5HZKA 2OCBA 2NIPA 5BN3A 1XEFA 4NCJA 2FA9A 5EXPA 4EPTA 1VYVA 1Z63A 3QIAA 2RAPA 4MDFA 2CL6X 2H8KA 2VBCA 4K81B 1JEDA 5DN6A 121PA 3GMTA 4RKEA 4TQ9A 5FL7A 4G01B 1KMQA 5FBVB 4ON9A 4FI3C 4Q9HA 3BBPA 4A6PA 1SZPA 3FKQA 3THOA 1DVRA 1AGPA 2BKEA 1QHHB 2GNOA 1NVVQ 5FPKA 5JSZB 3IO5A 4LSGA 4D81A 4JJZA 2Q6TA 1KJZA 2O0HA 1SXJD 3PQCA 5L3RA 1AS2A 2AFIE 3SS8A 1W36D 4JIMA 3G82C 1U8ZA 1KDRA 4D82A 2EWWA 1CU1A 1E6CA 2B92A 2ORWA 4M8NE 4AY2A 2BBWA 1P72A 4EDHA 1HA3A 1NBMD 5TV2A 4AKHA 4EFNA 3DVLA 1ZINA 2YWEA 4GOXA 3PEYA 5GJBA 2ZS9A 5F9HA 4S35A 1E2JA 4OK3A 2AD1A 1GNPA 4JYCA 3R9XA 1NMZA 4QG7A 4LUCA 4UNQA 3WBJA 1E0SA 3B1VA 1ZUHA 2KB0A 1TQ2A 1E4YA 1XD8A 3EW9A 2ZYVX 1G8GA 4QOSA 3QEOA 4URUR 2GF0A 3RWMB 1E69A 4MGIR 3H4MA 2MMCA 2WKQA 3U7EB 1VKJA 3M1IA 1QHYA 4X8LA 1A2BA 1MO3A 2A3RA 3R7WB 4MKHA 3VR1A 5JMTA 3NIBA 5M04A 2AXNA 2JIZD 2ZIAA 3BFVA 5TDHA 4D0LB 5IDVA 2GCNA 2DFKB 5EE1A 3CKLA 3GFTA 5SZIA 3RS5A 3ZYCA 4HUQB 3REGA 2C9YA 4JLMA 4PPQA 2CE7A 3BB3A 2F9MA 1ZCAA 1N5LA 3QG5A 1Q22A 1TL7C 2IS1A 2W6JD 4DLWA 1FMJA 5JCZA 3I61A 1ZW6A 1KNQA 1SKQA 3QSYA 1P2TA 3FKSA 4UXIA 2CLCX 2DY1A 2WMOB 1G8HA 4KCGA 1KO5A 3SBDA 4CF7A 2DWOA 4L16A 4S2EA 1OH7A 1IN7A 3AVWA 1QVRA 1TMKA 2J0UB 2G77B 4HDCA 4XWOA 4P4TA 1CJMA 1FUKA 2PZGA 4HZUA 1RRCA 4Z54A 1S0UA 4UJ3A 2R44A 1G64A 4PANA 4WXRA 5A4JA 3K0EA 5FBRB 4RZXA 1DEKA 3QKSA 4HDQB 4KFUA 2H18A 4RY2A 4B44A 3D8BA 4IDOA 3X2SA 1E9BA 4JT2A 3HJNA 3QUSA 3U3KA 4QBIA 3CRRA 3VAAA 2J46A 3IHWA 4XTRA 3GQBA 4KJZA 3VMFA 3RYTC 1C9KA 4FN5A 2QMHA 4OHWA 2ZJOA 4NYIQ 4N0EA 3T1QA 1EFHA 4F4CA 2CHVA 4LOAA 1B23P 1EGAA 3B1ZA 3A4NA 2WWWA 1E0KA 2CEAA 5LB4A 1FW6A 4NTZA 2IYRA 2UVQA 4I1UA 4RFSB 2QAGC 2F1HA 1Z6AA 1ZMXA 4AKEA 3L8ZA 1G5PA 5JRJA 3U4QA 4K46A 1VCMA 4F93B 4EKDA 5EP2A 1W4RA 1KSHA 5FR1A 1YR9A 4EFLA 2CDNA 5DYGA 4A0GA 3A8TA 3WNBA 3A36A 4LBYA 4V03A 2X2FA 4PR0A 2Q3FA 2GEVA 3ADDA 1KZ7B 2B21A 1N2CE 2BOVA 3RWOA 2PCJA 4DB4A 2EYQA 5F98A 2GXAA 3VR5A 4JKIA 2CLDX 4DLVA 4E07A 3ZD7A 3FE2A 2J87A 2N1BA 4MRRA 2H17A 3BFKA 1GRNA 4ZDJA 1MRNA 2O8DB 2C2HA 2RGNC 2JJ2A 1G41A 2BM0A 3V00A 2JLRA 4BFYA 1GZSA 1M7BA 5JZVA 5LD2B 1XZPA 3QEJA 5KPJA 5BWMA 1TX4B 1N6HA 3AF4A 3T15A 5KDOA 2GZHA 1AZTA 1L4UA 3OFND 4HATA 1XTKA 1N6RA 2ORIA 4RKFA 1GDDA 5HTKA 5JHHB 1W47A 2VLIA 2N46A 1OYWA 5SZKB 2IYXA 2AWOA 3LXRA 1Z3IX 1IONA 2BKUA 3UG7A 2NMVA 2XZLA 2QBYB 3CBQA 1CR2A 3KXKA 4IDHA 1J7KA 2PCLA 3GLHE 1YR6A 4Z1MA 1HQCA 3NBFA 2R6FA 1AIPA 3GLHB 4QM7A 2DFLA 1F2TA 5JECA 1KJYA 3VTKA 3PJRA 5CYPA 3MGCA 3S1AA 1R0ZA 3OEED 5DHAA 5HPYB 1XWIA 5AJYA 2NG1A 3RAPR 1GKIA 1SVLA 1F6BA 2PH1A 3BFXA 2OXCA 3CH4B 3ASZA 4QBFA 4QL3A 4V0LA 4R98A 1DG3A 3A37A 2EW1A 5DYIA 2JA1A 1G8YA 4YONB 2AKAB 3KQHA 2BM1A 5L3QA 1OB5A 2WZQA 3K70B 2JDID 3ETLA 5IRCD 1OW3B 4WXPA 1KK2A 2ZSDA 2GWHA 4XD7D 2ANBA 4DHEA 1DOAA 4URYR 4GSYA 3IPXA 1Z6GA 2HEIA 4B35A 1HH4A 1ZM7A 2QTHA 1J8YF 2G1JA 2JAQA 4IFEA 1XJ0A 3EIHA 2BIFA 1VPLA 2Z6VA 3HU3A 3T35A 2I1QA 4MYUA 1P61B 2GDJA 3B78A 2ZI9A 4C3ZA 1IY0A 1T3SA 1R10A 1W36C 1AN0A 2OV2A 4LV6A 1XX6A 2D2FA 1RZ3A 2ZYUX 3VU9A 4PC1A 2XAUA 3A4LA 3MAAC 4MRVA 4B2IA 2NO7A 2IYYA 4YLGA 3R9IA 1IOZA 3QBVA 2Z0MA 3TAHA 3GEHA 4KBGA 1G1MA 1G4UR 1YZLA 3BERA 4IW3B 1AQUA 3V9PA 2IYWA 1KNXA 2YNMA 3K0CC 3D3QA 3QE0A 1KY2A 1SVIA 3W8NA 5UKDA 4C7OB 5JHGB 3THYB 1VCNA 4V0ME 4JLKA 1VTKA 2JJ1D 4GPTA 4DEXA 2YJTD 1JR6A 5HZHA 3VNUA 4IVRA 1KO7A 2NGRA 3CF6R 2FZ4A 2QGNA 4FMDB 5EE3A 5J47A 3SQWA 1OIXA 4ZIRB 2FNAA 2ZS7A 2V6IA 3BK7A 2O0KA 3AH8A 4OJQA 4A8JB 2YZ2A 1RPZA 3IEUA 4OQXA 2W2TA 4NPHA 5B30A 2PJZA 4GFDA 2ZI3A 1QG4A 2EFCB 1YZTA 4KSCA 1A1VA 5LPNA 3RS4A 2KE5A 1OFHA 2QZ4A 2XX3A 3AKCA 1RJ9B 3P20A 1XRJA 4M21A 1G7CA 2BEJA 3THXA 4Q9IA 3A6PC 1O3YA 3L8YA 1E2EA 2FWRA 4QBGB 3R8FA 1Q20A 5FPSA 5EP1A 1J8MF 2AX4A 1ZIPA 3AVTA 1IJFA 1KAGA 1QHHA 2AWNA 3WP1B 3X1WA 1AZSC 4B3GA 4GOKA 2SHKA 2RGCA 2PMKA 4MRNA 3RHFA 4A6XA 1F60A 3FVQA 3NG1A 4P31A 2VHUA 4LV8B 1NJFA 1JQLB 1XTSA 3M6AA 5EUMA 1VYUA 1N0UA 3K9LA 2GZAA 4KV9A 2A5JA 4DIDA 2Z83A 3IGFA 1V5WA 2GK7A 2ZSAA 5EQTA 4A0HA 4YMTA 3U6KA 3DM5A 4XH9B 3ICQB 3B60A 2XTMA 2FF7A 1QHNA 2KWIA 1NG9A 4TYYA 4HB2A 3L0SA 3KDSE 4NCKA 1M8PA 1GM5A 2F1RA 2V4ZA 4ZO4A 1YZQA 2E87A 2HV8A 5G40A 4LJ8A 1GRQA 4LYHA 1KI1A 5FOVA 1WBBA 2C95A 4MITA 1E99A 1AKYA 4M1YA 4X8HA 2ZU0C 4C0SA 4BGDA 2V3CC 1W0JD 4LC1A 4OI4A 1P2VA 1CEEA 4PAOA 4JS0A 3A1UA 4QBHA 5JEEA 1NLFA 1X8KA 3ZZ0A 3I8SA 2DCUA 2V54A 2ZRAA 3B1YA 2WWXA 2FEOA 3RSOA 6Q21A 3MLEA 1CTQA 1QZXA 2V6JA 4G3XA 1E0AA 2EFEB 2ZI6A 3OE7A 5E7JA 3U3JA 1G19A 3K9NA 4XWAA 1XPRA 3QKUA 4RD3A 2BWJA 1WBDA 3IBGA 4HLUA 2ZR7A 2VQSA 1GTVA 3B1XA 2FFAA 3IHLA 3KJEA 1P73A 4JKYA 3RANA 4RD2A 4IOKA 2QE7A 4HUQA 2G83A 2W2VA 2ZAMA 2DWQA 4KHZA 4L4UA 3WYAA 4TL8A 1KO1A 4B32A 3AVVA 4TZ0A 2RGDA 2BVNA 2O5VA 721PA 3IILA 4F38A 3B82A 3WMGA 3P4YA 4DLXA 1Z06A 2ZU6A 3E5HA 4LHVA 4WA7A 3T1VA 3ADCA 3SFZA 3FOZA 4JLOA 3ZIAD 1AS0A 2XTZA 1G20E 3MWKA 3AQ4A 1ZM2A 1XP8A 4KU4A 4DBLC 1E2MA 3C15C 3RC3A 4AG5A 3U61B 3EPJA 1G6OA 2J0UA 1GILA 1G7TA 2WPDA 2YHSA 1D6JA 2CXXA 2P5SA 1Z28A 4PSAA 1Z0DA 3B2EA 2P6RA 3TMKA 2F6RA 4GNKA 3KJHA 4NP6A 3TUJC 2JLQA 2WKPA 2J0SA 3CR7A 5TVKA 4KFSA 4ZI2A 4IVQA 4HAUA 2W6ID 3GJ8A 3ZQ6A 4ASUA 2QT1A 3LV8A 4RD0A 4MQBA 5H70A 2B7BA 1T0JB 2ZQ5A 1GG2A 3I5XA 5SZJA 3GCGA 2WOOA 3FFAA 4TSFD 3HWSA 2OEPA 1JJVA 2PL3A 3N70A 2ZTSA 1DBSA 5EUQB 4RFSA 2IXFA 4XVUA 2CNWA 1UKEA 2DR3A 4IOMA 4JLDA 1G7SA 4E22A 3WHKA 4DRZA 4HAXA 5EP4A 4C0HA 1W4AA 1YHNA 1GKYA 2FSHA 4C0QC 3IUYA 3VHLB 2GJKA 3GJ7A 4LY6A 4Q4JB 2HLDD 1TU4A 1W5TA 1WRBA 1Z08A 2OO7A 2Q9AA 4KVAA 5IF9A 1ZRHA 2WWIA 1ZJ6A 4ZV4A 4NU0A 2J41A 4J0QA 4TMXA 4EAQA 5J5CA 3L0PA 1E2DA 3K0SA 2C77A 1I4DD 3IIMA 4BFXA 4RVCA 2ZSBA 3KQLA 1OE0A 4I81A 2O8DA 5F9FA 4BFWA 4KVGA 5FR2A 5IT5A 1R5OA 2AK2A 3WMEA 2ZETA 421PA 3PEVA 4W9MC 3NTUA 4WZBE 5DSZA 3SJAA 2IL1A 2G1KA 4BE7B 1IAQA 4P32A 3KB2A 4RCYA 5KNBA 4Q1FA 2PZFA 1T8TA 1S9DA 3W34A 1II9A 2PEYA 2ODNA 4KODA 1D2EA 4Q4AB 2GXUA 1E2NA 2IA5A 5HKKA 2YWGA 1QVAA 4LK2A 2VHQA 2B8TA 3HR7A 3U4QB 2QBYA 4DB2A 4PSVA 4Q48A 5IK2A 3LY5A 4PC7A 4AG6A 3Q7PA 3LLUA 2QORA 2C96A 3GLHA 4V0OA 5EZ5A 4TL6A 3RRNA 4A82A 1Z0KA 3L2OB 3THWB 3OIYA 3I5YA 1EESA 5KSPA 4JBXA 2OFXA 1NN5A 3X1DA 1KI7A 5FOXA 4OJKA 4FCVA 5FUWA 1GL6A 2PMDA 4A4DA 4B6FA 3W6OA 2WKRA 1NF3A 1XCPA 4XIGS 4AKGA 5D3MA 1SVWA 1F2UA 3C16C 4KSBA 1S3GA 4B43A 1N5IA 3K0FA 2JEOA 2CCJA 3SQXA 2CLSA 1GVNB 2ZJAA 1UBGA 2WICA 2IF2A 5ANRB 3UATA 4UNRA 4FWTA 4YMWA 3PUZA 2LCFA 2ZE6A 1FL9A 1NMXA 3I1FA 2OBMA 3SEAA 1X6VA 3SE0A 4KBFA 2R8RA 1UKZA 1FMLA 4MRSA 3LLMA 2ZUBA 1DPFA 1UF9A 2ZRNA 4UNSA 1KOFA 2W83A 2CMKA 4ARZB 4EPVA 2GBLA 3OAAD 3I32A 4ZDKA 3ND8A 4EPRA 3LQQA 2VRWA 3Q3JB 1W2GA 3TLXA 1BMFA 4FXPA 4PAQA 4US1R 4BFSA 1E79D 2HCJB 1I4TD 3IO3A 3VNVA 3F0TA 3W5JA 3HYRA 4JSYA 1BO6A 3IEVA 1SKYE 3MCAA 2WWFA 2YOGA 3NHBA 1KSFX 1SKYB 2ZJ5A 5JLJA 4CEJB 2GJSA 1DO0A 3S1AB 4X8MA 2V55B 3O47A 1TF2A 4Q03A 5P21A 2GCPA 1OYYA 4QC2A 4W7SA 2IYTA 4EPWA 4Q7KA 4C7OA 3LD9A 4Q00A 1Z83A 3QPUA 3THYA 2RCNA 3MWJA 3LFUA 4OHXA 5DISB 4AKIA 2QQEA 3BGWA 1OKKD 4V0MA 3K9GA 2NQ2C 4YDHB 3REFA 1FZQA 2QMOA 5J4KA 4DLZA 1W0KA 4ZIRA 4UJ5A 1TAGA 2P6UA 4D0NA 1G291 4JVLA 2VIIA 1YQTA 2KI5A 1FQJA 2JASA 3LA6A 1T5IA 2GEUA 4IXNA 1AKEA 3B1WA 3T1OA 5KNDA 3PUYA 2A5GA 1GNRA 4HUTA 3ASYA 2WAYA 4L8GA 2JLZA 4B3BA 3EIEA 2ZE7A 4Q01A 1DAHA 1OIVA 3W5IA 1RJ9A 2W00A 1CR0A 4LJ7A 1ZUIA 2BMFA 3QBTA 4JLPA 4C0BA 1Z07A 1SXJE 5DGXA 1SXJB 3GEIA 1OFTA 4P4UA 3FHCB 5AJVB 1W36B 2OLKA 1ZAKA 3FMIA 3MWLA 4DXAA 2J1LA 1G3RA 3TVTA 3OEHA 4EJSC 5BW8A 4TYWA 1U81A 2AXPA 1KK3A 4D4MA 2ZJ2A 1TF7A 1NBME 4D25A 1J90A 2C5LA 2MMGA 2XB4A 3K09A 4TLCA 2IYZA 2JJ8A 3ICEA 1IY1A 2YYZA 5JS7A 2ZRCA 4M53A 5JJIA 2Q9CA 1FUUA 4Q7MB 3RC8A 5HE8A 4Q9JA 2XNDA 1COWD 3LX8A 4DDUA 1Q3TA 1E2QA 2OE2A 1OIWA 5CB6A 2KJQA 1XB2A 3HP1A 3TIFA 5BYKA 5CK4A 5KDLA 2J59A 4US0R 4Q4HB 1H8HD 4LJ6A 2VSFA 4Q7JB 1GIAA 1DS6A 1Q1QA 5EE5B 2IHBA 3IBYA 4RSGA 3THXB 3KB1A 1N5KA 3GJXC 1YU9A 4FCTA 3SBEA 4E03A 5K8UA 1JR3D 1T6NA 3H0KA 2QROA 1M7HA 2VHJA 4Q02A 4DDVA 2ZRJA 4HLCA 3I92A 3FHOA 3CLVA 1G18A 2QSZA 1G3QA 2HF8A 4HYYA 3ZDQA 3ZD6A 521PA 1GAJA 2NZ8A 2Q0HA 3L82B 4HZIA 3H86A 4LYFA 4TMWA 5B57C 2J5XA 2QNRA 4GP7A 3CIOA 5HE9A 4M4SA 3EZFA 3UIEA 3AKEA 4P33A 1E9RA 2P3SA 2MSCB 4DLSA 3TAUA 4OI2A 3OHMA 5AJZA 4LJYA 5A5GA 1NVWQ 1M7GA 1SULA 2LKCA 1JAHA 2CBZA 2ZITA 1IXZA 3LBNA 2JLVA 1BYIA 1ZU4A 4OKSA 2OAQ1 2VYFA 5GADl 3U44B 2ATXA 2DPXA 2J3EA 3E2IA 3U5ZB 3MRSA 4Q9LA 2H7VA 2HJGA 2ZSFA 1XF9A 3LRPA 3W6PA 1T8UA 1KSJA 1M34E 3B6EA 4L9WA 3VR2A 1YR8A 1OB2A 3LVQE 1U9IA 4LHXA 2CJWB 4DLRA 1HV8A 3U7HB 3KKPA 2GAAA 2ZI5A 1SVSA 1DAGA 3QXHA 1D9ZA 1OXUA 2OSBA 2BC9A 3I4LA 4CT4B 1B0UA 4GZMA 2PJRA 1E2HA 5J4YA 2QN6A 2PX0A 3WY9A 4NKRA 1L8QA 3GD7A 4B76A 2QP4A 2IS4A 2ORVA 1JXMA 3LNCA 1CR4A 5E7MA 5HCNA 3UMSA 4QM6A 2FPMA 2NPIA 3R9WA 3KQUA 1UKVY 1QDEA 4OQMA 1E9EA 2OESA 5SZHB 4M1OA 2VL7A 1UBEA 2RGBA 4AYTA 3LW7A 1N5JA 3T1TA 1LW7A 3CO5A 4URXR 4URWR 5JWRA 2WWGA 4A36A 1IN8A 2YWHA 1MH1A 5DI9A 1KI8A 4B74A 1U90A 2Q3MA 3KL4A 3Q72A 4Q4JA 4RZUA 2CK3A 1HURA 4P3YA 2OFWA 2EYUA 2HXYA 1KDTA 2OFOA 4X8OA 5KYKA 4YMUA 2XOKA 1G21E 1OXSC 2QP3A 2VSXA 2ZJ8A 1XTIA 1E1QD 1N6OA 3QXJA 4LYJA 1UBCA 1JBKA 4Q5IA 3KKOA 3AF3A 1Z0IA 4DVGA 1IJEA 4M2LA 1VG1A 1XXHE 3P27A 3KUDA 1LV7A 4TWZA 1WXQA 3EZ6A 1XXHB 2RGAA 1DELA 3I73A 4IFBA 4L15A 5FPHA 2GKSA 2L0XA 2P2LA 2XSZA 5CJ2A 2V7QD 4LC0A 3KJGA 1ZC4A 4MGKR 1CXZA 1UDWA 2DHRA 2EFGA 2HXSA 4C2TA 3AV0B 3SC3A 1XCGB 5CJPA 1Z6YA 3VR4A 5FUYA 4Q4AA 3OF5A 4Q66C 3PFIA 3LO5A 1EFTA 1QHSA 4G5RA 4M0LA 4TQAA 5AR1A 4QJ3A 2RB4A 3AP2A 3AUYA 4OBEA 4BEBA 3I8XA 4ILEA 1YJ5A 2IXEA 1JI0A 2ZRMA 2VP4A 2VP6A 2F55A 3THWA 1PVOA 2VHTA 5C1BA 4NCHA 5EP3A 5C2JB 1H8ED 2E1RA 2VP0A 1IQPA 2J7KA 2X19A 3CF0A 2AKYA 3FMPB 4G1UC 2OUKA 2JLYA 2PZEA 5B64A 4LHZA 4YXWD 1E2FA 1XZQA 3C8UA 3AF1A 3EG5A 1PLLA 1DARA 1P4SA 2J45A 1CJTC 1MKYA 2O8FB 1OHHA 2GETA 1R8QA 1N6LA 2GHIA 3NH9A 3TKLA 1QF9A 3C14C 1GP2A 2I3BA 5L3SB 1KK1A 221PA 2Z43A 4RD6A 1GWNA 3CRQA 4W5JA 3DMNA 4ARZA 2P0EA 1HY3A 1ZVQA 4GZLA 4CVNA 3O8RA 1YZNA 4B71A 3H2YA 4YQFA 2X77A 1VMAA 2J7PA 2QRZA 3HYTA 2HT1A 2HYIC 1BS1A 4IJMA 2G88A 3QF4A 1FNMA 2C99A 1EXMA 4TMTA 4WAUA 3FYHA 2EWVA 3ZVRA 1PLKA 4CEJA 4G5GA 3MFYA 2GILA 4A2WA 2BV3A 3B9PA 1IN4A 1G5RA 3MUFA 2IWHA 5BQ5A 5D3MB 1FTNA 4BFVA 1F2UB 2V1UA 3T61A 5FI1B 2PLRA 4HB0A 4JBYA 4C30A 3K0FB 1SVOA 1ZD9A 5GVSA 3AUXA 4LPSA 3RRMA 1EWQA 2IWRA 3LBIA 4CGZA 4JLBA 2I1VB 4PFSA 3ONWA 1KAOA 2ZRBA 1ZCBA 4JL6A 1XU4A 2G9NA 2QTVB 5KSOA 4NCIA 5FTJA 2IYQA 4D0GA 4TTRA 1NG1A 2ECKA 5H68A 4ZDWA 1TPZA 2YINC 1Z47A 1ESNA 3KTAB 1ESMA 4TZ6A 3VKGA 1MO6A 4D80A 2J9RA 1DTSA 2IK8A 2G6BA 1A2KC 1JXOA 4YMSA 1R4AA 4PX9A 4PPFA 1ONBA 4M9XA 1KMHB 1DAMA 2QSYA 2A2ZA 4O25A 5F3WB 1OXXK 1Q12A 1SGWA 1SXJA 5KOYA 3EARA 1E2PA 3WRXC 2FH5B 4O2RA 2N42A 4MGZR 2RGXA 5KSYA 3O8CA 1PV4A 4KXFB 4RD4A 4CDGA 3TR0A 1E1RD 3DL0A 3R20A 5TMPA 4NBSA 1AA9A 1NBMA 1XD2B 1ETUA 1F5NA 4GI7A 2UKDA 3TUIC 1NY6A 3EIQA 1LF0A 4M22A 3V4RA 3GFPA 1XJQA 1Q57A 3H84A 2DBYA 4W5WA 2ZRPA 4BLOA 5KHOC 3KQKA 3VHXA 2RHDA 2O8CB 1ELOA 1MO4A 4QNRA 1Q21A 2W0SA 2ZE8A 5DH9A 1D2NA 2IBMA 1Z0JA 4Q4HA 3VR6A 3C5HA 4PAMA 5DLQC 2XXAB 4FMCB 3K0AB 1E96A 1NVXQ 2FSGA 5HR5A 1T91A 2VHCA 3PENA 5BN4A 4Q1EA 2JIZA 2Z5FA 2QMEA 1CLUA 1OV4A 2F3TA 3N2IA 3SJBA 4AURA 1LS1A 2QPAA 1E9FA 4TYNA 2OCYC 3N2EA 5CM8B 2GJ8A 1Q0UA 1A82A 2W0MA 1HYQA 3DHWC 3I62A 4TYQA 4DJTA 1GITA 4CEHB 1WE2A 2W6JA 3BS4A 4Z8YA 3BOSA 4HSEA 5HCIA 3RABA 3SFVA 5JJLA 3PEWA 4HAZA 1EFCA 4DSUA 1S9HA 2FDCA 4IVPA 3CNNA 4AYXA 5H1YA 2XB2A 4M1TA 4C0AC 3EWAA 2QGZA 3U44A 2ZR9A 4LHYA 5BN5A 2ZJZA 2A5YB 4DUGD 3NBXX 3TW8B 4JVSB 3RS2A 4MKFA 5JEDA 4PHHA 3AEZA 4OQLA 1A5TA 2I4IA 4B3XA 3FPAA 3DZ8A 4DZZA 4D2IA 5JBQA 1Z2AA 3GLIE 3TVDA 5ELXA 4C2UA 2CJWA 1DAKA 3W9YA 3GLIB 2AHOA 1P75A 2QT0A 4YC7A 3Q85A 3C4JA 3CW2A 3BB1A 2REXB 4I1SA 2NOAA 1M6NA 3CZQA 4JBWA 2CCGA 1Z2CA 3BAFA 2ZAOA 3TH5A 1RKBA 3SYLA 3DMDA 5K8LA 4EUNA 4GT1A 2FX3A 1W2HA 4BPBA 1SHZA 1R6BX 3BRWD 2FGKA 1P2UA 2PLFA 3AKDA 3SI7A 5AUOB 4DSOA 1PZNA 3U7GA 1VG8A 4PPNA 2AFHE 4DCVA 2VP9A 4RD1A 1P9RA 1VIYA 2QY9A 4GDFA 2GZDA 4F92B 4RCZA 4IEIA 2X8AA 4MYHA 1OFIA 3W90A 3NC0C 1JB1A 1AK2A 2D7DA 4AIIA 4US2R 4OK5A 1NNEA 2R62A 4B3CA 3GJ4A 3VR3A 821PA 3NBZC 1U98A 4PHTA 2IC5A 4YDSA 1EFRD 4TYPA 1U0HC 2FFQA 3P26A 4Q19A 5FOUA 2NO9A 5FTNA 1OXTA 1HT1E 4H1VA 1ZU5A 4TLDA 4TT3D 4OI1A 2FPLA 4BWYA 1CBUA 2WV9A 3MSXA 1XTRA 4LV5B 4JSTA 1W5SA 1D5CA 1XEWX 3OFNA 1E2GA 1WDTA 1G9XA 1IY2A 3T12A 1WB9A 1KTVA 1ODFA 4G5QA 4IDNA 3RRYA 1YR7A 2P65A 2WSSD 1XXHA 5KU1A 3GJ0A 1NN3A 5FUVA 4NH0A 1RIFA 4MYCA 1U8YA 4XTCS 5G53C 4NCNA 2LWIA 2DB3A 2GESA 1GOTA 3VX3A 4C0LA 5LBIA 3OESA 3TBKA 3ECCA 2EU8A 4Q47A 1CJVC 3QXCA 5JS8A 3P32A 5FBLB 1TTTA 2BMJA 3KFVA 4EFMA 2ZRGA 2EFDB 2HYDA 5JWOA 4RZ2A 3OEEA 4ESVA 1PLJA 5DN6D 5FL7D 4FINA 3QJYA 4IOLA 1DAIA 3CRW1 3NEYA 4BLPA 1W49A 3U2QA 2R65A 2WJYA 3AP1A 4V0NA 2GCOA 1G8PA 5JFGA 1G8FA 3NEJA 2BBTA 1US8B 1ANKA 3PEUA 4PQFA 3PITA 3P1JA 1AGRA 1D2MA 2P5TB 3GJ5A 4BASA 2JDIA 1VDZA 4F91B 4PO9A 5JCPA 1CS4C 3U3MA 3R8CA 3AVQA 2OM2A 4XD7A 4CIDA 2FMXA 2ZRIA 3QI2A 1JECA 3ZGXA 4LHWA 3NHAA 1E2IA 4LDJA 1ZM9A 2J0VA 4GOJA 3WMFA 3ZQJA 1CF4A 2O8FA 1XBTA 1CIPA 3B9QA 1H65A 4FIDA 1LS6A 3ZVMA 3DOEA 4Q21A 1EWRA 4XWKA 1XTQA 1ZNWA 2GJ9A 5L3SA 3EX7C 4C0KA 5CDFE 3A1TA 1HQYE 3ZS8A 5LD2C 1ZYUA 3V4FA 1VG0B 2C8VA 2EVWX 3ZS9A 3JZAA 4LX0A 1T9HA 1Y3AA 2OCAA 3PIRA 3KKMA 4I1VA 1T3LA 4AC9A 3QQ5A 4DCTA 3VKWA 4QJ5A 4Y0AA 5KNCA 2BDTA 1A4RA 4R2HA 4EPYA 1Q3HA 2KBFA 2VSOA 2QAGB 1NIPA 3A1WA 1TNDA 2FG5A 1S4QA 5AUPB 2GTPA 4BRUA 2JLWA 2JJ1A 1LNZA 2ZREA 3B85A 3CUEF 1NN0A 1XPOA 1HEIA 1W7AA 4JZKA 2WSMA 4PTLA 2H16A 2WHXA 2GXQA 3TRFA 5DNYB 3C41J 4JLVA 5AUQA 1I2MA 3BE4A 3E1SA 3EASA 5CLLA 4TL9A 3I3SR 2D2EA 2ZI7A 4IOJA 1S8FA 2C04A 3FMFA 2A78A 3SYNA 3EC1A 1LFDB 1P7CA 4PO8A 3A1VA 1UBFA 4KITB 4GL2A 1KO4A 3F8TA 3FKSD 2A30A 1RVDA 3TQCA 5E4FA 1BYUA 1NIJA 1RRPA 2OXRA 3IIKA 3KTAA 4URVR 4NL4H 3K70C 4LCBA 3HDTA 3GLGE 5J4HA 2B8WA 4OHVA 4CEIB 2GAOA 1RC8A 4OL0A 3GLGB 4ZKEA 2JLUA 1N0WA 3AGQA 4O3MA 3TSZA 3CRVA 3L0OA 1KMHA 4HAYA 2WM9B 3QF4B 4DCSA 2GBLC 2V1XA 2VF7A 4PPGA 1KI2A 5TARA 3Q5EA 4LBZA 2IEZA 2BEKA 2GA8A 3TSWA 3T06B 1NP6A 1II0A 4XJXA 1E9AA 2CVFA 1JAIA 1DO2A 2WTUA 4LZZA 1L4YA 1NL3A 2XGJA 2ERYA 2P6NA 4N1AA 2ZR0A 1MO5A 1XD2A 3NDBB 1G7RA 5GJWC 1W1WA 2CE2X 2ZVPX 2ONKA 2BJWA 4EPXA 4A2PA 4HLQB 3UKDA 2RMKA 1W48A 1W0JA 2GJAA 2OBLA 3UANA 3DKVA 5JWHA 4R71A 2ODBA 2G3YA 1BOFA 2O8CA 4D26A 3W6NA 1K6MA 2QPOA 3BC1A 5KUTA 1JR3E 2GEDA 4HLDA 3EPKA 3F3YA 1E9CA 1TEXA 2GVZC 2YWFA 4DCNA 1M2OB 1NKSA 4D4LA 1X8LA 2KSQA 2XXAA 3K0AA 1MV5A 3EZ2A 3UXMA 4A8JC 1OSNA 4QHTA 3MJHA 4UXJA 5C46F 3CB4A 1U0JA 1RRFA 4PXAA 2QAJA 1QHGA 3K1JA 3M0EA 1XEXB 2YC4C 3DZDA 2FJUA 3PVSA 1TEVA 2ZPTX 3HR8A 4TTPA 2VTKA 1IHUA 3LAWA 4Q1DA 4P0TA 2JJ2D 3QY0A 4BFUA 4N0DA 5FTLA 4BECA 4B73A 4D4JA 2WJVA 5KO2A 4CEHA 1NRJB 2ZUCA 1SHKA 2R6CA 4U7DA 1P3JA 5GVRA 2HDNB 2F9LA 1Z0AA 4KLNA 3NDPA 4OK6A 1S3SA 3EA0A 4PO1A 5FOTA 4R7ZA 2A5FA 4Y0VA 1IN6A 3H1TA 4O2LA 4QHSA 4PZLA 4A1FA 5EXXA 3ZIAA 4V0KA 3HU1A 3IQWA 2NTYC 2CCKA 2PT7A 5DE3A 3D6TB 3K9HA 3SZRA 5H8WA 1DADA 2D4HA 4Q1BA 4Z1MD 3EC2A 4WVFA 3CNLA 4MYTA 1W4CA 1RW4A 2R2AA 2FFHA 2GVDC 2W6IA 2VPPA 1KIMA 1UFQA 1KI4A 4WZ6A 3GJ6A 4BLSA 1J2JA 4FMDF 2WJHA 5BXQC 2BBOA 3QKRA 3GLIA 1E4VA 1WMSA 2WWYA 3QNUA 1LVGA 8OHMA 4TSFA 3UWOA 2Q3HA 3GEEA 4BZXA 4KFTA 3NXSA 1QBKC 3QVUA 4ZPXA 4XSHA 5E95A 1X86B 4LWZA 1XEWY 4FMCF 3ZZTA 3AP3A 2ZVQX 4ZCIA 4TMVA 1IM2A 4DDTA 2ATVA 1BKDR 1MOZA 4PQRA 1BIFA 1GKUB 2HLDA 5FTKA 4NHOA 3X1ZA 3AVUA 1KDOA 1WA5A 4IXMA 4QJ4A 3G0HA 1KY3A 3RDPA 4BZPA 4LGMA 1HUQA 3FMOB 2IUTA 4WZAE 4QKQA 3KJIA 4Q4LA 1CJUC 4C4PA 1IBRA 1ZNYA 4IRUB 1KI9A 1OFUX 3SYKA 4HB3A 3JZMA 1N3BA 3KXLA 2BMEA 2UZ3A 2O8BB 3X1YA 1U2RA 4F4JA 4BUJA 1R0YA 2ZI4A 1GL9B 3BH0A 1DAEA 2PT5A 2D74A 3OIVA 1T0HB 1E98A 1SVMA 4KO8A 3AM1A 2AK3A 4NYMR 2QUZA 4NZYA 4IHQA 2O8EB 5CB8A 4EQ6B 1MT0A 3K8YA 3AKYA 1M1YE 3ZVNA 1OT3A 1U9IC 2F1IA 2IYVA 3BD9A 3GJ3A 2REOA 3PR1A 3UG6A 2QL6A 4TMZA 3FDIA 4Z8XA 1PJRA 1YZKA 2O0JA 4I4LA 4QGGA 4JLNA 4R2IA 1G6HA 3Q9LA 4PHGA 4JLAA 2Q9BA 5CM9C 4OQFA 3AVYA 1MABB 2RKOA 3CWZA 3U60B 4TLBA 3KKNA 1V43A 4HB4A 1FX0B 1Z8FA 4JT4A 4ESHA 5EJEA 4BEJA 1AJEA 1S1MA 1UAAA 1ZD1A 4JVMA 3PV0A 2DFTA 2OAP1 3BXZA 4ACBA 1VHTA 4DT1B 1US8A 1Y63A 4Z51A 1OJLA 2ZJYA 1KSGA 1II8B 3BB4A 2AN9A 3WP0A 4M9QA 1CKEA 3GPLA 3ZZUA 3EZ9A 1LF5A 3GFOA 2QQ0A 4IDQA 4PHFA 5KDDA 4B2PA 3CRMA 4CRWB 1FNNA 1EX7A 2OBNA 3EAQA 1GL7A 3A4MA 2IF0A 3A58B 5GJVC 4M1MA 4GBMA 3RS0A 3OAAA 3AVPA 1BH2A 3NBYC 2Z4SA 1G3MA 1UPTA 3ND9A 1R8SA 4A92A 2P67A 1YVDA 4I1OA 1E79A 1YZGA 2GF9A 2PEZA 5FOSA 5C18A 3NWJA 1PUJA 1KO8A 3CX8A 2QENA 2F43B 5CDFA 3ADKA 1CP2A 2H1LA 4Q7LA 5CITA 4AWXA 2HF9A 1JEEA 1KDPA 5K8IA 1CJKC 1A7JA 2HCBA 4LRWA 1ZM3A 3TW4A 5C4MA 1FOEB 2JCSA 1UDXA 5K8TA 2D3WA 4JJKA 2QA5A 1HE8B 1KI6B 1U94A 5BYJA 1NSFA 2QAGA 1XNJA 1KI3A 4MUBA 2GCOB 5DI3B 4BLTA 3A1SA 1FFHA 1OKKA 2OLJA 3OE7D 5FBQB 3NH6A 4DDWA 2HUPA 4JLJA 2ZRKA 1E2KA 4R9UC 3ZJYA 1L2TA 1W46A 2QE7D 2NZJA 4JMPA 2VP2A 2IHYA 1Z5ZA 1EFUA 4ZCMA 2FE4A 3TGPA 1D8TA 3PCRB 3OZXA 2ZJBA 5C4GB 5J4LA 4XVRA 1NLZA 4PZYA 2MSEB 3K53A 5CYOA 4DIEA 2RGNA 5AJXA 2XZOA 3U3OA 1P9WA 1WQ1R 1QHIA 3DOFA 3QPWA 1U8AA 4MA4A 3IQXA 1P62B 4PC3A 5JJKA 2XJ9A 3VFDA 2QM7A 4CEIA 1W4BA 3UMFA 3D31A 2FFBA 3GLGA 3E70C 2WPDD 1XDBA 2IUUA 3QENA 3TSOA 2VF8A 3RRZA 3GLFE 2IYLD 2Q21A 4P4SB 2FU5C 1T3HA 4PC2A 3GLFB 2HJVA 1P60A 2O52A 1Z29A 4M9ZA 2QI9C 3PUXA 4JYBA 1KGDA 1PUIA 3PG5A 4NE2A 2XJ4A 4FD2A 2YOFA 1TUEA 3IDQA 4ASUD 4E09A 3EPLA 3NVAA 2Z4RA 3MG9A 4WOPA 2JLXA 3TR5A 4F4IA 5J4VA 1COWA 3WBKA 4M1SA 2VH5R 4LPKA 4KYUA 1UKYA 2GXSA 2RGEA 1N6NA 3AF0A 1VG9B 2V9PA 4QFMA 1FPMA 1UADA 5L3VA 2QP9X 2CNWD 1H8HA 2UZIR 3UMRA 5B58C 1QHXA 3M4YA 3AF2A 2HT6A 4BLQA 4WW0A 5A0FA 3RS7A 5FFMA 5KTYA 3F5FA 1JR3A 2C9OA 4DCUA 1YRAA 4U02A 2NO1A 4B75A 3SDZA 4TQUS 3CPJB 2BBSA 4DLTA 2FV8A 2WVJA 1R7RA 2ZXUA 2MSDB 4A2QA 3UK6A 1RYFA 3SR0A 1XEXA 1S96A 1F3OA 1XPUA 1KYIA 3C7KA 4V02A 3QVVA 3B8HA 3U7FB 3VKHA 4URZR 1WCV1 3B13B 2ZM5A 4QRHA 4Q18A 3UWKA 5LB2A 1SXJC 3WNCA 5FI0B 1Q1EA 5G41A 4JVNA 2IYUA 3FWYA 4MH0R 2J0QA 1DAFA 1G3UA 5G3ZA 4AD8A 3Q8XB 4HAVA 3P4XA 5CIQA 3K0CA 5TB5A 3ZH9B 5AJWA 5JI3E 1TF5A 1TADA 1GRRA 2NPFA 3T5DA 4BZQA 1OPXA 4OHZA 1ZIOA 4QHYA 4NYJR 5D3QA 3BH6A 2KBEA 4B2LA 5HKKD 4FW9A 5GJCA 4OYHA 4TLAA 2IT1A 2ODEA 5IK2D 1KHTA 4BQSA 2ASEA 4A0FA 4YMVA 5KSZA 1R5NA 3CF2A 3NC1C 1RRGA 4M9SA 4U00A 1G17A 1LY1A 1E32A 2ZSEA 1UJ2A 1GSIA 4RZ3A 2QU8A 5J40A 3KZ1E 2ZEJA 2FEMA 2XZPA 3KKQA 4GMXA 4C9BA 1YE8A 2IYSA 1FP6A 4Q1CA 3BH7A 2AL7A 4QGHA 5IHPA 4FMBB 3FB4A 3Q7QA 2BHRA 1EG7A 1G16A 2FOLA 2ZRLA 3KX2A 4GMDA 3KFXA 4L9SA 2IW3A 4AK9A 1MRSA 3PUVA 2W58A 3EXAA 4DKXA 3QXXA 4F7WA 1WF3A 2QMUA 2WIAA 3JVVA 3QF7A 3I72A 4B3DA 2RH5A 2VEDA 4O0MA 3K70D 2K5UA 1VCOA 4Q1AA 4KFRA 3KQNA 3TE6A 4BFZA 1JPJA 1XMJA 3CR8A 3B5JA 3WRYC 1G4AE 1S2MA 2IUSA 2R6DA 4DSTA 3CH5A 4EJSB 4LJ9A 4MRPA 2BCGY 1NY5A 1F48A 3DEFA 4RJLA 2DYKA 4LBWA 3CPHA 1BMFD 1GNQA 1AQYA 1DG1G 2F7SA 5JSZA 3WHLA 4KYIB 2C03A 4HAWA 5TY0A 3FFBA 1UM8A 1X8JA 4D6PA 1E1QA 3QG1A 2FSFA 3W3ZB 4JL8A 4XVQA 2O8BA 3MD0A 2IEYA 1NLYA 2F1JA 2FPKA 5EXSA 1EK0A 1IXRC 2IS2A 5FTMA 5JRZA 4ZCLA 2FZLA 2G0NA 1TUIA 3QKRB 2R6GA 1MR3F 1NN1A 1N6KA 1U0LA 4HEJA 2V7QA 1R5BA 3LBHA 2RGGA 4K8OA 2O8EA 4DLUA 2FGJA 2VA8A 4JL5A 4EQ6A 3LW8A 3L43A 2YKGA 2QEQA 5CLQA 3FHTA 1W0KD 4NONA 4NYMQ 2ZROA 1X3SA 2ZE5A 3B7GA 4W5HA 2ZRFA 3CNOA 2GRJA 2XTNA 5AWFC 2D7CA 3DO6A 1CULC 1N6IA 1NVVR 2GK6A 4B47A 4H9GA 4HLUC 2WBLC 5DO9A 1MABA 4KAXA 2ZRHA 1J70A 5FPTA 3LWNA 3GP8A 1FX0A 4A9AA 1Q44A 3R7WA 4MGYR 1H8EA 4LYAA 3WNDA 3LXXA 3TK1A 4HDOB 4PSKA 5G3YA 1NI3A 1TQDA 2V8OA 2ZUDA 1P9NA 2ZS8A 3VX4A 1ZBDA 3AVOA 4YXWA 4DT1A 1E94E 4XOIA 4QXAA 4IEEA 1II8A 1EX6A 1LTQA 3OEHD 4TLEA
chains in the Genus database with same CATH superfamily
2YYSA 1F0YA 3UTDA 1KPHA 4BLRA 3KEOA 2UUCB 3WLOA 1SK8A 2QM8A 2O6HA 3R6LA 4HI0E 1X1RA 1FTWA 2CHEA 2J5RA 2QB5A 5FPYA 3JVIA 4YAWA 4B34A 1JP7A 4LJAA 5K6AC 1L5QA 3TTWA 1M74A 1RSZA 4AS2A 5JUWA 1T1SA 4RVNA 4CN8A 2E55A 1JQAA 1OXVA 1K3FA 4BRZA 4FCWA 5CVCA 1UEIA 2ZKLA 3KEFA 4MW1A 5KTMA 1GFWA 1M8FA 3DZGA 1TT7A 3R7SA 2F43A 2G9UA 3EWSA 4G0NA 3RR2A 4ALJA 1RE0A 1V8DA 3NNDA 3BGIA 5KYUA 1M2WA 3HXMA 1OH8A 4J0DA 3K15A 4D8VA 3NVKI 2EQ5A 4MWCA 4N03A 4XKJA 3OX1A 3AV3A 4LI0A 2V6BA 1NMSA 1QONA 3D1VA 1LBSA 1FVHA 1KI6A 2HA2A 3LUKA 1MVOA 5CIWA 2HO5A 3Q5DA 1VE9A 1KRHA 1Z4PX 1QGOA 2V74B 5CNMA 1U99A 2H51A 4I3GA 2QUAA 2X5OA 3LX5A 2WM3A 4FR0A 3T5PA 1GPNA 1WZ2A 1EH5A 4C7KA 2QR3A 4DSNA 1YRLA 3L4SO 4UXHA 1T6XA 3JU3A 3KD3A 3NZEA 4UEOA 5F2EA 1J24A 1G5TA 1X1TA 1WV0A 2GBFA 3N0TA 3QJGA 3GGCA 5AHKA 5F1PA 3NTXA 5IW8A 2JHPA 3RVKA 3E6AA 1ZNXA 3AMVA 1QRSA 3RV4A 3PHIA 4UW9A 2R85A 3ZR4B 4C6SA 2OZEA 3A1EA 1DXYA 4UBOA 1NC1A 1U2ZA 2NXWA 4FGLA 1X1QA 3ONFA 3KKZA 3DH0A 4GBGA 3ED5A 3HEMA 4RHCA 3ZCXA 4MV6A 3GJZA 4Z7QB 3CX4A 5TF4A 2VRCA 5H82A 4D9BA 2YQZA 4PVDA 1EM6A 1XKXA 3LC0A 4DEYA 1E4OA 3DF9A 3ET5A 1FFAA 2ZTHA 2Y9PB 1E2LA 5LFAA 2FUNB 3G5LA 3O7MA 1S2GA 3QEMB 3PGA1 3BD6A 1UBNA 3O3NB 4FYPA 2EFYA 2BGIA 2OCPA 4PSAA 3U40A 2AF3C 4FKZA 1Z6PA 2DFNA 3OIUA 3LZDA 2P30A 3FI9A 1PF7E 2LDXA 4YP9A 3BJRA 3RVBA 3O4IA 4ERNA 2QRNA 3P0EA 3QP9A 3V9AA 3GLFA 4OJMX 3V1YA 3H99A 3RPEA 1PIWA 2ANCA 3NO4A 1KVUA 9ATCA 1T4DA 1A5AB 3GARA 1YUBA 5EFOA 3SNKA 2G0TA 4OVKA 5DCYA 2W6NA 4ZT7A 3N0VA 1P2SA 4X91A 3IA2A 4LZPA 4EGFA 4HX9A 4PC6A 1JKJB 3U3RA 2BR4A 3OJFA 1ZC3A 1T4GA 1DC5A 3R4VA 4CG0A 4EMSA 4HYEA 4D44A 1Q1ZA 5IUJC 4DQUA 2CUTA 4LFBB 4MO2A 3HE3A 4M1WA 4B3JA 5KOHB 4AJEA 1CSEE 1PR0A 3NBMA 1PUXA 4RETA 3HK2A 1NJ8A 4KL8S 2JG3A 4HTAA 1NBEA 2EX0A 1TMYA 2HMWA 4ZKDA 1BMDA 3W8RA 3IPYA 1VECA 1LNQA 3V48A 2GN6A 5EJ7A 1R6XA 3EPHA 2BI4A 2F67A 1Q1BA 4QX6A 2HLPA 1QYDA 3DFKA 2H9AA 2O3RA 3QXSA 5EYPA 3T3IA 3NHFA 3OPQA 2VKQA 1O0SA 1WMDA 4DLYA 1XNQB 2OQ2A 3N5CA 3EOAI 4OA8A 1C0KA 4NF2A 4G5SA 3SF0A 5CVTA 3SIRA 1NW3A 3ICCA 2HSWA 4N6GA 2VP5A 1Z5VA 3LG2A 3DNMA 4NC9A 3D8RA 3SIXA 4D79A 2D13A 5DGCA 4RH3A 5DHFA 5LZ7A 4AY3A 4CHTA 3N05A 4D41A 4KLZA 4XE5A 4OFWA 3OJ0A 4YRTA 3B3AA 4LFCB 1PNVA 4BX9A 1PWZA 1IY8A 2B34A 2F17A 3NTQA 4GVLA 1QKKA 1QVZA 1CUSA 1VBMA 1Y7TA 2DTXA 3M4XA 5A4DA 3RSLA 4CT5A 1E3MA 1Z6QA 2G17A 5FD8A 1EP2B 2FP4B 2VQDA 4J4BA 4FOSA 1OBCA 5JS1A 3W77A 4TTQA 5FL3A 4H0CA 1CR1A 4I5GA 4P38A 2HF7A 4AL4A 1EUCA 4M9RA 4MICA 5G0WA 4MAMA 3U26A 1P6XA 6CHYA 2OK7A 4R1OA 5A3VA 2X0EA 1QQTA 1Z35A 3KVYA 3A04A 3E48A 4UU1A 3ANTA 2A9KA 4OEHA 1N75A 5FWYB 2ODWA 3INGA 1QO9A 3OUTA 4DUGA 3R75A 1DNPA 3T5GA 1Q15A 2PUJA 3AFHA 3WV5A 4C6TB 5KJ1A 5D00A 1JIKA 4LJ4A 2X1VA 2SKEA 2G9QA 3SDBA 3ZCTA 4ZT3A 1J6UA 4NYJQ 4YRBA 4YCNA 1E0JA 3BORA 3WGOA 4P92A 2C1ZA 4M9CA 1KJWA 4ZAZA 1GAXA 1CRQA 2YJ6A 1GPKA 1D2CA 2R9VA 3Q0EA 1T24A 1XMIA 3FNBA 3C7DB 5LQSA 1BXGA 3SN6A 2I2DA 4W9NA 2ZUTA 3VV3A 3O9MA 3ZHCA 4DC9A 1P4GA 1EGVB 1TOAA 1U0GA 4OI0A 4UKDA 1U5BA 3WLTA 4YCBA 4A15A 3NYRA 2WOJA 4W5OA 2CL7X 3JYLA 4PN7A 2IHNA 2R1ZA 3VQTA 2XXBA 1J99A 1W88B 2I0FA 2XUIA 5CA1F 4JJ6A 2JLSA 5IUNC 3STYA 4UQOA 2BF4A 2OL4A 3FCYA 1ML4A 3HCBA 5C4IA 2WMNB 4ME6A 4ZC8A 4C0JA 4CKWA 1DJNA 2Q4RA 2P6PA 3UPUA 3PHCA 1OHHD 3CX7A 2NU7A 3SPXA 1SBIA 1FJ2A 2QPTA 3F8SA 3ZWPA 1Z37A 4KQ1A 9LDBA 2BGLA 5EXTA 3D7KA 1IIBA 2PBRA 4JOQA 1FUIA 5KYXB 4RAOA 3TTUA 3AL2A 3WYGA 1IK4A 1V6CA 1OH5A 4L4ZA 4S3MA 4B8WA 4CW7A 1WP9A 1PTKA 1TJ5A 3AI3A 4F86A 4HQ6A 4YV1A 5CK5A 3SHFA 4L74A 5CDSA 2UUAB 2ZIGA 3I2IA 1IVNA 2ZVJA 2W2XA 3D3KA 1ISMA 3PHJA 3RC2A 5KSWB 4IM7A 2WHPB 5GTDA 4QPZA 4KWTA 2O07A 4CM4B 3IT1A 2W8BB 4BQIA 3WIVA 1MG0A 1PR9A 1SNYA 2JNWA 1N6PA 1E5QA 2ZTLA 1SZDA 1QR6A 4LF8B 2PVCA 4UULA 4BNFA 1IUPA 2DBZA 2HMSA 4EUHA 3BICA 2BJVA 4NEGA 3G5UA 6PFKA 1QK5A 2RHGB 2FK7A 1JNYA 4LBVA 4M1KA 3T5CA 3W3AA 3L40A 4U0JA 1K8RA 2FPIA 2AZTA 4GXQA 3CBGA 2AUTA 2OVBA 3HJCA 4H1UA 3H11A 1GUAA 4RV5A 4UM5A 1I3CA 4RMJA 4D8UA 5JASA 3NCHA 2WIBA 2AEJA 4I99A 1N7IA 1PFGA 3PTZA 4YPVA 2NIPA 2FSVA 3HKEB 1X9IA 1XEFA 5L4SA 4KIWA 4NCJA 2WUWE 4EPTA 3I42A 4FFRA 1SB8A 4IRMA 1KP9A 1ST2A 1Z63A 1ZWKA 4MDFA 4IMJB 4YXFA 1EQUA 2CL6X 3W2FA 1N32B 1CJCA 1NT4A 2VCHA 5IMBA 3GMTA 4RKEA 4TRRA 4N0MA 5IAJA 3O4VA 4ON9A 2L17A 4FI3C 4Q9HA 4KWEA 3BBPA 1YVUA 1TJNA 1PG5A 4L6IA 2PFSA 3P19A 3O2SB 3R3ZA 2GNOA 1QHHB 4G9GA 4NBKA 3QV1A 4Y2RA 1NVVQ 2JZNA 3G2NA 1T5OA 1WWKA 4DG8A 5KEIA 3G8AA 4LSGA 1MB0A 1Z2DA 2V4MA 4CQMD 2R0QC 1FNSA 2C2BA 4JJZA 5ECGC 3LQ4A 3P0FA 3KOWA 1U65A 3GAZA 4QDZA 3LUBA 1C0PA 2X4GA 4JXJA 2AFIB 2UVPA 4JMLA 1U8ZA 4PF1A 4K40A 3ZKWB 5JZBA 4OQYA 3UW3A 1XZFA 1Y9DA 1PYOA 2DP4E 2Y1DA 1V1RA 2ZXFA 3MELA 5KKAA 1WZCA 1YIOA 1VHQA 1HDOA 1ZMOA 4M7RA 4ODIA 4WQMA 5EJGA 4AKHA 4GOXA 3CR3C 2O2SA 2ZS9A 4XYMA 1GNPA 1V26A 4JYCA 4OLJA 4LZWA 4V1CI 1PTJC 3M6UA 1NMZA 4LUCA 5IKPA 2X5NA 5K0ZA 3K8ZA 3DYVA 2IY7A 4UNQA 5BSGA 3ZDCA 4MVJI 2KB0A 1XD8A 4QOSA 4L5IA 1G8GA 3QEOA 2GQ0A 4EA6A 2I29A 1SG9A 2MMCA 2O7QA 3L49A 1VKJA 1NE2A 3GRPA 1JG6A 1N78A 4Q3AA 2YMPA 2J6CA 1GRCA 2YJZA 4GM4A 2B0CA 1MO3A 4C29A 4JFRA 4LRSB 3BRCA 3R7WB 3DO5A 4WTOA 2FSPA 3U3DA 4ERXA 3CJRA 4M0UA 1CY0A 4AF7A 1ZN7A 3NIBA 4ZC1A 5TQ0B 1I2ZA 2R4TA 2ZIAA 4HN9A 3TPZA 2E6UX 5IDVA 5EE1A 2GBIA 3GFTA 3A9VA 3RAGA 4DFDA 3REGA 1KMIY 2UYYA 2X2PA 1OLXB 1D0IA 1SHTX 2F9MA 2O3TA 2ORED 3ACCA 3BB3A 3V4LA 3QG5A 1XCJA 3JQGA 2AVDA 2IS1A 1X80B 2BLNA 3BQMB 4PIMA 1KNQA 3DEAA 2O2DA 1P2TA 2PFKA 1PJAA 1QVWA 4A82A 1RACA 3ESCA 2WMOB 2FPGB 4GXTA 4KCGA 2QTTA 2UAGA 2ON6A 2OORA 4JI8B 1BU8A 4L16A 1LDNA 4S2EA 4L9RA 3RSHA 1W96A 2CDCA 3ORFA 4J1SA 1OH7A 4DQKA 5GMOA 3AVWA 1TMKA 2ID4A 2G77B 4HDCA 5FLYA 1CJMA 1ZH6A 2XUZA 3ZI4A 2CSXA 2OHXA 2PU7A 4ISBA 1BNCA 1S0UA 2FZVA 2EP7A 4JJ7A 4QOHA 2D0IA 3G59A 1QR2A 4KWIA 1KVQA 1ADCA 3MWDB 3QBEA 4N7MA 5TQ2A 1UKBA 5BWLA 1JQEA 2X8BA 1H2WA 2A3NA 4RZXA 1MVNA 2RHLA 2VSNA 3QKSA 3RVLA 3B5EA 3OQPA 1TXGA 3X2SA 1VJTA 1EZ1A 1G5FA 5F3RA 3IUSA 1TO6A 4BO7A 4YRKA 2P9BA 3K4PA 3QUSA 4FJ0A 5LYYA 1ZIXA 4NZMA 4Y18A 3VAAA 2J46A 1JGTA 1AMNA 3ZDBA 3IHWA 3EIUA 3GQBA 4KJZA 5H9WA 4FN5A 2VDPB 2QMHA 3VTFA 1TYCA 1FDSA 3ENWA 3HACA 4MPJA 1EFHA 4U6NA 4WKGA 3T1QA 3D4NA 1MGOA 3BMCA 4F4CA 4TSKA 5K3OA 1B23P 1GTZA 2WWWA 2CEAA 2ZTUA 1WDMA 3FGOA 2OCGA 4NTZA 2ACVA 4RFSB 5F77A 5NLLA 1CHDA 4BV2A 1HDZA 3B7PA 4WFIA 1YR1A 3G2HA 1VCMA 1Y89A 1V1MB 3UMVA 1GGNA 1QGAA 5HJ7A 1WUKS 4G1FA 2WKSA 3MW8A 4UM8B 5GY7A 4R54A 4EFLA 2J3KA 1I1NA 3UUGA 3KJZA 4NU6A 4A0GA 3FWZA 4GBJA 4LBYA 1AKRA 4V03A 3WLIA 4TXHA 4BKUA 3KIPA 1KP3A 1O94A 3HCAA 2BOVA 1XWFA 3G13A 3O75A 2HXGA 2VH1A 4MVJF 2ISCA 3ZPXA 5A7FA 5AVTA 4DB4A 3PLAE 3ZZMA 2H59A 3WSTA 2PS0A 5EMNA 4E5VA 2CXTA 4MPRA 4DLVA 3O4GA 4HFJA 1PEKE 4TVKA 1GYQA 3DHEA 1KXJA 3VR3D 2O8DB 3KAQA 1T5HX 3MWGA 1G41A 2XOXA 2VNSA 4DF3A 4YV0A 5LD2B 3UUWA 3WTBA 2JI7A 3ZY5A 1VP9A 4CTMA 1DI0A 4EHJA 2XDAA 4P58A 1N6HA 3AF4A 3T15A 3IP9A 3NM6B 4MW4A 3KYJB 3OFND 1GUFA 3AHFA 4D42A 1YQWA 4BVEA 3VC3A 2VLIA 4QD3A 3OO1A 1WMFA 5D86A 4NDNE 5SZKB 1YBFA 3UAXA 3LXRA 1OBOA 1YAHA 4BNJA 1ORDA 3DDOA 1C8LA 1X7YB 4KQXA 1XZKA 2M2IA 3UAZA 1RWWA 2XA2A 2MIIA 5EWJB 3CBQA 1MA0A 2QQFA 3KXKA 2HB6A 1Z74A 3GLHE 3PUJA 4IDHA 1LBHA 4JIGA 1J2UA 4Z1MA 4ZYWA 2R6FA 4IWNA 5HIJA 1F2TA 2JIRA 1GGEA 1KJYA 2PNFA 3VPCA 4X64B 3OCYA 4F85A 3S1AA 2IYPA 4GLBA 2OGTA 5AJYA 3TFOA 2JPDA 1EA7A 1JKXA 1I36A 4NMXB 3CMMA 3SIPA 4WBNB 1Z25A 2L19A 3S4YA 2B35A 2POCA 4V0LA 4QL3A 4YASA 1JA9A 3BD8A 4QE3A 1BFKA 4HGOA 3CVUA 4RXTA 2E7ZA 2EW1A 3N39C 3KE8A 5DNWA 4AF8A 4OL9A 4Y9UA 1G8YA 3OBIA 4J29A 2OOKA 2AKAB 2BM1A 2E1PA 3B51X 4TM7A 1OB5A 2WZQA 3GPDG 2VQ3A 2NXJA 1KK2A 2Y9MB 2ANBA 4LOJA 4DHEA 1H4QA 5MN4A 4AUMA 3W5SA 2AFVA 2CB0A 1Z6GA 5HKOA 1A72A 1OGYA 3GNQA 3ESQA 1DGQA 2QTHA 5HBRA 2G1JA 3D2CA 4IFEA 3GGOA 2BIFA 1TE2A 3HU3A 4KPUA 1JS1X 3C1OA 4O4LF 5FRDA 1HFKA 4TWAA 4ETMA 5CGQB 4DABA 2HHHB 3V6LA 1XJ5A 3WRXA 1SCUB 2I3AA 4D8TA 5AKKA 1NAIA 1R10A 2I9PA 2PRSA 3A2MA 1YH3A 4A16A 2WY2D 2VAXA 4NBUA 3QPAA 2Y05A 1AHPA 2YVAA 4QUIA 4YLGA 5KMGB 3QBVA 2Z0MA 1XTZA 3FPKA 4PLWA 2ZCVA 3G2KA 1PW7A 2HI0A 1GTG1 5AI6A 3TKAA 1YS6A 2UDPA 2X3FA 4X6UA 4Z9FA 3O1HB 2IYWA 4MK4A 3K0CC 3QE0A 2Y1XA 5DM60 1NXTA 5UKDA 1L7RA 1XXLA 5LYJA 5B7QA 3MMSA 5FQNA 2A1UA 5BMVA 5KX5B 5BSTA 1M3SA 2M1XA 5HM8A 5LXTB 4DEXA 5HZHA 4MRMA 1CUXA 1KO7A 1K1EA 3CF6R 2FZ4A 2GNAA 5J47A 1IOWA 2ZVDA 3KWMA 1GPYA 2P90A 2O0KA 3E4DA 1TZMA 1T26A 2XT6A 3E15A 3HM2A 4FDUA 4OJQA 1NX6A 3MOSA 4A8JB 3IEUA 1A3CA 1PR4A 2IOQA 3L5KA 2A35A 2H00A 1GKKA 2JS7A 2W2TA 1UWCA 2EP5A 3FI0A 4UEKA 4DCOA 3QUQA 5D7BA 4QJIA 1CCWA 4TVOA 4Y2UA 1GFSA 2YCLA 3NAMA 3I4CA 3OQNA 1U2GC 2IPAB 2JVJA 4J16C 1PS0A 4L08A 1K7SN 3AKCA 1RJ9B 3VDRA 3P20A 5CX1B 4F8EA 5KJFA 4IJ6A 2V6MA 3GGGA 3LCCA 3FYCA 4IHJF 1HNXB 3QBDA 5EP1A 1E20A 4D46A 2I8CA 1J8MF 2AX4A 3FLBA 3NJ8A 2P3LA 3U9TA 4GPBA 2AWNA 3GRFA 3ZHSA 4E1BA 4K6HA 4ZFNA 1C1XB 2PXXA 1PX2A 2YVQA 3WRYA 4MRNA 4URHA 4LZNA 2PNJA 4A6XA 2AKEA 1Y6FA 1NJFA 5EUMA 1N3YA 1VYUA 1N0UA 3K9LA 2R11A 1LFAA 1OCEA 4KV9A 2A5JA 4DIDA 2Z83A 4ZVQA 3IGFA 4R84A 4XLZA 3MTEA 2JC3A 1T6ZA 3VH1A 4LMPA 4LTNA 4FT2A 3G1TA 1QDUA 3RFCA 4YMTA 4FVTA 1NM5A 1L6IA 4XH9B 1O4VA 3ICQB 2DJ5A 3B60A 1CFJA 2Z1NA 4TYYA 4PBSA 4NMWA 2P40A 3KDSE 1OX6A 3TFQA 1SUFA 1J22A 2FW0A 2VNHA 4ZO4A 3A4VA 1YZQA 1RYDA 4RA9B 1BCRB 5G40A 5K05A 4LJ8A 3AZQA 1QBGA 3ADPA 1KI1A 3KHSA 3PSHA 4LYHA 4BL5A 5C1OA 5A3QA 3RGGA 4RU1A 1AKYA 4RESA 5EIOA 4FEEA 5E0KB 1ONPA 4C0SA 4BGDA 1W0JD 5IVKA 1I14A 2FG7C 3NGLA 3V34A 1Y3DE 2ZWPA 3A1UA 1M2KA 4QBHA 5I7HA 4G0YA 1JLMA 2D0OB 1X8KA 1NQWA 1U2EA 1XC7A 3RVDA 3GPBA 2DCUA 3BHIA 4M99A 5COQA 5GP1A 5C5IA 4F1WA 3P2EA 4CIXA 4DMKA 4EQZA 1K63A 4W7IA 3RSOA 6Q21A 4RTRA 1E0AA 4G3XA 2V6JA 4BE9A 4CNQA 3LVFO 1Q6YA 3AR3A 4YT4A 2YN4A 4KR7A 3OD1A 3K9NA 1XPRA 3QKUA 2BWJA 3LHDA 1XZLA 4MV3A 1WBDA 3B1XA 3KJEA 2W4MA 3H2KA 3IHLA 4KQCA 3EQ6A 3IUJA 1GGJA 2TS1A 4W7HA 4C4XA 4A5SA 5H3HA 3CJQA 2W2VA 3WYAA 1N34B 2ZT6A 4XCXA 4TL8A 2FEWB 4JI5B 2NP6A 4KN6A 2ZTVA 1L7DA 5IJZA 3MHTA 2XLCA 3N86A 3SFTA 1QC5A 4X1IB 1YUNA 3UFXA 3LHKA 1DFGA 2G28A 5EZYA 4Y8VA 1ESCA 1JIXA 2G71A 2WMYA 4F38A 3I52A 4ZIRB 3I9OA 5C1PA 4D9IA 4RK4A 1Z06A 2ZU6A 4JC5A 4EX7A 3E8MA 3NORA 2WU0A 3ZLUA 5HW0A 3HLTA 1IQ0A 1I9CA 4XFKA 4E94A 2ILTA 1G20B 1NI5A 1Z26A 3C15C 2RK4A 3O8QA 2ZBPA 2X9LA 1Z34A 2QRJA 4ZCSA 5KOIA 2P6RA 3SS8A 3B2EA 2FUG1 4JAVC 4UHHA 5COBA 3HSYA 4RACA 4NBTA 3HS3A 2CB9A 1Q92A 1VHJA 3FYUA 3DONA 5TVKA 5CFOA 1E8NA 4HAUA 2SICE 1PO7A 1KYXA 3FCAA 4P86A 1ZUD1 4ASUA 4WERA 2OKCA 1VL8A 2QT1A 3SEZA 1QRUA 2XBUA 3ER6A 5H70A 2HL6A 2QVXX 1QRDA 3HYSA 1F3LA 1KA9H 5SY6A 3GCGA 5JNSA 4XGRA 3LRTA 3R9KA 5EJAA 1JJVA 1B6RA 3N70A 2ZTSA 4UCWA 3N8GA 4MVYA 4QT0A 3L8EA 3LX6A 4FGJA 4LOHA 3V1MA 4C03A 4FBLA 4CDMA 1BRTA 2B82A 2YV4A 4QAJA 4BJ5A 1IBMB 3ITKA 4JLDA 1ZG3A 1YRWA 2GRAA 3ASUA 4K3UA 3NP7A 4HAXA 4L5JA 1MXFA 3RFVA 3WHKA 2OMEA 4K9DA 1EX9A 1DBPA 3CT6A 4YB8A 1RWBA 1T5SA 1YHNA 2OVFA 3RIMA 1DEOA 2C2KA 3BUSA 4HXYA 4V0QA 3VHLB 4Q4JB 4EF4A 2HLDD 3C6XA 3WS7A 1TU4A 2R60A 1Z08A 5GV7A 3G1WA 1JQKA 2OXTA 5IF9A 3D64A 2F3QA 1ZJ6A 4EG6A 2FQQA 3B38A 4HS9A 5D3KA 4ZV4A 3VA7A 2X14A 4KQFA 5K3CA 2R84A 4J0QA 2ODQA 1WVGA 3ZWQA 3ETNA 4GF5A 1F38A 3OU7A 4RPIA 3T3HA 3IIMA 5MN5A 3AFGA 1NE7A 1Q84A 1GCIA 5ALRA 3NT5A 5DBFA 5A71A 4BFWA 1CS0A 2I8LA 2TSYB 4BNTA 2P27A 4M60A 4CM9D 3EX7C 2B0JA 4ZOCA 1OPRA 2GSDA 2ZETA 3IUMA 3NIGB 3OM8A 2GLXA 3NTOA 1OV6A 4RMHA 3WNQA 4QQRA 1NMQA 4L4RA 4E7PA 4CM5A 1Z7GA 4J03A 2BTQB 1IAQA 3SS9X 2XUKA 4Q1FA 3RV3A 4FSHA 1M6VB 1T8TA 1TD1A 1QGUB 1FF9A 1II9A 4O2BA 5BRNA 1PJ8A 1G2OA 4KODA 5CCEA 4CT0A 4R3UC 1DQYA 3HJGA 5HKKA 2YWGA 5JT1A 4BO8A 3CG0A 2VHQA 2B8TA 4YV2A 1T5TA 5JH7B 2QBYA 4PSVA 2W4IA 1LPMA 4N76A 5IK2A 4DB2A 5FUMA 1NW6A 1OFVA 3LY5A 3UHPA 3V80A 3L0ZA 1UFKA 3OZTA 4AG6A 4B6RA 3C98A 2QORA 3GLHA 4W6QA 4KOEC 3RRNA 1K2WA 1NC3A 1Z0KA 4LZOA 1RPTA 2RBKA 1M2EA 3H9QA 3IJPA 4FYYA 4JBXA 4O3FA 1NN5A 3TLJA 1S5PA 3GZNA 1EESA 3X1DA 1FP4A 1KY5A 2NZ2A 4FCVA 2HCFA 3CXRA 3FUWA 2WQZA 3COVA 4ZU1X 4XR4A 3BX1A 4AKGA 4R7GA 3EXFA 5D3MA 5C3UA 1T0PA 4ENVA 3USCS 2XUQA 1NQVA 3SSOA 4IGAA 2RAUA 1UXKA 4M83A 2H1VA 2RC6A 4MVJD 1ZS9A 1GVNB 2ZJAA 1A97A 2WICA 3I2YX 3KSAC 4H35A 1Y8RA 4EI7A 1NVFA 3ZI0A 1BD3A 1AKTA 1C9EA 4WA8A 1Y7PA 1NOKA 1D1PA 2LGJA 5DTMA 3SE0A 3TRJA 2VDWB 4G85A 4BV8A 2FZEA 1FMLA 1JX6A 2XKJE 3RT7A 1FS4A 3OQIA 3GROA 1L7QA 2W83A 2D1TA 2O3UA 4OATA 4EPVA 2GBLA 3OAAD 4QU9A 3EUWA 3ZHVA 2YRFA 3AB8A 4EPRA 1TMOA 1R3UA 1VE1A 2H9IA 3LC2O 1A8HA 5D01A 3TLXA 1VHWA 4US1R 1O8CA 1E79D 3LCJA 2HCJB 1I4TD 1TKRA 3HYRA 5AVJA 3GFSA 4YJ3B 3EK2A 1SKYE 1AKMA 1U7TA 1Z8NA 3MCAA 4K6MA 3F3SA 4MVWA 4PSUA 1KSFX 1XU9A 1KEVA 1ULUA 3MRTA 2HIAA 2V58A 2XCIA 3EVAA 4FKMA 4LQLA 2GJSA 5IM4F 4YJ2A 3WL8A 5J2UA 4OFZA 4ZODA 2FOIA 4WT7A 3R4CA 1OYYA 3GDGA 4QC2A 3SZLA 1QJ4A 2IYTA 2J9XB 4CCYB 1L5WA 1C9NA 3A31A 3ZCSA 4AS1A 5AK4A 4KZKA 3QPUA 1JSRA 1TAQA 3MWJA 2RAFA 3AUJB 1D7AA 3R6TA 3GVXA 4H6XA 4OHXA 1NFRA 5AOAA 2Z1DA 4YO8A 2B6NA 4A73A 1NAHA 4FGSA 4GX2A 2D5LA 4PIPA 2NADA 4YQEA 3ZWCA 3ZIUA 5ALEA 1JR4A 1LSUA 2P6UA 1YQTA 1Y5RA 1M1NA 1FQJA 3LKBA 3RUDA 3LLCA 3JYHA 3R0QA 5F5XA 4A27A 3HKCA 3PUYA 3LYUA 1WCIB 2J0EA 4HUTA 5KTOA 1XZNA 3EAGA 4RIHA 4L8GA 3C7AA 1U6IA 3DUFB 4ZVNA 3EIEA 5HXAA 4Q01A 5ITWA 3QI7A 2HO4A 2G72A 5TPZD 1ARZA 5AW6A 1EA5A 3C4QA 3S29A 5A0TA 1BAPA 1Q5PA 5DXJA 3W5IA 2BFMA 3WISA 4Z2AA 2IYAA 1CQXA 4OH7A 2OK8A 1ZUIA 5M7EA 1SOVA 3H2GA 3UJ8A 1TK9A 2XUJA 3S2ZA 3H87A 1UOPA 3O83A 1SXJE 2ZUFA 1YDEA 2HX1A 1CZHA 4PGMA 4MAFA 5KBYA 1ICIA 4P4UA 3FHCB 4OGLA 3ZJTA 3JQ8A 5A03A 1W1UA 3NOXA 2Y4NA 4DXAA 3TVTA 1SFRA 1PT7A 2A14A 3I2JA 3QHPA 3AYZB 4YK7A 4AWAA 4GZ6A 2QTGA 3HY6A 4D4MA 3HKBA 2I76A 2PPVA 3FVVA 4GPD1 1PR2A 3BF7A 1T9KA 1IAVA 2C5LA 2MMGA 4FDLA 2Q6VA 4X7BA 4OB8A 3TOVA 2DZDA 1WSBA 2JJ8A 3FSGA 3WGZA 4I9FA 2NUPB 3DEZA 4WNAA 2A4MA 4M53A 2WUVA 1FUUA 2VBIA 2C4MA 1OTXA 2ZYSA 3IX7A 4K9NA 4Q9DA 1RYMA 4IQ8A 5EIXA 3FTNA 3NGMA 4PU0A 2NVWA 1LXCA 1COWD 3VHXB 4DDUA 1Q3TA 5L4LA 3K5HA 4J9UE 4FS3A 1OIWA 3OVMA 2KJQA 3EJWA 3HSSA 3TIFA 5BYKA 1U11A 4CG3A 5GINE 2J09A 4DEVA 3IP7A 4F9EA 1TTHA 4LJ6A 1DC8A 2FPXA 4Q7JB 2IYFA 4I4TA 5EE5B 1G6KA 3KPJA 3H1AA 1YU9A 2IPXA 5A05A 1JR3D 1PWEA 2YW2A 1H0HA 5JISA 6ADHA 1BKSB 2ZULA 4TUYA 4YWJA 3HWWA 3I76A 2Q5IA 5EJIA 3TG2A 2H2GA 2ZRJA 4JX9A 4MUYA 3RC9A 4Z49A 2W4QA 2IP1A 1CQIA 2IYNA 2DPLA 2YQ5A 3WWYA 4B81A 1G18A 2YHUA 3IQDB 4QQNA 5A02A 3N59A 2QSZA 4AUKA 4FNAA 1XRSB 1LV8A 1G3QA 3QPDA 5DSTA 4BRSA 4F1JA 4COKA 3L82B 1XQYA 5B57C 2QNRA 3CIOA 3GDWA 3GN2A 2HREA 2L82A 2ONCA 4LJKA 1UFRA 2WFAA 4JHXA 4ONEA 5HE9A 5ALOA 1E9RA 3OTHA 5AW0A 4MUMA 2MSCB 4DLSA 4OI2A 3WI7A 4IILA 4P7JA 1H0SA 4PRKA 3WO1A 3ZI7A 1OWPA 3BULA 3CKYA 4CMAA 1YDFA 2E2WA 5BURA 2IPOA 1NVWQ 2LKCA 4DIUA 2I3ZA 2CBZA 5LUBA 2ZITA 2JLVA 3CLRC 1HF3A 1IVSA 1OR8A 3DDZX 2CXOA 3DBHB 4OKSA 2C7RA 2VYFA 2GRUA 1XDDA 2ATXA 2DPXA 2J3EA 4FYIA 5BN5B 3TZEA 2HK9A 4MV1A 4WCFA 3P5SA 1AK1A 2BFAA 2M6SA 2ZJ7A 4N8DA 3WQSB 5JCOC 1SBNE 5EJ4A 1MB9A 1SB9A 5K0NA 1M34E 3M9XA 1U4NA 1C80A 3VR2A 5E2AA 3N8KA 1GNLA 1YR8A 3PFGA 4WMLA 3SF8A 1KRXA 3H3FA 3BWVA 1USVA 1RYZA 3Q3IA 3CRNA 1V4BA 2YIJA 3G8CA 1CQWA 1ZGJA 3FMGA 1DMSA 3MXOA 2GN9A 4DAOA 3LNCA 5GIPE 1MNAA 5E7MA 5FUQA 2C4KA 5H16A 5DRTA 2G4VA 1K4MA 5DCLA 5HTOA 1QP7A 1BHQ1 2MINB 2X86A 4KQJA 3UT5B 4QT4A 2I6TA 2Y1LA 1QDEA 2A5LA 1FZTA 1J8VA 5IAOA 3H16A 3REOA 2PM8A 2X2OA 4M1OA 1I8TA 3LFHA 4QOFA 4IVNA 5EZSA 5SZHB 3D3JA 4G9BA 3UGKA 3QHAA 4AYTA 1ZCJA 1XTPA 3CO5A 4ICIA 2GO1A 2WWGA 5DGHA 3WWCA 5JWRA 3CLUD 2YWHA 2FN3A 2YZ7A 3GMIA 2CZCA 2C9ZA 4L0QA 5DI9A 1HYEA 3DTVD 2J85A 1IHOA 4AF6A 3DR5A 1QF6A 2IGBA 3QXGA 4XYGA 1OASA 2R1TB 1Y8CA 2OFWA 5CA0A 1DKQA 3EWNA 5MGNA 1KDTA 5ALIA 2GBCA 2QRVA 2X5XA 4B79A 4YMUA 3J81A 4IICA 3HU5A 1XZDA 3U7QB 1B6TA 1OXSC 1XE3A 4ZRMA 5KNCH 2EGUA 1YONA 4DYDA 1E1QD 3TL3A 3DVAB 3MCVA 3S8YA 4GEGA 4LF6B 1KJIA 1UBCA 1JBKA 3VZCA 2PZJA 1QYIA 2C9MA 4DVGA 1PYDA 4HBGA 1XXHE 3P27A 1RLTA 5CAEB 1WXFA 5FPHA 1Y3BE 2FMUA 2UZ0A 4WADA 1F2DA 1G63A 4FONA 2XUHA 4XB1A 3A6FA 1ZC4A 3KJGA 4R2XA 3RIYA 4YRLA 4Y6GB 3R3YA 1XLTC 2HXSA 3DW3X 1I1OA 5T4EA 4C2TA 2IPLA 1Z39A 2QV0A 4UHFA 3X0DA 5DW3A 2WD9A 5BNFA 1BE6A 1LPBB 1Z6YA 5FUYA 3S2YA 1JEYA 2R5WA 3LO5A 1EFTA 1P6QA 2AUMA 2VYQA 2VPXA 4G5RA 4GI3A 1EWTA 4M0LA 1UBRS 1PSWA 2RB4A 5M34A 2SCUA 3NLLA 2R1UA 2PKQP 2YN0A 2B5VA 3WLPA 1YJ5A 2IXEA 1JI0A 2VJOA 5YASA 3DD5A 4XLTA 1XNHA 5DBEX 3RC7A 3G89A 2RGYA 4R1TA 5FNVF 2X9GA 2DHCA 5EG5A 4KNVA 5IVPA 1PVOA 5CGZA 2VHTA 4V39A 5CNKA 5C2JB 2I1WA 5KWIA 4BCDA 1DMRA 1YJCA 1VE5A 4G1UC 2JLYA 3EQ8A 5B64A 3JWEA 4IMRA 1CFZA 4LHZA 4GMKA 2DERA 2QDXA 2ZUWA 2QLBA 3FYSA 4JCOA 3PRJA 3QU4A 3MB5A 3B1JA 3IODA 1DJLA 2CXHA 1JSCA 3EG5A 4JDPA 4Z3DA 1GXSB 1PLLA 1P4SA 1XRMA 1ZJJA 2AQHA 3PC7A 4FUTA 4OQPA 4OU4A 5U4QA 5EJ6A 3CEJA 2QD3A 1RI5A 5CB4B 4JJ4A 1TA4A 1GP2A 3C14C 3L0BA 4UU7A 3HBFA 5ENZA 4YCMA 3QVJA 5HQ3B 2YFQA 5L3SB 1E6UA 3G2LA 4RD6A 1U0BB 3ESXA 5ECYA 2WJ3A 2PT6A 4ARZA 3NHUA 1ZVQA 4GZLA 1Z18A 1UJ4A 4U2BA 1EK1A 3H2YA 1L3BA 3LYAA 4HFMA 4UPDA 5E38A 1VMAA 2O8VA 3RU7A 2QRZA 4AFNA 1ST3A 1ECJA 2WQ7A 5KQGA 5M2QA 2GMWA 1JW9B 3T9DA 1WS6A 2C99A 1BHO1 2XA1A 3DGFC 3OICA 1N2SA 1FRVA 2REQB 2X23A 5IFLA 4CEJA 2EF1A 2KLHA 4Y2QA 1P4JA 2HHJA 3MFYA 4XGIA 1X9GA 4X6LA 1ZVVA 3PGLA 1XHFA 1N3IA 2BEWA 5DULA 4HTFB 5GPBA 4QECA 1YHYA 2IWHA 1BQ3A 3PP8A 5DBGA 3T3EA 4I4IA 1JIIA 1KC3A 1F2UB 1B76A 2D2VA 2V1UA 3T61A 3D4IA 5JADA 3HP7A 1IC6A 3K0FB 3N7UA 5GVSA 4WGGA 4Y98A 2JIOA 3OETA 4LPSA 1QMPA 3RRMA 4CLRA 1HM5A 1Z8DA 4OSEA 3IMFA 4JLBA 1W8DA 1QE3A 2V03A 1ISHA 1RMYA 1WHSA 1UPBA 5KSOA 1XU4A 2Z1MA 4CM1A 4NCIA 2IYQA 3LT5A 4DC0A 2HA7A 4Z9AA 5H68A 5L53A 4TZ6A 1Z47A 2Q41A 1BU5A 3UK0A 3VKGA 3AEQA 3PFWO 2D5AA 4QUDA 3OCWA 1RT9A 2J9RA 1DTSA 1RCTE 2IK8A 3BIWA 3F5SA 1A76A 1ORHA 1PG0A 5KS2A 4XQEA 2NXEA 1FJXA 5KAMA 1UODA 3CEHA 3DLPX 5I4BA 4M9XA 1RBQA 4YGYA 1KMHB 1M1ZA 3EG9B 2JAWA 4EVQA 2D1FA 3E84A 2JFBA 4HWSA 2EOAA 4UM9B 5J59A 4W82A 1SXJA 4JP3A 1CZNA 4BNYA 1V48A 3K6JA 5LZ9A 1E2PA 2FH5B 4M86A