3ADPA

Crystal structure of the rabbit l-gulonate 3-dehydrogenase (nadh form)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
310
structure length
310
Chain Sequence
b'GDVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMKSLQQSGSLKGSLSAEEQLSLISSCTNLAEAVEGVVHIQECVPENLDLKRKIFAQLDSIVDDRVVLSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSPATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGMKRVLKSFGSIPEFSGATVEKVNQAMCKKVPADPEHLAARREWRDECLKRLAKLKRQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lambda-crystallin
publication title Crystal Structure of the Rabbit L-Gulonate 3-Dehydrogenase
rcsb
source organism Oryctolagus cuniculus
molecule tags Oxidoreductase
total genus 122
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.45: L-gulonate 3-dehydrogenase.
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3adpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3adpA01
3RD5A 2J8ZA 2DUWA 5JLAA 3HFGA 1LDYA 1GCOA 1ISIA 4YRDA 1V3VA 4IM7A 4IS3A 3SLKA 3O8QA 1U8FO 2GZ2A 3FN4A 4P4GA 3MWDB 2GGSA 4NZ9A 3DAGA 4AVYA 2AEJA 5IDXA 1P1IA 1JKIA 3BMOA 2YZ7A 4QXMA 2DFDA 5I9NA 1ULSA 2YJZA 5ER9A 2C82A 3VKVA 3WJ7A 4CMBA 5L40A 1Y6JA 1ZBQA 2ZATA 5L4SA 4E21A 4BKPA 3OM9A 5HS4A 1EK6A 1WMAA 1N8KA 4DQUA 1EFLA 4E3ZA 4PCVA 1QLHA 2ZKLA 4Q3NA 1A9ZA 4XYBA 1BXKA 4AFNA 3RWBA 5JY6A 2CMDA 2W4QA 3L0DA 3E6AA 3WGYA 4II2A 3RCBA 2DTXA 4BVAA 2NADA 3QLJA 4OM8A 2BGLA 1P74A 2I3GA 5JPIA 2BI7A 3ABIA 5DN9A 3UUWA 1PJQA 5C7OO 5U1PA 1G1AA 2Z95A 4DYVA 3ZWOA 1T2DA 5LC1A 4A7PA 1ZNQO 2FWMX 4DMMA 5JYEA 1Z45A 2OORA 5KJ1A 1KVTA 3WDSA 5TC4A 3CTMA 2C54A 4D3DA 4WLUA 2D2IA 1BXGA 1GQQA 5HM8A 4OSPA 1LRKA 1WNTA 3D1LA 4D79A 1DIAA 3LF2A 3FRJA 3WNQA 2CZCA 3MOIA 3RUIA 4E30A 1JDJA 1QXSA 5G0WA 3ANLA 2DAPA 9LDTA 3U0BA 1H6DA 3DMYA 1DFHA 1K89A 4L9RA 3G1TA 3BMCB 4M1QA 4BGVA 3QVTA 1XEAA 3RJ5A 2NM0A 4CV1A 2RH8A 4E12A 2QX7A 1P33A 3HDHA 4MP3A 4Z3KA 2GNAA 3JV7A 1QORA 4OKNA 1YS4A 3JQAB 3E1KA 4CLEA 4PVCA 4BQRA 1PSDA 4RQTA 4WPGA 1ISJA 3LK7A 4N5NA 3UGKA 4CLOB 3KTDA 1R12A 3S2IA 1R0KA 1WP4A 3F1KA 2XPCA 4NFHA 3TZQA 1Q0LA 3DBVO 3UN1A 4XR4A 3VH2A 1WVGA 3W8DA 1KEVA 3MJ4A 4HFJA 4JLWA 4AJ1A 3DZJA 4I5FA 5AVOA 1ZW1A 1P1RA 4CMEC 1E3WA 4L76A 4XEHA 5EL0A 4UREA 3ASVA 1IZ9A 2X4GA 2Y1GA 5IN4A 4DLLA 2X5KO 3IOYA 4YQYA 4R5MA 1GV0A 4FCCA 1OC4A 2R2GA 1I3NA 1B8UA 4ZVVA 2IEBA 3K9QO 1P31A 4RZHA 2VRBA 5EQFA 3ZHBA 1BVRA 1H9AA 4IJWA 3W4IA 2WDZA 5A9SB 3MJSA 3ZU2A 2FN7A 3R0IA 4XD2A 4A03A 3AY6A 4U5QA 1NTOA 2HAEA 1O95A 3BZUA 4ND2A 3U09A 4ITUA 1GZ6A 3H5RA 1ZK4A 2VWGA 3O9ZA 3WGOA 4NPCA 4ZD6A 4N54A 5A06A 1DLJA 1PGNA 4YDRA 4Q9NA 1VSUA 2EV9A 2P9GA 1A7KA 4CM4A 1I2BA 3S2FA 2QYTA 4EGFA 4Q3EA 1SAYA 4IIUA 2O4CA 4CPDA 1BXGB 4Y98A 2O3RA 3RUEA 1M2WA 1JN0A 1T1SA 4HX5A 4KZPA 4U0KA 2O3JA 3KSZO 2C5EA 1XA0A 4R1NA 4RV9A 4BO2A 1K6IA 5F1KA 1EVIA 5IDWA 4PRKA 4IQ0A 1WW8A 3L77A 2V6BA 4BO4A 1GV1A 1MG0A 2EW8A 5I9MA 1HYGA 2C7GA 3QSGA 3I23A 4X54A 2FPIA 3WWYA 4WNIA 1DC5A 1FDVA 1I3KA 1R16A 1T26A 4FN4A 1LXCA 2AA3A 1PL8A 3PYMA 4J1QA 3INTA 4NNJA 1IYZA 4S3MA 2QRLA 3JQFA 1ARZA 1GZ3A 2Y0EA 3WIEA 3M2TA 1KVRA 4F45A 3DZKA 3RBZA 5T6BA 2D1YA 1Y81A 2GSDA 1U3VA 4NU5A 1LDBA 1AGNA 4U8GA 2CVOA 3QVOA 2Q1WA 4LK3A 3V5NA 1DLIA 4UUNA 4QFDA 2IE0A 1B14A 4RVGA 5A9TA 4M49A 4P4LA 4ALNA 4L4RA 4PIVA 1HEUA 2YW9A 4IDAA 4BO9A 2YUTA 3RROA 2NTVA 3W8FA 1SB9A 2GPTA 3QIVA 2CVZA 3RVDA 1I32A 3QVWA 4TRRA 3LZ6A 3NJ4A 1YL6A 4CQMD 3BTSA 3BA1A 4UUMA 3K73O 5IZ4A 1GUYA 2VYND 3GDFA 2BHLA 4L73A 3ZU4A 2A94A 1EQUA 4UULA 4OXNA 5LCXA 4XYGA 4OHUA 2P4QA 2ZB8A 3GG9A 3H5AA 5BSHA 2X6TA 4LCEA 1ZJYA 3H5NA 5A04A 5IZCC 1LLQA 1ENZA 4NR0A 5CP8A 4MKZA 2FOIA 2JD0A 3JTMA 3GHHA 2PKRA 4XYMA 4JP2A 4D45A 8LDHA 3M1AA 4FJ2A 4XCVA 4IIVA 4JJIA 4NJMA 1MV8A 2PFGA 1PJLA 3WYEA 1PL7A 3LLVA 2BF7A 2UUPA 5TLSA 1DJQA 1T25A 3JCZA 3PQFA 4R3WA 4TKLA 1GL3A 1PJCA 3S2EA 2OBYA 3ZZNA 4PZCA 2JFFA 3WBFA 2Q2WA 1GPDG 1FDUA 4BB5A 2E49A 3ZDFA 2OBNA 2NVWA 3N58A 1N1EA 3ITKA 4LGVA 2AQHA 2A9FA 4FGWA 1UXIA 3H7AA 4D0RA 4BL5A 1SPXA 1CJCA 2X58A 2Q2QA 3OH8A 4FGSA 3C1TA 3K2EA 1T24A 2VYVA 4XQCA 2Y0CA 3GVXA 1LC0A 3INGA 5J23A 4YWJA 4IDDA 4MP8A 1GPJA 1LBEA 1ZVMA 4HBGA 2IXBA 2I66A 1G0OA 3AFNA 4MKRA 4DQVA 3RASA 3F4BA 4YQZA 4J16A 4XYLA 1QR6A 3MJCA 1YE3A 4IXTA 3PHHA 4YCAA 5DP2A 3B1JA 4AJNA 2Y05A 2J5KA 4IGEA 3VPSA 2BH9A 1VL6A 4E2WA 3NTQA 3WG9A 4R69A 4I9UA 5DZSA 2PH3A 4RPKA 4QUKA 5U9CA 3ZI0A 4Z3DA 1O94A 3GVCA 2D5CA 4GPD1 4NH4A 3RC7A 2X8LA 4GGPA 2V6FA 4OQYA 1JVSA 3OJFA 3GEGA 1LNQA 1SC6A 1YQXA 2EHDA 3ZV4A 4AJJA 5G0UA 1W8DA 4E6PA 4M54A 4FFMA 4N5MA 1XQ6A 4UUPA 4CMEA 1AXGA 3KBOA 5AXBA 5T5QA 3AM3A 2GF2A 1E7SA 4B8ZA 5F21A 1SMKA 2WE7A 1HTBA 4CM6A 4O5OA 4BGUA 1XQ1A 3PLNA 4ZU3A 2J5QA 3OJ0A 5TJHA 1ZSYA 5G0SA 2C59A 1EE2A 2DBRA 4DYDA 4NK4A 4PVDA 2ZCUA 4B7XA 5G4KA 4BNZA 4PLCA 4CMKA 5C37A 4DGSA 2FSVA 3U4DA 1Y8QB 3O03A 1NAIA 2FPGA 4WEOA 3ROPA 4ZJUA 2X0NA 3VAZA 4N7RA 1D8AA 2B83A 2Q45A 2IZZA 2HMWA 3VH3A 4CJXA 5JAMA 3DOJA 3L9XA 4PLYA 1E6UA 1ZEMA 2FZWA 4K26A 2O2YA 3GEMA 3I3OA 1GUFA 3UXYA 5JNLA 3EYWA 3AI2A 1C0LA 1VI2A 2HK7A 3PZRA 3TQHA 1P0FA 4E0BA 4EJ0A 2IRWA 4J0EA 3LVFO 5COQA 1V9LA 4D44A 3Q9NA 3RC9A 4WOJA 2W2KA 2FZEA 3AK4A 4KWIA 4H3VA 2AXQA 5KTKA 3TN7A 3P2OA 4CM8A 1GEEA 1XSEA 1SOVA 1C3VA 1PZGA 2Q1UA 3U4IA 1CETA 1EE9A 1SZJG 2C0CA 1R0LA 3IS3A 1LLDA 2NQ8A 3TWOA 3DXFA 4XRGA 3B6ZA 3TOZA 3PIDA 2PK3A 2VWPA 3VPFA 1DAPA 2YYYA 3GZNB 2HKIA 3D3WB 3KZVA 3LU1A 3SJUA 1ZK3A 4W99A 3GMDA 1NR1A 4IDEA 1ADFA 4NMHA 1WZIA 3C85A 4J2OA 4M89A 2EKPA 1I33A 3ZWAA 2VCYA 2YFHA 4JJFA 3KSDO 4DUPA 1HWYA 4J9VA 5IXYA 4XDYA 1ZXLA 1YL7A 4QSMA 3W4KA 5DCYA 1ZEJA 1OBFO 6LDHA 3RFXA 1RYEA 5DOVA 1QSGA 1U3TA 4Y6PA 4Z9XA 4MVJM 1LI4A 4OH1A 3SX2A 5MGBA 2PD6A 2E37A 1LDEA 3QP9A 2HMVA 1LQTA 2CF6A 2B36A 3VH1A 3OJEA 4JROA 1X1EA 1X1TA 2JL1A 1U3UA 2PZMA 2JJYA 4JXKA 2PKQO 2AHRA 4JJGA 2VHWA 2WTBA 1X13A 1C1XA 3V1TC 2FP4A 2J5RA 4CLHA 3I5MA 1SB8A 2NVUB 1UXHA 4ZQGA 3GGOA 2C7VA 2E82A 2AMFA 3HE3A 1E6WA 1WAMA 5DT9A 3V8BA 3ZV3A 1OI7A 2EJWA 3JQ7B 2XF8A 4AJ4A 1CIVA 1KERA 2O3TA 3PDUA 1HZJA 3HHPA 4E5MA 2QQ5A 3IJPA 1ZZEA 1OFGA 4Z9YA 2PR2A 1TT5A 2EG9A 4JBGA 1PGPA 4IJVA 1EK5A 2YV1A 2HO5A 5T8KA 4FDAA 1E3IA 4ZA2A 1EBFA 1LJ8A 3ZWBA 3PQDA 1BWSA 4IJKA 1S7CA 3WNVA 1CEQA 1HL3A 1ZJZA 2XXJA 3AY7A 4A0SA 3DOOA 4ZQEA 5LDGA 3GGGA 4XA8A 3UICA 4R9RA 1BMDA 1LSOA 3HUDA 5AXDA 4A27A 1IUKA 3E5MA 2BGKA 1KC3A 2EKQA 1A5ZA 2NWQA 4PZDA 4U0JA 4W9NA 4J7UA 4XR9A 1B3RA 1ONOA 3PVZA 1PJ4A 3KYCB 5A3JA 5JDCA 4J0FA 5C3MA 2YHIB 3OF2A 3JQ9A 2EKLA 3CKYA 1LSUA 5C5IA 1GQYA 1H6BA 3U5TA 3H6KA 5JAQA 2O3SA 4KTTE 4XQGA 4IJUA 4PRLA 4BNMA 3WYBA 5EMHA 1EQ2A 2C5AA 4ND1A 1SBYA 4G81A 4BNTA 4YJHB 2Y68A 1C1DA 1D3AA 2AQKA 4Z0PA 4XRRA 1Y8RB 2YFQA 3NGLA 1J6UA 2I5PO 4FS3A 1BTOA 1B7GO 4G5HA 1MB4A 2D3TA 1R66A 2VOEA 2Q4EA 2B4RO 2BRUA 7ADHA 4I9HA 1J5PA 3N74A 1F8FA 4CQMA 2VYNA 1V8BA 1ZSVA 4QO8A 5HBRA 3UAGA 1DRWA 1PWXA 2GASA 3MJEA 5JW6A 3F1LA 1QYVA 1LLUA 1U2GA 2DTEA 3DBHB 3KRTA 3OQ1A 4TVOA 1TEHA 2R00C 4MVJG 5CDTA 3GC6A 2IDZA 4E5PA 4EEZA 2OP1A 3GH3A 4EEXA 3QWBA 1E92A 1VKNA 3GF4A 4YEDA 4KDFA 3KOUA 1Z75A 1ONPA 2Q49A 3RKUA 2GD1O 1GEGA 3JQ8B 2Y67A 4XB2A 3BMQB 5LDHA 2TMDA 3VZPA 1X0XA 3JD4A 5B1YA 2IXAA 2HQ1A 4J6FA 1ZMOA 4KQXA 4GVLA 1ONNA 1W0CA 2V7PA 3I6QA 5JE8A 2OO5A 4ZN6A 3CEAA 4LMPA 3EW7A 5JXWA 1YDWA 3ST7A 5JDIA 3H2ZA 4B4WA 3WGIA 4AJOA 3UCXA 3VZSA 2YDYA 4MKXA 1QG6A 5HTOA 4JCOA 3TFOA 4YJFB 2PGDA 1WMBA 3IJRA 4ZQFA 4DLBA 4DC0A 4LCJA 1Q7GA 4DIFA 1SNYA 2O7SA 4B8WA 1H94A 1D7OA 2PV7A 3SC4A 1WDMA 3H9GA 3D7LA 4YT2A 3WTBA 3WJAA 1QYWA 1F17A 1LRLA 3WLFA 1PQUA 3DAPA 4BNVA 4EBFA 5BR7A 4LVCA 2IYOA 3LC2O 4J3FA 4XIYA 3STHA 3FNGA 1BDMA 2ZJ0A 2EEZA 4O59O 4TWRA 3UOGA 3AUUA 1SCUA 4A26A 1B16A 4YJGB 2VNSA 3NDRA 4OOEA 5JO0A 1BDBA 2WM3A 2DQ4A 4J1TA 4EW6A 1M6HA 1UZMA 4Q39A 1DHRA 2HRBA 1B0AA 1I30A 4FJ0A 2CDBA 3U49A 3WOHA 2O50A 4JNKA 3EZLA 2HUNA 2JAHA 1GYPA 3RUFA 3ORFA 3F5QA 3BMNA 2P91A 2Q4BA 3MJVA 2EIHA 3FNHA 4ND3A 2CVQA 4GGOA 2JD2A 3AM5A 2FSSA 3NDIA 4R16A 2PH5A 4YRBA 3EAGA 4URFA 4BKOA 4CQMB 3OQBA 5CG1A 3FD8A 2EW2A 3MZ0A 4UVIA 5H82A 3GAZA 2DUUA 5I7EA 4Q3AA 3C8MA 5DCWA 2X9NA 4E32A 2EP7A 5FYDA 4E31A 5CEEA 1HE4A 1VJ1A 2W98A 3LSYA 2X86A 2G5CA 1BW9A 1JAYA 4P22A 3AUAA 3DBRA 1IB6A 1UP6A 3IP3A 1PJBA 2B5WA 1DRVA 4FFPA 1GR0A 1R15A 1EMDA 1DIBA 1E6EA 4CMJA 2CDCA 2I9PA 1I3LA 2ZTUA 4HUJA 2PY6A 1KVQA 4HXYA 4B4UA 2UV8A 5DBFA 3AI1A 4ONEA 1TVEA 2P9CA 3KEQA 4UVEA 2Q46A 3E48A 1LUAA 4WLNA 3T4EA 1PJTA 2ZYDA 4KUEA 3CZMA 1K3TA 4Q3CA 3NT5A 3DFUA 5L53A 3PIIA 3GY0A 1XCBA 3AFMA 1DOHA 3GVPA 4EJ6A 4XJSA 1UZNA 4Y67A 4CMCA 2P4HX 3ONEA 2PD3A 4WCFB 3C1OA 4ROSA 1G6KA 3C24A 1MC5A 3A4VA 5BSFA 5CDYA 2EERA 4Y9DA 4DLAA 1R4MA 2RBEA 5C7LO 4OSOA 3QY9A 1NXQA 5F1OA 1P0CA 4XZ3A 3ZW9A 3TZHA 3A1NA 3FR8A 5A5EA 4M55A 4BQPA 2G82A 1T2FA 1R4NB 3IL2A 3TDKA 2I67A 4CMIA 4YAKA 3F4LA 4IZHA 4ZRNA 4BMNA 1E7YA 3L4BC 2FPPA 4OL9A 3EZYA 3HQ4O 1JLLA 1MGOA 2DVMA 3DC2A 5IXSA 2A4KA 2HJSA 1LTHR 3RFVA 4RF4A 3BYZA 3O8QB 3IQDB 2P9EA 3PWSA 4W4TA 3RFTA 3JQGA 2Q1TA 2UDPA 4CL3A 2ZYGA 3DR3A 2ZTMA 3BMOB 1N9GA 4O0LA 1KEWA 1AXEA 3Q2KA 2D5AA 1DO8A 1O8CA 1PS0A 5H81A 3GT0A 2PZJA 2YV3A 3VKUA 1DIHA 5THKA 2ZB4A 1HE3A 5BNIA 4CM7A 1YJQA 4L75A 3ZNQA 4DMLA 1BW9B 1Q0HA 1CRWG 3SXPA 4BO8A 2VUUA 1E5LA 4NIMA 5DCUA 2EJVA 3O26A 1U7HA 2BI8A 1YXMA 3NT4A 1HDZA 3GN1A 1RJWA 4Y6SA 1Z7EA 4NFYA 1QLJA 6ADHA 1QYCA 2UAGA 2EGGA 4PG6A 5JY1A 4R1UA 4BKRA 1OZAA 4BO6A 1LSJA 3UH1A 2ZK7A 3GNSA 4FW8A 4B7CA 2A92A 3AUSA 1XKQA 4BNKA 2DT5A 3VDQA 4E13A 1KEPA 4MIEA 4R3NA 4DBVO 1JWAB 2EF1A 4LVUA 2DTDA 3GDGA 2Q2VA 4DWVA 4RPLA 3PK0A 4U6SA 3DTTA 5FWNA 4J4TA 3NT2A 5JCJD 3DFZA 3VPHA 4E2ZA 2RIRA 2Q1SA 4CLDA 4F3YA 1NBOA 1QP8A 4INAA 3GR6A 4OQZA 2GERA 1XYGA 2O3QA 4BNXA 2HMSA 1KYQA 4GX2A 2QZ9A 2HMUA 1NWCA 1RYDA 3GFBA 1MUUA 2W90A 4IDFA 4C7KA 1YBVA 3AOEA 3JD2A 4J49A 1TI7A 2HU2A 4WE3A 1EVJA 1ORRA 4AJKA 3MTJA 2YHUA 3KHUA 5KJCA 5A05A 3D4PA 3GPDG 3RI3A 1YB5A 1U28A 4WGGA 4HV4A 4KQWA 3GMSA 4YTEA 2VOJA 3H4VA 4BMVA 1JKFA 3EK2A 5T57A 3F5SA 4QFCA 2WD7A 4MVJA 1KY4A 4RF2A 3FWZA 1PJ3A 2OP0A 4YACA 3PP8A 3WQQA 2JCVA 5HS6A 2NTJA 3TL2A 4ZICA 3RU7A 1NVGA 3UVEA 5KJFA 4J7CA 4AG3A 1YBAA 1E7WA 1EUZA 1X7DA 1W6UA 3K96A 1D1TA 3G49A 4ID9A 1HE5A 1X14A 4J1SA 1E3WB 3JQ6A 1YDEA 4TRNA 4GLLA 2QRKA 2Y66A 1GD1O 4BOYA 4H7PA 4NDNE 2BFAA 3WSVA 2ET6A 3WFJA 3MJTA 3QJ5A 4W82A 4YAJA 4JX8A 1H0KA 4FJ1A 5DDIP 3I4CA 3V1UA 2BFPA 2CNBA 4IMPA 1DIRA 3JD1A 4Z0TA 4XKJA 4JN6B 1XR3A 4FFRA 1Y1PA 1E3SA 5KNLA 3R3JA 1T4BA 4JK3A 4NJOA 5HA5A 3ROMA 1T1RA 4N5LA 3RUHA 3DHNA 5ILGA 2OL4A 3G0OA 2A35A 4PLFA 2DKNA 3RU9A 3BTOA 3AU9A 2PTGA 1EVZA 4BB6A 4CM4B 4CODB 1VSVA 2PNFA 3BHJA 3BTUA 1GU7A 1JTVA 2B69A 4XB1A 3I9MA 4MIYA 4PLHA 2XXBA 3FTNA 1YONA 1FF9A 5K6AC 3VH4A 1P1HA 5B4UA 3EUWA 4CV3A 3GLQA 2WMDA 4I8XA 4UEOA 4CM1A 1N5DA 3F3SA 4RORA 5TT1A 2O7QA 4FPXA 2AE1A 2GLXA 1P44A 1XHLA 1Y9AA 2Y93A 3CTVA 4L74A 4JBIA 3FI9A 3HG7A 4BNUA 3GGPA 3QVSA 1HLDA 2EWMA 4RPJA 4GWGA 3ZWMA 2EXXA 1CERA 1ML3A 3K5PA 1PR3A 1Q0QA 2Y1DA 1LU9A 4GX5A 4WLEA 2D8AA 2VT3A 2X9VA 1E3JA 4MPDA 4TZTA 1NR7A 3ASUA 3ONFA 3ANNA 1P1KA 1ZH8A 2GRAA 4H16A 4D3SA 1VC2A 3QWIA 3T7CA 4MIOA 1M6WA 1PGQA 4PZEA 1HXHA 3PYXA 5TQVA 2WYWA 3E9QA 2VZ0A 5F1PA 3DZBA 5KKAA 3T7EA 4B4VA 4PLGA 2NQTA 1JU9A 3VVBA 4OJNA 1RM5A 1RM4A 3FWNA 1PEDA 1Y5MA 5KWEA 1KVUA 1XLTA 1Q7CA 4FBGA 4GSLA 2AW5A 5GZ3A 2ZB3A 4E5YA 2XOXA 4KOAA 2H63A 3I9JA 1U5CA 2HSDA 3A9WA 5ICSA 3WICA 4EUFA 1VL8A 2QIOA 5EN4A 1N7HA 1BVUA 2SCUA 3MTGA 3PHGA 3JQAD 4UVGA 1GUZA 1H2BA 4R51A 5IDQA 1E0DA 2W2LD 1V35A 4XGNA 3NRCA 2J3KA 4NJMB 3Q0EA 3DWFA 4YAIA 5JAZA 1F06A 2GN8A 3TOXA 3QA9A 1A4IA 2I76A 4R1TA 3WQSB 3SVTA 1PL6A 3D4OA 4J9UE 3IC5A 1V3TA 1D4FA 2JHGA 5FI5A 4KUGA 4CLRA 2X0JA 2POQX 5A1TA 1VM6A 5L7TA 1HSZA 4PG8A 4R9SA 4B3JA 4DL9A 2VZ8A 1IE3A 1Z82A 2WYUA 4ZQHA 3DMTC 4A5OA 4R41A 4J2HA 4IINA 2JCXA 3KUXA 3VVCA 1H5QA 2CUKA 3ROQA 4BO0A 1MXFA 5CAEA 2NSDA 4OXYA 3P19A 1HSOA 3QWHA 3H9JA 1NFFA 3KO8A 3JQBC 1PGOA 3WLEA 1MLDA 3PYLA 3EVTA 4BNIA 3GOHA 5BSEA 1LDMA 1EEHA 2PZKA 1R37A 5A9RA 5G0VA 1GYRA 4XQ9A 3S2GA 1WWKA 4BO3A 5ENDA 3LLSA 4LRSB 1EVYA 1P77A 1QRRA 9LDBA 1E3LA 2JFGA 1QV6A 4B3HA 2G17A 1JAXA 1CWUA 2D59A 3HB4X 3FHLA 2CSUA 3VDRA 3GVHA 3ICCA 2I99A 1K2WA 4E2YA 5AOVA 3EC7A 5L51A 1J0XO 1SEVA 3SLGA 4AJLA 2VZ9A 5GZ6A 2O3UA 4MJLA 2HK9A 4WCFC 1R6DA 1U2DA 4NK5A 5CPFA 4MVJP 1TB4A 4FFLA 1DBVO 3FF4A 2VRCD 3HNPA 3GPIA 4PG4A 4IPTA 3DEYX 5DBIA 4I5DA 4P38A 4PG5A 3R1IA 5I8ZA 2X0RA 1KIFA 1NAHA 1YBMA 4QEDA 1M76A 1CQJA 2I6TA 2AQ8A 4QX6A 4W7IA 3ZHXA 3OP4A 4W6ZA 4B7UA 3ANMA 2IZ0A 4HFNA 4LISA 1B2LA 1S6YA 2UUOA 1EZ4A 2GR9A 1EBUA 1LLCA 5CEJA 4ALJA 2HK8A 3RC1A 4RO0A 4OGWA 3NTOA 1T2AA 1DC6A 4O6VA 1AUPA 3CMCO 1J49A 5G4KB 4K1LA 4D41A 1M75A 3Q3CA 1P9LA 2NLOA 4NBWA 3S8MA 3UFXA 3JD0A 3UCFA 5IZCA 1ENPA 3TRIA 1UDAA 3BIOA 3DZGA 3IUSA 4IDBA 1BGVA 1E7MA 4Q3BA 1UXJA 3PLRA 7MDHA 3OBBA 1PJ2A 2J6IA 4WK6A 3UHAA 5KVSA 4K9DA 1JWBB 5FF9A 4I5GA 5AQ1A 3LF1A 2P5YA 5L4LA 4YA6A 4YVFA 5JCJA 3WBBA 4O1MA 4RQUA 3ZW8A 4IS2A 3PDJA 1I5RA 5IN5A 1FK8A 1PZHA 2BGMA 4DPMA 2WYVA 5JC8A 4FD3A 1F14A 2LDXA 3G79A 4YXFA 2W2KB 1C14A 3FBGA 1P1FA 3TFQA 1MX3A 3D5TA 4PLVA 3WGTA 3OSUA 1Y5RA 1X15A 3NAQA 3TSCA 1E7RA 2VHYA 3EVNA 4CM8B 4R01A 1JW9B 3RBVA 1HZZA 3PJGA 3H3JA 3LC1O 4PG7A 1V3UA 4KDEA 3DONA 4MINA 1TXGA 4LW8A 1C0KA 3WR5A 2PWZA 4HNGA 4RPGA 2ZB7A 4F6LA 1UXGA 3WWZA 5F5NA 4TKMA 2H9IA 1VKOA 3R6DA 3VC7A 3ZV5A 1W73A 2WSBA 3HZZA 1VJTA 4E2XA 3ETGA 1UH5A 1NVMB 2Q99A 3B1KA 3RC2A 4MP6A 3W8EA 1XWFA 2P5UA 2O4UX 3U4CA 5L9AA 1UP4A 5B37A 3WMXA 2VUTA 2BELA 2VNAA 4RF3A 4QT0A 4HKTA 5ITVA 2X9GA 5TS3A 1I36A 4TZKA 3E9MA 3C1AA 4H15A 4XIJA 3DBLA 3WX0A 1ADCA 3PTZA 3B70A 5L95A 3UCEA 5FEUA 3I9NA 4J4BA 4F6CA 5CDUA 2GZ1A 3WYCA 4CUZA 2G76A 3KYDA 5B4TA 1XIVA 3MWEB 1C1XB 3NEPX 3GHYA 2GO1A 4FC6A 4M86A 5TSDA 3QHAA 3RAJA 3V2UA 5G0TA 3BHMA 4BNNA 1H6AA 2CD9A 1ZFNA 1HKUA 2G1UA 3TNLA 3HDYA 1ZMTA 4CMHA 1GFSA 1VJ0A 1K6XA 3RUDA 4ALMA 4EI2A 1HE2A 1BXZA 1DIGA 2BD0A 1R0SA 5A03A 5JMWA 4M87A 4XJTA 3JYQA 4LSWA 4UEJA 1O89A 1DAOA 1TT5B 3LT4A 3ON5A 1JVBA 3PXXA 2ZYAA 3FPCA 2VUSA 2CY0A 3VHRA 1DSSG 3ZWPA 2FHSA 3G1UA 1NQ5A 3F9IA 1TLTA 1K0UA 1GADO 3KLPX 3OECA 3OA0A 4DBZA 3AW9A 1ISMA 3Q6IA 4KTVE 3E8XA 4G65A 2CFCA 4R4JA 5DNAA 3GRKA 5I9LA 2X7HA 1L7DA 3HWRA 3HDQA 1GAEO 3BHIA 3WGZA 1W4ZA 5EQDA 2QG4A 3H65A 5KVVA 5KCZA 3QQPA 1H2HA 2ZTVA 1FDTA 4MOWA 3GZ4A 1LX6A 1P1JA 1LQUA 3BTVA 4G2NA 4BNYA 1DPGA 4Z9FA 5JMPA 3S55A 4NHEA 3PGJA 5H83A 1E1NA 3I9OA 1WDKA 3C7DB 5IAAA 4HY3A 2W8ZA 3PHJA 4YB8A 2B4QA 3D0OA 2HRZA 2B37A 3JYLA 5TJ9A 4DRYA 5L45A 2B35A 3CZRA 3WXBA 4BS9A 5EPOA 1NVTA 3JQEA 3PFFA 2D0IA 4XGKA 4NG5A 3PFWO 4NBRA 2TMGA 1PJSA 3V2HA 4A2CA 4I9NA 1HF3A 1XGKA 3JQFC 1C1DB 3FR7A 2VHZA 1YRLA 1ADBA 4HWKA 3LQFA 4RVSA 3U9LA 3ZU5A 2E4AA 2NUAA 3GG2A 3WB9A 3W1VA 1C0IA 1Z6ZA 4NBUA 1NHWA 3L07A 4FOSA 3TZ6A 3OICA 5TGDA 5L3ZA 3WMWA 4CMAA 3AUTA 4BNGA 4WOKA 1N1GA 3L9WA 3OEYA 3P5SA 3I83A 4K6FA 3BMCA 1RM3A 1E77A 4I1IA 5DP1A 5A4DA 4FQ8A 1AHHA 2AE2A 4I5EA 4GI2A 2WEKA 3M6IA 4BV8A 1U8XX 2Q50A 4GL4A 3TZKA 5KIAA 3D4NA 1X7GA 3IP1A 2QHXA 3CUKA 4TRMA 3JQAA 3E5RA 2GUGA 4BNFA 4ZHSA 4BGEA 2HDHA 5G2OA 1ZK1A 1RWBA 2W2LA 1NYTA 3QWFA 4DREA 3SBOA 5KVCA 5DULA 5EINA 4R54A 4PN3A 4CLOA 4FFNA 5F3RA 4CR8A 4D42A 3W6UA 3PQEA 1F12A 5MDHA 3QE3A 4GBJA 3HN2A 3DL2A 2I3AA 3DZIA 4Y8VA 1MG5A 3WQRA 1GYQA 3ITDA 4Q3DA 4M8SA 4YAGA 4LN1A 1LA2A 4BUCA 1QYXA 1HDGO 5AXAA 2X1HA 2ZQZA 3GFGA 4GMGA 3ZN2A 5JCXA 5ICMA 3ZHYA 5IDYA 1P45A 4YT8A 3L6DA 1TA4A 1Y7TA 3DDNA 4DIBA 5FFFA 5A9SA 3OMLA 5DF1A 3CIFA 4K6CA 1XU9A 1NPTO 4EITA 5DOZA 1IULA 4W7HA 5K9ZA 2X0IA 3SEFA 3FTPA 5JFOA 3I9LA 4YPOA 3D64A 1PZFA 1UDBA 1WDLA 2E48A 3WS7A 3PI7A 4CUKA 1X7HA 1FMCA 5KJ6A 3BMNB 4IUYA 5TT0A 1SO8A 3EHEA 1V6AA 5EJ2A 1KS9A 1C0PA 2VRCA 4TROA 4DPKA 3CINA 1QKIA 1J4AA 1NM5A 3GEDA 2AEFA 1QV7A 4AJEA 1BG6A 1KVSA 1MXHA 3P7MA 1L1FA 1N2SA 3IMFA 3OIDA 3IUPA 2CF5A 3HDJA 4IQ8A 2WD8A 3OA2A 4AJHA 4UUOA 1ADGA 3AI3A 1N7GA 4E4YA 2WE8A 2UYYA 1HETA 4BHTA 2JAPA 1OC2A 1YB4A 2Y99A 4KMSA 5DBGA 3ZWCA 1DC3A 4GX0A 5T67A 3AJRA 1B8VA 4TQGA 1MFZA 4ALKA 1WLYA 3DBRB 4FIZA 4IDCA 4DQXA 3JSAA 1WZEA 2NU6A 3H9UA 4LMRA 5EERA 3IKVA 3FNEA 2NVBA 3NUGA 4FOOA 4IQGA 4JP3A 2EP5A 1PR9A 3RUCA 1ZCJA 4PGFA 2X5JO 1AE1A 2R00A 2RHRA 3V2GA 1PTJA 3O38A 4L8VA 4BO7A 2B4TO 2HJRA 5TF4A 1GZ4A 1SOWA 1NQOA 1PQPA 2QRJA 3F6YA 4P4NA 5JC1A 4R68A 3DOCA 4DTIA 5JBIA 4ND5A 1U9JA 4J91A 1LRJA 2FMUA 2IODA 4AJ2A 5THQA 1B3BA 3ZNNA 5GMOA 1I24A 3GA0A 3OEWA 2P68A 4II3A 4DPLA 3NJ8A 4RDHA 1CYDA 1FDWA 2OOSA 3I52A 2OUIA 3X2EA 2VHVA 1O6ZA 4O63O 1H93A 4WNCA 1R4MB 3I9KA 1IZ0A 2YQ5A 3PJEA 3F46A 3GVIA 1PU2A 3GN2A 1L7EA 3A28A 4WUVA 3PEFA 4BNJA 4GKVA 4QTZA 3PHIA 1E1LA 1EDZA 4IMRA 2Z1NA 4CMIB 1Z74A 3KSUA 2YY7A 2JCYA 3HJAA 3JYNA 4GH5A 4WJZA 5T64A 1YB1A 3E03A 4GLOA 5CPBA 2RAFA 4RGBA 3TL3A 1IHYA 4QO7A 3U3XA 1NP3A 3EDMA 1DHTA 4J4HA 1I01A 3W4JA 3GNQA 4E33A 5ILOA 3CXRA 5IJZA 5L7WA 2NACA 2BFMA 2DBZA 3AM4A 4QECA 3OETA 3VPXA 3JQGB 3E9NA 4K28A 2C2YA 1UUFA 2Y1CA 3RJ9A 3I1JA 3S1LA 2NU7A 3KXDA 1ISFA 2ZTLA 5IFLA 1N9GB 3RKRA 3Q9UA 2OXIA 4HFRA 4FSHA 5EESA 5TNXA 1OOEA 5ADHA 1U5AA 5AXCA 5IG2A 2O23A 4PLPA 1Y9EA 4E5KA 5F5LA 1DDOA 3LC7O 4NU6A 4EZBA 1NASA 1HDRA 3IDSA 4GQAA 2OFPA 1T4DA 3UW3A 2IYPA 3ADPA 4XX0A 2B5VA 4WLFA 3AWDA 3VZRA 3K31A 2JKVA 4XYEA 2Y1EA 5JS6A 3JYPA 3ROKA 3KEOA 3DAFA 2VHXA 5BQFA 1I8TA 2UVDA 3GK3A 3JQDA 2Z1MA 5EIOA 4CV0A 3M1LA 3X2FA 4IY1A 1PWZA 1NPDA 3DTYA 1IL0A 4DVJA 2QZZA 3ZWVA 4GAEA 3H9EO 1NFQA 3ULKA 1PQWA 3ZWYA 1IHXA 1X0VA 3GAFA 2C29D 5ES3A 8ADHA 1O0SA 4D3FA 1TT7A 1U4SA 1UP7A 3I4FA 3PWKA 4CV2A 4CL8A 1ZO8A 5JYDA 1YGYA 1IPEA 3UF0A 1UZLA 5I8WA 3OQ6A 4PFJA 1VL0A 4CM9D 4OOFA 2PA3A 3ONDA 5GY7A 3QW2A 4B4OA 1F0YA 4RVDA 4PLTA 5I7SA 3GUYA 4NI5A 2VWQA 5CFZA 1DFIA 3PZBA 2EGHA 3HB5X 2FR0A 1RPNA 4HNHA 4L0QA 4CR7A 3PJDA 3HSKA 1UXKA 2GZ3A 3F47A 3ADOA 2F1KA 4JQCA 5KJEA 3DO5A 4BGIA 2AG8A 4YAEA 1DC4A 5T8KC 4RL6A 5HRUA 1Q2XA 5TRTA 1U4OA 3C3XA 1Y8QA 3K8ZA 1NX6A 3AU8A 2J3IA 1YJ8A 4WLOA 1YL5A 4GSKA 4R5HA 2FY8A 1BHSA 2HMTA 4TVBA 4U6QA 1CF2O 1P3DA 2WD7B 2BLLA 4WLVA 1NQTA 3VPGA 4BNLA 1EDOA 1NHGA 4DA9A 3H2SA 1ZXBA 4D0SA 3UKOA 4ALLA 3CH6A 2CDAA 2IZ1A 4DIOA 2OMEA 3KYBA 5TIIA 1JQBA 1YH3A 1PGJA 3DQPA 1U7TA 4W9NC 1V0JA 2HCTA 3L4BA 4HFMA 3E82A 4MDHA 5JDCC 3NX4A 3ZWWA 5HWSA 2NU8A 3JQ9C 1E1KA 2WWRA 4XGIA 1I2CA 5IF3A 1PS8A 3SJ7A 4QQRA 4FR5A 2AQIA 3GNTA 3EY4A 3PJFA 4NBTA 5I7VA 3FPLA 3K92A 1DXYA 1I2ZA 3ZWXA 2DBVO 3ETEA 4RJTA 1HT0A 4WECA 1T2EA 4C4OA 3MOGA 2B0JA 4CMGA 3RSHA 3FSRA 4J90A 4OAQA 4YJDA 3OIGA 1WXDA 1D1SA 2V6GA 4NFSA 2JHFA 3L6EA 3NV9A 3GZNA 4BV9A 3D3WA 4J43A 4EUHA 5CDSA 1ZK0A 2Y1FA 3DZFA 2RHCA 3JYOA 3CSDA 1WPQA 2FR1A 2GYYA 4YT4A 3FNFA 1ZKMA 4D43A 4KWHA 1DRUA 1F8GA 3A06A 3B1FA 4I08A 1H9BA 3ZHZA 4ESOA 5KKCA 3TZCA 3KV3O 2AEMA 2OHXA 3OJOA 1OMOA 2VQ3A 2J3JA 4TSKA 2OGUA 2NTNA 4YRAA 1M66A 1B15A 1VE9A 5K0ZA 1FXSA 3PHLA 5JO9A 1CDOA 2DBQA 1K6JA 5BNTA 4BO5A 4YBZA 3C7AA 4AJPA 1RM0A 1Q1NA 1M67A 1KC1A 4MO2A 1PIWA 4E5NA 4N18A 4JBHA 4CLXA 2DPGA 2NV6A 4MVJI 4WASA 3NTRA 5CDGA 2PKQP 3R3SA 1FJHA 4KUHA 4MVJH 1KETA 2GN4A 2NVUA 2Y0DA 2Z5LA 3KB6A 4JIGA 1PS9A 1HYEA 4MVJF 5JDIC 1I3MA 3G17A 1U1IA 1LC3A 1EFKA 3JQ7A 1KOLA 4CUJA 1YO6A 3RQSA 2PD4A 2VN8A 4A73A 5BNFA 3Q1LA 3GQVA 2DC1A 4WKGA 1B26A 4B3IA 3CMMA 4F46A 2FRDA 3RBXA 3E18A 4MVJE 4D46A 4RVHA 5KVQA 2VTDA 3COSA 2BMAA 3BAZA 1E7QA 3WFIA 3K2BA 1SEPA 1N92A 1T2CA 3LT1A 2DU8A 3P2YA 4IZIA 3ENNA 5G4LA 1UDCA 3QVXA 1GY8A 2PLAA 1E1MA 1ZUD1 4AICA 2QYSA 1JKJA 4PLZA 1DB3A 1HDOA 2P2SA 1BRMA 2V65A 4P8RA 4D7AA 1GTMA 2NNLD 4BO1A 1UAYA 3PPIA 1ULUA 3GRPA 4EUEA 3RUAA 3ZWNA 3JD3A 1UR5A 3IIEA 2I65A 4IXWA 3VTZA 2R6JA 4B79A 3L6OO 1HRDA 1A7AA 1LSSA 3HN7A 1YKFA 3KYCA 3MEQA 2YHIA 3B20A 1JA9A 5COAA 3I6IA 1NPYA 1PX0A 4UVHA 4CM3A 4A10A 5BSGA 1A9YA 3NGXA 2O48X 3INRA 3K6JA 4XDZA 4FC7A 4OIMA 3A14A 3PWZA 1ENYA 2C2XA 4UAGA 4J7XA 1NWHA 2G0TA 4EJMA 4CQLA 2JD1A 1O5IA 1IY8A 2ILTA 4YJHA 2H5LA 1DFGA 5L7YA 2PGLA 4AL4A 4CLRB 3KM0A 4BMSA 1MC4A 4TRJA 1LDGA 1Y8RA 2E6UX 2Q3EA 2X5OA 3JQCA 5JAIA 1EUDA 1Q7BA 4L4SA 1HDYA 4OYRA 4EDFA 2XAAA 2Y1OA 1GDHA 2F00A 5BT9A 2YV2A 2ZCVA 3QWAA 4U7WA 3DHEA 1ISHA 1Z7BA 4GMFA 1YVEI 1E5QA 3DBHA 4GVXA 4EYEA 4OMUA 1MA0A 3ENKA 1UJMA 3DB2A 2QW8A 2PZLA 3ZH2A 1ENOA 1XDWA 5ENVA 1YOVA 4RLHA 3PGXA 1K5HA 1UAGA 1O9BA 4FFOA 4ZRMA 5CEFA 4R1SA 1VRWA 4DC1A 5K6AA 3JQ8A 4J1NA 4OKIA 3BMQA 1GQ2A 4IBOA 2ZJ1A 3LYLA 1Z73A 1MP0A 5I7FA 3KETA 3CPSA 3MCVA 5U4QA 1A27A 3AY3A 3H8VA 3AOGA 3ETDA 3LT2A 3BXXA 3ZCXA 4YYZA 4RPHA 5AYVA 1QMGA 4RCVA 3TJRA 4HADA 4RZIA 1FDSA 2YDXA 3SC6A 5A5FA 1QYDA 5ER6A 4ND4A 4BKUA 4YJFA 1NQAO 4JGBA 4LRTB 2AG5A 2RH4A 3NYWA 4Z6KA 3L4SO 4UVDA 1G0NA 3EGOA 5A02A 1DEHA 3IAHA 1B8PA 2DPHA 3NKLA 4L4XA 2ZQYA 1HDCA 2VTEA 1ID1A 4XWYA 5TX7A 2PGJA 3ZGYA 2DLDA 1HDXA 5CG2A 1MFPA 5B4VA 4RDIA 1A4UA 1XELA 3QRWA 4BNHA 2DM6A 3M2PA 1ZSNA 3OIFA 4MVJD 3PRJA 3H9QA 4YJGA 4ILKA 3T4XA 1ZK2A 1XU7A 3V1YA 4CR6A 4NQZA 3ZNPA 4BKQA 3VOSA 1HYHA 3H3FA 4RVUA 1E3EA 4OO3A 4CQLB 4C7JA 1XG5A 4YR9A 1A71A 2DFVA 4S1VA 1LDNA 3NDJA 4ZGWA 1AN9A 4ZQBA 4BNWA 4DXHA 3O4RA 4GX1A 4IGFA 4ALIA 1U3WA 2C07A 3D3EA 5KOIA 5FI3A 4AJIA 3ZNOA 1VPDA 3G3EA 2VWHA 4TMFA 1DJNA 3OFSA 1H6CA 3U62A 3D5QA 2VT2A 3Q2IA 1AHIA 4OXKA 5A3VA 1KEUA 3WGGA 1GCUA 4PLWA 2HLPA 4CM5A 1CQIA 2JFHA 1YOVB 4RLSA 4CM9A 5ITWA 3C7CB 3DZHA 3ICPA 3LDHA 4GWKA 4KP7A 2GN6A 1OAAA 3DMTA 1KY5A 5L4NA 1VLLA 4NBVA 4WCDA 4BIIA 2X22A 2V6MA 3EMKA 1LEHA 4RF5A 3VZQA 2H6EA 1A72A 4GKBA 2IEDA 3Q11A 4LSMA 3JQBA 3RIHA 2H1SA 3DHYA 3FCOA 3WSWA 5CHEA 3U4HA 2GN9A 4IDGA 2YQ4A 5JSFA 3OJLA 3HADA 2BKAA 1NFRA 1KBZA 1RKXA 1EUCA 2X23A 3QV1A 1ISGA 1NNUA 2NU9A 3VTFA 5B12A 1IPFA 1I10A 1PZEA 4UEKA 2O2SA 3AOEC 3ZV6A 4Y6RA 4RVFA 1YQDA 1YQGA 2WJPA 2FR8A 1HLPA 2J3HA 3GUCA 2GCGA 3WTCA 2VYVD 3WGHA 5COBA 2BFOA 1ZIDA 4WCFA 1YWGO 4HP8A 3ZU3A 2ZIZA 3DBLB 3KLMX 3N7UA 1IOLA 3OHSX 4FB5A 5GZ1A 2C20A 3HFSA 3TF5A 4WEQA 4YT5A 3TPCA 2RCYA 3LT0A 3KYDB 2D4AA 4XQEA 3WIDA 2GDZA 3FBTA 3CE6A 1R4NA 3IKTA 2LDBA 3WGQA 1BSVA 3W6ZA 3K30A 3KVOA 5C7IO 3GDOA 2OZPA 4Z0HO 1I0ZA
chains in the Genus database with same CATH superfamily
5A0TA 2DUWA 3K9NA 4QYXA 3WAKA 3LG2A 1JG2A 1ISIA 3MJDA 2D06A 1OAOC 2YVUA 2C2MA 3LVRE 3SLKA 4N4AA 1U8FO 4P4GA 5KHAA 2JIDA 3SYMA 5EZQA 3TINA 3EZFA 4FR2A 3U9SA 1RC8A 2O52A 1WE2A 2JHPA 3DAGA 2MINA 3QLVC 2BV3A 3QF7A 4PZLA 1P1IA 1DJPA 1JKIA 1X9GA 4WVFA 1Z2PX 3WXMA 3OQJA 3CZ9A 3T0IA 3UJDA 3RSZA 3WJ7A 4DDWA 1ESDA 3ROEA 1E2PA 4EGAA 1ZBQA 2FCAA 2ZRBA 3L7OA 3OMXA 5JD6A 2AMVA 3ESXA 4OU4A 3DQZA 5T3YA 5FBVB 5L4SA 3OPVA 3T7KA 1OGIA 5F77A 5K8IA 2WP0A 1VPLA 1EK6A 1NP7A 1PR6A 2IUFA 3MBKA 3CZAA 1K5DA 3HBNA 4MWCA 1N8KA 2FLVA 4P7FA 4DQUA 1WIWA 3HCAA 4JDPA 4PCVA 1QLHA 2ZKLA 3K09A 5B6JA 4AXBA 3ITNA 4MICA 2O8VA 3RWBA 3RRYA 2A5JA 1YVDA 2CMDA 3FE2A 3JWJA 1FQWA 1SD1A 2DTXA 2WLTA 1UEIA 2NADA 1GG2A 2EEPA 3QLJA 2I3GA 1ZLXA 1P2DA 2WU8A 2G9RA 2YHBA 2PUTA 3ABIA 3TXAA 3WHKA 2I4LA 3W79A 3R7WA 2EFJA 1X70A 4DYVA 4RJIA 1Z5NA 2C84A 2IVZA 1EHIA 4BCBA 1Z45A 4X1IA 1YR3A 1KVTA 4E09A 3WDSA 5LMNB 4ENQA 4YRNA 1T9GR 3I3SR 1YDHA 3KWFA 3OJXA 4HDMB 5HF5A 4WLUA 2W6IA 2YNMA 3KQUA 2OQ2A 1GQQA 5MN4A 4O1IA 5DYIA 1SXPA 1M0EA 3DR5A 1WNTA 3FRJA 3EQ7A 3O73A 3WNQA 5ABPA 2E7ZA 2VDUE 3CUUA 4FEYA 2GXUA 3RODA 2W11A 3VX3A 4E30A 3RRZA 3OD5A 3UT5B 1JDJA 4G5FA 1QXSA 3S4YA 4Z49A 4JB3A 4UZSA 1ATIA 2DAPA 4GQIA 4PGAA 1I13A 4QDXA 4UTRA 3L4KA 2XXAB 2W6JA 2ROQA 3B6EA 1DFHA 1K89A 1N5JA 1XPJA 2H2FA 2HL6A 3AEZA 3UB2A 4LXUA 5KC8A 4A23A 2YIVX 3MCTA 3MMZA 3AXSA 5HFAA 1L4YA 2OPBA 3RS7A 2OAEA 1E2DA 4OTZA 4E12A 2R1ZA 5CLGA 1Z34A 1P33A 4KQMA 4X93A 1NW7A 3ZDCA 1WX1A 1HA3A 2IIVA 2X2OA 4CLEA 1RWWA 3NCHA 1KH2A 1ORVA 4BQRA 4I4LA 4YLEA 4LG1A 5B7NA 1WUJS 1KMNA 4RQTA 1ISJA 1RYHA 3FJOA 2I80A 3MWFA 4HLDA 3WRWA 1R9MA 1TU0A 2QX4A 3H04A 3BJRA 3ME5A 4HNRA 1XJ0A 3VKHA 2VSFA 3SHVA 4JVMA 4QGSA 2ES4A 1BWQA 1CHDA 2G5GX 3DMFA 4YCMA 4GUDA 3TZQA 2AKEA 2ESRA 1Q0LA 1Z29A 1ZVKA 3DBVO 4XR4A 4YQEA 3VH2A 2WHXA 3W8DA 1TMGE 2CGEA 1G19A 3A25A 1X1DA 1N0VC 2GEDA 3DZDA 4KXFB 2FWAA 1ZW1A 5F4ZA 1L5YA 2P2GA 4F4UA 1LBIA 4GSYA 1ODKA 1P9OA 2PS1A 5BN3B 1A1SA 2O0KA 5EL0A 2V7EA 5FUYA 3WWEA 2X4GA 2Y1GA 2P0AA 2Q21A 3D4BA 1HEYA 5IN4A 3TG8A 4Z1OA 2WHYA 4R5MA 1VKHA 1TAHA 1MABA 1KAMA 1Z38A 4GW3A 4WA7A 2ALJA 3NETA 1NF9A 3IUMA 4KPUB 1EGAA 2VRBA 4JUFA 1BGWA 3EEIA 5EQFA 5GWXA 3R5JA 5DLDA 1Z9BA 4WJLA 4N3BA 2WDZA 5A9SB 3MJSA 3CSUA 2FN7A 2XYHA 1V39A 3ZU2A 4A3SA 4LY9A 2COUA 3R0IA 4LRYA 5FBKA 2B4AA 2G5TA 1NV9A 3S27A 1D2EA 2EHJA 3SF8B 4U5QA 4EG4A 2VH5R 2D2XA 4AI6A 1RJFA 1YZQA 1RXSA 1JKXA 1T5LA 3H2YA 5DEOA 1GZ6A 1YFJA 1ZK4A 5CVUA 4NJEA 2G88A 1Q16A 3ZY5A 4ZYLA 2HEGA 1DUIA 4NPCA 4WXRA 4TSFA 2JEZA 4HMQA 3ZDDA 1A9XA 1DLJA 4RIIA 2EV9A 3I73A 1OBVA 1H66A 4I66A 3RGGA 4CM4A 2HLHA 3S2FA 3IB6A 3IP7A 2QYTA 5GGXA 1XRNA 1P2TA 4TMVA 2XZTA 4YRTA 1G7TA 1FC0A 2R79A 2E4UA 2JFUA 5LYJB 1JN0A 4HX5A 4KZPA 1CX9B 4N49A 4U0KA 3CUVA 2OV8A 2PDAA 1Q1QA 2RHHA 3AW8A 2X7JA 3CUWA 2I8LA 2C5EA 1XA0A 3SSOA 3TJZA 1DCFA 2EJCA 4RD3A 1L1RA 1MJFA 4RV9A 1C7RA 3DWIA 1Z4OA 2JI9A 4M46A 1WW8A 5LZ7A 1PV2A 2EW8A 2TRSB 4KAFA 1GTG1 2GRUA 4QLBA 3JRWA 3LFTA 5K5EA 4IEIA 1G5QA 3CN7A 2CHGA 2QYHA 4HSGA 4DANA 1LLFA 4EHLA 1I7DA 4V0RA 2Y3IA 4RSGA 4IXNA 2FEOA 1ADJA 1FDVA 4PLGA 1R16A 4WNIA 3C0KA 1Y1RA 3EXHC 3INTA 1O4VA 3QYFA 3QKSA 3R0XA 4FINA 4S3MA 3JQFA 1P2BA 2YQZA 4L27A 3URKA 4AF6A 5B55A 1ARZA 3A3YA 1UJ5A 2H7YA 1I51A 5ALDA 3HJGA 3WIEA 4EMSA 3C87A 4F45A 3DLCA 1NXWA 4R8KA 2PV0A 3RBZA 3HK2A 1BX3A 2D1YA 2CEKA 2GSDA 3AINA 4UOQA 1Y3DE 3H2GA 4R8RA 3VHXB 1XC7A 4D9IA 1G3QA 3U3ZA 1PLJA 3IQIX 1FB5A 3RK1A 4D0GA 1QIFA 2HR1A 4KRXA 3URMA 4AKHA 3V5NA 1SVKA 1PW5A 3H5WA 3QVJA 5HGXA 2QUKA 4QFDA 1NSTA 2X0FA 3F3YA 1N5OX 4P4LA 4BLWA 2WABA 3GD7A 4PY2A 4Y1FA 5IHPA 2ZBUA 2JLUA 3QYJA 3R2JA 1AQJA 2YW9A 3DE5X 3U7RA 1X9HA 4RW0A 3EJWA 3RTCA 5AJWA 2NTVA 4BO9A 3U13A 3ZH9B 3ORHA 5DI3A 1DDGA 3LZ6A 2G1KA 4K6OA 1DWPA 1P2VA 3EQ9A 5EHQA 5EJMA 2F59A 1P9RA 2WWFA 3BA1A 3ICVA 4G0YA 2QLNA 1TJ3A 3UWKA 1EQUA 3KKNA 1SQFA 5IBQA 3W9YA 4V1CB 2P4QA 1PQYA 1ULAA 3GG9A 3L18A 1Q22A 3HFJA 3BJEA 4UTZA 4ZZ2A 1JFTA 1IBMB 3TQOA 4DSTA 4JIMA 1LLQA 3D59A 2B20A 2JAUA 3EQ2A 5BRAA 2K87A 2Z3VA 4HQ0A 5SY9A 5CP8A 4MKZA 5DX0A 2AOUA 2Z3WA 5JNSA 5TVKA 5J9FA 2JD0A 2Z2XA 1D6JA 5T4BA 3WDKA 4E07A 2A58A 3K9BA 1QOQB 1ZOLA 3KQVA 3M1AA 4I1SA 3AFHA 4J94A 4K8OA 1MV8A 4Q47A 2HQRA 3EAQA 4L5BA 5FXMA 1PJLA 3SAJA 2P2NA 4YV2A 2LE0A 3WYEA 2A1UA 2HF8A 3K1YA 3LLVA 2QUAA 3JARB 5B3JC 4MUIA 3VOBA 3MD9A 1DJQA 2GJ4A 1JHZA 2W0SA 3R8XA 4W8HA 4D5EA 2QT0A 4UHDA 2LZ0A 3ML1A 1G291 3GJ8A 2Y92A 3DVRX 4UHCA 4DVGA 5AVZA 5I01A 3ZZNA 1Y82A 2V45A 1XQYA 1W2WB 2JFFA 2VR1A 1P5ZB 3UK1A 1G1MA 3F3MA 3R8CA 1K7SN 4CWAA 3ZDFA 1PR2A 2OBNA 3N58A 1N1EA 1LBTA 4HLNA 3TUIC 3F8SA 3L7JA 3VJMA 3DLAA 1HZZC 2AQHA 2A9FA 2I22A 4FGWA 3CEMA 3DVLA 4EBBA 2H0AA 4XPZA 1N9KA 4C1NA 1XTJA 2F4NA 2GEFA 2EVWX 2B7LA 3N59A 3OZSA 4Y6OA 4J3NA 3C1TA 3HKCB 4HPWA 3JWEA 1T24A 1MIOB 1KK2A 2Z6QA 3CF4G 2JLQA 2Y0CA 2ZYSA 4X60A 4Z7NB 3W6NA 4G5YA 2PSJA 5J23A 4YQFA 3L7CA 1GPJA 1KRHA 1LBEA 2PVPA 2CYAA 3I01M 3MG9A 1KYXA 1E9SA 2VF5X 3QLUA 1COZA 2C3YA 4EB8A 1XWIA 2IXBA 1G0OA 4DQVA 2FJ0A 4CT5A 2DHRA 1R0ZA 5I45A 2HPZA 4IXTA 3HR4A 4Q01A 4Z7JA 1MIHA 1VJ5A 3B1JA 4GM1A 2Y05A 1ZGHA 3DE3X 4IGEA 2WB2A 1XZPA 4IKPA 5CTJA 1FFCA 4MWDA 3LQ1A 1KI1A 3T6KA 3PUHA 3E8SA 4MPJA 3ZJUA 1P81A 1SXHA 1TK2A 1AGYA 4WN3A 3NTQA 2ZULA 4R69A 4I9UA 1XK6A 2WSIA 2PH3A 4RPKA 2C97A 3UV3A 3X1WA 3EASA 4DCUA 2BTEA 3RU2A 1NLMA 1F1BA 1GAJA 1LI7A 4B0OA 4EP1A 1QC5B 1BEZA 1V6CA 2QUBA 3CRNA 3GVCA 3IURA 4H3SA 2D5CA 4GPD1 3BG5A 4UBLA 3IBFA 4JUAA 4DOMA 4UCQA 1MNQA 3W7BA 4YUZA 3CH7A 3O5AA 2V6FA 3DOFA 3K2IA 2WJGA 4IYJA 4MEAA 4OGLA 3WLKX 1F4LA 1QH1B 2R1TB 5G0UA 2C5GA 3EUEA 3ZQKA 2WIDA 4N5MA 1XQ6A 4CMEA 1D1PA 1AD2A 1MB9A 2PAAA 2VJNA 4HDOB 3K9FC 1L5GB 3BBLA 3NO4A 1YA8A 1K68A 3M83A 2OGZA 3C6BA 4O5OA 4BGUA 1GTZA 4M7WA 3UMCA 3D3JA 5CH8A 3OJ0A 1GPNA 1IY2A 3TE6A 3HCCA 4KVGA 3NMUF 5FT9A 2C59A 1EE2A 1L5MA 3HBLA 4NK4A 4MI3A 4B7XA 4BNZA 1Y6QA 2VPQA 4DGSA 3MUEA 5CFLA 1XMOB 5LPNA 1QGYA 1CJBA 1NAIA 1N75A 5GAJA 4LF4B 2MDTA 2ACKA 1Z18A 2ZROA 2FZ4A 5IWAB 4X92A 1X2EA 1OKKD 3OZEA 5MHTA 1EWQA 4FKMA 1TC1A 2QJOA 2IZZA 1CFJA 4HJRA 2HMWA 1EM8B 3VH3A 5JTTA 3TVYA 2ZYHA 1IXYA 2IGBA 3BC1A 1TAGA 3EZ6A 2RAPA 3GEMA 4GS5A 5DNVA 3PNOA 1SG0A 5EMJA 1ODFA 2FG6C 3P0JA 3NBMA 2FJPA 5H1YA 3ZD8A 5BVHB 5JNLA 1GSIA 1QWOA 1P0FA 1IHPA 3LCJA 1ZIOA 4N3CA 1NLYA 1L7PA 2VXYA 4D44A 5BMOA 3RC9A 3AILA 4WOJA 1PQ4A 4A16A 3IR5A 2BKUA 2QPOA 2NU8B 2FZEA 2AD5A 3QKRA 4KIGA 3AK4A 4O2LA 5G1OA 1DKLA 3SIXA 2AXQA 3FNRA 3HRHA 5HCIA 4A1FA 5I8PA 2BP7A 2J3MA 3N0RA 5KTKA 3TN7A 2CXSA 1IEVA 2WAYA 3GYBA 3HA7A 2YIMA 1JDVA 2DQYA 1YACA 1Z5ZA 4TLCA 4WFJA 1YQQA 1C3VA 3BGSA 3U4IA 3F0TA 4RV4A 1M1YB 1RXEA 4ZJPA 1E58A 1EE9A 2FZ5A 2QK4A 2C0CA 3HDVA 2BMJA 2TMYA 5CB4B 4PFQA 2NQ8A 4KMOA 1DCTA 2ANBA 4XRGA 3AEXA 3TOZA 2VRWA 5AQEA 4B81A 3PIDA 4JSRA 1GA6A 2VWPA 4RDXA 3BIJA 2L19A 2YYYA 3R5KA 4B40A 4Y1RA 3RDPA 4M9ZA 1NXXA 4XD7D 1ZK3A 3ZE9A 4I3FA 4RK1A 1DKQA 1OIXA 4NMHA 4AZTA 4M89A 1I7PA 1MVOA 3ZWAA 1I33A 2WUWE 3B5EA 2VCYA 2YFHA 3DB1A 4RIGA 3WKAA 2VZLA 3UMJA 4DUPA 2QGNA 3T1YB 5BWMA 1QZ3A 3HN6A 1ZXLA 1YL7A 3GT4A 4B87A 2H8KA 4C20A 1DC8A 1DKOA 1OBFO 1NTRA 3ET4A 4LA4A 4EY3A 1RYEA 5T4FA 5DOVA 2OKCA 1RIFA 3DEZA 4QD3A 4G9EA 3SX2A 4OH1A 5EYPA 4BX8A 1WD7A 2H2AA 2PD6A 4HWSA 3PUKA 1RHQA 3O8NA 5CVJA 2VNIA 2F3PA 3PPXA 3VH1A 5LOVA 2YKGA 1W36C 1EG2A 2C3OA 1COWD 4GOKA 3TR0A 4P3KA 1QNLA 2JJYA 4ZZ3A 3LCVB 3HC7A 4GHWA 4KO1S 2AN3A 1DQZA 2AK2A 4IIEA 4GBGA 3T1NA 4D57A 3T5DA 5BWCA 3BIFA 3TG2A 2VAXA 5K45A 1C1XA 2E21A 3ED1A 2FAXA 1KHHA 3KXKA 2MSWA 3MHPA 1HO3A 5AM5A 4GPEA 4MW1A 4EA9A 1F9AA 4B2IA 3CWCA 1UXHA 3U3MA 4AN0A 5KMGA 3GGOA 4B5KA 5LUBA 3ROFA 1X1CA 4LFCB 4Z9BA 2FPGB 1E6WA 4U9HS 1WKBA 1Z6TA 4JY7A 3JQ7B 4WV3A 1U8YA 1RLUA 2YJ5A 2LCQA 4AJ4A 3GPBA 2H2GA 2CYBA 2GTPA 5KQGA 4PS1A 2G40A 1C3OB 1N2JA 3FM9A 1O87A 1JXAA 1OZHA 1QMPA 4REQB 2BAGA 2OWDA 1KSGA 5EKUA 4AX4A 1NJGA 1ZZEA 2QTAA 1A9RA 7REQA 1BAPA 1JMYA 2PR2A 4JBGA 2AJCA 3DF7A 2RAVA 4V0NA 4W1RA 3NALA 4IJVA 2Q5QA 3QUQA 4HEQA 1CY0A 1EINA 5T8KA 4KKXB 4JOCA 1XPRA 4ZA2A 4H7KA 4TTAA 2CDNA 4OHCA 5JS2A 4PQYA 1GHTA 1LJ8A 1V8ZA 1I5OA 4IH1A 3UJHA 3SK0A 3PQDA 1TO1E 1S7CA 4HEA1 4L0MA 4LTMA 4AMYA 1JFFA 3QIAA 1Y4ZA 3KP1A 3AY7A 2QG9A 4ZOBA 3UXEA 4ZQEA 1U3CA 2NIPA 4PSDA 5LDGA 3BZBA 2IHVA 5FLXA 3ESAA 2BKVA 4ZGGA 3UICA 4R9RA 3UPUA 4E08A 3DXYA 4E4TA 1GTSA 1WCXA 2ZJ2A 3TLAA 2RSLA 3JALB 1KC3A 1D2RA 3H0CA 2EKQA 1A5ZA 4P2BA 1UBEA 2J31A 4DEVA 3HO1A 2QR5A 3VGJA 2GRJA 1ND6A 1T3HA 1LK7A 4ZREA 2FE4A 5CA0B 1PUIA 5HRCA 3IRVA 3I6ZA 5KZMB 3BQMB 1FY2A 5A3JA 2PUFA 4K03A 2YHIB 3JQ9A 1YR9A 2XR1A 3TO5A 3DCIA 3GLGB 2OM6A 4DSNA 3CVYA 4KL8S 4JJAA 1P4GA 2NZJA 3WL5A 1TO6A 4GZLA 2XKJE 5KX5A 3U5TA 3SIPA 3H6KA 1BO6A 2JHAA 2GOYA 4RZQA 2AFRA 4IHJF 4PRLA 1XCOA 1VDZA 4BNMA 3FWPA 1AIPA 2GAFA 3E22A 4KXVA 2FW7A 1CZNA 3E9EA 1XU4A 4ND1A 3RM3A 3DD5A 4BNTA 4YJHB 5B1DA 3RVJA 2Y68A 5H80A 3CR8A 4ZI5A 2YXPX 5ALOA 4Z0PA 4YLGA 3QE4A 5DYGA 1AZLA 1DIOB 2IS6A 2P27A 3IDZA 2JARA 1V96A 3PPYA 3NGLA 5DHTA 1J6UA 2ZITA 4TMTA 4IFEA 4UFPA 4FS3A 4GRIA 3PUVA 4G5HA 1GR1A 1PO7A 2VOEA 1WB4A 3T35A 3N8IA 4AO7A 3M6FA 4X1KA 3PU6A 4I9HA 1J5PA 4DJEC 2CK3D 2ZVPX 1J33A 3OFND 4JQSA 1PWXA 1FSGA 1JG1A 3B3FA 1RWOA 3ISVA 4EW3A 1R0BA 4TVOA 4KYIB 4ZAFA 5F64A 3Q7SA 3NHLA 1MTZA 5IAJA 1MW9X 3GQBA 4MVJG 4PGHA 5CDTA 4S1PA 4DM7A 4RTMA 2AEEA 1N2CB 4EEZA 1M72A 3GH3A 1PNQA 3QNWA 4DFDA 3QWBA 3GF4A 3OTWA 3SYTA 3ESZA 5K0FA 4IV8A 1Z75A 1ONPA 5JEDA 3RKUA 2GD1O 4AG5A 3OM1A 3NWBA 5G1NA 3JQ8B 4S2UA 2Y67A 3OQIB 5I5EA 3FZGA 2TMDA 4LDJA 1X0XA 1ORDA 3CB4A 4YCNA 1Y3BE 1QB7A 3GJZA 3M81A 1DX6A 1ZMOA 3HM9A 4AC9A 3NHZA 1E79D 1VMAA 2D13A 2JVIA 1U9ZA 2V7PA 1A2QA 4D02A 2NZUG 1OH7A 2H3HA 4DS3A 1BS2A 5A4AA 3H7IA 4UD6A 1QGAA 3R23A 1RLJA 3EW7A 5FL7D 3ST7A 3ETLA 5JDIA 3H2ZA 1E9AA 2GPJA 3IJ5A 4FZRA 3NU1A 2B78A 3LD9A 1G16A 1Y5IA 3IUYA 3UCXA 1VYTA 1DAIA 2YJNA 3RS5A 4GYKA 4KPEC 1L8QA 1W36D 4Z4GA 3CLUC 2PGDA 3PD0A 5FOXA 1WMBA 2LWIA 1SCNE 2W6OA 3IJRA 3S99A 4DLBA 4A5SA 2CV1A 2IF2A 3TTYA 4K9LA 5AK4A 1MPTA 4C21A 3DOUA 4KB5A 2O7SA 3NR2A 3QUCA 3RVBA 1UAAA 2QUJA 3I45A 4PE5B 2O8BB 4YC7A 2QPTA 1PQUA 3AB8A 3DAPA 3MMNA 3PDIA 4RIFA 4LVCA 2IYOA 3MWGA 5JBNA 2ZZMA 2F55A 5FOQA 5E4TA 3O2SB 3STHA 3FNGA 4AY5A 4DZZA 5B7PA 1FS6A 3HXMA 2I6QA 1VBKA 3FVRA 1P29A 2GCOB 4O08A 3ZVKA 2RB4A 3B53X 3FVVA 1K6EA 1B16A 3ZY2A 4RKWA 1Z28A 4YJGB 2VNSA 5CB6A 1UMBA 2D1SA 4G97A 4OMFG 4RKFA 4V0MA 3WKCA 2VJMA 3ZKAA 1ILEA 2DQ4A 3N87A 3THYB 1H22A 1M6HA 3L2OB 4M88A 3FDIA 2MCFA 2Q0HA 4HJXA 3AJAA 4Q7EA 3V2IA 4X00A 2D7JA 2NUPA 1UFOA 2JVJA 3A0RB 4ITRC 4UMVA 3U49A 4C01A 2O50A 3WLTA 4U2FA 1U0HC 2HUNA 2JAHA 1GYPA 1TADA 1SD5A 2JIPA 1RC0A 2Z4TA 1HQYE 1Q0SA 2R5NA 1JHAA 2QI9C 3ER6A 3F5QA 3ORFA 4Q1VA 5EP3A 4DY4A 1R9GA 3AM5A 2IOFA 3IT2A 3SYNA 5B6IA 5JHHB 1R18A 2DKFA 4R16A 5AESA 4DBLC 3I9V6 3I37X 5DHFA 1TCUA 2HGSA 3EAGA 4URFA 3IELA 1YBFA 4Q4AA 4BKOA 1TAQA 4CQMB 5CG1A 8ABPA 4W5TA 3N2LA 4H7JA 2FFBA 3M7IA 2ZDGA 4ACAA 3REFA 5AOAA 2XEXA 1H5UA 4M1TA 4O8CA 2FPKA 5H82A 2XTJA 3EW9A 3MBIA 5KUTA 1C41A 1Z8NA 3QYAA 4DSAA 3ZGZA 2X9NA 2EP7A 3IBYA 4XASA 1EXDA 1HE4A 1N2CE 3PF9A 3WNCA 1L4KA 4BMCA 5HZGA 1NI4A 2G5CA 2X86A 3O4HA 1JAYA 1VBMA 1XQVA 4J8PA 2XKBA 1P73A 4MV1A 4A8JC 4TTJA 3GEPA 2NG1A 2VVTA 4NTZA 4U7TB 1P7WA 3JR7A 1IB6A 3V6MA 3C6YA 3CF0A 3TI9A 4FFPA 3R74A 4BBZA 1R15A 1PG0A 3T9BA 2YY6A 1DIBA 2NXEA 1RBZA 1TCBA 3I6YA 4MA5A 1EIZA 1FJXA 5CLHA 1XZGA 2FX3A 1NUQA 2PVSA 2WJZB 4N7JA 1YZGA 4RE6A 2HN9A 2JA2A 3OUUA 2VSOA 3HV0A 4B4UA 2A5GA 4EHJA 2P90A 4ONEA 1OKKA 1TVEA 1V95A 3KEQA 4UVEA 1LTQA 2Q46A 3QM1A 3ZCSA 2JGDA 1CJSA 3I53A 3VYVA 3AMVA 4ZI7A 2OCAA 2QTMA 4KUEA 3CZMA 5FPKA 3NT5A 3V3KA 1ELOA 2ZUFA 3LDUA 4FNMA 3GY0A 4L8LA 4LWPA 1TCAA 1JB1A 3HYSA 5HOQA 1DOHA 1KKMA 1H2RS 4Y30A 4B3FX 1SKYE 4Y67A 3UMVA 1V1JA 4MRMB 4Y6LA 2IYLD 3ENWA 4PWYA 1AC5A 1JEDA 1TCCA 4HH1A 3SKVA 2NAPA 4PQEA 1UPUA 2QJRA 4ZCTA 3A4VA 2XGSA 2EERA 1YUNA 2XVAA 1SXJC 2AC2A 3EIWA 2QMOA 2VLIA 3U9TA 5LP6B 2FPMA 4JLJA 1E6KA 5CJ2A 4NHOA 5I6DA 4G0UA 5TS2A 5JADA 4X5OA 5LQJA 3P0HA 2XJ4A 2D5IA 2ZAGA 1ESEA 5TVGA 3V8RA 3DM9B 2G82A 2QRQA 1T2FA 3ELUA 3ZCUA 4KE6A 1OXMA 1PWYE 2GCEA 4YAKA 4I6GA 1EWRA 3FY4A 4TVKA 5B1HA 4DJ5X 5JNRA 5K2OA 4OL9A 2BCJQ 1OI4A 1JLLA 3PRYA 1MGOA 2DVMA 4XD7A 1RHJA 1T5IA 2BLNA 5IXSA 2VNJA 5F78A 1AZTA 3R3VA 5IAKA 3RFVA 1QRAA 4I19A 3D54D 4WA8A 4Q4CA 3O8QB 3PWSA 2VO1A 4IWNA 1YZKA 4OQLA 4B85A 4AZ0A 5HPYB 4JT2A 2Q1TA 2J0UA 4RY8A 2UDPA 4CL3A 1FP7A 2ZYGA 2Q3LA 2Y0PA 2O2CA 1CE8B 3KOZA 3MWKA 3UAOA 1CY8A 4O0LA 3E8MA 3PGVA 1CLUA 3ZTWA 7GPBA 5J5VA 4F2HA 3OU6A 3TTTA 1TM2A 2QMHA 2QAGC 3HU3A 3NW9A 5H81A 2PBZA 3GT0A 1RRMA 3VKUA 1DIHA 2QSZA 1EFHA 2WNHA 5THKA 4U8HA 1VIVA 3AL3A 4DHEA 2ZFUA 1OFHA 1COWA 3TTWA 3UB4A 4L75A 2JRCA 1D4OA 4OBXA 1BW9B 4US0R 1GG5A 4Y7CA 4BO8A 1KF0A 4MZXA 2VUUA 4F56A 5LFAA 4LF5B 1IQPA 3D8RA 5DCUA 1ANKA 2BI8A 2YJ4A 3GGJA 1YXMA 5JSKA 4WZAB 2ATCA 2YWCA 2AKAB 3DEHA 1Z7EA 4JOSA 4LPSA 4NFYA 4B32A 4E3WA 2OENG 1KDPA 1WB5A 6ADHA 1QQAA 1P7CA 3L8ZA 4BASA 4R1UA 4BO6A 1OZAA 4PNZA 3LQRA 2KBFA 1JSCA 2GETA 4LZPA 4EJSA 2ABWA 2R96A 3AUSA 2AX4A 3DTVD 2DT5A 1PVOA 1Y1SA 2A3RA 2CFSA 5CUQA 1TZJA 1UK7A 1PNTA 1GJRA 1VKJA 4E13A 1YIDA 2F1IA 3A9CA 2XQFA 3O3MB 4PF1A 4R3NA 4UTNA 1JWAB 3EVZA 1L5FA 4X84A 1YC5A 4WOBA 3AKDA 2JIBA 2WSLA 3NC1C 3MLBA 4RPLA 2GLTA 1IG0A 2OYCA 4NZMA 5CHYA 4DC9A 4EMBA 2FMIA 1VLHA 3CEHA 4P08A 1VE6A 2ZI7A 2V7XA 3N6RA 3NONA 4JBYA 4EKNB 5I48A 4CKYA 4PHFA 3GA5A 3LW7A 1ABBA 1YZVA 3A26A 4YP1A 3VPHA 5M2QA 5EQJB 1AF7A 4PCAA 4F3YA 5JUWA 3KTAA 3TIGA 1R4ZA 1XVAA 2BHRA 2P9BA 2L17A 2YWEA 3AEQB 3AHHA 3RT9A 1ZJJA 1MX1A 2X41A 3PD7A 4MRNA 1NQVA 2O3QA 5EEGA 1AY0A 1ULHA 5EWJB 4RMNA 4XQ0A 2OCKA 4G36A 2C5SA 3VR6D 2QZ9A 1J8YF 3SJAA 1RYDA 1SBNE 1X80B 5JAOA 2P5TB 1MAWA 4JGIA 4C7KA 2I55A 1O0BA 1GA4A 1YBVA 1YCFA 1TUEA 3EGXB 1U8TA 4XPIA 4ZU1X 4BVJA 2E4ZA 3FFAA 3V7FA 4J7AA 5KCMA 5KJCA 2YHUA 1ZIYA 3ZDBA 2EP8A 2I33A 1Y5NA 3CO0S 2ZJOA 1Q84A 1PJ8A 3GPDG 4R40A 5DGCA 4EEKA 3EWAA 4KQWA 4LY0A 4AKTA 1SCDA 2PN1A 3KQSA 1Z5PA 2DSNA 2VOJA 1YU6A 3E81A 4QFCA 3AETB 5J2TF 1P9NA 2VHCA 3DMPA 4JFAA 3G9TA 1JALA 4LPKA 3RS0A 3WK6A 1QX3A 4AROA 2OP0A 3WQQA 1XAGA 4OK6A 1QHHB 1EXWA 4IJ5A 3O8CA 3ABQB 4EHKA 1IRIA 3G2MA 2DY1A 4J7CA 1T2VA 1AH2A 4G5GA 1NUAA 2ECPA 2GS9A 2I2XB 2XUAA 3LV8A 1VYUA 1PDWA 2AR7A 1EFDN 3RAPR 1HE5A 2GH1A 2HBZA 1CR1A 3SR4A 3NS7A 4TRNA 1PK9A 4G84A 3IAS6 2FUKA 3AI7A 1S1CA 4GI3A 1GD1O 4ZV7A 2DG2A 2XUDA 4QNMA 4CZ2A 1JEOA 1PFKA 3U4MA 4W82A 4YAJA 4JX8A 2CK3A 3UUEA 1S3GA 4G5QA 3OFNA 2JC3A 2BKEA 1DBPA 2A9PA 3GRFA 5AI0A 2BFPA 5D86A 4IMPA 1LBSA 2AH5A 2CUZA 2V98A 2WWVD 1T34A 4FP9A 5TE9A 4DLZA 1J5EB 4JN6B 1J2YA 3SIRA 1FQOA 1XR3A 2AXNA 5B3LA 5C53B 2QIPA 3U5ZB 5FJIA 2LRHA 4N7MA 1Z5OA 2HT1A 4JK3A 5FUWA 5HA5A 3ROMA 2B1JA 1T1RA 3WG9A 1QO0D 1UC4B 2CJYA 2SHKA 5D85A 2FEPA 3EXFB 4WMLA 2AK3A 1VZ3A 4PLFA 1WPRA 4EW1A 3RU9A 4RFSB 4XGQA 1Z0JA 2ZYRA 3FW1A 3WK4A 4MWGA 4DLTA 4DM4A 1EVZA 3ER8A 3Q12A 1EXVA 1E79A 4F2WA 5ELMA 4IHKA 3CNBA 1FZTA 5EOVA 4MQFA 4K0RA 4R2IA 2IVFA 2PNFA 3BHJA 5EIFA 1GU7A 3L84A 5FL7A 3L7LA 1NW5A 4BZWA 4IIJB 1U8AA 2XE8A 3FTNA 1YONA 2Q6VA 2CXPA 1F5NA 2H9YA 3RJMA 5B5SA 1EZZA 4FDMA 3HH8A 3V34A 4ZTZB 2HJHA 4IV0A 1YSCA 1V5WA 3R5TA 1DOZA 4AP5A 5K99A 4CV3A 4DY6A 2WU4A 3R6WA 1ZINA 4MAFA 4B82A 4CM1A 3EIHA 3NOXA 1SVOA 4YI5A 2AN1A 4OYHA 4MQ6A 4XJVA 4Z8YA 2FPIB 2Q3HA 4HDQB 5AD1A 1WQ4A 2GLXA 4ZAXA 1DJLA 2DUJA 1V8OA 3CTVA 1X2BA 2HMAA 4N5HX 4AY6A 1H9CA 1XAHA 3AUFA 3BE8A 3FPJA 3X1XA 4BC1A 3CURA 1IWOA 1S2DA 4EPTA 1FLVA 3MVEA 2CJXA 4C08A 4BFLA 2GKOA 2EXXA 3I05A 1LU9A 3QU4A 4GX5A 2ZR0A 5AKLA 1E3JA 5T4HA 2JA1A 4JEUA 5KU1A 1KP3A 1NR7A 1OLOA 1X8LA 2M6SA 4GE0A 5AHKA 1XJWA 4QYIB 1P1KA 5AJXA 1O6FA 2QMUA 4HZGA 3U37A 3VSAA 4ABYA 1FBTA 1X7ZB 3EVFA 3TR5A 4MIOA 1HXHA 2ZJ6A 3FCSB 5TQVA 5CRIA 1TECE 4P84A 1V6SA 4L8FA 2J9GA 2WMNB 5EWMB 4DR7B 4MMXB 5HJ2A 3QX3A 4QG3A 3FWNA 5HE8A 5SZHB 3C97A 4Q21A 5KWEA 1NLUA 1XLTA 2BE9A 4L6AA 5HOEA 5IBPA 5E9QA 2AW5A 2F43A 1B23P 2ZB3A 5FWXA 2JGLA 2X8AA 2HU8A 3O8DA 3PITA 1FTSA 4K9SA 4KOAA 2AT1A 4RY2A 1S9DA 1V8DA 2BEWA 2WPNA 3OZVA 4M1EA 2QM3A 3ZR4B 1VL8A 3WGVA 4PBSA 1C9YA 1N7HA 1WUKS 1A4XA 3EH1A 5DBOA 4UTPA 5TEWA 4F84A 3GJXC 1IN1A 4BWYA 4D8YA 1N0WA 1Q83A 1T9CA 2IHYA 3NRCA 3PDCA 4QTTB 1KOFA 1RJ9B 1Z07A 1J23A 1VSTA 1V5IA 3DWFA 2IYAA 1AVTA 1LNSA 4GF5A 4IIJF 4RMHA 2GN8A 1JIQA 5CLFA 4LF9B 3M4NA 2F64A 1A4IA 4Y0AA 3BBPA 1JR3D 3A9VA 2RKOA 1IHDA 1D4FA 4QPCA 1Y1TA 3REGA 4IHJA 4ZYYA 1TZCA 2IEZA 2C4KA 1HSZA 1XB2A 2ZWAA 5BYBA 4C7XA 4D96A 4B3JA 4LZZA 4P3XA 1A77A 3RTAA 1JHVA 5CU7A 4LKOA 2M6LA 4JB2A 3AYZB 4A5OA 2QRHA 3LHFA 4BVBA 4Q7QA 2O2JA 1U1GA 3I4LA 3LAWA 5CYGA 2JCXA 5JCOC 2X3YA 3PXUA 4NCAA 1H5QA 2CUKA 4ZAWA 1MXFA 1MAUA 4UHBA 4OXYA 1SU6A 1TA9A 4WFIA 1VTKA 3PC6A 1NFFA 3KO8A 4YRJA 3EPRA 3JQBC 3WLEA 2G67A 2V5AA 2O2HA 4CF4A 3PYLA 4YUAA 2PUWA 5JSHA 2WSMA 3GOHA 5FUBA 5K3EA 1KDTA 2BMVA 5BSEA 2P3SA 3ILHA 3QUAA 4BO3A 4TZ0A 1T4CB 5LNK1 5ENDA 3GOQA 1EVYA 1QRRA 3HJUA 5TQ0B 4ZCIA 9LDBA 2JFGA 1QV6A 4LNAA 4B3HA 3NC4A 3NBUA 4FGKA 4X20B 1AQUA 2WJVA 4ZRDA 1JAXA 3PQ2A 1CWUA 4X0EA 2ZJFA 4C03A 3B51X 3B85A 1JHMA 2CSUA 2QNBA 3FHJA 3HB0A 3ICCA 4OB8A 1G2OA 5E6SA 3WLRA 3QVGA 2FR8C 4FTWA 2I6SA 3B9QA 5AOVA 3EC7A 2G28A 1KI7A 1GNPA 1GN9A 3PKZA 5CM8B 1B93A 2J87A 2O3UA 4MJLA 4F4IA 1R8YA 4WCFC 4YCBA 4TZ6A 3EOBI 4UOEA 4N76A 5CPFA 1R2QA 1C2YA 2WUVA 5GPBA 4MO9A 4Q1FA 2QP9X 4MK4A 1EG7A 3KPUA 1B00A 1KZ7B 4IG4A 1QGUA 2VRCD 3AL2A 4MW5A 2XCOA 3UWOA 3NVKI 3T3DA 5HP4A 2ZSKA 3BCHA 3HYCA 4KSCA 3TD2A 1BEUB 5DBIA 4MWOA 4DARA 3BL8A 1PWHA 4MEJA 1L5SA 1T9KA 2GZAA 4F5ZA 3EX7C 1NAHA 5BURA 3SEQA 2GD2A 3ZHCA 2GM3A 4QEDA 1GGMA 5AKXA 2Z08A 3HY4A 1ZM9A 2B8EA 1AK9A 1N3LA 3QBTA 3ANMA 2IZ0A 3L0CA 4KO2S 4OHVA 5TQJA 2QSUA 4LISA 5FBLB 5BT8A 4TKVB 1E9VA 1MEEA 3CNLA 3M8KA 2UUOA 5B2EA 2WIFA 1EZ4A 2GR9A 2ZIXA 5CEJA 1RD4A 1FTNA 2HK8A 2Q3BA 3RC1A 5DHPA 1W25A 3M34A 1EA5A 2Q7XA 3H1BA 4RO0A 5CVEA 2XMSA 5FULA 3FOFC 1BQ3A 1DC6A 5JXJA 4O6VA 1WUIS 3BMXA 5G4KB 1QE0A 1XI2A 3FF1A 3F73A 1P9LA 3UFXA 5BV7A 3JD0A 3DTVA 5IZCA 3T3IA 1ZLYA 3DTNA 1UDAA 2R7LA 1R0XA 5DNUA 2EATA 4KWCA 1GZVA 1WXWA 1KQFA 1PT5A 4JVSB 1OB5A 2QAJA 3WYDA 4GZ3A 1L1QA 3N5KA 2EQBA 4MHSA 3QPVA 4LOAA 3N6VA 4XUCA 4EJFA 3FFWA 3ID6C 5J2UB 1MZPA 4GP7A 1NMSA 3K09C 5L4LA 4Y2QA 4YVFA 1M2OA 4HOYA 4RKEA 2J7PD 2HM7A 3QQ5A 3RVMA 3EA0A 3AL0C 3DW1X 4R2KA 1PZHA 3UV7A 4AY3A 4DPMA 2YWXA 1NU6A 3GRYA 3HI6A 2C9YA 2HT6A 4B9AA 2GTHA 2N1BA 1TIBA 1KL7A 1O95D 2W2KB 4WXHA 5IMSA 3D5TA 4ZVLA 4LF6B 1XMIA 5IC5A 3UH0A 1X1BA 3M6WA 3VR6A 1EI9A 1VG8A 1X15A 3Q9SA 4EVIA 4ZYXA 1WCIB 1R1DA 4QFBA 1IM2A 4QL3A 3VC1A 4EQ6A 4R01A 1JW9B 4MGKR 3RBVA 2YNMC 1E96A 4RLQA 2I3ZA 4GKKB 2GB4A 4TXNA 2VCEA 1Z5UA 4BWGA 2CJWA 4CCSA 4RZ3A 3VZDA 1E9FA 1XEXA 4CT0A 2PIDA 2V54A 3AFIA 1BYUA 1OVMA 3QELA 4HNGA 3ZK9A 4ERNA 3D2AA 1N6HA 1M73E 4WACA 3BPSA 4OB6A 1PHRA 1QS0B 1U0TA 1XEWX 3QHPA 3SEZA 4DDVA 4DV4B 2PUBA 1R4AA 5IMBA 4C0AC 4LJRA 2REQA 1Z2CA 2DCUA 2Q99A 2Q5HA 2WFLA 3ETGA 3NHSA 1Y98A 1FVOA 4IG9A 4K46A 1XWFA 4I4TA 3RC2A 3HY3A 4G4GA 3PKIA 1K7CA 3HGTA 1PCXA 2JBWA 3VR3D 3BN3A 3EVCA 5EVJA 4HKTA 2ZSEA 3UJBA 2X9GA 5PNTA 3WNZA 3TRJA 4TZKA 3G59A 3DVSX 2YMPA 4UC0A 4C05A 3WX0A 5J4VA 1ADCA 2EDCA 2PXHA 3ZE7A 2P5SA 3Q8KA 1T8SA 3N2KA 1BCRB 3PFBA 4PSAA 5L95A 4AKGA 3UCEA 3R7NA 5FEUA 3I72A 4XCQA 5KWIA 2GZ1A 1SHLA 3CO5A 3X43A 2AC4A 4CUZA 5FBHA 2CFTA 3GJQA 3OZFA 5B4TA 1FIUA 3MWEB 2D54A 3MYRA 1PG5A 3N0WA 3QHAA 4BTEA 1MOPA 1WXXA 1H6AA 4DLXA 1FFGA 2I2FA <