3ADPA

Crystal structure of the rabbit l-gulonate 3-dehydrogenase (nadh form)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
310
structure length
310
Chain Sequence
GDVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMKSLQQSGSLKGSLSAEEQLSLISSCTNLAEAVEGVVHIQECVPENLDLKRKIFAQLDSIVDDRVVLSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSPATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGMKRVLKSFGSIPEFSGATVEKVNQAMCKKVPADPEHLAARREWRDECLKRLAKLKRQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lambda-crystallin
publication title Crystal Structure of the Rabbit L-Gulonate 3-Dehydrogenase
rcsb
source organism Oryctolagus cuniculus
molecule tags Oxidoreductase
total genus 122
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.45: L-gulonate 3-dehydrogenase.
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3adpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3adpA01
3EUWA 2WEKA 4FW8A 1YGYA 1U1IA 2POQX 3DTTA 2UYYA 3QVTA 1KEUA 3RASA 1SOVA 2EERA 3IC5A 2X23A 1BDBA 3GVPA 1N5DA 3MJSA 8LDHA 3ANMA 2C29D 2HJRA 3WXBA 3H9JA 3L6EA 1LDNA 4ZRNA 1WXDA 1C1XB 4R4JA 2Y1EA 1O94A 3RFXA 4L75A 3WR5A 1XLTA 1P9LA 4CR6A 2GD1O 1DHTA 2XF8A 4HX5A 1FJHA 4CUZA 2VQ3A 4CODB 4RCVA 1QV7A 3C8MA 4WJZA 2O50A 3BMNB 3BMQA 3R6DA 1DC3A 5ES3A 2GF2A 1KVTA 2AEFA 5TJ9A 2YFQA 4BO6A 2NTVA 1E92A 3RCBA 2Z1NA 1P1RA 3JQ8A 1U3WA 1DHRA 1XIVA 4LCJA 2HCTA 3DEYX 2VYVD 2VWGA 4E5KA 2CSUA 4NBTA 4CM8A 2VRCD 1H94A 4ZQEA 2GN6A 1T1SA 3HUDA 1Z45A 4TRRA 4BO3A 1P0CA 2Y0CA 1NFQA 4BNFA 4A5OA 1X7DA 5J23A 2CDAA 2HK8A 2WD8A 2DBZA 2J5QA 4WKGA 5EQFA 3GDFA 5IZCA 4KWIA 2J3JA 1UR5A 3P5SA 4R54A 4TRMA 4YT8A 1ZEMA 3OM9A 4J1QA 3WBBA 5IN4A 3TZ6A 4J0EA 4JXKA 4CMGA 2Z95A 4Y6SA 5DDIP 1ZK1A 3UOGA 1VL0A 9LDBA 3HHPA 3Q1LA 5COQA 3ICCA 3RI3A 4CR7A 1G1AA 1DAOA 4BNKA 1LTHR 5DN9A 4DVJA 3DBHB 1LUAA 3ZW9A 1U5CA 2BFOA 3UUWA 3KOUA 4BUCA 1E1MA 5A1TA 4O6VA 4W7IA 4U0KA 4XYEA 3GG2A 4WNIA 4XZ3A 1J4AA 5EESA 4YPOA 2JHFA 2FP4A 2GN8A 3DO5A 2HAEA 1NNUA 2PGDA 3GNSA 1E6WA 1KETA 3LLVA 3ONEA 4M1QA 4AJJA 5GZ6A 1GR0A 4BB5A 3LK7A 1I3KA 5TX7A 5A3VA 4KOAA 3WJ7A 4CMKA 3GVCA 2DC1A 4XDYA 2WD7A 3DAFA 5B1YA 3EC7A 1C0LA 1EZ4A 2VHWA 1BXKA 4YBZA 3PVZA 4XB1A 3EDMA 4IUYA 3ZNPA 4UVGA 2AQKA 5FF9A 2VWHA 4CM9D 5CG2A 4EZBA 3IUSA 3ITDA 4CLOA 3PIIA 5G4KB 3GEGA 1HE5A 3W8DA 1CJCA 1ZO8A 3GGGA 3TJRA 4XIJA 1Y9AA 3B1JA 1MG5A 1GUZA 4IDAA 4UULA 1K6JA 4J7XA 1CIVA 3W6ZA 2W8ZA 4N5NA 3PJDA 3L77A 4AJ4A 3NDIA 3K96A 2NU8A 3G49A 3EHEA 4MIEA 1QLJA 3FF4A 4DPLA 3GFBA 5A3JA 2V6BA 5A5EA 4JBGA 3AFNA 1DAPA 4NK5A 2GGSA 2HMUA 4GKVA 4OO3A 1DBVO 4IIUA 1B3BA 3H5NA 1PS8A 1DRVA 2WJPA 1KVRA 1Q2XA 1PGQA 3M1AA 4XEHA 1NQOA 1QSGA 4MPDA 3ROMA 1PZEA 4J3FA 1I33A 2WYWA 1YBAA 3MJEA 1MLDA 3PGJA 3BMCA 2RH4A 3IAHA 2PNFA 3GMDA 1YBMA 4GGOA 4W9NC 4R3WA 4RPJA 4HFNA 1LSUA 1ENOA 4PLPA 1QYDA 2EJVA 1ADGA 1BW9A 2NVWA 1EDOA 3BMOB 3B6ZA 3EMKA 3EVTA 1B8UA 2W98A 3KSDO 3KTDA 4NK4A 4CM4A 5JCJD 4H16A 4O0LA 2Y05A 3V1UA 3OIFA 1N1GA 3KM0A 4BNNA 3MCVA 4FFMA 2RHRA 4J1NA 5AXCA 2IZZA 5MDHA 4IS2A 4DYVA 4CLHA 5B4TA 1E3JA 2Q2QA 2GZ3A 4YAEA 2O4CA 1XHLA 3UCXA 4ID9A 1AHHA 2GUGA 4CQMD 2C5EA 1ZMTA 2C54A 2R00A 3ZU3A 2Z5LA 4BO2A 3V2UA 1K3TA 2QIOA 1EUZA 1QRRA 5JFOA 1EVIA 1A27A 3WB9A 3FBTA 2D1YA 3PYXA 4JQCA 5I8ZA 4CM5A 3C1TA 1DJQA 3GMSA 1WWKA 5F1PA 3FN4A 5CAEA 1OAAA 4FC6A 1LC3A 5K9ZA 1YB4A 1WP4A 2R2GA 4XIYA 3NKLA 3W4JA 4ZQGA 3FPLA 5JC1A 2X58A 5CPFA 3WMXA 1EK5A 3NYWA 4NBRA 4RZIA 1TI7A 3HWRA 2C2YA 3OHSX 3BYZA 3H65A 2ZIZA 5IZ4A 3WYEA 1VPDA 1OBFO 3GGOA 4MVJA 1RWBA 4E2YA 4RLHA 4J1SA 3HFSA 4BKRA 1NVMB 1CYDA 2X4GA 1GAEO 1CQJA 3FPCA 1DIAA 2I76A 1E3WA 1SCUA 2BFAA 2JD2A 3AFMA 4DUPA 3RQSA 2HU2A 3AM4A 1VJ0A 4ZVVA 4PLWA 4UVDA 2BHLA 3JQBC 1T2FA 3UCFA 5DOZA 4FGSA 4S1VA 1IY8A 1R6DA 1HWYA 2B69A 4CMAA 2NU7A 1IHXA 4DLLA 3H6KA 1LLCA 1ZJZA 2AEMA 4NHEA 3D1LA 3RUIA 4B7UA 5IDWA 2QRJA 2YQ5A 3U3XA 2J5KA 3VDQA 2VYND 4XYGA 2X8LA 3N58A 2AMFA 5BSGA 3UFXA 1HDZA 1YBVA 3JQ8B 1HYGA 1EVJA 1KYQA 4DPKA 1DIGA 2FSVA 4FJ0A 4NMHA 1CF2O 4IQ8A 1I0ZA 2DFDA 1B15A 5EIOA 5BT9A 2E82A 4R5HA 2GZ1A 2EP5A 4FPXA 1E7QA 4D3SA 1KEWA 1V0JA 1PGNA 1HZZA 1HKUA 2DAPA 1ZXLA 3RJ5A 3LVFO 3H9QA 4PIVA 2O23A 3ZWMA 4CMEA 1Q7GA 3D7LA 4BNLA 2G0TA 1YOVB 3S2GA 2V7PA 4GBJA 3NRCA 4FJ2A 2CVZA 3EZYA 3K92A 5HS4A 4RVGA 4B7XA 1EUCA 1U2DA 1S6YA 1B3RA 4PFJA 2J8ZA 2Q2WA 4DQXA 3WIEA 1HLDA 4S3MA 2OORA 3GQVA 3GUYA 3KB6A 2EJWA 4JX8A 4BKQA 2VCYA 5JY1A 1GD1O 1MC4A 3RUHA 1E6UA 1NHGA 5DCUA 1NPTO 1E7WA 4MP8A 4IZHA 3RFTA 4W7HA 3JYQA 3Q9NA 1PWXA 3RU9A 4JP2A 1ULSA 3I23A 4GLOA 5JS6A 3H2ZA 1YWGO 4ALKA 2YDXA 4FR5A 4FFNA 1KBZA 3B1KA 3LQFA 3ZW8A 4LSMA 4MP3A 5C7OO 1I32A 1O6ZA 3AJRA 2WD7B 4ROSA 3U0BA 2NQTA 4HP8A 1ZJYA 4L8VA 5I9MA 1X15A 3OMLA 1Y8RB 5DCWA 5EMHA 1U3TA 2Q3EA 3V8BA 2BD0A 4WEOA 1EUDA 1DIRA 1HE2A 3VDRA 1V35A 5KKAA 1FDWA 2NSDA 5IDYA 1QYCA 3GLQA 1NXQA 1OOEA 3IOYA 2XXJA 4BO9A 3Q2IA 4JJGA 5KTKA 3GRPA 3UGKA 1NQ5A 3GFGA 3AM5A 5CDUA 4PGFA 5L4LA 1ZK2A 4XDZA 4D43A 1R4MB 3AOEA 2Q50A 2HMWA 2XOXA 4N5LA 3C24A 1YJQA 1PJSA 3T7CA 3H9UA 2D5CA 4RPLA 4R1TA 3H4VA 3HN7A 5I7SA 3FHLA 2BFMA 4KMSA 2W2KA 2CVQA 5GZ1A 1YQDA 2BI8A 1U3VA 3ANNA 4BKPA 5TF4A 1I01A 2CMDA 3PP8A 4J7CA 4RF2A 1UDCA 5IN5A 5CDYA 3Q9UA 1CETA 3C3XA 1K6IA 4CQLB 5COAA 1JKFA 4KZPA 1VKOA 4B8WA 2DFVA 3ZGYA 3PZRA 4XJSA 5DOVA 4IY1A 3LC2O 2BI7A 3O03A 3WMWA 4DXHA 2ZTVA 5K6AA 3OJOA 2PGLA 3FNGA 4I5FA 3G0OA 1C0IA 1C1XA 3AU9A 3VHRA 3PFWO 3LYLA 3PDUA 5TSDA 5I9NA 4PRLA 3S55A 4B8ZA 3ZU2A 4D7AA 1MA0A 1H6CA 1PSDA 2ZQZA 1AXEA 3CZRA 4PG6A 4BL5A 2D4AA 5DBIA 1ZUD1 5DF1A 3RWBA 3BMNA 4X54A 3WYBA 4M49A 3GPIA 1K0UA 4OKNA 1AGNA 3E18A 3ZHBA 4IJUA 3ZWAA 2D5AA 2QG4A 4GVXA 4E13A 3WQQA 4BNUA 2GN9A 4FIZA 3VOSA 2JFGA 3F1KA 1LRKA 2NADA 1QLHA 4R1UA 3GDOA 1B0AA 3WNVA 4BIIA 4OOEA 1U8FO 3VVCA 3MOGA 3RSHA 4IJWA 1PR9A 2VN8A 1ENYA 1JU9A 1ZCJA 1Y7TA 4A0SA 2VHYA 4K6FA 2VNAA 4OKIA 3H9GA 3D4NA 3DTYA 2ZB3A 5IG2A 5KJ1A 1C0PA 2AHRA 3F4BA 1DIBA 1H93A 3CZMA 3PFFA 2R6JA 4YACA 3WGOA 4TVOA 1LX6A 2ET6A 2DBVO 3ZWVA 1ZK0A 1F8FA 3JD4A 1DIHA 4U7WA 4MVJE 4TKLA 4NG5A 2GNAA 2Q45A 2TMDA 2FPGA 2BRUA 2RBEA 3GA0A 3ZV6A 3LF2A 3PJFA 4OM8A 4OOFA 2EXXA 2GASA 1YL7A 3DBHA 1Z75A 3WLEA 1EVZA 4FCCA 3DB2A 3I4FA 3MJCA 2O2YA 1I5RA 4R9SA 5CDGA 2HMVA 3X2EA 3U5TA 3EY4A 3H8VA 2JCVA 4RVHA 2ZTMA 4YRDA 3PPIA 4WOKA 4CV1A 3KHUA 3KLPX 1E3WB 4DRYA 4WK6A 1X1TA 2A92A 3DZBA 4D44A 3VVBA 4Y9DA 1PS9A 4DIFA 1EK6A 3ZWPA 3E03A 4GMGA 3H5RA 5A9RA 1B8PA 2W90A 2V65A 2VUUA 2WM3A 3RC9A 3JSAA 1B16A 3VPXA 3QVXA 2Y1DA 4EGFA 2O3SA 2P9EA 2OOSA 1JKJA 3DQPA 3W8EA 4LK3A 4FQ8A 1JTVA 1EQ2A 1MX3A 2BGKA 2QRLA 1NR7A 2EGGA 3DBRB 4I08A 3QQPA 4YTEA 2VZ9A 4CJXA 4PRKA 4Z3DA 4LMRA 1UZMA 4YDRA 5F1OA 4B4WA 4J49A 1PJQA 4PG5A 4R69A 4MO2A 5IZCC 2OL4A 4OIMA 4M8SA 4YEDA 5F1KA 3KRTA 1F17A 5CP8A 3S1LA 4ZQBA 4EI2A 5KCZA 1O95A 3EAGA 3WNQA 4MVJD 2PWZA 3E9NA 3GF4A 4O59O 1GUYA 1OC2A 3F1LA 3ADOA 4W4TA 1LA2A 1N7HA 4HNGA 1GZ6A 2O3QA 2D59A 4RVFA 5JSFA 1JVSA 2Q1UA 4CV3A 1FK8A 3OQ1A 2Z1MA 4KQWA 4E33A 1HF3A 3T4EA 4HUJA 4EUHA 4WEQA 4WE3A 5JLAA 3QHAA 2Q2VA 5BNIA 2VUSA 1ZH8A 5L95A 2G17A 3D5QA 1N8KA 4DREA 1QYVA 1T2EA 4L74A 4RF4A 2FR0A 1ID1A 1GUFA 3EW7A 4G81A 4OSPA 3M1LA 4W6ZA 1MV8A 2JAHA 4WCDA 4BNIA 4BNTA 4ND2A 1I3MA 1H6DA 1LDYA 1U4SA 3GHYA 4CMIA 1B14A 4RZHA 4E5PA 3U62A 3SJUA 3RBXA 3ABIA 1SEPA 3QLJA 4J2OA 3BHIA 3UH1A 2ZTUA 3BMOA 3STHA 3S2EA 2OFPA 4HWKA 4CPDA 2IXBA 4RDIA 1KIFA 3LLSA 5EN4A 4DIBA 1LSOA 1RM0A 4J9VA 1TA4A 4RQUA 1C0KA 2P4HX 2HDHA 4YAGA 2DKNA 1B2LA 2DT5A 1UZNA 4TKMA 4IIVA 2GPTA 3LU1A 4Q3BA 1D1SA 1BMDA 1ONNA 1H2BA 2O4UX 3VH4A 1TB4A 2Y0EA 4Y6PA 5JO0A 3IL2A 3FD8A 4L0QA 4PZCA 3L4BA 4GAEA 4BNHA 3UCEA 1Y5MA 1BGVA 3U09A 1DDOA 1GPDG 4EEXA 1K5HA 3U4CA 4RQTA 5LDHA 1V3VA 3KSZO 1SB8A 3QVOA 1GV0A 1RYEA 3GH3A 5T64A 2Q1SA 2HRBA 2YV2A 2HLPA 2IZ0A 1EVYA 4FJ1A 3GUCA 3M2TA 2IZ1A 3UAGA 5FFFA 3MEQA 3C1OA 2F00A 3FTPA 1R4NA 1KERA 2IXAA 2W2KB 3V5NA 4INAA 4Y6RA 4ALIA 1LSSA 4OAQA 5F5NA 3JQ7B 4JJFA 2CDBA 3K6JA 3KYDA 3WWYA 2LDXA 3C7DB 4YRBA 4D0SA 4RPGA 2YZ7A 1Z6ZA 4YQZA 2ZCUA 1PIWA 1UAGA 3NTOA 3GT0A 1ADBA 4UREA 3ETGA 1T2CA 2BGLA 4YJGB 4YQYA 4BNVA 4MVJH 3GVIA 4XR4A 4HFMA 4DLAA 3GK3A 1YRLA 4FC7A 3ZI0A 1PJBA 1YO6A 4BOYA 3AUUA 1ZBQA 2G5CA 1ISHA 2PD3A 4F6LA 2JKVA 1PJ2A 4O5OA 4OXYA 3W1VA 2ZYAA 2NVUA 3OICA 1AUPA 3L9XA 2Y0DA 4TSKA 3GAFA 2DUUA 1QORA 1R15A 3D64A 3V2GA 5JDCC 2VUTA 1C14A 1JN0A 4YT2A 1F0YA 2W4QA 5JYEA 4DQVA 4U8GA 4RDHA 3ZN2A 1V9LA 4HXYA 3PQEA 1ADFA 5IXSA 4IDGA 3WGQA 2Y1FA 1Z82A 5BNTA 4GX5A 3FRJA 4CL3A 1H6BA 4GX0A 4AJLA 4XYBA 3SLKA 3SXPA 2Y1GA 1DO8A 1FMCA 4HKTA 1XDWA 1IPFA 4RVDA 4B4UA 5CEFA 5L7TA 4PG4A 4W82A 1GY8A 5CEJA 3ADPA 2OP0A 1BXZA 3PHHA 2Q46A 4NBVA 5B4UA 3TOXA 3R3JA 3RVDA 3DOCA 5TGDA 2QRKA 1YOVA 3OIGA 3VPHA 4JJIA 1PJ3A 4B3JA 3DR3A 1P1HA 1T24A 2FY8A 2IEDA 4K6CA 4WCFB 1K89A 4XQGA 3G79A 1MXHA 5ENVA 2FR1A 1DRUA 2D3TA 2RH8A 3A1NA 1ZVMA 4P4GA 5L51A 3PI7A 4FFRA 4IMRA 1KY5A 1NX6A 4EUFA 3BHMA 2IODA 2H5LA 3KO8A 3AK4A 5GZ3A 3JQAB 3JQ9A 4OXNA 1OFGA 1MG0A 1WMBA 1A4IA 3NTQA 2I3AA 3LC7O 4OSOA 3AY3A 3PEFA 5K0ZA 3AI1A 3OJLA 5IDQA 1HTBA 1A7KA 1V3TA 4R1SA 1ZW1A 3I6IA 6ADHA 4Z0PA 1Z74A 1Q0HA 4RV9A 3O9ZA 4ZQHA 2B37A 3RAJA 3EK2A 4BNWA 1Y8RA 3LZ6A 1D7OA 4NR0A 4QX6A 1UUFA 2Y67A 5BSEA 3DBLB 5EINA 4XYLA 1ONOA 1Y5RA 3PJEA 3GNTA 1XR3A 3FNEA 3OJEA 4NPCA 3RD5A 4EJ0A 1F14A 4ZN6A 3GZNB 2X7HA 3WGZA 4E5YA 3ANLA 3BXXA 3MWEB 2H9IA 3AY7A 1FDSA 4CL8A 4CM6A 3F6YA 1CWUA 1G0NA 1R4MA 4ZD6A 3T4XA 4RVSA 3G1UA 3I9MA 2X0NA 1KEVA 3RROA 3NGXA 4OQYA 3EGOA 2JCXA 3FI9A 4M86A 1ZIDA 4DPMA 4FD3A 3WYCA 4BO8A 1PL6A 5JW6A 4JGBA 1BVRA 3MJTA 2AE2A 2J5RA 3PXXA 5G0WA 4GWGA 3H5AA 4CQLA 4IJKA 1E1KA 1P3DA 4ZQFA 5T8KA 3U4IA 2ZATA 4DBVO 4L73A 4GVLA 5F21A 2ZYDA 3WSWA 1U7HA 2EF1A 3INTA 4B3IA 1W0CA 5A9SB 3A9WA 4XWYA 1ML3A 5U4QA 1QKIA 4ZRMA 2FWMX 1H6AA 2HMSA 4KTTE 2GR9A 5LDGA 4H3VA 5C3MA 4AJIA 1IZ9A 4CUJA 4BO7A 3DL2A 1DLJA 1GQYA 5B4VA 4CQMB 1X7GA 1A5ZA 4CMIB 1N2SA 3OEWA 3QVWA 1L7DA 5L53A 1LSJA 3HDQA 4BMNA 1D4FA 4JK3A 3AUTA 3VAZA 4BGVA 1B8VA 1YQXA 4NIMA 3BTOA 4RJTA 3E1KA 4Q3AA 5L4SA 3P19A 2VWQA 4WLVA 5H81A 4GWKA 5JBIA 1DFGA 3DOOA 2B4QA 2D8AA 4CLRB 5TT0A 2E48A 3K5PA 4IXWA 4Y67A 1NBOA 3IDSA 4LISA 4OXKA 2GN4A 3PJGA 4NJOA 4ALJA 4FOSA 4D3FA 4ZHSA 3E8XA 4TVBA 2EW8A 3K2BA 2JFFA 3DMTC 5CDTA 2P68A 2B35A 3U49A 5FYDA 3HG7A 2HK7A 4NDNE 2RIRA 4GH5A 1Y81A 5BNFA 4DMLA 4HV4A 3R0IA 1HE3A 1I3LA 1I24A 3RBVA 2EW2A 5T67A 1DPGA 1GEEA 2V6FA 1R16A 1YH3A 4EDFA 2LDBA 2Q99A 3M2PA 3NDJA 4CMCA 1SZJG 5JAZA 3OP4A 1DC6A 2P91A 3TL3A 1E3LA 3ETEA 3NT5A 1R4NB 1PZFA 3UKOA 4C7JA 1XA0A 1HRDA 3R3SA 1I30A 3BTUA 5K6AC 2O2SA 2I3GA 4GX2A 3H3JA 2AEJA 1E5LA 1P44A 2NU9A 7MDHA 4XQCA 2VHVA 1IE3A 1P77A 1BWSA 1TT7A 3KYDB 3ZV5A 3ZWYA 4IDEA 4NBUA 1R12A 2ZJ1A 2EWMA 4XJTA 1ISJA 1YXMA 5AXAA 1PGPA 3P2OA 2PZLA 2GDZA 5A5FA 1YB1A 4RPHA 3FBGA 1Y9EA 1U3UA 4BNXA 2D0IA 3I83A 4WLOA 1P45A 1W4ZA 4CLDA 2B36A 1HT0A 2NVBA 2B0JA 2I9PA 2UV8A 2NVUB 4IS3A 3LSYA 1A9YA 4Q3CA 4TQGA 4UEOA 4BO1A 4ND3A 1DRWA 3DBRA 4XD2A 3FCOA 2P2SA 4DWVA 3DZJA 1PQWA 1PTJA 1HETA 5JDIA 3NAQA 5C7IO 1UDAA 3HADA 2ZQYA 4R68A 1P1IA 2FPPA 3IIEA 2PK3A 3CINA 4A26A 1IOLA 2PFGA 2BFPA 1T1RA 2YDYA 3A06A 1YL6A 4IQGA 3AOGA 4JROA 1PS0A 3GHHA 4FOOA 4PLZA 1YVEI 1KEPA 4AJKA 4D41A 2FZEA 4XGNA 4DMMA 2QW8A 2FOIA 1O0SA 3TSCA 4BNGA 2Q1WA 4I9HA 1JAYA 1WVGA 3A14A 2NLOA 1XU7A 1GCUA 1LI4A 3CXRA 1FXSA 4Z0HO 4PLFA 3OFSA 3C85A 5EJ2A 1JW9B 5KJCA 1P74A 3NV9A 3E5RA 4G5HA 3MJ4A 1S7CA 4YYZA 3AM3A 3QWFA 4GSLA 2UAGA 1O89A 4QEDA 1OMOA 4ZICA 3ROQA 3PGXA 3OEYA 3NUGA 3PQFA 1EDZA 1WW8A 4KP7A 3UF0A 2CY0A 3WOHA 1SB9A 4ND5A 1IHYA 4L9RA 3U4DA 3KYCB 3L9WA 3GNQA 4XQEA 3ST7A 4BQRA 2O3RA 4H7PA 1DB3A 4R51A 4BV8A 3L0DA 3ZZNA 3ZHZA 1Q7CA 3VTZA 3DFUA 4JIGA 2Y1OA 3O4RA 4FDAA 4NFYA 2PA3A 1KY4A 3WWZA 1P1KA 4GI2A 3WS7A 1N1EA 3KEQA 5A06A 1W73A 4E0BA 4IBOA 3RUEA 1P0FA 2PKQO 3B1FA 4BB6A 2CNBA 3JQFC 1DLIA 1XCBA 5T5QA 2AE1A 3PLNA 1IPEA 1ISFA 2VZ8A 3L6DA 4IDFA 5U9CA 3UXYA 2DTXA 5BQFA 1I2BA 5FWNA 1NPYA 5BSHA 2FR8A 1ORRA 5EQDA 3GC6A 3SC4A 1E6EA 3JYLA 2HK9A 1HDYA 1NM5A 3EYWA 5ILOA 4ND1A 4UUNA 4D42A 1ZKMA 3RIHA 1VLLA 4DIOA 1GFSA 1P33A 2C20A 1HSOA 4MKZA 3JQ7A 4NQZA 2YV3A 1T4DA 3QWHA 5ICSA 5FEUA 1NP3A 3SC6A 2H1SA 3HSKA 2O3TA 2GLXA 4N7RA 4BKUA 4XRRA 1GQQA 3G3EA 4LVUA 3BIOA 1HSZA 2DM6A 4YJGA 3ZU4A 3ZWWA 3JQCA 2VT2A 1ONPA 3IS3A 4B4VA 1M2WA 1TT5A 3L4SO 1YJ8A 5TRTA 1R66A 4U6QA 3E82A 3DONA 1ZNQO 3PQDA 3VKVA 4EJ6A 1A71A 1HDOA 3ETDA 1ZMOA 2FN7A 3ASVA 1AN9A 4MIYA 3D4PA 4A7PA 1WZIA 5THQA 1IL0A 4HFJA 2P9CA 4R16A 3VPGA 5H83A 2PGJA 3ULKA 3HDHA 3EZLA 4RGBA 3FR7A 1RM5A 3CMCO 3ORFA 4QSMA 1Z7EA 4M55A 1QP8A 1WZEA 3L4BC 4URFA 3NT2A 5KVCA 2CF6A 1IULA 3H9EO 4TZTA 1VL8A 4E3ZA 5C5IA 4CM3A 4N18A 4EEZA 4YAJA 4Z9YA 3I6QA 4BHTA 3IP3A 3ROPA 5JAMA 1K2WA 4CMHA 4BGIA 1VI2A 5CDSA 1EBFA 4R3NA 1O8CA 4L4XA 4A27A 2EKQA 1QYWA 1KVSA 3JQBA 1LQUA 1ZXBA 1L1FA 5L9AA 1XGKA 1ENPA 4YR9A 2CFCA 4BMVA 3BTVA 5C7LO 3VTFA 2VWPA 1M75A 4OHUA 2CD9A 4WCFA 2PH5A 1BDMA 1NQTA 5DBGA 5GY7A 3D0OA 3VH1A 2FSSA 3W8FA 4MIOA 3ONDA 3AW9A 3MTJA 3QIVA 4PLVA 3DC2A 7ADHA 5ITWA 4WUVA 1VJTA 3CUKA 3DBVO 4Z3KA 1DSSG 5A9TA 4GLLA 3I9KA 1IYZA 1UDBA 1X13A 1C1DB 3VH2A 1X0VA 3V1YA 3JQAA 4DTIA 3KV3O 3IMFA 1HDXA 3ONFA 1JKIA 4HNHA 1PZHA 3HZZA 1PGJA 1U4OA 1Y8QB 2C2XA 3VZPA 2B4TO 4Q3NA 4QO7A 5DZSA 4XA8A 2VRBA 2X5JO 5COBA 3PWKA 4FSHA 4OJNA 4MP6A 2EIHA 4BNYA 1FDUA 2X5OA 1XWFA 3O38A 3KBOA 4RORA 4IM7A 1TEHA 1T2AA 4J4BA 1VM6A 3DXFA 2UVDA 1D3AA 3E9MA 4G2NA 5KKCA 1CQIA 3DBLA 3HFGA 4RF3A 2J3HA 2WDZA 4XYMA 4H15A 3PZBA 4AVYA 3GZNA 5KVSA 4D0RA 3P2YA 2BH9A 3TFOA 1BXGB 2ZB7A 1DC5A 4QECA 4IGEA 2RCYA 1LBEA 4EITA 3VPSA 3A28A 1WDKA 4ALMA 2X1HA 2ILTA 1GZ4A 3TZHA 3ZHXA 3BTSA 2F1KA 3PDJA 2VTEA 3PIDA 4YJFB 3OA2A 3WQRA 3VZQA 1ZZEA 1SBYA 2OHXA 2QZZA 3DAPA 4G65A 2QYSA 2PZMA 1E3IA 4OGWA 4DGSA 1AXGA 1CERA 1ZFNA 3BA1A 5EL0A 5JCJA 4RVUA 1V8BA 3QRWA 5G0UA 3KSUA 5A9SA 5BSFA 3INGA 2DBQA 2PTGA 1CEQA 5MGBA 1M6HA 3JQ9C 3ZHYA 4PLCA 2AG5A 3DHEA 2E37A 5FI3A 4CQMA 3TL2A 4WECA 2P5UA 2C7VA 2QQ5A 5DP1A 1YE3A 2QZ9A 4GPD1 1H9AA 1HYEA 2CUKA 4PLYA 4KDEA 1BTOA 3DZFA 1PZGA 5B37A 5ILGA 1E3SA 4EBFA 1LRLA 1LEHA 1F06A 1QMGA 3DOJA 4A2CA 4CLRA 2AQIA 4YWJA 4D3DA 1W6UA 1YDEA 2BF7A 2WE8A 4Q9NA 4LCEA 4CMJA 3NDRA 4E31A 1O9BA 5JYDA 4TZKA 2Q4BA 2PD6A 3DZHA 5DT9A 3C1AA 1BSVA 2CZCA 1PX0A 3P7MA 1SC6A 2B5VA 5I7FA 4CLXA 4YRAA 2WTBA 2ZJ0A 5AOVA 3WFJA 4WNCA 1UXHA 3QWIA 1ZSYA 2JJYA 1E7MA 3DHNA 3WIDA 2AQ8A 1M66A 2IYPA 6LDHA 1MFZA 4TROA 1EE2A 2OXIA 3NJ8A 1XU9A 3QA9A 3WGYA 5EPOA 5T8KC 2HSDA 2EHDA 4GL4A 3C7CB 2UDPA 3Q11A 4CLEA 1PJLA 4IDBA 1LU9A 2P5YA 4E2WA 3TDKA 2DVMA 2D2IA 5HRUA 4U0JA 1I10A 2B4RO 4TMFA 3V2HA 2RAFA 2YJZA 1MXFA 1PQUA 2EKLA 2YV1A 3IJRA 5CFZA 3HJAA 1AHIA 4PLHA 2W2LA 2VYNA 1PR3A 2Y1CA 3TPCA 3D5TA 3WICA 1N9GB 4J43A 1KVQA 4TWRA 2BKAA 2OMEA 4NU5A 1YONA 4AJNA 3DZIA 4AFNA 1BRMA 3RUDA 1E7SA 3GEMA 3CTVA 3BAZA 1GTMA 1T4BA 2PKQP 1U28A 3QWBA 4U6SA 1AE1A 3WQSB 3G17A 3VC7A 2EKPA 2VOJA 4I9UA 5DULA 5ICMA 3K9QO 1TT5B 3Q6IA 1F8GA 1X1EA 3ENNA 3Q3CA 3IQDB 3SVTA 5ITVA 3LF1A 4K26A 4ZA2A 4HY3A 5JAIA 2C5AA 3GVHA 1PJ4A 3FSRA 2NWQA 4MVJG 1GL3A 4LMPA 1VL6A 4AG3A 1XG5A 3WX0A 4E21A 2B83A 4MVJI 4YJHB 1FDTA 4I8XA 3TRIA 1JLLA 4NH4A 3HDYA 3QWAA 2GRAA 4LGVA 2R00C 4WASA 1HE4A 4PN3A 2CVOA 4JP3A 3JTMA 1UP4A 1VSUA 4J90A 2AXQA 1GCOA 4YT5A 3PHIA 4E32A 1NAHA 2X6TA 4P38A 4TRNA 3RC7A 1UXGA 2EP7A 4PLGA 2ZTLA 1LC0A 1MFPA 2AQHA 5L40A 5KVQA 1WDLA 4NNJA 4CMBA 3CE6A 3OF2A 5LC1A 4FFPA 3V1TC 1VSVA 1ZK4A 4K28A 3KVOA 1DC4A 4LN1A 4QQRA 4BNZA 5TS3A 4PZEA 1NR1A 1GV1A 4M87A 1LDBA 1XELA 5JY6A 2GSDA 3DZGA 1JVBA 5AXDA 5KJ6A 2JCYA 2E49A 4BQPA 3JQDA 2FZWA 1XKQA 2Y93A 4GSKA 4F46A 3AUSA 1LRJA 3HDJA 1R0LA 3ON5A 4GX1A 1KS9A 5IXYA 5TJHA 1SO8A 2B5WA 4LRTB 3RFVA 3GGPA 1RKXA 1I36A 1KVUA 3KYCA 3KZVA 4ZJUA 3TZQA 4NFHA 5IF3A 1NPDA 3LT2A 1XYGA 4YA6A 1MB4A 3FR8A 2FRDA 2HQ1A 5CPBA 4BV9A 4QFCA 1XQ6A 3DWFA 2QYTA 2Y66A 1BG6A 5JDIC 2E6UX 3RC1A 1EE9A 2IE0A 1F12A 4FS3A 4J9UE 2C82A 4QO8A 4UEKA 3MOIA 2PR2A 3RJ9A 3KLMX 4FN4A 3UHAA 4C4OA 3DFZA 1LLUA 5JAQA 4P8RA 2PZJA 1JQBA 2V6MA 1K6XA 5CHEA 4E2XA 3DHYA 4FFOA 1IZ0A 3I1JA 3DZKA 5A05A 1ISGA 1JWBB 1PL8A 3FWNA 2EGHA 3QV1A 3GVXA 3VKUA 3W4IA 3WDSA 3K2EA 2NM0A 1NFFA 1YS4A 2I99A 3UN1A 4ONEA 2JD1A 5KOIA 3HN2A 3U4HA 1LLDA 3GY0A 4YB8A 1PWZA 1YL5A 4ALLA 3AU8A 4CMEC 4CM1A 1HZJA 5JE8A 1A72A 1LXCA 2OGUA 3AY6A 4IDDA 3O8QB 3TOZA 5A03A 3LC1O 4D46A 4MOWA 2WE7A 4IZIA 3JQAD 2BELA 5H82A 3KUXA 3JQ6A 1XEAA 4UAGA 2DLDA 3LT1A 1CRWG 3D3EA 4Y98A 4OYRA 4NI5A 1WNTA 3I9NA 2JL1A 3WFIA 4DYDA 2OUIA 1WMAA 5JNLA 4ND4A 1L7EA 1HL3A 1Z73A 2EEZA 3N74A 1NASA 5KNLA 2Y68A 1VRWA 4JCOA 5AQ1A 2J3KA 3HQ4O 4PVDA 3PHJA 1U8XX 5IFLA 2BMAA 5L45A 1FF9A 1GYRA 4M54A 2NACA 4KUEA 1NTOA 2YHUA 2C7GA 1T26A 3IKTA 4N5MA 2NUAA 3B20A 5T57A 4E5MA 3IP1A 1DFIA 4XB2A 3OBBA 1CDOA 1NWCA 1H0KA 4CM7A 5ADHA 4UUMA 1UH5A 4JBIA 1VJ1A 3PRJA 1QG6A 1HDRA 1M76A 4Z0TA 1EEHA 1KC3A 1GQ2A 5AYVA 3KXDA 3NT4A 1VKNA 3OJ0A 3WLFA 5JMWA 1ZSNA 4Q39A 1E5QA 3ZU5A 1DEHA 5CG1A 3JQGB 3HE3A 1PU2A 1WAMA 3COSA 4NBWA 3D4OA 1P1JA 3E9QA 4LRSB 3I3OA 3ZNNA 3WJAA 5C37A 3CEAA 1NAIA 2JD0A 1Z7BA 4B3HA 3AOEC 4QFDA 4WLEA 4BGEA 3QW2A 2VHXA 2X0IA 2WYUA 2O3JA 4IPTA 4Q3DA 2VNSA 3JCZA 3K30A 5DBFA 4B7CA 2X9NA 5THKA 1PEDA 1P1FA 4D45A 4IXTA 4IINA 1UP6A 1QV6A 2X5KO 1MUUA 2G82A 3L6OO 4F6CA 1T25A 3TN7A 5JDCA 3A4VA 5DCYA 2I67A 1V3UA 2DPHA 2V6GA 1P31A 2DTEA 3RU7A 4EYEA 4J4HA 5HWSA 1V6AA 4YCAA 1D8AA 1ZEJA 2P4QA 4UUOA 3INRA 4XGIA 5HA5A 2OBNA 3VZRA 5JCXA 1QXSA 3SEFA 3NJ4A 4HFRA 4FFLA 4R1NA 3C7AA 1M67A 2IEBA 1G0OA 1TVEA 4MKRA 1C1DA 1O5IA 2C0CA 3GZ4A 1GYPA 4OH1A 2H6EA 1JAXA 4DL9A 3WTCA 3WGTA 4DBZA 1Y1PA 1Y8QA 2O48X 4ITUA 4AJHA 3OJFA 4B79A 4EUEA 1PL7A 4R5MA 4IJVA 4P4NA 1KC1A 5ENDA 3ZV4A 4DC1A 2PKRA 5KIAA 4CR8A 1YDWA 2DPGA 1B7GO 1EFLA 2FMUA 3TZCA 3WGHA 4AJOA 3ZV3A 3NEPX 4RO0A 3OIDA 3RBZA 4ESOA 4B4OA 3PHLA 2G76A 3MZ0A 4HADA 3K73O 2YUTA 4BS9A 3N7UA 5TIIA 3JD0A 4PCVA 3OH8A 3KYBA 3JYPA 1WPQA 1I8TA 1OC4A 4YT4A 2AG8A 1H5QA 4IDCA 2ZK7A 1R0KA 1J49A 1UP7A 1BXGA 3QE3A 4UUPA 4MJLA 4CV2A 1JA9A 4CV0A 2A94A 3IKVA 3QSGA 1EQUA 2Q49A 1ADCA 2YYYA 2J6IA 3MWDB 3QY9A 3UVEA 1NYTA 3QJ5A 4HBGA 1U5AA 1VE9A 5CEEA 3W4KA 4YAIA 1RM4A 1Y6JA 4YJFA 4WCFC 3BMQB 1UJMA 2X86A 2WSBA 4RF5A 3ASUA 3CH6A 1E0DA 1GU7A 2W2LD 4O1MA 3FWZA 4E2ZA 3ZWXA 4A73A 5IDXA 4MVJF 3I4CA 2I5PO 2ZKLA 5KJFA 3PLRA 3QP9A 1GPJA 5G4LA 3ROKA 1ZK3A 4Y8VA 3KEOA 1I3NA 5B12A 4L4RA 5F3RA 4MINA 4N54A 4CM8B 1HYHA 3WGIA 1SEVA 3ZWNA 2X9VA 1U7TA 4AJEA 2ZYGA 3F9IA 1NHWA 2EV9A 4O63O 2GCGA 4J0FA 4JLWA 2NQ8A 3I5MA 3EVNA 3CIFA 9LDTA 1E1NA 1OI7A 3JYNA 3RUAA 1B26A 4Z9FA 4KUHA 4NJMA 3D3WA 5L3ZA 4DQUA 5I7VA 5KWEA 5TC4A 4QUKA 1DXYA 2GO1A 5F5LA 2YW9A 4W99A 1ULUA 3NX4A 3BZUA 2YHIA 3MTGA 1UZLA 4OMUA 4ILKA 3VPFA 1EFKA 3AUAA 4JNKA 4WLNA 4IMPA 1HXHA 1X7HA 4XRGA 3PWSA 3ZWCA 4YAKA 5KVVA 2PLAA 3GN1A 4OL9A 1J5PA 2EG9A 3F4LA 3AI3A 4ZGWA 3OECA 5JXWA 4PLTA 3TQHA 3OQ6A 3PK0A 3JD1A 5G2OA 3ZCXA 4AJPA 1H9BA 2G1UA 2NTJA 4KWHA 2OO5A 4II3A 1HDGO 3GEDA 3PYLA 1SMKA 4LSWA 3CTMA 3ZNOA 3W6UA 2YFHA 3CMMA 2C07A 1GZ3A 1E7YA 1T2DA 3JQEA 2X22A 4R9RA 4UVIA 4W9NA 3E48A 3JYOA 1DOHA 2OZPA 4R01A 5TLSA 3FNFA 4QXMA 5HTOA 5TT1A 3ZDFA 1D1TA 2X0JA 4D79A 2SCUA 1J0XO 3H7AA 1H2HA 1UXKA 3DDNA 4P22A 1TXGA 1Q1NA 4MVJP 5U1PA 3R1IA 3S2FA 2C59A 3KETA 1TLTA 1RJWA 1EMDA 3RKRA 3I9JA 4CLOB 2Y99A 2HO5A 1N9GA 1SNYA 1N92A 2XPCA 3RC2A 3VZSA 1WDMA 3DMTA 4IQ0A 3GDGA 2TMGA 2VZ0A 2VYVA 3TNLA 1MC5A 4DA9A 4WLFA 3K8ZA 3F46A 2VHZA 2VRCA 4DC0A 3PTZA 4GMFA 3HB5X 4KQXA 3S8MA 1A9ZA 2BLLA 2ZCVA 2H63A 3M6IA 5JMPA 5HBRA 5BR7A 1NQAO 4J1TA 1MP0A 1PQPA 2PY6A 1I2CA 4E12A 2PD4A 4ALNA 1Q7BA 4YJHA 2I66A 4XCVA 3F5QA 3ZWBA 1GADO 2O7QA 3WGGA 5ER9A 1M6WA 4LW8A 3IJPA 2DUWA 4YJDA 3GG9A 2XAAA 4J7UA 2IYOA 2Q1TA 3NTRA 5IAAA 3GOHA 1RM3A 4YXFA 3BMCB 3SBOA 2VTDA 2A9FA 1R37A 2E4AA 4FBGA 1ENZA 3OQBA 2UUOA 4JBHA 2DQ4A 3H3FA 2NNLD 4WOJA 4J91A 5G0VA 1BW9B 1FDVA 3FTNA 2PH3A 5FI5A 1HEUA 4CM4B 5G0TA 1A4UA 3K31A 3I52A 4GGPA 2J3IA 4BO5A 3TFQA 4L4SA 4L76A 2VOEA 1JWAB 1E7RA 1NWHA 5JO9A 1PGOA 1E77A 1E1LA 1WLYA 3OETA 4AJ1A 1LLQA 1A7AA 3RUCA 2JHGA 2HRZA 1ISMA 1Q0LA 2JAPA 4E30A 3TZKA 1NFRA 2AW5A 5JC8A 3JD2A 4BVAA 2OP1A 5AXBA 1ARZA 4I5GA 2XXBA 1UXJA 2GZ2A 2NV6A 1GDHA 4XGKA 8ADHA 4XR9A 2WWRA 1E3EA 3ENKA 3LT4A 1DJNA 2JFHA 5EERA 1NVGA 1JDJA 3AWDA 4J2HA 4MKXA 5TQVA 4EW6A 4CM9A 3GPDG 2QX7A 4XX0A 4BKOA 3GAZA 1RPNA 2HMTA 3QVSA 5ER6A 3HNPA 3E6AA 1Q0QA 2A35A 2WYVA 1X0XA 4NU6A 3JV7A 4P4LA 1EBUA 3ICPA 4LVCA 3RKUA 3HB4X 3U9LA 4CUKA 4K9DA 1DFHA 5I9LA 3OA0A 3LDHA 4OQZA 4ZU3A 4BMSA 1IB6A 1YKFA 1UAYA 4F3YA 4RPKA 4XQ9A 1HDCA 3F47A 1UXIA 3SJ7A 1LDGA 4U5QA 4I5DA 4A03A 2UUPA 2I6TA 2P9GA 2QHXA 1C3VA 2FPIA 4Z9XA 4BNMA 2X9GA 4UVHA 3TWOA 2Q4EA 3MJVA 3WG9A 4R41A 1XQ1A 2OBYA 2DU8A 5HS6A 1LNQA 4F45A 1KOLA 4Z6KA 2HUNA 1PJCA 5GMOA 3DMYA 2HKIA 3F3SA 4II2A 3CKYA 2X0RA 4PG8A 3O8QA 4M89A 1SAYA 1RYDA 2AA3A 4DLBA 1SOWA 1OZAA 1R0SA 3SLGA 3OSUA 1X14A 5I7EA 4XKJA 4QT0A 3H2SA 4J6FA 5G4KA 1LDEA 1ISIA 4I9NA 2ZB8A 1VC2A 3Q2KA 1LJ8A 2DTDA 5IJZA 4Q3EA 3I9OA 1U9JA 3JQFA 3ZWOA 3PYMA 3WTBA 3WSVA 3FNHA 2YY7A 4FGWA 1ZSVA 5LCXA 2NTNA 4WGGA 2PV7A 4UVEA 3UICA 3X2FA 5A04A 4KTVE 4BGUA 2VT3A 2YQ4A 4MVJM 4AL4A 3NGLA 1QR6A 4BO0A 4YVFA 4BO4A 4PZDA 1YQGA 3IUPA 4NFSA 1SPXA 3G1TA 5JPIA 1BVUA 3GR6A 4BNJA 1LQTA 4GQAA 3GN2A 4TRJA 4PVCA 5KJEA 5A4DA 3E5MA 5L7WA 1MGOA 4NJMB 3D3WB 4E4YA 3O26A 4GKBA 4AICA 3F5SA 1G6KA 2CDCA 4MDHA 4PG7A 3CSDA 2YHIB 5HM8A 3CPSA 3VH3A 1PJTA 3AI2A 5A02A 5G0SA 3JQGA 5L4NA 2O3UA 3UW3A 3SX2A 3JD3A 2BGMA 3T7EA 1HLPA 4EJMA 4AJ2A 3ZNQA 5DNAA 3GRKA 3L07A 5TNXA 3PHGA 1W8DA 4IGFA 4NZ9A 1GYQA 1NVTA 2A4KA 5L7YA 3LT0A 4J4TA 1GEGA 3I9LA 1YB5A 5T6BA 4E5NA 1IUKA 4WLUA 3B70A 5AVOA 4FB5A 3RUFA 3BHJA 2CF5A 4WPGA 5I8WA 3TF5A 2NU6A 4RL6A 5DP2A 3ZH2A 4UEJA 4J16A 1XSEA 1J6UA 4A10A 4I1IA 3Q0EA 2HJSA 3WBFA 2FHSA 4KDFA 3PWZA 4K1LA 2GYYA 1BHSA 2RHCA 1I2ZA 2GERA 3ITKA 4RLSA 2IDZA 2WMDA 1U2GA 4C7KA 4QTZA 4KUGA 4I5EA 2O7SA 2IRWA 2I65A 2DBRA 2PZKA 3DAGA 4JN6B 1QYXA 3S2IA 4E6PA 2ZB4A 1N7GA 1LDMA
chains in the Genus database with same CATH superfamily
2C4NA 2GWRA 2BEVA 4K86A 2H59A 4FW8A 1MB2A 2BM9A 1LPNA 4QUAA 2ZIXA 3U81A 2I2XB 3WLMA 4K1XA 1KEUA 4HH3C 4R8KA 2ZRDA 5ARDA 8LDHA 3M4ZA 1X9IA 3W2GA 5E7IA 1CEEA 3PCTA 1XQXA 1JJBA 2AVNA 4JFRA 2DFLA 2ORED 2AD5A 1VP9A 2BFEB 1TF7A 1IBLB 5F7XA 1C1XB 1C3OB 4IEEA 2JLXA 4R4JA 3T99A 5A0VA 4CR6A 4L75A 3W7BA 3SIXA 3GXBA 3FNRA 4G41A 1PEYA 1V8OA 3FFAA 4WRRA 4ZVQA 3Q72A 3SLRA 4DR3B 3RRYA 3RYCA 4GLBA 1JQLB 1FJHA 3P2KA 5B1EA 5K8CA 2BBTA 2XVXA 3C8MA 4JYBA 2XEXA 2GM3A 4QVGA 5ES3A 1ACMA 5T6MA 3I6YA 4UNPA 3RCBA 4PZZA 4O02B 2P6PA 1L5WA 1P1RA 2NUPA 5CFPA 1QGYA 2CMGA 2PBZA 5AFSA 5GJBA 3SU8A 2ID9A 1KNQA 1XIVA 4LCJA 5CCDA 4ZO7A 2V8OA 3CF4G 4X8HA 3AV3A 4V0MA 3RLFA 4ENSA 4QEZA 2VWGA 4NBTA 4HDRA 3VPCA 4CM8A 1GLVA 1PD0A 3E7PA 4FINA 3K9FC 1VBFA 4L7QA 2QUAA 1V25A 4KGXA 1T1SA 3LH5A 5COQA 4WZAB 4BO3A 1P0CA 1YR8A 2Y0CA 3EG5A 3R6LA 4G1EB 4IIYA 4LQCA 3DE5X 1X7DA 5GM2A 3VMFA 5J23A 4MDFA 1NRWA 2IS1A 3M49A 3FUTA 4WKGA 4XD7D 1NG1A 2UKDA 3DKRA 4HO1X 3R74A 1WSWA 4ALKA 1BEEA 2FJ0A 2EX0A 2ZI6A 4R54A 3SZLA 1YJ5A 3IEKA 1QQBA 3MT7A 2RCNA 3RF6A 3R7LA 3FOEC 2VH1A 2HNKA 5KSOA 2BCGY 2I6SA 3TZ6A 3CG4A 4YH1A 4J0EA 1CUBA 4MLZA 3CZAA 1BWQA 4BPRA 4XX0B 1ZK1A 4X7BA 5PGMA 2YBDA 5EKUA 4XDGA 1SBTA 1DDGA 1U5BB 2RHWA 2R6CA 2VA8A 1RCFA 3Q1LA 2QN3A 3FYDA 4PHCA 1GQFA 1JIUA 1IZ8A 4BNKA 1U7OA 1BKDR 1Q5PA 4HWSA 4MGEA 4DSAA 4LZWA 1I4EB 3FGPA 3BQ9A 4RMIA 1GPKA 3SR4A 2JBHA 1EIWA 2J9FB 3KOUA 4FFWA 4FUQA 2E85A 1Y3AA 1YSCA 1XE3A 3LP5A 4W7IA 3MJRA 1XZPA 1R5OA 3EXAA 2PNJA 2H2FA 4WNIA 4AMGA 1TK2A 3A6KA 3WHPA 2ONKA 3PD1A 4QOEA 1SQSA 1IRXA 4ZN6A 5J5VA 1SELA 1KETA 1SUAA 2PJDA 4JKIA 2YRFA 4KO1S 1JQKA 2F1RA 1M6VB 2VJPA 5TX7A 1LW7A 2R8EA 5CXUA 4ZCPA 5A3VA 4MUHA 4KOAA 3IJ5A 5EXSA 4DJDC 3UKJA 1INLA 1YQQA 2WD7A 4W8GA 1EGHA 2YJNA 1XRRA 1YMVA 3DAFA 5EIFA 3DE1X 3SVZA 1KJZA 1ZC3A 4DAEA 1ZY2A 1SCAA 2JJ2A 3OF5A 4HNRA 1UC8A 1I7NA 3OLCX 3T1TA 5EIXA 2CDRA 3PVZA 1P1BA 3BXGA 5FOXA 4YYEA 1J8DA 5FF9A 4FHFA 2ZCJA 2O6HA 5CG2A 3R76A 3LECA 5EWJB 4OAOA 4EL5A 2A9VA 1RZVA 2AMJA 3GEGA 2H18A 1W52X 1CJCA 2KS6A 4W8HA 2QVLA 1ZO8A 4DXDA 1THMA 3GGGA 5AVQA 4Z51A 1QZZA 1OGJA 1AK1A 1MG5A 1MO4A 1Y9AA 2ARKA 1ZVJA 3AL2A 5JH7F 2O8DA 4HAWA 2O19A 1W0KD 1VGQA 4PRYA 4L22A 3BGWA 1DELA 5I9BA 1XYVA 1K6JA 1XDBA 3KQVA 3W6ZA 3HP4A 4N5NA 4ND6A 1JL3A 3HO1A 4HTAA 4LNAA 3SEAA 1FL9A 2BOVA 4H4DA 2XT9A 4EG7A 3G49A 4RDCA 4P58A 4MIEA 3SQNA 4DPLA 1QONA 4UM9D 4ZYLA 3GFBA 1T4MA 3LXRA 4P4TA 4ED9A 5A3JA 1GFWA 4PIMA 5HZKA 5DGXA 3PNPA 3PNLA 3BGOS 4DCUA 4B0PA 2DJIA 2HMUA 1WW2A 4DWOA 4PZLA 3H1PA 5KYXB 3V55A 2Q28A 5JSZA 3JX9A 2RGNC 1Q2XA 1NZFA 4AUMA 1RQ7A 3I3SR 4RGQA 4NMWA 1R7RA 4FHDA 2HDNB 2AXNA 1M2OB 3NCHA 1ECLA 2A88A 1EX9A 3HVKA 4MMZB 4XEHA 4HVAA 4MPDA 3I2FA 3Q3IA 3HU2A 4HHEA 3WKAA 1BGWA 4MPRA 1ESZA 4HWPA 4MGZR 4HQFA 2ZI4A 3PGJA 3S5JA 2YH2A 1NKTA 3OOSA 3UGQA 3F5FA 1H2XA 3EC1A 3GMDA 1C3XA 4IO1A 4OY3A 4R3WA 4F4JA 3AR3A 2QRQA 4RPJA 3G02A 1ENOA 3BJEA 4PLPA 5F1PA 1ADGA 1E4OA 4BAGA 3EMKA 5D3MB 3B6ZA 3EVTA 1B8UA 4CM4A 1FUIA 3OPYA 4NK4A 4U2CA 4O0LA 1FJGB 2Y05A 5JI3E 3GLFE 3G2IA 3V1UA 5I48A 2DR2A 3OT5A 2IIPA 2R44A 2W70A 3THWB 3ZI4A 4FFMA 5BWMA 2J4CA 5FQNA 5MDHA 1WP9A 2Q21A 3JYHA 3EQ7A 5FFNA 2BFCB 5F52A 5FNVA 3SK0A 1E3JA 3OU2A 4X7PA 5B1SA 5LYJF 3GLHE 1A2KC 4WIAA 1JSLA 4QQNA 2WDPA 4N65A 2C5EA 5A1JA 5FDFA 3A37A 2OQIA 5EIEA 4RACA 4H60A 2NPOA 2C2MA 3NWPA 4C07A 4IUBS 1AT1A 1XZBA 2Z5LA 3V2UA 4M8KA 5F73A 4RQAA 2QVBA 4G4IA 5BV1A 1EUZA 1N34B 1QRRA 2R3SA 5EWLB 3KOOA 1DTEA 1BKYA 1N75A 2R48A 4DMHA 4QDUA 2WTEA 3PYXA 1PZXA 4JQCA 1RZRA 5I8ZA 2WABA 4LF6B 1T9DA 2CXPA 3RGGA 3NWJA 4DUYB 5JQGF 2E55A 3GMSA 3VR4A 3VYUB 3OFKA 4U2DA 1T1EA 5C4IA 3G1WA 1TW2A 1LC3A 2DFPA 4FC6A 1YB4A 2AMYA 4Z2YA 2NV2B 3ZXXA 4XIYA 5A2QA 1SZCA 4RGYA 2FE1A 1CK4A 4I6GA 3FPLA 4GMDA 4BCDA 3IQXA 5FPYA 3EGXB 4RZIA 3HWRA 2QTTA 3OHSX 2PXHA 3G5LA 4HEJA 2BEVB 4WWHA 3GGOA 4MVJA 4R3UC 3PUHA 1GL7A 1RWBA 2XNDA 4Y1RB 5ELMA 3TMYA 4D6XA 1ZR4A 1FNBA 3H8WA 2I4NA 1V4VA 2CN1A 3OZRA 4BKRA 3E61A 1IZZA 1EEXB 3T3PB 2WR8A 1CQJA 1P8AA 1QGOA 5CVCA 4DCVA 2WHQA 2I76A 1G66A 1J2RA 1SCUA 1P8JA 3CFYA 3EGIA 3EODA 4P3XA 4ZJZA 2CLIB 3AFMA 4A6XA 1QKKA 1NU6A 2J9YB 3AM4A 3EXFA 3PNBA 1U7PA 1GP2A 1PP4A 3HBFA 3SN6A 4INOA 1HWYA 3PG5A 3LYUA 3UTDA 4CMAA 2Y76A 2DOKA 3U16A 3LBIA 2D3WA 1WUHS 4IHQA 1LLCA 5K0CA 3PXGA 4B7UA 3KBBA 5IU6A 2B3DA 3JWJA 4KXFB 4CKCB 2OHFA 1MO3A 1R9GA 1UWCA 4R1MA 3M70A 5JVDA 3RKSA 1AUVA 5JBQA 2C2WA 1HYGA 4UBKA 4EFMA 3RHTA 4ZYZA 5AUOB 1OAOC 4XB6B 4LYGA 1I0ZA 2IJGX 1BH6A 2DFDA 3NUZA 1B15A 2ZYRA 5LZ8A 4R9UC 4OK3A 4FR2A 3IVMA 2B6HA 3L0SA 4P33A 5K3EA 5CH5A 4UASA 3BQMB 3SKXA 2ZSUA 1NOKA 2JGKA 1PGNA 2BEUA 3Q98A 4G1CA 1NBHA 1ZXLA 2ZSJA 3DCJA 3RJ5A 2A0UA 4OXIA 2O23A 3A27A 1L5SA 2NX2A 3G2OA 4MCJA 1X8XA 3ZWMA 3WVNA 4CMEA 3GARA 4PGAA 4ZVUA 2G0TA 5LZ9A 3D6NB 3V7NA 1PZNA 3DLIA 4WKCA 3NRCA 3RF7A 1RI5A 3EZYA 1JB9A 2ZYTX 4LAFA 4LUCA 3SBEA 5L6LB 4RVGA 3AVVA 2BZSA 1U2DA 1UEXC 5HIIA 1B3RA 4HUQB 1E0SA 1LVHA 1UPFA 2Q2WA 4DQXA 3SQXA 3WIEA 1MPTA 2GK3A 2IH4A 4D6YA 4HDKB 3HU5A 3R2JA 1E9FA 2V97A 3B6KA 2OORA 3KB6A 4P92A 4BAUA 1U0GA 4MKHA 3IBYA 3P9YA 2I2DA 2VCYA 4FOPA 3D54D 1GD1O 1AS3A 2AJCA 3Q8WA 4M7WA 3LHDA 1E6UA 1PT7A 3JVIA 3B82A 5AW7A 3GJ7A 4BRUA 4IHAA 1M34E 3RFTA 1I9GA 4OCZA 4W7HA 5JH7B 4YUZA 4RMHA 3W3AD 4F6RB 5CT9A 3H2ZA 1IB0A 2V5VA 3CUSA 3M6MD 2JRCA 2YDXA 4FR5A 4FFNA 2PQ2A 4TKVB 5FPSA 3UAVA 2OMKA 1BIFA 1TPZA 3ZW8A 1E6MA 5AVRA 3EG9B 4E88A 4UNQA 5TGZA 3GFOA 4N76A 2GO7A 2ZUWA 2DHRA 1N0VC 3FLBA 4A73A 1I32A 2OK7A 3AJRA 2WD7B 4JIMA 3ZI7A 4BN4A 5AI4A 1XPRA 4L8VA 2ZDQA 1M1ZA 1V1JA 4BLPA 1IU9A 1R0YA 5DCWA 1IN7A 1V2HE 2YQZA 1SWWA 3NHBA 4FHGA 4I6EA 4HDAA 3ROTA 2W00A 4TSFD 4UBIA 2DH6A 2FUKA 1G64A 2PJZA 3IOYA 3OOYA 5KTKA 2J45A 2P11A 3CLRC 3UGKA 2PSFA 3AM5A 3V1MA 1J2EA 1QGZA 1CDDA 1ZK2A 4RSRA 4Z9BA 1R4MB 2Q9UA 2X40A 2YZKA 1YCFA 2Q50A 4N5LA 2AI2A 2W58A 3KC2A 1PJSA 4KLZA 4TL7A 2WTNA 3QLUA 3H9UA 4YIKA 1XLWA 3T7CA 2IUEA 2HI0A 4M9ZA 5DLYA 4RPLA 5AKEA 5TQ2B 3VO8A 3ZE7A 2VPXA 4MO9A 2BFMA 2ZWMA 3F6RA 2W2KA 1U65A 2CVQA 3G0IA 4Q0MA 3HU3A 5KSYA 1XTUA 4KITB 1QCYA 4LDQA 2QAJA 5JATA 2CK3D 3PP8A 5TF4A 4J7CA 1YI1A 2YZ2A 3K0AB 1D9XA 4II7A 1K6IA 1T5LA 3C6BA 2VF5X 5COAA 1L2TA 4DNPA 2BBOA 3LIPA 4DXAA 3HS3A 3UM9A 5BORA 2E1RA 2DFVA 3HWX1 3PZRA 5LYJB 5K3FB 3O9MA 3COWA 1U94A 3OCZA 4HH0A 5JSZB 1JXMA 4MWDA 3OJOA 5K6AA 4UNIA 3DVLA 3PQ3A 1VKHA 1C0IA 3VHRA 2PPVA 3IV6A 3VVLA 2PGXA 1Q1QA 2D2FA 4B35A 4MKGA 2JAUA 4PRLA 4V0QA 3ZU2A 4B8ZA 4D7AA 1EP2B 1MA0A 4RZ2A 1G4HA 4IDNA 5DJ5A 2ZQZA 1JTFA 3WO1A 1AXEA 2VDNB 3FWPA 4BL5A 1RHUA 1ZUD1 4ERXA 5JQGB 4X54A 1ZIXA 5LDDC 1WOMA 3DDSA 3F8TA 3WNBA 4DIMA 3S8EA 1CXZA 3FHTA 4U1RA 4OKNA 1AGNA 3EXG2 1OFIA 1AQ6A 2WSSD 5C52B 3ZJTA 3FETA 2GN9A 2B7CA 2ZS7A 3I76A 1TLFA 3NYQA 4YDQA 1VFNA 4H59A 3AB8A 1T2UA 1LRKA 2E4VA 3K1YA 1FRNA 3DDCA 1QLHA 1VGVA 3L0IB 3HKCA 4PC2A 3CRW1 1YZ3A 3GDOA 3NHLA 2NT4A 4OOEA 3PI6A 1EG2A 4RUKA 2XE6A 3AC0A 3EXEB 4BECA 1DO2A 2YFKA 3RT9A 3ZVNA 1TD9A 3Q41A 1ZCJA 1Y7TA 1ZM7A 1MQAA 1U2GC 2D74A 2PMEA 5I5EA 3TCXB 2VHYA 4K6FA 3TD6A 4OKIA 3ZCQA 4CRWB 4I3FA 2VJNA 4Q00A 4WK0B 4NBSA 1UWLA 3ANXA 4YACA 3ZD6A 1N6HA 3JTEA 2ET6A 3ZE1B 5LN1A 3IUQA 1ZK0A 4BVBA 4CG0A 5J40A 2FXIA 1O6BA 1DIHA 2MINA 4OUDB 3DTVD 4WXYB 3U3MA 5ECGC 5JASA 4B09A 3R9XA 2TMDA 3IQEA 3K32A 1ZD5A 1U0SY 2FPGA 2BRUA 3LY8A 3GA0A 4JNCA 1TO6A 5FO1A 3SPXA 1Z5NA 3IUNA 4OOFA 4P98A 3BILA 1J0AA 4RK4A 1YL7A 2FWAA 2JFXA 3DBHA 3EDQA 1M1YE 4IIEA 3WLEA 1F9AA 1Z4OA 3GI1A 4YX9A 3DB2A 1PSZA 2GBPA 1A50B 4KBFA 4HG2A 5KYYA 1U1EA 3IDZA 4TMKA 1Z83A 4HGOA 4ENTA 1RS0A 2HMVA 1JIKA 1AB5A 2G70A 3NLLA 3U5TA 4IG4A 5M7EA 4YMGA 3H8VA 4ZMRA 1XNJA 5HF6A 1S2MA 5CFQA 3F7MA 3NXKA 4RVHA 5FTMA 1ZGZA 4Z4QA 3OLVA 3PPIA 3C2QA 5DTQA 3OOHA 2K5UA 3BEDA 3F5DA 1SCUB 3TCKA 4IOLA 1JKMA 1P2UA 1IY2A 2A92A 2J3QA 3D4IA 3OE7D 3OJCA 3I04A 3GGDA 2DEUA 1B23P 3EXFB 4RKRA 1KSFX 5KX5B 5EZQA 3E03A 3KKZA 5JIBA 1XU4A 5P21A 4LI0A 3A3PA 1DQYA 2V65A 3BK1A 4RSMA 3P52A 1FXUA 2VUUA 2WM3A 3SC2B 3WRWA 1N2BA 1W85A 3E3AA 2VBFA 5H0IA 3RC9A 1J0BA 4D4KA 3W3ZB 1A3CA 3PD0A 2Y1DA 5AOBA 1SQ6A 2ZU6A 1K8XB 2K4MA 2OOSA 3W8EA 4BU0A 1MX3A 2IBMA 5FBLB 2AI3A 2EGGA 4Q34A 1WPGA 3B5IA 2VZ9A 4HCJA 4RK7A 3S44A 2XRYA 4HSGA 3ZY5A 4LMRA 4B2IA 1UZMA 2OGTA 2VJDA 3CU5A 1FP7A 2IELA 2GHQA 4R7GA 2NSJA 2WY2D 1PJQA 2QLLA 4BQEA 4MO2A 1Q0UA 1I4OA 1ATIA 1JT2A 3JRXA 3P5BA 4YN3A 1E2KA 4YUXA 4Q9IA 2CLCX 5IKOA 3STWA 1F17A 5DYYA 2B61A 4R05A 2BKUA 3TLZA 3VJMA 1JEOA 2BGTA 2C5BA 3ZZ1A 2IYSA 3EAGA 4PR3A 4ZCSA 1RJ9A 3WNQA 3B3QA 2WHXA 4OJYA 2PWZA 4YONB 4GR4A 4DARA 1PFYA 3SY8A 3GF4A 4GXTA 1Q6YA 3IVXA 2XHZA 3ADOA 3NIFB 1J1IA 1E1CA 4HH4A 5EUBA 5M34A 1N7HA 5JSFA 4D9FA 2AOXA 2RGDA 4MV4A 1PNTA 1EHCA 2G72A 1UBFA 3A1SA 1SFRA 3OQ1A 3UXHA 1J00A 4CV3A 1Q50A 3COPA 2X0KA 2QU7A 3FKJA 3NC0C 2AUMA 4Q9KA 5BNIA 4JYAB 3LDGA 1U9IC 2HQRA 3HUTA 1ZH8A 3UWMA 4IIGA 3AB7A 1UT8A 3D5QA 1HC7A 4D8VA 5EIAA 3LAWA 1T2EA 1W19A 4L74A 1QO0A 4R1PA 4AJ1A 1A5TA 2MIIA 1YBHA 2JGFA 5AJVB 4BNIA 1QK3A 1JI0A 1VDZA 2JBAA 1I3MA 4PBSA 2CLHB 2UUBB 3F7OA 4BFCA 3AVTA 4RZHA 4E5PA 3SQOA 4S12A 1Z3CA 5K0JA 2RK4A 5LB2A 3RBXA 1PN3A 5JWOA 3ABIA 3QLJA 5E6SB 4BYMA 1BA2A 4KAJA 3KJXA 5KAPA 5BO5A 1NXTA 2DJ5A 2N75A 5K2MA 4CGZA 1LY1A 1S8FA 3LLSA 1NVUQ 1OA1A 1LSOA 2WIJA 5JLJA 1ICEA 1C0KA 2P4HX 4FLFA 2GBLA 4TMVA 3FOZA 2DKNA 2H1RA 1B2LA 1E9EA 4DR7B 1UZNA 1OZHA 3ND8A 2Q6TA 1W88B 4ITVA 4TKMA 3ZLTA 1NN0A 1OXMA 1RJGA 1SVMA 3M6XA 2HF7A 1RQ2A 1H2BA 2GCOA 3I92A 3LLUA 1TB4A 1CEXA 1CUZA 1Y33E 2WJJA 4L15A 3FLAA 3L4BA 1RR6A 2BE7A 4JJAA 3UCEA 1JEEA 3K8OE 1N6PA 1RYMA 2HRRA 1Y5MA 3N86A 3PGLA 1E2NA 1RNLA 5DIFA 1CUGA 5EZSA 1DG1G 1KQPA 3A4YA 4I55A 2XD9A 5JJ5A 1NJ6A 3GJZA 4UNNA 3KSZO 5BRAA 1TK3A 1OFVA 1YIAA 1J99A 5T64A 1JXQA 3CX6A 4HRXA 3X1MA 3H4IA 4GM0A 4HVLA 1S2GA 3OX3A 5C8YF 2VYFA 5K0GA 1JDUA 3RV3A 1OT3A 4TTQA 4G1BA 3WDLA 3FTPA 1IUNA 3CW8X 3L7IA 2Z5VA 2H4XA 1HA3A 2BTQA 3C4VA 4FOTA 4K9LA 1H3EA 3PLAE 2QD5A 5AKGA 4A8JC 4ZDJA 5JJIA 2W2KB 1JVNA 3N2EA 4Y6RA 5CB4A 5JSHA 3SVLA 1A77A 1LSSA 3KB8A 4OAQA 5FEMA 3T7KA 3JQ7B 3I2JA 2WFZA 3VNUA 4Y2GA 2F8MA 2QR2A 3O1JC 4GEGA 2HT6A 2YFYA 4JJFA 1PSWA 2IT1A 3B9RA 2BN4A 2HADA 1DKQA 3K6JA 4XJXA 5F2EA 2IHJA 4R40A 1SK9A 4D0SA 1FFYA 1Z6ZA 5THXA 2ZCUA 2Q5FA 4GBED 1XL1A 4CNQA 1ADBA 3QKSB 2EFGA 2B1RA 2Q6IA 1XZDA 1U8AA 1VIDA 1XEXB 5F64A 1GNTA 4YQYA 5KSPA 3JQRA 4HFMA 2QRHA 3ZI0A 4Z4CA 3SQWA 3NBUA 1E2UA 2IL1A 4BEJA 1DV2A 2H2HA 3AKDA 1XMJA 4YRPA 3QY0A 4BIMA 1ADYA 2YZGA 2Y0DA 2FF7A 4D97A 3Q8LA 2AS0A 1KSGA 3ISTA 4V38A 3DP7A 1R15A 3PHBE 4ICIA 1O58A 3ODGA 2VUTA 3OD1A 4GM1A 2BLNA 4JP5A 3PEWA 4YT2A 2Z5GA 4DQVA 3TB4A 3AZQA 5CB4F 3MGCA 4RDHA 4CW7A 2O57A 3QK7A 5ITZB 2QRVA 1IHPA 1QNLA 4B84A 3WGQA 5AHRA 1Z82A 4AECA 1PJAA 2M98A 4HAXA 4G0VA 1AY0A 3LA6A 3QGMA 3Q7RA 3HKCB 4HMOA 3HC7A 3ESQA 1SUBA 1T8UA 1LPMA 4XYBA 3SLKA 3ZWQA 8OHMA 5CEFA 1JH9A 5IC5A 4RVDA 1IPFA 4K9KA 4M21A 5B6IA 5L7TA 4PG4A 2JZNA 4RZXA 2H54A 2VDJA 1L8XA 5JADA 5CMLA 5B4UA 1BHQ1 2B3TA 4LG1A 5DNWA 3QBJA 1J2UA 2O0LA 1XTPA 3K7EA 1EXMA 3LK6A 3DPSA 1W1IA 3LO5A 4Q9LA 3IP8A 3MB8A 4HZUA 1HT1E 2OM6A 1OFCX 5F7ZA 3TRKA 2JGEA 1A2BA 3MCTA 1PJ3A 3DR3A 1UK8A 4EI8A 2FPMA 1Y7IA 2G07A 1RYFA 2PKYX 2GFHA 1HFWA 2WI8A 3AIOA 3WGJA 1P81A 1MXHA 4DMCA 4HLNA 3EGDA 5ENVA 3KSBC 3PEEA 1KJYA 1OGIA 2OCBA 4O08A 2X42A 4D98A 2GB4A 2D3TA 1U4NA 2RH8A 3OFND 3PPXA 4Y2XA 2FQ1A 4P4GA 4YRCA 1BU8A 3EJWA 2CSXA 3DJFA 5B3AA 3TYXA 3E1GA 2A14A 2G08A 4DDVA 1JEQB 1KY5A 1OJ7A 1H0SA 3DC7A 3LUHA 3NO4A 3IQIX 1L3IA 2J9ZB 2NZ8A 4AZTA 4NBNA 1ZOLA 2A8YA 1BJKA 1N0UA 4QYMA 3H5TA 4KIFA 1OFGA 2X5XA 4OHPA 1XMQB 3LC7O 2PRZA 4MARA 3IP6A 1G2QA 2P35A 1M0TA 4KLAA 3SOPA 2MR5A 5JNRA 6ADHA 1V3TA 3RC8A 3BXFA 1ST2A 1VHLA 1O8BA 2JHCA 2ZROA 3THRA 1CR6A 1WVMA 4ETIA 4WNYA 5HYVA 4JC8A 1KK1A 2KYRA 4ZQHA 3EK2A 2M9MA 4BNWA 1V5WA 4JZYA 1YU6A 2CNWA 3PE6A 4K81B 1E5DA 3LZ6A 4LXUA 5DI3A 3L8ZA 1D7OA 5C31A 4XEUA 1FTWA 4GQBA 4UM9B 1YS1X 2HWUA 1Y5RA 2H92A 3RABA 1JG1A 2IBSA 1PT5A 3OJEA 3I53A 4K6KA 4EDHA 4E5YA 4ZAZA 4IJ5A 1FP2A 1C4WA 3AY7A 1FDSA 3K20A 3K6RA 1N2CA 1JG7A 3F6YA 3QPUA 4ME6A 1CWUA 1G0NA 2BW0A 1CC1S 2Y4NA 1SBNE 3AVPA 3GCDA 4ZU1X 1IN5A 5JWRA 2EJBA 2PTHA 5BYJA 5IBPA 1S4MA 4MWOA 1E2FA 3EIFA 4X71A 2X0NA 2W2XA 3HCAA 3OT1A 3RROA 3ZJ5A 3U1BA 1LLFA 1B43A 5LZ4A 4MW6A 1TU0A 4ZCQA 1F2UB 4EW1A 1RJ9B 3PNVA 4ARAA 3PEVA 4TYPA 4WXMA 4LDPA 1DQZA 1GQOA 3CPJB 1J09A 4JLNA 4JSTA 3IBCA 5E1OA 4GWGA 4QC2A 3U2QA 4IJKA 1U04A 4EX6A 4ZQFA 1OILA 3CRNA 4XCQA 2A59A 621PA 3O6VA 1O96B 4HGYA 5F21A 2ZYDA 3UJ3X 1U7HA 5FB3A 1BE6A 2XTJA 1JIQA 3FY4A 1YRHA 2FFQA 2FPUA 3JPYA 4H7JA 2BUBA 1SKAA 4K8OA 2GDJA 3A3KA 3RYIB 3UWDA 4TXMA 2VIIA 4MEAA 3ZVLA 4BFVA 4L9SA 1H6AA 3LMKA 4L3WA 5LDGA 1ESCA 4JL6A 3NHFA 4U9UA 3DL2A 1IWBB 2OCKA 2ZAOA 2D0OB 1IQPA 1PYOA 2CCKA 4W7SA 5IAJA 4EI9A 2NZ2A 4KAAA 3KSAC 4LSGA 1LSJA 5CFRA 2APJA 4UU0A 5H5JA 5JYBA 1I5OA 4XIIA 1YZVA 3FWYA 1WHTA 5F9FA 1B8VA 2JK1A 1YQXA 1YHNA 5C8YB 3PXCX 4AULA 5KI6A 3C3YA 5DSTA 3HACA 3U7JA 4WLVA 4G1MB 5EHIA 3V4PB 4KPYA 4P0PB 1EVQA 1OD6A 2D8AA 1Z68A 2J32A 1D04A 1M8PA 4ZO6A 2QY9A 5GONA 4GT1A 1TQ4A 2HDWA 2NO9A 2PX3A 1DBIA 3DGEC 1BAPA 2I1VB 2R1TA 3PXAA 4KFTA 3E8XA 5FAKA 2R68A 1V37A 2W48A 3N2ZB 4BTLA 4EKGA 5DMHA 2IOFK 2ESRA 1UBTS 2HRDA 2VPZA 3EFEA 1RBMA 3F6SA 2P68A 2R8RA 3E23A 4YFVA 2B35A 3VGPA 1FA9A 3OCJA 4G0MA 2PQ6A 1F0KA 3HG7A 2HK7A 4UDOA 1WNFA 5A0TA 4GH5A 4DMLA 3AHJA 4BP9A 3WWOA 1FLVA 1FNSA 5IC4A 1NW9B 1SJ9A 3QUQA 1DPGA 5T67A 4ZCTA 1GEEA 5CLJA 5SZIA 1H8ED 2Q99A 3C7KA 3M2PA 1KQNA 3ZTWA 3UMFA 2BMEA 2QUJA 3NT5A 4C7OA 4LX8A 2OCLA 1XVVA 1X2BA 1ZINA 5HFAA 4PONA 1ORVA 4FBLA 2BGUA 4D9CA 5JSKA 5CB4B 1KDTA 2Z30A 1MX1A 3TSWA 2ZRAA 2EKBA 4GX2A 4I7EA 4CIWA 3EARA 2PUCA 1TQ8A 1KY2A 2VQDA 3Q7TA 4WDRA 4BV3A 3OLXA 2NU9A 1HT2E 3NHZA 1RW4A 2VHVA 1Z25A 1P77A 3QVGA 4NPHA 5K09A 5L3VA 4ZKEA 2CD7A 4IDEA 1R12A 4L7VA 1AGXA 1MPXA 1YR9A 2EWMA 5C18A 3H2JA 3AF0A 1PGPA 3IQFA 3LNTA 2PZLA 5IXSA 3VR6H 1WHSB 3QM1A 3W05A 3AP1A 5EEGA 4QLBA 1A69A 1X7ZA 3IAFA 2ID4A 3FBGA 4RPHA 3ZXIA 1U3UA 2C95A 4AY3A 4BNXA 2ZUCA 2CWWA 2O8CB 5D87A 3T9DA 2N1BA 2I55A 3EA0A 4U63A 2QT9A 2ZRMA 2VF7A 3GLSA 3DBOB 4FUTA 1W4ZA 4WLOA 2OFXA 3L7NA 1EBBA 2I0FA 2I9PA 3TTWA 2QSYA 5D85A 5J47A 2UUCB 1KI8A 2ECFA 2F90A 1CRQA 3OD5A 2Q7XA 4BO1A 1IBCA 3IAAA 2QQFA 3NKVA 1MB0A 1XTJA 3FCOA 2P2SA 3D2CA 5AK4A 1PQWA 2PLNA 1JLLB 1R0CA 4NICA 1DT3A 1SWVA 1P60A 1CUHA 1VE1A 2VSFA 3OKPA 1Y7LA 5U4XA 5B58T 5G4LA 3DZDA 2PUJA 2HWWA 1UPUA 2QRPA 3C74A 3L8HA 3KT6A 2C4MA 4LYDA 2FK8A 4MV5A 5CK4A 3CNHA 4BWVA 2AFHB 1LS6A 5H68A 4HLCA 2XMBA 4I9GA 4S04A 4IQGA 3AOGA 1EWRA 3F2VA 4JROA 2QP4A 3TTYA 2ZBDA 2NZXA 3F3MA 3HJHA 4FOOA 4PLZA 1KEPA 3HMQA 5EI5A 4XGNA 1TEVA 4DMMA 3DYVA 1JDZA 1CULC 3LX4A 2BSQA 2ZEJA 3QJYA 5LZ5A 1RP7A 3EXIB 4W5JA 1JAYA 3VKWA 2B5OA 5JAPA 3JVVA 1WVGA 4G1FA 1WUTA 1L9KA 2NLOA 4L5IA 3CXRA 2PU5A 2OLKA 3NU1A 3TQRA 4ER0A 3DQQA 1WXHA 4Z0HO 1A9XA 4MUGA 1ZQ1A 4WBNF 1XA3A 3NGMA 3C85A 1E63A 5EJ2A 5KJCA 1S96A 4WACA 1TJ3A 2O2GA 1JSXA 2CCJA 1SPBS 1NMXA 2HD4A 1F9EA 2FZVA 4G5HA 4Z0NA 3DP9A 3EGDB 5LIRA 1OXKB 4JI3B 4C3UA 3GYGA 4FYWA 1H1TA 3PRHA 1RMTA 3R8XA 1OWOA 3RNLA 3ROQA 2CJWA 4E94A 3HNRA 3I1IA 1EK1A 3HA5A 2QV7A 3NUGA 3PQFA 5TY0A 1EDZA 3FSJX 2CXUA 4ISCA 4JQOA 1XCPA 5KTSA 4OQ4A 3WJ2A 4FYVA 3K6SA 4TZ0A 2AI1A 3KLOA 4Q03A 3DVRX 2VBGA 1JA1A 4MXDA 1T29A 2JIOA 2E5LB 2QM8A 2V54A 2IFTA 2CNOA 4JSYA 1DKUA 3W8NA 3CRMA 3GNQA 4BQRA 2O3RA 3PTLA 1GKKA 1NBIA 3HPQA 1AOXA 2QNBA 1Y9ZA 3G7UA 4I4TA 2I8AA 4HWOA 5EXDA 3SDZA 3W5UA 1SVSA 3ZZNA 3DFUA 3GQBB 1F7VA 4ZVRA 1DXQA 1EVKA 4NFYA 2PA3A 2XUFA 2EJUA 1P1KA 3OZXA 1TIKA 2WG1A 5AVZA 3ABRB 5KHOC 1N2ZA 2R4QA 3EY9A 4EGSA 4C88A 4ZV4A 5KOJA 2OG1A 4LECA 4CTKA 1WEKA 1W73A 3EW9A 4MUYA 1EKXA 2RONA 4Q9DA 5DI3B 5SYAA 3VHLB 3B1FA 1HEIA 1XCBA 4EJFA 5T5QA 1I13A 4LDJA 2ZUVA 3BB4A 4LPKA 1ISFA 2C4WA 2VZ8A 3OZUA 4IDFA 1MB9A 1O95C 4NC9A 4URXR 5JOQA 3RU2A 2R8BA 2R87A 1N2CB 4LZNA 4D4JA 1NPYA 4RNCA 2ZYSA 5BSHA 4IIDA 3FMOB 3R41A 3ICWA 5EQDA 5KSZA 1Q19A 5EMJA 3UQYS 5F33A 1NJFA 2ENWA 4MR9A 5A4KA 4UUNA 1EX7A 1E4VA 2UVPA 3DOUA 4I4TF 4IV0A 4N01A 5KTOA 4DIOA 1R00A 8MHTA 5ICEA 2AJTA 2DETA 1X8JA 2JKYA 3KWFA 5JS2A 5LJLA 4XSHA 1QZUA 1IVYA 4XI9A 4ZIRB 4CETA 4MA0A 4ESVA 3A2NA 4DIEA 5KTRA 3USZA 4OMFG 4OB6A 2IYUA 4D9HA 5FEUA 2MU1A 3OZFA 3CN9A 3VZCA 4BUZA 3IFSA 3CH5A 5JEEA 3K9NA 1CQZA 1H2YA 1XWIA 1G8PA 1W49A 3ZX4A 4N7RA 4BKUA 3EB9A 1GO2A 5AI0A 3RT7A 1JMYA 2LZ0A 2B94A 5HUQA 1CNEA 4LVUA 3TXAA 4IEFB 1F8UA 2WD9A 3ZVKA 1A8UA 2VT2A 3D6MA 1M2WA 3HFJA 1YJ8A 4QSHA 2ZP1A 5TRTA 3UKDA 1VBNA 3KVVA 3E82A 5T4EA 4PINA 1PW7A 1ZNQO 3PQDA 2Z4SA 1L5QA 4G5OA 1CLUA 2WHPB 3ZJUA 3A9TA 4GOJA 3D4PA 4QXAA 2NUAB 4LFAB 3P9QA 2FEPA 4BVGA 4R16A 3UXEA 1QTQA 2F17A 4JMLA 1M2JA 3KJQA 3V9PA 1Z4LA 3ULKA 2BJWA 3AF1A 3QQ5A 2N47A 3EZLA 4I50A 5BW4A 1RBZA 3ORFA 3QU2A 1U0NA 3LQ2A 5KYVA 1P5FA 1TNDA 3NW9A 4G8CA 1F51E 2E89A 3EWNA 3OSZA 1IULA 1TFRA 4IDQA 1TU4A 3FJOA 1NUAA 5C5IA 2WIGA 2O06A 3C6ZA 4B74A 3AHFA 3K0SA 3G8YA 2GPAA 5EIBC 4PX2A 3DFFA 1EWKA 4YAJA 4EEZA 3ZUPA 1ZQ9A 4Z9YA 3DDUA 1N57A 3WADA 4ENVA 1PK8A 2XE7A 4YUWA 3G85A 3S81A 4JOBA 5JAMA 1K2WA 4PAQA 4QDJA 2CHUA 4B3DA 5CDSA 3HBMA 1KP9A 3CZ5A 3TH5A 5TMPA 2FSHA 4H3KB 4KGVA 3WRXC 4I1UA 1KI6A 1CRPA 3JQBA 2ZZKA 3ERCA 2B7LA 1ZXBA 2GBGA 2XMRA 1AURA 3C3DA 1JP7A 1KI1A 5B36A 5L9AA 4KSCA 4RBNA 3KEGA 4DT1A 1K8QA 4HNVA 2VWPA 5D00A 4BBAA 4WCFA 2ZJ2A 4RIIA 5FBZA 1NQTA 2EDAA 3UB2A 4H7KA 2PH7A 2YRXA 3ZXSA 6GPBA 4XFDA 1DCTA 2CXSA 4MIOA 4R9NA 4TVKA 4EGQA 5LQDA 5EKXA 1MHTA 4OBWA 2OPHA 5DM70 3DC2A 4C7OB 1WV1A 2Q3LA 4WUVA 2BKXA 1U7XA 3EA5A 4L8WB 2XBUA 3BH0A 4LDZA 4LYAA 3BB3A 1JLKA 3W5HA 1HOXA 1UBJS 2AWNA 1IAQA 5DTEA 3U4QA 3IMGA 3GFFA 1C1DB 3EEQA 4ABTA 1I6WA 1X0VA 2BGIA 2G5PA 1SGWA 3UJBA 4P3PA 3QVGB 1BDJA 1TUGA 2AK3A 4PNPA 5BQXA 2JLZA 2OQ2A 3T7DA 1HNZB 4HNHA 4K87A 2OFOA 1PGJA 3IQGX 2Z09A 4RENA 3VZPA 4EB8A 4F12A 5KDOA 3AHCA 1NF8A 1X8KA 2O7NA 3E9RA 1Z6QA 3FKSA 3P27A 3Q8XB 2VRBA 5IAKA 5TEVA 2IHNA 1N7JA 2PU7A 1G8KA 4FSHA 4YV2A 4HDMA 2QX9A 1Y3FE 4BMCA 1FDUA 3ELBA 3MELA 4JLMA 3KBOA 2LD4A 2VPPA 1DS6A 3B85A 3LUJA 4PXYA 4J4BA 1VM6A 1B76A 3OWHA 4F3RA 1XZQA 4MI9A 4R2JA 1CFJA 1TZMA 4WBNB 1UBNA 1MEJA 2IHZA 4QBIA 3ZY4A 1L7RA 5FL7D 1UDWA 3PZBA 1C1YA 3SYTA 1SUFA 1TCUA 2AFIE 2NXEA 3OZIA 4L2IA 1TMYA 3MJFA 1B6SA 2BH9A 4Q1EA 3D8BA 2VHJA 1BXGB 3MHTA 4RHEA 1WW3A 2ZS8A 1PNQA 1QGED 2ZB7A 3DUFB 1OXTA 4QECA 4IGEA 5F98A 3OPXA 1LBEA 4G07A 2A3RA 2VAVA 3MNFA 3O83A 4K2AA 4JLSA 3VPSA 4B9EA 4DV7B 2C88A 3AF5A 1X7WA 3ZBQA 3LDFA 2SECE 2OY0A 1ZLXA 3R23A 4MLCA 3ZHXA 2GM5A 3BTSA 4HDOB 3MB5A 4FILA 1OLSB 1W75A 4HNAA 1THTA 3PDJA 3PIDA 1Z6YA 4WAUA 1ZVKA 4QU0A 2XWQA 3OA2A 2ASVA 3GDWA 1SBYA 2F3RA 4HPWA 2DPMA 5ALSA 3BICA 3U7GA 3TD9A 1AXGA 1VRVA 4BQIA 3MT8A 3OG9A 3E35A 4LHXA 3V9AA 3BZBA 1A9XB 4PFKA 4C7VA 4Q9AA 1RI4A 2B1QA 4WXRA 3SE7A 4FGZA 2HCRA 4U7TB 2WP0A 1RHMA 4CF6A 5JPCA 3BMXA 1NDQA 5MGBA 2L82A 2QTVA 5T4BA 1M6HA 4DUGA 4GGMX 1ATZA 2IPAB 4BQNA 1K4KA 4QDZA 4PLCA 2PIAA 2YY6A 4RESA 3UQZA 4PQFA 1FFGA 5KMGB 4YMVA 1QRAA 1WA5A 4Z4FA 4JD5A 1KR2A 2QQ5A 3A1VA 1YE3A 3L7JA 3Q7PA 2A9QA 4IQ4A 3RVKA 3WMEA 3K6SB 3H6GA 2Q62A 1D4AA 1QX3A 4KDEA 4ZOCA 3M7IA 1PZGA 1CZUA 1H3FA 5TPZA 1N8SA 1R6AA 1P3JA 2P69A 1ZN7A 1LRLA 2W43A 2W4IA 4OU4A 3UEOA 1TYZA 2C4KA 4JHXA 4Q7MB 2NN3C 3PX7A 3K94A 3FTFA 3KE9A 5GJVC 5CLGA 4I4TB 1PG5A 3SCZA 1OB2A 2WJGA 1WZNA 3CKMA 3H1AA 2AQIA 3NC4A 4KBGA 5BQ5A 1VL2A 1JU3A 1Q12A 1QHEA 1BCSA 2BF7A 2WE8A 2IH2A 4V1CA 3NDRA 5DISB 1HFKA 4EFDA 5KOJB 2QM0A