3ADZA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGACYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 114
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3adzA00
5DGNF 5B01A 5DHKA 4OMHA 2Q58A 3ICNA 3KROA 3ZMCA 2P1CA 4NUAA 4OKMA 4H5CF 3QKCA 2OGDA 3RMGA 4LLTA 3SDUA 2FTZA 4E1EA 5A0KA 3VJCA 1EZFA 3ICZA 1HXGA 3N1VF 1HM7A 5JV0F 2Z7HA 4FP4A 1YHMA 4KQUA 5JV1F 1RTRA 3Q2QA 4MC3A 1WY0A 4N1ZF 1YV5A 3KRAA 5HN9A 5E8KA 3WCIA 5AYPA 2E92A 2Z4XA 5ILHA 3QQVA 1WL1A 5DW7A 1KIZA 5B03A 1RQJA 4F6VA 3LEEA 3LZ9A 3MZVA 1WL3A 2F9KF 5AELA 2OPMA 4NFJF 3WSBA 3VJ8A 3PYAA 4DI5A 4LA5A 5DZ2A 1WL2A 4KQ5A 2Z4YA 2F89F 3BNYA 4LIXA 3VJ9A 2VF6A 3AQBB 3P41A 2E8WA 4KVYA 5IK9A 1V4KA 3WCCA 5EASA 4KQSA 1PS1A 4XQTF 4DEMF 2F8CF 2ZCRA 3WEJA 2F94F 2Z4WA 1V4EA 5ILKA 1DI1A 3V1VA 5JV2F 3LOMA 3CC9A 4DWGA 5B0IA 4MC8A 1RQIA 4EA1A 2AEKA 3KRPB 3W7FA 5CG5A 5HNAA 3BNXA 3EZ3A 2ZCOA 3KRFB 3UCAA 3NPKA 3OYRA 4KK2A 4LPHF 4N9UA 4DXJA 4E9ZA 5EATA 3N0FA 3N3DA 5DJVF 5DJRF 4H5EF 5IK6A 3ASXA 5H9DA 5ILZA 3N1WF 3V66A 2E4OA 5B0JA 3VJDA 2O1OA 2E8UA 3KB9A 3AE0A 2F92F 5ILYA 3P8LA 4JZBA 5B0KA 4RYPA 3CKEA 1N21A 5IM1A 2E8XA 4LFVF 3WC9A 3M0GA 2Z4VA 2Z50A 5ERNA 1YYTA 3PKOA 5E8LA 4E9UA 4KPDA 3LLWA 3S9VA 2H8OA 3P8RA 5KSXF 5DHIA 4DWBA 4LA6A 3M00A 5IMNA 5AHUB 4JZXA 3ACWA 3N0GA 3TC1A 2OA6A 5A0IA 1HXAA 3OACB 3CP6A 5ILJA 3M02A 4OMGA 4OGUA 2E90A 2AZLA 4NFKF 5DIQF 4GA3A 1N24A 5IKAA 4KFAA 3TS7A 4JYXA 3ZL6A 5HN7A 3VJAA 4KVDA 3G4FA 4GP1A 5DGSF 2RAHA 5IL3A 5EAUA 1JFGA 3OABA 5HN8A 1N1ZA 4RNQA 1WMWA 2Z52A 1VG4A 2E8TA 3SDVA 3LG5A 3SDTA 3WCAA 1DGPA 3KRAB 3KRPA 3M01A 4EA2A 1FPSA 1UBVA 4DZWA 3KRFA 1YQ7A 3WCBA 3ACYA 3IBAA 4RXDA 2PS8A 2EWGA 3N46F 3VJBA 4KVIA 1YJ4A 1VG6A 5ER8A 2E94A 4LFEA 3PYBA 5DGMF 5C05A 2Q9ZA 2Z7IA 2Q80A 3P5PA 3N5JF 4XQSF 2AZJA 3N5HF 4NKFA 3WEGA 5I1UA 5EROA 5ERMA 1YHLA 3NF2A 5CG6A 1UBWA 3DYFA 4LZCA 3WJKA 4LLSA 4F62A 3PH7A 3WCEA 4FJQA 5IL8A 1V4JA 4EA0A 1N20A 3LDWA 4ZQ8A 3KRCB 4UMJA 3AQ0A 2DH4A 2PS7A 4RXEA 4LUUA 3V1XA 3EFQA 5JA0F 3WEKA 1YYQA 2FORA 3Q1OA 3TFNA 1VG2A 1VG3A 3NPRA 3PDEA 4QXSF 2J5CA 4RXCA 5JUZF 1HXCA 4LXWA 3OACA 4KKMA 3SDQA 3ZMBA 3WCDA 2Q9YA 3Q2ZA 1YYSA 3ZOUA 3EGTA 3WCMA 3LMDA 3NRIA 4KPJA 4KVWA 4K10A 3RBMA 4PVXF 4F6XA 1HX9A 2Z4ZA 3AQCB 3WEIA 1UBYA 5IKHA 5B0MA 3WJNA 1HM4A 3ACXA 2AETA 2J1OA 1N23A 3WJOA 1N22A 2PS5A 2E8VA 2PS6A 4KUXA 3KROB 3LSNA 4RXAA 3KBKA 3LJIA 3ADZA 3RYEA 3LGKA 4MC0A 1VG7A 5E8HA 2QISA 5IMIA 2OPNA 3ID0A 3WCGA 3WCLA 5ILDA 4JXYA 2ZCSA 4GAXA 4PVYF 4NFIF 2ONHA 4LZ0A 4P0VA 2ZEVA 5B0LA 2ZCQA 3WCHA 2I19A 4LTVA 3TFVA 5DJPF 4KWDA 3G4DA 4GP2A 4NKEA 4LTZA 1JFAA 5A0JA 3Q30A 4OKZA 2PS4A 1WKZA 5IN8A 4P0WA 5B02A 3N3LF 4L2XF 1YYUA 4DHDA 1N1BA 1ZW5A 1WL0A 3TFPA 5B00A 2ONGA 4JVJF 3N6KF 4LZ3A 5AFXA 3WSAA 3KRCA 3ICKA 1V4HA 1YHKA 4P0XA 3P5RA 2ZEUA 4Q23A 2J1PA 4JXNA 2ZY1A 2E91A 3B7LA 4WK5A 1YYRA 1UBXA 3SAEA 3OABB 3WEFA 3WE9A 3ICMA 3LGZB 3N45F 3ZCDA 2AELA 4NG6A 3WEHA 3N49F 2Z78A 3RYWA 3SDRA 2E93A 4XQRF 3WCJA 3M9UA 4H5DF 3MAVA 1KIYA 3APZA 1V4IA 4QPFA 2E95A 3LVSA 4HD1A 4LOBA 2F7MF 2AZKA 3LK5A 4LFGA 5ILIA 5IK0A 3WCFA 3VJEA 3DYGA 5IMPA 3IPIA 4LPGF 3S4JA 5IVGA 2F8ZF 3DYHA
chains in the Genus database with same CATH superfamily
5DGNF 5B01A 5DHKA 4OMHA 2Q58A 3ICNA 3KROA 3ZMCA 2P1CA 4NUAA 4OKMA 4H5CF 3QKCA 2OGDA 3RMGA 4LLTA 3SDUA 2FTZA 4E1EA 5A0KA 3VJCA 1EZFA 3ICZA 1HXGA 3N1VF 1HM7A 5JV0F 2Z7HA 4FP4A 1YHMA 4KQUA 5JV1F 1RTRA 3Q2QA 4MC3A 1WY0A 4N1ZF 1YV5A 3KRAA 5HN9A 5E8KA 3WCIA 5AYPA 2E92A 2Z4XA 5ILHA 3QQVA 1WL1A 5DW7A 1KIZA 5B03A 1RQJA 4F6VA 3LEEA 3LZ9A 3MZVA 1WL3A 2F9KF 5AELA 2OPMA 4NFJF 3WSBA 3VJ8A 3PYAA 4DI5A 4LA5A 5DZ2A 1WL2A 4KQ5A 2Z4YA 2F89F 3BNYA 4LIXA 3VJ9A 2VF6A 3AQBB 3P41A 2E8WA 4KVYA 5IK9A 1V4KA 3WCCA 5EASA 4KQSA 1PS1A 4XQTF 4DEMF 2F8CF 2ZCRA 3WEJA 2F94F 2Z4WA 1V4EA 5ILKA 1DI1A 3V1VA 5JV2F 3LOMA 3CC9A 4DWGA 5B0IA 4MC8A 1RQIA 4EA1A 2AEKA 3KRPB 3W7FA 5CG5A 5HNAA 3BNXA 3EZ3A 2ZCOA 3KRFB 3UCAA 3NPKA 3OYRA 4KK2A 4LPHF 4N9UA 4DXJA 4E9ZA 5EATA 3N0FA 3N3DA 5DJVF 5DJRF 4H5EF 5IK6A 3ASXA 5H9DA 5ILZA 3N1WF 3V66A 2E4OA 5B0JA 3VJDA 2O1OA 2E8UA 3KB9A 3AE0A 2F92F 5ILYA 3P8LA 4JZBA 5B0KA 4RYPA 3CKEA 1N21A 5IM1A 2E8XA 4LFVF 3WC9A 3M0GA 2Z4VA 2Z50A 5ERNA 1YYTA 3PKOA 5E8LA 4E9UA 4KPDA 3LLWA 3S9VA 2H8OA 3P8RA 5KSXF 5DHIA 4DWBA 4LA6A 3M00A 5IMNA 5AHUB 4JZXA 3ACWA 3N0GA 3TC1A 2OA6A 5A0IA 1HXAA 3OACB 3CP6A 5ILJA 3M02A 4OMGA 4OGUA 2E90A 2AZLA 4NFKF 5DIQF 4GA3A 1N24A 5IKAA 4KFAA 3TS7A 4JYXA 3ZL6A 5HN7A 3VJAA 4KVDA 3G4FA 4GP1A 5DGSF 2RAHA 5IL3A 5EAUA 1JFGA 3OABA 5HN8A 1N1ZA 4RNQA 1WMWA 2Z52A 1VG4A 2E8TA 3SDVA 3LG5A 3SDTA 3WCAA 1DGPA 3KRAB 3KRPA 3M01A 4EA2A 1FPSA 1UBVA 4DZWA 3KRFA 1YQ7A 3WCBA 3ACYA 3IBAA 4RXDA 2PS8A 2EWGA 3N46F 3VJBA 4KVIA 1YJ4A 1VG6A 5ER8A 2E94A 4LFEA 3PYBA 5DGMF 5C05A 2Q9ZA 2Z7IA 2Q80A 3P5PA 3N5JF 4XQSF 2AZJA 3N5HF 4NKFA 3WEGA 5I1UA 5EROA 5ERMA 1YHLA 3NF2A 5CG6A 1UBWA 3DYFA 4LZCA 3WJKA 4LLSA 4F62A 3PH7A 3WCEA 4FJQA 5IL8A 1V4JA 4EA0A 1N20A 3LDWA 4ZQ8A 3KRCB 4UMJA 3AQ0A 2DH4A 2PS7A 4RXEA 4LUUA 3V1XA 3EFQA 5JA0F 3WEKA 1YYQA 2FORA 3Q1OA 3TFNA 1VG2A 1VG3A 3NPRA 3PDEA 4QXSF 2J5CA 4RXCA 5JUZF 1HXCA 4LXWA 3OACA 4KKMA 3SDQA 3ZMBA 3WCDA 2Q9YA 3Q2ZA 1YYSA 3ZOUA 3EGTA 3WCMA 3LMDA 3NRIA 4KPJA 4KVWA 4K10A 3RBMA 4PVXF 4F6XA 1HX9A 2Z4ZA 3AQCB 3WEIA 1UBYA 5IKHA 5B0MA 3WJNA 1HM4A 3ACXA 2AETA 2J1OA 1N23A 3WJOA 1N22A 2PS5A 2E8VA 2PS6A 4KUXA 3KROB 3LSNA 4RXAA 3KBKA 3LJIA 3ADZA 3RYEA 3LGKA 4MC0A 1VG7A 5E8HA 2QISA 5IMIA 2OPNA 3ID0A 3WCGA 3WCLA 5ILDA 4JXYA 2ZCSA 4GAXA 4PVYF 4NFIF 2ONHA 4LZ0A 4P0VA 2ZEVA 5B0LA 2ZCQA 3WCHA 2I19A 4LTVA 3TFVA 5DJPF 4KWDA 3G4DA 4GP2A 4NKEA 4LTZA 1JFAA 5A0JA 3Q30A 4OKZA 2PS4A 1WKZA 5IN8A 4P0WA 5B02A 3N3LF 4L2XF 1YYUA 4DHDA 1N1BA 1ZW5A 1WL0A 3TFPA 5B00A 2ONGA 4JVJF 3N6KF 4LZ3A 5AFXA 3WSAA 3KRCA 3ICKA 1V4HA 1YHKA 4P0XA 3P5RA 2ZEUA 4Q23A 2J1PA 4JXNA 2ZY1A 2E91A 3B7LA 4WK5A 1YYRA 1UBXA 3SAEA 3OABB 3WEFA 3WE9A 3ICMA 3LGZB 3N45F 3ZCDA 2AELA 4NG6A 3WEHA 3N49F 2Z78A 3RYWA 3SDRA 2E93A 4XQRF 3WCJA 3M9UA 4H5DF 3MAVA 1KIYA 3APZA 1V4IA 4QPFA 2E95A 3LVSA 4HD1A 4LOBA 2F7MF 2AZKA 3LK5A 4LFGA 5ILIA 5IK0A 3WCFA 3VJEA 3DYGA 5IMPA 3IPIA 4LPGF 3S4JA 5IVGA 2F8ZF 3DYHA
chains in the Genus database with same CATH topology
5DGNF 5B01A 5DHKA 4OMHA 2Q58A 3ICNA 3KROA 3ZMCA 2P1CA 4NUAA 4OKMA 4H5CF 3QKCA 2OGDA 3RMGA 4LLTA 3SDUA 2FTZA 4E1EA 5A0KA 3VJCA 1EZFA 3ICZA 1HXGA 3N1VF 1HM7A 5JV0F 2Z7HA 4FP4A 1YHMA 4KQUA 5JV1F 1RTRA 3Q2QA 4MC3A 1WY0A 4N1ZF 1YV5A 3KRAA 5HN9A 5E8KA 3WCIA 5AYPA 2E92A 2Z4XA 5ILHA 3QQVA 1WL1A 5DW7A 1KIZA 5B03A 1RQJA 4F6VA 3LEEA 3LZ9A 3MZVA 1WL3A 2F9KF 5AELA 2OPMA 4NFJF 3WSBA 3VJ8A 3PYAA 4DI5A 4LA5A 5DZ2A 1WL2A 4KQ5A 2Z4YA 2F89F 3BNYA 4LIXA 3VJ9A 2VF6A 3AQBB 3P41A 2E8WA 4KVYA 5IK9A 1V4KA 3WCCA 5EASA 4KQSA 1PS1A 4XQTF 4DEMF 2F8CF 2ZCRA 3WEJA 2F94F 2Z4WA 1V4EA 5ILKA 1DI1A 3V1VA 5JV2F 3LOMA 3CC9A 4DWGA 5B0IA 4MC8A 1RQIA 4EA1A 2AEKA 3KRPB 3W7FA 5CG5A 5HNAA 3BNXA 3EZ3A 2ZCOA 3KRFB 3UCAA 3NPKA 3OYRA 4KK2A 4LPHF 4N9UA 4DXJA 4E9ZA 5EATA 3N0FA 3N3DA 5DJVF 5DJRF 4H5EF 5IK6A 3ASXA 5H9DA 5ILZA 3N1WF 3V66A 2E4OA 5B0JA 3VJDA 2O1OA 2E8UA 3KB9A 3AE0A 2F92F 5ILYA 3P8LA 4JZBA 5B0KA 4RYPA 3CKEA 1N21A 5IM1A 2E8XA 4LFVF 3WC9A 3M0GA 2Z4VA 2Z50A 5ERNA 1YYTA 3PKOA 5E8LA 4E9UA 4KPDA 3LLWA 3S9VA 2H8OA 3P8RA 5KSXF 5DHIA 4DWBA 4LA6A 3M00A 5IMNA 5AHUB 4JZXA 3ACWA 3N0GA 3TC1A 2OA6A 5A0IA 1HXAA 3OACB 3CP6A 5ILJA 3M02A 4OMGA 4OGUA 2E90A 2AZLA 4NFKF 5DIQF 4GA3A 1N24A 5IKAA 4KFAA 3TS7A 4JYXA 3ZL6A 5HN7A 3VJAA 4KVDA 3G4FA 4GP1A 5DGSF 2RAHA 5IL3A 5EAUA 1JFGA 3OABA 5HN8A 1N1ZA 4RNQA 1WMWA 2Z52A 1VG4A 2E8TA 3SDVA 3LG5A 3SDTA 3WCAA 1DGPA 3KRAB 3KRPA 3M01A 4EA2A 1FPSA 1UBVA 4DZWA 3KRFA 1YQ7A 3WCBA 3ACYA 3IBAA 4RXDA 2PS8A 2EWGA 3N46F 3VJBA 4KVIA 1YJ4A 1VG6A 5ER8A 2E94A 4LFEA 3PYBA 5DGMF 5C05A 2Q9ZA 2Z7IA 2Q80A 3P5PA 3N5JF 4XQSF 2AZJA 3N5HF 4NKFA 3WEGA 5I1UA 5EROA 5ERMA 1YHLA 3NF2A 5CG6A 1UBWA 3DYFA 4LZCA 3WJKA 4LLSA 4F62A 3PH7A 3WCEA 4FJQA 5IL8A 1V4JA 4EA0A 1N20A 3LDWA 4ZQ8A 3KRCB 4UMJA 3AQ0A 2DH4A 2PS7A 4RXEA 4LUUA 3V1XA 3EFQA 5JA0F 3WEKA 1YYQA 2FORA 3Q1OA 3TFNA 1VG2A 1VG3A 3NPRA 3PDEA 4QXSF 2J5CA 4RXCA 5JUZF 1HXCA 4LXWA 3OACA 4KKMA 3SDQA 3ZMBA 3WCDA 2Q9YA 3Q2ZA 1YYSA 3ZOUA 3EGTA 3WCMA 3LMDA 3NRIA 4KPJA 4KVWA 4K10A 3RBMA 4PVXF 4F6XA 1HX9A 2Z4ZA 3AQCB 3WEIA 1UBYA 5IKHA 5B0MA 3WJNA 1HM4A 3ACXA 2AETA 2J1OA 1N23A 3WJOA 1N22A 2PS5A 2E8VA 2PS6A 4KUXA 3KROB 3LSNA 4RXAA 3KBKA 3LJIA 3ADZA 3RYEA 3LGKA 4MC0A 1VG7A 5E8HA 2QISA 5IMIA 2OPNA 3ID0A 3WCGA 3WCLA 5ILDA 4JXYA 2ZCSA 4GAXA 4PVYF 4NFIF 2ONHA 4LZ0A 4P0VA 2ZEVA 5B0LA 2ZCQA 3WCHA 2I19A 4LTVA 3TFVA 5DJPF 4KWDA 3G4DA 4GP2A 4NKEA 4LTZA 1JFAA 5A0JA 3Q30A 4OKZA 2PS4A 1WKZA 5IN8A 4P0WA 5B02A 3N3LF 4L2XF 1YYUA 4DHDA 1N1BA 1ZW5A 1WL0A 3TFPA 5B00A 2ONGA 4JVJF 3N6KF 4LZ3A 5AFXA 3WSAA 3KRCA 3ICKA 1V4HA 1YHKA 4P0XA 3P5RA 2ZEUA 4Q23A 2J1PA 4JXNA 2ZY1A 2E91A 3B7LA 4WK5A 1YYRA 1UBXA 3SAEA 3OABB 3WEFA 3WE9A 3ICMA 3LGZB 3N45F 3ZCDA 2AELA 4NG6A 3WEHA 3N49F 2Z78A 3RYWA 3SDRA 2E93A 4XQRF 3WCJA 3M9UA 4H5DF 3MAVA 1KIYA 3APZA 1V4IA 4QPFA 2E95A 3LVSA 4HD1A 4LOBA 2F7MF 2AZKA 3LK5A 4LFGA 5ILIA 5IK0A 3WCFA 3VJEA 3DYGA 5IMPA 3IPIA 4LPGF 3S4JA 5IVGA 2F8ZF 3DYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DGN F;  5B01 A;  5DHK A;  4OMH A;  2Q58 A;  3ICN A;  3KRO A;  3ZMC A;  2P1C A;  4NUA A;  4OKM A;  4H5C F;  3QKC A;  2OGD A;  3RMG A;  4LLT A;  3SDU A;  2FTZ A;  4E1E A;  5A0K A;  3VJC A;  1EZF A;  3ICZ A;  1HXG A;  3N1V F;  1HM7 A;  5JV0 F;  2Z7H A;  4FP4 A;  1YHM A;  4KQU A;  5JV1 F;  1RTR A;  3Q2Q A;  4MC3 A;  1WY0 A;  4N1Z F;  1YV5 A;  3KRA A;  5HN9 A;  5E8K A;  3WCI A;  5AYP A;  2E92 A;  2Z4X A;  5ILH A;  3QQV A;  1WL1 A;  5DW7 A;  1KIZ A;  5B03 A;  1RQJ A;  4F6V A;  3LEE A;  3LZ9 A;  3MZV A;  1WL3 A;  2F9K F;  5AEL A;  2OPM A;  4NFJ F;  3WSB A;  3VJ8 A;  3PYA A;  4DI5 A;  4LA5 A;  5DZ2 A;  1WL2 A;  4KQ5 A;  2Z4Y A;  2F89 F;  3BNY A;  4LIX A;  3VJ9 A;  2VF6 A;  3AQB B;  3P41 A;  2E8W A;  4KVY A;  5IK9 A;  1V4K A;  3WCC A;  5EAS A;  4KQS A;  1PS1 A;  4XQT F;  4DEM F;  2F8C F;  2ZCR A;  3WEJ A;  2F94 F;  2Z4W A;  1V4E A;  5ILK A;  1DI1 A;  3V1V A;  5JV2 F;  3LOM A;  3CC9 A;  4DWG A;  5B0I A;  4MC8 A;  1RQI A;  4EA1 A;  2AEK A;  3KRP B;  3W7F A;  5CG5 A;  5HNA A;  3BNX A;  3EZ3 A;  2ZCO A;  3KRF B;  3UCA A;  3NPK A;  3OYR A;  4KK2 A;  4LPH F;  4N9U A;  4DXJ A;  4E9Z A;  5EAT A;  3N0F A;  3N3D A;  5DJV F;  5DJR F;  4H5E F;  5IK6 A;  3ASX A;  5H9D A;  5ILZ A;  3N1W F;  3V66 A;  2E4O A;  5B0J A;  3VJD A;  2O1O A;  2E8U A;  3KB9 A;  3AE0 A;  2F92 F;  5ILY A;  3P8L A;  4JZB A;  5B0K A;  4RYP A;  3CKE A;  1N21 A;  5IM1 A;  2E8X A;  4LFV F;  3WC9 A;  3M0G A;  2Z4V A;  2Z50 A;  5ERN A;  1YYT A;  3PKO A;  5E8L A;  4E9U A;  4KPD A;  3LLW A;  3S9V A;  2H8O A;  3P8R A;  5KSX F;  5DHI A;  4DWB A;  4LA6 A;  3M00 A;  5IMN A;  5AHU B;  4JZX A;  3ACW A;  3N0G A;  3TC1 A;  2OA6 A;  5A0I A;  1HXA A;  3OAC B;  3CP6 A;  5ILJ A;  3M02 A;  4OMG A;  4OGU A;  2E90 A;  2AZL A;  4NFK F;  5DIQ F;  4GA3 A;  1N24 A;  5IKA A;  4KFA A;  3TS7 A;  4JYX A;  3ZL6 A;  5HN7 A;  3VJA A;  4KVD A;  3G4F A;  4GP1 A;  5DGS F;  2RAH A;  5IL3 A;  5EAU A;  1JFG A;  3OAB A;  5HN8 A;  1N1Z A;  4RNQ A;  1WMW A;  2Z52 A;  1VG4 A;  2E8T A;  3SDV A;  3LG5 A;  3SDT A;  3WCA A;  1DGP A;  3KRA B;  3KRP A;  3M01 A;  4EA2 A;  1FPS A;  1UBV A;  4DZW A;  3KRF A;  1YQ7 A;  3WCB A;  3ACY A;  3IBA A;  4RXD A;  2PS8 A;  2EWG A;  3N46 F;  3VJB A;  4KVI A;  1YJ4 A;  1VG6 A;  5ER8 A;  2E94 A;  4LFE A;  3PYB A;  5DGM F;  5C05 A;  2Q9Z A;  2Z7I A;  2Q80 A;  3P5P A;  3N5J F;  4XQS F;  2AZJ A;  3N5H F;  4NKF A;  3WEG A;  5I1U A;  5ERO A;  5ERM A;  1YHL A;  3NF2 A;  5CG6 A;  1UBW A;  3DYF A;  4LZC A;  3WJK A;  4LLS A;  4F62 A;  3PH7 A;  3WCE A;  4FJQ A;  5IL8 A;  1V4J A;  4EA0 A;  1N20 A;  3LDW A;  4ZQ8 A;  3KRC B;  4UMJ A;  3AQ0 A;  2DH4 A;  2PS7 A;  4RXE A;  4LUU A;  3V1X A;  3EFQ A;  5JA0 F;  3WEK A;  1YYQ A;  2FOR A;  3Q1O A;  3TFN A;  1VG2 A;  1VG3 A;  3NPR A;  3PDE A;  4QXS F;  2J5C A;  4RXC A;  5JUZ F;  1HXC A;  4LXW A;  3OAC A;  4KKM A;  3SDQ A;  3ZMB A;  3WCD A;  2Q9Y A;  3Q2Z A;  1YYS A;  3ZOU A;  3EGT A;  3WCM A;  3LMD A;  3NRI A;  4KPJ A;  4KVW A;  4K10 A;  3RBM A;  4PVX F;  4F6X A;  1HX9 A;  2Z4Z A;  3AQC B;  3WEI A;  1UBY A;  5IKH A;  5B0M A;  3WJN A;  1HM4 A;  3ACX A;  2AET A;  2J1O A;  1N23 A;  3WJO A;  1N22 A;  2PS5 A;  2E8V A;  2PS6 A;  4KUX A;  3KRO B;  3LSN A;  4RXA A;  3KBK A;  3LJI A;  3ADZ A;  3RYE A;  3LGK A;  4MC0 A;  1VG7 A;  5E8H A;  2QIS A;  5IMI A;  2OPN A;  3ID0 A;  3WCG A;  3WCL A;  5ILD A;  4JXY A;  2ZCS A;  4GAX A;  4PVY F;  4NFI F;  2ONH A;  4LZ0 A;  4P0V A;  2ZEV A;  5B0L A;  2ZCQ A;  3WCH A;  2I19 A;  4LTV A;  3TFV A;  5DJP F;  4KWD A;  3G4D A;  4GP2 A;  4NKE A;  4LTZ A;  1JFA A;  5A0J A;  3Q30 A;  4OKZ A;  2PS4 A;  1WKZ A;  5IN8 A;  4P0W A;  5B02 A;  3N3L F;  4L2X F;  1YYU A;  4DHD A;  1N1B A;  1ZW5 A;  1WL0 A;  3TFP A;  5B00 A;  2ONG A;  4JVJ F;  3N6K F;  4LZ3 A;  5AFX A;  3WSA A;  3KRC A;  3ICK A;  1V4H A;  1YHK A;  4P0X A;  3P5R A;  2ZEU A;  4Q23 A;  2J1P A;  4JXN A;  2ZY1 A;  2E91 A;  3B7L A;  4WK5 A;  1YYR A;  1UBX A;  3SAE A;  3OAB B;  3WEF A;  3WE9 A;  3ICM A;  3LGZ B;  3N45 F;  3ZCD A;  2AEL A;  4NG6 A;  3WEH A;  3N49 F;  2Z78 A;  3RYW A;  3SDR A;  2E93 A;  4XQR F;  3WCJ A;  3M9U A;  4H5D F;  3MAV A;  1KIY A;  3APZ A;  1V4I A;  4QPF A;  2E95 A;  3LVS A;  4HD1 A;  4LOB A;  2F7M F;  2AZK A;  3LK5 A;  4LFG A;  5ILI A;  5IK0 A;  3WCF A;  3VJE A;  3DYG A;  5IMP A;  3IPI A;  4LPG F;  3S4J A;  5IVG A;  2F8Z F;  3DYH A; 
#chains in the Genus database with same CATH topology
 5DGN F;  5B01 A;  5DHK A;  4OMH A;  2Q58 A;  3ICN A;  3KRO A;  3ZMC A;  2P1C A;  4NUA A;  4OKM A;  4H5C F;  3QKC A;  2OGD A;  3RMG A;  4LLT A;  3SDU A;  2FTZ A;  4E1E A;  5A0K A;  3VJC A;  1EZF A;  3ICZ A;  1HXG A;  3N1V F;  1HM7 A;  5JV0 F;  2Z7H A;  4FP4 A;  1YHM A;  4KQU A;  5JV1 F;  1RTR A;  3Q2Q A;  4MC3 A;  1WY0 A;  4N1Z F;  1YV5 A;  3KRA A;  5HN9 A;  5E8K A;  3WCI A;  5AYP A;  2E92 A;  2Z4X A;  5ILH A;  3QQV A;  1WL1 A;  5DW7 A;  1KIZ A;  5B03 A;  1RQJ A;  4F6V A;  3LEE A;  3LZ9 A;  3MZV A;  1WL3 A;  2F9K F;  5AEL A;  2OPM A;  4NFJ F;  3WSB A;  3VJ8 A;  3PYA A;  4DI5 A;  4LA5 A;  5DZ2 A;  1WL2 A;  4KQ5 A;  2Z4Y A;  2F89 F;  3BNY A;  4LIX A;  3VJ9 A;  2VF6 A;  3AQB B;  3P41 A;  2E8W A;  4KVY A;  5IK9 A;  1V4K A;  3WCC A;  5EAS A;  4KQS A;  1PS1 A;  4XQT F;  4DEM F;  2F8C F;  2ZCR A;  3WEJ A;  2F94 F;  2Z4W A;  1V4E A;  5ILK A;  1DI1 A;  3V1V A;  5JV2 F;  3LOM A;  3CC9 A;  4DWG A;  5B0I A;  4MC8 A;  1RQI A;  4EA1 A;  2AEK A;  3KRP B;  3W7F A;  5CG5 A;  5HNA A;  3BNX A;  3EZ3 A;  2ZCO A;  3KRF B;  3UCA A;  3NPK A;  3OYR A;  4KK2 A;  4LPH F;  4N9U A;  4DXJ A;  4E9Z A;  5EAT A;  3N0F A;  3N3D A;  5DJV F;  5DJR F;  4H5E F;  5IK6 A;  3ASX A;  5H9D A;  5ILZ A;  3N1W F;  3V66 A;  2E4O A;  5B0J A;  3VJD A;  2O1O A;  2E8U A;  3KB9 A;  3AE0 A;  2F92 F;  5ILY A;  3P8L A;  4JZB A;  5B0K A;  4RYP A;  3CKE A;  1N21 A;  5IM1 A;  2E8X A;  4LFV F;  3WC9 A;  3M0G A;  2Z4V A;  2Z50 A;  5ERN A;  1YYT A;  3PKO A;  5E8L A;  4E9U A;  4KPD A;  3LLW A;  3S9V A;  2H8O A;  3P8R A;  5KSX F;  5DHI A;  4DWB A;  4LA6 A;  3M00 A;  5IMN A;  5AHU B;  4JZX A;  3ACW A;  3N0G A;  3TC1 A;  2OA6 A;  5A0I A;  1HXA A;  3OAC B;  3CP6 A;  5ILJ A;  3M02 A;  4OMG A;  4OGU A;  2E90 A;  2AZL A;  4NFK F;  5DIQ F;  4GA3 A;  1N24 A;  5IKA A;  4KFA A;  3TS7 A;  4JYX A;  3ZL6 A;  5HN7 A;  3VJA A;  4KVD A;  3G4F A;  4GP1 A;  5DGS F;  2RAH A;  5IL3 A;  5EAU A;  1JFG A;  3OAB A;  5HN8 A;  1N1Z A;  4RNQ A;  1WMW A;  2Z52 A;  1VG4 A;  2E8T A;  3SDV A;  3LG5 A;  3SDT A;  3WCA A;  1DGP A;  3KRA B;  3KRP A;  3M01 A;  4EA2 A;  1FPS A;  1UBV A;  4DZW A;  3KRF A;  1YQ7 A;  3WCB A;  3ACY A;  3IBA A;  4RXD A;  2PS8 A;  2EWG A;  3N46 F;  3VJB A;  4KVI A;  1YJ4 A;  1VG6 A;  5ER8 A;  2E94 A;  4LFE A;  3PYB A;  5DGM F;  5C05 A;  2Q9Z A;  2Z7I A;  2Q80 A;  3P5P A;  3N5J F;  4XQS F;  2AZJ A;  3N5H F;  4NKF A;  3WEG A;  5I1U A;  5ERO A;  5ERM A;  1YHL A;  3NF2 A;  5CG6 A;  1UBW A;  3DYF A;  4LZC A;  3WJK A;  4LLS A;  4F62 A;  3PH7 A;  3WCE A;  4FJQ A;  5IL8 A;  1V4J A;  4EA0 A;  1N20 A;  3LDW A;  4ZQ8 A;  3KRC B;  4UMJ A;  3AQ0 A;  2DH4 A;  2PS7 A;  4RXE A;  4LUU A;  3V1X A;  3EFQ A;  5JA0 F;  3WEK A;  1YYQ A;  2FOR A;  3Q1O A;  3TFN A;  1VG2 A;  1VG3 A;  3NPR A;  3PDE A;  4QXS F;  2J5C A;  4RXC A;  5JUZ F;  1HXC A;  4LXW A;  3OAC A;  4KKM A;  3SDQ A;  3ZMB A;  3WCD A;  2Q9Y A;  3Q2Z A;  1YYS A;  3ZOU A;  3EGT A;  3WCM A;  3LMD A;  3NRI A;  4KPJ A;  4KVW A;  4K10 A;  3RBM A;  4PVX F;  4F6X A;  1HX9 A;  2Z4Z A;  3AQC B;  3WEI A;  1UBY A;  5IKH A;  5B0M A;  3WJN A;  1HM4 A;  3ACX A;  2AET A;  2J1O A;  1N23 A;  3WJO A;  1N22 A;  2PS5 A;  2E8V A;  2PS6 A;  4KUX A;  3KRO B;  3LSN A;  4RXA A;  3KBK A;  3LJI A;  3ADZ A;  3RYE A;  3LGK A;  4MC0 A;  1VG7 A;  5E8H A;  2QIS A;  5IMI A;  2OPN A;  3ID0 A;  3WCG A;  3WCL A;  5ILD A;  4JXY A;  2ZCS A;  4GAX A;  4PVY F;  4NFI F;  2ONH A;  4LZ0 A;  4P0V A;  2ZEV A;  5B0L A;  2ZCQ A;  3WCH A;  2I19 A;  4LTV A;  3TFV A;  5DJP F;  4KWD A;  3G4D A;  4GP2 A;  4NKE A;  4LTZ A;  1JFA A;  5A0J A;  3Q30 A;  4OKZ A;  2PS4 A;  1WKZ A;  5IN8 A;  4P0W A;  5B02 A;  3N3L F;  4L2X F;  1YYU A;  4DHD A;  1N1B A;  1ZW5 A;  1WL0 A;  3TFP A;  5B00 A;  2ONG A;  4JVJ F;  3N6K F;  4LZ3 A;  5AFX A;  3WSA A;  3KRC A;  3ICK A;  1V4H A;  1YHK A;  4P0X A;  3P5R A;  2ZEU A;  4Q23 A;  2J1P A;  4JXN A;  2ZY1 A;  2E91 A;  3B7L A;  4WK5 A;  1YYR A;  1UBX A;  3SAE A;  3OAB B;  3WEF A;  3WE9 A;  3ICM A;  3LGZ B;  3N45 F;  3ZCD A;  2AEL A;  4NG6 A;  3WEH A;  3N49 F;  2Z78 A;  3RYW A;  3SDR A;  2E93 A;  4XQR F;  3WCJ A;  3M9U A;  4H5D F;  3MAV A;  1KIY A;  3APZ A;  1V4I A;  4QPF A;  2E95 A;  3LVS A;  4HD1 A;  4LOB A;  2F7M F;  2AZK A;  3LK5 A;  4LFG A;  5ILI A;  5IK0 A;  3WCF A;  3VJE A;  3DYG A;  5IMP A;  3IPI A;  4LPG F;  3S4J A;  5IVG A;  2F8Z F;  3DYH A; 
#chains in the Genus database with same CATH homology
 5DGN F;  5B01 A;  5DHK A;  4OMH A;  2Q58 A;  3ICN A;  3KRO A;  3ZMC A;  2P1C A;  4NUA A;  4OKM A;  4H5C F;  3QKC A;  2OGD A;  3RMG A;  4LLT A;  3SDU A;  2FTZ A;  4E1E A;  5A0K A;  3VJC A;  1EZF A;  3ICZ A;  1HXG A;  3N1V F;  1HM7 A;  5JV0 F;  2Z7H A;  4FP4 A;  1YHM A;  4KQU A;  5JV1 F;  1RTR A;  3Q2Q A;  4MC3 A;  1WY0 A;  4N1Z F;  1YV5 A;  3KRA A;  5HN9 A;  5E8K A;  3WCI A;  5AYP A;  2E92 A;  2Z4X A;  5ILH A;  3QQV A;  1WL1 A;  5DW7 A;  1KIZ A;  5B03 A;  1RQJ A;  4F6V A;  3LEE A;  3LZ9 A;  3MZV A;  1WL3 A;  2F9K F;  5AEL A;  2OPM A;  4NFJ F;  3WSB A;  3VJ8 A;  3PYA A;  4DI5 A;  4LA5 A;  5DZ2 A;  1WL2 A;  4KQ5 A;  2Z4Y A;  2F89 F;  3BNY A;  4LIX A;  3VJ9 A;  2VF6 A;  3AQB B;  3P41 A;  2E8W A;  4KVY A;  5IK9 A;  1V4K A;  3WCC A;  5EAS A;  4KQS A;  1PS1 A;  4XQT F;  4DEM F;  2F8C F;  2ZCR A;  3WEJ A;  2F94 F;  2Z4W A;  1V4E A;  5ILK A;  1DI1 A;  3V1V A;  5JV2 F;  3LOM A;  3CC9 A;  4DWG A;  5B0I A;  4MC8 A;  1RQI A;  4EA1 A;  2AEK A;  3KRP B;  3W7F A;  5CG5 A;  5HNA A;  3BNX A;  3EZ3 A;  2ZCO A;  3KRF B;  3UCA A;  3NPK A;  3OYR A;  4KK2 A;  4LPH F;  4N9U A;  4DXJ A;  4E9Z A;  5EAT A;  3N0F A;  3N3D A;  5DJV F;  5DJR F;  4H5E F;  5IK6 A;  3ASX A;  5H9D A;  5ILZ A;  3N1W F;  3V66 A;  2E4O A;  5B0J A;  3VJD A;  2O1O A;  2E8U A;  3KB9 A;  3AE0 A;  2F92 F;  5ILY A;  3P8L A;  4JZB A;  5B0K A;  4RYP A;  3CKE A;  1N21 A;  5IM1 A;  2E8X A;  4LFV F;  3WC9 A;  3M0G A;  2Z4V A;  2Z50 A;  5ERN A;  1YYT A;  3PKO A;  5E8L A;  4E9U A;  4KPD A;  3LLW A;  3S9V A;  2H8O A;  3P8R A;  5KSX F;  5DHI A;  4DWB A;  4LA6 A;  3M00 A;  5IMN A;  5AHU B;  4JZX A;  3ACW A;  3N0G A;  3TC1 A;  2OA6 A;  5A0I A;  1HXA A;  3OAC B;  3CP6 A;  5ILJ A;  3M02 A;  4OMG A;  4OGU A;  2E90 A;  2AZL A;  4NFK F;  5DIQ F;  4GA3 A;  1N24 A;  5IKA A;  4KFA A;  3TS7 A;  4JYX A;  3ZL6 A;  5HN7 A;  3VJA A;  4KVD A;  3G4F A;  4GP1 A;  5DGS F;  2RAH A;  5IL3 A;  5EAU A;  1JFG A;  3OAB A;  5HN8 A;  1N1Z A;  4RNQ A;  1WMW A;  2Z52 A;  1VG4 A;  2E8T A;  3SDV A;  3LG5 A;  3SDT A;  3WCA A;  1DGP A;  3KRA B;  3KRP A;  3M01 A;  4EA2 A;  1FPS A;  1UBV A;  4DZW A;  3KRF A;  1YQ7 A;  3WCB A;  3ACY A;  3IBA A;  4RXD A;  2PS8 A;  2EWG A;  3N46 F;  3VJB A;  4KVI A;  1YJ4 A;  1VG6 A;  5ER8 A;  2E94 A;  4LFE A;  3PYB A;  5DGM F;  5C05 A;  2Q9Z A;  2Z7I A;  2Q80 A;  3P5P A;  3N5J F;  4XQS F;  2AZJ A;  3N5H F;  4NKF A;  3WEG A;  5I1U A;  5ERO A;  5ERM A;  1YHL A;  3NF2 A;  5CG6 A;  1UBW A;  3DYF A;  4LZC A;  3WJK A;  4LLS A;  4F62 A;  3PH7 A;  3WCE A;  4FJQ A;  5IL8 A;  1V4J A;  4EA0 A;  1N20 A;  3LDW A;  4ZQ8 A;  3KRC B;  4UMJ A;  3AQ0 A;  2DH4 A;  2PS7 A;  4RXE A;  4LUU A;  3V1X A;  3EFQ A;  5JA0 F;  3WEK A;  1YYQ A;  2FOR A;  3Q1O A;  3TFN A;  1VG2 A;  1VG3 A;  3NPR A;  3PDE A;  4QXS F;  2J5C A;  4RXC A;  5JUZ F;  1HXC A;  4LXW A;  3OAC A;  4KKM A;  3SDQ A;  3ZMB A;  3WCD A;  2Q9Y A;  3Q2Z A;  1YYS A;  3ZOU A;  3EGT A;  3WCM A;  3LMD A;  3NRI A;  4KPJ A;  4KVW A;  4K10 A;  3RBM A;  4PVX F;  4F6X A;  1HX9 A;  2Z4Z A;  3AQC B;  3WEI A;  1UBY A;  5IKH A;  5B0M A;  3WJN A;  1HM4 A;  3ACX A;  2AET A;  2J1O A;  1N23 A;  3WJO A;  1N22 A;  2PS5 A;  2E8V A;  2PS6 A;  4KUX A;  3KRO B;  3LSN A;  4RXA A;  3KBK A;  3LJI A;  3ADZ A;  3RYE A;  3LGK A;  4MC0 A;  1VG7 A;  5E8H A;  2QIS A;  5IMI A;  2OPN A;  3ID0 A;  3WCG A;  3WCL A;  5ILD A;  4JXY A;  2ZCS A;  4GAX A;  4PVY F;  4NFI F;  2ONH A;  4LZ0 A;  4P0V A;  2ZEV A;  5B0L A;  2ZCQ A;  3WCH A;  2I19 A;  4LTV A;  3TFV A;  5DJP F;  4KWD A;  3G4D A;  4GP2 A;  4NKE A;  4LTZ A;  1JFA A;  5A0J A;  3Q30 A;  4OKZ A;  2PS4 A;  1WKZ A;  5IN8 A;  4P0W A;  5B02 A;  3N3L F;  4L2X F;  1YYU A;  4DHD A;  1N1B A;  1ZW5 A;  1WL0 A;  3TFP A;  5B00 A;  2ONG A;  4JVJ F;  3N6K F;  4LZ3 A;  5AFX A;  3WSA A;  3KRC A;  3ICK A;  1V4H A;  1YHK A;  4P0X A;  3P5R A;  2ZEU A;  4Q23 A;  2J1P A;  4JXN A;  2ZY1 A;  2E91 A;  3B7L A;  4WK5 A;  1YYR A;  1UBX A;  3SAE A;  3OAB B;  3WEF A;  3WE9 A;  3ICM A;  3LGZ B;  3N45 F;  3ZCD A;  2AEL A;  4NG6 A;  3WEH A;  3N49 F;  2Z78 A;  3RYW A;  3SDR A;  2E93 A;  4XQR F;  3WCJ A;  3M9U A;  4H5D F;  3MAV A;  1KIY A;  3APZ A;  1V4I A;  4QPF A;  2E95 A;  3LVS A;  4HD1 A;  4LOB A;  2F7M F;  2AZK A;  3LK5 A;  4LFG A;  5ILI A;  5IK0 A;  3WCF A;  3VJE A;  3DYG A;  5IMP A;  3IPI A;  4LPG F;  3S4J A;  5IVG A;  2F8Z F;  3DYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...