3ADZA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGACYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 114
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3adzA00
2F8ZF 4LOBA 2F8CF 3N3LF 4H5DF 5EASA 1WL3A 3M00A 4N9UA 5ERMA 1HXCA 4DWGA 1N24A 5JV0F 2ZEVA 3NPKA 5AHUB 2AZJA 3ZL6A 3ACXA 1JFGA 5ILHA 1DI1A 2OPNA 3ICMA 4DXJA 1YHLA 1YV5A 5HN9A 4DWBA 1JFAA 3V1VA 3BNXA 4KK2A 3KRCB 3KRFA 4EA2A 3LEEA 4GA3A 2E8XA 5IM1A 3VJBA 4GAXA 5B0KA 5JV1F 4K10A 3N0FA 3KRPB 3RMGA 3WCGA 2FORA 5E8LA 4F62A 4LPHF 5ILYA 1PS1A 2PS8A 4FP4A 5ILKA 2Z50A 1YYSA 3B7LA 4XQTF 2OGDA 4P0WA 3ASXA 4DZWA 3ACWA 4GP2A 4E9ZA 3G4FA 2PS5A 3WJKA 3NF2A 3WEJA 3LK5A 4P0VA 4KUXA 4UMJA 4KQUA 1WL1A 4MC8A 4JXNA 5IMPA 5DJPF 5ILDA 2E93A 5DHKA 5B03A 3CP6A 3N0GA 3AQBB 2J1PA 3LSNA 3M9UA 1YHKA 3LMDA 3OACB 3MAVA 1WY0A 3OABB 4OKZA 2J1OA 3LZ9A 3EFQA 3WSBA 3ADZA 3VJCA 3ID0A 1V4IA 4LZCA 1V4EA 3MZVA 4QXSF 3QQVA 4DHDA 4KPJA 4LPGF 3SDVA 4PVXF 4LFVF 5AFXA 3ZCDA 4LTZA 5KSXF 1EZFA 1WL0A 2Z52A 3S4JA 2E90A 3ZMBA 1FPSA 5DGNF 3Q2QA 3TFNA 5DJVF 1DGPA 4RXCA 5IN8A 5IKAA 1VG3A 1HM7A 5A0JA 3VJ8A 5B01A 5AYPA 4H5EF 4NKFA 2E94A 2OA6A 4LZ3A 3WCCA 2F94F 4LFEA 3ZMCA 3QKCA 5CG5A 3Q2ZA 4H5CF 5IK0A 1YJ4A 3WCEA 3RYWA 2ZCQA 5IK9A 3N1VF 3KROA 5B00A 3LOMA 4JZXA 3ZOUA 1N22A 3N45F 4GP1A 2Z4WA 1UBYA 2ZCSA 2E8VA 3P8RA 2H8OA 3WCIA 4NFIF 4QPFA 3P41A 3SAEA 3KB9A 5CG6A 4OMHA 3RBMA 5B0MA 5EAUA 1UBWA 1V4KA 2Q9YA 5A0KA 5I1UA 4WK5A 3AQ0A 1WKZA 3KRFB 1N1ZA 4RNQA 4NG6A 1RQIA 3PKOA 5B0IA 3WCFA 5IKHA 5E8HA 3WCDA 5JA0F 3WCHA 2RAHA 2VF6A 2Z7IA 2AETA 4KFAA 3NPRA 3WCLA 3P5RA 4RXDA 2F9KF 3V1XA 4LFGA 2P1CA 3SDTA 4RXAA 3PYAA 5DW7A 3DYGA 3S9VA 5IK6A 3WC9A 3KRAA 3N5HF 5IL3A 1HX9A 2AZLA 4EA1A 4NFJF 3WEHA 2Z4ZA 4E9UA 1VG7A 3WEIA 1YYQA 4KVWA 5IMIA 5DHIA 3TFVA 5DGMF 4LLTA 3N46F 5B02A 1HXAA 2E95A 4LXWA 3NRIA 5JV2F 5B0JA 4HD1A 5H9DA 3Q1OA 2Z7HA 3DYFA 3LJIA 4KKMA 4KPDA 3EZ3A 3WEKA 3OYRA 5JUZF 1WL2A 1VG2A 1RQJA 5ILZA 2AEKA 3WEFA 3APZA 3WEGA 1V4JA 2ZEUA 3KBKA 5ER8A 3AE0A 1N23A 1HXGA 4JVJF 1YQ7A 5E8KA 3TC1A 3VJDA 4KQ5A 1YYUA 3SDRA 2PS4A 4LLSA 4MC0A 5DJRF 4FJQA 4RXEA 1N20A 4JYXA 4F6XA 2J5CA 2E4OA 4KQSA 3P8LA 2AELA 2F89F 1KIYA 4PVYF 1UBVA 3N5JF 3TFPA 1HM4A 5ILIA 5ERNA 1UBXA 2AZKA 2Z78A 3ICZA 3SDQA 4JZBA 5ILJA 3KROB 4NKEA 1KIZA 5B0LA 5AELA 5EATA 4RYPA 5HNAA 1YHMA 3WCMA 3LDWA 3SDUA 3KRCA 2OPMA 5DIQF 2Z4YA 3PDEA 1VG6A 1V4HA 3N3DA 2EWGA 3EGTA 3WCJA 4NUAA 3DYHA 3KRPA 5DGSF 4Q23A 4LTVA 3N49F 5A0IA 3WJOA 2O1OA 2Q80A 2Q58A 4KVDA 4DEMF 3LVSA 5EROA 3WCAA 3M0GA 2QISA 1ZW5A 3CC9A 2ZY1A 4E1EA 3LGKA 2Z4VA 4NFKF 3ICKA 3WE9A 3RYEA 4N1ZF 4LA5A 2I19A 3ICNA 5HN7A 1WMWA 2F92F 3M01A 4KWDA 2E8UA 3G4DA 4JXYA 5IVGA 1YYTA 4F6VA 3WJNA 4LUUA 3LLWA 3AQCB 4L2XF 4LIXA 3N1WF 2E8WA 2PS7A 4OGUA 3VJAA 3P5PA 4P0XA 3ACYA 5IL8A 3UCAA 3V66A 3PYBA 3KRAB 2E92A 3OACA 3OABA 5C05A 3VJ9A 2Q9ZA 2ONHA 3IPIA 4MC3A 2DH4A 3LGZB 2E8TA 3BNYA 2ONGA 4XQRF 3WSAA 2Z4XA 2PS6A 5IMNA 3TS7A 3WCBA 2E91A 3W7FA 2ZCRA 1VG4A 3LG5A 4KVIA 3CKEA 1N21A 3M02A 5HN8A 5DZ2A 3VJEA 4EA0A 1YYRA 3N6KF 2F7MF 4XQSF 2FTZA 1N1BA 1RTRA 4LZ0A 4KVYA 4OMGA 3Q30A 4DI5A 4ZQ8A 4OKMA 2ZCOA 3PH7A 4LA6A 3IBAA
chains in the Genus database with same CATH superfamily
2F8ZF 4LOBA 2F8CF 3N3LF 4H5DF 5EASA 1WL3A 3M00A 4N9UA 5ERMA 1HXCA 4DWGA 1N24A 5JV0F 2ZEVA 3NPKA 5AHUB 2AZJA 3ZL6A 3ACXA 1JFGA 5ILHA 1DI1A 2OPNA 3ICMA 4DXJA 1YHLA 1YV5A 5HN9A 4DWBA 1JFAA 3V1VA 3BNXA 4KK2A 3KRCB 3KRFA 4EA2A 3LEEA 4GA3A 2E8XA 5IM1A 3VJBA 4GAXA 5B0KA 5JV1F 4K10A 3N0FA 3KRPB 3RMGA 3WCGA 2FORA 5E8LA 4F62A 4LPHF 5ILYA 1PS1A 2PS8A 4FP4A 5ILKA 2Z50A 1YYSA 3B7LA 4XQTF 2OGDA 4P0WA 3ASXA 4DZWA 3ACWA 4GP2A 4E9ZA 3G4FA 2PS5A 3WJKA 3NF2A 3WEJA 3LK5A 4P0VA 4KUXA 4UMJA 4KQUA 1WL1A 4MC8A 4JXNA 5IMPA 5DJPF 5ILDA 2E93A 5DHKA 5B03A 3CP6A 3N0GA 3AQBB 2J1PA 3LSNA 3M9UA 1YHKA 3LMDA 3OACB 3MAVA 1WY0A 3OABB 4OKZA 2J1OA 3LZ9A 3EFQA 3WSBA 3ADZA 3VJCA 3ID0A 1V4IA 4LZCA 1V4EA 3MZVA 4QXSF 3QQVA 4DHDA 4KPJA 4LPGF 3SDVA 4PVXF 4LFVF 5AFXA 3ZCDA 4LTZA 5KSXF 1EZFA 1WL0A 2Z52A 3S4JA 2E90A 3ZMBA 1FPSA 5DGNF 3Q2QA 3TFNA 5DJVF 1DGPA 4RXCA 5IN8A 5IKAA 1VG3A 1HM7A 5A0JA 3VJ8A 5B01A 5AYPA 4H5EF 4NKFA 2E94A 2OA6A 4LZ3A 3WCCA 2F94F 4LFEA 3ZMCA 3QKCA 5CG5A 3Q2ZA 4H5CF 5IK0A 1YJ4A 3WCEA 3RYWA 2ZCQA 5IK9A 3N1VF 3KROA 5B00A 3LOMA 4JZXA 3ZOUA 1N22A 3N45F 4GP1A 2Z4WA 1UBYA 2ZCSA 2E8VA 3P8RA 2H8OA 3WCIA 4NFIF 4QPFA 3P41A 3SAEA 3KB9A 5CG6A 4OMHA 3RBMA 5B0MA 5EAUA 1UBWA 1V4KA 2Q9YA 5A0KA 5I1UA 4WK5A 3AQ0A 1WKZA 3KRFB 1N1ZA 4RNQA 4NG6A 1RQIA 3PKOA 5B0IA 3WCFA 5IKHA 5E8HA 3WCDA 5JA0F 3WCHA 2RAHA 2VF6A 2Z7IA 2AETA 4KFAA 3NPRA 3WCLA 3P5RA 4RXDA 2F9KF 3V1XA 4LFGA 2P1CA 3SDTA 4RXAA 3PYAA 5DW7A 3DYGA 3S9VA 5IK6A 3WC9A 3KRAA 3N5HF 5IL3A 1HX9A 2AZLA 4EA1A 4NFJF 3WEHA 2Z4ZA 4E9UA 1VG7A 3WEIA 1YYQA 4KVWA 5IMIA 5DHIA 3TFVA 5DGMF 4LLTA 3N46F 5B02A 1HXAA 2E95A 4LXWA 3NRIA 5JV2F 5B0JA 4HD1A 5H9DA 3Q1OA 2Z7HA 3DYFA 3LJIA 4KKMA 4KPDA 3EZ3A 3WEKA 3OYRA 5JUZF 1WL2A 1VG2A 1RQJA 5ILZA 2AEKA 3WEFA 3APZA 3WEGA 1V4JA 2ZEUA 3KBKA 5ER8A 3AE0A 1N23A 1HXGA 4JVJF 1YQ7A 5E8KA 3TC1A 3VJDA 4KQ5A 1YYUA 3SDRA 2PS4A 4LLSA 4MC0A 5DJRF 4FJQA 4RXEA 1N20A 4JYXA 4F6XA 2J5CA 2E4OA 4KQSA 3P8LA 2AELA 2F89F 1KIYA 4PVYF 1UBVA 3N5JF 3TFPA 1HM4A 5ILIA 5ERNA 1UBXA 2AZKA 2Z78A 3ICZA 3SDQA 4JZBA 5ILJA 3KROB 4NKEA 1KIZA 5B0LA 5AELA 5EATA 4RYPA 5HNAA 1YHMA 3WCMA 3LDWA 3SDUA 3KRCA 2OPMA 5DIQF 2Z4YA 3PDEA 1VG6A 1V4HA 3N3DA 2EWGA 3EGTA 3WCJA 4NUAA 3DYHA 3KRPA 5DGSF 4Q23A 4LTVA 3N49F 5A0IA 3WJOA 2O1OA 2Q80A 2Q58A 4KVDA 4DEMF 3LVSA 5EROA 3WCAA 3M0GA 2QISA 1ZW5A 3CC9A 2ZY1A 4E1EA 3LGKA 2Z4VA 4NFKF 3ICKA 3WE9A 3RYEA 4N1ZF 4LA5A 2I19A 3ICNA 5HN7A 1WMWA 2F92F 3M01A 4KWDA 2E8UA 3G4DA 4JXYA 5IVGA 1YYTA 4F6VA 3WJNA 4LUUA 3LLWA 3AQCB 4L2XF 4LIXA 3N1WF 2E8WA 2PS7A 4OGUA 3VJAA 3P5PA 4P0XA 3ACYA 5IL8A 3UCAA 3V66A 3PYBA 3KRAB 2E92A 3OACA 3OABA 5C05A 3VJ9A 2Q9ZA 2ONHA 3IPIA 4MC3A 2DH4A 3LGZB 2E8TA 3BNYA 2ONGA 4XQRF 3WSAA 2Z4XA 2PS6A 5IMNA 3TS7A 3WCBA 2E91A 3W7FA 2ZCRA 1VG4A 3LG5A 4KVIA 3CKEA 1N21A 3M02A 5HN8A 5DZ2A 3VJEA 4EA0A 1YYRA 3N6KF 2F7MF 4XQSF 2FTZA 1N1BA 1RTRA 4LZ0A 4KVYA 4OMGA 3Q30A 4DI5A 4ZQ8A 4OKMA 2ZCOA 3PH7A 4LA6A 3IBAA
chains in the Genus database with same CATH topology
2F8ZF 4LOBA 2F8CF 3N3LF 4H5DF 5EASA 1WL3A 3M00A 4N9UA 5ERMA 1HXCA 4DWGA 1N24A 5JV0F 2ZEVA 3NPKA 5AHUB 2AZJA 3ZL6A 3ACXA 1JFGA 5ILHA 1DI1A 2OPNA 3ICMA 4DXJA 1YHLA 1YV5A 5HN9A 4DWBA 1JFAA 3V1VA 3BNXA 4KK2A 3KRCB 3KRFA 4EA2A 3LEEA 4GA3A 2E8XA 5IM1A 3VJBA 4GAXA 5B0KA 5JV1F 4K10A 3N0FA 3KRPB 3RMGA 3WCGA 2FORA 5E8LA 4F62A 4LPHF 5ILYA 1PS1A 2PS8A 4FP4A 5ILKA 2Z50A 1YYSA 3B7LA 4XQTF 2OGDA 4P0WA 3ASXA 4DZWA 3ACWA 4GP2A 4E9ZA 3G4FA 2PS5A 3WJKA 3NF2A 3WEJA 3LK5A 4P0VA 4KUXA 4UMJA 4KQUA 1WL1A 4MC8A 4JXNA 5IMPA 5DJPF 5ILDA 2E93A 5DHKA 5B03A 3CP6A 3N0GA 3AQBB 2J1PA 3LSNA 3M9UA 1YHKA 3LMDA 3OACB 3MAVA 1WY0A 3OABB 4OKZA 2J1OA 3LZ9A 3EFQA 3WSBA 3ADZA 3VJCA 3ID0A 1V4IA 4LZCA 1V4EA 3MZVA 4QXSF 3QQVA 4DHDA 4KPJA 4LPGF 3SDVA 4PVXF 4LFVF 5AFXA 3ZCDA 4LTZA 5KSXF 1EZFA 1WL0A 2Z52A 3S4JA 2E90A 3ZMBA 1FPSA 5DGNF 3Q2QA 3TFNA 5DJVF 1DGPA 4RXCA 5IN8A 5IKAA 1VG3A 1HM7A 5A0JA 3VJ8A 5B01A 5AYPA 4H5EF 4NKFA 2E94A 2OA6A 4LZ3A 3WCCA 2F94F 4LFEA 3ZMCA 3QKCA 5CG5A 3Q2ZA 4H5CF 5IK0A 1YJ4A 3WCEA 3RYWA 2ZCQA 5IK9A 3N1VF 3KROA 5B00A 3LOMA 4JZXA 3ZOUA 1N22A 3N45F 4GP1A 2Z4WA 1UBYA 2ZCSA 2E8VA 3P8RA 2H8OA 3WCIA 4NFIF 4QPFA 3P41A 3SAEA 3KB9A 5CG6A 4OMHA 3RBMA 5B0MA 5EAUA 1UBWA 1V4KA 2Q9YA 5A0KA 5I1UA 4WK5A 3AQ0A 1WKZA 3KRFB 1N1ZA 4RNQA 4NG6A 1RQIA 3PKOA 5B0IA 3WCFA 5IKHA 5E8HA 3WCDA 5JA0F 3WCHA 2RAHA 2VF6A 2Z7IA 2AETA 4KFAA 3NPRA 3WCLA 3P5RA 4RXDA 2F9KF 3V1XA 4LFGA 2P1CA 3SDTA 4RXAA 3PYAA 5DW7A 3DYGA 3S9VA 5IK6A 3WC9A 3KRAA 3N5HF 5IL3A 1HX9A 2AZLA 4EA1A 4NFJF 3WEHA 2Z4ZA 4E9UA 1VG7A 3WEIA 1YYQA 4KVWA 5IMIA 5DHIA 3TFVA 5DGMF 4LLTA 3N46F 5B02A 1HXAA 2E95A 4LXWA 3NRIA 5JV2F 5B0JA 4HD1A 5H9DA 3Q1OA 2Z7HA 3DYFA 3LJIA 4KKMA 4KPDA 3EZ3A 3WEKA 3OYRA 5JUZF 1WL2A 1VG2A 1RQJA 5ILZA 2AEKA 3WEFA 3APZA 3WEGA 1V4JA 2ZEUA 3KBKA 5ER8A 3AE0A 1N23A 1HXGA 4JVJF 1YQ7A 5E8KA 3TC1A 3VJDA 4KQ5A 1YYUA 3SDRA 2PS4A 4LLSA 4MC0A 5DJRF 4FJQA 4RXEA 1N20A 4JYXA 4F6XA 2J5CA 2E4OA 4KQSA 3P8LA 2AELA 2F89F 1KIYA 4PVYF 1UBVA 3N5JF 3TFPA 1HM4A 5ILIA 5ERNA 1UBXA 2AZKA 2Z78A 3ICZA 3SDQA 4JZBA 5ILJA 3KROB 4NKEA 1KIZA 5B0LA 5AELA 5EATA 4RYPA 5HNAA 1YHMA 3WCMA 3LDWA 3SDUA 3KRCA 2OPMA 5DIQF 2Z4YA 3PDEA 1VG6A 1V4HA 3N3DA 2EWGA 3EGTA 3WCJA 4NUAA 3DYHA 3KRPA 5DGSF 4Q23A 4LTVA 3N49F 5A0IA 3WJOA 2O1OA 2Q80A 2Q58A 4KVDA 4DEMF 3LVSA 5EROA 3WCAA 3M0GA 2QISA 1ZW5A 3CC9A 2ZY1A 4E1EA 3LGKA 2Z4VA 4NFKF 3ICKA 3WE9A 3RYEA 4N1ZF 4LA5A 2I19A 3ICNA 5HN7A 1WMWA 2F92F 3M01A 4KWDA 2E8UA 3G4DA 4JXYA 5IVGA 1YYTA 4F6VA 3WJNA 4LUUA 3LLWA 3AQCB 4L2XF 4LIXA 3N1WF 2E8WA 2PS7A 4OGUA 3VJAA 3P5PA 4P0XA 3ACYA 5IL8A 3UCAA 3V66A 3PYBA 3KRAB 2E92A 3OACA 3OABA 5C05A 3VJ9A 2Q9ZA 2ONHA 3IPIA 4MC3A 2DH4A 3LGZB 2E8TA 3BNYA 2ONGA 4XQRF 3WSAA 2Z4XA 2PS6A 5IMNA 3TS7A 3WCBA 2E91A 3W7FA 2ZCRA 1VG4A 3LG5A 4KVIA 3CKEA 1N21A 3M02A 5HN8A 5DZ2A 3VJEA 4EA0A 1YYRA 3N6KF 2F7MF 4XQSF 2FTZA 1N1BA 1RTRA 4LZ0A 4KVYA 4OMGA 3Q30A 4DI5A 4ZQ8A 4OKMA 2ZCOA 3PH7A 4LA6A 3IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8Z F;  4LOB A;  2F8C F;  3N3L F;  4H5D F;  5EAS A;  1WL3 A;  3M00 A;  4N9U A;  5ERM A;  1HXC A;  4DWG A;  1N24 A;  5JV0 F;  2ZEV A;  3NPK A;  5AHU B;  2AZJ A;  3ZL6 A;  3ACX A;  1JFG A;  5ILH A;  1DI1 A;  2OPN A;  3ICM A;  4DXJ A;  1YHL A;  1YV5 A;  5HN9 A;  4DWB A;  1JFA A;  3V1V A;  3BNX A;  4KK2 A;  3KRC B;  3KRF A;  4EA2 A;  3LEE A;  4GA3 A;  2E8X A;  5IM1 A;  3VJB A;  4GAX A;  5B0K A;  5JV1 F;  4K10 A;  3N0F A;  3KRP B;  3RMG A;  3WCG A;  2FOR A;  5E8L A;  4F62 A;  4LPH F;  5ILY A;  1PS1 A;  2PS8 A;  4FP4 A;  5ILK A;  2Z50 A;  1YYS A;  3B7L A;  4XQT F;  2OGD A;  4P0W A;  3ASX A;  4DZW A;  3ACW A;  4GP2 A;  4E9Z A;  3G4F A;  2PS5 A;  3WJK A;  3NF2 A;  3WEJ A;  3LK5 A;  4P0V A;  4KUX A;  4UMJ A;  4KQU A;  1WL1 A;  4MC8 A;  4JXN A;  5IMP A;  5DJP F;  5ILD A;  2E93 A;  5DHK A;  5B03 A;  3CP6 A;  3N0G A;  3AQB B;  2J1P A;  3LSN A;  3M9U A;  1YHK A;  3LMD A;  3OAC B;  3MAV A;  1WY0 A;  3OAB B;  4OKZ A;  2J1O A;  3LZ9 A;  3EFQ A;  3WSB A;  3ADZ A;  3VJC A;  3ID0 A;  1V4I A;  4LZC A;  1V4E A;  3MZV A;  4QXS F;  3QQV A;  4DHD A;  4KPJ A;  4LPG F;  3SDV A;  4PVX F;  4LFV F;  5AFX A;  3ZCD A;  4LTZ A;  5KSX F;  1EZF A;  1WL0 A;  2Z52 A;  3S4J A;  2E90 A;  3ZMB A;  1FPS A;  5DGN F;  3Q2Q A;  3TFN A;  5DJV F;  1DGP A;  4RXC A;  5IN8 A;  5IKA A;  1VG3 A;  1HM7 A;  5A0J A;  3VJ8 A;  5B01 A;  5AYP A;  4H5E F;  4NKF A;  2E94 A;  2OA6 A;  4LZ3 A;  3WCC A;  2F94 F;  4LFE A;  3ZMC A;  3QKC A;  5CG5 A;  3Q2Z A;  4H5C F;  5IK0 A;  1YJ4 A;  3WCE A;  3RYW A;  2ZCQ A;  5IK9 A;  3N1V F;  3KRO A;  5B00 A;  3LOM A;  4JZX A;  3ZOU A;  1N22 A;  3N45 F;  4GP1 A;  2Z4W A;  1UBY A;  2ZCS A;  2E8V A;  3P8R A;  2H8O A;  3WCI A;  4NFI F;  4QPF A;  3P41 A;  3SAE A;  3KB9 A;  5CG6 A;  4OMH A;  3RBM A;  5B0M A;  5EAU A;  1UBW A;  1V4K A;  2Q9Y A;  5A0K A;  5I1U A;  4WK5 A;  3AQ0 A;  1WKZ A;  3KRF B;  1N1Z A;  4RNQ A;  4NG6 A;  1RQI A;  3PKO A;  5B0I A;  3WCF A;  5IKH A;  5E8H A;  3WCD A;  5JA0 F;  3WCH A;  2RAH A;  2VF6 A;  2Z7I A;  2AET A;  4KFA A;  3NPR A;  3WCL A;  3P5R A;  4RXD A;  2F9K F;  3V1X A;  4LFG A;  2P1C A;  3SDT A;  4RXA A;  3PYA A;  5DW7 A;  3DYG A;  3S9V A;  5IK6 A;  3WC9 A;  3KRA A;  3N5H F;  5IL3 A;  1HX9 A;  2AZL A;  4EA1 A;  4NFJ F;  3WEH A;  2Z4Z A;  4E9U A;  1VG7 A;  3WEI A;  1YYQ A;  4KVW A;  5IMI A;  5DHI A;  3TFV A;  5DGM F;  4LLT A;  3N46 F;  5B02 A;  1HXA A;  2E95 A;  4LXW A;  3NRI A;  5JV2 F;  5B0J A;  4HD1 A;  5H9D A;  3Q1O A;  2Z7H A;  3DYF A;  3LJI A;  4KKM A;  4KPD A;  3EZ3 A;  3WEK A;  3OYR A;  5JUZ F;  1WL2 A;  1VG2 A;  1RQJ A;  5ILZ A;  2AEK A;  3WEF A;  3APZ A;  3WEG A;  1V4J A;  2ZEU A;  3KBK A;  5ER8 A;  3AE0 A;  1N23 A;  1HXG A;  4JVJ F;  1YQ7 A;  5E8K A;  3TC1 A;  3VJD A;  4KQ5 A;  1YYU A;  3SDR A;  2PS4 A;  4LLS A;  4MC0 A;  5DJR F;  4FJQ A;  4RXE A;  1N20 A;  4JYX A;  4F6X A;  2J5C A;  2E4O A;  4KQS A;  3P8L A;  2AEL A;  2F89 F;  1KIY A;  4PVY F;  1UBV A;  3N5J F;  3TFP A;  1HM4 A;  5ILI A;  5ERN A;  1UBX A;  2AZK A;  2Z78 A;  3ICZ A;  3SDQ A;  4JZB A;  5ILJ A;  3KRO B;  4NKE A;  1KIZ A;  5B0L A;  5AEL A;  5EAT A;  4RYP A;  5HNA A;  1YHM A;  3WCM A;  3LDW A;  3SDU A;  3KRC A;  2OPM A;  5DIQ F;  2Z4Y A;  3PDE A;  1VG6 A;  1V4H A;  3N3D A;  2EWG A;  3EGT A;  3WCJ A;  4NUA A;  3DYH A;  3KRP A;  5DGS F;  4Q23 A;  4LTV A;  3N49 F;  5A0I A;  3WJO A;  2O1O A;  2Q80 A;  2Q58 A;  4KVD A;  4DEM F;  3LVS A;  5ERO A;  3WCA A;  3M0G A;  2QIS A;  1ZW5 A;  3CC9 A;  2ZY1 A;  4E1E A;  3LGK A;  2Z4V A;  4NFK F;  3ICK A;  3WE9 A;  3RYE A;  4N1Z F;  4LA5 A;  2I19 A;  3ICN A;  5HN7 A;  1WMW A;  2F92 F;  3M01 A;  4KWD A;  2E8U A;  3G4D A;  4JXY A;  5IVG A;  1YYT A;  4F6V A;  3WJN A;  4LUU A;  3LLW A;  3AQC B;  4L2X F;  4LIX A;  3N1W F;  2E8W A;  2PS7 A;  4OGU A;  3VJA A;  3P5P A;  4P0X A;  3ACY A;  5IL8 A;  3UCA A;  3V66 A;  3PYB A;  3KRA B;  2E92 A;  3OAC A;  3OAB A;  5C05 A;  3VJ9 A;  2Q9Z A;  2ONH A;  3IPI A;  4MC3 A;  2DH4 A;  3LGZ B;  2E8T A;  3BNY A;  2ONG A;  4XQR F;  3WSA A;  2Z4X A;  2PS6 A;  5IMN A;  3TS7 A;  3WCB A;  2E91 A;  3W7F A;  2ZCR A;  1VG4 A;  3LG5 A;  4KVI A;  3CKE A;  1N21 A;  3M02 A;  5HN8 A;  5DZ2 A;  3VJE A;  4EA0 A;  1YYR A;  3N6K F;  2F7M F;  4XQS F;  2FTZ A;  1N1B A;  1RTR A;  4LZ0 A;  4KVY A;  4OMG A;  3Q30 A;  4DI5 A;  4ZQ8 A;  4OKM A;  2ZCO A;  3PH7 A;  4LA6 A;  3IBA A; 
#chains in the Genus database with same CATH topology
 2F8Z F;  4LOB A;  2F8C F;  3N3L F;  4H5D F;  5EAS A;  1WL3 A;  3M00 A;  4N9U A;  5ERM A;  1HXC A;  4DWG A;  1N24 A;  5JV0 F;  2ZEV A;  3NPK A;  5AHU B;  2AZJ A;  3ZL6 A;  3ACX A;  1JFG A;  5ILH A;  1DI1 A;  2OPN A;  3ICM A;  4DXJ A;  1YHL A;  1YV5 A;  5HN9 A;  4DWB A;  1JFA A;  3V1V A;  3BNX A;  4KK2 A;  3KRC B;  3KRF A;  4EA2 A;  3LEE A;  4GA3 A;  2E8X A;  5IM1 A;  3VJB A;  4GAX A;  5B0K A;  5JV1 F;  4K10 A;  3N0F A;  3KRP B;  3RMG A;  3WCG A;  2FOR A;  5E8L A;  4F62 A;  4LPH F;  5ILY A;  1PS1 A;  2PS8 A;  4FP4 A;  5ILK A;  2Z50 A;  1YYS A;  3B7L A;  4XQT F;  2OGD A;  4P0W A;  3ASX A;  4DZW A;  3ACW A;  4GP2 A;  4E9Z A;  3G4F A;  2PS5 A;  3WJK A;  3NF2 A;  3WEJ A;  3LK5 A;  4P0V A;  4KUX A;  4UMJ A;  4KQU A;  1WL1 A;  4MC8 A;  4JXN A;  5IMP A;  5DJP F;  5ILD A;  2E93 A;  5DHK A;  5B03 A;  3CP6 A;  3N0G A;  3AQB B;  2J1P A;  3LSN A;  3M9U A;  1YHK A;  3LMD A;  3OAC B;  3MAV A;  1WY0 A;  3OAB B;  4OKZ A;  2J1O A;  3LZ9 A;  3EFQ A;  3WSB A;  3ADZ A;  3VJC A;  3ID0 A;  1V4I A;  4LZC A;  1V4E A;  3MZV A;  4QXS F;  3QQV A;  4DHD A;  4KPJ A;  4LPG F;  3SDV A;  4PVX F;  4LFV F;  5AFX A;  3ZCD A;  4LTZ A;  5KSX F;  1EZF A;  1WL0 A;  2Z52 A;  3S4J A;  2E90 A;  3ZMB A;  1FPS A;  5DGN F;  3Q2Q A;  3TFN A;  5DJV F;  1DGP A;  4RXC A;  5IN8 A;  5IKA A;  1VG3 A;  1HM7 A;  5A0J A;  3VJ8 A;  5B01 A;  5AYP A;  4H5E F;  4NKF A;  2E94 A;  2OA6 A;  4LZ3 A;  3WCC A;  2F94 F;  4LFE A;  3ZMC A;  3QKC A;  5CG5 A;  3Q2Z A;  4H5C F;  5IK0 A;  1YJ4 A;  3WCE A;  3RYW A;  2ZCQ A;  5IK9 A;  3N1V F;  3KRO A;  5B00 A;  3LOM A;  4JZX A;  3ZOU A;  1N22 A;  3N45 F;  4GP1 A;  2Z4W A;  1UBY A;  2ZCS A;  2E8V A;  3P8R A;  2H8O A;  3WCI A;  4NFI F;  4QPF A;  3P41 A;  3SAE A;  3KB9 A;  5CG6 A;  4OMH A;  3RBM A;  5B0M A;  5EAU A;  1UBW A;  1V4K A;  2Q9Y A;  5A0K A;  5I1U A;  4WK5 A;  3AQ0 A;  1WKZ A;  3KRF B;  1N1Z A;  4RNQ A;  4NG6 A;  1RQI A;  3PKO A;  5B0I A;  3WCF A;  5IKH A;  5E8H A;  3WCD A;  5JA0 F;  3WCH A;  2RAH A;  2VF6 A;  2Z7I A;  2AET A;  4KFA A;  3NPR A;  3WCL A;  3P5R A;  4RXD A;  2F9K F;  3V1X A;  4LFG A;  2P1C A;  3SDT A;  4RXA A;  3PYA A;  5DW7 A;  3DYG A;  3S9V A;  5IK6 A;  3WC9 A;  3KRA A;  3N5H F;  5IL3 A;  1HX9 A;  2AZL A;  4EA1 A;  4NFJ F;  3WEH A;  2Z4Z A;  4E9U A;  1VG7 A;  3WEI A;  1YYQ A;  4KVW A;  5IMI A;  5DHI A;  3TFV A;  5DGM F;  4LLT A;  3N46 F;  5B02 A;  1HXA A;  2E95 A;  4LXW A;  3NRI A;  5JV2 F;  5B0J A;  4HD1 A;  5H9D A;  3Q1O A;  2Z7H A;  3DYF A;  3LJI A;  4KKM A;  4KPD A;  3EZ3 A;  3WEK A;  3OYR A;  5JUZ F;  1WL2 A;  1VG2 A;  1RQJ A;  5ILZ A;  2AEK A;  3WEF A;  3APZ A;  3WEG A;  1V4J A;  2ZEU A;  3KBK A;  5ER8 A;  3AE0 A;  1N23 A;  1HXG A;  4JVJ F;  1YQ7 A;  5E8K A;  3TC1 A;  3VJD A;  4KQ5 A;  1YYU A;  3SDR A;  2PS4 A;  4LLS A;  4MC0 A;  5DJR F;  4FJQ A;  4RXE A;  1N20 A;  4JYX A;  4F6X A;  2J5C A;  2E4O A;  4KQS A;  3P8L A;  2AEL A;  2F89 F;  1KIY A;  4PVY F;  1UBV A;  3N5J F;  3TFP A;  1HM4 A;  5ILI A;  5ERN A;  1UBX A;  2AZK A;  2Z78 A;  3ICZ A;  3SDQ A;  4JZB A;  5ILJ A;  3KRO B;  4NKE A;  1KIZ A;  5B0L A;  5AEL A;  5EAT A;  4RYP A;  5HNA A;  1YHM A;  3WCM A;  3LDW A;  3SDU A;  3KRC A;  2OPM A;  5DIQ F;  2Z4Y A;  3PDE A;  1VG6 A;  1V4H A;  3N3D A;  2EWG A;  3EGT A;  3WCJ A;  4NUA A;  3DYH A;  3KRP A;  5DGS F;  4Q23 A;  4LTV A;  3N49 F;  5A0I A;  3WJO A;  2O1O A;  2Q80 A;  2Q58 A;  4KVD A;  4DEM F;  3LVS A;  5ERO A;  3WCA A;  3M0G A;  2QIS A;  1ZW5 A;  3CC9 A;  2ZY1 A;  4E1E A;  3LGK A;  2Z4V A;  4NFK F;  3ICK A;  3WE9 A;  3RYE A;  4N1Z F;  4LA5 A;  2I19 A;  3ICN A;  5HN7 A;  1WMW A;  2F92 F;  3M01 A;  4KWD A;  2E8U A;  3G4D A;  4JXY A;  5IVG A;  1YYT A;  4F6V A;  3WJN A;  4LUU A;  3LLW A;  3AQC B;  4L2X F;  4LIX A;  3N1W F;  2E8W A;  2PS7 A;  4OGU A;  3VJA A;  3P5P A;  4P0X A;  3ACY A;  5IL8 A;  3UCA A;  3V66 A;  3PYB A;  3KRA B;  2E92 A;  3OAC A;  3OAB A;  5C05 A;  3VJ9 A;  2Q9Z A;  2ONH A;  3IPI A;  4MC3 A;  2DH4 A;  3LGZ B;  2E8T A;  3BNY A;  2ONG A;  4XQR F;  3WSA A;  2Z4X A;  2PS6 A;  5IMN A;  3TS7 A;  3WCB A;  2E91 A;  3W7F A;  2ZCR A;  1VG4 A;  3LG5 A;  4KVI A;  3CKE A;  1N21 A;  3M02 A;  5HN8 A;  5DZ2 A;  3VJE A;  4EA0 A;  1YYR A;  3N6K F;  2F7M F;  4XQS F;  2FTZ A;  1N1B A;  1RTR A;  4LZ0 A;  4KVY A;  4OMG A;  3Q30 A;  4DI5 A;  4ZQ8 A;  4OKM A;  2ZCO A;  3PH7 A;  4LA6 A;  3IBA A; 
#chains in the Genus database with same CATH homology
 2F8Z F;  4LOB A;  2F8C F;  3N3L F;  4H5D F;  5EAS A;  1WL3 A;  3M00 A;  4N9U A;  5ERM A;  1HXC A;  4DWG A;  1N24 A;  5JV0 F;  2ZEV A;  3NPK A;  5AHU B;  2AZJ A;  3ZL6 A;  3ACX A;  1JFG A;  5ILH A;  1DI1 A;  2OPN A;  3ICM A;  4DXJ A;  1YHL A;  1YV5 A;  5HN9 A;  4DWB A;  1JFA A;  3V1V A;  3BNX A;  4KK2 A;  3KRC B;  3KRF A;  4EA2 A;  3LEE A;  4GA3 A;  2E8X A;  5IM1 A;  3VJB A;  4GAX A;  5B0K A;  5JV1 F;  4K10 A;  3N0F A;  3KRP B;  3RMG A;  3WCG A;  2FOR A;  5E8L A;  4F62 A;  4LPH F;  5ILY A;  1PS1 A;  2PS8 A;  4FP4 A;  5ILK A;  2Z50 A;  1YYS A;  3B7L A;  4XQT F;  2OGD A;  4P0W A;  3ASX A;  4DZW A;  3ACW A;  4GP2 A;  4E9Z A;  3G4F A;  2PS5 A;  3WJK A;  3NF2 A;  3WEJ A;  3LK5 A;  4P0V A;  4KUX A;  4UMJ A;  4KQU A;  1WL1 A;  4MC8 A;  4JXN A;  5IMP A;  5DJP F;  5ILD A;  2E93 A;  5DHK A;  5B03 A;  3CP6 A;  3N0G A;  3AQB B;  2J1P A;  3LSN A;  3M9U A;  1YHK A;  3LMD A;  3OAC B;  3MAV A;  1WY0 A;  3OAB B;  4OKZ A;  2J1O A;  3LZ9 A;  3EFQ A;  3WSB A;  3ADZ A;  3VJC A;  3ID0 A;  1V4I A;  4LZC A;  1V4E A;  3MZV A;  4QXS F;  3QQV A;  4DHD A;  4KPJ A;  4LPG F;  3SDV A;  4PVX F;  4LFV F;  5AFX A;  3ZCD A;  4LTZ A;  5KSX F;  1EZF A;  1WL0 A;  2Z52 A;  3S4J A;  2E90 A;  3ZMB A;  1FPS A;  5DGN F;  3Q2Q A;  3TFN A;  5DJV F;  1DGP A;  4RXC A;  5IN8 A;  5IKA A;  1VG3 A;  1HM7 A;  5A0J A;  3VJ8 A;  5B01 A;  5AYP A;  4H5E F;  4NKF A;  2E94 A;  2OA6 A;  4LZ3 A;  3WCC A;  2F94 F;  4LFE A;  3ZMC A;  3QKC A;  5CG5 A;  3Q2Z A;  4H5C F;  5IK0 A;  1YJ4 A;  3WCE A;  3RYW A;  2ZCQ A;  5IK9 A;  3N1V F;  3KRO A;  5B00 A;  3LOM A;  4JZX A;  3ZOU A;  1N22 A;  3N45 F;  4GP1 A;  2Z4W A;  1UBY A;  2ZCS A;  2E8V A;  3P8R A;  2H8O A;  3WCI A;  4NFI F;  4QPF A;  3P41 A;  3SAE A;  3KB9 A;  5CG6 A;  4OMH A;  3RBM A;  5B0M A;  5EAU A;  1UBW A;  1V4K A;  2Q9Y A;  5A0K A;  5I1U A;  4WK5 A;  3AQ0 A;  1WKZ A;  3KRF B;  1N1Z A;  4RNQ A;  4NG6 A;  1RQI A;  3PKO A;  5B0I A;  3WCF A;  5IKH A;  5E8H A;  3WCD A;  5JA0 F;  3WCH A;  2RAH A;  2VF6 A;  2Z7I A;  2AET A;  4KFA A;  3NPR A;  3WCL A;  3P5R A;  4RXD A;  2F9K F;  3V1X A;  4LFG A;  2P1C A;  3SDT A;  4RXA A;  3PYA A;  5DW7 A;  3DYG A;  3S9V A;  5IK6 A;  3WC9 A;  3KRA A;  3N5H F;  5IL3 A;  1HX9 A;  2AZL A;  4EA1 A;  4NFJ F;  3WEH A;  2Z4Z A;  4E9U A;  1VG7 A;  3WEI A;  1YYQ A;  4KVW A;  5IMI A;  5DHI A;  3TFV A;  5DGM F;  4LLT A;  3N46 F;  5B02 A;  1HXA A;  2E95 A;  4LXW A;  3NRI A;  5JV2 F;  5B0J A;  4HD1 A;  5H9D A;  3Q1O A;  2Z7H A;  3DYF A;  3LJI A;  4KKM A;  4KPD A;  3EZ3 A;  3WEK A;  3OYR A;  5JUZ F;  1WL2 A;  1VG2 A;  1RQJ A;  5ILZ A;  2AEK A;  3WEF A;  3APZ A;  3WEG A;  1V4J A;  2ZEU A;  3KBK A;  5ER8 A;  3AE0 A;  1N23 A;  1HXG A;  4JVJ F;  1YQ7 A;  5E8K A;  3TC1 A;  3VJD A;  4KQ5 A;  1YYU A;  3SDR A;  2PS4 A;  4LLS A;  4MC0 A;  5DJR F;  4FJQ A;  4RXE A;  1N20 A;  4JYX A;  4F6X A;  2J5C A;  2E4O A;  4KQS A;  3P8L A;  2AEL A;  2F89 F;  1KIY A;  4PVY F;  1UBV A;  3N5J F;  3TFP A;  1HM4 A;  5ILI A;  5ERN A;  1UBX A;  2AZK A;  2Z78 A;  3ICZ A;  3SDQ A;  4JZB A;  5ILJ A;  3KRO B;  4NKE A;  1KIZ A;  5B0L A;  5AEL A;  5EAT A;  4RYP A;  5HNA A;  1YHM A;  3WCM A;  3LDW A;  3SDU A;  3KRC A;  2OPM A;  5DIQ F;  2Z4Y A;  3PDE A;  1VG6 A;  1V4H A;  3N3D A;  2EWG A;  3EGT A;  3WCJ A;  4NUA A;  3DYH A;  3KRP A;  5DGS F;  4Q23 A;  4LTV A;  3N49 F;  5A0I A;  3WJO A;  2O1O A;  2Q80 A;  2Q58 A;  4KVD A;  4DEM F;  3LVS A;  5ERO A;  3WCA A;  3M0G A;  2QIS A;  1ZW5 A;  3CC9 A;  2ZY1 A;  4E1E A;  3LGK A;  2Z4V A;  4NFK F;  3ICK A;  3WE9 A;  3RYE A;  4N1Z F;  4LA5 A;  2I19 A;  3ICN A;  5HN7 A;  1WMW A;  2F92 F;  3M01 A;  4KWD A;  2E8U A;  3G4D A;  4JXY A;  5IVG A;  1YYT A;  4F6V A;  3WJN A;  4LUU A;  3LLW A;  3AQC B;  4L2X F;  4LIX A;  3N1W F;  2E8W A;  2PS7 A;  4OGU A;  3VJA A;  3P5P A;  4P0X A;  3ACY A;  5IL8 A;  3UCA A;  3V66 A;  3PYB A;  3KRA B;  2E92 A;  3OAC A;  3OAB A;  5C05 A;  3VJ9 A;  2Q9Z A;  2ONH A;  3IPI A;  4MC3 A;  2DH4 A;  3LGZ B;  2E8T A;  3BNY A;  2ONG A;  4XQR F;  3WSA A;  2Z4X A;  2PS6 A;  5IMN A;  3TS7 A;  3WCB A;  2E91 A;  3W7F A;  2ZCR A;  1VG4 A;  3LG5 A;  4KVI A;  3CKE A;  1N21 A;  3M02 A;  5HN8 A;  5DZ2 A;  3VJE A;  4EA0 A;  1YYR A;  3N6K F;  2F7M F;  4XQS F;  2FTZ A;  1N1B A;  1RTR A;  4LZ0 A;  4KVY A;  4OMG A;  3Q30 A;  4DI5 A;  4ZQ8 A;  4OKM A;  2ZCO A;  3PH7 A;  4LA6 A;  3IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...