3AE4B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae4B01
1GTEA 3B2GA 1PFDA 3AB5A 3AMZA 1YJIA 4YSYB 1RWSA 2HTME 2JX5A 3NVYA 1ZXIA 2W54A 3HRDD 1OQQA 1QOBA 1V8CA 3PO0A 3FC4A 1E10A 3AE6B 1V97A 1H7WA 1GT8A 3CIRB 2WLBA 2WQYB 3AH7A 1DOXA 1QT9A 2K5PA 3AEDB 3DWGC 1J7CA 1ZUD2 4YSZB 3HUIA 4HRSA 2L52A 1VJKA 4JWSC 2W55A 1QOGA 3KWLA 1TKEA 4JWUC 5G5GA 3VRAB 1IUEA 1WWTA 3W5UB 5EE1A 1ZP0B 2LEKA 3LXFA 3NVZA 2BS3B 2DWQA 1AYFA 4ITKA 3AE1B 4YT0B 2DBYA 1WRIA 1CJEA 3RPFC 3P1MA 4ZHPA 2QJLA 1FXIA 1E6EB 4FXCA 2E3TA 1JQ4A 2MH7A 1N62A 1NI3A 1H7XA 2KAJA 4US8A 4IDIA 1FFVA 1FFUA 3NVVA 1A70A 4YTNB 3VR9B 2ACZB 1KFYB 1NEKB 3VR8B 1FRDA 1PUTA 1L6UA 1J7AA 3SFEB 1SB3C 2N0SB 1QOFA 2PVOD 3AEFB 4KX6B 3P4PB 3HVZA 5H8YE 1ZOYB 2CU3A 1ROEA 1PDXA 1RFKA 3CF4A 2W3RA 5C3JB 1JWBD 3NVWA 3AE4B 2M56B 1TJEA 1XLPA 3L4PA 3ZYYX 1DOYA 5GXGB 3P4SB 3AE2B 1N5WA 2PVGC 4P6VF 4C80A 4YXDB 1N60A 1FO4A 3B2FA 1UWMA 3DWMA 4WWMA 1JROA 2B76B 1DOIA 1I7HA 2G1EA 1WGKA 3AN1A 4N58A 4ZOHC 1VDVA 4USAA 2QIEB 4A9AA 1E7PB 4ZHOA 2BS2B 1JALA 3AM9A 1J7BA 4US9A 3AE7B 1FMAD 3AEBB 4JX1C 2WP9B 5G5HA 3W9CB 1RM6C 2Q5WD 1E9MA 2CJNA 1KF6B 1TKYA 3AV8A 5AUKA 1YJJA 2H88B 1JRPA 2H89B 1FRRA 3CWIA 2WDQB 2K22A 3P4QB 2JQRB 1L0VB 1TYGB 1E0ZA 1OFFA 2Y5CA 1CZPA 1EWYC 3AE3B 2WDRB 2FBWB 1SIJA 2L83A 2K9XA 2W3SA 2MJ3A 2BS4B 1GAQB 3W5VB 3VRBB 1NVID 4YTMB 3ABVB 2WU5B 2WDVB 3AEGB 4YSXB 4HROA 3SR6A 5EE3A 3AE9B 4LTUA 5MPOA 1TKGA 1YQ3B 1KRHA 5C2TB 3AECB 1L5PA 1N63A 2BT6A 2CJOA 2OHFA 3EUB2 5AUIA 1GPXA 3P63A 3P4RB 1NYQA 1N5XA 1R7SA 1VLBA 1XLOA 1WYGA 1NENB 3B9JA 1QF6A 1B9RA 1F0ZA 1XLNA 3FAHA 2MJDA 1QOAA 1SF0A 1AWDA 3AE8B 3NS1A 4C7YA 1FXAA 1NYRA 1FIQA 2EKIA 2M19A 3AEAB 2PKOA 1L6VA 3LB8C 3AE5B 3AEEB 1YQ4B 2WS3B 1DGJA 5EE9A 2KMMA 4C7ZA 3NRZA 1GTHA 1N61A 1WXQA 2MJEA 1FM0D 4YTPB 1XO3A 4N6EB 5EE0A 1QLBB 1OQRA 2WU2B 3ETRA 2PIAA 1JWAD 1RYJA 4N59A 2AX5A 3WCQA 4WQMA 1JW9D 1XLQA 3SFDB 3BIID 5H92C 1T3QA
chains in the Genus database with same CATH superfamily
4HK2A 3AB5A 3Q8AA 4YSYB 4CO7A 1V9JA 1UGJA 4G50A 1YD8U 4E74A 2N1VA 4CYEA 2WQYB 3Q3NC 3QQ8B 1UD7A 1UZXB 4KKJA 2NBVB 2W55A 3ZNZB 4KVGB 3W5UB 3AULA 2RDHA 3CMMB 2ZEQA 4K81A 3NVVA 1A70A 3BZDB 2KVRA 3VR8B 2N0SB 2INCC 4KZCA 3KUDB 4ZRJA 1TBEA 2MBQA 3EFCA 1GJZA 3SDLC 2JU6X 5DPWA 1KOTA 5CHFA 2FAZA 4MGYE 1TS5A 3L17A 3GZNB 1MI0A 2AL6A 2KDBA 1I35A 3ZKJC 1PQSA 3RZWC 5L83A 5C1ZA 1L0XB 3W1YA 3DVNV 1TY2A 5D6JB 3U4EG 3PHXB 2L8JA 4FJVB 4ANUA 2WDRB 3RN9C 2JPHA 3DVNU 1PGAA 1GAQB 1VZ8A 3U30A 4GDLB 3RCZA 2VH1A 4LDTD 3AECB 5CX3A 3P63A 4W9JA 2GLSA 4RM8A 5LXHA 3EC8A 3K9PB 3GE3C 2FUG1 1MG8A 3TL5A 4FXCA 1TS4A 2LXCA 4ASWC 2E6XA 4F1SA 2O2VB 1YX6B 5CHWA 1RYJA 3AU5A 1UBQA 3VTUA 3J9CA 3BYTB 3NY5A 4AJYB 4JIOU 1K51A 1RWSA 2ZCCA 3Q8CA 5D3DA 1UUPA 5I4DA 2K5PA 3AEDB 1EO6A 3HUIA 2KVZA 4TQ1A 5CHVC 1UBIA 2RR9A 3MHZA 4I6NB 1I4QA 4DQOC 1TY0A 1WGYA 3QK0A 3VH3B 3V6CB 1SE9A 1VD2A 3NUHB 4WURA 4URKA 1NI2A 2BYTA 3BVZA 2IO3B 1JWBD 2IGHA 3AE4B 4NAWB 2CR5A 2IYDB 4LNOA 1DOYA 2M4NA 1FCLA 4ICUA 3M62B 4IW0A 3PZ8A 4EZJA 3ZLZA 3R2IA 1JALA 2WYQA 3AEBB 4C4VA 2BKFA 3VTVA 3TBLD 3NHEB 2CJNA 1KF6B 1TKYA 3AV8A 4MGIE 1I4RA 2ZCBA 3DBRB 1J8CA 1V1OA 2Z59B 1OEYJ 3W5VB 2PPHA 4YSXB 1PGXA 5JH5C 1YQ3B 1N63A 4UDUC 1LGRA 5LLIA 1VLBA 1XF5L 3ZDMC 1ESFA 3R7RA 3LB8C 1P7EA 4IDIA 4OZAA 2N7JA 5JHBA 1MPEA 1YN3A 4PT5A 3Q3FA 3L08A 2PIAA 2INNE 2L0FA 2D2QA 3B08A 2LRUA 4LNNA 2JZZA 1TTNA 1LQBA 2XN9C 3A33B 2N7DA 2WXMA 4FJYA 3V6EB 4BVUC 3RULA 4S0RA 4TKNA 1KJTA 2JVCA 5KHOA 5HG2A 4F7ZA 3BK2A 1ZP0B 1A5RA 5JHAA 3I9V1 3CF6E 1FXIA 4LLGM 1MJDA 2DYMA 4RGTA 2KANA 2MH7A 5DPTA 3IT4B 2LGIA 3OWEB 4BOSC 3NS8A 4ANWA 4DXGA 5JZEB 3DHIC 3HK0A 3B0AA 2WX1A 2KDFB 4P6VF 1L4ZB 3N1XC 4L1BA 4HVBA 2B76B 1DOIA 1GC7A 1WGKA 1TT5B 2LJ5A 3IBEA 2BS2B 4TMAB 4B0MA 1YN5A 1D5ZC 2KO3A 1E5WA 1VCBA 2J4XA 2JYEA 4KGRA 1MHXA 1IGCA 2L83A 5GMVA 1V86A 4A20A 2LASA 3V60A 3ZRCA 2C7NB 5DPSA 3UINB 4RMAA 3DBHI 4LTUA 2JYTA 2EELA 5C2TB 1L5PA 2OHFA 2WDTB 4MM3B 1N5XA 4A90A 1P0RA 3Q8BA 4MELA 2CKHB 1V49A 2MEKA 2ZW1A 4DBGA 1ET6A 1F2RI 2DYBA 2RDBC 4OVVA 3V05A 4B95A 3O13A 3H7PA 3P2BA 1T3QA 1GTEA 2LHEA 2LI5A 3ONSA 3AE6B 4RH6A 3X0WA 2IO0B 5IAAC 1QOGA 1V81A 2FE8A 2NVUI 1V5OA 4MGZE 3WANA 1T0RC 1GUAB 3L16A 3X23A 3GOEA 4BKSA 2BS3B 1PGBA 1WRIA 1CJEA 4ZHPA 4KZ0A 1KM7A 5J18A 4YTNB 4USAA 4R3DA 3L54A 4LNFA 5G5HA 3Q2AC 3PGEA 4BBNC 3CF4A 1G6JA 5BMIA 1S1QB 3L4PA 3MJ5A 1QZEA 1FNWA 1UWMA 4K3CA 4ZRKA 4BKSD 2G1EA 3AN1A 2K6QA 1E7PB 2O6VA 2ONQA 2WNMA 2KT7A 3RNCC 2RD0A 2R61A 2EMSA 2KKCA 2GBKA 2H88B 1TIFA 3ZIMA 2IO2B 2C7HA 2JQRB 1WM2A 1WXAA 3NZUA 2WXLA 1U4AA 2ZNVC 1EU3A 4XZ4A 4P7IA 3BY4B 3R7QA 3E56A 2NS5A 1JMLA 2FCQA 4AJWA 4K3BA 4GGQA 1T6BX 2LWPA 2ON8A 3Q8EA 2XBBC 1C9FA 4BKTA 1OGWA 3NOBA 2NBUA 2K25A 1WJNA 4JL9A 4X57B 2IPKD 4IM3A 3H6NA 2QDFA 2IZVB 1SE2A 2MRPA 4M0WA 1LFDA 3DVGX 3SFDB 1C77A 2M0XA 3UQAA 2IGGA 1ACCA 3TIXA 4C56C 2VZKD 3TSSA 1R4NI 1JRUA 1WZ0A 2A5UA 1V97A 4A3OA 4DHZB 1WYWB 3DWGC 4YSZB 3DOWA 4CHKA 3KWVA 3VRAB 3BVMA 3TEWA 3C8YA 2QJLA 1BMLC 1NI3A 4K7WA 4I6LB 2IJ0A 3QA8A 4ICVA 3ZJUA 4KX6B 4RF0A 5J17A 1YNTE 3GB1A 2NTSA 3NG0A 4YXDB 1LO5D 3DBSA 3O65B 4XDDA 2EMTA 3ECIA 2BWES 4NAWA 2WXGA 3GE8C 2WDQB 3P4QB 2JY6A 4NJCA 2UYZB 3VDZA 1GOZA 5L95C 1OFFA 2K9XA 2BS4B 3V61A 4W9HA 3W1SA 1QKZA 2RSUA 5AUIA 1SE4A 1V5TA 1K8RB 1WX8A 2HJ1A 2KJRA 1GB4A 1SJED 1AN8A 1T0SC 1WIAA 1WX9A 5D2MB 3AEAB 3JSVB 1HXYD 1YQ4B 3RT3B 2VH2A 1WXQA 4PS3A 3K9OB 3W1SC 3ML8A 4ANXA 2KTRA 3VH4B 4L2YA 4J3OD 3AI5A 2C60A 3B2GA 3A1QB 3C0RB 3NVYA 1S3SG 1C76A 4WIPA 3H7PB 3QAQA 2GB1A 1H7WA 4OVZA 3A4SC 3P42A 4EZLA 1YQBA 1WZ3A 3ALBA 3HHMA 1CQVA 2DBYA 3L13A 2MW5A 4HLEA 3Q3MC 2JRIB 2IY1B 3DHHC 3FILA 4E3CA 1SB3C 4IC7B 2KC1A 3IG3A 3P4PB 3HVZA 5C23A 3ZNGC 3MC0B 4MEMA 1RAXA 2PW9A 4DXFA 3T3NA 3U2SC 2FCMA 1BXTA 3IAM1 5LXIB 3N32A 1JWMD 3KH0A 2I38A 2MSED 2C7MB 5BYSA 2L32A 3RNBC 1I4XA 2ZNVB 4DK5A 1P9DU 3DBLI 4HCNB 4ARIA 3AXCA 4HWIB 1JRPA 2G4SA 3CWIA 4AP4C 2J42A 2BYVE 2O6VB 3SEBA 1ZW7A 4NPNA 4NY0A 2KFJA 4JLCA 2OOBB 1QILA 4JGHB 2CHXA 2L0TA 5MPOA 3ZXVA 4PS7A 3VXWA 1F0ZA 3N20C 3ZGZA 4NZLB 2OJWA 3NS1A 2MA9B 1FXAA 2EKIA 3ZRFA 2VZKB 1GTHA 2MBEA 2D3AA 4EOYA 4YL8A 1LXDA 3MC8A 4MM3A 4MSQB 2UU7A 3WCQA 1IP9A 1SE3A 2GI9A 2LFIA 1ZXIA 1F52A 4M0WB 2J0KA 1J7CA 5AZHA 2LVQA 1VJKA 2LMCA 3TMPB 3ZTDA 2WXIA 5CTRC 2TSSA 2L05A 3JVZX 4XGAB 2KXJA 1R4MI 1FFUA 4HJGE 1WR6E 4OW0A 1C1YB 2DHZA 2PVOD 2HE7A 3KUZA 4S17A 4W9EA 1YN4A 1XXGA 4EKUA 3RD2A 2CU3A 4HPMB 1HTOA 1PDXA 3NVWA 2HDEA 4M8MA 5BMGA 4W9DA 3URYA 2M1MA 1I4PA 1HEZE 4N58A 3WAOA 3ZO5B 4FBJB 2MBBB 1TZ1A 3PVLA 2N9XA 1L4DB 3PLVA 2KNBA 4FADA 1CZPA 1EWYC 5TR5A 2LUEA 2GRIA 1OEYA 3R2TA 3UF8A 4KKIA 3DHGC 2KC2A 2KLGA 2CJOA 2DENB 1R7SA 1QF6A 2KWCA 2QCZA 1AWDA 2GBMA 2SAKA 2J7QB 1M94A 2PKOA 2GBRA 4C7ZA 2WHIA 3GS2A 1XO3A 1M4VA 3APFA 2MCNB 2BB5A 2INPE 2LGDA 4FN2A 1JW9D 1WJUA 2C5LC 4BOZB 2JWUA 1UH6A 2KTRB 3OG5A 2KQ4X 5DCNA 1SBBB 2I1JA 1GT8A 2DYOA 3E9SA 1WGHA 4JWSC 2LRWA 2KWDA 1WGRA 4LK0M 3LXFA 2DWQA 1AYFA 3H8HA 4HPPA 1FCCC 4AUQC 2N9KA 2E3TA 2N9PC 2MHJA 4NNJB 2K0PA 2J0JA 3APDA 2QEJC 1X1MA 4M02A 4MT5A 1WE7A 3FILB 2DAFA 2D3CA 5J2RA 2PVGC 3GZNI 1RFAA 3CSFA 3N1ZC 4A9AA 4F8CB 1VDVA 2WXOA 3TJPA 1Q0WB 3U8ZA 1FMAD 4DHZE 4GN1A 4HCPB 5IKCM 5D3IB 3ZQ4A 1TYGB 2CHWA 4IKGA 2Y5CA 3TEXA 3I5JC 4KGTA 1C4CA 1VZ6A 3PT2B 1ZDXA 4EFOA 4OVUA 1P7FA 1CMXB 5IA7A 5DPRA 4KDLB 2N9EB 3ENEA 2BYEA 4I6PA 1UNSA 1NYQA 1NENB 2KFKB 1E7UA 2BQQA 2OJRA 4AQ7A 2R2QA 1NYRA 2M19A 3M3JA 5EE9A 2G4DB 3HM6X 4P1CC 4OZCA 3IT6B 4OHJA 1L7YA 4FULA 2BVCA 4ZYSA 1I42A 5EE0A 2PE9A 4N59A 4A3PA 2QHOA 1XLQA 3BIID 3U7DA 5AZFA 4BBNF 4IOIE 3JSVA 3NZ3A 1QOBA 3PO0A 1C78A 2G45B 5HKHA 2FCSA 1TS3A 2GOWA 4J6IA 1YJ1A 4XE0A 4DWFA 3BYYB 2XK5A 2LEKA 2FIDA 3A1QA 2DX5B 4II3B 2CU1A 2MLBA 2D10A 2V3NA 4KSLC 2ZVOA 1FFVA 2ACZB 4MH0E 1TGZB 2KYWA 1ZOYB 1DYQA 5BMHA 1TJEA 2IY0B 5GXGB 1Y8RC 2HTHA 2L76A 3VVWB 1E90A 4IM2A 3KQ4A 2PEAA 2LHDA 1J7BA 3AE7B 3W9CB 1B1ZA 2I1KA 2DNFA 3I63C 4EZKA 2ZVNA 1STEA 2ICIA 2KN4A 1ENFA 3DBRI 1NVID 4JQWC 4ZRIA 2V3SA 3DCGA 1Q1OA 2LD9A 3SR6A 3WALA 3VTWA 2PMVA 1GPXA 4E71A 5BYRA 1RRBA 2ZZPB 1UF0A 1WYGA 4GIVA 3LYYA 2Z0DB 2DZMA 1JCKB 4GXBA 1AW7A 1WX7A 2BWFA 4W9CA 1L6VA 1L2NA 3EA6A 2LVPA 2MJEA 3T3OA 1QLBB 5T8IA 3QWZB 2DZIA 2JUOA 3VQIA 1WFYA 3KVFB 1FEHA 4HEA1 1F77A 2O6VD 4GSWA 3AMZA 1ZXHA 2HTME 1FPYA 1OQYA 2D3GA 3TEZA 2NR2A 1WGGA 4MJSA 1YMHE 2V4IB 4RM9A 4RF1A 1ZUD2 4GOCA 1LM8B 2BW2A 4XWTA 4XC2A 1FNUA 2JXTA 2WXRA 3P1MA 1JQ4A 1WXVA 1N62A 2LGYA 4US8A 2K8CA 4NQKE 1TS2A 1WMHA 5D7GA 2K1FA 4XWWA 3A9KA 1E7VA 1EM7A 1WXSA 1F9JA 3QARA 4L23A 2MQJA 5FK9C 2JRHA 2KMAA 4RCOA 4BZAA 1MVKA 1SGHA 1Z2MA 4ZRQA 2CS4A 2N9LA 1P3QU 5IOIA 3KYCD 2D11A 4ACFA 3IFWB 2AYOB 4O1NA 2WXNA 4ZOHC 4EEWA 2KTFA 2KN5A 3MHSD 4JX1C 4Q2JA 4NAMA 1SJHD 1FRRA 2G9HD 2Z0EB 2IGDA 3H9DA 2FBWB 2W3SA 1KLGD 4LNKA 5E6JA 3RNEC 1Z5SB 3U7ZA 1QQRA 1XCTL 1WJ6A 3WAPA 3RUIB 4G0NB 3AE9B 1L0YB 4KV2A 1JWSD 1XLOA 4LNIA 2N1WA 1KLVA 2MJDA 3RNAC 3CSTA 2IO1B 3AE8B 2ZPYA 1IBXA 3PRZA 1FNVA 4QAYA 1HE8A 1JWUD 3ZVVA 4N6EB 2REXA 2Y3AA 3QJZA 3N9YC 2INDC 2N7EA 4WQMA 2DZKA 1F2RC 5G2NA 1ISNA 5BO4B 3R8BA 4RFBA 3N1YC 1ET9A 1QT9A 3R3MA 3IVFA 2Y5BB 4GLSC 3UIPB 1C4AA 5HI1A 4JWUC 1F1HA 4KIKB 3VFKA 1SSNA 3RFZB 2SEBD 1E6EB 1D5XC 2K39A 4TUUA 2XK5B 5EE1A 3PZDA 4PYUA 1WE6A 3MJWA 1ROEA 1RFKA 3HVDA 3KYDD 4BFRA 4DDID 2KLCA 5E6PA 1KLUD 4C80A 4ARCA 4XX5A 2VRRB 1D6EC 4WWMA 1D5MC 3R66C 3VUYA 4US9A 2MWSB 4W9LA 2ZW0A 2MP2B 1BT0A 3JW0X 1L0VB 1KTKA 2KHWB 2LGSA 1MHHE 1AARA 4LCDE 3KUCB 2LZ6A 1E8YA 3D32A 4HROA 1K53A 3T9LA 4WJPA 4DHJB 1TKGA 2WXJA 3PHWB 4K7SA 3P4RB 1V80A 4MDKE 1CK1A 4NJ6A 1SF0A 2D07B 2JT4B 2J53A 2BGFA 3N30A 3OAWA 1HA5A 3AEEB 3UI3A 1ZDVA 4WJQA 3ZW3A 2W82A 2RPVA 1OQRA 3ETRA 1JWAD 2AX5A 4HKZE 2Z8LA 4BKGA 2KFKA 4B9KA 2AL3A 2JXXA 4GDKA 2W54A 3GP7A 1OQQA 3L0WB 2FIFA 1WGDA 4WWNA 1TZOA 4DXAB 2YLMA 4K1RB 2QC8A 4IWQA 3MC9A 4PK1A 4YWGG 1IUEA 1WWTA 4MJSB 5IP4D 1K52A 4WWOA 4B6WA 2NMQA 1EUVB 4ITKA 3A4RA 1L6UA 2LUMA 3PS6A 2YEPB 3QC8B 2W3RA 4WJOA 3TUOA 3NJTA 1WMHB 3LDZE 1MFWA 3A9KB 1ZKHA 1N5WA 2Y5PA 4G3XB 4RGMA 3RNGC 3B2FA 2GMIC 3WA0A 3SD5A 3RMKC 2WP9B 1XD3B 4IWPA 1EWCA 1WY8A 4IM0A 2NPTB 2WXFA 5KHQA 4GU2A 3SHQA 1VZ7A 2MX2A 3PLUA 1SIJA 2RDGA 4KDIC 3QX1A 2KWVB 2KX3A 3DBHB 1V1PA 2YVCA 5HHDG 1I4GA 1KRHA 3HIZA 3MP9A 1D3ZA 2K6DB 3ZNID 2R2OA 3B9JA 3AU4A 4M8NA 1B9RA 2XNAC 4FLHA 2C9WB 4BAXA 1FIQA 1V2YA 3BK1A 4AOFA 5EDSA 1PYWD 3NRZA 4FHKA 2XEWA 2JZPA 2J0MA 3S2AA 1IBXB 2KWUB 2DZJA 3JYUA 5AZGA 4NJ7A 4W9FA 2AQ2B 1YJIA 4B0EA 2JX5A 1HZ5A 1EF5A 3FC4A 3Q69A 3PSEB 4TQ0A 1EF1A 2HD5B 2B3AA 4HRSA 3KWLA 3BINA 1TKEA 1WF9A 3T8MA 5G5GA 4PS8A 1Q5WB 2LXAA 3BVGA 4WWPA 3EFUA 2M8SA 3M63B 3W2DA 2NBWB 1C4PA 4OZBA 3RYTA 2NTTA 3VR9B 1KFYB 1NEKB 1FRDA 3AEFB 1FD6A 3DPDA 1WSPA 1D4BA 1WH3A 4A6QA 5C3JB 3A9JB 1P98A 3SU8X 2AEHA 1T5XD 2RPQA 1GG3A 4W9IA 4ZDVA 1BUIC 3DWMA 1YOVB 2D3BA 1KH0A 4ZHOA 1GC6A 1E9MA 4RGOS 2WXPA 2KD0A 2M17A 1YJJA 4P16A 2BTEA 2H89B 2GBJA 1I4HA 3VRBB 4CQNA 4ZRPA 4D2KA 2WDVB 3ZUNA 2BB6A 5EE3A 4HDOA 3EECA 3LJ3A 2HJ8A 1HTQA 2ZJDA 3FAHA 2RMMA 1QOAA 2IDYA 2D5GA 3U52E 3WIMA 3DQVA 1DOXA 3V3XA 3ZXRA 3ML9A 1N61A 2AQ1B 1XT9B 3QCAA 4REZA 3Q3JA 4AWJA 2AWTA 1R4NB 4XYCA 1RLFA 3HRDD 4DDGD 4GB9A 1HZ6A 1ZGUB 1ZE3D 2EKEC 2WLBA 3AH7A 4G11A 2WXQA 2JF5A 4LJOB 4WQOB 4ZYNA 4A55A 4GDKB 3MTNB 1T0YA 3NVZA 3HM3A 4TV3A 3I3TB 3RI7C 2PLPA 4HXDA 1ZPSA 2L7RA 1PUTA 4LDTB 4II2B 1J7AA 3SFEB 1WM3A 1QOFA 4WJNA 3APCA 4TSSA 3H1UA 4KIKA 2KMCA 3IHPC 2M56B 3Q8FA 2L1AA 3N3KB 3P4SB 4M01A 3AE2B 5E6NA 1UWXA 3Q6BA 4EE2A 3B1LX 2CHZA 4JPSA 3PTFC 2UWQA 3NZSA 3KLSX 3PREA 2Q5WD 4WH4A 5AUKA 3Q3OC 1J19A 2KDEB 4MACA 2K22A 3PV1A 2DAJA 2FUHB 1IGDA 2IBIB 5TSSA 2WU5B 1H4RA 2X8XX 1C3TA 3I57A 4RGNA 2MP2A 4KGSA 1V1PB 5D94A 1XLNA 4JE3B 1Y56A 1E8XA 2WS3B 1DGJA 1UELA 1WR1A 2WX0A 2KOXA 1E8WA 2QILA 3DDCB 4KSKC 4N9F4 4HJKA 1XQQA 1PFDA 1WJ4A 3RNFC 3WAMA 1P1AA 1IPGA 2ASQA 2JZ3B 2YEPF 3PZ7A 1SIFA 4EUTA 2L52A 2KACA 4DHJD 3EGRA 5G55A 2BPSA 2KJHB 3AE1B 4YT0B 2BF8B 3UIOB 2LVOA 2KAJA 1V6EA 1E8ZA 2K8HA 5H8YE 2NCNA 2KDMA 3C19A 4P1BC 1IYFA 4PYZA 4C4VB 5E6OA 1XCQL 2LGXA 2V1YA 4NQLB 1XLPA 3Q14C 1NBFC 2BBCA 3VUWA 1FO4A 5JXVA 3PRPB 4MGKE 2GBNA 3DBLB 4GMVA 3AM9A 2PE6B 4IUMB 1T0QC 2KJ6A 1YX5B 4IG7B 4GDLA 1SXTA 2L00B 1E0ZA 2JWZA 2K3UA 3KW5B 5AEKB 2WXKA 2X38A 2L3ZA 2MJ3A 3M95A 4HDQA 2V9HA 5FKAC 3V62A 4YTMB 4LJPB 1WXMA 3EHVA 3EUB2 4K7UA 2NPTA 3ZTCA 3QIJA 4W9GA 4XDCA 4MSMB 3IAS1 2O2VA 2LJIA 3VHTC 2RGFA 2KX0A 5FR3A 2BYFA 2WXHA 4RNAA 2FCNA 4H2AA 3OJ4B 3PRMB 3OJ3A 3UQBA 3AE5B 4HKQA 1FM0D 4YTPB 2WU2B 1FXTB 2MBOA 2V0GA 3ZNHB 3VUXA 1UGMA 5H92C 3L10B 2WWZA 2PTLA 2KZRA 4C00A 1K50A 2QMTA 1V8CA 1NDDA 1C79A 1E10A 5BYQA 3RZFA 3OLMD 3VAWA 2A4ZA 3CIRB 4WAFA 4FHJA 2G3QB 1XEEA 3RPFC 1R4MB 2N4FA 2OEDA 5HFYA 3ZDTA 5IN7A 1H7XA 4M00A 1H8CA 2BKRB 3ZJTA 3QHTA 5IO9A 2M0AA 4HPLB 2KDIA 2V3PA 3IXSA 1OTRB 3TEYA 3ZYYX 1N60A 1EU4A 4AS1A 1JROA 3H7SA 2AQ3B 1I7HA 2KQSA 1MG4A 2ZPNA 2QIEB 2W9NA 4A8XC 1RM6C 3DVGY 5FR6A 3A9JA 3FKYA 3AE3B 4FA6A 1WI0A 3UGBB 1VRAB 2PJHA 2QSDA 1J0GA 1Q10A 4ANVA 3ABVB 1GNUA 1SEBD 3AEGB 3ZJVA 1HQRD 1VR9A 2J52A 2BT6A 2MBHA 1N6ZA 3TCAA 4MH8A 2DLBA 3BWUD 2FNJB 2JSVX 1WRDB 2V4LA 3PPAA 1GB1A 4W9KA 4C7YA 4WAAA 5LNK1 2KK8A 2KMMA 3MFGA 2KQ7A 2K8BA 2I2YA 4FJZA 4IWOA 2WGSA 1YIWA
chains in the Genus database with same CATH topology
1ACCA 2AQ2B 3AB5A 1YJIA 3Q8AA 4YSYB 2JX5A 2VZKD 1HZ5A 1UGJA 4B0EA 3TSSA 3NZ3A 4C56C 1QOBA 3PO0A 3FC4A 3Q69A 1C78A 4TQ0A 1V97A 2WQYB 1TS3A 3DWGC 4KKJA 4YSZB 4HRSA 3KWVA 2W55A 3KWLA 4XE0A 3BYYB 1TKEA 5G5GA 3VRAB 3W5UB 3BVMA 3BVGA 3TEWA 2LEKA 3C8YA 2RDHA 2QJLA 3W2DA 1C4PA 2V3NA 1BMLC 1NI3A 4OZBA 2NTTA 2IJ0A 1FFVA 3NVVA 1A70A 3VR9B 3BZDB 2ACZB 1KFYB 1NEKB 3VR8B 1FRDA 2N0SB 3ZJUA 3AEFB 1FD6A 4KX6B 4RF0A 1WSPA 1ZOYB 1D4BA 1YNTE 2JU6X 4A6QA 5C3JB 1TS5A 1DYQA 5BMHA 1TJEA 1MI0A 1T5XD 3GB1A 5GXGB 2NTSA 4YXDB 1LO5D 1BUIC 3DWMA 1KH0A 4XDDA 3KQ4A 4ZHOA 2LHDA 1J7BA 1L0XB 3AE7B 3W9CB 1B1ZA 1TY2A 3U4EG 1E9MA 4RGOS 2WXPA 4P16A 1YJJA 2BTEA 2H89B 2WXGA 2WDQB 3P4QB 4NJCA 1STEA 1GOZA 1OFFA 2WDRB 2ICIA 2KN4A 2K9XA 1I4HA 1ENFA 2BS4B 1PGAA 1GAQB 3VRBB 1NVID 1VZ8A 4ZRPA 4CQNA 4GDLB 4D2KA 2WDVB 3SR6A 2BB6A 5EE3A 3W1SA 1QKZA 3AECB 2PMVA 1GPXA 5BYRA 5AUIA 1SE4A 3P63A 1WYGA 3LYYA 3FAHA 1GB4A 2RMMA 1SJED 1QOAA 1AN8A 2IDYA 2D5GA 3U52E 2FUG1 1JCKB 1AW7A 4FXCA 1TS4A 1DOXA 3AEAB 3V3XA 1L6VA 1HXYD 1YQ4B 2E6XA 1N61A 1WXQA 3EA6A 2MJEA 3T3OA 2AQ1B 1QLBB 1RYJA 5T8IA 4REZA 4L2YA 4J3OD 3VQIA 3J9CA 3BYTB 4HEA1 1FEHA 1F77A 3B2GA 3AMZA 1K51A 1ZXHA 1RWSA 2HTME 3NVYA 3HRDD 3TEZA 3Q8CA 5D3DA 1C76A 4WIPA 1UUPA 1YMHE 2V4IB 1HZ6A 1H7WA 2GB1A 4OVZA 1ZE3D 2WLBA 5I4DA 3AH7A 2WXQA 2K5PA 3AEDB 3P42A 4RF1A 1ZUD2 3HUIA 4TQ1A 4A55A 4GDKB 3MHZA 2BW2A 4XWTA 1I4QA 1FNUA 4DQOC 1TY0A 3NVZA 1CQVA 2JXTA 2DBYA 2WXRA 4IOIE 3P1MA 1JQ4A 1N62A 4US8A 2PLPA 3FILA 1ZPSA 1PUTA 1TS2A 1SB3C 5D7GA 1J7AA 3SFEB 4XWWA 3NUHB 1QOFA 4WURA 4TSSA 3P4PB 1EM7A 3HVZA 2BYTA 3BVZA 1JWBD 3MC0B 4L23A 2IGHA 5FK9C 3AE4B 2M56B 3Q8FA 4NAWB 4RCOA 1DOYA 2L1AA 2PW9A 1MVKA 4DXFA 3T3NA 3P4SB 3U2SC 3AE2B 1BXTA 4ZRQA 1FCLA 2N9LA 3IAM1 1JWMD 1UWXA 4EE2A 2I38A 3PZ8A 2WXNA 4O1NA 4JPSA 4ZOHC 5BYSA 2L32A 3R2IA 1JALA 1I4XA 4JX1C 3AEBB 3KLSX 4Q2JA 2Q5WD 4ARIA 4NAMA 2CJNA 1SJHD 1KF6B 1TKYA 4WH4A 3AV8A 5AUKA 1I4RA 1JRPA 1FRRA 3CWIA 4MACA 2G9HD 2J42A 2K22A 3SEBA 2IGDA 2FBWB 2W3SA 1KLGD 1V1OA 5E6JA 1IGDA 3U7ZA 3W5VB 1QQRA 1XCTL 5TSSA 1QILA 2WU5B 4YSXB 1PGXA 3AE9B 3I57A 4RGNA 1L0YB 1YQ3B 1N63A 4KGSA 5MPOA 4UDUC 1JWSD 1V1PB 1XLOA 1VLBA 1XF5L 1F0ZA 1XLNA 2MJDA 3ZGZA 1ESFA 4NZLB 3AE8B 3NS1A 1IBXA 1FNVA 1FXAA 1P7EA 2EKIA 3LB8C 1Y56A 4IDIA 2N7JA 4JE3B 2VZKB 1JWUD 4OZAA 2WS3B 1DGJA 1MPEA 1YN3A 1GTHA 4PT5A 4N6EB 2Y3AA 2PIAA 2INNE 3N9YC 3WCQA 4WQMA 2QILA 1F2RC 1SE3A 2GI9A 1PFDA 2LFIA 1ZXIA 2XN9C 3R8BA 4RFBA 2WXMA 1ET9A 2YEPF 3PZ7A 1QT9A 1J7CA 2L52A 1VJKA 2KACA 2LMCA 1C4AA 4GLSC 5HI1A 3EGRA 4JWUC 2WXIA 5HG2A 2TSSA 3BK2A 1ZP0B 1SSNA 3RFZB 3I9V1 3AE1B 4YT0B 2SEBD 1FXIA 4LLGM 1E6EB 2DYMA 4RGTA 1D5XC 2MH7A 2KAJA 3IT4B 2LGIA 1FFUA 3OWEB 4HJGE 5EE1A 5H8YE 4OW0A 2PVOD 1YN4A 1XXGA 2KDMA 2CU3A 4DXGA 1ROEA 1PDXA 1RFKA 3NVWA 3HVDA 1XCQL 1XLPA 2HDEA 1KLUD 2BBCA 4P6VF 4C80A 1L4ZB 4ARCA 4L1BA 1FO4A 5BMGA 1D6EC 4WWMA 1D5MC 3URYA 5JXVA 2B76B 1I4PA 1HEZE 1DOIA 1WGKA 4N58A 2BS2B 4TMAB 4B0MA 3AM9A 4US9A 1YN5A 1D5ZC 2ZW0A 1L4DB 2J4XA 2JYEA 1SXTA 4KGRA 1MHXA 1L0VB 1KTKA 2K3UA 1E0ZA 1IGCA 1CZPA 1EWYC 2WXKA 2X38A 2L83A 2MJ3A 1MHHE 5FKAC 4YTMB 2GRIA 3R2TA 4HROA 4KKIA 1K53A 4LTUA 1TKGA 2EELA 2JYTA 5C2TB 2WXJA 1L5PA 2OHFA 2CJOA 3EUB2 4MM3B 4XDCA 3P4RB 1N5XA 1R7SA 3IAS1 1QF6A 1CK1A 4A90A 2LJIA 1SF0A 3Q8BA 1AWDA 2J53A 5FR3A 2WXHA 4RNAA 2SAKA 4H2AA 2PKOA 1HA5A 3AE5B 3AEEB 2MEKA 2ZW1A 3UI3A 4C7ZA 1ZDVA 4HKQA 1ET6A 3GS2A 1F2RI 1FM0D 4YTPB 1M4VA 1XO3A 2W82A 2RPVA 1OQRA 2WU2B 3ETRA 2BB5A 1JWAD 2INPE 2AX5A 4HKZE 2V0GA 3V05A 2Z8LA 1JW9D 3O13A 5H92C 1T3QA 2PTLA 1GTEA 2LHEA 1K50A 2JWUA 2QMTA 2W54A 3GP7A 1OQQA 1V8CA 1C79A 1E10A 2KQ4X 3AE6B 5BYQA 4RH6A 1SBBB 1GT8A 3CIRB 2DYOA 1TZOA 3E9SA 4JWSC 4WAFA 1QOGA 2FE8A 2KWDA 1XEEA 4YWGG 4LK0M 1IUEA 1WWTA 3LXFA 2BS3B 2DWQA 1AYFA 1PGBA 3H8HA 3RPFC 1FCCC 1WRIA 1CJEA 2OEDA 4ZHPA 5HFYA 1K52A 2N9KA 2E3TA 1H7XA 2NMQA 4ITKA 3ZJTA 4YTNB 4USAA 4R3DA 5G5HA 1L6UA 2K0PA 2LUMA 2M0AA 2QEJC 2YEPB 2V3PA 4MT5A 3IXSA 3CF4A 2W3RA 3FILB 5BMIA 3TUOA 3TEYA 3L4PA 3ZYYX 3MJ5A 1N5WA 2Y5PA 2PVGC 4RGMA 1N60A 3B2FA 1FNWA 1EU4A 1UWMA 4AS1A 1JROA 2AQ3B 1I7HA 2G1EA 4A9AA 3AN1A 1VDVA 2QIEB 2WXOA 1E7PB 2ONQA 2WNMA 1FMAD 2WP9B 4A8XC 1RM6C 1EWCA 2R61A 2H88B 5D3IB 2WXFA 3ZQ4A 2JQRB 1TYGB 1VZ7A 2Y5CA 4IKGA 3AE3B 2WXLA 1SIJA 2RDGA 3TEXA 4KGTA 1VRAB 1C4CA 1EU3A 2QSDA 1Q10A 1VZ6A 1ZDXA 1V1PA 3ABVB 3E56A 1SEBD 5HHDG 3AEGB 1JMLA 1I4GA 3ZJVA 1HQRD 1P7FA 1VR9A 2J52A 1KRHA 2BT6A 3MP9A 4MH8A 2DLBA 3BWUD 2JSVX 1UNSA 1NYQA 3B9JA 1NENB 1B9RA 1T6BX 2ON8A 3Q8EA 1GB1A 1C9FA 2XNAC 4AQ7A 4C7YA 1NYRA 2M19A 1FIQA 3BK1A 5LNK1 5EE9A 1PYWD 2KMMA 3NRZA 4OZCA 2IPKD 3IT6B 4OHJA 3MFGA 4ZYSA 2JZPA 5EE0A 1IBXB 4N59A 1SE2A 2I2YA 4M0WA 1XLQA 3SFDB 1C77A 3BIID 2IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTE A;  3B2G A;  1PFD A;  3AB5 A;  3AMZ A;  1YJI A;  4YSY B;  1RWS A;  2HTM E;  2JX5 A;  3NVY A;  1ZXI A;  2W54 A;  3HRD D;  1OQQ A;  1QOB A;  1V8C A;  3PO0 A;  3FC4 A;  1E10 A;  3AE6 B;  1V97 A;  1H7W A;  1GT8 A;  3CIR B;  2WLB A;  2WQY B;  3AH7 A;  1DOX A;  1QT9 A;  2K5P A;  3AED B;  3DWG C;  1J7C A;  1ZUD 2;  4YSZ B;  3HUI A;  4HRS A;  2L52 A;  1VJK A;  4JWS C;  2W55 A;  1QOG A;  3KWL A;  1TKE A;  4JWU C;  5G5G A;  3VRA B;  1IUE A;  1WWT A;  3W5U B;  5EE1 A;  1ZP0 B;  2LEK A;  3LXF A;  3NVZ A;  2BS3 B;  2DWQ A;  1AYF A;  4ITK A;  3AE1 B;  4YT0 B;  2DBY A;  1WRI A;  1CJE A;  3RPF C;  3P1M A;  4ZHP A;  2QJL A;  1FXI A;  1E6E B;  4FXC A;  2E3T A;  1JQ4 A;  2MH7 A;  1N62 A;  1NI3 A;  1H7X A;  2KAJ A;  4US8 A;  4IDI A;  1FFV A;  1FFU A;  3NVV A;  1A70 A;  4YTN B;  3VR9 B;  2ACZ B;  1KFY B;  1NEK B;  3VR8 B;  1FRD A;  1PUT A;  1L6U A;  1J7A A;  3SFE B;  1SB3 C;  2N0S B;  1QOF A;  2PVO D;  3AEF B;  4KX6 B;  3P4P B;  3HVZ A;  5H8Y E;  1ZOY B;  2CU3 A;  1ROE A;  1PDX A;  1RFK A;  3CF4 A;  2W3R A;  5C3J B;  1JWB D;  3NVW A;  3AE4 B;  2M56 B;  1TJE A;  1XLP A;  3L4P A;  3ZYY X;  1DOY A;  5GXG B;  3P4S B;  3AE2 B;  1N5W A;  2PVG C;  4P6V F;  4C80 A;  4YXD B;  1N60 A;  1FO4 A;  3B2F A;  1UWM A;  3DWM A;  4WWM A;  1JRO A;  2B76 B;  1DOI A;  1I7H A;  2G1E A;  1WGK A;  3AN1 A;  4N58 A;  4ZOH C;  1VDV A;  4USA A;  2QIE B;  4A9A A;  1E7P B;  4ZHO A;  2BS2 B;  1JAL A;  3AM9 A;  1J7B A;  4US9 A;  3AE7 B;  1FMA D;  3AEB B;  4JX1 C;  2WP9 B;  5G5H A;  3W9C B;  1RM6 C;  2Q5W D;  1E9M A;  2CJN A;  1KF6 B;  1TKY A;  3AV8 A;  5AUK A;  1YJJ A;  2H88 B;  1JRP A;  2H89 B;  1FRR A;  3CWI A;  2WDQ B;  2K22 A;  3P4Q B;  2JQR B;  1L0V B;  1TYG B;  1E0Z A;  1OFF A;  2Y5C A;  1CZP A;  1EWY C;  3AE3 B;  2WDR B;  2FBW B;  1SIJ A;  2L83 A;  2K9X A;  2W3S A;  2MJ3 A;  2BS4 B;  1GAQ B;  3W5V B;  3VRB B;  1NVI D;  4YTM B;  3ABV B;  2WU5 B;  2WDV B;  3AEG B;  4YSX B;  4HRO A;  3SR6 A;  5EE3 A;  3AE9 B;  4LTU A;  5MPO A;  1TKG A;  1YQ3 B;  1KRH A;  5C2T B;  3AEC B;  1L5P A;  1N63 A;  2BT6 A;  2CJO A;  2OHF A;  3EUB 2;  5AUI A;  1GPX A;  3P63 A;  3P4R B;  1NYQ A;  1N5X A;  1R7S A;  1VLB A;  1XLO A;  1WYG A;  1NEN B;  3B9J A;  1QF6 A;  1B9R A;  1F0Z A;  1XLN A;  3FAH A;  2MJD A;  1QOA A;  1SF0 A;  1AWD A;  3AE8 B;  3NS1 A;  4C7Y A;  1FXA A;  1NYR A;  1FIQ A;  2EKI A;  2M19 A;  3AEA B;  2PKO A;  1L6V A;  3LB8 C;  3AE5 B;  3AEE B;  1YQ4 B;  2WS3 B;  1DGJ A;  5EE9 A;  2KMM A;  4C7Z A;  3NRZ A;  1GTH A;  1N61 A;  1WXQ A;  2MJE A;  1FM0 D;  4YTP B;  1XO3 A;  4N6E B;  5EE0 A;  1QLB B;  1OQR A;  2WU2 B;  3ETR A;  2PIA A;  1JWA D;  1RYJ A;  4N59 A;  2AX5 A;  3WCQ A;  4WQM A;  1JW9 D;  1XLQ A;  3SFD B;  3BII D;  5H92 C;  1T3Q A; 
#chains in the Genus database with same CATH topology
 4HK2 A;  3AB5 A;  3Q8A A;  4YSY B;  4CO7 A;  1V9J A;  1UGJ A;  4G50 A;  1YD8 U;  4E74 A;  2N1V A;  4CYE A;  2WQY B;  3Q3N C;  3QQ8 B;  1UD7 A;  1UZX B;  4KKJ A;  2NBV B;  2W55 A;  3ZNZ B;  4KVG B;  3W5U B;  3AUL A;  2RDH A;  3CMM B;  2ZEQ A;  4K81 A;  3NVV A;  1A70 A;  3BZD B;  2KVR A;  3VR8 B;  2N0S B;  2INC C;  4KZC A;  3KUD B;  4ZRJ A;  1TBE A;  2MBQ A;  3EFC A;  1GJZ A;  3SDL C;  2JU6 X;  5DPW A;  1KOT A;  5CHF A;  2FAZ A;  4MGY E;  1TS5 A;  3L17 A;  3GZN B;  1MI0 A;  2AL6 A;  2KDB A;  1I35 A;  3ZKJ C;  1PQS A;  3RZW C;  5L83 A;  5C1Z A;  1L0X B;  3W1Y A;  3DVN V;  1TY2 A;  5D6J B;  3U4E G;  3PHX B;  2L8J A;  4FJV B;  4ANU A;  2WDR B;  3RN9 C;  2JPH A;  3DVN U;  1PGA A;  1GAQ B;  1VZ8 A;  3U30 A;  4GDL B;  3RCZ A;  2VH1 A;  4LDT D;  3AEC B;  5CX3 A;  3P63 A;  4W9J A;  2GLS A;  4RM8 A;  5LXH A;  3EC8 A;  3K9P B;  3GE3 C;  2FUG 1;  1MG8 A;  3TL5 A;  4FXC A;  1TS4 A;  2LXC A;  4ASW C;  2E6X A;  4F1S A;  2O2V B;  1YX6 B;  5CHW A;  1RYJ A;  3AU5 A;  1UBQ A;  3VTU A;  3J9C A;  3BYT B;  3NY5 A;  4AJY B;  4JIO U;  1K51 A;  1RWS A;  2ZCC A;  3Q8C A;  5D3D A;  1UUP A;  5I4D A;  2K5P A;  3AED B;  1EO6 A;  3HUI A;  2KVZ A;  4TQ1 A;  5CHV C;  1UBI A;  2RR9 A;  3MHZ A;  4I6N B;  1I4Q A;  4DQO C;  1TY0 A;  1WGY A;  3QK0 A;  3VH3 B;  3V6C B;  1SE9 A;  1VD2 A;  3NUH B;  4WUR A;  4URK A;  1NI2 A;  2BYT A;  3BVZ A;  2IO3 B;  1JWB D;  2IGH A;  3AE4 B;  4NAW B;  2CR5 A;  2IYD B;  4LNO A;  1DOY A;  2M4N A;  1FCL A;  4ICU A;  3M62 B;  4IW0 A;  3PZ8 A;  4EZJ A;  3ZLZ A;  3R2I A;  1JAL A;  2WYQ A;  3AEB B;  4C4V A;  2BKF A;  3VTV A;  3TBL D;  3NHE B;  2CJN A;  1KF6 B;  1TKY A;  3AV8 A;  4MGI E;  1I4R A;  2ZCB A;  3DBR B;  1J8C A;  1V1O A;  2Z59 B;  1OEY J;  3W5V B;  2PPH A;  4YSX B;  1PGX A;  5JH5 C;  1YQ3 B;  1N63 A;  4UDU C;  1LGR A;  5LLI A;  1VLB A;  1XF5 L;  3ZDM C;  1ESF A;  3R7R A;  3LB8 C;  1P7E A;  4IDI A;  4OZA A;  2N7J A;  5JHB A;  1MPE A;  1YN3 A;  4PT5 A;  3Q3F A;  3L08 A;  2PIA A;  2INN E;  2L0F A;  2D2Q A;  3B08 A;  2LRU A;  4LNN A;  2JZZ A;  1TTN A;  1LQB A;  2XN9 C;  3A33 B;  2N7D A;  2WXM A;  4FJY A;  3V6E B;  4BVU C;  3RUL A;  4S0R A;  4TKN A;  1KJT A;  2JVC A;  5KHO A;  5HG2 A;  4F7Z A;  3BK2 A;  1ZP0 B;  1A5R A;  5JHA A;  3I9V 1;  3CF6 E;  1FXI A;  4LLG M;  1MJD A;  2DYM A;  4RGT A;  2KAN A;  2MH7 A;  5DPT A;  3IT4 B;  2LGI A;  3OWE B;  4BOS C;  3NS8 A;  4ANW A;  4DXG A;  5JZE B;  3DHI C;  3HK0 A;  3B0A A;  2WX1 A;  2KDF B;  4P6V F;  1L4Z B;  3N1X C;  4L1B A;  4HVB A;  2B76 B;  1DOI A;  1GC7 A;  1WGK A;  1TT5 B;  2LJ5 A;  3IBE A;  2BS2 B;  4TMA B;  4B0M A;  1YN5 A;  1D5Z C;  2KO3 A;  1E5W A;  1VCB A;  2J4X A;  2JYE A;  4KGR A;  1MHX A;  1IGC A;  2L83 A;  5GMV A;  1V86 A;  4A20 A;  2LAS A;  3V60 A;  3ZRC A;  2C7N B;  5DPS A;  3UIN B;  4RMA A;  3DBH I;  4LTU A;  2JYT A;  2EEL A;  5C2T B;  1L5P A;  2OHF A;  2WDT B;  4MM3 B;  1N5X A;  4A90 A;  1P0R A;  3Q8B A;  4MEL A;  2CKH B;  1V49 A;  2MEK A;  2ZW1 A;  4DBG A;  1ET6 A;  1F2R I;  2DYB A;  2RDB C;  4OVV A;  3V05 A;  4B95 A;  3O13 A;  3H7P A;  3P2B A;  1T3Q A;  1GTE A;  2LHE A;  2LI5 A;  3ONS A;  3AE6 B;  4RH6 A;  3X0W A;  2IO0 B;  5IAA C;  1QOG A;  1V81 A;  2FE8 A;  2NVU I;  1V5O A;  4MGZ E;  3WAN A;  1T0R C;  1GUA B;  3L16 A;  3X23 A;  3GOE A;  4BKS A;  2BS3 B;  1PGB A;  1WRI A;  1CJE A;  4ZHP A;  4KZ0 A;  1KM7 A;  5J18 A;  4YTN B;  4USA A;  4R3D A;  3L54 A;  4LNF A;  5G5H A;  3Q2A C;  3PGE A;  4BBN C;  3CF4 A;  1G6J A;  5BMI A;  1S1Q B;  3L4P A;  3MJ5 A;  1QZE A;  1FNW A;  1UWM A;  4K3C A;  4ZRK A;  4BKS D;  2G1E A;  3AN1 A;  2K6Q A;  1E7P B;  2O6V A;  2ONQ A;  2WNM A;  2KT7 A;  3RNC C;  2RD0 A;  2R61 A;  2EMS A;  2KKC A;  2GBK A;  2H88 B;  1TIF A;  3ZIM A;  2IO2 B;  2C7H A;  2JQR B;  1WM2 A;  1WXA A;  3NZU A;  2WXL A;  1U4A A;  2ZNV C;  1EU3 A;  4XZ4 A;  4P7I A;  3BY4 B;  3R7Q A;  3E56 A;  2NS5 A;  1JML A;  2FCQ A;  4AJW A;  4K3B A;  4GGQ A;  1T6B X;  2LWP A;  2ON8 A;  3Q8E A;  2XBB C;  1C9F A;  4BKT A;  1OGW A;  3NOB A;  2NBU A;  2K25 A;  1WJN A;  4JL9 A;  4X57 B;  2IPK D;  4IM3 A;  3H6N A;  2QDF A;  2IZV B;  1SE2 A;  2MRP A;  4M0W A;  1LFD A;  3DVG X;  3SFD B;  1C77 A;  2M0X A;  3UQA A;  2IGG A;  1ACC A;  3TIX A;  4C56 C;  2VZK D;  3TSS A;  1R4N I;  1JRU A;  1WZ0 A;  2A5U A;  1V97 A;  4A3O A;  4DHZ B;  1WYW B;  3DWG C;  4YSZ B;  3DOW A;  4CHK A;  3KWV A;  3VRA B;  3BVM A;  3TEW A;  3C8Y A;  2QJL A;  1BML C;  1NI3 A;  4K7W A;  4I6L B;  2IJ0 A;  3QA8 A;  4ICV A;  3ZJU A;  4KX6 B;  4RF0 A;  5J17 A;  1YNT E;  3GB1 A;  2NTS A;  3NG0 A;  4YXD B;  1LO5 D;  3DBS A;  3O65 B;  4XDD A;  2EMT A;  3ECI A;  2BWE S;  4NAW A;  2WXG A;  3GE8 C;  2WDQ B;  3P4Q B;  2JY6 A;  4NJC A;  2UYZ B;  3VDZ A;  1GOZ A;  5L95 C;  1OFF A;  2K9X A;  2BS4 B;  3V61 A;  4W9H A;  3W1S A;  1QKZ A;  2RSU A;  5AUI A;  1SE4 A;  1V5T A;  1K8R B;  1WX8 A;  2HJ1 A;  2KJR A;  1GB4 A;  1SJE D;  1AN8 A;  1T0S C;  1WIA A;  1WX9 A;  5D2M B;  3AEA B;  3JSV B;  1HXY D;  1YQ4 B;  3RT3 B;  2VH2 A;  1WXQ A;  4PS3 A;  3K9O B;  3W1S C;  3ML8 A;  4ANX A;  2KTR A;  3VH4 B;  4L2Y A;  4J3O D;  3AI5 A;  2C60 A;  3B2G A;  3A1Q B;  3C0R B;  3NVY A;  1S3S G;  1C76 A;  4WIP A;  3H7P B;  3QAQ A;  2GB1 A;  1H7W A;  4OVZ A;  3A4S C;  3P42 A;  4EZL A;  1YQB A;  1WZ3 A;  3ALB A;  3HHM A;  1CQV A;  2DBY A;  3L13 A;  2MW5 A;  4HLE A;  3Q3M C;  2JRI B;  2IY1 B;  3DHH C;  3FIL A;  4E3C A;  1SB3 C;  4IC7 B;  2KC1 A;  3IG3 A;  3P4P B;  3HVZ A;  5C23 A;  3ZNG C;  3MC0 B;  4MEM A;  1RAX A;  2PW9 A;  4DXF A;  3T3N A;  3U2S C;  2FCM A;  1BXT A;  3IAM 1;  5LXI B;  3N32 A;  1JWM D;  3KH0 A;  2I38 A;  2MSE D;  2C7M B;  5BYS A;  2L32 A;  3RNB C;  1I4X A;  2ZNV B;  4DK5 A;  1P9D U;  3DBL I;  4HCN B;  4ARI A;  3AXC A;  4HWI B;  1JRP A;  2G4S A;  3CWI A;  4AP4 C;  2J42 A;  2BYV E;  2O6V B;  3SEB A;  1ZW7 A;  4NPN A;  4NY0 A;  2KFJ A;  4JLC A;  2OOB B;  1QIL A;  4JGH B;  2CHX A;  2L0T A;  5MPO A;  3ZXV A;  4PS7 A;  3VXW A;  1F0Z A;  3N20 C;  3ZGZ A;  4NZL B;  2OJW A;  3NS1 A;  2MA9 B;  1FXA A;  2EKI A;  3ZRF A;  2VZK B;  1GTH A;  2MBE A;  2D3A A;  4EOY A;  4YL8 A;  1LXD A;  3MC8 A;  4MM3 A;  4MSQ B;  2UU7 A;  3WCQ A;  1IP9 A;  1SE3 A;  2GI9 A;  2LFI A;  1ZXI A;  1F52 A;  4M0W B;  2J0K A;  1J7C A;  5AZH A;  2LVQ A;  1VJK A;  2LMC A;  3TMP B;  3ZTD A;  2WXI A;  5CTR C;  2TSS A;  2L05 A;  3JVZ X;  4XGA B;  2KXJ A;  1R4M I;  1FFU A;  4HJG E;  1WR6 E;  4OW0 A;  1C1Y B;  2DHZ A;  2PVO D;  2HE7 A;  3KUZ A;  4S17 A;  4W9E A;  1YN4 A;  1XXG A;  4EKU A;  3RD2 A;  2CU3 A;  4HPM B;  1HTO A;  1PDX A;  3NVW A;  2HDE A;  4M8M A;  5BMG A;  4W9D A;  3URY A;  2M1M A;  1I4P A;  1HEZ E;  4N58 A;  3WAO A;  3ZO5 B;  4FBJ B;  2MBB B;  1TZ1 A;  3PVL A;  2N9X A;  1L4D B;  3PLV A;  2KNB A;  4FAD A;  1CZP A;  1EWY C;  5TR5 A;  2LUE A;  2GRI A;  1OEY A;  3R2T A;  3UF8 A;  4KKI A;  3DHG C;  2KC2 A;  2KLG A;  2CJO A;  2DEN B;  1R7S A;  1QF6 A;  2KWC A;  2QCZ A;  1AWD A;  2GBM A;  2SAK A;  2J7Q B;  1M94 A;  2PKO A;  2GBR A;  4C7Z A;  2WHI A;  3GS2 A;  1XO3 A;  1M4V A;  3APF A;  2MCN B;  2BB5 A;  2INP E;  2LGD A;  4FN2 A;  1JW9 D;  1WJU A;  2C5L C;  4BOZ B;  2JWU A;  1UH6 A;  2KTR B;  3OG5 A;  2KQ4 X;  5DCN A;  1SBB B;  2I1J A;  1GT8 A;  2DYO A;  3E9S A;  1WGH A;  4JWS C;  2LRW A;  2KWD A;  1WGR A;  4LK0 M;  3LXF A;  2DWQ A;  1AYF A;  3H8H A;  4HPP A;  1FCC C;  4AUQ C;  2N9K A;  2E3T A;  2N9P C;  2MHJ A;  4NNJ B;  2K0P A;  2J0J A;  3APD A;  2QEJ C;  1X1M A;  4M02 A;  4MT5 A;  1WE7 A;  3FIL B;  2DAF A;  2D3C A;  5J2R A;  2PVG C;  3GZN I;  1RFA A;  3CSF A;  3N1Z C;  4A9A A;  4F8C B;  1VDV A;  2WXO A;  3TJP A;  1Q0W B;  3U8Z A;  1FMA D;  4DHZ E;  4GN1 A;  4HCP B;  5IKC M;  5D3I B;  3ZQ4 A;  1TYG B;  2CHW A;  4IKG A;  2Y5C A;  3TEX A;  3I5J C;  4KGT A;  1C4C A;  1VZ6 A;  3PT2 B;  1ZDX A;  4EFO A;  4OVU A;  1P7F A;  1CMX B;  5IA7 A;  5DPR A;  4KDL B;  2N9E B;  3ENE A;  2BYE A;  4I6P A;  1UNS A;  1NYQ A;  1NEN B;  2KFK B;  1E7U A;  2BQQ A;  2OJR A;  4AQ7 A;  2R2Q A;  1NYR A;  2M19 A;  3M3J A;  5EE9 A;  2G4D B;  3HM6 X;  4P1C C;  4OZC A;  3IT6 B;  4OHJ A;  1L7Y A;  4FUL A;  2BVC A;  4ZYS A;  1I42 A;  5EE0 A;  2PE9 A;  4N59 A;  4A3P A;  2QHO A;  1XLQ A;  3BII D;  3U7D A;  5AZF A;  4BBN F;  4IOI E;  3JSV A;  3NZ3 A;  1QOB A;  3PO0 A;  1C78 A;  2G45 B;  5HKH A;  2FCS A;  1TS3 A;  2GOW A;  4J6I A;  1YJ1 A;  4XE0 A;  4DWF A;  3BYY B;  2XK5 A;  2LEK A;  2FID A;  3A1Q A;  2DX5 B;  4II3 B;  2CU1 A;  2MLB A;  2D10 A;  2V3N A;  4KSL C;  2ZVO A;  1FFV A;  2ACZ B;  4MH0 E;  1TGZ B;  2KYW A;  1ZOY B;  1DYQ A;  5BMH A;  1TJE A;  2IY0 B;  5GXG B;  1Y8R C;  2HTH A;  2L76 A;  3VVW B;  1E90 A;  4IM2 A;  3KQ4 A;  2PEA A;  2LHD A;  1J7B A;  3AE7 B;  3W9C B;  1B1Z A;  2I1K A;  2DNF A;  3I63 C;  4EZK A;  2ZVN A;  1STE A;  2ICI A;  2KN4 A;  1ENF A;  3DBR I;  1NVI D;  4JQW C;  4ZRI A;  2V3S A;  3DCG A;  1Q1O A;  2LD9 A;  3SR6 A;  3WAL A;  3VTW A;  2PMV A;  1GPX A;  4E71 A;  5BYR A;  1RRB A;  2ZZP B;  1UF0 A;  1WYG A;  4GIV A;  3LYY A;  2Z0D B;  2DZM A;  1JCK B;  4GXB A;  1AW7 A;  1WX7 A;  2BWF A;  4W9C A;  1L6V A;  1L2N A;  3EA6 A;  2LVP A;  2MJE A;  3T3O A;  1QLB B;  5T8I A;  3QWZ B;  2DZI A;  2JUO A;  3VQI A;  1WFY A;  3KVF B;  1FEH A;  4HEA 1;  1F77 A;  2O6V D;  4GSW A;  3AMZ A;  1ZXH A;  2HTM E;  1FPY A;  1OQY A;  2D3G A;  3TEZ A;  2NR2 A;  1WGG A;  4MJS A;  1YMH E;  2V4I B;  4RM9 A;  4RF1 A;  1ZUD 2;  4GOC A;  1LM8 B;  2BW2 A;  4XWT A;  4XC2 A;  1FNU A;  2JXT A;  2WXR A;  3P1M A;  1JQ4 A;  1WXV A;  1N62 A;  2LGY A;  4US8 A;  2K8C A;  4NQK E;  1TS2 A;  1WMH A;  5D7G A;  2K1F A;  4XWW A;  3A9K A;  1E7V A;  1EM7 A;  1WXS A;  1F9J A;  3QAR A;  4L23 A;  2MQJ A;  5FK9 C;  2JRH A;  2KMA A;  4RCO A;  4BZA A;  1MVK A;  1SGH A;  1Z2M A;  4ZRQ A;  2CS4 A;  2N9L A;  1P3Q U;  5IOI A;  3KYC D;  2D11 A;  4ACF A;  3IFW B;  2AYO B;  4O1N A;  2WXN A;  4ZOH C;  4EEW A;  2KTF A;  2KN5 A;  3MHS D;  4JX1 C;  4Q2J A;  4NAM A;  1SJH D;  1FRR A;  2G9H D;  2Z0E B;  2IGD A;  3H9D A;  2FBW B;  2W3S A;  1KLG D;  4LNK A;  5E6J A;  3RNE C;  1Z5S B;  3U7Z A;  1QQR A;  1XCT L;  1WJ6 A;  3WAP A;  3RUI B;  4G0N B;  3AE9 B;  1L0Y B;  4KV2 A;  1JWS D;  1XLO A;  4LNI A;  2N1W A;  1KLV A;  2MJD A;  3RNA C;  3CST A;  2IO1 B;  3AE8 B;  2ZPY A;  1IBX A;  3PRZ A;  1FNV A;  4QAY A;  1HE8 A;  1JWU D;  3ZVV A;  4N6E B;  2REX A;  2Y3A A;  3QJZ A;  3N9Y C;  2IND C;  2N7E A;  4WQM A;  2DZK A;  1F2R C;  5G2N A;  1ISN A;  5BO4 B;  3R8B A;  4RFB A;  3N1Y C;  1ET9 A;  1QT9 A;  3R3M A;  3IVF A;  2Y5B B;  4GLS C;  3UIP B;  1C4A A;  5HI1 A;  4JWU C;  1F1H A;  4KIK B;  3VFK A;  1SSN A;  3RFZ B;  2SEB D;  1E6E B;  1D5X C;  2K39 A;  4TUU A;  2XK5 B;  5EE1 A;  3PZD A;  4PYU A;  1WE6 A;  3MJW A;  1ROE A;  1RFK A;  3HVD A;  3KYD D;  4BFR A;  4DDI D;  2KLC A;  5E6P A;  1KLU D;  4C80 A;  4ARC A;  4XX5 A;  2VRR B;  1D6E C;  4WWM A;  1D5M C;  3R66 C;  3VUY A;  4US9 A;  2MWS B;  4W9L A;  2ZW0 A;  2MP2 B;  1BT0 A;  3JW0 X;  1L0V B;  1KTK A;  2KHW B;  2LGS A;  1MHH E;  1AAR A;  4LCD E;  3KUC B;  2LZ6 A;  1E8Y A;  3D32 A;  4HRO A;  1K53 A;  3T9L A;  4WJP A;  4DHJ B;  1TKG A;  2WXJ A;  3PHW B;  4K7S A;  3P4R B;  1V80 A;  4MDK E;  1CK1 A;  4NJ6 A;  1SF0 A;  2D07 B;  2JT4 B;  2J53 A;  2BGF A;  3N30 A;  3OAW A;  1HA5 A;  3AEE B;  3UI3 A;  1ZDV A;  4WJQ A;  3ZW3 A;  2W82 A;  2RPV A;  1OQR A;  3ETR A;  1JWA D;  2AX5 A;  4HKZ E;  2Z8L A;  4BKG A;  2KFK A;  4B9K A;  2AL3 A;  2JXX A;  4GDK A;  2W54 A;  3GP7 A;  1OQQ A;  3L0W B;  2FIF A;  1WGD A;  4WWN A;  1TZO A;  4DXA B;  2YLM A;  4K1R B;  2QC8 A;  4IWQ A;  3MC9 A;  4PK1 A;  4YWG G;  1IUE A;  1WWT A;  4MJS B;  5IP4 D;  1K52 A;  4WWO A;  4B6W A;  2NMQ A;  1EUV B;  4ITK A;  3A4R A;  1L6U A;  2LUM A;  3PS6 A;  2YEP B;  3QC8 B;  2W3R A;  4WJO A;  3TUO A;  3NJT A;  1WMH B;  3LDZ E;  1MFW A;  3A9K B;  1ZKH A;  1N5W A;  2Y5P A;  4G3X B;  4RGM A;  3RNG C;  3B2F A;  2GMI C;  3WA0 A;  3SD5 A;  3RMK C;  2WP9 B;  1XD3 B;  4IWP A;  1EWC A;  1WY8 A;  4IM0 A;  2NPT B;  2WXF A;  5KHQ A;  4GU2 A;  3SHQ A;  1VZ7 A;  2MX2 A;  3PLU A;  1SIJ A;  2RDG A;  4KDI C;  3QX1 A;  2KWV B;  2KX3 A;  3DBH B;  1V1P A;  2YVC A;  5HHD G;  1I4G A;  1KRH A;  3HIZ A;  3MP9 A;  1D3Z A;  2K6D B;  3ZNI D;  2R2O A;  3B9J A;  3AU4 A;  4M8N A;  1B9R A;  2XNA C;  4FLH A;  2C9W B;  4BAX A;  1FIQ A;  1V2Y A;  3BK1 A;  4AOF A;  5EDS A;  1PYW D;  3NRZ A;  4FHK A;  2XEW A;  2JZP A;  2J0M A;  3S2A A;  1IBX B;  2KWU B;  2DZJ A;  3JYU A;  5AZG A;  4NJ7 A;  4W9F A;  2AQ2 B;  1YJI A;  4B0E A;  2JX5 A;  1HZ5 A;  1EF5 A;  3FC4 A;  3Q69 A;  3PSE B;  4TQ0 A;  1EF1 A;  2HD5 B;  2B3A A;  4HRS A;  3KWL A;  3BIN A;  1TKE A;  1WF9 A;  3T8M A;  5G5G A;  4PS8 A;  1Q5W B;  2LXA A;  3BVG A;  4WWP A;  3EFU A;  2M8S A;  3M63 B;  3W2D A;  2NBW B;  1C4P A;  4OZB A;  3RYT A;  2NTT A;  3VR9 B;  1KFY B;  1NEK B;  1FRD A;  3AEF B;  1FD6 A;  3DPD A;  1WSP A;  1D4B A;  1WH3 A;  4A6Q A;  5C3J B;  3A9J B;  1P98 A;  3SU8 X;  2AEH A;  1T5X D;  2RPQ A;  1GG3 A;  4W9I A;  4ZDV A;  1BUI C;  3DWM A;  1YOV B;  2D3B A;  1KH0 A;  4ZHO A;  1GC6 A;  1E9M A;  4RGO S;  2WXP A;  2KD0 A;  2M17 A;  1YJJ A;  4P16 A;  2BTE A;  2H89 B;  2GBJ A;  1I4H A;  3VRB B;  4CQN A;  4ZRP A;  4D2K A;  2WDV B;  3ZUN A;  2BB6 A;  5EE3 A;  4HDO A;  3EEC A;  3LJ3 A;  2HJ8 A;  1HTQ A;  2ZJD A;  3FAH A;  2RMM A;  1QOA A;  2IDY A;  2D5G A;  3U52 E;  3WIM A;  3DQV A;  1DOX A;  3V3X A;  3ZXR A;  3ML9 A;  1N61 A;  2AQ1 B;  1XT9 B;  3QCA A;  4REZ A;  3Q3J A;  4AWJ A;  2AWT A;  1R4N B;  4XYC A;  1RLF A;  3HRD D;  4DDG D;  4GB9 A;  1HZ6 A;  1ZGU B;  1ZE3 D;  2EKE C;  2WLB A;  3AH7 A;  4G11 A;  2WXQ A;  2JF5 A;  4LJO B;  4WQO B;  4ZYN A;  4A55 A;  4GDK B;  3MTN B;  1T0Y A;  3NVZ A;  3HM3 A;  4TV3 A;  3I3T B;  3RI7 C;  2PLP A;  4HXD A;  1ZPS A;  2L7R A;  1PUT A;  4LDT B;  4II2 B;  1J7A A;  3SFE B;  1WM3 A;  1QOF A;  4WJN A;  3APC A;  4TSS A;  3H1U A;  4KIK A;  2KMC A;  3IHP C;  2M56 B;  3Q8F A;  2L1A A;  3N3K B;  3P4S B;  4M01 A;  3AE2 B;  5E6N A;  1UWX A;  3Q6B A;  4EE2 A;  3B1L X;  2CHZ A;  4JPS A;  3PTF C;  2UWQ A;  3NZS A;  3KLS X;  3PRE A;  2Q5W D;  4WH4 A;  5AUK A;  3Q3O C;  1J19 A;  2KDE B;  4MAC A;  2K22 A;  3PV1 A;  2DAJ A;  2FUH B;  1IGD A;  2IBI B;  5TSS A;  2WU5 B;  1H4R A;  2X8X X;  1C3T A;  3I57 A;  4RGN A;  2MP2 A;  4KGS A;  1V1P B;  5D94 A;  1XLN A;  4JE3 B;  1Y56 A;  1E8X A;  2WS3 B;  1DGJ A;  1UEL A;  1WR1 A;  2WX0 A;  2KOX A;  1E8W A;  2QIL A;  3DDC B;  4KSK C;  4N9F 4;  4HJK A;  1XQQ A;  1PFD A;  1WJ4 A;  3RNF C;  3WAM A;  1P1A A;  1IPG A;  2ASQ A;  2JZ3 B;  2YEP F;  3PZ7 A;  1SIF A;  4EUT A;  2L52 A;  2KAC A;  4DHJ D;  3EGR A;  5G55 A;  2BPS A;  2KJH B;  3AE1 B;  4YT0 B;  2BF8 B;  3UIO B;  2LVO A;  2KAJ A;  1V6E A;  1E8Z A;  2K8H A;  5H8Y E;  2NCN A;  2KDM A;  3C19 A;  4P1B C;  1IYF A;  4PYZ A;  4C4V B;  5E6O A;  1XCQ L;  2LGX A;  2V1Y A;  4NQL B;  1XLP A;  3Q14 C;  1NBF C;  2BBC A;  3VUW A;  1FO4 A;  5JXV A;  3PRP B;  4MGK E;  2GBN A;  3DBL B;  4GMV A;  3AM9 A;  2PE6 B;  4IUM B;  1T0Q C;  2KJ6 A;  1YX5 B;  4IG7 B;  4GDL A;  1SXT A;  2L00 B;  1E0Z A;  2JWZ A;  2K3U A;  3KW5 B;  5AEK B;  2WXK A;  2X38 A;  2L3Z A;  2MJ3 A;  3M95 A;  4HDQ A;  2V9H A;  5FKA C;  3V62 A;  4YTM B;  4LJP B;  1WXM A;  3EHV A;  3EUB 2;  4K7U A;  2NPT A;  3ZTC A;  3QIJ A;  4W9G A;  4XDC A;  4MSM B;  3IAS 1;  2O2V A;  2LJI A;  3VHT C;  2RGF A;  2KX0 A;  5FR3 A;  2BYF A;  2WXH A;  4RNA A;  2FCN A;  4H2A A;  3OJ4 B;  3PRM B;  3OJ3 A;  3UQB A;  3AE5 B;  4HKQ A;  1FM0 D;  4YTP B;  2WU2 B;  1FXT B;  2MBO A;  2V0G A;  3ZNH B;  3VUX A;  1UGM A;  5H92 C;  3L10 B;  2WWZ A;  2PTL A;  2KZR A;  4C00 A;  1K50 A;  2QMT A;  1V8C A;  1NDD A;  1C79 A;  1E10 A;  5BYQ A;  3RZF A;  3OLM D;  3VAW A;  2A4Z A;  3CIR B;  4WAF A;  4FHJ A;  2G3Q B;  1XEE A;  3RPF C;  1R4M B;  2N4F A;  2OED A;  5HFY A;  3ZDT A;  5IN7 A;  1H7X A;  4M00 A;  1H8C A;  2BKR B;  3ZJT A;  3QHT A;  5IO9 A;  2M0A A;  4HPL B;  2KDI A;  2V3P A;  3IXS A;  1OTR B;  3TEY A;  3ZYY X;  1N60 A;  1EU4 A;  4AS1 A;  1JRO A;  3H7S A;  2AQ3 B;  1I7H A;  2KQS A;  1MG4 A;  2ZPN A;  2QIE B;  2W9N A;  4A8X C;  1RM6 C;  3DVG Y;  5FR6 A;  3A9J A;  3FKY A;  3AE3 B;  4FA6 A;  1WI0 A;  3UGB B;  1VRA B;  2PJH A;  2QSD A;  1J0G A;  1Q10 A;  4ANV A;  3ABV B;  1GNU A;  1SEB D;  3AEG B;  3ZJV A;  1HQR D;  1VR9 A;  2J52 A;  2BT6 A;  2MBH A;  1N6Z A;  3TCA A;  4MH8 A;  2DLB A;  3BWU D;  2FNJ B;  2JSV X;  1WRD B;  2V4L A;  3PPA A;  1GB1 A;  4W9K A;  4C7Y A;  4WAA A;  5LNK 1;  2KK8 A;  2KMM A;  3MFG A;  2KQ7 A;  2K8B A;  2I2Y A;  4FJZ A;  4IWO A;  2WGS A;  1YIW A; 
#chains in the Genus database with same CATH homology
 1ACC A;  2AQ2 B;  3AB5 A;  1YJI A;  3Q8A A;  4YSY B;  2JX5 A;  2VZK D;  1HZ5 A;  1UGJ A;  4B0E A;  3TSS A;  3NZ3 A;  4C56 C;  1QOB A;  3PO0 A;  3FC4 A;  3Q69 A;  1C78 A;  4TQ0 A;  1V97 A;  2WQY B;  1TS3 A;  3DWG C;  4KKJ A;  4YSZ B;  4HRS A;  3KWV A;  2W55 A;  3KWL A;  4XE0 A;  3BYY B;  1TKE A;  5G5G A;  3VRA B;  3W5U B;  3BVM A;  3BVG A;  3TEW A;  2LEK A;  3C8Y A;  2RDH A;  2QJL A;  3W2D A;  1C4P A;  2V3N A;  1BML C;  1NI3 A;  4OZB A;  2NTT A;  2IJ0 A;  1FFV A;  3NVV A;  1A70 A;  3VR9 B;  3BZD B;  2ACZ B;  1KFY B;  1NEK B;  3VR8 B;  1FRD A;  2N0S B;  3ZJU A;  3AEF B;  1FD6 A;  4KX6 B;  4RF0 A;  1WSP A;  1ZOY B;  1D4B A;  1YNT E;  2JU6 X;  4A6Q A;  5C3J B;  1TS5 A;  1DYQ A;  5BMH A;  1TJE A;  1MI0 A;  1T5X D;  3GB1 A;  5GXG B;  2NTS A;  4YXD B;  1LO5 D;  1BUI C;  3DWM A;  1KH0 A;  4XDD A;  3KQ4 A;  4ZHO A;  2LHD A;  1J7B A;  1L0X B;  3AE7 B;  3W9C B;  1B1Z A;  1TY2 A;  3U4E G;  1E9M A;  4RGO S;  2WXP A;  4P16 A;  1YJJ A;  2BTE A;  2H89 B;  2WXG A;  2WDQ B;  3P4Q B;  4NJC A;  1STE A;  1GOZ A;  1OFF A;  2WDR B;  2ICI A;  2KN4 A;  2K9X A;  1I4H A;  1ENF A;  2BS4 B;  1PGA A;  1GAQ B;  3VRB B;  1NVI D;  1VZ8 A;  4ZRP A;  4CQN A;  4GDL B;  4D2K A;  2WDV B;  3SR6 A;  2BB6 A;  5EE3 A;  3W1S A;  1QKZ A;  3AEC B;  2PMV A;  1GPX A;  5BYR A;  5AUI A;  1SE4 A;  3P63 A;  1WYG A;  3LYY A;  3FAH A;  1GB4 A;  2RMM A;  1SJE D;  1QOA A;  1AN8 A;  2IDY A;  2D5G A;  3U52 E;  2FUG 1;  1JCK B;  1AW7 A;  4FXC A;  1TS4 A;  1DOX A;  3AEA B;  3V3X A;  1L6V A;  1HXY D;  1YQ4 B;  2E6X A;  1N61 A;  1WXQ A;  3EA6 A;  2MJE A;  3T3O A;  2AQ1 B;  1QLB B;  1RYJ A;  5T8I A;  4REZ A;  4L2Y A;  4J3O D;  3VQI A;  3J9C A;  3BYT B;  4HEA 1;  1FEH A;  1F77 A;  3B2G A;  3AMZ A;  1K51 A;  1ZXH A;  1RWS A;  2HTM E;  3NVY A;  3HRD D;  3TEZ A;  3Q8C A;  5D3D A;  1C76 A;  4WIP A;  1UUP A;  1YMH E;  2V4I B;  1HZ6 A;  1H7W A;  2GB1 A;  4OVZ A;  1ZE3 D;  2WLB A;  5I4D A;  3AH7 A;  2WXQ A;  2K5P A;  3AED B;  3P42 A;  4RF1 A;  1ZUD 2;  3HUI A;  4TQ1 A;  4A55 A;  4GDK B;  3MHZ A;  2BW2 A;  4XWT A;  1I4Q A;  1FNU A;  4DQO C;  1TY0 A;  3NVZ A;  1CQV A;  2JXT A;  2DBY A;  2WXR A;  4IOI E;  3P1M A;  1JQ4 A;  1N62 A;  4US8 A;  2PLP A;  3FIL A;  1ZPS A;  1PUT A;  1TS2 A;  1SB3 C;  5D7G A;  1J7A A;  3SFE B;  4XWW A;  3NUH B;  1QOF A;  4WUR A;  4TSS A;  3P4P B;  1EM7 A;  3HVZ A;  2BYT A;  3BVZ A;  1JWB D;  3MC0 B;  4L23 A;  2IGH A;  5FK9 C;  3AE4 B;  2M56 B;  3Q8F A;  4NAW B;  4RCO A;  1DOY A;  2L1A A;  2PW9 A;  1MVK A;  4DXF A;  3T3N A;  3P4S B;  3U2S C;  3AE2 B;  1BXT A;  4ZRQ A;  1FCL A;  2N9L A;  3IAM 1;  1JWM D;  1UWX A;  4EE2 A;  2I38 A;  3PZ8 A;  2WXN A;  4O1N A;  4JPS A;  4ZOH C;  5BYS A;  2L32 A;  3R2I A;  1JAL A;  1I4X A;  4JX1 C;  3AEB B;  3KLS X;  4Q2J A;  2Q5W D;  4ARI A;  4NAM A;  2CJN A;  1SJH D;  1KF6 B;  1TKY A;  4WH4 A;  3AV8 A;  5AUK A;  1I4R A;  1JRP A;  1FRR A;  3CWI A;  4MAC A;  2G9H D;  2J42 A;  2K22 A;  3SEB A;  2IGD A;  2FBW B;  2W3S A;  1KLG D;  1V1O A;  5E6J A;  1IGD A;  3U7Z A;  3W5V B;  1QQR A;  1XCT L;  5TSS A;  1QIL A;  2WU5 B;  4YSX B;  1PGX A;  3AE9 B;  3I57 A;  4RGN A;  1L0Y B;  1YQ3 B;  1N63 A;  4KGS A;  5MPO A;  4UDU C;  1JWS D;  1V1P B;  1XLO A;  1VLB A;  1XF5 L;  1F0Z A;  1XLN A;  2MJD A;  3ZGZ A;  1ESF A;  4NZL B;  3AE8 B;  3NS1 A;  1IBX A;  1FNV A;  1FXA A;  1P7E A;  2EKI A;  3LB8 C;  1Y56 A;  4IDI A;  2N7J A;  4JE3 B;  2VZK B;  1JWU D;  4OZA A;  2WS3 B;  1DGJ A;  1MPE A;  1YN3 A;  1GTH A;  4PT5 A;  4N6E B;  2Y3A A;  2PIA A;  2INN E;  3N9Y C;  3WCQ A;  4WQM A;  2QIL A;  1F2R C;  1SE3 A;  2GI9 A;  1PFD A;  2LFI A;  1ZXI A;  2XN9 C;  3R8B A;  4RFB A;  2WXM A;  1ET9 A;  2YEP F;  3PZ7 A;  1QT9 A;  1J7C A;  2L52 A;  1VJK A;  2KAC A;  2LMC A;  1C4A A;  4GLS C;  5HI1 A;  3EGR A;  4JWU C;  2WXI A;  5HG2 A;  2TSS A;  3BK2 A;  1ZP0 B;  1SSN A;  3RFZ B;  3I9V 1;  3AE1 B;  4YT0 B;  2SEB D;  1FXI A;  4LLG M;  1E6E B;  2DYM A;  4RGT A;  1D5X C;  2MH7 A;  2KAJ A;  3IT4 B;  2LGI A;  1FFU A;  3OWE B;  4HJG E;  5EE1 A;  5H8Y E;  4OW0 A;  2PVO D;  1YN4 A;  1XXG A;  2KDM A;  2CU3 A;  4DXG A;  1ROE A;  1PDX A;  1RFK A;  3NVW A;  3HVD A;  1XCQ L;  1XLP A;  2HDE A;  1KLU D;  2BBC A;  4P6V F;  4C80 A;  1L4Z B;  4ARC A;  4L1B A;  1FO4 A;  5BMG A;  1D6E C;  4WWM A;  1D5M C;  3URY A;  5JXV A;  2B76 B;  1I4P A;  1HEZ E;  1DOI A;  1WGK A;  4N58 A;  2BS2 B;  4TMA B;  4B0M A;  3AM9 A;  4US9 A;  1YN5 A;  1D5Z C;  2ZW0 A;  1L4D B;  2J4X A;  2JYE A;  1SXT A;  4KGR A;  1MHX A;  1L0V B;  1KTK A;  2K3U A;  1E0Z A;  1IGC A;  1CZP A;  1EWY C;  2WXK A;  2X38 A;  2L83 A;  2MJ3 A;  1MHH E;  5FKA C;  4YTM B;  2GRI A;  3R2T A;  4HRO A;  4KKI A;  1K53 A;  4LTU A;  1TKG A;  2EEL A;  2JYT A;  5C2T B;  2WXJ A;  1L5P A;  2OHF A;  2CJO A;  3EUB 2;  4MM3 B;  4XDC A;  3P4R B;  1N5X A;  1R7S A;  3IAS 1;  1QF6 A;  1CK1 A;  4A90 A;  2LJI A;  1SF0 A;  3Q8B A;  1AWD A;  2J53 A;  5FR3 A;  2WXH A;  4RNA A;  2SAK A;  4H2A A;  2PKO A;  1HA5 A;  3AE5 B;  3AEE B;  2MEK A;  2ZW1 A;  3UI3 A;  4C7Z A;  1ZDV A;  4HKQ A;  1ET6 A;  3GS2 A;  1F2R I;  1FM0 D;  4YTP B;  1M4V A;  1XO3 A;  2W82 A;  2RPV A;  1OQR A;  2WU2 B;  3ETR A;  2BB5 A;  1JWA D;  2INP E;  2AX5 A;  4HKZ E;  2V0G A;  3V05 A;  2Z8L A;  1JW9 D;  3O13 A;  5H92 C;  1T3Q A;  2PTL A;  1GTE A;  2LHE A;  1K50 A;  2JWU A;  2QMT A;  2W54 A;  3GP7 A;  1OQQ A;  1V8C A;  1C79 A;  1E10 A;  2KQ4 X;  3AE6 B;  5BYQ A;  4RH6 A;  1SBB B;  1GT8 A;  3CIR B;  2DYO A;  1TZO A;  3E9S A;  4JWS C;  4WAF A;  1QOG A;  2FE8 A;  2KWD A;  1XEE A;  4YWG G;  4LK0 M;  1IUE A;  1WWT A;  3LXF A;  2BS3 B;  2DWQ A;  1AYF A;  1PGB A;  3H8H A;  3RPF C;  1FCC C;  1WRI A;  1CJE A;  2OED A;  4ZHP A;  5HFY A;  1K52 A;  2N9K A;  2E3T A;  1H7X A;  2NMQ A;  4ITK A;  3ZJT A;  4YTN B;  4USA A;  4R3D A;  5G5H A;  1L6U A;  2K0P A;  2LUM A;  2M0A A;  2QEJ C;  2YEP B;  2V3P A;  4MT5 A;  3IXS A;  3CF4 A;  2W3R A;  3FIL B;  5BMI A;  3TUO A;  3TEY A;  3L4P A;  3ZYY X;  3MJ5 A;  1N5W A;  2Y5P A;  2PVG C;  4RGM A;  1N60 A;  3B2F A;  1FNW A;  1EU4 A;  1UWM A;  4AS1 A;  1JRO A;  2AQ3 B;  1I7H A;  2G1E A;  4A9A A;  3AN1 A;  1VDV A;  2QIE B;  2WXO A;  1E7P B;  2ONQ A;  2WNM A;  1FMA D;  2WP9 B;  4A8X C;  1RM6 C;  1EWC A;  2R61 A;  2H88 B;  5D3I B;  2WXF A;  3ZQ4 A;  2JQR B;  1TYG B;  1VZ7 A;  2Y5C A;  4IKG A;  3AE3 B;  2WXL A;  1SIJ A;  2RDG A;  3TEX A;  4KGT A;  1VRA B;  1C4C A;  1EU3 A;  2QSD A;  1Q10 A;  1VZ6 A;  1ZDX A;  1V1P A;  3ABV B;  3E56 A;  1SEB D;  5HHD G;  3AEG B;  1JML A;  1I4G A;  3ZJV A;  1HQR D;  1P7F A;  1VR9 A;  2J52 A;  1KRH A;  2BT6 A;  3MP9 A;  4MH8 A;  2DLB A;  3BWU D;  2JSV X;  1UNS A;  1NYQ A;  3B9J A;  1NEN B;  1B9R A;  1T6B X;  2ON8 A;  3Q8E A;  1GB1 A;  1C9F A;  2XNA C;  4AQ7 A;  4C7Y A;  1NYR A;  2M19 A;  1FIQ A;  3BK1 A;  5LNK 1;  5EE9 A;  1PYW D;  2KMM A;  3NRZ A;  4OZC A;  2IPK D;  3IT6 B;  4OHJ A;  3MFG A;  4ZYS A;  2JZP A;  5EE0 A;  1IBX B;  4N59 A;  1SE2 A;  2I2Y A;  4M0W A;  1XLQ A;  3SFD B;  1C77 A;  3BII D;  2IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...