3AE4B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae4B01
1A70A 2KAJA 1GT8A 3AE3B 2WS3B 1QF6A 5EE1A 1WYGA 2Y5CA 1QOGA 1TJEA 2BS3B 2W3SA 3AE9B 2BS4B 3B2GA 4YTNB 1SF0A 4USAA 1B9RA 3B9JA 4HROA 2AX5A 1AWDA 3AEAB 3VR9B 4WWMA 5EE3A 3AEDB 5H8YE 1JW9D 1DGJA 2M19A 1FMAD 3NVWA 4N58A 2MH7A 3CWIA 1QOFA 1N5WA 2E3TA 4N59A 1L6UA 3LXFA 3WCQA 4ZHPA 1J7CA 2K22A 2WP9B 3AEFB 3AEBB 3VRBB 1XLOA 1NI3A 1N60A 1TKEA 3HRDD 3AV8A 1R7SA 3AMZA 1NVID 4FXCA 3ETRA 3AE2B 3NVVA 4ITKA 1E7PB 1F0ZA 1FRRA 1T3QA 1E6EB 1GTHA 3AH7A 1ZP0B 1IUEA 3P4SB 1AYFA 4JWSC 1QOBA 2CU3A 4JX1C 3FAHA 1KRHA 1GAQB 2W54A 4JWUC 2MJ3A 1FM0D 1DOXA 3NVZA 1OQRA 1N5XA 1WWTA 1ZXIA 5EE0A 1N61A 1FIQA 1H7WA 2MJDA 2PVOD 1RYJA 3NS1A 1V97A 3SFDB 3NVYA 1QT9A 2K5PA 1QOAA 5AUKA 2WDRB 3AE7B 3P4RB 1XLPA 2FBWB 2WDQB 3HVZA 1V8CA 1SB3C 3AEEB 1XO3A 2M56B 4ZOHC 4C80A 3AE6B 2ACZB 4US8A 1KF6B 1CZPA 3ZYYX 1FO4A 2JQRB 2K9XA 3AEGB 1N62A 2WLBA 2WQYB 3B2FA 1H7XA 1KFYB 1J7BA 1JWBD 1ZOYB 2BT6A 1FFUA 2OHFA 3RPFC 3SFEB 5H92C 3ABVB 2G1EA 2JX5A 2DBYA 3FC4A 1JRPA 1FXIA 2CJOA 1L0VB 1UWMA 2W55A 2W3RA 5C3JB 3AN1A 1YQ4B 1PDXA 4YSZB 4YTPB 2WDVB 2H89B 2WU5B 4YTMB 1XLNA 2WU2B 2Q5WD 4LTUA 4IDIA 1GPXA 1FRDA 1NYRA 1JROA 3AM9A 1E10A 4YSYB 3P4PB 1ROEA 1GTEA 5C2TB 5G5HA 1YQ3B 1WXQA 3AE8B 4US9A 2QIEB 3DWMA 3W5UB 4C7ZA 3PO0A 3P4QB 3CF4A 1NEKB 1E9MA 5EE9A 1WGKA 1TKYA 2CJNA 2N0SB 1VLBA 4A9AA 1JQ4A 2QJLA 2PIAA 1TYGB 5AUIA 1WRIA 3VRAB 3AE5B 2L83A 5GXGB 3AE1B 2B76B 1FFVA 4C7YA 1RM6C 1L6VA 3EUB2 3LB8C 1EWYC 3CIRB 1YJIA 1SIJA 2KMMA 3P63A 1DOYA 4WQMA 2BS2B 3HUIA 1DOIA 1L5PA 2H88B 1PUTA 1XLQA 1VDVA 4YXDB 1NYQA 1TKGA 3BIID 3NRZA 1ZUD2 4N6EB 1QLBB 2DWQA 1E0ZA 1OQQA 2EKIA 2LEKA 3L4PA 1JWAD 1I7HA 3AECB 1VJKA 2PKOA 3DWGC 2PVGC 3AB5A 3P1MA 1PFDA 1YJJA 1RWSA 4P6VF 3VR8B 2HTME 1RFKA 1OFFA 3SR6A 2L52A 3W9CB 4ZHOA 3KWLA 1NENB 1FXAA 5G5GA 1JALA 1CJEA 4YT0B 4YSXB 4KX6B 1J7AA 2MJEA 5MPOA 1N63A 3AE4B 4HRSA 3W5VB
chains in the Genus database with same CATH superfamily
3RNCC 3ONSA 4GLSC 1TJEA 4ANVA 1WZ0A 4NAWB 1AWDA 2QMTA 5D3IB 3VTUA 4GU2A 2LHEA 4RF1A 1ZXHA 1V1OA 1YQBA 3TMPB 2VZKD 1NI3A 1FNWA 1NVID 2Z0EB 2BB6A 1T0RC 1K53A 1Z2MA 1T3QA 5FK9C 2RDGA 4CYEA 4NJ6A 3AULA 5E6PA 2XEWA 3PRPB 4LNOA 4L1BA 3JSVA 2JT4B 2V3NA 3V3XA 3ZUNA 1AN8A 2VH2A 4ZOHC 2CKHB 2KJRA 1H7XA 3GS2A 2FUHB 2PMVA 3GZNB 2V4LA 4MACA 1RFAA 4ANXA 2QCZA 4HEA1 5DPTA 2KXJA 1Q5WB 3QQ8B 3ZJUA 4WIPA 2UU7A 3Q14C 1GPXA 1JROA 2ON8A 3P42A 2LVOA 2FE8A 3AE8B 5D6JB 2XN9C 2KTFA 5CHVC 3H6NA 4MELA 3AI5A 1IYFA 3AU4A 2ZW1A 2C7MB 2ZPNA 4RGOS 2PLPA 4WQMA 2V9HA 1OQYA 2NTTA 2MP2A 1YD8U 1E8XA 1QLBB 4A8XC 2LJIA 3EGRA 3PGEA 4BVUC 2KJHB 3U52E 2N9XA 3P1MA 2QSDA 3DHIC 4HWIB 1B1ZA 4WWOA 1OFFA 2LGYA 1S1QB 3ML9A 4KX6B 4GMVA 2L0TA 4EFOA 3N1XC 4XYCA 5C23A 2JF5A 3JW0X 3IAS1 1HZ6A 1XEEA 1I4HA 2IY0B 3UIOB 4C4VA 4ZDVA 1J8CA 3OG5A 2PW9A 2WXJA 4WWNA 2I2YA 1BUIC 3LYYA 3ZRFA 2E3TA 3BINA 3W1YA 4GIVA 4K7WA 3AEFB 3RT3B 2LD9A 1TKEA 2YLMA 5HG2A 2D11A 4TSSA 4RFBA 2DYMA 4NJCA 4AUQC 3R66C 2NVUI 1ZP0B 1IUEA 1WR6E 1KRHA 4KZCA 2WXHA 2BVCA 3I63C 1WSPA 4DXFA 1WE6A 2JPHA 1PYWD 2A4ZA 2ZVNA 2JQRB 2K9XA 3SDLC 4MM3A 2MBBB 1OEYJ 3W1SA 1GJZA 2JZ3B 2LXAA 3MTNB 2SAKA 2OEDA 1FEHA 3I3TB 4C56C 3QIJA 2LVPA 5C2TB 2MBOA 2L76A 4CO7A 3ZGZA 5BMGA 4KGTA 5AUIA 2ZJDA 3AE1B 4JIOU 3PLVA 2NCNA 2LRUA 5BYQA 2FCNA 3S2AA 4BKSD 3A1QB 4W9HA 2V4IB 4ZYNA 1I4RA 3QJZA 1UWXA 2BPSA 2FUG1 2MSED 2J0MA 3GE8C 3H7SA 5LLIA 5L95C 3IT6B 3A4SC 2N4FA 3AXCA 2WS3B 1LXDA 1WMHA 4KZ0A 3RNAC 2BS3B 1P0RA 2JYTA 5D7GA 1VZ8A 3N9YC 1WM2A 3PPAA 3RNBC 1M4VA 5DPSA 4ACFA 1XT9B 4IM3A 2JVCA 1K51A 2PTLA 1P3QU 4EZKA 2V3SA 4IUMB 3VUWA 1QKZA 4WJOA 2K0PA 2ONQA 4FJVB 2J0JA 2W54A 3BVGA 4JWUC 2GBNA 3ENEA 4MDKE 2JSVX 1N61A 1V49A 3NS1A 1MJDA 3RUIB 2L8JA 2KO3A 4GDKB 1VR9A 3DBRB 2WLBA 1OTRB 3RPFC 2BT6A 1RLFA 3OJ4B 1ESFA 1H4RA 1PDXA 2WU5B 2H89B 3PRMB 2Q5WD 2D5GA 1F9JA 1HXYD 1CK1A 4KVGB 2QIEB 2UYZB 3PO0A 3WAPA 3DBRI 1RAXA 2PE6B 3RMKC 4OHJA 1WRIA 4G11A 1KJTA 4C7YA 1UF0A 2ZVOA 1YJIA 4HDQA 2IZVB 3HUIA 2I1JA 3Q8AA 5TSSA 3VTVA 4RMAA 3MC0B 2BB5A 2LASA 2LEKA 1QILA 3AECB 1SBBB 2KJ6A 4ANWA 1C1YB 4W9DA 3U7DA 1F1HA 3KWVA 2OJWA 2WXPA 2BWFA 1J0GA 3K9PB 1R4MB 1XD3B 1GC6A 3PTFC 4MT5A 2CU1A 4J6IA 2YEPB 2MBEA 5JHBA 5BMIA 4KGSA 2BYEA 1P7FA 2XK5A 2EKEC 4LJPB 3RZFA 2VRRB 5IAAC 2K22A 1A5RA 1YIWA 1EU3A 1GOZA 2LGXA 4RGMA 3KUDB 1GTHA 1L4DB 4OZBA 2M8SA 3FKYA 4ZRJA 2WXGA 4W9FA 2PVOD 2KC1A 3PSEB 1YX5B 4L2YA 1I4XA 4DHJB 4MH8A 3PT2B 4OW0A 1KFYB 2RR9A 2YEPF 3UIPB 3B08A 2MLBA 3PV1A 3ZQ4A 3MC9A 4ANUA 2HD5B 3JVZX 4BBNC 2IGDA 2Y3AA 4FJYA 2RSUA 2WDVB 5JXVA 1VD2A 3L54A 4RM8A 2LXCA 1KLGD 2DYBA 4NZLB 1UGMA 3N3KB 1E90A 2AQ2B 5AEKB 2AWTA 3MP9A 1TBEA 2G9HD 3GB1A 2KTRB 3R7RA 3OJ3A 1EO6A 1EWYC 1SIJA 3P63A 1SSNA 2BS2B 1XLQA 2H88B 1D4BA 4FADA 2R2QA 1D5MC 1WGHA 2WXMA 4REZA 3KYDD 4BOZB 2MQJA 1I7HA 3BWUD 2JY6A 2NTSA 1BMLC 4MGYE 5E6NA 4MEMA 4EE2A 1V86A 1QZEA 3MJ5A 1OEYA 1V1PB 2KX0A 2PJHA 2EMSA 2AX5A 2L1AA 1VCBA 4M00A 4FULA 5EDSA 1TZOA 2RDHA 1UUPA 4KSKC 4LNIA 4DHJD 2FNJB 3ZJTA 4W9JA 2J52A 1TY2A 4S0RA 4NAWA 3AH7A 2WX1A 4LLGM 2N7JA 3RI7C 2IJ0A 3DVGY 4MGIE 3EFCA 4TKNA 1IGDA 4IWOA 4KDLB 3WAOA 1PGAA 1YMHE 2AEHA 4W9EA 5IP4D 1I4PA 1P98A 5E6JA 1N62A 2LJ5A 2WQYB 2WXFA 3TEXA 2MBHA 3KUZA 4HLEA 3W1SC 1V80A 3PZDA 2J4XA 2JWUA 1GTEA 1WXQA 2KFKB 1XCQL 2VZKB 4G0NB 2FAZA 2J0KA 3KH0A 1WIAA 1L6VA 3H7PB 3CIRB 4N6EB 3P2BA 4H2AA 1TT5B 3ZNID 3Q3OC 4B0MA 2L0FA 2I38A 2KLCA 3PHXB 2JU6X 1ZDVA 3V61A 1PFDA 3MC8A 1MG4A 4LNNA 1J7AA 4LNFA 4M01A 1N63A 3AE4B 3V05A 2KAJA 4FJZA 5EE1A 3HK0A 2W3SA 1Z5SB 1ENFA 3VR9B 4LCDE 2GOWA 3Q8EA 1FNVA 2INPE 3IVFA 1N60A 2D2QA 3AV8A 2CS4A 1UNSA 3URYA 1WJUA 4WJPA 4FHJA 4RH6A 3R3MA 2QEJC 1N6ZA 1WJNA 1T0SC 4GDLB 4WJNA 2K8CA 3QX1A 3U30A 1FM0D 1ZKHA 2WXKA 3H8HA 3Q8FA 2KN4A 2QDFA 3ZYYX 3ZDMC 4XE0A 4HPLB 4BFRA 4LDTD 1WX7A 1TS5A 2LUEA 1LFDA 3DQVA 2CJOA 3QWZB 3K9OB 4C00A 1V5TA 3RN9C 4ZRPA 4YTPB 1GB4A 2GBRA 2INNE 2DZMA 3VQIA 3EHVA 3VTWA 3Q3JA 3W5UB 2CR5A 2EMTA 4K7UA 5CHWA 1V81A 2Y5BB 1C4AA 4W9LA 3KUCB 1Q0WB 3DBHB 1PUTA 1TKGA 2BQQA 2HJ1A 2J53A 2KZRA 3EECA 4AP4C 3IHPC 2BKFA 4YWGG 1C9FA 3I57A 1F2RC 3ZXVA 2N9PC 1Y8RC 4FHKA 4AJYB 2DYOA 1NENB 5G5GA 1IPGA 5DPWA 2ZNVC 2C7HA 3DBHI 4ICVA 4R3DA 1WYGA 2Y5CA 1D3ZA 3BVZA 3A1QA 3NG0A 3MFGA 3D32A 5H8YE 2GLSA 2DLBA 3CF6E 2M19A 5IOIA 1STEA 1ZPSA 2MH7A 3SHQA 5IKCM 1J7CA 5TR5A 3HRDD 1DYQA 1IBXB 1UD7A 4KKJA 1WGDA 1UBIA 4JWSC 2CU3A 3HHMA 3N20C 4LK0M 2HJ8A 4DQOC 4DWFA 4WAAA 2MBQA 3SFDB 2IGHA 1IGCA 2RPVA 3AEEB 3E56A 2ACZB 3JYUA 1FFUA 3ABVB 4XWWA 4MGZE 1E7UA 1WGYA 1MG8A 2HDEA 1L0VB 3T3NA 2G3QB 4K3BA 2WNMA 2KWVB 2OJRA 1C3TA 3R8BA 1FRDA 2L3ZA 1FPYA 3P4PB 2FCMA 4GDKA 2M0XA 1WGKA 4GB9A 2K8BA 1FFVA 1TTNA 1SIFA 3HVDA 3NHEB 4M0WB 1K50A 1DOIA 1VDVA 1BT0A 2WWZA 2DHZA 2IPKD 4QAYA 2VH1A 4DDID 4JLCA 1EF1A 3N30A 4M8MA 2CHZA 3ECIA 5D3DA 4RF0A 4XGAB 2DAJA 4LJOB 3ZNZB 2X38A 3VR8B 1RRBA 2M1MA 3L10B 4FA6A 1JALA 2BWES 3A33B 1U4AA 4M02A 3R7QA 4IM2A 3B2GA 2EELA 2NS5A 1DGJA 3UINB 3BYYB 2B3AA 4ZHPA 4WURA 2MWSB 1XLOA 3VDZA 1YX6B 2BBCA 2M17A 3AMZA 2KANA 4OZAA 3DVNU 2NMQA 4EZJA 4JX1C 3L08A 1JMLA 2PE9A 1DOXA 3QCAA 2KWUB 1QT9A 5CX3A 2WDQB 2TSSA 3OLMD 4L23A 4IC7B 2JXXA 1JWBD 4XC2A 4BBNF 1I35A 2FCQA 2JX5A 3RFZB 1E8ZA 3RULA 5HHDG 3X0WA 5C3JB 3AN1A 2LZ6A 4BOSC 4LTUA 4FN2A 1AARA 5I4DA 3N1ZC 4XX5A 3VUXA 3H9DA 4JL9A 2QJLA 2IO0B 2XNAC 1WXMA 3IBEA 4F7ZA 2K39A 1NYQA 1VZ7A 2FIFA 2KOXA 4F1SA 3ZNGC 2EKIA 2GRIA 3DHHC 2R2OA 3TEWA 2O6VB 1VJKA 1PGXA 2KDIA 3H1UA 4NAMA 5CTRC 4K7SA 3LDZE 3KWLA 2KYWA 1T6BX 2KTRA 4HRSA 5C1ZA 3KQ4A 1I4GA 1HEZE 4BKGA 4PYUA 3WIMA 5J18A 4GSWA 4EKUA 2NBUA 2LGSA 3FILB 3WA0A 3TBLD 3VVWB 3I5JC 2IO2B 1FMAD 1WGGA 4II3B 4N59A 4XZ4A 4BAXA 2IY1B 4IG7B 2MX2A 1L7YA 5DPRA 1I42A 2V0GA 2D3CA 1V1PA 5AZFA 2KDFB 3NS8A 1YN3A 3P4SB 1C4PA 2WGSA 4NQLB 3BK2A 4DXAB 3FAHA 2MJ3A 1WY8A 4JE3B 2KN5A 3U4EG 1WWTA 3ZTDA 2K5PA 4W9KA 5AUKA 3WANA 2L05A 4KDIC 4US8A 5JZEB 5FR3A 1SE4A 4DHZB 3NZSA 1KTKA 3OAWA 4HDOA 1TIFA 4OZCA 3PVLA 2W3RA 4TQ0A 4RNAA 4DHZE 1FXTB 4URKA 2O6VD 4YSYB 3ZTCA 3ZJVA 2SEBD 4Q2JA 4US9A 1JWMD 3DWMA 1SE9A 4PS7A 1FNUA 1NBFC 5FKAC 2LFIA 3RNEC 2PIAA 2J7QB 2W9NA 1JCKB 2JUOA 1L5PA 3B1LX 2RPQA 4YXDB 3M62B 3NRZA 1F77A 1XQQA 3APCA 3RNGC 4W9CA 3E9SA 3L4PA 3SD5A 3HM6X 2KFKA 2WXNA 3NZ3A 2AL3A 3C0RB 4MJSB 2MJEA 3ML8A 2AYOB 5J2RA 2KHWB 4IW0A 4P7IA 2N9EB 4OVUA 3H7PA 1A70A 3PZ8A 4NY0A 1WM3A 3HIZA 2BS4B 3VUYA 2NPTB 3DVGX 2D07B 1SF0A 3ZVVA 3B0AA 3NJTA 3W2DA 3M3JA 4JGHB 4II2B 1P1AA 4ZRIA 2KK8A 2V3PA 4B9KA 3ZNHB 2LVQA 3Q8BA 3PS6A 2OOBB 2PEAA 3WALA 4ITKA 3VHTC 1WX8A 2LGDA 1TS4A 2KDBA 2ZEQA 4NNJB 5HKHA 1UBQA 4LNKA 2KD0A 1CQVA 1T0YA 1Y56A 2D3GA 4RGNA 2D3BA 1YN5A 4K81A 4UDUC 2ZNVB 1XO3A 2M56B 4K3CA 3QA8A 3J9CA 5LNK1 4ASWC 5H92C 1ET9A 2KDEB 4D2KA 4A55A 4GDLA 1L4ZB 2ZPYA 1UWMA 4TQ1A 1NYRA 4PK1A 1EWCA 1KM7A 4WH4A 1UH6A 2J42A 4BKTA 1JRUA 3TL5A 3UQAA 2Y5PA 2NBVB 3A9KB 1S3SG 2KQSA 1E9MA 1WE7A 4I6LB 4CHKA 2N0SB 4XWTA 3AE5B 5DCNA 3RYTA 3EUB2 3M63B 3L13A 4W9GA 4HPPA 3DBLB 2GMIC 1C76A 1C78A 2WXIA 2RD0A 5IA7A 1ISNA 4FBJB 1L2NA 3BYTB 2GB1A 4AOFA 3CSFA 1CMXB 2KQ7A 4RGTA 2UWQA 4RM9A 4EZLA 5CHFA 1MFWA 1GT8A 3GP7A 3DBLI 4IM0A 4LDTB 3NZUA 3NOBA 5EE3A 3TEZA 4DK5A 2CHXA 3ZDTA 4ARCA 4DBGA 4ZYSA 1KLVA 3V62A 4N58A 4HXDA 1L6UA 2JXTA 2JRHA 3LXFA 2R61A 3R2TA 3TUOA 1TGZB 1R7SA 2RGFA 3NVVA 4GGQA 1FRRA 1V2YA 1ET6A 4F8CB 1XF5L 3V6EB 1QOBA 4M8NA 3NVZA 1TY0A 1WRDB 5EE0A 1D5ZC 1H7WA 2DZJA 4AQ7A 3NVYA 3AU5A 2FBWB 3QAQA 3ZRCA 1KF6B 1IBXA 3ZKJC 1UGJA 2ZW0A 4HCPB 4NJ7A 2E6XA 4HJGE 3O13A 4A3OA 4P1CC 1R4NB 3APFA 2DNFA 1FXIA 2KVRA 5IO9A 4BKSA 1GC7A 1YQ4B 4IDIA 1D6EC 2WXRA 3UQBA 1PQSA 3CF4A 2CJNA 1TKYA 5T8IA 1WFYA 1TYGB 2IDYA 3Q8CA 2B76B 3Q6BA 2JWZA 4YL8A 5JH5C 3T3OA 2KQ4X 2MA9B 1R4NI 1WXSA 1ZUD2 1VRAB 1H8CA 1MHHE 3TEYA 3KLSX 1M94A 3PLUA 2O2VB 1TS3A 3W9CB 1FXAA 2KDMA 1CJEA 5J17A 3DVNV 1C79A 3PREA 1MVKA 1HQRD 4M0WA 2LI5A 2BYTA 1K8RB 2IO3B 1AW7A 4USAA 1MPEA 3DHGC 5KHQA 1EM7A 3KVFB 3NY5A 4OVVA 1LO5D 2IGGA 2L00B 4MGKE 1SEBD 1V5OA 3RNFC 4XDCA 2K1FA 2N9LA 3ETRA 1WGRA 2HE7A 1GB1A 4N9F4 1F0ZA 3OWEB 1ZW7A 2W82A 3CSTA 1GAQB 4HPMB 4KKIA 4TUUA 1OQRA 1P7EA 1N5XA 3L16A 1V97A 4KIKB 4ICUA 2DZIA 1FO4A 3GZNI 2OHFA 1KH0A 3KYCD 1FCLA 3GE3C 4NPNA 3VH3B 3A9JB 3FC4A 1JRPA 3APDA 5FR6A 4YTMB 4WWPA 2K6QA 5BMHA 3ZLZA 3VXWA 1X1MA 1NEKB 4IKGA 1V6EA 4W9IA 3R2IA 3V6CB 2ICIA 3VH4B 1WYWB 2C9WB 3BIID 4DXGA 5AZGA 1JWAD 4P6VF 2HTME 2C7NB 5HFYA 3V60A 4YT0B 1K52A 3PHWB 1D5XC 3MHSD 2MW5A 1E8YA 4TMAB 2IO1B 1B9RA 3B9JA 4WWMA 3AEAB 4CQNA 2O6VA 3NVWA 4HJKA 1YJ1A 2WXOA 1N5WA 4P16A 3RZWC 1BXTA 2NBWB 3JSVB 1WH3A 2IYDB 3AEBB 2GBMA 4AJWA 2WXQA 2CHWA 1EUVB 1MI0A 2L7RA 1E6EB 2ZCBA 3MJWA 3FILA 2LWPA 4I6PA 2KACA 3CMMB 3T8MA 1J19A 1FIQA 2JZPA 2MJDA 2WDTB 1QOAA 4X57B 1XLPA 1SB3C 4PS8A 1HA5A 1T0QC 2K6DB 1CZPA 2ASQA 1WI0A 3SEBA 3N32A 2AL6A 3B2FA 1IP9A 1GG3A 2DBYA 3ZXRA 2LMCA 1WF9A 1G6JA 2MP2B 1LQBA 2W55A 4YSZB 3U7ZA 4FLHA 4HK2A 2K8HA 1WXAA 2RDBC 3VFKA 5LXHA 4MSMB 1GUAB 3TIXA 1WXVA 1WZ3A 3P4QB 5EE9A 4A9AA 1VLBA 3RCZA 2KMAA 3VRAB 1TS2A 4HCNB 3PRZA 2KMMA 3U2SC 2KWDA 2WXLA 2D3AA 2KX3A 1OQQA 4C4VB 3I9V1 4A6QA 2DX5B 1ZDXA 3BK1A 3DWGC 2PVGC 3C8YA 1RFKA 2L52A 1C4CA 4AWJA 4YSXB 1PGBA 2LRWA 2QILA 3W5VB 1UZXB 3Q3MC 4YTNB 1F52A 3C19A 3O65B 2MCNB 1QOFA 3BVMA 4MJSA 2REXA 4G50A 2INCC 4E71A 1HTOA 4BZAA 4EUTA 4AS1A 4E3CA 2A5UA 4MM3B 4P1BC 3LJ3A 3EC8A 2N9KA 1YOVB 2NPTA 1AYFA 3M95A 2V1YA 1LGRA 2KVZA 1Q10A 4EOYA 2ZCCA 5HI1A 2C5LC 2MRPA 1NI2A 1ZXIA 2YVCA 3NUHB 5L83A 2GI9A 2MEKA 2NR2A 4IWQA 4WQOB 2BYVE 1ZE3D 3AEGB 4ARIA 1EU4A 1ZOYB 2G1EA 1P9DU 3L0WB 3HM3A 4PYZA 3BZDB 1ZGUB 1XLNA 3ZO5B 3VAWA 1SE3A 2M4NA 1YQ3B 2N1VA 3UI3A 2JZZA 1QQRA 5G55A 1JQ4A 2AQ1B 2WX0A 5GXGB 1MHXA 3Q3NC 3QHTA 2HTHA 3X23A 2K3UA 1DOYA 3ALBA 3DOWA 1WMHB 4IOIE 1JWSD 1E0ZA 3AB5A 1YJJA 1RWSA 1WR1A 3A9KA 3SR6A 1HTQA 2KKCA 3TCAA 4EEWA 1KLUD 1R4MI 1L0XB 3UF8A 2KLGA 3MHZA 3TJPA 2GBKA 2K25A 1Q1OA 3EFUA 1QOGA 3RD2A 1E8WA 4HROA 4G3XB 3AEDB 4B95A 1JW9D 3CWIA 4TV3A 1VZ6A 3VRBB 4OVZA 5KHOA 1GNUA 4FXCA 3IT4B 2N7EA 1E5WA 1E7VA 4KSLC 2BGFA 2G45B 4ZRQA 5E6OA 2JRIB 3EA6A 2M0AA 2BYFA 5LXIB 4A90A 1V8CA 4PT5A 4C80A 2FIDA 1NDDA 1XXGA 2PPHA 4IWPA 1J7BA 2Z0DB 2KC2A 3TSSA 4JQWC 1XCTL 5AZHA 5BYRA 2WU2B 1E10A 2D10A 1ROEA 5G5HA 4GN1A 1YN4A 1FCCC 5IN7A 1T5XD 3QK0A 2KFJA 1SE2A 2BF8B 2BKRB 3LB8C 2KNBA 2ZZPB 4O1NA 5D2MB 4NQKE 1LM8B 2N7DA 3IFWB 4RCOA 3DDCB 3SU8X 1WJ6A 2MHJA 3PZ7A 1SGHA 4B6WA 1F2RI 2XK5B 4ZHOA 4DDGD 1JWUD 5JHAA 2GBJA 3QC8B 2AQ3B 4HVBA 5MPOA 2KWCA 4WJQA 1TZ1A 2DENB 3DCGA 4E74A 4GXBA 3AE3B 2Z59B 1QF6A 1SXTA 2LHDA 4PS3A 3IAM1 2LGIA 3AE9B 5BYSA 2QC8A 2WHIA 3DPDA 4MH0E 4WAFA 2O2VA 5G2NA 1SJED 3Q3FA 3WCQA 1UELA 2WP9B 1OGWA 4XDDA 1FD6A 1HE8A 3A4RA 3DBSA 3AE2B 2DAFA 1E7PB 2QHOA 2WYQA 1HZ5A 4KGRA 2KT7A 4MSQB 3QARA 2G4DB 3T9LA 1SJHD 1V9JA 3KW5B 2X8XX 3GOEA 1KOTA 1RYJA 2BTEA 3Q2AC 3BY4B 1L0YB 2WDRB 3AE7B 3P4RB 3HVZA 2RMMA 2Z8LA 3AE6B 4I6NB 1WJ4A 4ZRKA 2C60A 4KV2A 3SFEB 2L32A 1EF5A 2FCSA 1ACCA 5BO4B 2KMCA 3AM9A 4K1RB 3Q69A 2DZKA 4KIKA 2JYEA 1I4QA 4HKZE 4C7ZA 3ZIMA 2LUMA 1WX9A 4B0EA 2L83A 1RM6C 3UGBB 3A9JA 3L17A 4JPSA 2I1KA 2BW2A 4S17A 2DWQA 1C77A 3IXSA 3IG3A 4A20A 2N1WA 2IBIB 2PKOA 2INDC 4A3PA 3ZW3A 5D94A 3WAMA 4HKQA 2G4SA 3U8ZA 5GMVA 1YNTE 4J3OD 2XBBC 3N1YC 4GOCA
chains in the Genus database with same CATH topology
1D5XC 3KQ4A 3MJ5A 1V1PB 1I4GA 4GLSC 1TJEA 1HEZE 4TMAB 4NAWB 1B9RA 3B9JA 2AX5A 1AWDA 3AEAB 2QMTA 4WWMA 4CQNA 5D3IB 3FILB 2L1AA 1FMAD 2LHEA 3NVWA 1TZOA 4RF1A 2WXOA 4N59A 1N5WA 4P16A 1BXTA 2RDHA 1ZXHA 1UUPA 1V1OA 3AEBB 2VZKD 1NI3A 3ZJTA 1FNWA 2J52A 1TY2A 2WXQA 1NVID 2V0GA 2BB6A 1V1PA 1MI0A 1K53A 1T3QA 1E6EB 1YN3A 3AH7A 3P4SB 1C4PA 5FK9C 3BK2A 2RDGA 4LLGM 3FAHA 2N7JA 3FILA 2IJ0A 2MJ3A 2KACA 4JE3B 3U4EG 1WWTA 1FIQA 1IGDA 2JZPA 2MJDA 4L1BA 2V3NA 1PGAA 1YMHE 2K5PA 1QOAA 5AUKA 3V3XA 1XLPA 1AN8A 1I4PA 1SB3C 4ZOHC 5E6JA 1HA5A 4US8A 1CZPA 1N62A 5FR3A 3SEBA 1SE4A 2WQYB 3B2FA 1H7XA 3GS2A 2PMVA 2WXFA 3TEXA 1KTKA 4MACA 2DBYA 4HEA1 2LMCA 4OZCA 2W55A 2W3RA 3ZJUA 4WIPA 4YSZB 3U7ZA 4TQ0A 4RNAA 1GPXA 1JROA 2ON8A 4YSYB 2J4XA 2JWUA 3P42A 1GTEA 3ZJVA 2SEBD 4Q2JA 2FE8A 1WXQA 3AE8B 4US9A 1JWMD 3DWMA 2XN9C 3P4QB 1FNUA 5EE9A 4A9AA 5FKAC 2LFIA 1XCQL 1VLBA 2PIAA 2VZKB 3VRAB 2ZW1A 1TS2A 1L6VA 3CIRB 2KMMA 4RGOS 2PLPA 4WQMA 3U2SC 1JCKB 2KWDA 1L5PA 4YXDB 2NTTA 4N6EB 2WXLA 3NRZA 4H2AA 1QLBB 4A8XC 2LJIA 1F77A 1OQQA 3EGRA 4B0MA 3I9V1 4A6QA 2I38A 3U52E 1ZDXA 3E9SA 2JU6X 1ZDVA 3BK1A 3L4PA 3P1MA 3DWGC 2PVGC 1PFDA 2QSDA 3C8YA 1B1ZA 2WXNA 1RFKA 1OFFA 3NZ3A 2L52A 1C4CA 4YSXB 4KX6B 1J7AA 2MJEA 1PGBA 1N63A 3AE4B 3V05A 2QILA 3W5VB 1A70A 2KAJA 3PZ8A 5EE1A 2W3SA 3IAS1 1HZ6A 2BS4B 1I4HA 1XEEA 4YTNB 1SF0A 2PW9A 2WXJA 1ENFA 3VR9B 2I2YA 3W2DA 1BUIC 3Q8EA 3LYYA 1FNVA 2INPE 1QOFA 2E3TA 3BVMA 2V3PA 3AEFB 1N60A 1TKEA 5HG2A 3AV8A 3Q8BA 4TSSA 4RFBA 4AS1A 1UNSA 2DYMA 4ITKA 4NJCA 3URYA 4MM3B 2N9KA 4RH6A 1ZP0B 1IUEA 1AYFA 1TS4A 2QEJC 4GDLB 1KRHA 1CQVA 1Q10A 1FM0D 2WXKA 2WXHA 1Y56A 5HI1A 1ZXIA 3H8HA 1WSPA 4RGNA 4DXFA 1YN5A 4UDUC 3NUHB 2GI9A 1PYWD 2MEKA 3Q8FA 1XO3A 2M56B 2KN4A 3ZYYX 1ZE3D 2JQRB 2K9XA 3AEGB 4ARIA 3J9CA 4XE0A 1EU4A 5LNK1 1ZOYB 5H92C 1ET9A 4D2KA 2G1EA 3W1SA 1TS5A 4A55A 3BZDB 2CJOA 1L4ZB 1UWMA 4ZRPA 1XLNA 2SAKA 4YTPB 1GB4A 2OEDA 1FEHA 2INNE 4TQ1A 1NYRA 4C56C 1EWCA 1SE3A 4WH4A 3VQIA 2J42A 5C2TB 1YQ3B 3UI3A 1QQRA 2Y5PA 3W5UB 3ZGZA 5BMGA 1E9MA 1JQ4A 4KGTA 2N0SB 2AQ1B 4XWTA 5AUIA 5GXGB 3AE5B 1MHXA 3AE1B 1C4AA 2K3UA 3EUB2 1DOYA 1PUTA 1C76A 1TKGA 4IOIE 5BYQA 1C78A 1JWSD 2J53A 2WXIA 1E0ZA 1C9FA 4YWGG 2V4IB 3I57A 1I4RA 1F2RC 3AB5A 1YJJA 1RWSA 3SR6A 1UWXA 3BYTB 2DYOA 2FUG1 2GB1A 1NENB 5G5GA 4RGTA 1KLUD 3IT6B 1L0XB 1GT8A 3GP7A 2WS3B 3MHZA 4R3DA 1WYGA 2Y5CA 1QOGA 2BS3B 3BVZA 3MFGA 4HROA 2JYTA 5EE3A 5D7GA 1VZ8A 3TEZA 3AEDB 5H8YE 1JW9D 3N9YC 2DLBA 1M4VA 2M19A 4ARCA 4ZYSA 1STEA 1ZPSA 4N58A 2MH7A 3CWIA 1L6UA 2JXTA 3LXFA 1J7CA 2R61A 3R2TA 1VZ6A 3VRBB 4OVZA 3TUOA 3HRDD 1DYQA 1K51A 2PTLA 1R7SA 4FXCA 1IBXB 3NVVA 1QKZA 3IT4B 4KKJA 2K0PA 1FRRA 1ET6A 2ONQA 1XF5L 4JWSC 1QOBA 2CU3A 4LK0M 2W54A 3BVGA 4JWUC 4ZRQA 3NVZA 1TY0A 2JSVX 3EA6A 4DQOC 5EE0A 1D5ZC 1N61A 1H7WA 4AQ7A 2M0AA 3NS1A 3NVYA 3SFDB 4A90A 2IGHA 1IGCA 2RPVA 2FBWB 4GDKB 1V8CA 1VR9A 4PT5A 3AEEB 3E56A 4C80A 2ACZB 1KF6B 1IBXA 1UGJA 1XXGA 2WLBA 2ZW0A 3RPFC 1J7BA 2BT6A 1FFUA 2E6XA 4HJGE 3ABVB 3O13A 4XWWA 3TSSA 1ESFA 2HDEA 1FXIA 1L0VB 3T3NA 1YQ4B 1PDXA 1XCTL 2WNMA 2WU5B 2H89B 5BYRA 2WU2B 2Q5WD 4IDIA 2D5GA 1FRDA 3R8BA 1E10A 3P4PB 1HXYD 1ROEA 1D6EC 5G5HA 1CK1A 2WXRA 2QIEB 1YN4A 1FCCC 3PO0A 3CF4A 1T5XD 1TKYA 1WGKA 2CJNA 5T8IA 1SE2A 1TYGB 4OHJA 1WRIA 2IDYA 1FFVA 2B76B 3Q8CA 4C7YA 3T3OA 3LB8C 1YJIA 4O1NA 3HVDA 2KQ4X 3HUIA 1K50A 1DOIA 1VDVA 4RCOA 3Q8AA 5TSSA 1ZUD2 3PZ7A 2IPKD 1VRAB 3MC0B 5D3DA 2BB5A 2LEKA 1QILA 1F2RI 4RF0A 1MHHE 3AECB 1SBBB 3KLSX 3TEYA 2X38A 3VR8B 4ZHOA 3W9CB 1TS3A 1JWUD 1FXAA 2KDMA 1JALA 2AQ3B 1CJEA 3KWVA 5MPOA 2WXPA 1C79A 1MVKA 1HQRD 4M0WA 4MT5A 3AE3B 1QF6A 2BYTA 1SXTA 2LHDA 2YEPB 3IAM1 2LGIA 3AE9B 1AW7A 3B2GA 5BYSA 2EELA 4USAA 4KGSA 5BMIA 1MPEA 1EM7A 1P7FA 1DGJA 4WAFA 3BYYB 1LO5D 1SJED 3WCQA 2IGGA 4ZHPA 2K22A 2WP9B 4XDDA 4WURA 1XLOA 1FD6A 1SEBD 1EU3A 2BBCA 3AMZA 4XDCA 1GOZA 2N9LA 3AE2B 3ETRA 4RGMA 1GB1A 4OZAA 1E7PB 1F0ZA 2NMQA 3OWEB 1GTHA 1HZ5A 1L4DB 4KGRA 4OZBA 4JX1C 2W82A 1JMLA 1GAQB 4KKIA 1SJHD 1DOXA 2WXGA 1OQRA 1P7EA 1N5XA 2PVOD 1RYJA 2BTEA 1V97A 1QT9A 4L2YA 1L0YB 2WDRB 3AE7B 3P4RB 3HVZA 2WDQB 2RMMA 1I4XA 2TSSA 2Z8LA 4MH8A 4L23A 3AE6B 1FO4A 4OW0A 2OHFA 1KFYB 1JWBD 1KH0A 1FCLA 2YEPF 3SFEB 2JX5A 3RFZB 2L32A 3FC4A 3ZQ4A 1JRPA 1ACCA 2IGDA 2Y3AA 5HHDG 5C3JB 3AN1A 2WDVB 5JXVA 4YTMB 4LTUA 1KLGD 3AM9A 4NZLB 5BMHA 3Q69A 5I4DA 2AQ2B 2JYEA 1I4QA 3MP9A 4HKZE 4C7ZA 1NEKB 2G9HD 4IKGA 2LUMA 2QJLA 4B0EA 3GB1A 2XNAC 2L83A 3R2IA 1RM6C 1EWYC 1SIJA 2ICIA 3P63A 1SSNA 4JPSA 2BS2B 2BW2A 1XLQA 2H88B 1NYQA 3BIID 1D4BA 1VZ7A 2DWQA 1C77A 3IXSA 1D5MC 4DXGA 2WXMA 2EKIA 4REZA 2GRIA 3TEWA 1JWAD 1I7HA 1PGXA 1VJKA 2PKOA 3BWUD 4P6VF 2HTME 1BMLC 2NTSA 4NAMA 4HKQA 3KWLA 5HFYA 1YNTE 4YT0B 1T6BX 4J3OD 1K52A 4EE2A 4HRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A70 A;  2KAJ A;  1GT8 A;  3AE3 B;  2WS3 B;  1QF6 A;  5EE1 A;  1WYG A;  2Y5C A;  1QOG A;  1TJE A;  2BS3 B;  2W3S A;  3AE9 B;  2BS4 B;  3B2G A;  4YTN B;  1SF0 A;  4USA A;  1B9R A;  3B9J A;  4HRO A;  2AX5 A;  1AWD A;  3AEA B;  3VR9 B;  4WWM A;  5EE3 A;  3AED B;  5H8Y E;  1JW9 D;  1DGJ A;  2M19 A;  1FMA D;  3NVW A;  4N58 A;  2MH7 A;  3CWI A;  1QOF A;  1N5W A;  2E3T A;  4N59 A;  1L6U A;  3LXF A;  3WCQ A;  4ZHP A;  1J7C A;  2K22 A;  2WP9 B;  3AEF B;  3AEB B;  3VRB B;  1XLO A;  1NI3 A;  1N60 A;  1TKE A;  3HRD D;  3AV8 A;  1R7S A;  3AMZ A;  1NVI D;  4FXC A;  3ETR A;  3AE2 B;  3NVV A;  4ITK A;  1E7P B;  1F0Z A;  1FRR A;  1T3Q A;  1E6E B;  1GTH A;  3AH7 A;  1ZP0 B;  1IUE A;  3P4S B;  1AYF A;  4JWS C;  1QOB A;  2CU3 A;  4JX1 C;  3FAH A;  1KRH A;  1GAQ B;  2W54 A;  4JWU C;  2MJ3 A;  1FM0 D;  1DOX A;  3NVZ A;  1OQR A;  1N5X A;  1WWT A;  1ZXI A;  5EE0 A;  1N61 A;  1FIQ A;  1H7W A;  2MJD A;  2PVO D;  1RYJ A;  3NS1 A;  1V97 A;  3SFD B;  3NVY A;  1QT9 A;  2K5P A;  1QOA A;  5AUK A;  2WDR B;  3AE7 B;  3P4R B;  1XLP A;  2FBW B;  2WDQ B;  3HVZ A;  1V8C A;  1SB3 C;  3AEE B;  1XO3 A;  2M56 B;  4ZOH C;  4C80 A;  3AE6 B;  2ACZ B;  4US8 A;  1KF6 B;  1CZP A;  3ZYY X;  1FO4 A;  2JQR B;  2K9X A;  3AEG B;  1N62 A;  2WLB A;  2WQY B;  3B2F A;  1H7X A;  1KFY B;  1J7B A;  1JWB D;  1ZOY B;  2BT6 A;  1FFU A;  2OHF A;  3RPF C;  3SFE B;  5H92 C;  3ABV B;  2G1E A;  2JX5 A;  2DBY A;  3FC4 A;  1JRP A;  1FXI A;  2CJO A;  1L0V B;  1UWM A;  2W55 A;  2W3R A;  5C3J B;  3AN1 A;  1YQ4 B;  1PDX A;  4YSZ B;  4YTP B;  2WDV B;  2H89 B;  2WU5 B;  4YTM B;  1XLN A;  2WU2 B;  2Q5W D;  4LTU A;  4IDI A;  1GPX A;  1FRD A;  1NYR A;  1JRO A;  3AM9 A;  1E10 A;  4YSY B;  3P4P B;  1ROE A;  1GTE A;  5C2T B;  5G5H A;  1YQ3 B;  1WXQ A;  3AE8 B;  4US9 A;  2QIE B;  3DWM A;  3W5U B;  4C7Z A;  3PO0 A;  3P4Q B;  3CF4 A;  1NEK B;  1E9M A;  5EE9 A;  1WGK A;  1TKY A;  2CJN A;  2N0S B;  1VLB A;  4A9A A;  1JQ4 A;  2QJL A;  2PIA A;  1TYG B;  5AUI A;  1WRI A;  3VRA B;  3AE5 B;  2L83 A;  5GXG B;  3AE1 B;  2B76 B;  1FFV A;  4C7Y A;  1RM6 C;  1L6V A;  3EUB 2;  3LB8 C;  1EWY C;  3CIR B;  1YJI A;  1SIJ A;  2KMM A;  3P63 A;  1DOY A;  4WQM A;  2BS2 B;  3HUI A;  1DOI A;  1L5P A;  2H88 B;  1PUT A;  1XLQ A;  1VDV A;  4YXD B;  1NYQ A;  1TKG A;  3BII D;  3NRZ A;  1ZUD 2;  4N6E B;  1QLB B;  2DWQ A;  1E0Z A;  1OQQ A;  2EKI A;  2LEK A;  3L4P A;  1JWA D;  1I7H A;  3AEC B;  1VJK A;  2PKO A;  3DWG C;  2PVG C;  3AB5 A;  3P1M A;  1PFD A;  1YJJ A;  1RWS A;  4P6V F;  3VR8 B;  2HTM E;  1RFK A;  1OFF A;  3SR6 A;  2L52 A;  3W9C B;  4ZHO A;  3KWL A;  1NEN B;  1FXA A;  5G5G A;  1JAL A;  1CJE A;  4YT0 B;  4YSX B;  4KX6 B;  1J7A A;  2MJE A;  5MPO A;  1N63 A;  3AE4 B;  4HRS A;  3W5V B; 
#chains in the Genus database with same CATH topology
 3RNC C;  3ONS A;  4GLS C;  1TJE A;  4ANV A;  1WZ0 A;  4NAW B;  1AWD A;  2QMT A;  5D3I B;  3VTU A;  4GU2 A;  2LHE A;  4RF1 A;  1ZXH A;  1V1O A;  1YQB A;  3TMP B;  2VZK D;  1NI3 A;  1FNW A;  1NVI D;  2Z0E B;  2BB6 A;  1T0R C;  1K53 A;  1Z2M A;  1T3Q A;  5FK9 C;  2RDG A;  4CYE A;  4NJ6 A;  3AUL A;  5E6P A;  2XEW A;  3PRP B;  4LNO A;  4L1B A;  3JSV A;  2JT4 B;  2V3N A;  3V3X A;  3ZUN A;  1AN8 A;  2VH2 A;  4ZOH C;  2CKH B;  2KJR A;  1H7X A;  3GS2 A;  2FUH B;  2PMV A;  3GZN B;  2V4L A;  4MAC A;  1RFA A;  4ANX A;  2QCZ A;  4HEA 1;  5DPT A;  2KXJ A;  1Q5W B;  3QQ8 B;  3ZJU A;  4WIP A;  2UU7 A;  3Q14 C;  1GPX A;  1JRO A;  2ON8 A;  3P42 A;  2LVO A;  2FE8 A;  3AE8 B;  5D6J B;  2XN9 C;  2KTF A;  5CHV C;  3H6N A;  4MEL A;  3AI5 A;  1IYF A;  3AU4 A;  2ZW1 A;  2C7M B;  2ZPN A;  4RGO S;  2PLP A;  4WQM A;  2V9H A;  1OQY A;  2NTT A;  2MP2 A;  1YD8 U;  1E8X A;  1QLB B;  4A8X C;  2LJI A;  3EGR A;  3PGE A;  4BVU C;  2KJH B;  3U52 E;  2N9X A;  3P1M A;  2QSD A;  3DHI C;  4HWI B;  1B1Z A;  4WWO A;  1OFF A;  2LGY A;  1S1Q B;  3ML9 A;  4KX6 B;  4GMV A;  2L0T A;  4EFO A;  3N1X C;  4XYC A;  5C23 A;  2JF5 A;  3JW0 X;  3IAS 1;  1HZ6 A;  1XEE A;  1I4H A;  2IY0 B;  3UIO B;  4C4V A;  4ZDV A;  1J8C A;  3OG5 A;  2PW9 A;  2WXJ A;  4WWN A;  2I2Y A;  1BUI C;  3LYY A;  3ZRF A;  2E3T A;  3BIN A;  3W1Y A;  4GIV A;  4K7W A;  3AEF B;  3RT3 B;  2LD9 A;  1TKE A;  2YLM A;  5HG2 A;  2D11 A;  4TSS A;  4RFB A;  2DYM A;  4NJC A;  4AUQ C;  3R66 C;  2NVU I;  1ZP0 B;  1IUE A;  1WR6 E;  1KRH A;  4KZC A;  2WXH A;  2BVC A;  3I63 C;  1WSP A;  4DXF A;  1WE6 A;  2JPH A;  1PYW D;  2A4Z A;  2ZVN A;  2JQR B;  2K9X A;  3SDL C;  4MM3 A;  2MBB B;  1OEY J;  3W1S A;  1GJZ A;  2JZ3 B;  2LXA A;  3MTN B;  2SAK A;  2OED A;  1FEH A;  3I3T B;  4C56 C;  3QIJ A;  2LVP A;  5C2T B;  2MBO A;  2L76 A;  4CO7 A;  3ZGZ A;  5BMG A;  4KGT A;  5AUI A;  2ZJD A;  3AE1 B;  4JIO U;  3PLV A;  2NCN A;  2LRU A;  5BYQ A;  2FCN A;  3S2A A;  4BKS D;  3A1Q B;  4W9H A;  2V4I B;  4ZYN A;  1I4R A;  3QJZ A;  1UWX A;  2BPS A;  2FUG 1;  2MSE D;  2J0M A;  3GE8 C;  3H7S A;  5LLI A;  5L95 C;  3IT6 B;  3A4S C;  2N4F A;  3AXC A;  2WS3 B;  1LXD A;  1WMH A;  4KZ0 A;  3RNA C;  2BS3 B;  1P0R A;  2JYT A;  5D7G A;  1VZ8 A;  3N9Y C;  1WM2 A;  3PPA A;  3RNB C;  1M4V A;  5DPS A;  4ACF A;  1XT9 B;  4IM3 A;  2JVC A;  1K51 A;  2PTL A;  1P3Q U;  4EZK A;  2V3S A;  4IUM B;  3VUW A;  1QKZ A;  4WJO A;  2K0P A;  2ONQ A;  4FJV B;  2J0J A;  2W54 A;  3BVG A;  4JWU C;  2GBN A;  3ENE A;  4MDK E;  2JSV X;  1N61 A;  1V49 A;  3NS1 A;  1MJD A;  3RUI B;  2L8J A;  2KO3 A;  4GDK B;  1VR9 A;  3DBR B;  2WLB A;  1OTR B;  3RPF C;  2BT6 A;  1RLF A;  3OJ4 B;  1ESF A;  1H4R A;  1PDX A;  2WU5 B;  2H89 B;  3PRM B;  2Q5W D;  2D5G A;  1F9J A;  1HXY D;  1CK1 A;  4KVG B;  2QIE B;  2UYZ B;  3PO0 A;  3WAP A;  3DBR I;  1RAX A;  2PE6 B;  3RMK C;  4OHJ A;  1WRI A;  4G11 A;  1KJT A;  4C7Y A;  1UF0 A;  2ZVO A;  1YJI A;  4HDQ A;  2IZV B;  3HUI A;  2I1J A;  3Q8A A;  5TSS A;  3VTV A;  4RMA A;  3MC0 B;  2BB5 A;  2LAS A;  2LEK A;  1QIL A;  3AEC B;  1SBB B;  2KJ6 A;  4ANW A;  1C1Y B;  4W9D A;  3U7D A;  1F1H A;  3KWV A;  2OJW A;  2WXP A;  2BWF A;  1J0G A;  3K9P B;  1R4M B;  1XD3 B;  1GC6 A;  3PTF C;  4MT5 A;  2CU1 A;  4J6I A;  2YEP B;  2MBE A;  5JHB A;  5BMI A;  4KGS A;  2BYE A;  1P7F A;  2XK5 A;  2EKE C;  4LJP B;  3RZF A;  2VRR B;  5IAA C;  2K22 A;  1A5R A;  1YIW A;  1EU3 A;  1GOZ A;  2LGX A;  4RGM A;  3KUD B;  1GTH A;  1L4D B;  4OZB A;  2M8S A;  3FKY A;  4ZRJ A;  2WXG A;  4W9F A;  2PVO D;  2KC1 A;  3PSE B;  1YX5 B;  4L2Y A;  1I4X A;  4DHJ B;  4MH8 A;  3PT2 B;  4OW0 A;  1KFY B;  2RR9 A;  2YEP F;  3UIP B;  3B08 A;  2MLB A;  3PV1 A;  3ZQ4 A;  3MC9 A;  4ANU A;  2HD5 B;  3JVZ X;  4BBN C;  2IGD A;  2Y3A A;  4FJY A;  2RSU A;  2WDV B;  5JXV A;  1VD2 A;  3L54 A;  4RM8 A;  2LXC A;  1KLG D;  2DYB A;  4NZL B;  1UGM A;  3N3K B;  1E90 A;  2AQ2 B;  5AEK B;  2AWT A;  3MP9 A;  1TBE A;  2G9H D;  3GB1 A;  2KTR B;  3R7R A;  3OJ3 A;  1EO6 A;  1EWY C;  1SIJ A;  3P63 A;  1SSN A;  2BS2 B;  1XLQ A;  2H88 B;  1D4B A;  4FAD A;  2R2Q A;  1D5M C;  1WGH A;  2WXM A;  4REZ A;  3KYD D;  4BOZ B;  2MQJ A;  1I7H A;  3BWU D;  2JY6 A;  2NTS A;  1BML C;  4MGY E;  5E6N A;  4MEM A;  4EE2 A;  1V86 A;  1QZE A;  3MJ5 A;  1OEY A;  1V1P B;  2KX0 A;  2PJH A;  2EMS A;  2AX5 A;  2L1A A;  1VCB A;  4M00 A;  4FUL A;  5EDS A;  1TZO A;  2RDH A;  1UUP A;  4KSK C;  4LNI A;  4DHJ D;  2FNJ B;  3ZJT A;  4W9J A;  2J52 A;  1TY2 A;  4S0R A;  4NAW A;  3AH7 A;  2WX1 A;  4LLG M;  2N7J A;  3RI7 C;  2IJ0 A;  3DVG Y;  4MGI E;  3EFC A;  4TKN A;  1IGD A;  4IWO A;  4KDL B;  3WAO A;  1PGA A;  1YMH E;  2AEH A;  4W9E A;  5IP4 D;  1I4P A;  1P98 A;  5E6J A;  1N62 A;  2LJ5 A;  2WQY B;  2WXF A;  3TEX A;  2MBH A;  3KUZ A;  4HLE A;  3W1S C;  1V80 A;  3PZD A;  2J4X A;  2JWU A;  1GTE A;  1WXQ A;  2KFK B;  1XCQ L;  2VZK B;  4G0N B;  2FAZ A;  2J0K A;  3KH0 A;  1WIA A;  1L6V A;  3H7P B;  3CIR B;  4N6E B;  3P2B A;  4H2A A;  1TT5 B;  3ZNI D;  3Q3O C;  4B0M A;  2L0F A;  2I38 A;  2KLC A;  3PHX B;  2JU6 X;  1ZDV A;  3V61 A;  1PFD A;  3MC8 A;  1MG4 A;  4LNN A;  1J7A A;  4LNF A;  4M01 A;  1N63 A;  3AE4 B;  3V05 A;  2KAJ A;  4FJZ A;  5EE1 A;  3HK0 A;  2W3S A;  1Z5S B;  1ENF A;  3VR9 B;  4LCD E;  2GOW A;  3Q8E A;  1FNV A;  2INP E;  3IVF A;  1N60 A;  2D2Q A;  3AV8 A;  2CS4 A;  1UNS A;  3URY A;  1WJU A;  4WJP A;  4FHJ A;  4RH6 A;  3R3M A;  2QEJ C;  1N6Z A;  1WJN A;  1T0S C;  4GDL B;  4WJN A;  2K8C A;  3QX1 A;  3U30 A;  1FM0 D;  1ZKH A;  2WXK A;  3H8H A;  3Q8F A;  2KN4 A;  2QDF A;  3ZYY X;  3ZDM C;  4XE0 A;  4HPL B;  4BFR A;  4LDT D;  1WX7 A;  1TS5 A;  2LUE A;  1LFD A;  3DQV A;  2CJO A;  3QWZ B;  3K9O B;  4C00 A;  1V5T A;  3RN9 C;  4ZRP A;  4YTP B;  1GB4 A;  2GBR A;  2INN E;  2DZM A;  3VQI A;  3EHV A;  3VTW A;  3Q3J A;  3W5U B;  2CR5 A;  2EMT A;  4K7U A;  5CHW A;  1V81 A;  2Y5B B;  1C4A A;  4W9L A;  3KUC B;  1Q0W B;  3DBH B;  1PUT A;  1TKG A;  2BQQ A;  2HJ1 A;  2J53 A;  2KZR A;  3EEC A;  4AP4 C;  3IHP C;  2BKF A;  4YWG G;  1C9F A;  3I57 A;  1F2R C;  3ZXV A;  2N9P C;  1Y8R C;  4FHK A;  4AJY B;  2DYO A;  1NEN B;  5G5G A;  1IPG A;  5DPW A;  2ZNV C;  2C7H A;  3DBH I;  4ICV A;  4R3D A;  1WYG A;  2Y5C A;  1D3Z A;  3BVZ A;  3A1Q A;  3NG0 A;  3MFG A;  3D32 A;  5H8Y E;  2GLS A;  2DLB A;  3CF6 E;  2M19 A;  5IOI A;  1STE A;  1ZPS A;  2MH7 A;  3SHQ A;  5IKC M;  1J7C A;  5TR5 A;  3HRD D;  1DYQ A;  1IBX B;  1UD7 A;  4KKJ A;  1WGD A;  1UBI A;  4JWS C;  2CU3 A;  3HHM A;  3N20 C;  4LK0 M;  2HJ8 A;  4DQO C;  4DWF A;  4WAA A;  2MBQ A;  3SFD B;  2IGH A;  1IGC A;  2RPV A;  3AEE B;  3E56 A;  2ACZ B;  3JYU A;  1FFU A;  3ABV B;  4XWW A;  4MGZ E;  1E7U A;  1WGY A;  1MG8 A;  2HDE A;  1L0V B;  3T3N A;  2G3Q B;  4K3B A;  2WNM A;  2KWV B;  2OJR A;  1C3T A;  3R8B A;  1FRD A;  2L3Z A;  1FPY A;  3P4P B;  2FCM A;  4GDK A;  2M0X A;  1WGK A;  4GB9 A;  2K8B A;  1FFV A;  1TTN A;  1SIF A;  3HVD A;  3NHE B;  4M0W B;  1K50 A;  1DOI A;  1VDV A;  1BT0 A;  2WWZ A;  2DHZ A;  2IPK D;  4QAY A;  2VH1 A;  4DDI D;  4JLC A;  1EF1 A;  3N30 A;  4M8M A;  2CHZ A;  3ECI A;  5D3D A;  4RF0 A;  4XGA B;  2DAJ A;  4LJO B;  3ZNZ B;  2X38 A;  3VR8 B;  1RRB A;  2M1M A;  3L10 B;  4FA6 A;  1JAL A;  2BWE S;  3A33 B;  1U4A A;  4M02 A;  3R7Q A;  4IM2 A;  3B2G A;  2EEL A;  2NS5 A;  1DGJ A;  3UIN B;  3BYY B;  2B3A A;  4ZHP A;  4WUR A;  2MWS B;  1XLO A;  3VDZ A;  1YX6 B;  2BBC A;  2M17 A;  3AMZ A;  2KAN A;  4OZA A;  3DVN U;  2NMQ A;  4EZJ A;  4JX1 C;  3L08 A;  1JML A;  2PE9 A;  1DOX A;  3QCA A;  2KWU B;  1QT9 A;  5CX3 A;  2WDQ B;  2TSS A;  3OLM D;  4L23 A;  4IC7 B;  2JXX A;  1JWB D;  4XC2 A;  4BBN F;  1I35 A;  2FCQ A;  2JX5 A;  3RFZ B;  1E8Z A;  3RUL A;  5HHD G;  3X0W A;  5C3J B;  3AN1 A;  2LZ6 A;  4BOS C;  4LTU A;  4FN2 A;  1AAR A;  5I4D A;  3N1Z C;  4XX5 A;  3VUX A;  3H9D A;  4JL9 A;  2QJL A;  2IO0 B;  2XNA C;  1WXM A;  3IBE A;  4F7Z A;  2K39 A;  1NYQ A;  1VZ7 A;  2FIF A;  2KOX A;  4F1S A;  3ZNG C;  2EKI A;  2GRI A;  3DHH C;  2R2O A;  3TEW A;  2O6V B;  1VJK A;  1PGX A;  2KDI A;  3H1U A;  4NAM A;  5CTR C;  4K7S A;  3LDZ E;  3KWL A;  2KYW A;  1T6B X;  2KTR A;  4HRS A;  5C1Z A;  3KQ4 A;  1I4G A;  1HEZ E;  4BKG A;  4PYU A;  3WIM A;  5J18 A;  4GSW A;  4EKU A;  2NBU A;  2LGS A;  3FIL B;  3WA0 A;  3TBL D;  3VVW B;  3I5J C;  2IO2 B;  1FMA D;  1WGG A;  4II3 B;  4N59 A;  4XZ4 A;  4BAX A;  2IY1 B;  4IG7 B;  2MX2 A;  1L7Y A;  5DPR A;  1I42 A;  2V0G A;  2D3C A;  1V1P A;  5AZF A;  2KDF B;  3NS8 A;  1YN3 A;  3P4S B;  1C4P A;  2WGS A;  4NQL B;  3BK2 A;  4DXA B;  3FAH A;  2MJ3 A;  1WY8 A;  4JE3 B;  2KN5 A;  3U4E G;  1WWT A;  3ZTD A;  2K5P A;  4W9K A;  5AUK A;  3WAN A;  2L05 A;  4KDI C;  4US8 A;  5JZE B;  5FR3 A;  1SE4 A;  4DHZ B;  3NZS A;  1KTK A;  3OAW A;  4HDO A;  1TIF A;  4OZC A;  3PVL A;  2W3R A;  4TQ0 A;  4RNA A;  4DHZ E;  1FXT B;  4URK A;  2O6V D;  4YSY B;  3ZTC A;  3ZJV A;  2SEB D;  4Q2J A;  4US9 A;  1JWM D;  3DWM A;  1SE9 A;  4PS7 A;  1FNU A;  1NBF C;  5FKA C;  2LFI A;  3RNE C;  2PIA A;  2J7Q B;  2W9N A;  1JCK B;  2JUO A;  1L5P A;  3B1L X;  2RPQ A;  4YXD B;  3M62 B;  3NRZ A;  1F77 A;  1XQQ A;  3APC A;  3RNG C;  4W9C A;  3E9S A;  3L4P A;  3SD5 A;  3HM6 X;  2KFK A;  2WXN A;  3NZ3 A;  2AL3 A;  3C0R B;  4MJS B;  2MJE A;  3ML8 A;  2AYO B;  5J2R A;  2KHW B;  4IW0 A;  4P7I A;  2N9E B;  4OVU A;  3H7P A;  1A70 A;  3PZ8 A;  4NY0 A;  1WM3 A;  3HIZ A;  2BS4 B;  3VUY A;  2NPT B;  3DVG X;  2D07 B;  1SF0 A;  3ZVV A;  3B0A A;  3NJT A;  3W2D A;  3M3J A;  4JGH B;  4II2 B;  1P1A A;  4ZRI A;  2KK8 A;  2V3P A;  4B9K A;  3ZNH B;  2LVQ A;  3Q8B A;  3PS6 A;  2OOB B;  2PEA A;  3WAL A;  4ITK A;  3VHT C;  1WX8 A;  2LGD A;  1TS4 A;  2KDB A;  2ZEQ A;  4NNJ B;  5HKH A;  1UBQ A;  4LNK A;  2KD0 A;  1CQV A;  1T0Y A;  1Y56 A;  2D3G A;  4RGN A;  2D3B A;  1YN5 A;  4K81 A;  4UDU C;  2ZNV B;  1XO3 A;  2M56 B;  4K3C A;  3QA8 A;  3J9C A;  5LNK 1;  4ASW C;  5H92 C;  1ET9 A;  2KDE B;  4D2K A;  4A55 A;  4GDL A;  1L4Z B;  2ZPY A;  1UWM A;  4TQ1 A;  1NYR A;  4PK1 A;  1EWC A;  1KM7 A;  4WH4 A;  1UH6 A;  2J42 A;  4BKT A;  1JRU A;  3TL5 A;  3UQA A;  2Y5P A;  2NBV B;  3A9K B;  1S3S G;  2KQS A;  1E9M A;  1WE7 A;  4I6L B;  4CHK A;  2N0S B;  4XWT A;  3AE5 B;  5DCN A;  3RYT A;  3EUB 2;  3M63 B;  3L13 A;  4W9G A;  4HPP A;  3DBL B;  2GMI C;  1C76 A;  1C78 A;  2WXI A;  2RD0 A;  5IA7 A;  1ISN A;  4FBJ B;  1L2N A;  3BYT B;  2GB1 A;  4AOF A;  3CSF A;  1CMX B;  2KQ7 A;  4RGT A;  2UWQ A;  4RM9 A;  4EZL A;  5CHF A;  1MFW A;  1GT8 A;  3GP7 A;  3DBL I;  4IM0 A;  4LDT B;  3NZU A;  3NOB A;  5EE3 A;  3TEZ A;  4DK5 A;  2CHX A;  3ZDT A;  4ARC A;  4DBG A;  4ZYS A;  1KLV A;  3V62 A;  4N58 A;  4HXD A;  1L6U A;  2JXT A;  2JRH A;  3LXF A;  2R61 A;  3R2T A;  3TUO A;  1TGZ B;  1R7S A;  2RGF A;  3NVV A;  4GGQ A;  1FRR A;  1V2Y A;  1ET6 A;  4F8C B;  1XF5 L;  3V6E B;  1QOB A;  4M8N A;  3NVZ A;  1TY0 A;  1WRD B;  5EE0 A;  1D5Z C;  1H7W A;  2DZJ A;  4AQ7 A;  3NVY A;  3AU5 A;  2FBW B;  3QAQ A;  3ZRC A;  1KF6 B;  1IBX A;  3ZKJ C;  1UGJ A;  2ZW0 A;  4HCP B;  4NJ7 A;  2E6X A;  4HJG E;  3O13 A;  4A3O A;  4P1C C;  1R4N B;  3APF A;  2DNF A;  1FXI A;  2KVR A;  5IO9 A;  4BKS A;  1GC7 A;  1YQ4 B;  4IDI A;  1D6E C;  2WXR A;  3UQB A;  1PQS A;  3CF4 A;  2CJN A;  1TKY A;  5T8I A;  1WFY A;  1TYG B;  2IDY A;  3Q8C A;  2B76 B;  3Q6B A;  2JWZ A;  4YL8 A;  5JH5 C;  3T3O A;  2KQ4 X;  2MA9 B;  1R4N I;  1WXS A;  1ZUD 2;  1VRA B;  1H8C A;  1MHH E;  3TEY A;  3KLS X;  1M94 A;  3PLU A;  2O2V B;  1TS3 A;  3W9C B;  1FXA A;  2KDM A;  1CJE A;  5J17 A;  3DVN V;  1C79 A;  3PRE A;  1MVK A;  1HQR D;  4M0W A;  2LI5 A;  2BYT A;  1K8R B;  2IO3 B;  1AW7 A;  4USA A;  1MPE A;  3DHG C;  5KHQ A;  1EM7 A;  3KVF B;  3NY5 A;  4OVV A;  1LO5 D;  2IGG A;  2L00 B;  4MGK E;  1SEB D;  1V5O A;  3RNF C;  4XDC A;  2K1F A;  2N9L A;  3ETR A;  1WGR A;  2HE7 A;  1GB1 A;  4N9F 4;  1F0Z A;  3OWE B;  1ZW7 A;  2W82 A;  3CST A;  1GAQ B;  4HPM B;  4KKI A;  4TUU A;  1OQR A;  1P7E A;  1N5X A;  3L16 A;  1V97 A;  4KIK B;  4ICU A;  2DZI A;  1FO4 A;  3GZN I;  2OHF A;  1KH0 A;  3KYC D;  1FCL A;  3GE3 C;  4NPN A;  3VH3 B;  3A9J B;  3FC4 A;  1JRP A;  3APD A;  5FR6 A;  4YTM B;  4WWP A;  2K6Q A;  5BMH A;  3ZLZ A;  3VXW A;  1X1M A;  1NEK B;  4IKG A;  1V6E A;  4W9I A;  3R2I A;  3V6C B;  2ICI A;  3VH4 B;  1WYW B;  2C9W B;  3BII D;  4DXG A;  5AZG A;  1JWA D;  4P6V F;  2HTM E;  2C7N B;  5HFY A;  3V60 A;  4YT0 B;  1K52 A;  3PHW B;  1D5X C;  3MHS D;  2MW5 A;  1E8Y A;  4TMA B;  2IO1 B;  1B9R A;  3B9J A;  4WWM A;  3AEA B;  4CQN A;  2O6V A;  3NVW A;  4HJK A;  1YJ1 A;  2WXO A;  1N5W A;  4P16 A;  3RZW C;  1BXT A;  2NBW B;  3JSV B;  1WH3 A;  2IYD B;  3AEB B;  2GBM A;  4AJW A;  2WXQ A;  2CHW A;  1EUV B;  1MI0 A;  2L7R A;  1E6E B;  2ZCB A;  3MJW A;  3FIL A;  2LWP A;  4I6P A;  2KAC A;  3CMM B;  3T8M A;  1J19 A;  1FIQ A;  2JZP A;  2MJD A;  2WDT B;  1QOA A;  4X57 B;  1XLP A;  1SB3 C;  4PS8 A;  1HA5 A;  1T0Q C;  2K6D B;  1CZP A;  2ASQ A;  1WI0 A;  3SEB A;  3N32 A;  2AL6 A;  3B2F A;  1IP9 A;  1GG3 A;  2DBY A;  3ZXR A;  2LMC A;  1WF9 A;  1G6J A;  2MP2 B;  1LQB A;  2W55 A;  4YSZ B;  3U7Z A;  4FLH A;  4HK2 A;  2K8H A;  1WXA A;  2RDB C;  3VFK A;  5LXH A;  4MSM B;  1GUA B;  3TIX A;  1WXV A;  1WZ3 A;  3P4Q B;  5EE9 A;  4A9A A;  1VLB A;  3RCZ A;  2KMA A;  3VRA B;  1TS2 A;  4HCN B;  3PRZ A;  2KMM A;  3U2S C;  2KWD A;  2WXL A;  2D3A A;  2KX3 A;  1OQQ A;  4C4V B;  3I9V 1;  4A6Q A;  2DX5 B;  1ZDX A;  3BK1 A;  3DWG C;  2PVG C;  3C8Y A;  1RFK A;  2L52 A;  1C4C A;  4AWJ A;  4YSX B;  1PGB A;  2LRW A;  2QIL A;  3W5V B;  1UZX B;  3Q3M C;  4YTN B;  1F52 A;  3C19 A;  3O65 B;  2MCN B;  1QOF A;  3BVM A;  4MJS A;  2REX A;  4G50 A;  2INC C;  4E71 A;  1HTO A;  4BZA A;  4EUT A;  4AS1 A;  4E3C A;  2A5U A;  4MM3 B;  4P1B C;  3LJ3 A;  3EC8 A;  2N9K A;  1YOV B;  2NPT A;  1AYF A;  3M95 A;  2V1Y A;  1LGR A;  2KVZ A;  1Q10 A;  4EOY A;  2ZCC A;  5HI1 A;  2C5L C;  2MRP A;  1NI2 A;  1ZXI A;  2YVC A;  3NUH B;  5L83 A;  2GI9 A;  2MEK A;  2NR2 A;  4IWQ A;  4WQO B;  2BYV E;  1ZE3 D;  3AEG B;  4ARI A;  1EU4 A;  1ZOY B;  2G1E A;  1P9D U;  3L0W B;  3HM3 A;  4PYZ A;  3BZD B;  1ZGU B;  1XLN A;  3ZO5 B;  3VAW A;  1SE3 A;  2M4N A;  1YQ3 B;  2N1V A;  3UI3 A;  2JZZ A;  1QQR A;  5G55 A;  1JQ4 A;  2AQ1 B;  2WX0 A;  5GXG B;  1MHX A;  3Q3N C;  3QHT A;  2HTH A;  3X23 A;  2K3U A;  1DOY A;  3ALB A;  3DOW A;  1WMH B;  4IOI E;  1JWS D;  1E0Z A;  3AB5 A;  1YJJ A;  1RWS A;  1WR1 A;  3A9K A;  3SR6 A;  1HTQ A;  2KKC A;  3TCA A;  4EEW A;  1KLU D;  1R4M I;  1L0X B;  3UF8 A;  2KLG A;  3MHZ A;  3TJP A;  2GBK A;  2K25 A;  1Q1O A;  3EFU A;  1QOG A;  3RD2 A;  1E8W A;  4HRO A;  4G3X B;  3AED B;  4B95 A;  1JW9 D;  3CWI A;  4TV3 A;  1VZ6 A;  3VRB B;  4OVZ A;  5KHO A;  1GNU A;  4FXC A;  3IT4 B;  2N7E A;  1E5W A;  1E7V A;  4KSL C;  2BGF A;  2G45 B;  4ZRQ A;  5E6O A;  2JRI B;  3EA6 A;  2M0A A;  2BYF A;  5LXI B;  4A90 A;  1V8C A;  4PT5 A;  4C80 A;  2FID A;  1NDD A;  1XXG A;  2PPH A;  4IWP A;  1J7B A;  2Z0D B;  2KC2 A;  3TSS A;  4JQW C;  1XCT L;  5AZH A;  5BYR A;  2WU2 B;  1E10 A;  2D10 A;  1ROE A;  5G5H A;  4GN1 A;  1YN4 A;  1FCC C;  5IN7 A;  1T5X D;  3QK0 A;  2KFJ A;  1SE2 A;  2BF8 B;  2BKR B;  3LB8 C;  2KNB A;  2ZZP B;  4O1N A;  5D2M B;  4NQK E;  1LM8 B;  2N7D A;  3IFW B;  4RCO A;  3DDC B;  3SU8 X;  1WJ6 A;  2MHJ A;  3PZ7 A;  1SGH A;  4B6W A;  1F2R I;  2XK5 B;  4ZHO A;  4DDG D;  1JWU D;  5JHA A;  2GBJ A;  3QC8 B;  2AQ3 B;  4HVB A;  5MPO A;  2KWC A;  4WJQ A;  1TZ1 A;  2DEN B;  3DCG A;  4E74 A;  4GXB A;  3AE3 B;  2Z59 B;  1QF6 A;  1SXT A;  2LHD A;  4PS3 A;  3IAM 1;  2LGI A;  3AE9 B;  5BYS A;  2QC8 A;  2WHI A;  3DPD A;  4MH0 E;  4WAF A;  2O2V A;  5G2N A;  1SJE D;  3Q3F A;  3WCQ A;  1UEL A;  2WP9 B;  1OGW A;  4XDD A;  1FD6 A;  1HE8 A;  3A4R A;  3DBS A;  3AE2 B;  2DAF A;  1E7P B;  2QHO A;  2WYQ A;  1HZ5 A;  4KGR A;  2KT7 A;  4MSQ B;  3QAR A;  2G4D B;  3T9L A;  1SJH D;  1V9J A;  3KW5 B;  2X8X X;  3GOE A;  1KOT A;  1RYJ A;  2BTE A;  3Q2A C;  3BY4 B;  1L0Y B;  2WDR B;  3AE7 B;  3P4R B;  3HVZ A;  2RMM A;  2Z8L A;  3AE6 B;  4I6N B;  1WJ4 A;  4ZRK A;  2C60 A;  4KV2 A;  3SFE B;  2L32 A;  1EF5 A;  2FCS A;  1ACC A;  5BO4 B;  2KMC A;  3AM9 A;  4K1R B;  3Q69 A;  2DZK A;  4KIK A;  2JYE A;  1I4Q A;  4HKZ E;  4C7Z A;  3ZIM A;  2LUM A;  1WX9 A;  4B0E A;  2L83 A;  1RM6 C;  3UGB B;  3A9J A;  3L17 A;  4JPS A;  2I1K A;  2BW2 A;  4S17 A;  2DWQ A;  1C77 A;  3IXS A;  3IG3 A;  4A20 A;  2N1W A;  2IBI B;  2PKO A;  2IND C;  4A3P A;  3ZW3 A;  5D94 A;  3WAM A;  4HKQ A;  2G4S A;  3U8Z A;  5GMV A;  1YNT E;  4J3O D;  2XBB C;  3N1Y C;  4GOC A; 
#chains in the Genus database with same CATH homology
 1D5X C;  3KQ4 A;  3MJ5 A;  1V1P B;  1I4G A;  4GLS C;  1TJE A;  1HEZ E;  4TMA B;  4NAW B;  1B9R A;  3B9J A;  2AX5 A;  1AWD A;  3AEA B;  2QMT A;  4WWM A;  4CQN A;  5D3I B;  3FIL B;  2L1A A;  1FMA D;  2LHE A;  3NVW A;  1TZO A;  4RF1 A;  2WXO A;  4N59 A;  1N5W A;  4P16 A;  1BXT A;  2RDH A;  1ZXH A;  1UUP A;  1V1O A;  3AEB B;  2VZK D;  1NI3 A;  3ZJT A;  1FNW A;  2J52 A;  1TY2 A;  2WXQ A;  1NVI D;  2V0G A;  2BB6 A;  1V1P A;  1MI0 A;  1K53 A;  1T3Q A;  1E6E B;  1YN3 A;  3AH7 A;  3P4S B;  1C4P A;  5FK9 C;  3BK2 A;  2RDG A;  4LLG M;  3FAH A;  2N7J A;  3FIL A;  2IJ0 A;  2MJ3 A;  2KAC A;  4JE3 B;  3U4E G;  1WWT A;  1FIQ A;  1IGD A;  2JZP A;  2MJD A;  4L1B A;  2V3N A;  1PGA A;  1YMH E;  2K5P A;  1QOA A;  5AUK A;  3V3X A;  1XLP A;  1AN8 A;  1I4P A;  1SB3 C;  4ZOH C;  5E6J A;  1HA5 A;  4US8 A;  1CZP A;  1N62 A;  5FR3 A;  3SEB A;  1SE4 A;  2WQY B;  3B2F A;  1H7X A;  3GS2 A;  2PMV A;  2WXF A;  3TEX A;  1KTK A;  4MAC A;  2DBY A;  4HEA 1;  2LMC A;  4OZC A;  2W55 A;  2W3R A;  3ZJU A;  4WIP A;  4YSZ B;  3U7Z A;  4TQ0 A;  4RNA A;  1GPX A;  1JRO A;  2ON8 A;  4YSY B;  2J4X A;  2JWU A;  3P42 A;  1GTE A;  3ZJV A;  2SEB D;  4Q2J A;  2FE8 A;  1WXQ A;  3AE8 B;  4US9 A;  1JWM D;  3DWM A;  2XN9 C;  3P4Q B;  1FNU A;  5EE9 A;  4A9A A;  5FKA C;  2LFI A;  1XCQ L;  1VLB A;  2PIA A;  2VZK B;  3VRA B;  2ZW1 A;  1TS2 A;  1L6V A;  3CIR B;  2KMM A;  4RGO S;  2PLP A;  4WQM A;  3U2S C;  1JCK B;  2KWD A;  1L5P A;  4YXD B;  2NTT A;  4N6E B;  2WXL A;  3NRZ A;  4H2A A;  1QLB B;  4A8X C;  2LJI A;  1F77 A;  1OQQ A;  3EGR A;  4B0M A;  3I9V 1;  4A6Q A;  2I38 A;  3U52 E;  1ZDX A;  3E9S A;  2JU6 X;  1ZDV A;  3BK1 A;  3L4P A;  3P1M A;  3DWG C;  2PVG C;  1PFD A;  2QSD A;  3C8Y A;  1B1Z A;  2WXN A;  1RFK A;  1OFF A;  3NZ3 A;  2L52 A;  1C4C A;  4YSX B;  4KX6 B;  1J7A A;  2MJE A;  1PGB A;  1N63 A;  3AE4 B;  3V05 A;  2QIL A;  3W5V B;  1A70 A;  2KAJ A;  3PZ8 A;  5EE1 A;  2W3S A;  3IAS 1;  1HZ6 A;  2BS4 B;  1I4H A;  1XEE A;  4YTN B;  1SF0 A;  2PW9 A;  2WXJ A;  1ENF A;  3VR9 B;  2I2Y A;  3W2D A;  1BUI C;  3Q8E A;  3LYY A;  1FNV A;  2INP E;  1QOF A;  2E3T A;  3BVM A;  2V3P A;  3AEF B;  1N60 A;  1TKE A;  5HG2 A;  3AV8 A;  3Q8B A;  4TSS A;  4RFB A;  4AS1 A;  1UNS A;  2DYM A;  4ITK A;  4NJC A;  3URY A;  4MM3 B;  2N9K A;  4RH6 A;  1ZP0 B;  1IUE A;  1AYF A;  1TS4 A;  2QEJ C;  4GDL B;  1KRH A;  1CQV A;  1Q10 A;  1FM0 D;  2WXK A;  2WXH A;  1Y56 A;  5HI1 A;  1ZXI A;  3H8H A;  1WSP A;  4RGN A;  4DXF A;  1YN5 A;  4UDU C;  3NUH B;  2GI9 A;  1PYW D;  2MEK A;  3Q8F A;  1XO3 A;  2M56 B;  2KN4 A;  3ZYY X;  1ZE3 D;  2JQR B;  2K9X A;  3AEG B;  4ARI A;  3J9C A;  4XE0 A;  1EU4 A;  5LNK 1;  1ZOY B;  5H92 C;  1ET9 A;  4D2K A;  2G1E A;  3W1S A;  1TS5 A;  4A55 A;  3BZD B;  2CJO A;  1L4Z B;  1UWM A;  4ZRP A;  1XLN A;  2SAK A;  4YTP B;  1GB4 A;  2OED A;  1FEH A;  2INN E;  4TQ1 A;  1NYR A;  4C56 C;  1EWC A;  1SE3 A;  4WH4 A;  3VQI A;  2J42 A;  5C2T B;  1YQ3 B;  3UI3 A;  1QQR A;  2Y5P A;  3W5U B;  3ZGZ A;  5BMG A;  1E9M A;  1JQ4 A;  4KGT A;  2N0S B;  2AQ1 B;  4XWT A;  5AUI A;  5GXG B;  3AE5 B;  1MHX A;  3AE1 B;  1C4A A;  2K3U A;  3EUB 2;  1DOY A;  1PUT A;  1C76 A;  1TKG A;  4IOI E;  5BYQ A;  1C78 A;  1JWS D;  2J53 A;  2WXI A;  1E0Z A;  1C9F A;  4YWG G;  2V4I B;  3I57 A;  1I4R A;  1F2R C;  3AB5 A;  1YJJ A;  1RWS A;  3SR6 A;  1UWX A;  3BYT B;  2DYO A;  2FUG 1;  2GB1 A;  1NEN B;  5G5G A;  4RGT A;  1KLU D;  3IT6 B;  1L0X B;  1GT8 A;  3GP7 A;  2WS3 B;  3MHZ A;  4R3D A;  1WYG A;  2Y5C A;  1QOG A;  2BS3 B;  3BVZ A;  3MFG A;  4HRO A;  2JYT A;  5EE3 A;  5D7G A;  1VZ8 A;  3TEZ A;  3AED B;  5H8Y E;  1JW9 D;  3N9Y C;  2DLB A;  1M4V A;  2M19 A;  4ARC A;  4ZYS A;  1STE A;  1ZPS A;  4N58 A;  2MH7 A;  3CWI A;  1L6U A;  2JXT A;  3LXF A;  1J7C A;  2R61 A;  3R2T A;  1VZ6 A;  3VRB B;  4OVZ A;  3TUO A;  3HRD D;  1DYQ A;  1K51 A;  2PTL A;  1R7S A;  4FXC A;  1IBX B;  3NVV A;  1QKZ A;  3IT4 B;  4KKJ A;  2K0P A;  1FRR A;  1ET6 A;  2ONQ A;  1XF5 L;  4JWS C;  1QOB A;  2CU3 A;  4LK0 M;  2W54 A;  3BVG A;  4JWU C;  4ZRQ A;  3NVZ A;  1TY0 A;  2JSV X;  3EA6 A;  4DQO C;  5EE0 A;  1D5Z C;  1N61 A;  1H7W A;  4AQ7 A;  2M0A A;  3NS1 A;  3NVY A;  3SFD B;  4A90 A;  2IGH A;  1IGC A;  2RPV A;  2FBW B;  4GDK B;  1V8C A;  1VR9 A;  4PT5 A;  3AEE B;  3E56 A;  4C80 A;  2ACZ B;  1KF6 B;  1IBX A;  1UGJ A;  1XXG A;  2WLB A;  2ZW0 A;  3RPF C;  1J7B A;  2BT6 A;  1FFU A;  2E6X A;  4HJG E;  3ABV B;  3O13 A;  4XWW A;  3TSS A;  1ESF A;  2HDE A;  1FXI A;  1L0V B;  3T3N A;  1YQ4 B;  1PDX A;  1XCT L;  2WNM A;  2WU5 B;  2H89 B;  5BYR A;  2WU2 B;  2Q5W D;  4IDI A;  2D5G A;  1FRD A;  3R8B A;  1E10 A;  3P4P B;  1HXY D;  1ROE A;  1D6E C;  5G5H A;  1CK1 A;  2WXR A;  2QIE B;  1YN4 A;  1FCC C;  3PO0 A;  3CF4 A;  1T5X D;  1TKY A;  1WGK A;  2CJN A;  5T8I A;  1SE2 A;  1TYG B;  4OHJ A;  1WRI A;  2IDY A;  1FFV A;  2B76 B;  3Q8C A;  4C7Y A;  3T3O A;  3LB8 C;  1YJI A;  4O1N A;  3HVD A;  2KQ4 X;  3HUI A;  1K50 A;  1DOI A;  1VDV A;  4RCO A;  3Q8A A;  5TSS A;  1ZUD 2;  3PZ7 A;  2IPK D;  1VRA B;  3MC0 B;  5D3D A;  2BB5 A;  2LEK A;  1QIL A;  1F2R I;  4RF0 A;  1MHH E;  3AEC B;  1SBB B;  3KLS X;  3TEY A;  2X38 A;  3VR8 B;  4ZHO A;  3W9C B;  1TS3 A;  1JWU D;  1FXA A;  2KDM A;  1JAL A;  2AQ3 B;  1CJE A;  3KWV A;  5MPO A;  2WXP A;  1C79 A;  1MVK A;  1HQR D;  4M0W A;  4MT5 A;  3AE3 B;  1QF6 A;  2BYT A;  1SXT A;  2LHD A;  2YEP B;  3IAM 1;  2LGI A;  3AE9 B;  1AW7 A;  3B2G A;  5BYS A;  2EEL A;  4USA A;  4KGS A;  5BMI A;  1MPE A;  1EM7 A;  1P7F A;  1DGJ A;  4WAF A;  3BYY B;  1LO5 D;  1SJE D;  3WCQ A;  2IGG A;  4ZHP A;  2K22 A;  2WP9 B;  4XDD A;  4WUR A;  1XLO A;  1FD6 A;  1SEB D;  1EU3 A;  2BBC A;  3AMZ A;  4XDC A;  1GOZ A;  2N9L A;  3AE2 B;  3ETR A;  4RGM A;  1GB1 A;  4OZA A;  1E7P B;  1F0Z A;  2NMQ A;  3OWE B;  1GTH A;  1HZ5 A;  1L4D B;  4KGR A;  4OZB A;  4JX1 C;  2W82 A;  1JML A;  1GAQ B;  4KKI A;  1SJH D;  1DOX A;  2WXG A;  1OQR A;  1P7E A;  1N5X A;  2PVO D;  1RYJ A;  2BTE A;  1V97 A;  1QT9 A;  4L2Y A;  1L0Y B;  2WDR B;  3AE7 B;  3P4R B;  3HVZ A;  2WDQ B;  2RMM A;  1I4X A;  2TSS A;  2Z8L A;  4MH8 A;  4L23 A;  3AE6 B;  1FO4 A;  4OW0 A;  2OHF A;  1KFY B;  1JWB D;  1KH0 A;  1FCL A;  2YEP F;  3SFE B;  2JX5 A;  3RFZ B;  2L32 A;  3FC4 A;  3ZQ4 A;  1JRP A;  1ACC A;  2IGD A;  2Y3A A;  5HHD G;  5C3J B;  3AN1 A;  2WDV B;  5JXV A;  4YTM B;  4LTU A;  1KLG D;  3AM9 A;  4NZL B;  5BMH A;  3Q69 A;  5I4D A;  2AQ2 B;  2JYE A;  1I4Q A;  3MP9 A;  4HKZ E;  4C7Z A;  1NEK B;  2G9H D;  4IKG A;  2LUM A;  2QJL A;  4B0E A;  3GB1 A;  2XNA C;  2L83 A;  3R2I A;  1RM6 C;  1EWY C;  1SIJ A;  2ICI A;  3P63 A;  1SSN A;  4JPS A;  2BS2 B;  2BW2 A;  1XLQ A;  2H88 B;  1NYQ A;  3BII D;  1D4B A;  1VZ7 A;  2DWQ A;  1C77 A;  3IXS A;  1D5M C;  4DXG A;  2WXM A;  2EKI A;  4REZ A;  2GRI A;  3TEW A;  1JWA D;  1I7H A;  1PGX A;  1VJK A;  2PKO A;  3BWU D;  4P6V F;  2HTM E;  1BML C;  2NTS A;  4NAM A;  4HKQ A;  3KWL A;  5HFY A;  1YNT E;  4YT0 B;  1T6B X;  4J3O D;  1K52 A;  4EE2 A;  4HRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...