3AE4C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae4C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae4C02
4YTMD 3AEDC 2G3AA 3AEGC 1NEKC 2H88D 3AECD 2H89D 2WDQC 3AEFD 1E7PC 1NENC 3AE2D 3AEBD 4YSXD 3P4SC 3AEED 2WDVD 3AE4C 3AE3C 2WU2D 3SFDC 3VRBC 1PV3A 4YSYD 1OW7A 3AE7D 3AE9C 2WDRC 1L0VD 3AEAD 1QLBC 1KFYC 2BS3C 1KFYD 3P4QD 4YSZD 3AEAC 1L0VC 4YTND 3CIRC 3P4PD 4KX6C 4YSYC 3AE3D 3AE4D 4YT0D 3AE5C 3AEEC 2B76D 3AEBC 4YSXC 3P4PC 3AE8C 3CIRD 3B71A 1KTMA 1ZOYD 4YSZC 2H88C 4YTPC 1NEKD 3AEDD 1OW6A 4YTPD 3AE1C 1ZOYC 3AE6C 3AE7C 3VR8D 3VRAD 1YQ3D 2ACZD 2WU2C 2BS4C 2WDVC 3VRAC 3P4RC 3SFED 4KX6D 3AE2C 2WDQD 3AE1D 2WU5C 3P4QC 3ABVC 1OW8A 4YTMC 2FBWC 2WQYC 2WDRD 3AE9D 3AE8D 4YXDD 2WP9D 2B76C 3AE5D 3SFDD 3VRBD 4YT0C 2WS3D 5C3JC 1ZP0C 3S9OA 1ZP0D 2WS3C 5C2TC 4YTNC 2WP9C 2H89C 3AECC 1KF6C 3ABVD 2WU5D 5C2TD 3VR9C 3P4SD 3SFEC 3P4RD 1K04A 3VR9D 5C3JD 2BS2C 1NEND 1YQ3C 2ACZC 3AEFC 3VR8C 4YXDC 3AE6D 3AEGD 1YQ4C 2WQYD 1K05A 2FBWD 1YQ4D 1KF6D
chains in the Genus database with same CATH superfamily
2D2CD 4YTMD 2BCCG 2VRSA 3AECD 5B66E 4Y99C 2AEMA 2FY8A 2YXQB 1GL2A 3H1HJ 2NZ2A 2P2UA 3RL0B 3CL3D 3FXEA 2HFED 2QJPC 1VQ6P 1L0VC 4YSZD 1IFDA 2OGUA 1SFCD 4WY4B 1HVVA 3A7OA 1KB9D 2B87B 4D6TG 3FX0A 4HJGH 3BCCD 1DD3A 1JM0A 4Y99B 2OTKE 3TNUB 1N73A 2ZYGA 3L70G 2XZRA 1L0ND 4W7ZA 2AXTH 2Q3IA 3UIAA 1NU1D 4H13C 3CX5E 3AE2C 3CCJP 1KQFB 3L74D 1KILD 5AW3B 3H1HG 4MN4C 5KLVG 1PGOA 1NKNA 3AE9D 1N73C 1LTJA 4YXWH 3MZWB 3P7KA 1S5LX 3P8MC 3CCRP 1KILB 3HE5A 2YMYA 4YTNC 1VQKP 3CWBG 1G1JA 2E43A 1VQNP 1NTMD 1SQXE 2Y0DA 2WPSA 1KZUB 1K04A 1BGYD 1YITP 4JBZA 3V2RA 4XE5B 1YQ4C 2WQYD 3CC2P 1KF6D 1KFMA 2KB7P 2A06G 3Q1MA 2QM7A 4YSXD 3OJAB 3AE3C 1AA0A 1X8YA 2KUBA 1JMBA 1GL2C 3G9RA 3IFMA 5GTHE 1RH5B 1YI2P 3TSIA 1TFFA 1JO5A 3CIRC 1IFNA 2KXPB 1YTZT 1Z56A 1L0LG 4WY4C 3JSVC 4YT0D 3MUDC 1AV1A 2D2CB 1USEA 3CCUP 4YSZC 4DDGA 1N8RQ 1KYOI 5GTIH 1FE6A 2WU2C 3CCMP 5AVRB 2W6JH 3SFED 2FFDC 5C39A 1KC8Q 1S3JA 3PRJA 3H1KD 1LWUC 3M9QA 2WDRD 3D6ZA 4KJMA 2WT7A 1MZ9A 3RBZA 1J1EB 3CX5I 3TK1A 1LP1A 3WU2H 2N9BA 1G1IA 4GT1A 2E42A 1AQ5A 1LWUB 1LWUA 3PTZA 2H7HA 2J59M 1T8ZA 2IX7C 3VR8C 5H2FE 1IK7A 3OAKA 4C7NA 2K1AA 5AW4B 4KHXA 3A0BH 2E74C 2WTYA 3S1KA 4AQRD 2BCCE 1L0VD 1M1JB 4DZOA 2YXRB 1NJIQ 1PP9E 2KNCA 3RBXA 3L70D 4EIJA 3GF3A 3HD7A 3AE5C 2JEEA 2OYHB 1X22A 4H0LB 3B71A 1MFTA 1QX8A 1U7JA 4YTPC 1NGMB 2WSFH 1JTHB 4GIFA 5CCHA 3HD7D 2W83C 1DIPA 4IFMA 1WMKA 2W6AA 3IAOA 2O01H 3P4RC 5TISH 2L91A 5CCHD 3M91A 1J2JB 3G3ZA 4N78D 3CXHH 3C8VA 4YXDD 2WITA 2Y9YA 3II6A 1GW4A 1JY2O 2WS3C 3OA7A 1BGYG 1NTZE 2H89C 2RH0A 1DD4A 2I8DA 1NU1J 2WU5D 3NFQA 3HRNA 1X9VA 1VQ7P 2IBZG 2A06E 4PD4H 1SVFA 3RK2B 4HH2A 1M1JA 4IFFA 1K9MQ 4I6MC 5KJ7D 2QJYC 3AEGC 3RK2D 1E7PC 5E79E 2WDVD 1BE3D 2WU2D 2A45H 3VRBC 1L4AA 2M5AB 1CZQA 3L75J 1URQC 2P10A 3VONA 1OWAA 3CCSP 1FDOA 1EZVD 1T3UA 1VF5C 1VPCA 2WSSH 1KTMA 2IZ0A 3OW2O 1JB0J 3R2PA 4BRYA 1SQQG 1OW6A 1QL2A 1URQA 1PIXA 1LTAC 2HODA 3V2QA 5KAFE 2Y9ZA 3GW6A 3L70J 2O1KA 2H43A 1OW8A 1L4AD 1BDCA 1DEBA 4I2LC 4NPDA 1H8AA 3GHGB 1KB9E 5KLVJ 2HG5D 3V5BA 3H32B 3CCQP 2Q7CA 3RK2C 2ZFCA 3V2NA 2KIKA 4BXLA 3ABVD 1VQ8P 2NPSB 2N1TC 1J1DC 1VQOP 1SQVK 1OVUA 3P4SD 3VR9D 5APQA 4A7PA 3AE6D 2C9NY 4RESB 1SQPJ 3I56P 4DHIB 4PJ0H 2YO3A 5CCGC 2GUSA 4DOJA 1JY3N 1NTKG 3NXSA 1SQVJ 5AW0B 1NAFA 2DW3A 2A06D 1LT1A 1EXJA 2KYVA 2ZXXA 1QLBC 4JQ0D 1JUNA 5E79H 1RF0C 4GODA 1BCCG 4L75A 4KX6C 1Q86Q 3T97B 1GTWA 3AE4D 5CJ0A 1S5LH 3A5TA 5GTIE 2KZJA 5TJHA 3P32A 2W8ZA 3HD7C 3K5BA 3USSA 4ZKPA 3V2PA 2AXTE 1H0TA 2SPZA 4H44B 1JY3P 1FZGA 5AW6B 1NTZK 3H1JJ 3VMYA 4PJ0E 4DDIA 2IYOA 2V4HA 3FGAD 1ZN5A 2YNYA 3L71J 1MV8A 1M8OB 1NVOA 4PD4E 1L0NK 4ASWA 1ZR2A 2C9LY 3SSUA 1SQBG 1NWQA 1VDFA 1D7MA 3HTKA 4I1LA 4IL6X 3NMDA 1NYHA 3P8CD 5BVZA 2N1TA 3TDKA 1N7LA 5K5GB 5C3JD 2C0WA 1YQ3C 1SLQA 5APXA 3A0BE 3GMAA 2BCCD 3IF4A 2FBWD 1WRGA 1KQGB 3EQ2A 5CBNA 1NKZB 2LR2A 3H25A 1QEXA 4GDOA 3L71E 1EC5A 5KLIB 1UIIA 1Q2NA 3U1AA 3RGUA 3W67A 1RE3A 4U3FD 3CCEP 4ZMDA 3AEAC 3FWLA 3HE4B 3BCCJ 3VMAA 1SQPE 3CX5H 1NTMJ 2KSEA 3P4PC 3H1LD 1L2PA 2IBZE 2ZFYA 1GU4A 4XFJA 1NTMK 3AE1C 3KDPB 1EDJA 3L75G 2W6BA 5KJ7C 3CD6P 1NTME 1SQXD 3L75D 1HBWA 1HJ0A 5B5EE 4L73A 1BGYE 2R5DA 3L37A 1HWTC 2R32A 4AYCA 2M3EA 1FJPA 2FFDB 2D2CC 1S1CX 4YTMC 3CC7P 1SQVE 2FYUE 1BCCJ 1H88A 3M0DC 3E1IA 3EWKA 2K9JA 1L0NE 1H0TB 1BSNA 2Q1KA 4UB6H 2PP6A 2K9YA 2WT7B 4WY4D 3S9OA 3WUVA 1LT9B 3CX5D 4YPCA 1ZMEC 2B89A 2QJKC 5AVZB 5CHXA 2HR3A 3L74E 2ZT9B 4WBAA 1NTKJ 3FWNA 2C0XA 2XDJA 1KYOE 1FC2C 3B5ND 2GUVA 2QA4P 1NTKE 3PP5A 1PP9J 4ZNCA 5KLIC 3Q5SA 5KLVK 2WDQC 2JKVA 1SS1A 3P8CE 3KZIE 1OMIA 2ITAA 1IFJA 2R3SA 4OH8B 1BCCE 3SFDC 4IFDK 2B9BA 2CPBA 1NTZD 1PGPA 2RMZA 1VL2A 1KFYD 1OVVA 3VP8A 1M90Q 2I1KA 4CPGA 3CIRD 1JTHA 2NRGA 1FZAA 4DT0A 2GA1A 1M1KQ 1ZOYC 2G8YA 1GL2D 5KJ7A 4EOTA 4PD4I 2PGDA 3KHUA 2WSCJ 4ZKUA 1DH3A 1SQBE 2FBWC 1HJBA 2WQYC 3M0DA 1VQMP 1EZVI 1N86A 3GG2A 1ZP0C 4LGDE 5KTBA 1GK4A 3V4QA 5AVYB 3D71A 1ZRTD 1QVGO 1P84E 2OYOA 2POHA 2JP3A 2FKWB 5KAFH 4AUWA 2WSEJ 3H1JG 2WSCH 3AEFC 1RF1C 2XNDH 1IO4A 1PL5A 5AVSB 2O3JA 3Q5PA 1USDA 3AE2D 2PAJA 1S4XA 3H1HE 2OYHA 2E76D 4PV1C 1NTKD 2Y0CA 3ZDMA 1PV3A 2KP8A 2WVRA 3KXDA 5BU5A 1R5SA 1RF1B 4M3LA 1RF1A 2LXCB 3TGUE 1RE3C 4N6JA 1NOHA 3AEEC 1VQ5P 2YMKA 3V4WA 4PV1B 2E75C 1HF9A 4Z1MH 2H8PD 4BRYB 3AE7C 4PD4D 2ACZD 2UWJE 1K8AQ 5AW2B 4LC1A 3F5HA 3JC22 1BE3J 1OFCX 2V7QJ 1QLED 1NTMG 2YKPA 3JCUE 1A02F 1M56D 1YJNP 3AE5D 5KAIH 1RQUA 4QMAA 2FXOA 1HTLC 3B5NB 1FZBA 2P67A 1W2EA 2Q5UA 1MFZA 1N7SB 5KKZC 3CXHE 3O6QB 5BU8B 1N7SC 3SWYA 1JY2P 3EFGA 5APSA 1OX3A 2ZJSE 2J58A 3L4FA 2ACZC 1YYCA 4YXDC 1JOCA 2KLVA 3JCUH 1H89A 4U3FE 3I55P 2H88D 1G2CB 4RO0A 3AEED 1M1JC 3VMZA 3CWBE 4YSYD 4UB6E 3NTNA 3Q3DA 1KN7A 1Y9BA 2M0BA 4H0LD 1PPJG 3H1IG 5APWA 4H44D 4WY4A 3LW5J 2E74B 1LTIC 3H1KG 1AVOA 1SQVD 3CC4P 3TGUJ 2QRXA 4LDTA 3CXHD 2L5GB 5H2FH 3B5NA 1BDDA 3MTUE 5B66H 4OGQD 2LXBA 1T2KD 1FS0E 1L0NJ 4H44C 1NU1G 2ZAEB 3L72G 5KLVD 2E76B 3L72D 1AFOA 5AVVB 3I5CA 1P84I 1HUCA 1GU5A 2B76C 3L73G 4OWFA 4ASVA 1SQPK 2QG4A 1ZP0D 3B5NC 2QJYB 3A0HH 1YHQP 1LTTC 3QH9A 2KK7A 4RKUJ 4UB8H 2HPCB 4KT0J 1JCCA 1NHLA 2FYNC 3N7NA 2IPPA 4OGQB 1RHZB 3P4RD 2QM8A 3BCCE 4OGQC 2AEFA 2N1TD 3HUSA 1ZV8A 1LP1B 1CI6B 5CMZA 3AEDC 3CXHI 1NENC 3H1KJ 2FYNB 2OYIC 2YIUC 3TGUG 4K3AA 4FJVA 2M5AA 1L4AB 3LW5H 1KYOH 3RL0C 1R5LA 2WDRC 1Y8AA 3MIWA 1SQQK 1CSBA 4K35A 4YTND 3SWFA 3P4PD 3MD0A 5DJTB 4YSYC 1FDIA 2LKMA 2AXCA 3IR9A 3PJSK 4H0LC 4O9BA 3VOPA 1NEKD 5DJUB 2YKQA 1URQB 1LTBC 1T3JA 1JMMA 1VF5B 3M06A 4TLFA 1FZEA 1N7SD 2P58A 1SQQD 2I1JA 3MP7B 2ZT9D 1N73B 1NTKK 3E7KA 3L70E 2JWAA 1SQXK 5C3JC 2WWWA 2NPSD 5C2TC 1M7LA 3ITKA 1SQXJ 3AECC 4JYBA 1KF6C 2V7QH 1KQLA 4HKZH 1BE3G 2NPSA 1IFMA 3R4YA 2WPRA 3PLNA 1A02J 1L0LE 5CCGA 3GF7A 1Q81Q 4EI2A 1KILA 3HE5B 1K73Q 3U59A 3CWBJ 3HTKB 1VQPP 3F89A 2A45G 1Y47A 1JY2N 4U7JA 3GLMA 4DCKA 2H89D 2XKMA 3MGNA 5L8RJ 3L75E 2AEJA 3H1IE 1IFIA 1FDMA 4U3FJ 1KV4A 3AE7D 1SQQE 1ZXGA 2OARA 1ZRTE 2KS1A 3H1KE 1SQVG 1OZHA 4EDFA 2JO1A 1AQTA 2PRRA 2YKOA 1L0NG 3BASA 2CK3H 2WPQA 1ZLLA 2ZYAA 3AE3D 3HD7B 2XV5A 1R8EA 5M1BA 4YSXC 1PGQA 5CJ4A 3AE8C 4OVNF 1ZOYD 3U1CA 5CCGD 1S9KE 5APVA 1EQ7A 4YTPD 4EYYQ 1LGHB 3KZIH 1NTZJ 1Q90D 3RK3E 1E5WA 2BS4C 1T2KC 3GHGC 4NPFX 1KMIZ 4W7YA 1SFCB 4GKGA 2BEZF 3ABVC 3C1LA 3LIDA 1U57A 1X0TA 2IDBA 3RL0D 1OIPA 2JWDA 2K3RA 3L35A 2A45I 1SP4A 3H1IJ 3TYYA 2WMMA 3VRBD 1LTJB 2QVAA 1HGVA 5GTHH 1HGZA 3D6YA 2HPCA 4DHJA 3N4XA 1PP9D 2K9JB 1GDTA 2NPSC 1PP9G 1YIJP 1LT9C 1GL2B 3G71P 2KS1B 2PFXA 3KQGA 1KILC 2KNCB 1NEKC 2IYPA 2B87A 1ZW0A 2QJPB 1LTGC 1KYOD 1WT6A 2K37A 3AE4C 1NH4A 1L0LD 1EXIA 1OW7A 3O8ZA 1ZR4A 1N2DC 1LJ2A 3P4QD 1YJ9P 2XU6A 1EZVG 1PPJD 2B76D 4IL6E 2OQQA 1VQ4P 3H1ID 5AW5B 1DX7A 2O01J 3BCCG 3MUDA 1LTSC 2ZYDA 1P84D 4RJTA 2XNXA 2Y0EA 2WDVC 3BRTB 3S4RA 2WDQD 2M3BA 2KLUA 2FFDA 1TU3F 4I7ZC 2WZ7A 5AVUB 1XTGB 4YT0C 2MKVA 3H1HD 1OXZA 4DJGA 4I6LA 1BE3E 2E74D 1KD1Q 3A2AA 2WP9C 3L73D 3CMAP 2IZ1A 2K88A 3BRVB 1JEKA 1L0LJ 2FXMA 1QGKB 5APUA 4GOEA 5TISE 3RL0g 4I7ZB 2QEXP 4LLHA 1S5LE 2FYZA 4Y28J 1FOSF 1FOSE 5KLVE 2QJKB 1SQPG 1SQPD 2KOGA 3KYQA 4B86A 2P7JA 3HUSB 1KFYC 3E1RA 4IL6H 1KB9I 1QL1A 3SWKA 1KFNA 5APYA 3VMXA 2E75B 3A3YB 3WU2E 4C7RA 2H88C 1U7MA 4JPZB 1LNQA 1FBMA 1IFPA 1YQ3D 3L71D 2Q9IA 4KX6D 2QIWA 1FZFA 1YJWP 2WU5C 1BGYJ 3V6IA 1QVFO 2Z5HA 2WS3D 2E76C 4PV1D 3CMEP 1JCDA 3H1LE 3RK3B 1J1EC 5AW7B 5KKZB 2YO2A 1G2CA 2QSIA 1IK9A 3VR9C 2BS2C 1NEND 2Z5IA 1LT9A 3AEGD 2FYUG 2QE7H 5EFWB 3WUUA 1CW5A 3QWOC 2HLOA 1PZQA 2FYUD 1RE4A 2CPSA 1N7SA 3H1JD 3AEFD 1FU1A 1AJYA 1GD2E 3O6QA 3AEBD 2P1JA 3P4SC 2KSJA 4GOFA 1S72P 1P84H 1GMJA 3G6EP 4JYCA 2BS3C 1L4AC 1KILE 3L72E 1PGJA 5AW8B 5CCHC 1RE4C 4H13D 3TF5A 1JNMA 3Q5RA 3A0HE 3PHLA 2IBZI 3PH0A 3L36A 1IZNB 4N78E 2O01N 1RQVA 2KZIA 5AVQB 2IFNA 5AVXB 3Q2YA 3CPWO 2BCCJ 2N9YB 5AVWB 1BCCD 1MKMA 4H13B 3L72J 3H6PA 2Q3EA 1GK6A 3H1JE 1PFIA 3B8EB 2R44A 2FYUJ 3SFDD 1RY3A 3G4SP 3H32A 1CI6A 3MHVA 2FYUK 1FZCC 4JF7A 4R4LA 1IC2A 1GW3A 1W2BO 4NPEA 3KPEA 5C2TD 2WSFJ 2RN0A 2MJZA 3H1LJ 1DEEG 2IBZD 4BWNA 4C7NB 1SQQJ 1HH0A 1FZCA 1EZVE 1GZLA 1FAVA 2BASA 2W90A 4XA4A 3L73J 1OVRA 1JY3O 1NU1K 1NTZG 3HUSC 1T6AA 2J5UA 1UIXA 3CLQA 4UB8E 2E75D 2OYIB 2GM4A 1BSHA 2RKLA 3AEBC 1RF0A 3L71G 4WWIA 2W27A 3TNUA 3CI9A 2HYNA 3WUTA 1X79B 3AE6C 4D6TE 4WB4A 1IJDB 4U3FG 4WVZA 3VRAD 3VRAC 1Q82Q 3B4SA 2ZXEB 3AE1D 3H1LG 3EFFK 3W68A 3M9BA 2FXPA 5CBOA 1PPJE 1YBKA 1SQXG 5AW1B 4R4MA 1NO4A 2ZT9C 5AW9B 1FZCB 5AVTB 2Q6QA 2IFMA 4IOIH 2YIUB 2N1TB 3VTPC 4DHZA 1EDLA 2ZVNB 1S2EA 3M0AA 3FXDA 3CWBD 4L76A 2OYIA 1EDIA 2G3AA 4D6TD 3T97A 1YTZI 1E79H 2R5BA 2OTLP 3CCLP 1AVYA 1SQBJ 1VF5D 2JDIH 3L73E 3AE9C 4TT3H 3AEAD 5APTA 3CCVP 1VQ9P 1URQD 2WSEH 3HE4A 1NU1E 1XTCC 3WMM0 4W80A 1EDKA 1SQBK 3L74G 1NAYA 3BATA 2OYHC 1KORA 1VQLP 3IN6A 2M8RA 3VYIA 3C9IA 3AEDD 3VP9A 3BVHA 1M57D 2WPVB 3VR8D 2HODB 2Z4EA 2BEQD 2KI7B 1SFCC 3P4QC 3VN0A 1FJKA 2E5YA 2O1JA 1J1DB 4C46A 1S9KD 5KAIE 1L0LK 5B5EH 3AE8D 1LTJC 2WP9D 3GHGA 3RK3D 2B88A 1Q7YQ 3RK3C 2JR8A 4N3YB 4D6TJ 1MUUA 1SFCA 1SQBD 1W5CE 4HYTB 2E5TA 3D70A 2ZVOB 1KQSO 3M9HA 3TGUD 2OTJP 2JJLA 3SFEC 3L74J 3LIEA 4L74A 1KB9H 2R3CA 1K05A 1YQ4D 4HB1A
chains in the Genus database with same CATH topology
2D2CD 4YTMD 3AEDC 2G3AA 3AEGC 3Q5PA 4U7JA 1NEKC 3GLMA 2H88D 3AECD 2H89D 2WDQC 3AEFD 3Q1MA 1AJYA 1E7PC 1NENC 3AE2D 5L8RJ 3H25A 3O6QA 3AEBD 4YSXD 2E74C 4GDOA 3AEED 3P4SC 2WDVD 1OMIA 3AE4C 3AE3C 2WU2D 2E76D 4PV1C 2YIUC 3SFDC 3VRBC 1PV3A 1EXIA 4YSYD 1GMJA 1EXJA 1VF5D 1OW7A 3AE7D 2J5UA 2NZ2A 3VRBD 3AE9C 3Q3DA 4TT3H 1UIXA 2WDRC 1L0VD 3AEAD 3G9RA 1ZRTE 1Y9BA 1QLBC 1KFYC 1VL2A 1KFYD 2P10A 2BS3C 1KILE 3P4QD 2E75D 2QJPC 3AEAC 4H0LD 1L0VC 4YSZD 1FDOA 4YTND 3CIRC 2JO1A 3P4PD 1VF5C 4H44D 4KX6C 4YSYC 4H13D 3T97B 3GF3A 3LW5J 1FDIA 3AE3D 3AE4D 1R8EA 4YT0D 3AE5C 3AEEC 2B76D 2OQQA 3Q5RA 5M1BA 1DD3A 2D2CB 2YMKA 3AEBC 3P4PC 2E74B 2E75B 3AE8C 4H0LB 3B71A 3CIRD 1KTMA 1KORA 1ZOYD 2O01J 3IN6A 4PV1B 2E75C 4H0LC 1JB0J 4XFJA 2H88C 4YSZC 4YTPC 1HF9A 4Z1MH 1NEKD 1NGMB 3AEDD 1OW6A 1RQVA 4YTPD 3AE1C 1DIPA 1ZOYC 2G8YA 3AE6C 3AE7C 4H44B 2WPVB 1WMKA 1Q90D 1PIXA 3VR8D 3Q2YA 3RK3E 4OGQD 1YQ3D 2ACZD 3VRAD 1HJ0A 2BS4C 2WU2C 3IAOA 2WDVC 3VRAC 4H13C 3P4RC 3SFED 4H44C 1VF5B 1MKMA 2BEQD 3FGAD 4KX6D 2QIWA 2WSCJ 3AE2C 1KMIZ 4H13B 2WDQD 3AE1D 2BEZF 2WU5C 3P4QC 2V7QJ 3ABVC 1OW8A 1S1CX 2D2CC 1KQFB 4YTMC 1TU3F 4I7ZC 2FBWC 3C8VA 2WQYC 3EWKA 1U57A 2E76B 2IDBA 2WDRD 2ZT9D 3AE9D 3AE8D 4YXDD 3D6ZA 2B76C 2WP9D 2K9YA 1RQUA 3AE5D 2WS3D 4YT0C 2MKVA 2E76C 4PV1D 3SFDD 2FXPA 5C3JC 1ZP0C 3S9OA 2E74D 1ZP0D 1S5LX 2WS3C 5C2TC 3D6YA 4R4MA 2WP9C 4YTNC 1ZMEC 3D71A 2H89C 3AECC 2QJKC 4R4LA 2ZT9C 1KF6C 4IL6X 1DD4A 2ZT9B 4RKUJ 5KKZC 4KT0J 2FYNC 3ABVD 1NYHA 2QSIA 2WU5D 3D70A 3RL0g 2JP3A 4I7ZB 4OGQB 5C2TD 2WSFJ 2WSEJ 3R4YA 3VR9C 3P4SD 3SFEC 3P4RD 1K04A 3VR9D 5C3JD 2BS2C 1NEND 1YQ3C 4OGQC 2ACZC 4YSXC 3AEFC 3GMAA 3VR8C 4YXDC 3GF7A 1YQ4D 5KLIC 3AEGD 1IK7A 3AE6D 1YQ4C 2QJYC 1K05A 4Y28J 2FBWD 2WQYD 1KQGB 3Q5SA 1PL5A 1KF6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTM D;  3AED C;  2G3A A;  3AEG C;  1NEK C;  2H88 D;  3AEC D;  2H89 D;  2WDQ C;  3AEF D;  1E7P C;  1NEN C;  3AE2 D;  3AEB D;  4YSX D;  3P4S C;  3AEE D;  2WDV D;  3AE4 C;  3AE3 C;  2WU2 D;  3SFD C;  3VRB C;  1PV3 A;  4YSY D;  1OW7 A;  3AE7 D;  3AE9 C;  2WDR C;  1L0V D;  3AEA D;  1QLB C;  1KFY C;  2BS3 C;  1KFY D;  3P4Q D;  4YSZ D;  3AEA C;  1L0V C;  4YTN D;  3CIR C;  3P4P D;  4KX6 C;  4YSY C;  3AE3 D;  3AE4 D;  4YT0 D;  3AE5 C;  3AEE C;  2B76 D;  3AEB C;  4YSX C;  3P4P C;  3AE8 C;  3CIR D;  3B71 A;  1KTM A;  1ZOY D;  4YSZ C;  2H88 C;  4YTP C;  1NEK D;  3AED D;  1OW6 A;  4YTP D;  3AE1 C;  1ZOY C;  3AE6 C;  3AE7 C;  3VR8 D;  3VRA D;  1YQ3 D;  2ACZ D;  2WU2 C;  2BS4 C;  2WDV C;  3VRA C;  3P4R C;  3SFE D;  4KX6 D;  3AE2 C;  2WDQ D;  3AE1 D;  2WU5 C;  3P4Q C;  3ABV C;  1OW8 A;  4YTM C;  2FBW C;  2WQY C;  2WDR D;  3AE9 D;  3AE8 D;  4YXD D;  2WP9 D;  2B76 C;  3AE5 D;  3SFD D;  3VRB D;  4YT0 C;  2WS3 D;  5C3J C;  1ZP0 C;  3S9O A;  1ZP0 D;  2WS3 C;  5C2T C;  4YTN C;  2WP9 C;  2H89 C;  3AEC C;  1KF6 C;  3ABV D;  2WU5 D;  5C2T D;  3VR9 C;  3P4S D;  3SFE C;  3P4R D;  1K04 A;  3VR9 D;  5C3J D;  2BS2 C;  1NEN D;  1YQ3 C;  2ACZ C;  3AEF C;  3VR8 C;  4YXD C;  3AE6 D;  3AEG D;  1YQ4 C;  2WQY D;  1K05 A;  2FBW D;  1YQ4 D;  1KF6 D; 
#chains in the Genus database with same CATH topology
 2D2C D;  4YTM D;  2BCC G;  2VRS A;  3AEC D;  5B66 E;  4Y99 C;  2AEM A;  2FY8 A;  2YXQ B;  1GL2 A;  3H1H J;  2NZ2 A;  2P2U A;  3RL0 B;  3CL3 D;  3FXE A;  2HFE D;  2QJP C;  1VQ6 P;  1L0V C;  4YSZ D;  1IFD A;  2OGU A;  1SFC D;  4WY4 B;  1HVV A;  3A7O A;  1KB9 D;  2B87 B;  4D6T G;  3FX0 A;  4HJG H;  3BCC D;  1DD3 A;  1JM0 A;  4Y99 B;  2OTK E;  3TNU B;  1N73 A;  2ZYG A;  3L70 G;  2XZR A;  1L0N D;  4W7Z A;  2AXT H;  2Q3I A;  3UIA A;  1NU1 D;  4H13 C;  3CX5 E;  3AE2 C;  3CCJ P;  1KQF B;  3L74 D;  1KIL D;  5AW3 B;  3H1H G;  4MN4 C;  5KLV G;  1PGO A;  1NKN A;  3AE9 D;  1N73 C;  1LTJ A;  4YXW H;  3MZW B;  3P7K A;  1S5L X;  3P8M C;  3CCR P;  1KIL B;  3HE5 A;  2YMY A;  4YTN C;  1VQK P;  3CWB G;  1G1J A;  2E43 A;  1VQN P;  1NTM D;  1SQX E;  2Y0D A;  2WPS A;  1KZU B;  1K04 A;  1BGY D;  1YIT P;  4JBZ A;  3V2R A;  4XE5 B;  1YQ4 C;  2WQY D;  3CC2 P;  1KF6 D;  1KFM A;  2KB7 P;  2A06 G;  3Q1M A;  2QM7 A;  4YSX D;  3OJA B;  3AE3 C;  1AA0 A;  1X8Y A;  2KUB A;  1JMB A;  1GL2 C;  3G9R A;  3IFM A;  5GTH E;  1RH5 B;  1YI2 P;  3TSI A;  1TFF A;  1JO5 A;  3CIR C;  1IFN A;  2KXP B;  1YTZ T;  1Z56 A;  1L0L G;  4WY4 C;  3JSV C;  4YT0 D;  3MUD C;  1AV1 A;  2D2C B;  1USE A;  3CCU P;  4YSZ C;  4DDG A;  1N8R Q;  1KYO I;  5GTI H;  1FE6 A;  2WU2 C;  3CCM P;  5AVR B;  2W6J H;  3SFE D;  2FFD C;  5C39 A;  1KC8 Q;  1S3J A;  3PRJ A;  3H1K D;  1LWU C;  3M9Q A;  2WDR D;  3D6Z A;  4KJM A;  2WT7 A;  1MZ9 A;  3RBZ A;  1J1E B;  3CX5 I;  3TK1 A;  1LP1 A;  3WU2 H;  2N9B A;  1G1I A;  4GT1 A;  2E42 A;  1AQ5 A;  1LWU B;  1LWU A;  3PTZ A;  2H7H A;  2J59 M;  1T8Z A;  2IX7 C;  3VR8 C;  5H2F E;  1IK7 A;  3OAK A;  4C7N A;  2K1A A;  5AW4 B;  4KHX A;  3A0B H;  2E74 C;  2WTY A;  3S1K A;  4AQR D;  2BCC E;  1L0V D;  1M1J B;  4DZO A;  2YXR B;  1NJI Q;  1PP9 E;  2KNC A;  3RBX A;  3L70 D;  4EIJ A;  3GF3 A;  3HD7 A;  3AE5 C;  2JEE A;  2OYH B;  1X22 A;  4H0L B;  3B71 A;  1MFT A;  1QX8 A;  1U7J A;  4YTP C;  1NGM B;  2WSF H;  1JTH B;  4GIF A;  5CCH A;  3HD7 D;  2W83 C;  1DIP A;  4IFM A;  1WMK A;  2W6A A;  3IAO A;  2O01 H;  3P4R C;  5TIS H;  2L91 A;  5CCH D;  3M91 A;  1J2J B;  3G3Z A;  4N78 D;  3CXH H;  3C8V A;  4YXD D;  2WIT A;  2Y9Y A;  3II6 A;  1GW4 A;  1JY2 O;  2WS3 C;  3OA7 A;  1BGY G;  1NTZ E;  2H89 C;  2RH0 A;  1DD4 A;  2I8D A;  1NU1 J;  2WU5 D;  3NFQ A;  3HRN A;  1X9V A;  1VQ7 P;  2IBZ G;  2A06 E;  4PD4 H;  1SVF A;  3RK2 B;  4HH2 A;  1M1J A;  4IFF A;  1K9M Q;  4I6M C;  5KJ7 D;  2QJY C;  3AEG C;  3RK2 D;  1E7P C;  5E79 E;  2WDV D;  1BE3 D;  2WU2 D;  2A45 H;  3VRB C;  1L4A A;  2M5A B;  1CZQ A;  3L75 J;  1URQ C;  2P10 A;  3VON A;  1OWA A;  3CCS P;  1FDO A;  1EZV D;  1T3U A;  1VF5 C;  1VPC A;  2WSS H;  1KTM A;  2IZ0 A;  3OW2 O;  1JB0 J;  3R2P A;  4BRY A;  1SQQ G;  1OW6 A;  1QL2 A;  1URQ A;  1PIX A;  1LTA C;  2HOD A;  3V2Q A;  5KAF E;  2Y9Z A;  3GW6 A;  3L70 J;  2O1K A;  2H43 A;  1OW8 A;  1L4A D;  1BDC A;  1DEB A;  4I2L C;  4NPD A;  1H8A A;  3GHG B;  1KB9 E;  5KLV J;  2HG5 D;  3V5B A;  3H32 B;  3CCQ P;  2Q7C A;  3RK2 C;  2ZFC A;  3V2N A;  2KIK A;  4BXL A;  3ABV D;  1VQ8 P;  2NPS B;  2N1T C;  1J1D C;  1VQO P;  1SQV K;  1OVU A;  3P4S D;  3VR9 D;  5APQ A;  4A7P A;  3AE6 D;  2C9N Y;  4RES B;  1SQP J;  3I56 P;  4DHI B;  4PJ0 H;  2YO3 A;  5CCG C;  2GUS A;  4DOJ A;  1JY3 N;  1NTK G;  3NXS A;  1SQV J;  5AW0 B;  1NAF A;  2DW3 A;  2A06 D;  1LT1 A;  1EXJ A;  2KYV A;  2ZXX A;  1QLB C;  4JQ0 D;  1JUN A;  5E79 H;  1RF0 C;  4GOD A;  1BCC G;  4L75 A;  4KX6 C;  1Q86 Q;  3T97 B;  1GTW A;  3AE4 D;  5CJ0 A;  1S5L H;  3A5T A;  5GTI E;  2KZJ A;  5TJH A;  3P32 A;  2W8Z A;  3HD7 C;  3K5B A;  3USS A;  4ZKP A;  3V2P A;  2AXT E;  1H0T A;  2SPZ A;  4H44 B;  1JY3 P;  1FZG A;  5AW6 B;  1NTZ K;  3H1J J;  3VMY A;  4PJ0 E;  4DDI A;  2IYO A;  2V4H A;  3FGA D;  1ZN5 A;  2YNY A;  3L71 J;  1MV8 A;  1M8O B;  1NVO A;  4PD4 E;  1L0N K;  4ASW A;  1ZR2 A;  2C9L Y;  3SSU A;  1SQB G;  1NWQ A;  1VDF A;  1D7M A;  3HTK A;  4I1L A;  4IL6 X;  3NMD A;  1NYH A;  3P8C D;  5BVZ A;  2N1T A;  3TDK A;  1N7L A;  5K5G B;  5C3J D;  2C0W A;  1YQ3 C;  1SLQ A;  5APX A;  3A0B E;  3GMA A;  2BCC D;  3IF4 A;  2FBW D;  1WRG A;  1KQG B;  3EQ2 A;  5CBN A;  1NKZ B;  2LR2 A;  3H25 A;  1QEX A;  4GDO A;  3L71 E;  1EC5 A;  5KLI B;  1UII A;  1Q2N A;  3U1A A;  3RGU A;  3W67 A;  1RE3 A;  4U3F D;  3CCE P;  4ZMD A;  3AEA C;  3FWL A;  3HE4 B;  3BCC J;  3VMA A;  1SQP E;  3CX5 H;  1NTM J;  2KSE A;  3P4P C;  3H1L D;  1L2P A;  2IBZ E;  2ZFY A;  1GU4 A;  4XFJ A;  1NTM K;  3AE1 C;  3KDP B;  1EDJ A;  3L75 G;  2W6B A;  5KJ7 C;  3CD6 P;  1NTM E;  1SQX D;  3L75 D;  1HBW A;  1HJ0 A;  5B5E E;  4L73 A;  1BGY E;  2R5D A;  3L37 A;  1HWT C;  2R32 A;  4AYC A;  2M3E A;  1FJP A;  2FFD B;  2D2C C;  1S1C X;  4YTM C;  3CC7 P;  1SQV E;  2FYU E;  1BCC J;  1H88 A;  3M0D C;  3E1I A;  3EWK A;  2K9J A;  1L0N E;  1H0T B;  1BSN A;  2Q1K A;  4UB6 H;  2PP6 A;  2K9Y A;  2WT7 B;  4WY4 D;  3S9O A;  3WUV A;  1LT9 B;  3CX5 D;  4YPC A;  1ZME C;  2B89 A;  2QJK C;  5AVZ B;  5CHX A;  2HR3 A;  3L74 E;  2ZT9 B;  4WBA A;  1NTK J;  3FWN A;  2C0X A;  2XDJ A;  1KYO E;  1FC2 C;  3B5N D;  2GUV A;  2QA4 P;  1NTK E;  3PP5 A;  1PP9 J;  4ZNC A;  5KLI C;  3Q5S A;  5KLV K;  2WDQ C;  2JKV A;  1SS1 A;  3P8C E;  3KZI E;  1OMI A;  2ITA A;  1IFJ A;  2R3S A;  4OH8 B;  1BCC E;  3SFD C;  4IFD K;  2B9B A;  2CPB A;  1NTZ D;  1PGP A;  2RMZ A;  1VL2 A;  1KFY D;  1OVV A;  3VP8 A;  1M90 Q;  2I1K A;  4CPG A;  3CIR D;  1JTH A;  2NRG A;  1FZA A;  4DT0 A;  2GA1 A;  1M1K Q;  1ZOY C;  2G8Y A;  1GL2 D;  5KJ7 A;  4EOT A;  4PD4 I;  2PGD A;  3KHU A;  2WSC J;  4ZKU A;  1DH3 A;  1SQB E;  2FBW C;  1HJB A;  2WQY C;  3M0D A;  1VQM P;  1EZV I;  1N86 A;  3GG2 A;  1ZP0 C;  4LGD E;  5KTB A;  1GK4 A;  3V4Q A;  5AVY B;  3D71 A;  1ZRT D;  1QVG O;  1P84 E;  2OYO A;  2POH A;  2JP3 A;  2FKW B;  5KAF H;  4AUW A;  2WSE J;  3H1J G;  2WSC H;  3AEF C;  1RF1 C;  2XND H;  1IO4 A;  1PL5 A;  5AVS B;  2O3J A;  3Q5P A;  1USD A;  3AE2 D;  2PAJ A;  1S4X A;  3H1H E;  2OYH A;  2E76 D;  4PV1 C;  1NTK D;  2Y0C A;  3ZDM A;  1PV3 A;  2KP8 A;  2WVR A;  3KXD A;  5BU5 A;  1R5S A;  1RF1 B;  4M3L A;  1RF1 A;  2LXC B;  3TGU E;  1RE3 C;  4N6J A;  1NOH A;  3AEE C;  1VQ5 P;  2YMK A;  3V4W A;  4PV1 B;  2E75 C;  1HF9 A;  4Z1M H;  2H8P D;  4BRY B;  3AE7 C;  4PD4 D;  2ACZ D;  2UWJ E;  1K8A Q;  5AW2 B;  4LC1 A;  3F5H A;  3JC2 2;  1BE3 J;  1OFC X;  2V7Q J;  1QLE D;  1NTM G;  2YKP A;  3JCU E;  1A02 F;  1M56 D;  1YJN P;  3AE5 D;  5KAI H;  1RQU A;  4QMA A;  2FXO A;  1HTL C;  3B5N B;  1FZB A;  2P67 A;  1W2E A;  2Q5U A;  1MFZ A;  1N7S B;  5KKZ C;  3CXH E;  3O6Q B;  5BU8 B;  1N7S C;  3SWY A;  1JY2 P;  3EFG A;  5APS A;  1OX3 A;  2ZJS E;  2J58 A;  3L4F A;  2ACZ C;  1YYC A;  4YXD C;  1JOC A;  2KLV A;  3JCU H;  1H89 A;  4U3F E;  3I55 P;  2H88 D;  1G2C B;  4RO0 A;  3AEE D;  1M1J C;  3VMZ A;  3CWB E;  4YSY D;  4UB6 E;  3NTN A;  3Q3D A;  1KN7 A;  1Y9B A;  2M0B A;  4H0L D;  1PPJ G;  3H1I G;  5APW A;  4H44 D;  4WY4 A;  3LW5 J;  2E74 B;  1LTI C;  3H1K G;  1AVO A;  1SQV D;  3CC4 P;  3TGU J;  2QRX A;  4LDT A;  3CXH D;  2L5G B;  5H2F H;  3B5N A;  1BDD A;  3MTU E;  5B66 H;  4OGQ D;  2LXB A;  1T2K D;  1FS0 E;  1L0N J;  4H44 C;  1NU1 G;  2ZAE B;  3L72 G;  5KLV D;  2E76 B;  3L72 D;  1AFO A;  5AVV B;  3I5C A;  1P84 I;  1HUC A;  1GU5 A;  2B76 C;  3L73 G;  4OWF A;  4ASV A;  1SQP K;  2QG4 A;  1ZP0 D;  3B5N C;  2QJY B;  3A0H H;  1YHQ P;  1LTT C;  3QH9 A;  2KK7 A;  4RKU J;  4UB8 H;  2HPC B;  4KT0 J;  1JCC A;  1NHL A;  2FYN C;  3N7N A;  2IPP A;  4OGQ B;  1RHZ B;  3P4R D;  2QM8 A;  3BCC E;  4OGQ C;  2AEF A;  2N1T D;  3HUS A;  1ZV8 A;  1LP1 B;  1CI6 B;  5CMZ A;  3AED C;  3CXH I;  1NEN C;  3H1K J;  2FYN B;  2OYI C;  2YIU C;  3TGU G;  4K3A A;  4FJV A;  2M5A A;  1L4A B;  3LW5 H;  1KYO H;  3RL0 C;  1R5L A;  2WDR C;  1Y8A A;  3MIW A;  1SQQ K;  1CSB A;  4K35 A;  4YTN D;  3SWF A;  3P4P D;  3MD0 A;  5DJT B;  4YSY C;  1FDI A;  2LKM A;  2AXC A;  3IR9 A;  3PJS K;  4H0L C;  4O9B A;  3VOP A;  1NEK D;  5DJU B;  2YKQ A;  1URQ B;  1LTB C;  1T3J A;  1JMM A;  1VF5 B;  3M06 A;  4TLF A;  1FZE A;  1N7S D;  2P58 A;  1SQQ D;  2I1J A;  3MP7 B;  2ZT9 D;  1N73 B;  1NTK K;  3E7K A;  3L70 E;  2JWA A;  1SQX K;  5C3J C;  2WWW A;  2NPS D;  5C2T C;  1M7L A;  3ITK A;  1SQX J;  3AEC C;  4JYB A;  1KF6 C;  2V7Q H;  1KQL A;  4HKZ H;  1BE3 G;  2NPS A;  1IFM A;  3R4Y A;  2WPR A;  3PLN A;  1A02 J;  1L0L E;  5CCG A;  3GF7 A;  1Q81 Q;  4EI2 A;  1KIL A;  3HE5 B;  1K73 Q;  3U59 A;  3CWB J;  3HTK B;  1VQP P;  3F89 A;  2A45 G;  1Y47 A;  1JY2 N;  4U7J A;  3GLM A;  4DCK A;  2H89 D;  2XKM A;  3MGN A;  5L8R J;  3L75 E;  2AEJ A;  3H1I E;  1IFI A;  1FDM A;  4U3F J;  1KV4 A;  3AE7 D;  1SQQ E;  1ZXG A;  2OAR A;  1ZRT E;  2KS1 A;  3H1K E;  1SQV G;  1OZH A;  4EDF A;  2JO1 A;  1AQT A;  2PRR A;  2YKO A;  1L0N G;  3BAS A;  2CK3 H;  2WPQ A;  1ZLL A;  2ZYA A;  3AE3 D;  3HD7 B;  2XV5 A;  1R8E A;  5M1B A;  4YSX C;  1PGQ A;  5CJ4 A;  3AE8 C;  4OVN F;  1ZOY D;  3U1C A;  5CCG D;  1S9K E;  5APV A;  1EQ7 A;  4YTP D;  4EYY Q;  1LGH B;  3KZI H;  1NTZ J;  1Q90 D;  3RK3 E;  1E5W A;  2BS4 C;  1T2K C;  3GHG C;  4NPF X;  1KMI Z;  4W7Y A;  1SFC B;  4GKG A;  2BEZ F;  3ABV C;  3C1L A;  3LID A;  1U57 A;  1X0T A;  2IDB A;  3RL0 D;  1OIP A;  2JWD A;  2K3R A;  3L35 A;  2A45 I;  1SP4 A;  3H1I J;  3TYY A;  2WMM A;  3VRB D;  1LTJ B;  2QVA A;  1HGV A;  5GTH H;  1HGZ A;  3D6Y A;  2HPC A;  4DHJ A;  3N4X A;  1PP9 D;  2K9J B;  1GDT A;  2NPS C;  1PP9 G;  1YIJ P;  1LT9 C;  1GL2 B;  3G71 P;  2KS1 B;  2PFX A;  3KQG A;  1KIL C;  2KNC B;  1NEK C;  2IYP A;  2B87 A;  1ZW0 A;  2QJP B;  1LTG C;  1KYO D;  1WT6 A;  2K37 A;  3AE4 C;  1NH4 A;  1L0L D;  1EXI A;  1OW7 A;  3O8Z A;  1ZR4 A;  1N2D C;  1LJ2 A;  3P4Q D;  1YJ9 P;  2XU6 A;  1EZV G;  1PPJ D;  2B76 D;  4IL6 E;  2OQQ A;  1VQ4 P;  3H1I D;  5AW5 B;  1DX7 A;  2O01 J;  3BCC G;  3MUD A;  1LTS C;  2ZYD A;  1P84 D;  4RJT A;  2XNX A;  2Y0E A;  2WDV C;  3BRT B;  3S4R A;  2WDQ D;  2M3B A;  2KLU A;  2FFD A;  1TU3 F;  4I7Z C;  2WZ7 A;  5AVU B;  1XTG B;  4YT0 C;  2MKV A;  3H1H D;  1OXZ A;  4DJG A;  4I6L A;  1BE3 E;  2E74 D;  1KD1 Q;  3A2A A;  2WP9 C;  3L73 D;  3CMA P;  2IZ1 A;  2K88 A;  3BRV B;  1JEK A;  1L0L J;  2FXM A;  1QGK B;  5APU A;  4GOE A;  5TIS E;  3RL0 g;  4I7Z B;  2QEX P;  4LLH A;  1S5L E;  2FYZ A;  4Y28 J;  1FOS F;  1FOS E;  5KLV E;  2QJK B;  1SQP G;  1SQP D;  2KOG A;  3KYQ A;  4B86 A;  2P7J A;  3HUS B;  1KFY C;  3E1R A;  4IL6 H;  1KB9 I;  1QL1 A;  3SWK A;  1KFN A;  5APY A;  3VMX A;  2E75 B;  3A3Y B;  3WU2 E;  4C7R A;  2H88 C;  1U7M A;  4JPZ B;  1LNQ A;  1FBM A;  1IFP A;  1YQ3 D;  3L71 D;  2Q9I A;  4KX6 D;  2QIW A;  1FZF A;  1YJW P;  2WU5 C;  1BGY J;  3V6I A;  1QVF O;  2Z5H A;  2WS3 D;  2E76 C;  4PV1 D;  3CME P;  1JCD A;  3H1L E;  3RK3 B;  1J1E C;  5AW7 B;  5KKZ B;  2YO2 A;  1G2C A;  2QSI A;  1IK9 A;  3VR9 C;  2BS2 C;  1NEN D;  2Z5I A;  1LT9 A;  3AEG D;  2FYU G;  2QE7 H;  5EFW B;  3WUU A;  1CW5 A;  3QWO C;  2HLO A;  1PZQ A;  2FYU D;  1RE4 A;  2CPS A;  1N7S A;  3H1J D;  3AEF D;  1FU1 A;  1AJY A;  1GD2 E;  3O6Q A;  3AEB D;  2P1J A;  3P4S C;  2KSJ A;  4GOF A;  1S72 P;  1P84 H;  1GMJ A;  3G6E P;  4JYC A;  2BS3 C;  1L4A C;  1KIL E;  3L72 E;  1PGJ A;  5AW8 B;  5CCH C;  1RE4 C;  4H13 D;  3TF5 A;  1JNM A;  3Q5R A;  3A0H E;  3PHL A;  2IBZ I;  3PH0 A;  3L36 A;  1IZN B;  4N78 E;  2O01 N;  1RQV A;  2KZI A;  5AVQ B;  2IFN A;  5AVX B;  3Q2Y A;  3CPW O;  2BCC J;  2N9Y B;  5AVW B;  1BCC D;  1MKM A;  4H13 B;  3L72 J;  3H6P A;  2Q3E A;  1GK6 A;  3H1J E;  1PFI A;  3B8E B;  2R44 A;  2FYU J;  3SFD D;  1RY3 A;  3G4S P;  3H32 A;  1CI6 A;  3MHV A;  2FYU K;  1FZC C;  4JF7 A;  4R4L A;  1IC2 A;  1GW3 A;  1W2B O;  4NPE A;  3KPE A;  5C2T D;  2WSF J;  2RN0 A;  2MJZ A;  3H1L J;  1DEE G;  2IBZ D;  4BWN A;  4C7N B;  1SQQ J;  1HH0 A;  1FZC A;  1EZV E;  1GZL A;  1FAV A;  2BAS A;  2W90 A;  4XA4 A;  3L73 J;  1OVR A;  1JY3 O;  1NU1 K;  1NTZ G;  3HUS C;  1T6A A;  2J5U A;  1UIX A;  3CLQ A;  4UB8 E;  2E75 D;  2OYI B;  2GM4 A;  1BSH A;  2RKL A;  3AEB C;  1RF0 A;  3L71 G;  4WWI A;  2W27 A;  3TNU A;  3CI9 A;  2HYN A;  3WUT A;  1X79 B;  3AE6 C;  4D6T E;  4WB4 A;  1IJD B;  4U3F G;  4WVZ A;  3VRA D;  3VRA C;  1Q82 Q;  3B4S A;  2ZXE B;  3AE1 D;  3H1L G;  3EFF K;  3W68 A;  3M9B A;  2FXP A;  5CBO A;  1PPJ E;  1YBK A;  1SQX G;  5AW1 B;  4R4M A;  1NO4 A;  2ZT9 C;  5AW9 B;  1FZC B;  5AVT B;  2Q6Q A;  2IFM A;  4IOI H;  2YIU B;  2N1T B;  3VTP C;  4DHZ A;  1EDL A;  2ZVN B;  1S2E A;  3M0A A;  3FXD A;  3CWB D;  4L76 A;  2OYI A;  1EDI A;  2G3A A;  4D6T D;  3T97 A;  1YTZ I;  1E79 H;  2R5B A;  2OTL P;  3CCL P;  1AVY A;  1SQB J;  1VF5 D;  2JDI H;  3L73 E;  3AE9 C;  4TT3 H;  3AEA D;  5APT A;  3CCV P;  1VQ9 P;  1URQ D;  2WSE H;  3HE4 A;  1NU1 E;  1XTC C;  3WMM 0;  4W80 A;  1EDK A;  1SQB K;  3L74 G;  1NAY A;  3BAT A;  2OYH C;  1KOR A;  1VQL P;  3IN6 A;  2M8R A;  3VYI A;  3C9I A;  3AED D;  3VP9 A;  3BVH A;  1M57 D;  2WPV B;  3VR8 D;  2HOD B;  2Z4E A;  2BEQ D;  2KI7 B;  1SFC C;  3P4Q C;  3VN0 A;  1FJK A;  2E5Y A;  2O1J A;  1J1D B;  4C46 A;  1S9K D;  5KAI E;  1L0L K;  5B5E H;  3AE8 D;  1LTJ C;  2WP9 D;  3GHG A;  3RK3 D;  2B88 A;  1Q7Y Q;  3RK3 C;  2JR8 A;  4N3Y B;  4D6T J;  1MUU A;  1SFC A;  1SQB D;  1W5C E;  4HYT B;  2E5T A;  3D70 A;  2ZVO B;  1KQS O;  3M9H A;  3TGU D;  2OTJ P;  2JJL A;  3SFE C;  3L74 J;  3LIE A;  4L74 A;  1KB9 H;  2R3C A;  1K05 A;  1YQ4 D;  4HB1 A; 
#chains in the Genus database with same CATH homology
 2D2C D;  4YTM D;  3AED C;  2G3A A;  3AEG C;  3Q5P A;  4U7J A;  1NEK C;  3GLM A;  2H88 D;  3AEC D;  2H89 D;  2WDQ C;  3AEF D;  3Q1M A;  1AJY A;  1E7P C;  1NEN C;  3AE2 D;  5L8R J;  3H25 A;  3O6Q A;  3AEB D;  4YSX D;  2E74 C;  4GDO A;  3AEE D;  3P4S C;  2WDV D;  1OMI A;  3AE4 C;  3AE3 C;  2WU2 D;  2E76 D;  4PV1 C;  2YIU C;  3SFD C;  3VRB C;  1PV3 A;  1EXI A;  4YSY D;  1GMJ A;  1EXJ A;  1VF5 D;  1OW7 A;  3AE7 D;  2J5U A;  2NZ2 A;  3VRB D;  3AE9 C;  3Q3D A;  4TT3 H;  1UIX A;  2WDR C;  1L0V D;  3AEA D;  3G9R A;  1ZRT E;  1Y9B A;  1QLB C;  1KFY C;  1VL2 A;  1KFY D;  2P10 A;  2BS3 C;  1KIL E;  3P4Q D;  2E75 D;  2QJP C;  3AEA C;  4H0L D;  1L0V C;  4YSZ D;  1FDO A;  4YTN D;  3CIR C;  2JO1 A;  3P4P D;  1VF5 C;  4H44 D;  4KX6 C;  4YSY C;  4H13 D;  3T97 B;  3GF3 A;  3LW5 J;  1FDI A;  3AE3 D;  3AE4 D;  1R8E A;  4YT0 D;  3AE5 C;  3AEE C;  2B76 D;  2OQQ A;  3Q5R A;  5M1B A;  1DD3 A;  2D2C B;  2YMK A;  3AEB C;  3P4P C;  2E74 B;  2E75 B;  3AE8 C;  4H0L B;  3B71 A;  3CIR D;  1KTM A;  1KOR A;  1ZOY D;  2O01 J;  3IN6 A;  4PV1 B;  2E75 C;  4H0L C;  1JB0 J;  4XFJ A;  2H88 C;  4YSZ C;  4YTP C;  1HF9 A;  4Z1M H;  1NEK D;  1NGM B;  3AED D;  1OW6 A;  1RQV A;  4YTP D;  3AE1 C;  1DIP A;  1ZOY C;  2G8Y A;  3AE6 C;  3AE7 C;  4H44 B;  2WPV B;  1WMK A;  1Q90 D;  1PIX A;  3VR8 D;  3Q2Y A;  3RK3 E;  4OGQ D;  1YQ3 D;  2ACZ D;  3VRA D;  1HJ0 A;  2BS4 C;  2WU2 C;  3IAO A;  2WDV C;  3VRA C;  4H13 C;  3P4R C;  3SFE D;  4H44 C;  1VF5 B;  1MKM A;  2BEQ D;  3FGA D;  4KX6 D;  2QIW A;  2WSC J;  3AE2 C;  1KMI Z;  4H13 B;  2WDQ D;  3AE1 D;  2BEZ F;  2WU5 C;  3P4Q C;  2V7Q J;  3ABV C;  1OW8 A;  1S1C X;  2D2C C;  1KQF B;  4YTM C;  1TU3 F;  4I7Z C;  2FBW C;  3C8V A;  2WQY C;  3EWK A;  1U57 A;  2E76 B;  2IDB A;  2WDR D;  2ZT9 D;  3AE9 D;  3AE8 D;  4YXD D;  3D6Z A;  2B76 C;  2WP9 D;  2K9Y A;  1RQU A;  3AE5 D;  2WS3 D;  4YT0 C;  2MKV A;  2E76 C;  4PV1 D;  3SFD D;  2FXP A;  5C3J C;  1ZP0 C;  3S9O A;  2E74 D;  1ZP0 D;  1S5L X;  2WS3 C;  5C2T C;  3D6Y A;  4R4M A;  2WP9 C;  4YTN C;  1ZME C;  3D71 A;  2H89 C;  3AEC C;  2QJK C;  4R4L A;  2ZT9 C;  1KF6 C;  4IL6 X;  1DD4 A;  2ZT9 B;  4RKU J;  5KKZ C;  4KT0 J;  2FYN C;  3ABV D;  1NYH A;  2QSI A;  2WU5 D;  3D70 A;  3RL0 g;  2JP3 A;  4I7Z B;  4OGQ B;  5C2T D;  2WSF J;  2WSE J;  3R4Y A;  3VR9 C;  3P4S D;  3SFE C;  3P4R D;  1K04 A;  3VR9 D;  5C3J D;  2BS2 C;  1NEN D;  1YQ3 C;  4OGQ C;  2ACZ C;  4YSX C;  3AEF C;  3GMA A;  3VR8 C;  4YXD C;  3GF7 A;  1YQ4 D;  5KLI C;  3AEG D;  1IK7 A;  3AE6 D;  1YQ4 C;  2QJY C;  1K05 A;  4Y28 J;  2FBW D;  2WQY D;  1KQG B;  3Q5S A;  1PL5 A;  1KF6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...