3AE4C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae4C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae4C02
3AEDD 3AE7D 2H88C 3AEFD 3AEBD 4YT0D 1K04A 1YQ3C 1ZP0D 5C3JC 3VRBD 2WS3C 3AE1C 2WDQC 2BS3C 3SFDC 3SFEC 1E7PC 3AE6C 3P4PC 1L0VD 2WDVD 1OW7A 4YTMD 3AEDC 3AE7C 2ACZD 2WDRC 3AEGD 3AEFC 2H89D 1NEND 3AEBC 4YT0C 1ZP0C 3AE8D 3CIRD 3VRBC 3P4RD 3VRAD 3ABVD 3AE3D 3P4SD 1YQ4D 2B76D 2WP9D 3AEAD 3AE5D 1L0VC 2WDVC 3AE4D 4YTMC 1KF6D 1ZOYD 1OW6A 3VR9D 3AE2D 3AEGC 2FBWD 3AECD 3P4QD 2H89C 3AEED 1NENC 4YTND 3AE8C 3CIRC 3P4RC 1QLBC 3AE9D 3VRAC 3B71A 4YSXD 3S9OA 3VR8D 3ABVC 3AE3C 2WU2D 3P4SC 2G3AA 1YQ4C 2B76C 3AEAC 2WP9C 3AE5C 3AE4C 5C2TD 1KF6C 1ZOYC 3VR9C 3AE2C 2FBWC 3P4QC 3AECC 3AEEC 1KFYD 1PV3A 1NEKD 3AE9C 2ACZC 4YSXC 3VR8C 2WU2C 4YXDD 4KX6D 2WU5D 1KTMA 5C2TC 4YSZD 4YSYD 2WDRD 2WQYD 1OW8A 1KFYC 4YTPD 1NEKC 2H88D 4YXDC 4YTNC 2BS4C 4KX6C 1YQ3D 2WU5C 2BS2C 5C3JD 2WS3D 3AE1D 2WDQD 4YSZC 3SFDD 4YSYC 3SFED 2WQYC 3AE6D 1K05A 4YTPC 3P4PD
chains in the Genus database with same CATH superfamily
4PJ0H 2P58A 1FZEA 5CCHC 2I8DA 1T3UA 1JNMA 5GTIH 2ITAA 1OIPA 3CXHH 1NOHA 2NPSD 3RK2C 2FFDB 2WDRC 1Z56A 3CX5E 1LWUB 3L74D 4DDGA 2JEEA 5B66H 2Y0EA 2FXPA 2C9LY 3MTUE 1M7LA 1NHLA 3VMXA 3TK1A 3RK3C 1JY2P 3BATA 2FYUG 2OYIC 1KF6D 4DZOA 2KSEA 3CX5I 1N7SA 5GTHE 3L72G 1Q7YQ 4YTND 3RL0B 5AW0B 2OYHA 1KQLA 2CPSA 1JY3P 3VRAC 3V2RA 1L4AA 1SQBE 1BGYE 2G3AA 1T6AA 1ZOYC 2A45I 1LT9A 2R3CA 1NAFA 1RE3A 1VQKP 1URQA 1RF1A 3Q2YA 3AE9C 3H1JD 2GUSA 1J2JB 1X79B 5KLIC 2BEQD 3A2AA 3CX5H 2N1TD 1OW8A 2LXBA 1VL2A 2E5TA 1S5LE 1NEKC 1NTMK 4BRYB 1CW5A 1BDCA 2O01J 2R5BA 2K37A 2C9NY 2E42A 2A45H 5GTHH 2M5AA 1VDFA 1JY2N 3BCCE 3CC4P 5AW3B 2FYUE 1X22A 1BE3D 1KILE 4WY4A 1JY3N 3HD7C 3SFEC 4K35A 2QJKB 1GTWA 1AQ5A 4H0LD 4YTMD 5APYA 5AVUB 1KQFB 3V4QA 4EIJA 1EZVD 2HFED 2AEMA 5KKZC 1OFCX 1FU1A 1QL2A 3VONA 2WPSA 3SWFA 2O3JA 4Y28J 2K1AA 1S5LH 1R5LA 3AE4D 1N73C 2Q5UA 1SQBK 3AEGC 3L35A 3TGUD 1RE4A 2RKLA 3VR8D 3AE3C 1AFOA 2YO2A 4JF7A 1FZCA 2ZFCA 1Y9BA 3VR9C 1ZW0A 4DHZA 3QH9A 5APQA 1KFYD 4I1LA 2MKVA 3IN6A 1LP1A 1EZVI 5C39A 1ZLLA 1N7LA 1PIXA 1JM0A 1T2KD 2P2UA 1QEXA 4YSYD 4FJVA 2FXMA 1H88A 3A5TA 1ZR2A 4IOIH 2AEJA 1VPCA 1IO4A 1N7SC 4I6MC 5CCGD 2WS3D 2OYHC 2FXOA 3PLNA 4YSZC 2E5YA 1L4AC 3B5ND 2LXCB 3P4PD 1J1DB 1LTJA 3AEDD 1LT9C 1PPJG 1RE3C 2B88A 2NPSB 1URQC 1RF1C 2A06G 4RESB 3MZWB 4NPEA 4WB4A 3Q5RA 1NJIQ 3AE6C 1YYCA 4M3LA 3E7KA 3I56P 1KB9D 4IL6X 1USEA 1KILA 1SVFA 3CCLP 2M8RA 3TDKA 3HE4A 1J1EB 3PTZA 3L73J 1N8RQ 3Q5PA 1T3JA 3V2QA 3L70D 3CCQP 3T97B 2KP8A 1GD2E 1OVRA 2O01H 4GIFA 3D6YA 2D2CC 3AE8C 4ZKPA 1PGOA 3S9OA 2O01N 1UIIA 2R44A 4EI2A 4WY4C 1SQVJ 3H1HD 3V2NA 2QJPB 2YKPA 3HUSA 3CI9A 2B9BA 3HE5A 2ZT9C 2WPQA 1KFMA 2N1TB 1NO4A 3OAKA 3JC22 1JTHB 1KD1Q 1PPJE 1FBMA 2KS1B 2WDRD 2A06E 2P10A 1AA0A 2IDBA 2H88D 4I2LC 2HODB 2WSCJ 4EDFA 4U3FJ 1RE4C 1SQVG 4Y99C 1M1JB 2YKQA 2ZYAA 2WQYC 1JO5A 1DD3A 3CMEP 3MUDA 1VQLP 5CJ4A 1SS1A 1FZCC 3H25A 1JY3O 2OTKE 3V4WA 4H0LB 2K9JB 1ZP0D 4W7ZA 2H7HA 1L0ND 3WUUA 4GT1A 1G2CA 1HJ0A 1FDIA 2FY8A 3CCVP 4MN4C 2R32A 4DDIA 3AEFC 1Q82Q 1EC5A 4YT0C 1NTZD 4DJGA 4U3FG 4LDTA 2MJZA 2HG5D 3H6PA 4RKUJ 2FKWB 3AE5D 3CCMP 2IPPA 3KYQA 1VF5B 3L73E 1DH3A 3CL3D 4KHXA 4DOJA 3MIWA 2PGDA 2H89C 2RN0A 2XU6A 3O6QA 3Q3DA 4LGDE 4JYBA 4YXWH 2WT7A 1KMIZ 5APTA 1SQVE 2FYZA 4YPCA 5APSA 3L71G 4GDOA 4C7NB 4KX6D 3VMYA 1SFCB 2W27A 1KILC 2HPCB 4D6TJ 4IFFA 2Z5HA 3D70A 2QRXA 1NTKD 5AVXB 2FYNB 4HYTB 2Z4EA 3B5NB 2BS4C 2WU5C 1U7MA 2YO3A 2E75C 5EFWB 2WDQD 5L8RJ 1GL2D 3B8EB 1W2EA 1KV4A 3H1IJ 3BVHA 2L5GB 3S4RA 1S72P 3SSUA 3I55P 3CCUP 1OXZA 2E76C 3G6EP 2V7QJ 3HUSC 5BVZA 2IFNA 5M1BA 2BCCD 4D6TG 1NTMJ 2JWDA 3KZIE 3G4SP 4I6LA 2E74B 1PL5A 4GOFA 1YIJP 3IAOA 2P67A 1FC2C 1EDIA 3ABVD 3AEAD 3H1IG 4AUWA 1L0VC 3AEED 1NTZK 3KHUA 3MUDC 4NPFX 2NRGA 2WSCH 1NTMG 5KLVD 4N6JA 1GMJA 1PZQA 3A3YB 3AECC 5APUA 2JKVA 1N86A 4YSXC 3KZIH 2ZJSE 2QIWA 4H13D 2WU2C 3L74J 1CSBA 1JOCA 2ZVNB 3PP5A 4PD4E 3WUTA 3RK3B 1ZN5A 4D6TE 1BSNA 1AV1A 1TFFA 1AJYA 4LLHA 2YIUB 4I7ZC 3WMM0 4PD4I 1NTKK 1VQ9P 3GHGB 3H1IE 3ZDMA 5AVRB 1BCCD 3CWBD 2FFDA 1LWUA 3L74G 1SQBG 2POHA 3H1JJ 4GOEA 2LR2A 4GKGA 1KYOH 1NTME 4ASVA 3E1IA 1RQVA 4C46A 2PAJA 2KIKA 1FDMA 1LJ2A 2QEXP 1QL1A 4PD4H 1Q86Q 2B76D 2WP9D 1RQUA 1VQPP 5TISE 5H2FE 3L37A 4N78D 4IFMA 1VQ7P 1DD4A 2QM7A 3B71A 3H1JG 1BE3J 3MGNA 4BXLA 1PP9D 1G1JA 1IZNB 4OGQC 1ZR4A 3BCCG 1ZMEC 2V7QH 1T8ZA 1IFDA 1MKMA 1VQ8P 4ZKUA 4BRYA 1EDKA 2I1KA 2KOGA 2RH0A 1MUUA 2JJLA 3L74E 2I1JA 1HJBA 1QX8A 1GL2B 2QJYC 2V4HA 1A02F 1FJPA 2YMKA 4ASWA 2PFXA 4QMAA 3TGUJ 1CZQA 2K3RA 5TISH 1E79H 4UB8E 1OVVA 1QGKB 2YNYA 1KC8Q 3N4XA 5K5GB 1EZVG 3SFDC 1EXIA 3VMAA 3UIAA 3H1JE 1IFMA 1OW7A 2K88A 3S1KA 3AE7C 3G9RA 3P4RD 1IC2A 3A7OA 3TGUG 3L72D 1HBWA 5AW1B 3M9HA 4DHJA 4UB8H 2FFDC 1LWUC 2Z5IA 1K9MQ 1BE3E 4H13B 1LTGC 1OX3A 3VP8A 1SQPD 2KNCB 1JB0J 1HH0A 2LKMA 2AXCA 2HLOA 1NAYA 3RL0C 3H1LD 1VF5D 2HR3A 2GA1A 2KZIA 1EZVE 3KQGA 3L75D 2C0XA 1SLQA 2WZ7A 3GF3A 3L70J 5BU8B 1L0LD 3L4FA 4YXDC 2D2CB 1SQPE 5KJ7D 2BS2C 1FE6A 2NPSA 2JO1A 1KZUB 3P8CD 3TGUE 4TT3H 3VOPA 3H1HJ 3N7NA 4AYCA 3CD6P 1OZHA 3CC7P 1YQ3C 5C3JC 1SFCD 3AE1C 2KLVA 1L0LE 3WU2E 3M9QA 2BEZF 2L91A 2WSSH 4W80A 2WDVD 3KXDA 3P8CE 4DHIB 3L70G 4L74A 3T97A 1X9VA 3AEBC 2E43A 3VRBC 3OW2O 1YQ4D 3I5CA 5AVSB 2P7JA 1LTAC 4Y99B 4OWFA 2KXPB 3H1HG 1SQXD 5CBOA 3AE2D 2FBWD 1NENC 3CIRC 3H32B 3CPWO 2WSFJ 2R5DA 2N1TA 3P4SC 1IFJA 4PV1D 1JTHA 1YJ9P 4KJMA 1DX7A 5C2TD 1LTIC 2E74D 1PFIA 2J59M 2KS1A 1L0NJ 1EXJA 3P4QC 4H44D 1FDOA 2Q7CA 4JYCA 1SQXE 1TU3F 2Y9ZA 4WBAA 2IFMA 2HODA 1NTZJ 3LIDA 1KB9E 3MHVA 1M56D 5AVQB 1M1JA 4W7YA 1Q81Q 1SQPK 3LW5J 5CCHD 2XNXA 2YXQB 1MFZA 3E1RA 1NWQA 3L70E 2K9JA 1KB9I 2Q6QA 1Y8AA 2XNDH 4YTPC 3L73G 2KSJA 3RK2D 3K5BA 1L0LK 2Y0CA 3H1HE 3NTNA 2Y0DA 3EWKA 3JCUE 1JCCA 1NTZG 2SPZA 3NMDA 2WWWA 3TNUB 3RK3D 3V6IA 4A7PA 1NYHA 2N9BA 4RJTA 1NTKJ 3CMAP 1KB9H 3VRAD 2YMYA 1PGJA 3V5BA 2WSEJ 2E75B 2NPSC 1ZOYD 3GMAA 4R4LA 3BRTB 3RK3E 1X8YA 1H0TB 5AVVB 2XKMA 3C8VA 3VMZA 1QLBC 3AE9D 2M0BA 1EQ7A 4C7NA 1P84D 1SFCA 4XFJA 3IR9A 1KF6C 3Q1MA 2HPCA 1SQXK 2BCCJ 2KLUA 1J1EC 3M0DA 1HUCA 5CCGA 1FAVA 1S9KD 3JCUH 2J58A 1NTKG 1L0NE 1NEKD 3CCRP 3B5NA 1S5LX 1SQQD 3VYIA 5KAFE 1LTJC 2CPBA 1NTZE 1LGHB 3H1KD 3PH0A 1N2DC 5B5EE 3RBXA 1HGZA 2IZ0A 4RO0A 3RL0g 1YI2P 2QJPC 1KQGB 1MZ9A 2JDIH 4JPZB 3HD7D 1SQQE 2AEFA 2IBZD 3SFED 2ZFYA 2N1TC 1WRGA 1K05A 1RHZB 5KLVJ 2OTLP 3H1KE 2KK7A 2W6BA 2WSFH 1AVOA 3FXDA 1GK6A 2C0WA 1QVGO 2ZAEB 3FXEA 1NGMB 1GW4A 3PHLA 3AEGD 1RF0A 5KAFH 1M1JC 1NTKE 3AE3D 3EFFK 5B5EH 4H0LC 4HH2A 2IBZI 4YTMC 1IFNA 3LW5H 3VR9D 4PV1B 4BWNA 2CK3H 4H44B 3L71D 4UB6E 1BCCJ 3CWBJ 3JSVC 2ZVOB 3AE4C 1NKZB 1YITP 1L0NK 1U57A 2B87B 1NU1D 2BCCE 3U1CA 5AW5B 3VR8C 1NKNA 1N7SD 1RH5B 1VQOP 3A0HE 3P8MC 1AQTA 4YSZD 1L4AD 1KFYC 4WVZA 2H43A 3GHGA 1SQQK 1BCCG 3CWBG 3RK2B 1URQD 1T2KC 2WSEH 4YSYC 4ZMDA 3AE6D 3GF7A 1ZRTD 1PP9J 5KLVE 3M0DC 3CXHD 2KYVA 5CCGC 2OYIB 1NH4A 1XTGB 2WS3C 5AW7B 5CMZA 2Y9YA 3B5NC 1E7PC 1DEBA 5AW2B 1W5CE 1YBKA 3P4PC 4HKZH 2P1JA 3AEDC 2PP6A 1ZRTE 3A0HH 2D2CD 3AE8D 4WY4D 3HTKB 1FS0E 1U7JA 4IL6E 1OW6A 4N3YB 1GW3A 5KLIB 2ZT9D 1FOSF 4AQRD 2IYOA 2Q3EA 2PRRA 1HF9A 1IFPA 1BCCE 1FZGA 3CWBE 1CI6B 3V2PA 4L76A 1JMMA 1Y47A 2DW3A 3FWLA 4Z1MH 1GL2A 4EOTA 3OA7A 4C7RA 3P32A 3CX5D 1RF0C 3WUVA 2BASA 1A02J 3L72J 1NU1K 2WQYD 3IFMA 3HD7B 1JEKA 3O8ZA 3R2PA 4IL6H 3R4YA 2B89A 3P7KA 1H8AA 5KLVK 4N78E 5KKZB 1SQBD 1BGYD 3L36A 3FGAD 2H88C 1K8AQ 3AEFD 5KTBA 1PP9E 4YT0D 1N73B 3TF5A 1SQPJ 2BS3C 1FOSE 1BE3G 1YTZI 3GLMA 2ZYDA 5H2FH 3H1LJ 2YIUC 2H89D 5CJ0A 3L75J 1ZP0C 2WITA 2WVRA 5CBNA 3M0AA 1FZBA 3IF4A 3GHGC 1L0LJ 4L75A 1GK4A 1X0TA 2ZXXA 2QG4A 3CCSP 1VQMP 3A0BE 2QM8A 3BCCD 2HYNA 1S3JA 1UIXA 1SQPG 2R3SA 1R8EA 2KNCA 2FYUD 1KILD 2RMZA 3AE5C 1M8OB 1N7SB 4U7JA 3H1LG 2OYHB 1MV8A 2KZJA 4KT0J 1L4AB 3L75G 3FX0A 2ACZC 2QSIA 1L0LG 2WU5D 1BDDA 2E75D 1LT9B 1OMIA 1ZV8A 2Q3IA 5AW8B 1URQB 2IYPA 1RF1B 5KAIE 2KB7P 2E76D 3L72E 1Q2NA 1SQXJ 1HTLC 2UWJE 4KX6C 1S1CX 2ZYGA 3A0BH 5CHXA 3U59A 3GG2A 2WDQC 2VRSA 2M5AB 1GL2C 1PGPA 1EDLA 1GZLA 1L0VD 4WY4B 2K9YA 2XZRA 1LTSC 1SQXG 3H1LE 3CCJP 3II6A 4HJGH 1YHQP 3H32A 3L75E 2ZT9B 5KAIH 3BASA 2IX7C 2WTYA 3AECD 2WMMA 3GW6A 4YSXD 3ABVC 2WU2D 4LC1A 3AEAC 5AW4B 2XV5A 3SWYA 2GUVA 5AW6B 3AEEC 3W68A 1RY3A 1HGVA 2WPVB 5AW9B 3PRJA 1S2EA 3G3ZA 1IFIA 2FYUK 2OYOA 2W6AA 1K73Q 1FZCB 2QJKC 1L2PA 2H8PD 1M90Q 2QE7H 3F5HA 1FZAA 3QWOC 2JWAA 1LP1B 2ZXEB 4XE5B 4H13C 2Q1KA 1FJKA 5DJUB 5DJTB 3FWNA 3CC2P 3WU2H 1LTTC 5E79E 5APVA 1EDJA 3TNUA 3Q5SA 4TLFA 1VQ5P 1K04A 1S4XA 2Q9IA 1IK7A 2JP3A 1SQQJ 1LTJB 4B86A 3C9IA 5APXA 1PPJD 1LNQA 3H1KJ 3HRNA 1L0NG 3LIEA 2A06D 1H0TA 4WWIA 2XDJA 4GODA 1MFTA 4OGQD 1WMKA 1KILB 1G1IA 3HE4B 3VN0A 5E79H 1GU5A 2B76C 2WP9C 5BU5A 1SQQG 2IZ1A 1J1DC 1BSHA 5KJ7A 3H1KG 1JUNA 1GU4A 3CCEP 1JY2O 1R5SA 2E76B 1QVFO 1YTZT 1KTMA 1JMBA 5APWA 3HUSB 3HE5B 2AXTE 1HVVA 2IBZG 4JQ0D 1D7MA 3D71A 4R4MA 1M57D 1VQNP 3L73D 4YTNC 1WT6A 1KFNA 4IFDK 1HWTC 3SFDD 3L71J 2GM4A 3AE7D 1JCDA 1Q90D 1QLED 1P84E 2N9YB 2OGUA 3C1LA 1NU1J 1SQVD 4HB1A 1DEEG 5TJHA 2WPRA 3EQ2A 3BRVB 1SP4A 1S9KE 4ZNCA 2JR8A 1W2BO 1XTCC 2QA4P 1P84I 2ACZD 2O1JA 2BCCG 2W83C 5AVYB 3OJAB 2W90A 2AXTH 1G2CB 2NZ2A 3D6ZA 3EFGA 2G8YA 1VQ4P 2B87A 4OH8B 4U3FD 1NU1G 2IBZE 3P4RC 3ITKA 2KI7B 2QVAA 4DT0A 2M3BA 2W6JH 5CCHA 3RL0D 1P84H 2OARA 1LTBC 3O6QB 1ZXGA 4I7ZB 5KLVG 3VP9A 2OTJP 4XA4A 1H89A 1IK9A 2YXRB 1YJNP 4YXDD 4U3FE 2KUBA 2WT7B 4K3AA 2OQQA 2M3EA 3KDPB 1NVOA 1YQ3D 5C3JD 1OWAA 3F89A 2OYIA 3AE1D 3VTPC 1VF5C 1KORA 1KQSO 3L71E 3B4SA 1USDA 5AVZB 5AVWB 3AEBD 3MD0A 4CPGA 3MP7B 5KJ7C 3SWKA 1E5WA 3VRBD 3G71P 1NU1E 1KYOD 3U1AA 3HTKA 2O1KA 1GDTA 3PJSK 1SQVK 1NEND 3TYYA 4OGQB 4PD4D 3CIRD 1SFCC 4D6TD 4UB6H 1LT1A 1OVUA 3P4SD 2W8ZA 2WDVC 3RGUA 1KYOE 2FYNC 3TSIA 4O9BA 1VQ6P 3P4QD 1CI6A 1SQBJ 3W67A 1BGYJ 3M06A 4PJ0E 4L73A 3H1ID 1YQ4C 2QJYB 1KYOI 3NFQA 1IJDB 5GTIE 3CXHE 3RBZA 3AE2C 2FBWC 2YKOA 3KPEA 4JBZA 2J5UA 1PV3A 4DCKA 3M9BA 1PGQA 3HD7A 1NTMD 4EYYQ 1PP9G 1KN7A 3M91A 4PV1C 5B66E 5C2TC 2A45G 3CXHI 3USSA 2E74C 4H44C 1YJWP 4YTPD 1AVYA 1M1KQ 4NPDA 1BGYG 1FZFA 4OVNF 5AVTB 1N73A 3BCCJ 1DIPA 3CLQA 3NXSA 2FYUJ
chains in the Genus database with same CATH topology
2E76C 3AEDD 3AE7D 3FGAD 3H25A 1Q90D 2H88C 3Q5SA 1KILE 2V7QJ 3AEFD 4H0LB 3AEBD 4YT0D 1K04A 1YQ3C 1ZP0D 5C3JC 3VRBD 3EWKA 2WS3C 3AE1C 5M1BA 2WDQC 1IK7A 2BS3C 2JP3A 3SFDC 3SFEC 2BEZF 1EXIA 3Q5RA 4TT3H 1E7PC 3AE6C 1HJ0A 1FDIA 3P4PC 1L0VD 4H0LD 2WDVD 2E74B 3GLMA 1NGMB 1OW7A 4YTMD 3AEDC 3AE7C 1PL5A 1RQVA 1NYHA 3G9RA 2K9YA 2ACZD 2WDRC 1KQFB 4IL6X 2YIUC 3AEFC 1ZRTE 3AEGD 2H89D 3IAOA 3AEBC 1NEND 4YT0C 1ZP0C 4OGQB 2D2CD 3AE8D 5KKZC 3CIRD 3P4RD 3VRBC 2FXPA 3VRAD 2ZT9B 3ABVD 3AE3D 2NZ2A 3P4SD 2WSEJ 4Y28J 1YQ4D 4RKUJ 2B76D 2WP9D 3AEAD 2E75B 3AE5D 1RQUA 4H0LC 3Q5PA 1L0VC 2WDVC 3D6ZA 3AE4D 1VF5B 2FYNC 1KF6D 4YTMC 4OGQD 1ZOYD 1OW6A 3GMAA 4R4LA 1WMKA 3T97B 3VR9D 4PV1B 2G8YA 3AE2D 3AEGC 2FBWD 3RK3E 3AECD 2H89C 3AEED 2ZT9D 1NENC 3P4QD 4YTND 3O6QA 3D6YA 2D2CC 3AE8C 3CIRC 3C8VA 3P4RC 1DD4A 2WSFJ 3Q3DA 1QLBC 3AE9D 3VRAC 3B71A 1UIXA 4H44B 4YSXD 3S9OA 1R8EA 1HF9A 3ABVC 3VR8D 3AE3C 2WU2D 3P4SC 2G3AA 1YQ4C 2B76C 3AEAC 2WP9C 4PV1D 3AE5C 3AE4C 5C2TD 1GMJA 4XFJA 1KF6C 3Q1MA 4H13B 1KMIZ 1Y9BA 1ZOYC 1U57A 2E74D 4OGQC 4U7JA 1ZMEC 3VR9C 3AE2C 2FBWC 1EXJA 3AECC 3P4QC 3AEEC 4H44D 2ZT9C 1KFYD 1FDOA 2J5UA 1PV3A 2MKVA 3IN6A 4I7ZB 4KT0J 4Z1MH 1NEKD 3Q2YA 3AE9C 4GDOA 1MKMA 2WPVB 2ACZC 4YSXC 1TU3F 1S5LX 3VR8C 2QIWA 1JB0J 2QSIA 4H13D 2WU2C 4YXDD 2E76B 1PIXA 4KX6D 4PV1C 2WU5D 2QJKC 5KLIC 2E75D 1KTMA 5C2TC 2BEQD 1OMIA 4YSZD 2E74C 1VF5D 4YSYD 2WDRD 3D70A 2WQYD 2OQQA 1OW8A 4H44C 2P10A 1VL2A 1KFYC 4YTPD 3LW5J 2E76D 2QJYC 1NEKC 3GF3A 2IDBA 3D71A 4R4MA 2H88D 2O01J 3RL0g 2YMKA 4H13C 4YXDC 2QJPC 4YTNC 1KQGB 2D2CB 2BS4C 4KX6C 1S1CX 1YQ3D 2WU5C 1AJYA 2BS2C 5C3JD 2WSCJ 3R4YA 2WS3D 2E75C 3AE1D 2WDQD 4I7ZC 5L8RJ 4YSZC 2JO1A 3SFDD 1VF5C 4YSYC 3SFED 1KORA 2WQYC 3AE6D 3GF7A 1DIPA 1DD3A 1K05A 4YTPC 3P4PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED D;  3AE7 D;  2H88 C;  3AEF D;  3AEB D;  4YT0 D;  1K04 A;  1YQ3 C;  1ZP0 D;  5C3J C;  3VRB D;  2WS3 C;  3AE1 C;  2WDQ C;  2BS3 C;  3SFD C;  3SFE C;  1E7P C;  3AE6 C;  3P4P C;  1L0V D;  2WDV D;  1OW7 A;  4YTM D;  3AED C;  3AE7 C;  2ACZ D;  2WDR C;  3AEG D;  3AEF C;  2H89 D;  1NEN D;  3AEB C;  4YT0 C;  1ZP0 C;  3AE8 D;  3CIR D;  3VRB C;  3P4R D;  3VRA D;  3ABV D;  3AE3 D;  3P4S D;  1YQ4 D;  2B76 D;  2WP9 D;  3AEA D;  3AE5 D;  1L0V C;  2WDV C;  3AE4 D;  4YTM C;  1KF6 D;  1ZOY D;  1OW6 A;  3VR9 D;  3AE2 D;  3AEG C;  2FBW D;  3AEC D;  3P4Q D;  2H89 C;  3AEE D;  1NEN C;  4YTN D;  3AE8 C;  3CIR C;  3P4R C;  1QLB C;  3AE9 D;  3VRA C;  3B71 A;  4YSX D;  3S9O A;  3VR8 D;  3ABV C;  3AE3 C;  2WU2 D;  3P4S C;  2G3A A;  1YQ4 C;  2B76 C;  3AEA C;  2WP9 C;  3AE5 C;  3AE4 C;  5C2T D;  1KF6 C;  1ZOY C;  3VR9 C;  3AE2 C;  2FBW C;  3P4Q C;  3AEC C;  3AEE C;  1KFY D;  1PV3 A;  1NEK D;  3AE9 C;  2ACZ C;  4YSX C;  3VR8 C;  2WU2 C;  4YXD D;  4KX6 D;  2WU5 D;  1KTM A;  5C2T C;  4YSZ D;  4YSY D;  2WDR D;  2WQY D;  1OW8 A;  1KFY C;  4YTP D;  1NEK C;  2H88 D;  4YXD C;  4YTN C;  2BS4 C;  4KX6 C;  1YQ3 D;  2WU5 C;  2BS2 C;  5C3J D;  2WS3 D;  3AE1 D;  2WDQ D;  4YSZ C;  3SFD D;  4YSY C;  3SFE D;  2WQY C;  3AE6 D;  1K05 A;  4YTP C;  3P4P D; 
#chains in the Genus database with same CATH topology
 4PJ0 H;  2P58 A;  1FZE A;  5CCH C;  2I8D A;  1T3U A;  1JNM A;  5GTI H;  2ITA A;  1OIP A;  3CXH H;  1NOH A;  2NPS D;  3RK2 C;  2FFD B;  2WDR C;  1Z56 A;  3CX5 E;  1LWU B;  3L74 D;  4DDG A;  2JEE A;  5B66 H;  2Y0E A;  2FXP A;  2C9L Y;  3MTU E;  1M7L A;  1NHL A;  3VMX A;  3TK1 A;  3RK3 C;  1JY2 P;  3BAT A;  2FYU G;  2OYI C;  1KF6 D;  4DZO A;  2KSE A;  3CX5 I;  1N7S A;  5GTH E;  3L72 G;  1Q7Y Q;  4YTN D;  3RL0 B;  5AW0 B;  2OYH A;  1KQL A;  2CPS A;  1JY3 P;  3VRA C;  3V2R A;  1L4A A;  1SQB E;  1BGY E;  2G3A A;  1T6A A;  1ZOY C;  2A45 I;  1LT9 A;  2R3C A;  1NAF A;  1RE3 A;  1VQK P;  1URQ A;  1RF1 A;  3Q2Y A;  3AE9 C;  3H1J D;  2GUS A;  1J2J B;  1X79 B;  5KLI C;  2BEQ D;  3A2A A;  3CX5 H;  2N1T D;  1OW8 A;  2LXB A;  1VL2 A;  2E5T A;  1S5L E;  1NEK C;  1NTM K;  4BRY B;  1CW5 A;  1BDC A;  2O01 J;  2R5B A;  2K37 A;  2C9N Y;  2E42 A;  2A45 H;  5GTH H;  2M5A A;  1VDF A;  1JY2 N;  3BCC E;  3CC4 P;  5AW3 B;  2FYU E;  1X22 A;  1BE3 D;  1KIL E;  4WY4 A;  1JY3 N;  3HD7 C;  3SFE C;  4K35 A;  2QJK B;  1GTW A;  1AQ5 A;  4H0L D;  4YTM D;  5APY A;  5AVU B;  1KQF B;  3V4Q A;  4EIJ A;  1EZV D;  2HFE D;  2AEM A;  5KKZ C;  1OFC X;  1FU1 A;  1QL2 A;  3VON A;  2WPS A;  3SWF A;  2O3J A;  4Y28 J;  2K1A A;  1S5L H;  1R5L A;  3AE4 D;  1N73 C;  2Q5U A;  1SQB K;  3AEG C;  3L35 A;  3TGU D;  1RE4 A;  2RKL A;  3VR8 D;  3AE3 C;  1AFO A;  2YO2 A;  4JF7 A;  1FZC A;  2ZFC A;  1Y9B A;  3VR9 C;  1ZW0 A;  4DHZ A;  3QH9 A;  5APQ A;  1KFY D;  4I1L A;  2MKV A;  3IN6 A;  1LP1 A;  1EZV I;  5C39 A;  1ZLL A;  1N7L A;  1PIX A;  1JM0 A;  1T2K D;  2P2U A;  1QEX A;  4YSY D;  4FJV A;  2FXM A;  1H88 A;  3A5T A;  1ZR2 A;  4IOI H;  2AEJ A;  1VPC A;  1IO4 A;  1N7S C;  4I6M C;  5CCG D;  2WS3 D;  2OYH C;  2FXO A;  3PLN A;  4YSZ C;  2E5Y A;  1L4A C;  3B5N D;  2LXC B;  3P4P D;  1J1D B;  1LTJ A;  3AED D;  1LT9 C;  1PPJ G;  1RE3 C;  2B88 A;  2NPS B;  1URQ C;  1RF1 C;  2A06 G;  4RES B;  3MZW B;  4NPE A;  4WB4 A;  3Q5R A;  1NJI Q;  3AE6 C;  1YYC A;  4M3L A;  3E7K A;  3I56 P;  1KB9 D;  4IL6 X;  1USE A;  1KIL A;  1SVF A;  3CCL P;  2M8R A;  3TDK A;  3HE4 A;  1J1E B;  3PTZ A;  3L73 J;  1N8R Q;  3Q5P A;  1T3J A;  3V2Q A;  3L70 D;  3CCQ P;  3T97 B;  2KP8 A;  1GD2 E;  1OVR A;  2O01 H;  4GIF A;  3D6Y A;  2D2C C;  3AE8 C;  4ZKP A;  1PGO A;  3S9O A;  2O01 N;  1UII A;  2R44 A;  4EI2 A;  4WY4 C;  1SQV J;  3H1H D;  3V2N A;  2QJP B;  2YKP A;  3HUS A;  3CI9 A;  2B9B A;  3HE5 A;  2ZT9 C;  2WPQ A;  1KFM A;  2N1T B;  1NO4 A;  3OAK A;  3JC2 2;  1JTH B;  1KD1 Q;  1PPJ E;  1FBM A;  2KS1 B;  2WDR D;  2A06 E;  2P10 A;  1AA0 A;  2IDB A;  2H88 D;  4I2L C;  2HOD B;  2WSC J;  4EDF A;  4U3F J;  1RE4 C;  1SQV G;  4Y99 C;  1M1J B;  2YKQ A;  2ZYA A;  2WQY C;  1JO5 A;  1DD3 A;  3CME P;  3MUD A;  1VQL P;  5CJ4 A;  1SS1 A;  1FZC C;  3H25 A;  1JY3 O;  2OTK E;  3V4W A;  4H0L B;  2K9J B;  1ZP0 D;  4W7Z A;  2H7H A;  1L0N D;  3WUU A;  4GT1 A;  1G2C A;  1HJ0 A;  1FDI A;  2FY8 A;  3CCV P;  4MN4 C;  2R32 A;  4DDI A;  3AEF C;  1Q82 Q;  1EC5 A;  4YT0 C;  1NTZ D;  4DJG A;  4U3F G;  4LDT A;  2MJZ A;  2HG5 D;  3H6P A;  4RKU J;  2FKW B;  3AE5 D;  3CCM P;  2IPP A;  3KYQ A;  1VF5 B;  3L73 E;  1DH3 A;  3CL3 D;  4KHX A;  4DOJ A;  3MIW A;  2PGD A;  2H89 C;  2RN0 A;  2XU6 A;  3O6Q A;  3Q3D A;  4LGD E;  4JYB A;  4YXW H;  2WT7 A;  1KMI Z;  5APT A;  1SQV E;  2FYZ A;  4YPC A;  5APS A;  3L71 G;  4GDO A;  4C7N B;  4KX6 D;  3VMY A;  1SFC B;  2W27 A;  1KIL C;  2HPC B;  4D6T J;  4IFF A;  2Z5H A;  3D70 A;  2QRX A;  1NTK D;  5AVX B;  2FYN B;  4HYT B;  2Z4E A;  3B5N B;  2BS4 C;  2WU5 C;  1U7M A;  2YO3 A;  2E75 C;  5EFW B;  2WDQ D;  5L8R J;  1GL2 D;  3B8E B;  1W2E A;  1KV4 A;  3H1I J;  3BVH A;  2L5G B;  3S4R A;  1S72 P;  3SSU A;  3I55 P;  3CCU P;  1OXZ A;  2E76 C;  3G6E P;  2V7Q J;  3HUS C;  5BVZ A;  2IFN A;  5M1B A;  2BCC D;  4D6T G;  1NTM J;  2JWD A;  3KZI E;  3G4S P;  4I6L A;  2E74 B;  1PL5 A;  4GOF A;  1YIJ P;  3IAO A;  2P67 A;  1FC2 C;  1EDI A;  3ABV D;  3AEA D;  3H1I G;  4AUW A;  1L0V C;  3AEE D;  1NTZ K;  3KHU A;  3MUD C;  4NPF X;  2NRG A;  2WSC H;  1NTM G;  5KLV D;  4N6J A;  1GMJ A;  1PZQ A;  3A3Y B;  3AEC C;  5APU A;  2JKV A;  1N86 A;  4YSX C;  3KZI H;  2ZJS E;  2QIW A;  4H13 D;  2WU2 C;  3L74 J;  1CSB A;  1JOC A;  2ZVN B;  3PP5 A;  4PD4 E;  3WUT A;  3RK3 B;  1ZN5 A;  4D6T E;  1BSN A;  1AV1 A;  1TFF A;  1AJY A;  4LLH A;  2YIU B;  4I7Z C;  3WMM 0;  4PD4 I;  1NTK K;  1VQ9 P;  3GHG B;  3H1I E;  3ZDM A;  5AVR B;  1BCC D;  3CWB D;  2FFD A;  1LWU A;  3L74 G;  1SQB G;  2POH A;  3H1J J;  4GOE A;  2LR2 A;  4GKG A;  1KYO H;  1NTM E;  4ASV A;  3E1I A;  1RQV A;  4C46 A;  2PAJ A;  2KIK A;  1FDM A;  1LJ2 A;  2QEX P;  1QL1 A;  4PD4 H;  1Q86 Q;  2B76 D;  2WP9 D;  1RQU A;  1VQP P;  5TIS E;  5H2F E;  3L37 A;  4N78 D;  4IFM A;  1VQ7 P;  1DD4 A;  2QM7 A;  3B71 A;  3H1J G;  1BE3 J;  3MGN A;  4BXL A;  1PP9 D;  1G1J A;  1IZN B;  4OGQ C;  1ZR4 A;  3BCC G;  1ZME C;  2V7Q H;  1T8Z A;  1IFD A;  1MKM A;  1VQ8 P;  4ZKU A;  4BRY A;  1EDK A;  2I1K A;  2KOG A;  2RH0 A;  1MUU A;  2JJL A;  3L74 E;  2I1J A;  1HJB A;  1QX8 A;  1GL2 B;  2QJY C;  2V4H A;  1A02 F;  1FJP A;  2YMK A;  4ASW A;  2PFX A;  4QMA A;  3TGU J;  1CZQ A;  2K3R A;  5TIS H;  1E79 H;  4UB8 E;  1OVV A;  1QGK B;  2YNY A;  1KC8 Q;  3N4X A;  5K5G B;  1EZV G;  3SFD C;  1EXI A;  3VMA A;  3UIA A;  3H1J E;  1IFM A;  1OW7 A;  2K88 A;  3S1K A;  3AE7 C;  3G9R A;  3P4R D;  1IC2 A;  3A7O A;  3TGU G;  3L72 D;  1HBW A;  5AW1 B;  3M9H A;  4DHJ A;  4UB8 H;  2FFD C;  1LWU C;  2Z5I A;  1K9M Q;  1BE3 E;  4H13 B;  1LTG C;  1OX3 A;  3VP8 A;  1SQP D;  2KNC B;  1JB0 J;  1HH0 A;  2LKM A;  2AXC A;  2HLO A;  1NAY A;  3RL0 C;  3H1L D;  1VF5 D;  2HR3 A;  2GA1 A;  2KZI A;  1EZV E;  3KQG A;  3L75 D;  2C0X A;  1SLQ A;  2WZ7 A;  3GF3 A;  3L70 J;  5BU8 B;  1L0L D;  3L4F A;  4YXD C;  2D2C B;  1SQP E;  5KJ7 D;  2BS2 C;  1FE6 A;  2NPS A;  2JO1 A;  1KZU B;  3P8C D;  3TGU E;  4TT3 H;  3VOP A;  3H1H J;  3N7N A;  4AYC A;  3CD6 P;  1OZH A;  3CC7 P;  1YQ3 C;  5C3J C;  1SFC D;  3AE1 C;  2KLV A;  1L0L E;  3WU2 E;  3M9Q A;  2BEZ F;  2L91 A;  2WSS H;  4W80 A;  2WDV D;  3KXD A;  3P8C E;  4DHI B;  3L70 G;  4L74 A;  3T97 A;  1X9V A;  3AEB C;  2E43 A;  3VRB C;  3OW2 O;  1YQ4 D;  3I5C A;  5AVS B;  2P7J A;  1LTA C;  4Y99 B;  4OWF A;  2KXP B;  3H1H G;  1SQX D;  5CBO A;  3AE2 D;  2FBW D;  1NEN C;  3CIR C;  3H32 B;  3CPW O;  2WSF J;  2R5D A;  2N1T A;  3P4S C;  1IFJ A;  4PV1 D;  1JTH A;  1YJ9 P;  4KJM A;  1DX7 A;  5C2T D;  1LTI C;  2E74 D;  1PFI A;  2J59 M;  2KS1 A;  1L0N J;  1EXJ A;  3P4Q C;  4H44 D;  1FDO A;  2Q7C A;  4JYC A;  1SQX E;  1TU3 F;  2Y9Z A;  4WBA A;  2IFM A;  2HOD A;  1NTZ J;  3LID A;  1KB9 E;  3MHV A;  1M56 D;  5AVQ B;  1M1J A;  4W7Y A;  1Q81 Q;  1SQP K;  3LW5 J;  5CCH D;  2XNX A;  2YXQ B;  1MFZ A;  3E1R A;  1NWQ A;  3L70 E;  2K9J A;  1KB9 I;  2Q6Q A;  1Y8A A;  2XND H;  4YTP C;  3L73 G;  2KSJ A;  3RK2 D;  3K5B A;  1L0L K;  2Y0C A;  3H1H E;  3NTN A;  2Y0D A;  3EWK A;  3JCU E;  1JCC A;  1NTZ G;  2SPZ A;  3NMD A;  2WWW A;  3TNU B;  3RK3 D;  3V6I A;  4A7P A;  1NYH A;  2N9B A;  4RJT A;  1NTK J;  3CMA P;  1KB9 H;  3VRA D;  2YMY A;  1PGJ A;  3V5B A;  2WSE J;  2E75 B;  2NPS C;  1ZOY D;  3GMA A;  4R4L A;  3BRT B;  3RK3 E;  1X8Y A;  1H0T B;  5AVV B;  2XKM A;  3C8V A;  3VMZ A;  1QLB C;  3AE9 D;  2M0B A;  1EQ7 A;  4C7N A;  1P84 D;  1SFC A;  4XFJ A;  3IR9 A;  1KF6 C;  3Q1M A;  2HPC A;  1SQX K;  2BCC J;  2KLU A;  1J1E C;  3M0D A;  1HUC A;  5CCG A;  1FAV A;  1S9K D;  3JCU H;  2J58 A;  1NTK G;  1L0N E;  1NEK D;  3CCR P;  3B5N A;  1S5L X;  1SQQ D;  3VYI A;  5KAF E;  1LTJ C;  2CPB A;  1NTZ E;  1LGH B;  3H1K D;  3PH0 A;  1N2D C;  5B5E E;  3RBX A;  1HGZ A;  2IZ0 A;  4RO0 A;  3RL0 g;  1YI2 P;  2QJP C;  1KQG B;  1MZ9 A;  2JDI H;  4JPZ B;  3HD7 D;  1SQQ E;  2AEF A;  2IBZ D;  3SFE D;  2ZFY A;  2N1T C;  1WRG A;  1K05 A;  1RHZ B;  5KLV J;  2OTL P;  3H1K E;  2KK7 A;  2W6B A;  2WSF H;  1AVO A;  3FXD A;  1GK6 A;  2C0W A;  1QVG O;  2ZAE B;  3FXE A;  1NGM B;  1GW4 A;  3PHL A;  3AEG D;  1RF0 A;  5KAF H;  1M1J C;  1NTK E;  3AE3 D;  3EFF K;  5B5E H;  4H0L C;  4HH2 A;  2IBZ I;  4YTM C;  1IFN A;  3LW5 H;  3VR9 D;  4PV1 B;  4BWN A;  2CK3 H;  4H44 B;  3L71 D;  4UB6 E;  1BCC J;  3CWB J;  3JSV C;  2ZVO B;  3AE4 C;  1NKZ B;  1YIT P;  1L0N K;  1U57 A;  2B87 B;  1NU1 D;  2BCC E;  3U1C A;  5AW5 B;  3VR8 C;  1NKN A;  1N7S D;  1RH5 B;  1VQO P;  3A0H E;  3P8M C;  1AQT A;  4YSZ D;  1L4A D;  1KFY C;  4WVZ A;  2H43 A;  3GHG A;  1SQQ K;  1BCC G;  3CWB G;  3RK2 B;  1URQ D;  1T2K C;  2WSE H;  4YSY C;  4ZMD A;  3AE6 D;  3GF7 A;  1ZRT D;  1PP9 J;  5KLV E;  3M0D C;  3CXH D;  2KYV A;  5CCG C;  2OYI B;  1NH4 A;  1XTG B;  2WS3 C;  5AW7 B;  5CMZ A;  2Y9Y A;  3B5N C;  1E7P C;  1DEB A;  5AW2 B;  1W5C E;  1YBK A;  3P4P C;  4HKZ H;  2P1J A;  3AED C;  2PP6 A;  1ZRT E;  3A0H H;  2D2C D;  3AE8 D;  4WY4 D;  3HTK B;  1FS0 E;  1U7J A;  4IL6 E;  1OW6 A;  4N3Y B;  1GW3 A;  5KLI B;  2ZT9 D;  1FOS F;  4AQR D;  2IYO A;  2Q3E A;  2PRR A;  1HF9 A;  1IFP A;  1BCC E;  1FZG A;  3CWB E;  1CI6 B;  3V2P A;  4L76 A;  1JMM A;  1Y47 A;  2DW3 A;  3FWL A;  4Z1M H;  1GL2 A;  4EOT A;  3OA7 A;  4C7R A;  3P32 A;  3CX5 D;  1RF0 C;  3WUV A;  2BAS A;  1A02 J;  3L72 J;  1NU1 K;  2WQY D;  3IFM A;  3HD7 B;  1JEK A;  3O8Z A;  3R2P A;  4IL6 H;  3R4Y A;  2B89 A;  3P7K A;  1H8A A;  5KLV K;  4N78 E;  5KKZ B;  1SQB D;  1BGY D;  3L36 A;  3FGA D;  2H88 C;  1K8A Q;  3AEF D;  5KTB A;  1PP9 E;  4YT0 D;  1N73 B;  3TF5 A;  1SQP J;  2BS3 C;  1FOS E;  1BE3 G;  1YTZ I;  3GLM A;  2ZYD A;  5H2F H;  3H1L J;  2YIU C;  2H89 D;  5CJ0 A;  3L75 J;  1ZP0 C;  2WIT A;  2WVR A;  5CBN A;  3M0A A;  1FZB A;  3IF4 A;  3GHG C;  1L0L J;  4L75 A;  1GK4 A;  1X0T A;  2ZXX A;  2QG4 A;  3CCS P;  1VQM P;  3A0B E;  2QM8 A;  3BCC D;  2HYN A;  1S3J A;  1UIX A;  1SQP G;  2R3S A;  1R8E A;  2KNC A;  2FYU D;  1KIL D;  2RMZ A;  3AE5 C;  1M8O B;  1N7S B;  4U7J A;  3H1L G;  2OYH B;  1MV8 A;  2KZJ A;  4KT0 J;  1L4A B;  3L75 G;  3FX0 A;  2ACZ C;  2QSI A;  1L0L G;  2WU5 D;  1BDD A;  2E75 D;  1LT9 B;  1OMI A;  1ZV8 A;  2Q3I A;  5AW8 B;  1URQ B;  2IYP A;  1RF1 B;  5KAI E;  2KB7 P;  2E76 D;  3L72 E;  1Q2N A;  1SQX J;  1HTL C;  2UWJ E;  4KX6 C;  1S1C X;  2ZYG A;  3A0B H;  5CHX A;  3U59 A;  3GG2 A;  2WDQ C;  2VRS A;  2M5A B;  1GL2 C;  1PGP A;  1EDL A;  1GZL A;  1L0V D;  4WY4 B;  2K9Y A;  2XZR A;  1LTS C;  1SQX G;  3H1L E;  3CCJ P;  3II6 A;  4HJG H;  1YHQ P;  3H32 A;  3L75 E;  2ZT9 B;  5KAI H;  3BAS A;  2IX7 C;  2WTY A;  3AEC D;  2WMM A;  3GW6 A;  4YSX D;  3ABV C;  2WU2 D;  4LC1 A;  3AEA C;  5AW4 B;  2XV5 A;  3SWY A;  2GUV A;  5AW6 B;  3AEE C;  3W68 A;  1RY3 A;  1HGV A;  2WPV B;  5AW9 B;  3PRJ A;  1S2E A;  3G3Z A;  1IFI A;  2FYU K;  2OYO A;  2W6A A;  1K73 Q;  1FZC B;  2QJK C;  1L2P A;  2H8P D;  1M90 Q;  2QE7 H;  3F5H A;  1FZA A;  3QWO C;  2JWA A;  1LP1 B;  2ZXE B;  4XE5 B;  4H13 C;  2Q1K A;  1FJK A;  5DJU B;  5DJT B;  3FWN A;  3CC2 P;  3WU2 H;  1LTT C;  5E79 E;  5APV A;  1EDJ A;  3TNU A;  3Q5S A;  4TLF A;  1VQ5 P;  1K04 A;  1S4X A;  2Q9I A;  1IK7 A;  2JP3 A;  1SQQ J;  1LTJ B;  4B86 A;  3C9I A;  5APX A;  1PPJ D;  1LNQ A;  3H1K J;  3HRN A;  1L0N G;  3LIE A;  2A06 D;  1H0T A;  4WWI A;  2XDJ A;  4GOD A;  1MFT A;  4OGQ D;  1WMK A;  1KIL B;  1G1I A;  3HE4 B;  3VN0 A;  5E79 H;  1GU5 A;  2B76 C;  2WP9 C;  5BU5 A;  1SQQ G;  2IZ1 A;  1J1D C;  1BSH A;  5KJ7 A;  3H1K G;  1JUN A;  1GU4 A;  3CCE P;  1JY2 O;  1R5S A;  2E76 B;  1QVF O;  1YTZ T;  1KTM A;  1JMB A;  5APW A;  3HUS B;  3HE5 B;  2AXT E;  1HVV A;  2IBZ G;  4JQ0 D;  1D7M A;  3D71 A;  4R4M A;  1M57 D;  1VQN P;  3L73 D;  4YTN C;  1WT6 A;  1KFN A;  4IFD K;  1HWT C;  3SFD D;  3L71 J;  2GM4 A;  3AE7 D;  1JCD A;  1Q90 D;  1QLE D;  1P84 E;  2N9Y B;  2OGU A;  3C1L A;  1NU1 J;  1SQV D;  4HB1 A;  1DEE G;  5TJH A;  2WPR A;  3EQ2 A;  3BRV B;  1SP4 A;  1S9K E;  4ZNC A;  2JR8 A;  1W2B O;  1XTC C;  2QA4 P;  1P84 I;  2ACZ D;  2O1J A;  2BCC G;  2W83 C;  5AVY B;  3OJA B;  2W90 A;  2AXT H;  1G2C B;  2NZ2 A;  3D6Z A;  3EFG A;  2G8Y A;  1VQ4 P;  2B87 A;  4OH8 B;  4U3F D;  1NU1 G;  2IBZ E;  3P4R C;  3ITK A;  2KI7 B;  2QVA A;  4DT0 A;  2M3B A;  2W6J H;  5CCH A;  3RL0 D;  1P84 H;  2OAR A;  1LTB C;  3O6Q B;  1ZXG A;  4I7Z B;  5KLV G;  3VP9 A;  2OTJ P;  4XA4 A;  1H89 A;  1IK9 A;  2YXR B;  1YJN P;  4YXD D;  4U3F E;  2KUB A;  2WT7 B;  4K3A A;  2OQQ A;  2M3E A;  3KDP B;  1NVO A;  1YQ3 D;  5C3J D;  1OWA A;  3F89 A;  2OYI A;  3AE1 D;  3VTP C;  1VF5 C;  1KOR A;  1KQS O;  3L71 E;  3B4S A;  1USD A;  5AVZ B;  5AVW B;  3AEB D;  3MD0 A;  4CPG A;  3MP7 B;  5KJ7 C;  3SWK A;  1E5W A;  3VRB D;  3G71 P;  1NU1 E;  1KYO D;  3U1A A;  3HTK A;  2O1K A;  1GDT A;  3PJS K;  1SQV K;  1NEN D;  3TYY A;  4OGQ B;  4PD4 D;  3CIR D;  1SFC C;  4D6T D;  4UB6 H;  1LT1 A;  1OVU A;  3P4S D;  2W8Z A;  2WDV C;  3RGU A;  1KYO E;  2FYN C;  3TSI A;  4O9B A;  1VQ6 P;  3P4Q D;  1CI6 A;  1SQB J;  3W67 A;  1BGY J;  3M06 A;  4PJ0 E;  4L73 A;  3H1I D;  1YQ4 C;  2QJY B;  1KYO I;  3NFQ A;  1IJD B;  5GTI E;  3CXH E;  3RBZ A;  3AE2 C;  2FBW C;  2YKO A;  3KPE A;  4JBZ A;  2J5U A;  1PV3 A;  4DCK A;  3M9B A;  1PGQ A;  3HD7 A;  1NTM D;  4EYY Q;  1PP9 G;  1KN7 A;  3M91 A;  4PV1 C;  5B66 E;  5C2T C;  2A45 G;  3CXH I;  3USS A;  2E74 C;  4H44 C;  1YJW P;  4YTP D;  1AVY A;  1M1K Q;  4NPD A;  1BGY G;  1FZF A;  4OVN F;  5AVT B;  1N73 A;  3BCC J;  1DIP A;  3CLQ A;  3NXS A;  2FYU J; 
#chains in the Genus database with same CATH homology
 2E76 C;  3AED D;  3AE7 D;  3FGA D;  3H25 A;  1Q90 D;  2H88 C;  3Q5S A;  1KIL E;  2V7Q J;  3AEF D;  4H0L B;  3AEB D;  4YT0 D;  1K04 A;  1YQ3 C;  1ZP0 D;  5C3J C;  3VRB D;  3EWK A;  2WS3 C;  3AE1 C;  5M1B A;  2WDQ C;  1IK7 A;  2BS3 C;  2JP3 A;  3SFD C;  3SFE C;  2BEZ F;  1EXI A;  3Q5R A;  4TT3 H;  1E7P C;  3AE6 C;  1HJ0 A;  1FDI A;  3P4P C;  1L0V D;  4H0L D;  2WDV D;  2E74 B;  3GLM A;  1NGM B;  1OW7 A;  4YTM D;  3AED C;  3AE7 C;  1PL5 A;  1RQV A;  1NYH A;  3G9R A;  2K9Y A;  2ACZ D;  2WDR C;  1KQF B;  4IL6 X;  2YIU C;  3AEF C;  1ZRT E;  3AEG D;  2H89 D;  3IAO A;  3AEB C;  1NEN D;  4YT0 C;  1ZP0 C;  4OGQ B;  2D2C D;  3AE8 D;  5KKZ C;  3CIR D;  3P4R D;  3VRB C;  2FXP A;  3VRA D;  2ZT9 B;  3ABV D;  3AE3 D;  2NZ2 A;  3P4S D;  2WSE J;  4Y28 J;  1YQ4 D;  4RKU J;  2B76 D;  2WP9 D;  3AEA D;  2E75 B;  3AE5 D;  1RQU A;  4H0L C;  3Q5P A;  1L0V C;  2WDV C;  3D6Z A;  3AE4 D;  1VF5 B;  2FYN C;  1KF6 D;  4YTM C;  4OGQ D;  1ZOY D;  1OW6 A;  3GMA A;  4R4L A;  1WMK A;  3T97 B;  3VR9 D;  4PV1 B;  2G8Y A;  3AE2 D;  3AEG C;  2FBW D;  3RK3 E;  3AEC D;  2H89 C;  3AEE D;  2ZT9 D;  1NEN C;  3P4Q D;  4YTN D;  3O6Q A;  3D6Y A;  2D2C C;  3AE8 C;  3CIR C;  3C8V A;  3P4R C;  1DD4 A;  2WSF J;  3Q3D A;  1QLB C;  3AE9 D;  3VRA C;  3B71 A;  1UIX A;  4H44 B;  4YSX D;  3S9O A;  1R8E A;  1HF9 A;  3ABV C;  3VR8 D;  3AE3 C;  2WU2 D;  3P4S C;  2G3A A;  1YQ4 C;  2B76 C;  3AEA C;  2WP9 C;  4PV1 D;  3AE5 C;  3AE4 C;  5C2T D;  1GMJ A;  4XFJ A;  1KF6 C;  3Q1M A;  4H13 B;  1KMI Z;  1Y9B A;  1ZOY C;  1U57 A;  2E74 D;  4OGQ C;  4U7J A;  1ZME C;  3VR9 C;  3AE2 C;  2FBW C;  1EXJ A;  3AEC C;  3P4Q C;  3AEE C;  4H44 D;  2ZT9 C;  1KFY D;  1FDO A;  2J5U A;  1PV3 A;  2MKV A;  3IN6 A;  4I7Z B;  4KT0 J;  4Z1M H;  1NEK D;  3Q2Y A;  3AE9 C;  4GDO A;  1MKM A;  2WPV B;  2ACZ C;  4YSX C;  1TU3 F;  1S5L X;  3VR8 C;  2QIW A;  1JB0 J;  2QSI A;  4H13 D;  2WU2 C;  4YXD D;  2E76 B;  1PIX A;  4KX6 D;  4PV1 C;  2WU5 D;  2QJK C;  5KLI C;  2E75 D;  1KTM A;  5C2T C;  2BEQ D;  1OMI A;  4YSZ D;  2E74 C;  1VF5 D;  4YSY D;  2WDR D;  3D70 A;  2WQY D;  2OQQ A;  1OW8 A;  4H44 C;  2P10 A;  1VL2 A;  1KFY C;  4YTP D;  3LW5 J;  2E76 D;  2QJY C;  1NEK C;  3GF3 A;  2IDB A;  3D71 A;  4R4M A;  2H88 D;  2O01 J;  3RL0 g;  2YMK A;  4H13 C;  4YXD C;  2QJP C;  4YTN C;  1KQG B;  2D2C B;  2BS4 C;  4KX6 C;  1S1C X;  1YQ3 D;  2WU5 C;  1AJY A;  2BS2 C;  5C3J D;  2WSC J;  3R4Y A;  2WS3 D;  2E75 C;  3AE1 D;  2WDQ D;  4I7Z C;  5L8R J;  4YSZ C;  2JO1 A;  3SFD D;  1VF5 C;  4YSY C;  3SFE D;  1KOR A;  2WQY C;  3AE6 D;  3GF7 A;  1DIP A;  1DD3 A;  1K05 A;  4YTP C;  3P4P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...