3AE4C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae4C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae4C02
3P4RC 4YSXC 1L0VC 1ZP0D 1KFYD 3AEED 4YTPD 3ABVC 4YSYC 3AEGC 3P4QC 3P4PD 4YSZC 4KX6C 3VRBD 3AE1D 4YTMC 3VR9C 1NENC 3AE5D 3AEFC 4YT0C 5C2TD 2WU2D 1KF6C 3AE2D 3AEAC 3AECD 2WDVC 2H88C 2FBWC 2ACZD 5C3JD 2BS3C 2WDQD 3AE8D 4YTNC 2WS3C 2WP9C 1K04A 3SFDC 3P4RD 4YSXD 1YQ3C 3AEBC 2H89D 3ABVD 3AEDC 2BS2C 4YSYD 3P4QD 4YSZD 1OW7A 1KFYC 1QLBC 4KX6D 3AE6C 3VR9D 3AE3C 1E7PC 1NEND 3SFED 2BS4C 2WDRD 4YT0D 1KF6D 3CIRC 3AEAD 1ZOYC 2WDVD 3P4SC 3AE9C 2H88D 3VRAC 2FBWD 1YQ4C 2WU5C 3AE7C 1L0VD 1NEKC 4YXDC 3AE4C 1PV3A 1OW6A 4YTND 2WS3D 2WP9D 3VR8C 2B76C 5C2TC 3SFDD 2WQYC 1KTMA 1YQ3D 3AEBD 3S9OA 3AEGD 1K05A 1ZP0C 4YTMD 3AE8C 3AEEC 4YTPC 3B71A 2H89C 3AE6D 3P4PC 3AEFD 3AE3D 3VRBC 3AE1C 3AE5C 3CIRD 1ZOYD 2G3AA 3P4SD 3AE9D 3VRAD 2WU2C 3AE2C 3AECC 3SFEC 1YQ4D 2WU5D 3AE7D 1NEKD 4YXDD 2WDRC 3AE4D 2ACZC 5C3JC 3VR8D 2B76D 1OW8A 2WQYD 3AEDD 2WDQC
chains in the Genus database with same CATH superfamily
1L0VC 1YYCA 1LTJB 3S1KA 1OX3A 1VF5B 5CCHA 4YSYC 3H1KD 3H1IG 3E1RA 2OGUA 1PZQA 3P8CE 5APUA 4RESB 2FFDC 4YT0C 1SQXJ 2PGDA 1KF6C 1YHQP 3FX0A 3S4RA 3U1AA 2QM8A 1SQBK 3V6IA 5C39A 2WSSH 3RL0g 2M0BA 5CCGA 3P8MC 2I1JA 1HWTC 4JYBA 1QLBC 1N7SD 3FWLA 1LWUA 2NPSA 1NTMG 5AVZB 1ZOYC 3H1HD 2WT7A 2P1JA 1HUCA 1BE3G 1JY3N 3IFMA 2FYUE 2K37A 2K9YA 1VQ8P 1H0TB 1SFCA 3CX5E 3L75E 1X79B 4EDFA 2C0WA 3VN0A 2FY8A 5AVXB 2B88A 3LW5J 1W5CE 3L71E 2QG4A 5KTBA 2Y9YA 1KFNA 3VRAD 2I8DA 3BRVB 1Q2NA 3FXEA 1VQLP 2QJKB 4KT0J 5CHXA 1VQNP 3V2RA 2ZFCA 3L72D 1OVUA 2FYUG 5KLVE 1H89A 3O8ZA 2MJZA 1N7SC 3HE4B 1X9VA 1J1EB 3AE5D 1JEKA 1OWAA 1AQ5A 2C9NY 3L71G 3M0AA 2AXTH 4Y99B 4LGDE 2LXBA 3B8EB 2Q3IA 4MN4C 3P32A 4DHJA 3G3ZA 2YMYA 1H0TA 4KX6D 1GDTA 2P10A 3GF7A 3Q5RA 3MIWA 1SQQG 2W6AA 3HD7B 3V2QA 4CPGA 3VRAC 1FU1A 2O01H 1R5LA 3CI9A 5C2TC 3HUSC 1NAYA 4L75A 3G6EP 3TGUE 1KB9H 5H2FE 1PP9G 3M0DC 2FFDB 1BCCG 5TISH 1SQVG 1Q90D 2BEQD 1HVVA 3NTNA 2E74B 3IAOA 4GT1A 1KN7A 3AE5C 1J2JB 2XU6A 3H1KG 3HE4A 3EWKA 1ZXGA 3H1IJ 4BXLA 1N73B 2V4HA 1OW8A 2WQYD 3AEDD 1SQPJ 4U7JA 2W27A 4IFFA 1YTZT 1VQ7P 1BGYD 5APQA 4KX6C 2Y0EA 1GL2C 4OGQD 1JCCA 4PD4H 1OIPA 4XE5B 1JO5A 2QVAA 3RK3D 1P84E 4DOJA 3AECD 2B89A 3KYQA 2V7QH 5GTHH 2N1TB 1FBMA 3P7KA 2ZYDA 3CX5H 2B9BA 2P2UA 3HD7A 2E43A 4BRYB 4YSXD 1RQUA 3H1HG 3W67A 2M3EA 3OA7A 1FJPA 4H0LD 2R3CA 2RKLA 5CCHD 1W2BO 1RE4A 3L70E 2MKVA 1K9MQ 2BS4C 3Q3DA 3CC2P 2W8ZA 5KLIB 2FBWD 1GTWA 2KNCB 4Y28J 2WP9D 2WQYC 3AEBD 1N73A 1IFJA 2WPQA 1YBKA 4OVNF 5TJHA 5CCGD 2FYNB 1G2CB 3AE3D 3I55P 4OGQC 1NKNA 3CD6P 1KYOE 2FYUJ 2NPSD 3WUTA 1XTCC 3RK3C 4JPZB 3GHGB 3AECC 2V7QJ 1OFCX 2LR2A 2N1TA 2WPVB 4YSXC 1LTTC 3A7OA 1SFCD 4BRYA 1AVOA 3L71J 4H0LC 2NRGA 3P4PD 1NU1K 5CCHC 2G8YA 5AVYB 1VF5D 1ZRTD 1VQKP 2QJPB 2YIUC 3HE5B 4K3AA 1SQXE 5GTIE 2FBWC 2JWDA 1L0NK 3BCCE 5KLVJ 2E75B 2WP9C 1SLQA 2WPSA 3AEBC 2P7JA 1SVFA 4N3YB 1RE3A 5AW1B 3P4QD 5CCGC 2IBZD 3VR9D 3AE3C 3KQGA 1RF1A 2YKQA 4U3FE 1G2CA 3AEAD 2JEEA 5APSA 2NPSC 2H88D 4C7NA 1FDOA 1KQLA 1OW6A 4YTND 1GL2B 3GHGA 2WVRA 3N7NA 3S9OA 1M56D 2KLUA 1BSNA 1SFCC 3P4PC 2BEZF 1FZGA 2IZ1A 2C0XA 3L4FA 5BVZA 2B87B 2Y9ZA 3AE9D 3TGUJ 1BGYG 3A5TA 2WTYA 2WDRC 3D6YA 3HE5A 1PIXA 4IL6H 2RMZA 3M9BA 1LTGC 1IC2A 2PP6A 4N78D 3E7KA 5B66E 3P4QC 1NOHA 5APXA 2QSIA 3JCUE 3CCRP 1NTZE 3VMYA 2ZVOB 3VR9C 1ZLLA 1DH3A 1FOSF 1KB9D 3VMZA 3AEAC 2IYPA 2H88C 5C3JD 4YTNC 1K04A 2XV5A 2ZXEB 3CLQA 1SS1A 2YNYA 5AVQB 1AVYA 3ABVD 1Q86Q 4PV1B 1KYOH 1SQBD 3CCSP 1KFYC 4DZOA 1T3UA 1DX7A 3VMXA 3AE9C 2B87A 2QJYB 1L0VD 1EQ7A 4HYTB 4AYCA 2K88A 2UWJE 5AW3B 4D6TD 3PLNA 1RQVA 3HD7D 1IK9A 1VQ6P 1K05A 1OVRA 1IK7A 4PD4D 4WWIA 3JC22 2A06D 2QJKC 5CBNA 1RH5B 2H89C 3CCQP 3ITKA 1S4XA 3WUVA 1LTSC 2OTJP 5KAFE 2E74D 3GG2A 1L0LE 2WSCJ 1J1EC 5C3JC 2AEFA 1N7LA 3H1JD 1SQPK 3MHVA 4I6MC 1QGKB 3CXHH 4LLHA 1LWUB 3ABVC 4Y99C 1BDDA 5AW8B 4RO0A 2HR3A 1G1IA 1S9KE 3VYIA 1DD4A 1PGQA 3IN6A 3A0HE 4AUWA 2FYZA 4DJGA 1L0LG 3HD7C 2N1TD 2IBZI 1G1JA 3QWOC 2N9YB 1NTME 1ZR2A 5CJ0A 1EZVI 3LW5H 2O01N 1YI2P 1BE3E 1RE4C 1LTAC 3BCCJ 4W7YA 1FDMA 1GW3A 3EFGA 4PJ0E 3M06A 1PPJD 1OXZA 2IDBA 2E74C 2W6JH 2A45I 1YJWP 1AA0A 1HGVA 2HG5D 1N73C 2R5BA 4U3FJ 2KI7B 3VONA 2VRSA 1NH4A 3CCMP 2WWWA 1KILB 4AQRD 3MUDA 3SFEC 1EDJA 3CCLP 3VTPC 1IFPA 3L74D 4C46A 5L8RJ 2N1TC 4D6TE 1GK4A 2O3JA 4N6JA 2C9LY 1URQB 3AEGC 3RBZA 1KB9I 1Y47A 2Q7CA 2ZYAA 1W2EA 4YPCA 4H13B 1MUUA 1JY2N 3WU2H 1SQBG 5C2TD 3F5HA 4IOIH 3CCUP 5KLVK 3CCEP 5KLIC 4ZKUA 1NTZJ 3VP8A 2E75D 3MGNA 3B5NA 4KJMA 4WY4B 1JCDA 1SQQE 1JB0J 1RE3C 4D6TG 3H25A 2WITA 5KAFH 2A45H 3USSA 1HBWA 1AQTA 3LIEA 2HYNA 3TF5A 3TDKA 1RF1C 3KDPB 2A06G 2FYNC 1PP9E 1BCCE 1SQVE 5APYA 4PD4I 1WRGA 1RF0A 1PV3A 1VQOP 1KILA 2R3SA 3SWFA 3GHGC 3CX5I 1GL2D 3AE8C 4L74A 3OW2O 3H1KE 1VPCA 3H1JG 1CI6B 1JY2O 1URQA 3CWBD 1K8AQ 1JY2P 2FXPA 4JBZA 2R32A 1VQMP 5AW0B 2YO2A 2QJPC 1IFNA 4LC1A 2KXPB 1IFIA 1A02J 1EXJA 2Q1KA 2ZXXA 2E75C 2NZ2A 4GOFA 4Z1MH 1GU4A 4WY4A 1L0LJ 2XZRA 2E76B 5M1BA 3H1HE 4DDIA 4I2LC 2JO1A 1Y8AA 1NU1D 3Q5SA 2FKWB 1JM0A 1KQSO 3MZWB 1RY3A 4A7PA 2HODB 1S1CX 1PPJG 1PGJA 3G4SP 1S72P 4UB8E 1Q82Q 4GDOA 1L0ND 1UIXA 4YXWH 4YSZD 1OW7A 1DD3A 5E79E 5AVTB 1E7PC 2OYHB 4PV1D 1CI6A 2QIWA 3W68A 2FXMA 1S3JA 1AV1A 1NTMJ 3WUUA 3A0BE 3H1LD 3L72E 2QA4P 1BE3J 1XTGB 1NVOA 5KAIE 1S5LE 3MTUE 3L74G 2KSJA 1H8AA 1BDCA 2OYOA 1FC2C 3NMDA 5AW6B 2H8PD 3CIRD 1NTKK 3GF3A 4W7ZA 5CBOA 3H32B 5APVA 1SQBJ 1RF1B 4ASWA 2HODA 3L72G 2CPSA 2DW3A 4YSZC 1DEEG 1QL1A 3AE1D 4YTMC 4C7NB 2H43A 1ZMEC 4PV1C 1FZCB 1P84I 2OYHA 3NFQA 4D6TJ 1N86A 3VMAA 4ZMDA 1VQ9P 1M7LA 1OMIA 2OTLP 1HTLC 3SSUA 2HLOA 2OARA 4I7ZB 2QJYC 2JKVA 3A3YB 1SQXK 2I1KA 5H2FH 1LTBC 2WDRD 2BCCD 3CIRC 2IX7C 4H44B 1GK6A 1U7MA 3CWBG 1SQQJ 3H32A 1GU5A 1T6AA 1BGYE 4OWFA 2WSEJ 1PP9J 1EZVD 1BCCJ 5AVUB 2CK3H 1SQVJ 3AE1C 4M3LA 1LWUC 2D2CB 1KYOI 1EDIA 1T8ZA 3CPWO 2XKMA 4GOEA 3RK3E 2G3AA 1X0TA 2KZJA 1FZCA 3MUDC 3V2PA 1EDLA 3H1KJ 1KFYD 1P84H 1NU1G 3V5BA 4B86A 2KOGA 1SQPD 1JNMA 4IFMA 4DDGA 3MP7B 1URQD 4ASVA 1L0NG 2ACZD 3BASA 4H13D 4KHXA 2M3BA 2R5DA 1L2PA 2WDQD 1X8YA 3P4RD 1NTZK 3SWYA 2H89D 3CC4P 1S5LX 2Z4EA 1L4AB 3TSIA 3B5NC 2YKOA 3CXHI 3H1HJ 3KZIE 2YXRB 3H1LG 4WY4D 4ZNCA 3P8CD 3Q5PA 2WSCH 3T97B 4WBAA 3JSVC 2WSFJ 1UIIA 2Z5HA 2YKPA 4R4LA 2HFED 1LT1A 3QH9A 3K5BA 1CZQA 1R8EA 2WS3D 1RF0C 4IFDK 1KILC 2KZIA 1IO4A 2KS1B 1M1JB 2JJLA 3ZDMA 2HPCB 1FZEA 2W83C 3AE6D 2KYVA 1ZRTE 1URQC 1VQ5P 5APTA 1WMKA 2E5YA 3L72J 4NPDA 5AW2B 2WU5D 2ACZC 4H13C 4JQ0D 2WDQC 2E42A 5B5EE 3P4RC 1FAVA 5K5GB 3V2NA 3CX5D 3L75D 5GTIH 1LNQA 3I56P 2GA1A 2IBZE 2PRRA 1L4AA 1L0LK 2R44A 3CCJP 4WY4C 2JP3A 4WVZA 2ZYGA 2QRXA 2IFMA 3T97A 1JMBA 2E76D 1R5SA 4W80A 5CMZA 2WS3C 3V4QA 2BCCG 1ZR4A 3GW6A 2W6BA 1YIJP 2BASA 5KLVD 2KS1A 1DIPA 1M1JA 3AE6C 3L73D 2AXTE 1MFTA 1NEND 3SFED 2HPCA 4JF7A 2IBZG 3KPEA 1EDKA 2Q6QA 3Q2YA 3VOPA 1EZVG 4GODA 2WU5C 1NTMK 1KZUB 1HJ0A 4XFJA 1JTHA 1S2EA 2P67A 3AEGD 3TNUB 3PRJA 1U7JA 2O1JA 4N78E 1J1DB 3F89A 4DCKA 2A45G 3L37A 3R2PA 1NO4A 3BRTB 3OJAB 2QM7A 3RK2C 1NU1J 2ZVNB 1KB9E 3P4SD 5TISE 5B66H 1SQPG 1IFMA 3B5NB 3AE7D 2E76C 3JCUH 3AE4D 3D70A 3VP9A 2IPPA 2Y0DA 3KZIH 1BGYJ 1L0NJ 3TGUD 1PGOA 1SQBE 4HJGH 4C7RA 1U57A 1ZN5A 3VRBD 2FYUK 1NENC 1JOCA 4WB4A 1LT9B 3AEFC 3AE2D 1OZHA 2OYHC 4JYCA 3H1LJ 1NGMB 3D6ZA 3AE8D 4PD4E 1NAFA 1WT6A 2A06E 3M9HA 2LXCB 3TNUA 3OAKA 5GTHE 3U59A 3L35A 2WZ7A 5KKZB 1KMIZ 1E79H 5KJ7A 1LTJA 1ZV8A 2KLVA 2YMKA 5AVVB 1GMJA 2JDIH 1P84D 5B5EH 3P4SC 2K3RA 1K73Q 3AE7C 3AE4C 3H1JE 1Q7YQ 1SQQK 4H44D 4QMAA 1KTMA 2WMMA 3H6PA 1M1KQ 2N9BA 3C8VA 1TU3F 3CCVP 3CC7P 1QX8A 4UB6E 1SQVK 3L70D 3VRBC 1IJDB 4I1LA 4DT0A 4K35A 1QVFO 3SWKA 3L73E 3L75G 1M57D 2OYIB 2D2CD 3AE2C 5CJ4A 5AW7B 1LT9A 2IZ0A 1FZCC 3FWNA 2K9JB 5BU8B 1CSBA 3RL0B 1JY3O 1PGPA 5AVSB 1KORA 3M91A 1JY3P 3KHUA 4YTPD 4OH8B 1KV4A 3A0HH 1NTKD 4I7ZC 2IYOA 2BCCJ 4L76A 1X22A 2PFXA 2YXQB 4BWNA 1NJIQ 3GMAA 1MV8A 1PPJE 1KYOD 2IFNA 3NXSA 2AEMA 3R4YA 5KLVG 2ZT9B 2GUVA 2J59M 3EFFK 3L73G 3PH0A 2BS3C 4H44C 1E5WA 3RK2B 4PJ0H 3HTKB 1Q81Q 2BS2C 3PJSK 3PP5A 1L4AD 1GD2E 3B4SA 1M90Q 1LTIC 2D2CC 1HGZA 1SQXD 3BCCD 3L74E 1ZW0A 2OYIA 3SFDD 1DEBA 5AW4B 2XNXA 2K9JA 2Z5IA 2L5GB 4YTMD 5AVWB 4YTPC 3EQ2A 2ZAEB 1Y9BA 5EFWB 3CXHD 5AW9B 2CPBA 1N2DC 3G71P 3TGUG 1H88A 1YTZI 4U3FD 4NPEA 4HB1A 5APWA 1OVVA 3VR8D 3CMAP 2AEJA 4EIJA 2O01J 4I6LA 3HTKA 1YJNP 1PFIA 2KK7A 1FZFA 1L4AC 1VQPP 2SPZA 2FFDA 4IL6E 2QE7H 4RKUJ 5DJTB 1JUNA 2E5TA 2KB7P 1MZ9A 3SFDC 3BVHA 4UB6H 1TFFA 4GKGA 2WSEH 1N7SB 3E1IA 3LIDA 3AEDC 3U1CA 2Q9IA 2KSEA 1NTZD 3CWBE 1N8RQ 1M1JC 1NTKE 3FGAD 2L91A 3A2AA 4O9BA 1MFZA 1FZAA 2JR8A 3L70G 1NHLA 3VR8C 1NKZB 1LP1B 3TK1A 1HF9A 2KUBA 3L75J 2O1KA 2P58A 1YITP 2OTKE 1VDFA 1RHZB 1KC8Q 2POHA 3KXDA 3UIAA 2AXCA 4R4MA 2ZFYA 5KJ7D 3H1JJ 3RBXA 2OQQA 2Q5UA 3HUSB 4GIFA 1NU1E 1NTKG 3IR9A 1USEA 3G9RA 1NEKD 2B76D 2Y0CA 1FJKA 3B5ND 3BATA 2RN0A 1KD1Q 1AFOA 1L0NE 2KNCA 4DHZA 3L73J 2M8RA 1N7SA 1EXIA 2WSFH 4EOTA 1KQFB 4EYYQ 1MKMA 3CXHE 2J58A 4UB8H 1YJ9P 1KILD 1L0LD 3FXDA 5E79H 3C9IA 3H1ID 3H1LE 1QVGO 3I5CA 1LP1A 3L36A 1SQXG 5AW5B 1FZBA 1A02F 1IFDA 3BCCG 3N4XA 3O6QB 1EC5A 3A0BH 4TLFA 3IF4A 2QEXP 2ITAA 4HKZH 5AVRB 1SP4A 1J1DC 1S9KD 5KJ7C 1PL5A 1LTJC 1HH0A 3V4WA 2WDVD 5KAIH 1VF5C 1S5LH 1QLED 3HUSA 1NEKC 1KFMA 1FDIA 1CW5A 1VL2A 1KQGB 1M8OB 2B76C 1YQ3D 4U3FG 3M0DA 3MD0A 1D7MA 2GUSA 1NTMD 4NPFX 4RJTA 1T2KD 2M5AB 3HRNA 3Q1MA 4IL6X 2LKMA 1BE3D 4DHIB 3L74J 2J5UA 1BSHA 1YQ4D 4YXDD 3C1LA 1FS0E 1LT9C 2H7HA 1GW4A 1ZP0D 3TYYA 3AEED 4OGQB 3RL0D 1HJBA 3II6A 1GL2A 5BU5A 3RK3B 1JMMA 2JWAA 4L73A 5DJUB 2BCCE 1LGHB 1JTHB 3O6QA 1T3JA 4FJVA 1Z56A 2WU2D 1IZNB 5KKZC 2WDVC 1GZLA 2FYUD 1NTZG 3PHLA 4H0LB 1QEXA 2ZT9D 1AJYA 1YQ3C 2FXOA 1VQ4P 3WU2E 4YSYD 3L70J 2YIUB 3RK2D 1NWQA 1EZVE 1T2KC 1USDA 3L71D 2M5AA 4YT0D 2W90A 1KF6D 4LDTA 1QL2A 2K1AA 1YQ4C 2WPRA 4YXDC 4TT3H 1KILE 2XNDH 2OYIC 2ZJSE 3CMEP 3H1IE 3PTZA 3CWBJ 1ZP0C 3WMM0 1NTKJ 3AEEC 4HH2A 1FE6A 2GM4A 3RL0C 3B71A 1SQQD 3M9QA 1NYHA 1SQPE 3D71A 2PAJA 2RH0A 4XA4A 3AEFD 2NPSB 3CL3D 2WT7B 4EI2A 2KP8A 1FOSE 2XDJA 1ZOYD 1LJ2A 1PP9D 2Q3EA 2WU2C 1BCCD 4ZKPA 1SQVD 2YO3A 3RGUA 2KIKA 3GLMA 1SFCB 2ZT9C
chains in the Genus database with same CATH topology
3P4RC 2WPVB 4YSXC 5L8RJ 1KORA 1L0VC 1ZP0D 1KFYD 3AEED 4YTPD 1EXJA 4OGQB 3VR8C 2E75C 3ABVC 1VF5B 4H0LC 2NZ2A 4Z1MH 4YSYC 3AEGC 3P4QC 3P4PD 4YSZC 2QSIA 1EXIA 4I7ZC 1U57A 4KX6C 3VRBD 3AE1D 4YTMC 1KQFB 4OGQD 3VR9C 2G8YA 1MKMA 1VF5D 1ZMEC 2E76B 1NENC 4PV1C 3AE5D 5M1BA 3O6QA 4H13B 2JP3A 4RKUJ 5C2TC 3GMAA 2YIUC 3AEFC 4YT0C 3R4YA 2JO1A 5C2TD 2WU2D 1KF6C 1DD4A 3AE2D 3AEAC 5KKZC 3AECD 2ZT9B 3IN6A 2WDVC 2H88C 3Q5SA 2E76D 2FBWC 2ACZD 5C3JD 4H13D 1NGMB 3D6ZA 2BS3C 2E75B 2WDQD 4H0LB 3AE8D 2WS3C 2WP9C 4YTNC 1K04A 1OMIA 2ZT9D 4H44C 3SFDC 1AJYA 5KLIC 3P4RD 4YSXD 1YQ3C 3AEBC 1S1CX 3RL0g 1RQUA 4I7ZB 2H89D 2QJYC 4GDOA 2E75D 1S5LX 3ABVD 3AEDC 4H0LD 1UIXA 2BS2C 4PV1B 4YSYD 1JB0J 3P4QD 4YSZD 1OW7A 3H25A 2WS3D 1KFYC 1QLBC 4KX6D 1DIPA 1DD3A 3AE6C 2MKVA 1KMIZ 3VR9D 3AE3C 1E7PC 2P10A 1NEND 4PV1D 3FGAD 3SFED 3Q5PA 3T97B 2BS4C 2YMKA 2WDRD 3Q3DA 1PL5A 4YT0D 2QIWA 1GMJA 3GF7A 3Q5RA 2FYNC 2WSFJ 1KF6D 3AEAD 1ZOYC 3CIRC 2WDVD 4H44B 3P4SC 2IDBA 1VF5C 2E74C 3AE9C 3Q2YA 2H88D 2D2CC 2FBWD 3VRAC 4R4LA 1YQ4C 2WU5C 3AE7C 1FDOA 1L0VD 1NEKC 4YXDC 3AE4C 1PV3A 4Y28J 1OW6A 1FDIA 4TT3H 1R8EA 1HJ0A 1VL2A 1KILE 1KQGB 1RQVA 4XFJA 2B76C 4H44D 2WP9D 3SFDD 2WQYC 1KTMA 1YQ3D 3AEBD 3S9OA 1HF9A 3AEGD 2K9YA 1K05A 1IK7A 1ZP0C 3C8VA 4YTMD 3AE8C 3AEEC 1TU3F 4YTPC 4YTND 1Q90D 2QJKC 3B71A 2BEQD 1NYHA 1Y9BA 2WSEJ 3D71A 2H89C 3AE6D 3P4PC 3AEFD 3AE3D 3Q1MA 4IL6X 2E74B 2BEZF 3AE1C 4R4MA 2D2CB 3VRBC 1ZRTE 4OGQC 3LW5J 3IAOA 3AE5C 2FXPA 3RK3E 2OQQA 3CIRD 1ZOYD 2G3AA 3P4SD 2J5UA 2E74D 3AE9D 3VRAD 2WU2C 2D2CD 3AE2C 3EWKA 1WMKA 3AECC 3G9RA 3SFEC 2V7QJ 2WSCJ 1YQ4D 2WU5D 1NEKD 3AE7D 4YXDD 2E76C 2WDRC 3AE4D 3D6YA 2ACZC 5C3JC 1PIXA 3VR8D 3GLMA 4H13C 3D70A 2B76D 1OW8A 2QJPC 2WQYD 3GF3A 3AEDD 2WDQC 4U7JA 4KT0J 2ZT9C 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4R C;  4YSX C;  1L0V C;  1ZP0 D;  1KFY D;  3AEE D;  4YTP D;  3ABV C;  4YSY C;  3AEG C;  3P4Q C;  3P4P D;  4YSZ C;  4KX6 C;  3VRB D;  3AE1 D;  4YTM C;  3VR9 C;  1NEN C;  3AE5 D;  3AEF C;  4YT0 C;  5C2T D;  2WU2 D;  1KF6 C;  3AE2 D;  3AEA C;  3AEC D;  2WDV C;  2H88 C;  2FBW C;  2ACZ D;  5C3J D;  2BS3 C;  2WDQ D;  3AE8 D;  4YTN C;  2WS3 C;  2WP9 C;  1K04 A;  3SFD C;  3P4R D;  4YSX D;  1YQ3 C;  3AEB C;  2H89 D;  3ABV D;  3AED C;  2BS2 C;  4YSY D;  3P4Q D;  4YSZ D;  1OW7 A;  1KFY C;  1QLB C;  4KX6 D;  3AE6 C;  3VR9 D;  3AE3 C;  1E7P C;  1NEN D;  3SFE D;  2BS4 C;  2WDR D;  4YT0 D;  1KF6 D;  3CIR C;  3AEA D;  1ZOY C;  2WDV D;  3P4S C;  3AE9 C;  2H88 D;  3VRA C;  2FBW D;  1YQ4 C;  2WU5 C;  3AE7 C;  1L0V D;  1NEK C;  4YXD C;  3AE4 C;  1PV3 A;  1OW6 A;  4YTN D;  2WS3 D;  2WP9 D;  3VR8 C;  2B76 C;  5C2T C;  3SFD D;  2WQY C;  1KTM A;  1YQ3 D;  3AEB D;  3S9O A;  3AEG D;  1K05 A;  1ZP0 C;  4YTM D;  3AE8 C;  3AEE C;  4YTP C;  3B71 A;  2H89 C;  3AE6 D;  3P4P C;  3AEF D;  3AE3 D;  3VRB C;  3AE1 C;  3AE5 C;  3CIR D;  1ZOY D;  2G3A A;  3P4S D;  3AE9 D;  3VRA D;  2WU2 C;  3AE2 C;  3AEC C;  3SFE C;  1YQ4 D;  2WU5 D;  3AE7 D;  1NEK D;  4YXD D;  2WDR C;  3AE4 D;  2ACZ C;  5C3J C;  3VR8 D;  2B76 D;  1OW8 A;  2WQY D;  3AED D;  2WDQ C; 
#chains in the Genus database with same CATH topology
 1L0V C;  1YYC A;  1LTJ B;  3S1K A;  1OX3 A;  1VF5 B;  5CCH A;  4YSY C;  3H1K D;  3H1I G;  3E1R A;  2OGU A;  1PZQ A;  3P8C E;  5APU A;  4RES B;  2FFD C;  4YT0 C;  1SQX J;  2PGD A;  1KF6 C;  1YHQ P;  3FX0 A;  3S4R A;  3U1A A;  2QM8 A;  1SQB K;  3V6I A;  5C39 A;  2WSS H;  3RL0 g;  2M0B A;  5CCG A;  3P8M C;  2I1J A;  1HWT C;  4JYB A;  1QLB C;  1N7S D;  3FWL A;  1LWU A;  2NPS A;  1NTM G;  5AVZ B;  1ZOY C;  3H1H D;  2WT7 A;  2P1J A;  1HUC A;  1BE3 G;  1JY3 N;  3IFM A;  2FYU E;  2K37 A;  2K9Y A;  1VQ8 P;  1H0T B;  1SFC A;  3CX5 E;  3L75 E;  1X79 B;  4EDF A;  2C0W A;  3VN0 A;  2FY8 A;  5AVX B;  2B88 A;  3LW5 J;  1W5C E;  3L71 E;  2QG4 A;  5KTB A;  2Y9Y A;  1KFN A;  3VRA D;  2I8D A;  3BRV B;  1Q2N A;  3FXE A;  1VQL P;  2QJK B;  4KT0 J;  5CHX A;  1VQN P;  3V2R A;  2ZFC A;  3L72 D;  1OVU A;  2FYU G;  5KLV E;  1H89 A;  3O8Z A;  2MJZ A;  1N7S C;  3HE4 B;  1X9V A;  1J1E B;  3AE5 D;  1JEK A;  1OWA A;  1AQ5 A;  2C9N Y;  3L71 G;  3M0A A;  2AXT H;  4Y99 B;  4LGD E;  2LXB A;  3B8E B;  2Q3I A;  4MN4 C;  3P32 A;  4DHJ A;  3G3Z A;  2YMY A;  1H0T A;  4KX6 D;  1GDT A;  2P10 A;  3GF7 A;  3Q5R A;  3MIW A;  1SQQ G;  2W6A A;  3HD7 B;  3V2Q A;  4CPG A;  3VRA C;  1FU1 A;  2O01 H;  1R5L A;  3CI9 A;  5C2T C;  3HUS C;  1NAY A;  4L75 A;  3G6E P;  3TGU E;  1KB9 H;  5H2F E;  1PP9 G;  3M0D C;  2FFD B;  1BCC G;  5TIS H;  1SQV G;  1Q90 D;  2BEQ D;  1HVV A;  3NTN A;  2E74 B;  3IAO A;  4GT1 A;  1KN7 A;  3AE5 C;  1J2J B;  2XU6 A;  3H1K G;  3HE4 A;  3EWK A;  1ZXG A;  3H1I J;  4BXL A;  1N73 B;  2V4H A;  1OW8 A;  2WQY D;  3AED D;  1SQP J;  4U7J A;  2W27 A;  4IFF A;  1YTZ T;  1VQ7 P;  1BGY D;  5APQ A;  4KX6 C;  2Y0E A;  1GL2 C;  4OGQ D;  1JCC A;  4PD4 H;  1OIP A;  4XE5 B;  1JO5 A;  2QVA A;  3RK3 D;  1P84 E;  4DOJ A;  3AEC D;  2B89 A;  3KYQ A;  2V7Q H;  5GTH H;  2N1T B;  1FBM A;  3P7K A;  2ZYD A;  3CX5 H;  2B9B A;  2P2U A;  3HD7 A;  2E43 A;  4BRY B;  4YSX D;  1RQU A;  3H1H G;  3W67 A;  2M3E A;  3OA7 A;  1FJP A;  4H0L D;  2R3C A;  2RKL A;  5CCH D;  1W2B O;  1RE4 A;  3L70 E;  2MKV A;  1K9M Q;  2BS4 C;  3Q3D A;  3CC2 P;  2W8Z A;  5KLI B;  2FBW D;  1GTW A;  2KNC B;  4Y28 J;  2WP9 D;  2WQY C;  3AEB D;  1N73 A;  1IFJ A;  2WPQ A;  1YBK A;  4OVN F;  5TJH A;  5CCG D;  2FYN B;  1G2C B;  3AE3 D;  3I55 P;  4OGQ C;  1NKN A;  3CD6 P;  1KYO E;  2FYU J;  2NPS D;  3WUT A;  1XTC C;  3RK3 C;  4JPZ B;  3GHG B;  3AEC C;  2V7Q J;  1OFC X;  2LR2 A;  2N1T A;  2WPV B;  4YSX C;  1LTT C;  3A7O A;  1SFC D;  4BRY A;  1AVO A;  3L71 J;  4H0L C;  2NRG A;  3P4P D;  1NU1 K;  5CCH C;  2G8Y A;  5AVY B;  1VF5 D;  1ZRT D;  1VQK P;  2QJP B;  2YIU C;  3HE5 B;  4K3A A;  1SQX E;  5GTI E;  2FBW C;  2JWD A;  1L0N K;  3BCC E;  5KLV J;  2E75 B;  2WP9 C;  1SLQ A;  2WPS A;  3AEB C;  2P7J A;  1SVF A;  4N3Y B;  1RE3 A;  5AW1 B;  3P4Q D;  5CCG C;  2IBZ D;  3VR9 D;  3AE3 C;  3KQG A;  1RF1 A;  2YKQ A;  4U3F E;  1G2C A;  3AEA D;  2JEE A;  5APS A;  2NPS C;  2H88 D;  4C7N A;  1FDO A;  1KQL A;  1OW6 A;  4YTN D;  1GL2 B;  3GHG A;  2WVR A;  3N7N A;  3S9O A;  1M56 D;  2KLU A;  1BSN A;  1SFC C;  3P4P C;  2BEZ F;  1FZG A;  2IZ1 A;  2C0X A;  3L4F A;  5BVZ A;  2B87 B;  2Y9Z A;  3AE9 D;  3TGU J;  1BGY G;  3A5T A;  2WTY A;  2WDR C;  3D6Y A;  3HE5 A;  1PIX A;  4IL6 H;  2RMZ A;  3M9B A;  1LTG C;  1IC2 A;  2PP6 A;  4N78 D;  3E7K A;  5B66 E;  3P4Q C;  1NOH A;  5APX A;  2QSI A;  3JCU E;  3CCR P;  1NTZ E;  3VMY A;  2ZVO B;  3VR9 C;  1ZLL A;  1DH3 A;  1FOS F;  1KB9 D;  3VMZ A;  3AEA C;  2IYP A;  2H88 C;  5C3J D;  4YTN C;  1K04 A;  2XV5 A;  2ZXE B;  3CLQ A;  1SS1 A;  2YNY A;  5AVQ B;  1AVY A;  3ABV D;  1Q86 Q;  4PV1 B;  1KYO H;  1SQB D;  3CCS P;  1KFY C;  4DZO A;  1T3U A;  1DX7 A;  3VMX A;  3AE9 C;  2B87 A;  2QJY B;  1L0V D;  1EQ7 A;  4HYT B;  4AYC A;  2K88 A;  2UWJ E;  5AW3 B;  4D6T D;  3PLN A;  1RQV A;  3HD7 D;  1IK9 A;  1VQ6 P;  1K05 A;  1OVR A;  1IK7 A;  4PD4 D;  4WWI A;  3JC2 2;  2A06 D;  2QJK C;  5CBN A;  1RH5 B;  2H89 C;  3CCQ P;  3ITK A;  1S4X A;  3WUV A;  1LTS C;  2OTJ P;  5KAF E;  2E74 D;  3GG2 A;  1L0L E;  2WSC J;  1J1E C;  5C3J C;  2AEF A;  1N7L A;  3H1J D;  1SQP K;  3MHV A;  4I6M C;  1QGK B;  3CXH H;  4LLH A;  1LWU B;  3ABV C;  4Y99 C;  1BDD A;  5AW8 B;  4RO0 A;  2HR3 A;  1G1I A;  1S9K E;  3VYI A;  1DD4 A;  1PGQ A;  3IN6 A;  3A0H E;  4AUW A;  2FYZ A;  4DJG A;  1L0L G;  3HD7 C;  2N1T D;  2IBZ I;  1G1J A;  3QWO C;  2N9Y B;  1NTM E;  1ZR2 A;  5CJ0 A;  1EZV I;  3LW5 H;  2O01 N;  1YI2 P;  1BE3 E;  1RE4 C;  1LTA C;  3BCC J;  4W7Y A;  1FDM A;  1GW3 A;  3EFG A;  4PJ0 E;  3M06 A;  1PPJ D;  1OXZ A;  2IDB A;  2E74 C;  2W6J H;  2A45 I;  1YJW P;  1AA0 A;  1HGV A;  2HG5 D;  1N73 C;  2R5B A;  4U3F J;  2KI7 B;  3VON A;  2VRS A;  1NH4 A;  3CCM P;  2WWW A;  1KIL B;  4AQR D;  3MUD A;  3SFE C;  1EDJ A;  3CCL P;  3VTP C;  1IFP A;  3L74 D;  4C46 A;  5L8R J;  2N1T C;  4D6T E;  1GK4 A;  2O3J A;  4N6J A;  2C9L Y;  1URQ B;  3AEG C;  3RBZ A;  1KB9 I;  1Y47 A;  2Q7C A;  2ZYA A;  1W2E A;  4YPC A;  4H13 B;  1MUU A;  1JY2 N;  3WU2 H;  1SQB G;  5C2T D;  3F5H A;  4IOI H;  3CCU P;  5KLV K;  3CCE P;  5KLI C;  4ZKU A;  1NTZ J;  3VP8 A;  2E75 D;  3MGN A;  3B5N A;  4KJM A;  4WY4 B;  1JCD A;  1SQQ E;  1JB0 J;  1RE3 C;  4D6T G;  3H25 A;  2WIT A;  5KAF H;  2A45 H;  3USS A;  1HBW A;  1AQT A;  3LIE A;  2HYN A;  3TF5 A;  3TDK A;  1RF1 C;  3KDP B;  2A06 G;  2FYN C;  1PP9 E;  1BCC E;  1SQV E;  5APY A;  4PD4 I;  1WRG A;  1RF0 A;  1PV3 A;  1VQO P;  1KIL A;  2R3S A;  3SWF A;  3GHG C;  3CX5 I;  1GL2 D;  3AE8 C;  4L74 A;  3OW2 O;  3H1K E;  1VPC A;  3H1J G;  1CI6 B;  1JY2 O;  1URQ A;  3CWB D;  1K8A Q;  1JY2 P;  2FXP A;  4JBZ A;  2R32 A;  1VQM P;  5AW0 B;  2YO2 A;  2QJP C;  1IFN A;  4LC1 A;  2KXP B;  1IFI A;  1A02 J;  1EXJ A;  2Q1K A;  2ZXX A;  2E75 C;  2NZ2 A;  4GOF A;  4Z1M H;  1GU4 A;  4WY4 A;  1L0L J;  2XZR A;  2E76 B;  5M1B A;  3H1H E;  4DDI A;  4I2L C;  2JO1 A;  1Y8A A;  1NU1 D;  3Q5S A;  2FKW B;  1JM0 A;  1KQS O;  3MZW B;  1RY3 A;  4A7P A;  2HOD B;  1S1C X;  1PPJ G;  1PGJ A;  3G4S P;  1S72 P;  4UB8 E;  1Q82 Q;  4GDO A;  1L0N D;  1UIX A;  4YXW H;  4YSZ D;  1OW7 A;  1DD3 A;  5E79 E;  5AVT B;  1E7P C;  2OYH B;  4PV1 D;  1CI6 A;  2QIW A;  3W68 A;  2FXM A;  1S3J A;  1AV1 A;  1NTM J;  3WUU A;  3A0B E;  3H1L D;  3L72 E;  2QA4 P;  1BE3 J;  1XTG B;  1NVO A;  5KAI E;  1S5L E;  3MTU E;  3L74 G;  2KSJ A;  1H8A A;  1BDC A;  2OYO A;  1FC2 C;  3NMD A;  5AW6 B;  2H8P D;  3CIR D;  1NTK K;  3GF3 A;  4W7Z A;  5CBO A;  3H32 B;  5APV A;  1SQB J;  1RF1 B;  4ASW A;  2HOD A;  3L72 G;  2CPS A;  2DW3 A;  4YSZ C;  1DEE G;  1QL1 A;  3AE1 D;  4YTM C;  4C7N B;  2H43 A;  1ZME C;  4PV1 C;  1FZC B;  1P84 I;  2OYH A;  3NFQ A;  4D6T J;  1N86 A;  3VMA A;  4ZMD A;  1VQ9 P;  1M7L A;  1OMI A;  2OTL P;  1HTL C;  3SSU A;  2HLO A;  2OAR A;  4I7Z B;  2QJY C;  2JKV A;  3A3Y B;  1SQX K;  2I1K A;  5H2F H;  1LTB C;  2WDR D;  2BCC D;  3CIR C;  2IX7 C;  4H44 B;  1GK6 A;  1U7M A;  3CWB G;  1SQQ J;  3H32 A;  1GU5 A;  1T6A A;  1BGY E;  4OWF A;  2WSE J;  1PP9 J;  1EZV D;  1BCC J;  5AVU B;  2CK3 H;  1SQV J;  3AE1 C;  4M3L A;  1LWU C;  2D2C B;  1KYO I;  1EDI A;  1T8Z A;  3CPW O;  2XKM A;  4GOE A;  3RK3 E;  2G3A A;  1X0T A;  2KZJ A;  1FZC A;  3MUD C;  3V2P A;  1EDL A;  3H1K J;  1KFY D;  1P84 H;  1NU1 G;  3V5B A;  4B86 A;  2KOG A;  1SQP D;  1JNM A;  4IFM A;  4DDG A;  3MP7 B;  1URQ D;  4ASV A;  1L0N G;  2ACZ D;  3BAS A;  4H13 D;  4KHX A;  2M3B A;  2R5D A;  1L2P A;  2WDQ D;  1X8Y A;  3P4R D;  1NTZ K;  3SWY A;  2H89 D;  3CC4 P;  1S5L X;  2Z4E A;  1L4A B;  3TSI A;  3B5N C;  2YKO A;  3CXH I;  3H1H J;  3KZI E;  2YXR B;  3H1L G;  4WY4 D;  4ZNC A;  3P8C D;  3Q5P A;  2WSC H;  3T97 B;  4WBA A;  3JSV C;  2WSF J;  1UII A;  2Z5H A;  2YKP A;  4R4L A;  2HFE D;  1LT1 A;  3QH9 A;  3K5B A;  1CZQ A;  1R8E A;  2WS3 D;  1RF0 C;  4IFD K;  1KIL C;  2KZI A;  1IO4 A;  2KS1 B;  1M1J B;  2JJL A;  3ZDM A;  2HPC B;  1FZE A;  2W83 C;  3AE6 D;  2KYV A;  1ZRT E;  1URQ C;  1VQ5 P;  5APT A;  1WMK A;  2E5Y A;  3L72 J;  4NPD A;  5AW2 B;  2WU5 D;  2ACZ C;  4H13 C;  4JQ0 D;  2WDQ C;  2E42 A;  5B5E E;  3P4R C;  1FAV A;  5K5G B;  3V2N A;  3CX5 D;  3L75 D;  5GTI H;  1LNQ A;  3I56 P;  2GA1 A;  2IBZ E;  2PRR A;  1L4A A;  1L0L K;  2R44 A;  3CCJ P;  4WY4 C;  2JP3 A;  4WVZ A;  2ZYG A;  2QRX A;  2IFM A;  3T97 A;  1JMB A;  2E76 D;  1R5S A;  4W80 A;  5CMZ A;  2WS3 C;  3V4Q A;  2BCC G;  1ZR4 A;  3GW6 A;  2W6B A;  1YIJ P;  2BAS A;  5KLV D;  2KS1 A;  1DIP A;  1M1J A;  3AE6 C;  3L73 D;  2AXT E;  1MFT A;  1NEN D;  3SFE D;  2HPC A;  4JF7 A;  2IBZ G;  3KPE A;  1EDK A;  2Q6Q A;  3Q2Y A;  3VOP A;  1EZV G;  4GOD A;  2WU5 C;  1NTM K;  1KZU B;  1HJ0 A;  4XFJ A;  1JTH A;  1S2E A;  2P67 A;  3AEG D;  3TNU B;  3PRJ A;  1U7J A;  2O1J A;  4N78 E;  1J1D B;  3F89 A;  4DCK A;  2A45 G;  3L37 A;  3R2P A;  1NO4 A;  3BRT B;  3OJA B;  2QM7 A;  3RK2 C;  1NU1 J;  2ZVN B;  1KB9 E;  3P4S D;  5TIS E;  5B66 H;  1SQP G;  1IFM A;  3B5N B;  3AE7 D;  2E76 C;  3JCU H;  3AE4 D;  3D70 A;  3VP9 A;  2IPP A;  2Y0D A;  3KZI H;  1BGY J;  1L0N J;  3TGU D;  1PGO A;  1SQB E;  4HJG H;  4C7R A;  1U57 A;  1ZN5 A;  3VRB D;  2FYU K;  1NEN C;  1JOC A;  4WB4 A;  1LT9 B;  3AEF C;  3AE2 D;  1OZH A;  2OYH C;  4JYC A;  3H1L J;  1NGM B;  3D6Z A;  3AE8 D;  4PD4 E;  1NAF A;  1WT6 A;  2A06 E;  3M9H A;  2LXC B;  3TNU A;  3OAK A;  5GTH E;  3U59 A;  3L35 A;  2WZ7 A;  5KKZ B;  1KMI Z;  1E79 H;  5KJ7 A;  1LTJ A;  1ZV8 A;  2KLV A;  2YMK A;  5AVV B;  1GMJ A;  2JDI H;  1P84 D;  5B5E H;  3P4S C;  2K3R A;  1K73 Q;  3AE7 C;  3AE4 C;  3H1J E;  1Q7Y Q;  1SQQ K;  4H44 D;  4QMA A;  1KTM A;  2WMM A;  3H6P A;  1M1K Q;  2N9B A;  3C8V A;  1TU3 F;  3CCV P;  3CC7 P;  1QX8 A;  4UB6 E;  1SQV K;  3L70 D;  3VRB C;  1IJD B;  4I1L A;  4DT0 A;  4K35 A;  1QVF O;  3SWK A;  3L73 E;  3L75 G;  1M57 D;  2OYI B;  2D2C D;  3AE2 C;  5CJ4 A;  5AW7 B;  1LT9 A;  2IZ0 A;  1FZC C;  3FWN A;  2K9J B;  5BU8 B;  1CSB A;  3RL0 B;  1JY3 O;  1PGP A;  5AVS B;  1KOR A;  3M91 A;  1JY3 P;  3KHU A;  4YTP D;  4OH8 B;  1KV4 A;  3A0H H;  1NTK D;  4I7Z C;  2IYO A;  2BCC J;  4L76 A;  1X22 A;  2PFX A;  2YXQ B;  4BWN A;  1NJI Q;  3GMA A;  1MV8 A;  1PPJ E;  1KYO D;  2IFN A;  3NXS A;  2AEM A;  3R4Y A;  5KLV G;  2ZT9 B;  2GUV A;  2J59 M;  3EFF K;  3L73 G;  3PH0 A;  2BS3 C;  4H44 C;  1E5W A;  3RK2 B;  4PJ0 H;  3HTK B;  1Q81 Q;  2BS2 C;  3PJS K;  3PP5 A;  1L4A D;  1GD2 E;  3B4S A;  1M90 Q;  1LTI C;  2D2C C;  1HGZ A;  1SQX D;  3BCC D;  3L74 E;  1ZW0 A;  2OYI A;  3SFD D;  1DEB A;  5AW4 B;  2XNX A;  2K9J A;  2Z5I A;  2L5G B;  4YTM D;  5AVW B;  4YTP C;  3EQ2 A;  2ZAE B;  1Y9B A;  5EFW B;  3CXH D;  5AW9 B;  2CPB A;  1N2D C;  3G71 P;  3TGU G;  1H88 A;  1YTZ I;  4U3F D;  4NPE A;  4HB1 A;  5APW A;  1OVV A;  3VR8 D;  3CMA P;  2AEJ A;  4EIJ A;  2O01 J;  4I6L A;  3HTK A;  1YJN P;  1PFI A;  2KK7 A;  1FZF A;  1L4A C;  1VQP P;  2SPZ A;  2FFD A;  4IL6 E;  2QE7 H;  4RKU J;  5DJT B;  1JUN A;  2E5T A;  2KB7 P;  1MZ9 A;  3SFD C;  3BVH A;  4UB6 H;  1TFF A;  4GKG A;  2WSE H;  1N7S B;  3E1I A;  3LID A;  3AED C;  3U1C A;  2Q9I A;  2KSE A;  1NTZ D;  3CWB E;  1N8R Q;  1M1J C;  1NTK E;  3FGA D;  2L91 A;  3A2A A;  4O9B A;  1MFZ A;  1FZA A;  2JR8 A;  3L70 G;  1NHL A;  3VR8 C;  1NKZ B;  1LP1 B;  3TK1 A;  1HF9 A;  2KUB A;  3L75 J;  2O1K A;  2P58 A;  1YIT P;  2OTK E;  1VDF A;  1RHZ B;  1KC8 Q;  2POH A;  3KXD A;  3UIA A;  2AXC A;  4R4M A;  2ZFY A;  5KJ7 D;  3H1J J;  3RBX A;  2OQQ A;  2Q5U A;  3HUS B;  4GIF A;  1NU1 E;  1NTK G;  3IR9 A;  1USE A;  3G9R A;  1NEK D;  2B76 D;  2Y0C A;  1FJK A;  3B5N D;  3BAT A;  2RN0 A;  1KD1 Q;  1AFO A;  1L0N E;  2KNC A;  4DHZ A;  3L73 J;  2M8R A;  1N7S A;  1EXI A;  2WSF H;  4EOT A;  1KQF B;  4EYY Q;  1MKM A;  3CXH E;  2J58 A;  4UB8 H;  1YJ9 P;  1KIL D;  1L0L D;  3FXD A;  5E79 H;  3C9I A;  3H1I D;  3H1L E;  1QVG O;  3I5C A;  1LP1 A;  3L36 A;  1SQX G;  5AW5 B;  1FZB A;  1A02 F;  1IFD A;  3BCC G;  3N4X A;  3O6Q B;  1EC5 A;  3A0B H;  4TLF A;  3IF4 A;  2QEX P;  2ITA A;  4HKZ H;  5AVR B;  1SP4 A;  1J1D C;  1S9K D;  5KJ7 C;  1PL5 A;  1LTJ C;  1HH0 A;  3V4W A;  2WDV D;  5KAI H;  1VF5 C;  1S5L H;  1QLE D;  3HUS A;  1NEK C;  1KFM A;  1FDI A;  1CW5 A;  1VL2 A;  1KQG B;  1M8O B;  2B76 C;  1YQ3 D;  4U3F G;  3M0D A;  3MD0 A;  1D7M A;  2GUS A;  1NTM D;  4NPF X;  4RJT A;  1T2K D;  2M5A B;  3HRN A;  3Q1M A;  4IL6 X;  2LKM A;  1BE3 D;  4DHI B;  3L74 J;  2J5U A;  1BSH A;  1YQ4 D;  4YXD D;  3C1L A;  1FS0 E;  1LT9 C;  2H7H A;  1GW4 A;  1ZP0 D;  3TYY A;  3AEE D;  4OGQ B;  3RL0 D;  1HJB A;  3II6 A;  1GL2 A;  5BU5 A;  3RK3 B;  1JMM A;  2JWA A;  4L73 A;  5DJU B;  2BCC E;  1LGH B;  1JTH B;  3O6Q A;  1T3J A;  4FJV A;  1Z56 A;  2WU2 D;  1IZN B;  5KKZ C;  2WDV C;  1GZL A;  2FYU D;  1NTZ G;  3PHL A;  4H0L B;  1QEX A;  2ZT9 D;  1AJY A;  1YQ3 C;  2FXO A;  1VQ4 P;  3WU2 E;  4YSY D;  3L70 J;  2YIU B;  3RK2 D;  1NWQ A;  1EZV E;  1T2K C;  1USD A;  3L71 D;  2M5A A;  4YT0 D;  2W90 A;  1KF6 D;  4LDT A;  1QL2 A;  2K1A A;  1YQ4 C;  2WPR A;  4YXD C;  4TT3 H;  1KIL E;  2XND H;  2OYI C;  2ZJS E;  3CME P;  3H1I E;  3PTZ A;  3CWB J;  1ZP0 C;  3WMM 0;  1NTK J;  3AEE C;  4HH2 A;  1FE6 A;  2GM4 A;  3RL0 C;  3B71 A;  1SQQ D;  3M9Q A;  1NYH A;  1SQP E;  3D71 A;  2PAJ A;  2RH0 A;  4XA4 A;  3AEF D;  2NPS B;  3CL3 D;  2WT7 B;  4EI2 A;  2KP8 A;  1FOS E;  2XDJ A;  1ZOY D;  1LJ2 A;  1PP9 D;  2Q3E A;  2WU2 C;  1BCC D;  4ZKP A;  1SQV D;  2YO3 A;  3RGU A;  2KIK A;  3GLM A;  1SFC B;  2ZT9 C; 
#chains in the Genus database with same CATH homology
 3P4R C;  2WPV B;  4YSX C;  5L8R J;  1KOR A;  1L0V C;  1ZP0 D;  1KFY D;  3AEE D;  4YTP D;  1EXJ A;  4OGQ B;  3VR8 C;  2E75 C;  3ABV C;  1VF5 B;  4H0L C;  2NZ2 A;  4Z1M H;  4YSY C;  3AEG C;  3P4Q C;  3P4P D;  4YSZ C;  2QSI A;  1EXI A;  4I7Z C;  1U57 A;  4KX6 C;  3VRB D;  3AE1 D;  4YTM C;  1KQF B;  4OGQ D;  3VR9 C;  2G8Y A;  1MKM A;  1VF5 D;  1ZME C;  2E76 B;  1NEN C;  4PV1 C;  3AE5 D;  5M1B A;  3O6Q A;  4H13 B;  2JP3 A;  4RKU J;  5C2T C;  3GMA A;  2YIU C;  3AEF C;  4YT0 C;  3R4Y A;  2JO1 A;  5C2T D;  2WU2 D;  1KF6 C;  1DD4 A;  3AE2 D;  3AEA C;  5KKZ C;  3AEC D;  2ZT9 B;  3IN6 A;  2WDV C;  2H88 C;  3Q5S A;  2E76 D;  2FBW C;  2ACZ D;  5C3J D;  4H13 D;  1NGM B;  3D6Z A;  2BS3 C;  2E75 B;  2WDQ D;  4H0L B;  3AE8 D;  2WS3 C;  2WP9 C;  4YTN C;  1K04 A;  1OMI A;  2ZT9 D;  4H44 C;  3SFD C;  1AJY A;  5KLI C;  3P4R D;  4YSX D;  1YQ3 C;  3AEB C;  1S1C X;  3RL0 g;  1RQU A;  4I7Z B;  2H89 D;  2QJY C;  4GDO A;  2E75 D;  1S5L X;  3ABV D;  3AED C;  4H0L D;  1UIX A;  2BS2 C;  4PV1 B;  4YSY D;  1JB0 J;  3P4Q D;  4YSZ D;  1OW7 A;  3H25 A;  2WS3 D;  1KFY C;  1QLB C;  4KX6 D;  1DIP A;  1DD3 A;  3AE6 C;  2MKV A;  1KMI Z;  3VR9 D;  3AE3 C;  1E7P C;  2P10 A;  1NEN D;  4PV1 D;  3FGA D;  3SFE D;  3Q5P A;  3T97 B;  2BS4 C;  2YMK A;  2WDR D;  3Q3D A;  1PL5 A;  4YT0 D;  2QIW A;  1GMJ A;  3GF7 A;  3Q5R A;  2FYN C;  2WSF J;  1KF6 D;  3AEA D;  1ZOY C;  3CIR C;  2WDV D;  4H44 B;  3P4S C;  2IDB A;  1VF5 C;  2E74 C;  3AE9 C;  3Q2Y A;  2H88 D;  2D2C C;  2FBW D;  3VRA C;  4R4L A;  1YQ4 C;  2WU5 C;  3AE7 C;  1FDO A;  1L0V D;  1NEK C;  4YXD C;  3AE4 C;  1PV3 A;  4Y28 J;  1OW6 A;  1FDI A;  4TT3 H;  1R8E A;  1HJ0 A;  1VL2 A;  1KIL E;  1KQG B;  1RQV A;  4XFJ A;  2B76 C;  4H44 D;  2WP9 D;  3SFD D;  2WQY C;  1KTM A;  1YQ3 D;  3AEB D;  3S9O A;  1HF9 A;  3AEG D;  2K9Y A;  1K05 A;  1IK7 A;  1ZP0 C;  3C8V A;  4YTM D;  3AE8 C;  3AEE C;  1TU3 F;  4YTP C;  4YTN D;  1Q90 D;  2QJK C;  3B71 A;  2BEQ D;  1NYH A;  1Y9B A;  2WSE J;  3D71 A;  2H89 C;  3AE6 D;  3P4P C;  3AEF D;  3AE3 D;  3Q1M A;  4IL6 X;  2E74 B;  2BEZ F;  3AE1 C;  4R4M A;  2D2C B;  3VRB C;  1ZRT E;  4OGQ C;  3LW5 J;  3IAO A;  3AE5 C;  2FXP A;  3RK3 E;  2OQQ A;  3CIR D;  1ZOY D;  2G3A A;  3P4S D;  2J5U A;  2E74 D;  3AE9 D;  3VRA D;  2WU2 C;  2D2C D;  3AE2 C;  3EWK A;  1WMK A;  3AEC C;  3G9R A;  3SFE C;  2V7Q J;  2WSC J;  1YQ4 D;  2WU5 D;  1NEK D;  3AE7 D;  4YXD D;  2E76 C;  2WDR C;  3AE4 D;  3D6Y A;  2ACZ C;  5C3J C;  1PIX A;  3VR8 D;  3GLM A;  4H13 C;  3D70 A;  2B76 D;  1OW8 A;  2QJP C;  2WQY D;  3GF3 A;  3AED D;  2WDQ C;  4U7J A;  4KT0 J;  2ZT9 C;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...