3AE4C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae4C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae4C02
5C3JD 3P4PC 2WU2D 4YXDC 1OW6A 3B71A 3AE3C 3AEEC 3SFDC 1E7PC 2WS3C 2BS3C 3CIRC 1K04A 5C2TC 2H89C 3CIRD 3AE6D 2FBWD 2G3AA 3P4QD 2H88D 4YTMC 4YTPC 3ABVC 1YQ4C 4YTPD 1KTMA 1KF6D 1YQ3D 3AE7C 1ZOYC 2WU5C 4YSXD 3SFDD 4KX6D 3AEBC 3AE4D 4YT0C 3P4QC 4YSZD 1ZP0C 2WDQC 2B76D 3SFEC 3VR9C 2WU2C 2WP9C 3P4SC 2WDRD 2WP9D 3AEFC 3AE2D 1NEND 2WQYD 1K05A 3AE8C 2ACZD 1QLBC 2WQYC 1NENC 3AE8D 3VRBD 3VRBC 1ZP0D 2WDQD 3AE5C 3AE9D 2H88C 2BS2C 1PV3A 4YTMD 4YSYC 1YQ3C 3AE9C 3P4SD 3P4PD 4YSYD 3VRAD 3AE1C 4YXDD 1YQ4D 3AE7D 3AE1D 1KFYC 1NEKD 2BS4C 3P4RD 1KF6C 4YT0D 5C2TD 4YSZC 2H89D 4YTND 3AE6C 1ZOYD 4YSXC 3S9OA 3AEBD 4YTNC 1OW8A 3AE3D 1OW7A 1L0VC 3ABVD 3VR8C 3AE5D 1L0VD 3VRAC 3AEFD 3AEAC 5C3JC 2WDRC 1KFYD 3AEAD 1NEKC 3AEDC 3P4RC 4KX6C 3AEDD 3AE4C 3AEED 2WS3D 3AEGC 3AE2C 3AECC 2ACZC 3AEGD 2FBWC 2WU5D 2B76C 2WDVC 3AECD 3SFED 3VR9D 3VR8D 2WDVD
chains in the Genus database with same CATH superfamily
1HTLC 4YPCA 1OIPA 4I1LA 1RF1A 1KV4A 4ZKUA 2B89A 3HD7A 1E7PC 3H1LE 1SQPJ 2OQQA 2YKPA 3CIRC 2YKQA 4A7PA 2IBZI 3L72G 3TSIA 2H88D 3PTZA 3CMAP 2WPRA 1SQXE 1SQQJ 5CBNA 1L4AC 3PHLA 2JWDA 2FKWB 3CCSP 4O9BA 3L73J 3GHGC 3A0BH 1ZOYC 3A5TA 4LC1A 1ZV8A 4PJ0E 1SQQG 1Q81Q 3SWKA 1OVVA 4PD4I 4D6TJ 1MFTA 2IDBA 5APQA 1GL2A 2YKOA 2MJZA 2E74D 3AEFC 1GU5A 1BE3E 5KLVE 2FYUK 3A7OA 1KB9E 1NTZE 1GK6A 1NTMG 1LT1A 1S5LX 1RHZB 2R3CA 1YQ3C 4NPEA 4ZKPA 1KFYC 1LT9A 1OX3A 1KF6C 3LW5J 3NTNA 1XTCC 5AVXB 4YTND 3AE6C 3EQ2A 3MHVA 3PJSK 1TU3F 2IBZD 2XNDH 3CWBD 3S4RA 3II6A 5KJ7D 2WDRC 1IFIA 3L71D 1SP4A 2GUSA 1JY3N 3WU2E 2JO1A 3L74J 1AVYA 2NRGA 3NMDA 1NAFA 1VF5B 1ZRTE 3RK2C 2FY8A 1KILA 4W7ZA 3WUUA 3L73D 2W6JH 3B5NC 4ASWA 1FAVA 1L0LG 4ZNCA 2KUBA 4Y28J 3M0DA 4D6TD 3M0AA 1T3UA 1EZVI 2YIUC 3H1KG 4PV1C 2OYHC 1FOSF 4ASVA 1RE3A 3PLNA 1NTKG 4DHZA 2ZXEB 3SFEC 3CL3D 5KKZB 1USDA 3TDKA 3A3YB 4HH2A 1FZCA 3CCVP 3BRTB 3KXDA 2HR3A 1PZQA 2ZXXA 3GF7A 1NTME 3MGNA 1DX7A 1PPJD 2KS1B 4C7NA 5APSA 2W8ZA 1NH4A 2WDQD 3JSVC 2H88C 3V6IA 4UB8H 4NPDA 1VQPP 1YQ4D 3PH0A 2HODB 4RKUJ 2OTJP 3P4RD 1DD3A 2BS4C 2Z5IA 4YSZC 1VF5D 1NKZB 1Q7YQ 1KYOE 2R5DA 3VR8C 1L0VD 4MN4C 3R2PA 5AW7B 1RE4C 3WUTA 2J59M 1L0LJ 1IFNA 1J2JB 4I7ZC 3VTPC 2E5TA 2WDVC 1U7MA 2P7JA 1VQKP 1T6AA 1P84E 2WMMA 1ZXGA 2WU2D 1ZN5A 2A06D 1YIJP 3KQGA 4JYBA 5CHXA 4BXLA 3I55P 2RMZA 1QLED 4DDIA 5APWA 3M9HA 1CSBA 1Y9BA 4PD4H 1NVOA 2QJYC 1UIXA 2KI7B 1SQPG 2E74B 5L8RJ 1Y47A 3H1KJ 5GTHE 1JB0J 5DJUB 2CPBA 2OGUA 1BDDA 1FJKA 3IFMA 1OFCX 3Q5PA 3E1RA 1FE6A 2XDJA 2I1JA 3AE2D 3AE8C 1NTMJ 2QSIA 1YBKA 1JY3O 3FGAD 1YTZT 3CCRP 3P4PD 2XV5A 1L0NE 3D6YA 1YJNP 3P8CD 1N7SA 3MD0A 1NKNA 1M1JC 1OW7A 1ZR2A 3IAOA 1J1EC 3G9RA 5C3JC 1L4AA 1NTMK 2HFED 2AXTE 4CPGA 4GOEA 2HODA 2K3RA 3CCQP 1NTKD 3KZIE 2D2CB 3B5NB 5AW5B 2B87A 1KFNA 4WY4C 2BCCG 1LTJC 2WPVB 1VF5C 1HGVA 1NTZG 3TNUB 1YJ9P 2Q5UA 5CCHD 1T3JA 1W5CE 3M9QA 1SQQE 1S72P 5KLIC 3USSA 1BCCD 2OYIC 1YITP 2QEXP 2L91A 1SQBE 3L70E 5GTIH 3SFDD 1L0NG 2E76C 1WMKA 3LW5H 1RQVA 3JCUH 3H1KE 1KMIZ 3B8EB 3L35A 1GW3A 4H13D 1SQXK 1SFCD 5AW9B 1NEND 4BRYA 3LIDA 4PV1D 2FFDA 3H32A 3AE8D 2ZYAA 4DT0A 4C7RA 1NTKK 3P7KA 1N73C 2Y0EA 2ZVOB 1FDMA 3VP8A 2PRRA 2QE7H 2GUVA 2OYIA 2E5YA 2KLUA 3V5BA 3P4RC 2WSEJ 1VQOP 1HGZA 1AJYA 1NJIQ 3AE2C 4RJTA 2WU5D 3AECD 4OH8B 3L74G 1LT9B 2KIKA 1Q90D 2V4HA 5CBOA 3P4PC 4R4MA 3Q3DA 4L74A 1DD4A 3BASA 2IYPA 3AE3C 3AEEC 5AVYB 3CD6P 4DHIB 4WBAA 2QM8A 1R5SA 4D6TE 3FWNA 2JJLA 3ABVC 1KC8Q 3RBXA 3TF5A 1SQXG 1L0LD 2IFNA 1KORA 2O01N 3PP5A 2OTKE 5KKZC 4WY4B 2ZYDA 3AE4D 3GW6A 1HH0A 2E76B 1AV1A 2E42A 3WUVA 4H13C 5CCHC 2YNYA 1G1IA 4XA4A 1Q86Q 1EDJA 3L75E 1CI6A 5AVQB 3CXHI 3V2QA 1S5LE 2AEJA 1FDOA 3SSUA 3AE9D 2BS2C 5AVTB 2C9NY 2Y0CA 1MUUA 1BCCE 1LTGC 1G2CB 3RL0g 1M1JA 2KS1A 1RE3C 3L73G 4YSXC 1KD1Q 1XTGB 5M1BA 1BCCG 1J1DC 1PGOA 3RK2D 2FYUJ 3OAKA 2YO3A 2OARA 1P84D 5TISE 3VR9D 2KB7P 4C46A 4IL6X 5C3JD 4IL6E 1KILB 1JM0A 3Q1MA 1SFCA 2QJPB 5CCGA 3L36A 3GLMA 5APYA 1T2KC 1GU4A 3U1CA 4WB4A 2PP6A 3CWBG 4KT0J 4LGDE 3R4YA 1E79H 1KF6D 2Q3IA 1IZNB 2Y9ZA 1AA0A 3EFFK 4KX6D 1G2CA 2V7QJ 1NTKJ 4YT0C 1HUCA 1EZVD 3IN6A 3BCCE 2R44A 1K05A 4OWFA 1AFOA 2K9YA 5KAFH 1UIIA 1DEBA 2BCCJ 2N1TB 2PFXA 2ZVNB 3AE9C 2KNCB 1KYOD 2GM4A 1R8EA 1L0LE 1FZFA 2YXRB 2HPCB 2FYUD 1LGHB 1IO4A 2Q6QA 1EXJA 2K9JA 1GTWA 1LJ2A 3W68A 3CC7P 5C39A 2VRSA 2P10A 3T97A 3CCLP 1GZLA 2ACZC 2XZRA 1FZAA 2YMYA 2JP3A 2LXBA 2QRXA 3CCUP 1S9KD 1KN7A 2A06G 2H8PD 1NGMB 5APVA 5E79E 3N4XA 2N1TC 1K8AQ 2FBWD 2I8DA 1JEKA 4DCKA 1PL5A 2WPSA 5KJ7C 1LWUC 1YQ4C 3L71E 3MTUE 3HE5B 1SQBJ 3L70J 3MUDC 3HD7D 4OGQD 3AEBC 3BVHA 4LDTA 4PD4D 4H0LB 2HPCA 3CX5I 1M1KQ 4RO0A 1FZCB 1IFPA 3RL0B 3IR9A 4YXWH 2A45H 3WU2H 1GL2C 1ZR4A 2P1JA 3UIAA 2JKVA 4HB1A 1PFIA 2BCCE 3VRBC 3HTKB 2W90A 4YT0D 1KQLA 5KLVK 4DHJA 1BGYE 1URQD 5AW4B 4UB6H 4EI2A 1NEKC 1VQ6P 5APTA 1PIXA 3BCCD 2FFDB 2P67A 2WITA 3HD7C 2OYIB 4IFDK 2W6AA 1RQUA 5B66E 1JUNA 2P58A 2RH0A 3OJAB 2IFMA 2QJKC 1Q2NA 1FZEA 3SFDC 1WT6A 1L4AB 1IFJA 1S2EA 3L70D 1YYCA 3H32B 5CCGC 1SQBG 2B9BA 1L2PA 5BVZA 1SS1A 2XKMA 3VYIA 1GK4A 1OWAA 1T8ZA 2XNXA 2UWJE 1MKMA 1KZUB 2OTLP 2WU2C 2FYNB 1IK7A 2NPSD 5CJ4A 3I56P 2C0XA 2JDIH 1H8AA 4IFFA 1IK9A 4TLFA 5CCHA 2CK3H 3G6EP 3QWOC 3QH9A 2JR8A 3PRJA 4IFMA 5C2TD 3B4SA 3AEBD 3L4FA 4HJGH 3CPWO 4PD4E 2WSCJ 5AVWB 1RF1B 1EDLA 3FXEA 3G71P 2KZJA 3AEAC 1NOHA 3O6QB 3RK3B 1KB9I 5KTBA 5B5EE 5GTHH 1LTJA 3AEED 4H44C 1LTTC 3M06A 3RK3E 3AEGD 1SQPK 1N7SB 1LP1B 2OYHA 1EXIA 4Z1MH 1LTSC 3HRNA 5AW1B 1QL2A 1OW6A 4K35A 2ZT9D 3P32A 1BCCJ 3P8CE 3NFQA 3H1HG 1WRGA 1USEA 3VN0A 2KLVA 5CJ0A 1IC2A 2FYZA 1PGQA 4Y99B 4YTMC 1MV8A 1PP9E 1SQVJ 2E75B 2WSFH 1BGYD 1YI2P 4BWNA 1KILC 3KDPB 1IFDA 2W27A 1LTJB 5CMZA 1NTKE 1SVFA 2M3BA 3L75D 3CCMP 3IF4A 1KQGB 1NU1J 5KAIE 3JC22 1FU1A 1JOCA 3M91A 4U7JA 2WWWA 2O1JA 1P84I 3M9BA 3S1KA 4EOTA 1FOSE 1SQBD 5CCGD 3HUSA 2FYUE 2N9BA 2IZ0A 1KFMA 4AQRD 2E75C 5KLVJ 3H1KD 4HKZH 3AE3D 2Q3EA 3CXHE 2NZ2A 2Y9YA 1JNMA 1VQLP 5GTIE 1MZ9A 3AEAD 2LKMA 3MP7B 3AE4C 2KYVA 1M8OB 2P2UA 3L75G 1N86A 2B76C 5AVZB 2H7HA 2WDVD 4H44B 1AVOA 2E74C 1LNQA 1JY2P 3T97B 4JF7A 1W2EA 5KLVG 3CC2P 1M56D 1FZBA 3U1AA 2HYNA 3CX5E 1SQQK 3L74E 1BE3G 1AQTA 2SPZA 4Y99C 5AVSB 1GL2B 2FXOA 3TGUG 4EIJA 1EZVE 2FYUG 1Q82Q 3E7KA 4U3FE 1HBWA 4DJGA 1H0TB 1EDIA 2KOGA 1R5LA 3U59A 2WDQC 1EQ7A 3GHGA 3KPEA 1GD2E 4ZMDA 1GL2D 3H1JE 4DOJA 2WQYC 4W7YA 1GMJA 4YTMD 2WT7B 3P4SD 3V2NA 3VP9A 5AW2B 1MFZA 3MUDA 3H1HJ 3L72J 2H89D 4M3LA 4H44D 1X22A 1G1JA 3VMXA 2PGDA 3EWKA 1KILE 2QJPC 3K5BA 2QJKB 1FDIA 3CLQA 1PGJA 4KX6C 2J58A 4FJVA 3HE5A 1SQXJ 5H2FH 1FZGA 3CCEP 1K73Q 1L0LK 5DJTB 2R3SA 2G8YA 3RL0C 4TT3H 4XFJA 5KLIB 2G3AA 4I2LC 3A0HH 4U3FG 3V2RA 2O3JA 1NO4A 3HTKA 1DH3A 2M0BA 1VQMP 1HWTC 2JWAA 2FYNC 3VOPA 4JYCA 2NPSA 3N7NA 2IBZG 1BSNA 1EC5A 3V4WA 1X8YA 2K37A 2B76D 2WZ7A 1Z56A 1VPCA 4N6JA 2WTYA 1OVRA 2KP8A 2BCCD 2O01H 1RE4A 2ZFCA 1GDTA 3H6PA 1L0NK 2E75D 4N78D 3CX5D 1NENC 1M1JB 1ZW0A 2WSEH 4QMAA 3L74D 1A02J 4IL6H 5AVVB 2R5BA 3F89A 1URQC 3AE1C 4YSYD 2ZT9B 4BRYB 5TJHA 2O01J 1E5WA 3GHGB 3MIWA 1M7LA 3L72E 3CCJP 3L75J 1N7SD 3A0BE 5AW3B 1OW8A 1NU1D 4U3FD 1L0VC 5KJ7A 2D2CC 4PJ0H 2PAJA 1SQXD 3VRAC 1LWUA 2K9JB 3RK3D 1L0NJ 2RN0A 1OMIA 1ZLLA 2M5AB 3P8MC 1JY2O 3WMM0 1QGKB 2H43A 1KB9H 4WWIA 2LXCB 4HYTB 5APUA 1S1CX 1N73A 5BU5A 5KAFE 2R32A 1KQFB 2WSSH 2H89C 3CIRD 1BE3D 5AW8B 3C9IA 1PP9J 3M0DC 4YTPC 2AEMA 3OA7A 4D6TG 2C0WA 2N9YB 3B5NA 4KHXA 1BGYG 3VMYA 4JPZB 2NPSB 4I6MC 3D71A 3BCCG 2WPQA 4GDOA 1RY3A 1GW4A 1S9KE 2IYOA 1OVUA 2WP9C 1VDFA 2N1TA 4WVZA 1EZVG 1SQVG 1VQNP 2QA4P 3O6QA 3RK3C 3C8VA 3VRBD 3AE5C 1L4AD 2RKLA 4YXDD 3EFGA 3AE7D 1CI6B 4N3YB 1SQVE 5E79H 3AE1D 3H25A 3H1LG 2ZAEB 3CXHD 1JMBA 5K5GB 1ZOYD 2QVAA 4W80A 1YJWP 4YTNC 2GA1A 2KXPB 1H88A 1M90Q 1JCCA 3H1ID 4I6LA 2W83C 1NTZK 3A2AA 1URQB 3VMAA 4N78E 1IJDB 1CW5A 1X9VA 1N73B 3L37A 1RF0A 3H1HD 4UB8E 2YIUB 1W2BO 3MZWB 2BASA 3L70G 1PP9G 1QVFO 1M57D 1NTMD 3AE6D 3P4QD 3GMAA 1NU1E 4EDFA 1N8RQ 1VQ7P 1KYOH 4YTPD 1NYHA 1LTIC 2AXCA 3RL0D 3AE7C 5EFWB 4DZOA 3F5HA 3H1LJ 3TGUD 1SQPE 1TFFA 1JMMA 2M8RA 4YSZD 4H0LD 1OXZA 1ZP0C 4UB6E 2A45I 1JY3P 3VR9C 4OGQB 1QEXA 1RH5B 2YXQB 3Q5SA 2WP9D 3VONA 3H1JJ 3HD7B 1BSHA 1SFCC 1P84H 1N2DC 2WQYD 5B66H 1JO5A 2KK7A 1PV3A 4C7NB 2ZJSE 2YMKA 4GOFA 1KB9D 2ZT9C 2QJYB 3FXDA 1H0TA 4DDGA 3S9OA 2WSFJ 2Q1KA 2O1KA 1VL2A 3CC4P 1KFYD 2FFDC 3AEDD 2IBZE 3L71G 3V4QA 2WS3D 3AEGC 1JCDA 1VQ4P 2IPPA 3AECC 1T2KD 1FC2C 4YXDC 1SQVD 2YO2A 2M3EA 2BEZF 3B71A 5AW0B 3LIEA 4AUWA 4U3FJ 1Y8AA 2N1TD 2Z5HA 1IFMA 3RBZA 1NHLA 3CI9A 1EDKA 3L73E 3BCCJ 3O8ZA 3BATA 1LT9C 3ITKA 2AXTH 4IOIH 1FZCC 2C9LY 1FBMA 2JEEA 4H0LC 3G3ZA 3H1JG 3H1IG 2OYOA 3P4SC 3KZIH 5B5EH 4EYYQ 1NWQA 2XU6A 5BU8B 1BE3J 2KZIA 1PP9D 1VQ9P 1QX8A 1SLQA 5AVRB 3W67A 4K3AA 3KYQA 2CPSA 1KQSO 1KILD 2IZ1A 2L5GB 1J1EB 1CZQA 3RGUA 2BEQD 4GT1A 3HE4B 4RESB 1SQVK 3AE5D 2Q9IA 3JCUE 4OVNF 3RK2B 3CWBE 1A02F 3VMZA 5KAIH 3V2PA 2FBWC 1LWUB 1N7LA 1FJPA 2B88A 1DEEG 1JY2N 2B87B 3G4SP 2I1KA 1YTZI 2MKVA 3OW2O 1HF9A 3TNUA 2K1AA 3Q5RA 2Q7CA 3H1IJ 4GKGA 1NAYA 1KTMA 2M5AA 2A06E 2Y0DA 3KHUA 3CXHH 1NU1G 2E76D 3P4QC 1D7MA 1KYOI 2POHA 4WY4A 4WY4D 3CWBJ 1OZHA 4LLHA 4L73A 1U57A 2KNCA 3C1LA 2ACZD 3SWYA 3L72D 2A45G 1ZP0D 1BGYJ 1FS0E 3VRAD 1PPJE 1NEKD 3CX5H 1LTBC 1JTHB 3H1LD 3HE4A 4L75A 5AW6B 3TGUJ 1X79B 1RF1C 3H1IE 1S4XA 2LR2A 1LTAC 3ABVD 3HUSB 1QL1A 2QG4A 1ZMEC 3H1JD 1HJBA 4R4LA 2WT7A 3ZDMA 1RF0C 3E1IA 1J1DB 1AQ5A 1S5LH 2Z4EA 1HVVA 1VQ8P 3TK1A 5AVUB 1QVGO 3Q2YA 3GF3A 4JBZA 5KLVD 3D70A 2WS3C 2BS3C 5C2TC 1K04A 1NTZD 3CMEP 1NU1K 1YHQP 4NPFX 3I5CA 1VQ5P 4PV1B 2WVRA 3TGUE 2IX7C 1SFCB 1SQPD 2WSCH 2V7QH 3TYYA 4GODA 1YQ3D 1URQA 2ZFYA 4OGQC 2W6BA 4YSXD 2WU5C 2DW3A 1SQQD 3HUSC 4H13B 2AEFA 2FXPA 4I7ZB 1N7SC 1BDCA 2WDRD 5TISH 3GG2A 2QM7A 3SWFA 5H2FE 3D6ZA 5APXA 1QLBC 2J5UA 4GIFA 4XE5B 4YSYC 2K88A 2KSJA 4KJMA 4JQ0D 1K9MQ 1ZRTD 2KSEA 2NPSC 1JTHA 1X0TA 4B86A 3FX0A 2ITAA 3A0HE 1L0ND 3B5ND 2D2CD 4AYCA 2FXMA 1PGPA 2QIWA 2ZYGA 3AEFD 1H89A 3BRVB 1DIPA 3FWLA 1HJ0A 3AEDC 4L76A 2HLOA 3H1HE 2HG5D 3NXSA 1PPJG 1LP1A 2OYHB 3SFED 3VR8D 3L71J 1NTZJ 1U7JA 2E43A 1SQBK 1S3JA
chains in the Genus database with same CATH topology
5C3JD 1ZRTE 4Z1MH 4R4MA 3P4PC 1S1CX 2WPVB 2WU2D 3T97B 1VF5C 4YXDC 1OW6A 3Q3DA 2G8YA 2QJKC 3Q1MA 1DD4A 2BEZF 3B71A 4TT3H 2ZT9D 1NGMB 3Q2YA 3AE3C 3GF3A 3AEEC 4XFJA 1Q90D 2MKVA 1KQFB 3SFDC 3D70A 2OQQA 1K04A 1HF9A 1E7PC 2BS3C 2WS3C 3CIRC 5C2TC 2H89C 3GLMA 3CIRD 3AE6D 2FBWD 2G3AA 3GMAA 3P4QD 2H88D 4YTMC 1PL5A 3Q5RA 5KLIC 4YTPC 3ABVC 4PV1B 2E75B 1YQ4C 4YTPD 1Y9BA 1KTMA 1NYHA 4KT0J 1EXIA 3R4YA 4Y28J 1KF6D 2QJYC 1KORA 1UIXA 1YQ3D 2FYNC 4OGQC 2E74B 5KKZC 3AE7C 1ZOYC 5L8RJ 3D71A 2WU5C 2YIUC 4KX6D 3SFDD 4H13B 3AEBC 2E76C 4OGQD 3AE4D 1WMKA 2V7QJ 4GDOA 4PV1C 4YT0C 1RQVA 2E76D 2FXPA 3P4QC 4YSZD 4H0LD 1JB0J 1KMIZ 4H0LB 1KQGB 1MKMA 4I7ZB 1ZP0C 2WDQC 2B76D 2E76B 2IDBA 4H0LC 3SFEC 3VR9C 2WU2C 2WP9C 3P4SC 2WDRD 4H13D 4OGQB 1IK7A 3Q5SA 2WP9D 2E74D 4H13C 3IN6A 4U7JA 1U57A 3AEFC 3Q5PA 3GF7A 3O6QA 3AE2D 3C8VA 1K05A 3AE8C 3D6ZA 1NEND 2ACZD 2WQYD 2E75D 2QSIA 1QLBC 2J5UA 4PV1D 2WQYC 2K9YA 1NENC 3AE8D 3VRBD 3FGAD 3VRBC 1GMJA 1FDOA 1ZP0D 2WDQD 3AE5C 3AE9D 2H88C 2BS2C 1PV3A 1S5LX 4YTMD 4YSYC 1YQ3C 3AE9C 3P4SD 3P4PD 4YSYD 3VRAD 3AE1C 4YXDD 1YQ4D 1R8EA 2ZT9B 2YMKA 4RKUJ 2O01J 3AE7D 1KFYC 3AE1D 3H25A 3D6YA 1NEKD 1DD3A 2ZT9C 3RL0g 3LW5J 1KF6C 2BS4C 3P4RD 4YT0D 5C2TD 4YSZC 2H89D 1VF5D 4YTND 2BEQD 3AE6C 1ZOYD 2E75C 4YSXC 4H44D 3S9OA 3AEBD 4YTNC 1TU3F 1OW8A 2D2CD 2WSFJ 3AE3D 1OW7A 1L0VC 3ABVD 2WSCJ 2D2CC 3VR8C 2NZ2A 5M1BA 3AE5D 1L0VD 3EWKA 1ZMEC 1KILE 1VL2A 2QIWA 2QJPC 3IAOA 3VRAC 3AEFD 3AEAC 3G9RA 5C3JC 2WDRC 1KFYD 1EXJA 1DIPA 4R4LA 1HJ0A 3AEDC 1NEKC 3AEAD 3P4RC 4YSXD 1FDIA 1OMIA 1PIXA 4KX6C 3AEDD 3AE4C 2WSEJ 3AEED 1AJYA 2WS3D 3AEGC 2P10A 4H44C 3AE2C 4I7ZC 2JO1A 3AECC 2ACZC 3RK3E 2FBWC 3AEGD 2WU5D 2B76C 2WDVC 3AECD 1RQUA 3SFED 3VR9D 3VR8D 2D2CB 2WDVD 4H44B 4IL6X 2JP3A 2E74C 1VF5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3J D;  3P4P C;  2WU2 D;  4YXD C;  1OW6 A;  3B71 A;  3AE3 C;  3AEE C;  3SFD C;  1E7P C;  2WS3 C;  2BS3 C;  3CIR C;  1K04 A;  5C2T C;  2H89 C;  3CIR D;  3AE6 D;  2FBW D;  2G3A A;  3P4Q D;  2H88 D;  4YTM C;  4YTP C;  3ABV C;  1YQ4 C;  4YTP D;  1KTM A;  1KF6 D;  1YQ3 D;  3AE7 C;  1ZOY C;  2WU5 C;  4YSX D;  3SFD D;  4KX6 D;  3AEB C;  3AE4 D;  4YT0 C;  3P4Q C;  4YSZ D;  1ZP0 C;  2WDQ C;  2B76 D;  3SFE C;  3VR9 C;  2WU2 C;  2WP9 C;  3P4S C;  2WDR D;  2WP9 D;  3AEF C;  3AE2 D;  1NEN D;  2WQY D;  1K05 A;  3AE8 C;  2ACZ D;  1QLB C;  2WQY C;  1NEN C;  3AE8 D;  3VRB D;  3VRB C;  1ZP0 D;  2WDQ D;  3AE5 C;  3AE9 D;  2H88 C;  2BS2 C;  1PV3 A;  4YTM D;  4YSY C;  1YQ3 C;  3AE9 C;  3P4S D;  3P4P D;  4YSY D;  3VRA D;  3AE1 C;  4YXD D;  1YQ4 D;  3AE7 D;  3AE1 D;  1KFY C;  1NEK D;  2BS4 C;  3P4R D;  1KF6 C;  4YT0 D;  5C2T D;  4YSZ C;  2H89 D;  4YTN D;  3AE6 C;  1ZOY D;  4YSX C;  3S9O A;  3AEB D;  4YTN C;  1OW8 A;  3AE3 D;  1OW7 A;  1L0V C;  3ABV D;  3VR8 C;  3AE5 D;  1L0V D;  3VRA C;  3AEF D;  3AEA C;  5C3J C;  2WDR C;  1KFY D;  3AEA D;  1NEK C;  3AED C;  3P4R C;  4KX6 C;  3AED D;  3AE4 C;  3AEE D;  2WS3 D;  3AEG C;  3AE2 C;  3AEC C;  2ACZ C;  3AEG D;  2FBW C;  2WU5 D;  2B76 C;  2WDV C;  3AEC D;  3SFE D;  3VR9 D;  3VR8 D;  2WDV D; 
#chains in the Genus database with same CATH topology
 1HTL C;  4YPC A;  1OIP A;  4I1L A;  1RF1 A;  1KV4 A;  4ZKU A;  2B89 A;  3HD7 A;  1E7P C;  3H1L E;  1SQP J;  2OQQ A;  2YKP A;  3CIR C;  2YKQ A;  4A7P A;  2IBZ I;  3L72 G;  3TSI A;  2H88 D;  3PTZ A;  3CMA P;  2WPR A;  1SQX E;  1SQQ J;  5CBN A;  1L4A C;  3PHL A;  2JWD A;  2FKW B;  3CCS P;  4O9B A;  3L73 J;  3GHG C;  3A0B H;  1ZOY C;  3A5T A;  4LC1 A;  1ZV8 A;  4PJ0 E;  1SQQ G;  1Q81 Q;  3SWK A;  1OVV A;  4PD4 I;  4D6T J;  1MFT A;  2IDB A;  5APQ A;  1GL2 A;  2YKO A;  2MJZ A;  2E74 D;  3AEF C;  1GU5 A;  1BE3 E;  5KLV E;  2FYU K;  3A7O A;  1KB9 E;  1NTZ E;  1GK6 A;  1NTM G;  1LT1 A;  1S5L X;  1RHZ B;  2R3C A;  1YQ3 C;  4NPE A;  4ZKP A;  1KFY C;  1LT9 A;  1OX3 A;  1KF6 C;  3LW5 J;  3NTN A;  1XTC C;  5AVX B;  4YTN D;  3AE6 C;  3EQ2 A;  3MHV A;  3PJS K;  1TU3 F;  2IBZ D;  2XND H;  3CWB D;  3S4R A;  3II6 A;  5KJ7 D;  2WDR C;  1IFI A;  3L71 D;  1SP4 A;  2GUS A;  1JY3 N;  3WU2 E;  2JO1 A;  3L74 J;  1AVY A;  2NRG A;  3NMD A;  1NAF A;  1VF5 B;  1ZRT E;  3RK2 C;  2FY8 A;  1KIL A;  4W7Z A;  3WUU A;  3L73 D;  2W6J H;  3B5N C;  4ASW A;  1FAV A;  1L0L G;  4ZNC A;  2KUB A;  4Y28 J;  3M0D A;  4D6T D;  3M0A A;  1T3U A;  1EZV I;  2YIU C;  3H1K G;  4PV1 C;  2OYH C;  1FOS F;  4ASV A;  1RE3 A;  3PLN A;  1NTK G;  4DHZ A;  2ZXE B;  3SFE C;  3CL3 D;  5KKZ B;  1USD A;  3TDK A;  3A3Y B;  4HH2 A;  1FZC A;  3CCV P;  3BRT B;  3KXD A;  2HR3 A;  1PZQ A;  2ZXX A;  3GF7 A;  1NTM E;  3MGN A;  1DX7 A;  1PPJ D;  2KS1 B;  4C7N A;  5APS A;  2W8Z A;  1NH4 A;  2WDQ D;  3JSV C;  2H88 C;  3V6I A;  4UB8 H;  4NPD A;  1VQP P;  1YQ4 D;  3PH0 A;  2HOD B;  4RKU J;  2OTJ P;  3P4R D;  1DD3 A;  2BS4 C;  2Z5I A;  4YSZ C;  1VF5 D;  1NKZ B;  1Q7Y Q;  1KYO E;  2R5D A;  3VR8 C;  1L0V D;  4MN4 C;  3R2P A;  5AW7 B;  1RE4 C;  3WUT A;  2J59 M;  1L0L J;  1IFN A;  1J2J B;  4I7Z C;  3VTP C;  2E5T A;  2WDV C;  1U7M A;  2P7J A;  1VQK P;  1T6A A;  1P84 E;  2WMM A;  1ZXG A;  2WU2 D;  1ZN5 A;  2A06 D;  1YIJ P;  3KQG A;  4JYB A;  5CHX A;  4BXL A;  3I55 P;  2RMZ A;  1QLE D;  4DDI A;  5APW A;  3M9H A;  1CSB A;  1Y9B A;  4PD4 H;  1NVO A;  2QJY C;  1UIX A;  2KI7 B;  1SQP G;  2E74 B;  5L8R J;  1Y47 A;  3H1K J;  5GTH E;  1JB0 J;  5DJU B;  2CPB A;  2OGU A;  1BDD A;  1FJK A;  3IFM A;  1OFC X;  3Q5P A;  3E1R A;  1FE6 A;  2XDJ A;  2I1J A;  3AE2 D;  3AE8 C;  1NTM J;  2QSI A;  1YBK A;  1JY3 O;  3FGA D;  1YTZ T;  3CCR P;  3P4P D;  2XV5 A;  1L0N E;  3D6Y A;  1YJN P;  3P8C D;  1N7S A;  3MD0 A;  1NKN A;  1M1J C;  1OW7 A;  1ZR2 A;  3IAO A;  1J1E C;  3G9R A;  5C3J C;  1L4A A;  1NTM K;  2HFE D;  2AXT E;  4CPG A;  4GOE A;  2HOD A;  2K3R A;  3CCQ P;  1NTK D;  3KZI E;  2D2C B;  3B5N B;  5AW5 B;  2B87 A;  1KFN A;  4WY4 C;  2BCC G;  1LTJ C;  2WPV B;  1VF5 C;  1HGV A;  1NTZ G;  3TNU B;  1YJ9 P;  2Q5U A;  5CCH D;  1T3J A;  1W5C E;  3M9Q A;  1SQQ E;  1S72 P;  5KLI C;  3USS A;  1BCC D;  2OYI C;  1YIT P;  2QEX P;  2L91 A;  1SQB E;  3L70 E;  5GTI H;  3SFD D;  1L0N G;  2E76 C;  1WMK A;  3LW5 H;  1RQV A;  3JCU H;  3H1K E;  1KMI Z;  3B8E B;  3L35 A;  1GW3 A;  4H13 D;  1SQX K;  1SFC D;  5AW9 B;  1NEN D;  4BRY A;  3LID A;  4PV1 D;  2FFD A;  3H32 A;  3AE8 D;  2ZYA A;  4DT0 A;  4C7R A;  1NTK K;  3P7K A;  1N73 C;  2Y0E A;  2ZVO B;  1FDM A;  3VP8 A;  2PRR A;  2QE7 H;  2GUV A;  2OYI A;  2E5Y A;  2KLU A;  3V5B A;  3P4R C;  2WSE J;  1VQO P;  1HGZ A;  1AJY A;  1NJI Q;  3AE2 C;  4RJT A;  2WU5 D;  3AEC D;  4OH8 B;  3L74 G;  1LT9 B;  2KIK A;  1Q90 D;  2V4H A;  5CBO A;  3P4P C;  4R4M A;  3Q3D A;  4L74 A;  1DD4 A;  3BAS A;  2IYP A;  3AE3 C;  3AEE C;  5AVY B;  3CD6 P;  4DHI B;  4WBA A;  2QM8 A;  1R5S A;  4D6T E;  3FWN A;  2JJL A;  3ABV C;  1KC8 Q;  3RBX A;  3TF5 A;  1SQX G;  1L0L D;  2IFN A;  1KOR A;  2O01 N;  3PP5 A;  2OTK E;  5KKZ C;  4WY4 B;  2ZYD A;  3AE4 D;  3GW6 A;  1HH0 A;  2E76 B;  1AV1 A;  2E42 A;  3WUV A;  4H13 C;  5CCH C;  2YNY A;  1G1I A;  4XA4 A;  1Q86 Q;  1EDJ A;  3L75 E;  1CI6 A;  5AVQ B;  3CXH I;  3V2Q A;  1S5L E;  2AEJ A;  1FDO A;  3SSU A;  3AE9 D;  2BS2 C;  5AVT B;  2C9N Y;  2Y0C A;  1MUU A;  1BCC E;  1LTG C;  1G2C B;  3RL0 g;  1M1J A;  2KS1 A;  1RE3 C;  3L73 G;  4YSX C;  1KD1 Q;  1XTG B;  5M1B A;  1BCC G;  1J1D C;  1PGO A;  3RK2 D;  2FYU J;  3OAK A;  2YO3 A;  2OAR A;  1P84 D;  5TIS E;  3VR9 D;  2KB7 P;  4C46 A;  4IL6 X;  5C3J D;  4IL6 E;  1KIL B;  1JM0 A;  3Q1M A;  1SFC A;  2QJP B;  5CCG A;  3L36 A;  3GLM A;  5APY A;  1T2K C;  1GU4 A;  3U1C A;  4WB4 A;  2PP6 A;  3CWB G;  4KT0 J;  4LGD E;  3R4Y A;  1E79 H;  1KF6 D;  2Q3I A;  1IZN B;  2Y9Z A;  1AA0 A;  3EFF K;  4KX6 D;  1G2C A;  2V7Q J;  1NTK J;  4YT0 C;  1HUC A;  1EZV D;  3IN6 A;  3BCC E;  2R44 A;  1K05 A;  4OWF A;  1AFO A;  2K9Y A;  5KAF H;  1UII A;  1DEB A;  2BCC J;  2N1T B;  2PFX A;  2ZVN B;  3AE9 C;  2KNC B;  1KYO D;  2GM4 A;  1R8E A;  1L0L E;  1FZF A;  2YXR B;  2HPC B;  2FYU D;  1LGH B;  1IO4 A;  2Q6Q A;  1EXJ A;  2K9J A;  1GTW A;  1LJ2 A;  3W68 A;  3CC7 P;  5C39 A;  2VRS A;  2P10 A;  3T97 A;  3CCL P;  1GZL A;  2ACZ C;  2XZR A;  1FZA A;  2YMY A;  2JP3 A;  2LXB A;  2QRX A;  3CCU P;  1S9K D;  1KN7 A;  2A06 G;  2H8P D;  1NGM B;  5APV A;  5E79 E;  3N4X A;  2N1T C;  1K8A Q;  2FBW D;  2I8D A;  1JEK A;  4DCK A;  1PL5 A;  2WPS A;  5KJ7 C;  1LWU C;  1YQ4 C;  3L71 E;  3MTU E;  3HE5 B;  1SQB J;  3L70 J;  3MUD C;  3HD7 D;  4OGQ D;  3AEB C;  3BVH A;  4LDT A;  4PD4 D;  4H0L B;  2HPC A;  3CX5 I;  1M1K Q;  4RO0 A;  1FZC B;  1IFP A;  3RL0 B;  3IR9 A;  4YXW H;  2A45 H;  3WU2 H;  1GL2 C;  1ZR4 A;  2P1J A;  3UIA A;  2JKV A;  4HB1 A;  1PFI A;  2BCC E;  3VRB C;  3HTK B;  2W90 A;  4YT0 D;  1KQL A;  5KLV K;  4DHJ A;  1BGY E;  1URQ D;  5AW4 B;  4UB6 H;  4EI2 A;  1NEK C;  1VQ6 P;  5APT A;  1PIX A;  3BCC D;  2FFD B;  2P67 A;  2WIT A;  3HD7 C;  2OYI B;  4IFD K;  2W6A A;  1RQU A;  5B66 E;  1JUN A;  2P58 A;  2RH0 A;  3OJA B;  2IFM A;  2QJK C;  1Q2N A;  1FZE A;  3SFD C;  1WT6 A;  1L4A B;  1IFJ A;  1S2E A;  3L70 D;  1YYC A;  3H32 B;  5CCG C;  1SQB G;  2B9B A;  1L2P A;  5BVZ A;  1SS1 A;  2XKM A;  3VYI A;  1GK4 A;  1OWA A;  1T8Z A;  2XNX A;  2UWJ E;  1MKM A;  1KZU B;  2OTL P;  2WU2 C;  2FYN B;  1IK7 A;  2NPS D;  5CJ4 A;  3I56 P;  2C0X A;  2JDI H;  1H8A A;  4IFF A;  1IK9 A;  4TLF A;  5CCH A;  2CK3 H;  3G6E P;  3QWO C;  3QH9 A;  2JR8 A;  3PRJ A;  4IFM A;  5C2T D;  3B4S A;  3AEB D;  3L4F A;  4HJG H;  3CPW O;  4PD4 E;  2WSC J;  5AVW B;  1RF1 B;  1EDL A;  3FXE A;  3G71 P;  2KZJ A;  3AEA C;  1NOH A;  3O6Q B;  3RK3 B;  1KB9 I;  5KTB A;  5B5E E;  5GTH H;  1LTJ A;  3AEE D;  4H44 C;  1LTT C;  3M06 A;  3RK3 E;  3AEG D;  1SQP K;  1N7S B;  1LP1 B;  2OYH A;  1EXI A;  4Z1M H;  1LTS C;  3HRN A;  5AW1 B;  1QL2 A;  1OW6 A;  4K35 A;  2ZT9 D;  3P32 A;  1BCC J;  3P8C E;  3NFQ A;  3H1H G;  1WRG A;  1USE A;  3VN0 A;  2KLV A;  5CJ0 A;  1IC2 A;  2FYZ A;  1PGQ A;  4Y99 B;  4YTM C;  1MV8 A;  1PP9 E;  1SQV J;  2E75 B;  2WSF H;  1BGY D;  1YI2 P;  4BWN A;  1KIL C;  3KDP B;  1IFD A;  2W27 A;  1LTJ B;  5CMZ A;  1NTK E;  1SVF A;  2M3B A;  3L75 D;  3CCM P;  3IF4 A;  1KQG B;  1NU1 J;  5KAI E;  3JC2 2;  1FU1 A;  1JOC A;  3M91 A;  4U7J A;  2WWW A;  2O1J A;  1P84 I;  3M9B A;  3S1K A;  4EOT A;  1FOS E;  1SQB D;  5CCG D;  3HUS A;  2FYU E;  2N9B A;  2IZ0 A;  1KFM A;  4AQR D;  2E75 C;  5KLV J;  3H1K D;  4HKZ H;  3AE3 D;  2Q3E A;  3CXH E;  2NZ2 A;  2Y9Y A;  1JNM A;  1VQL P;  5GTI E;  1MZ9 A;  3AEA D;  2LKM A;  3MP7 B;  3AE4 C;  2KYV A;  1M8O B;  2P2U A;  3L75 G;  1N86 A;  2B76 C;  5AVZ B;  2H7H A;  2WDV D;  4H44 B;  1AVO A;  2E74 C;  1LNQ A;  1JY2 P;  3T97 B;  4JF7 A;  1W2E A;  5KLV G;  3CC2 P;  1M56 D;  1FZB A;  3U1A A;  2HYN A;  3CX5 E;  1SQQ K;  3L74 E;  1BE3 G;  1AQT A;  2SPZ A;  4Y99 C;  5AVS B;  1GL2 B;  2FXO A;  3TGU G;  4EIJ A;  1EZV E;  2FYU G;  1Q82 Q;  3E7K A;  4U3F E;  1HBW A;  4DJG A;  1H0T B;  1EDI A;  2KOG A;  1R5L A;  3U59 A;  2WDQ C;  1EQ7 A;  3GHG A;  3KPE A;  1GD2 E;  4ZMD A;  1GL2 D;  3H1J E;  4DOJ A;  2WQY C;  4W7Y A;  1GMJ A;  4YTM D;  2WT7 B;  3P4S D;  3V2N A;  3VP9 A;  5AW2 B;  1MFZ A;  3MUD A;  3H1H J;  3L72 J;  2H89 D;  4M3L A;  4H44 D;  1X22 A;  1G1J A;  3VMX A;  2PGD A;  3EWK A;  1KIL E;  2QJP C;  3K5B A;  2QJK B;  1FDI A;  3CLQ A;  1PGJ A;  4KX6 C;  2J58 A;  4FJV A;  3HE5 A;  1SQX J;  5H2F H;  1FZG A;  3CCE P;  1K73 Q;  1L0L K;  5DJT B;  2R3S A;  2G8Y A;  3RL0 C;  4TT3 H;  4XFJ A;  5KLI B;  2G3A A;  4I2L C;  3A0H H;  4U3F G;  3V2R A;  2O3J A;  1NO4 A;  3HTK A;  1DH3 A;  2M0B A;  1VQM P;  1HWT C;  2JWA A;  2FYN C;  3VOP A;  4JYC A;  2NPS A;  3N7N A;  2IBZ G;  1BSN A;  1EC5 A;  3V4W A;  1X8Y A;  2K37 A;  2B76 D;  2WZ7 A;  1Z56 A;  1VPC A;  4N6J A;  2WTY A;  1OVR A;  2KP8 A;  2BCC D;  2O01 H;  1RE4 A;  2ZFC A;  1GDT A;  3H6P A;  1L0N K;  2E75 D;  4N78 D;  3CX5 D;  1NEN C;  1M1J B;  1ZW0 A;  2WSE H;  4QMA A;  3L74 D;  1A02 J;  4IL6 H;  5AVV B;  2R5B A;  3F89 A;  1URQ C;  3AE1 C;  4YSY D;  2ZT9 B;  4BRY B;  5TJH A;  2O01 J;  1E5W A;  3GHG B;  3MIW A;  1M7L A;  3L72 E;  3CCJ P;  3L75 J;  1N7S D;  3A0B E;  5AW3 B;  1OW8 A;  1NU1 D;  4U3F D;  1L0V C;  5KJ7 A;  2D2C C;  4PJ0 H;  2PAJ A;  1SQX D;  3VRA C;  1LWU A;  2K9J B;  3RK3 D;  1L0N J;  2RN0 A;  1OMI A;  1ZLL A;  2M5A B;  3P8M C;  1JY2 O;  3WMM 0;  1QGK B;  2H43 A;  1KB9 H;  4WWI A;  2LXC B;  4HYT B;  5APU A;  1S1C X;  1N73 A;  5BU5 A;  5KAF E;  2R32 A;  1KQF B;  2WSS H;  2H89 C;  3CIR D;  1BE3 D;  5AW8 B;  3C9I A;  1PP9 J;  3M0D C;  4YTP C;  2AEM A;  3OA7 A;  4D6T G;  2C0W A;  2N9Y B;  3B5N A;  4KHX A;  1BGY G;  3VMY A;  4JPZ B;  2NPS B;  4I6M C;  3D71 A;  3BCC G;  2WPQ A;  4GDO A;  1RY3 A;  1GW4 A;  1S9K E;  2IYO A;  1OVU A;  2WP9 C;  1VDF A;  2N1T A;  4WVZ A;  1EZV G;  1SQV G;  1VQN P;  2QA4 P;  3O6Q A;  3RK3 C;  3C8V A;  3VRB D;  3AE5 C;  1L4A D;  2RKL A;  4YXD D;  3EFG A;  3AE7 D;  1CI6 B;  4N3Y B;  1SQV E;  5E79 H;  3AE1 D;  3H25 A;  3H1L G;  2ZAE B;  3CXH D;  1JMB A;  5K5G B;  1ZOY D;  2QVA A;  4W80 A;  1YJW P;  4YTN C;  2GA1 A;  2KXP B;  1H88 A;  1M90 Q;  1JCC A;  3H1I D;  4I6L A;  2W83 C;  1NTZ K;  3A2A A;  1URQ B;  3VMA A;  4N78 E;  1IJD B;  1CW5 A;  1X9V A;  1N73 B;  3L37 A;  1RF0 A;  3H1H D;  4UB8 E;  2YIU B;  1W2B O;  3MZW B;  2BAS A;  3L70 G;  1PP9 G;  1QVF O;  1M57 D;  1NTM D;  3AE6 D;  3P4Q D;  3GMA A;  1NU1 E;  4EDF A;  1N8R Q;  1VQ7 P;  1KYO H;  4YTP D;  1NYH A;  1LTI C;  2AXC A;  3RL0 D;  3AE7 C;  5EFW B;  4DZO A;  3F5H A;  3H1L J;  3TGU D;  1SQP E;  1TFF A;  1JMM A;  2M8R A;  4YSZ D;  4H0L D;  1OXZ A;  1ZP0 C;  4UB6 E;  2A45 I;  1JY3 P;  3VR9 C;  4OGQ B;  1QEX A;  1RH5 B;  2YXQ B;  3Q5S A;  2WP9 D;  3VON A;  3H1J J;  3HD7 B;  1BSH A;  1SFC C;  1P84 H;  1N2D C;  2WQY D;  5B66 H;  1JO5 A;  2KK7 A;  1PV3 A;  4C7N B;  2ZJS E;  2YMK A;  4GOF A;  1KB9 D;  2ZT9 C;  2QJY B;  3FXD A;  1H0T A;  4DDG A;  3S9O A;  2WSF J;  2Q1K A;  2O1K A;  1VL2 A;  3CC4 P;  1KFY D;  2FFD C;  3AED D;  2IBZ E;  3L71 G;  3V4Q A;  2WS3 D;  3AEG C;  1JCD A;  1VQ4 P;  2IPP A;  3AEC C;  1T2K D;  1FC2 C;  4YXD C;  1SQV D;  2YO2 A;  2M3E A;  2BEZ F;  3B71 A;  5AW0 B;  3LIE A;  4AUW A;  4U3F J;  1Y8A A;  2N1T D;  2Z5H A;  1IFM A;  3RBZ A;  1NHL A;  3CI9 A;  1EDK A;  3L73 E;  3BCC J;  3O8Z A;  3BAT A;  1LT9 C;  3ITK A;  2AXT H;  4IOI H;  1FZC C;  2C9L Y;  1FBM A;  2JEE A;  4H0L C;  3G3Z A;  3H1J G;  3H1I G;  2OYO A;  3P4S C;  3KZI H;  5B5E H;  4EYY Q;  1NWQ A;  2XU6 A;  5BU8 B;  1BE3 J;  2KZI A;  1PP9 D;  1VQ9 P;  1QX8 A;  1SLQ A;  5AVR B;  3W67 A;  4K3A A;  3KYQ A;  2CPS A;  1KQS O;  1KIL D;  2IZ1 A;  2L5G B;  1J1E B;  1CZQ A;  3RGU A;  2BEQ D;  4GT1 A;  3HE4 B;  4RES B;  1SQV K;  3AE5 D;  2Q9I A;  3JCU E;  4OVN F;  3RK2 B;  3CWB E;  1A02 F;  3VMZ A;  5KAI H;  3V2P A;  2FBW C;  1LWU B;  1N7L A;  1FJP A;  2B88 A;  1DEE G;  1JY2 N;  2B87 B;  3G4S P;  2I1K A;  1YTZ I;  2MKV A;  3OW2 O;  1HF9 A;  3TNU A;  2K1A A;  3Q5R A;  2Q7C A;  3H1I J;  4GKG A;  1NAY A;  1KTM A;  2M5A A;  2A06 E;  2Y0D A;  3KHU A;  3CXH H;  1NU1 G;  2E76 D;  3P4Q C;  1D7M A;  1KYO I;  2POH A;  4WY4 A;  4WY4 D;  3CWB J;  1OZH A;  4LLH A;  4L73 A;  1U57 A;  2KNC A;  3C1L A;  2ACZ D;  3SWY A;  3L72 D;  2A45 G;  1ZP0 D;  1BGY J;  1FS0 E;  3VRA D;  1PPJ E;  1NEK D;  3CX5 H;  1LTB C;  1JTH B;  3H1L D;  3HE4 A;  4L75 A;  5AW6 B;  3TGU J;  1X79 B;  1RF1 C;  3H1I E;  1S4X A;  2LR2 A;  1LTA C;  3ABV D;  3HUS B;  1QL1 A;  2QG4 A;  1ZME C;  3H1J D;  1HJB A;  4R4L A;  2WT7 A;  3ZDM A;  1RF0 C;  3E1I A;  1J1D B;  1AQ5 A;  1S5L H;  2Z4E A;  1HVV A;  1VQ8 P;  3TK1 A;  5AVU B;  1QVG O;  3Q2Y A;  3GF3 A;  4JBZ A;  5KLV D;  3D70 A;  2WS3 C;  2BS3 C;  5C2T C;  1K04 A;  1NTZ D;  3CME P;  1NU1 K;  1YHQ P;  4NPF X;  3I5C A;  1VQ5 P;  4PV1 B;  2WVR A;  3TGU E;  2IX7 C;  1SFC B;  1SQP D;  2WSC H;  2V7Q H;  3TYY A;  4GOD A;  1YQ3 D;  1URQ A;  2ZFY A;  4OGQ C;  2W6B A;  4YSX D;  2WU5 C;  2DW3 A;  1SQQ D;  3HUS C;  4H13 B;  2AEF A;  2FXP A;  4I7Z B;  1N7S C;  1BDC A;  2WDR D;  5TIS H;  3GG2 A;  2QM7 A;  3SWF A;  5H2F E;  3D6Z A;  5APX A;  1QLB C;  2J5U A;  4GIF A;  4XE5 B;  4YSY C;  2K88 A;  2KSJ A;  4KJM A;  4JQ0 D;  1K9M Q;  1ZRT D;  2KSE A;  2NPS C;  1JTH A;  1X0T A;  4B86 A;  3FX0 A;  2ITA A;  3A0H E;  1L0N D;  3B5N D;  2D2C D;  4AYC A;  2FXM A;  1PGP A;  2QIW A;  2ZYG A;  3AEF D;  1H89 A;  3BRV B;  1DIP A;  3FWL A;  1HJ0 A;  3AED C;  4L76 A;  2HLO A;  3H1H E;  2HG5 D;  3NXS A;  1PPJ G;  1LP1 A;  2OYH B;  3SFE D;  3VR8 D;  3L71 J;  1NTZ J;  1U7J A;  2E43 A;  1SQB K;  1S3J A; 
#chains in the Genus database with same CATH homology
 5C3J D;  1ZRT E;  4Z1M H;  4R4M A;  3P4P C;  1S1C X;  2WPV B;  2WU2 D;  3T97 B;  1VF5 C;  4YXD C;  1OW6 A;  3Q3D A;  2G8Y A;  2QJK C;  3Q1M A;  1DD4 A;  2BEZ F;  3B71 A;  4TT3 H;  2ZT9 D;  1NGM B;  3Q2Y A;  3AE3 C;  3GF3 A;  3AEE C;  4XFJ A;  1Q90 D;  2MKV A;  1KQF B;  3SFD C;  3D70 A;  2OQQ A;  1K04 A;  1HF9 A;  1E7P C;  2BS3 C;  2WS3 C;  3CIR C;  5C2T C;  2H89 C;  3GLM A;  3CIR D;  3AE6 D;  2FBW D;  2G3A A;  3GMA A;  3P4Q D;  2H88 D;  4YTM C;  1PL5 A;  3Q5R A;  5KLI C;  4YTP C;  3ABV C;  4PV1 B;  2E75 B;  1YQ4 C;  4YTP D;  1Y9B A;  1KTM A;  1NYH A;  4KT0 J;  1EXI A;  3R4Y A;  4Y28 J;  1KF6 D;  2QJY C;  1KOR A;  1UIX A;  1YQ3 D;  2FYN C;  4OGQ C;  2E74 B;  5KKZ C;  3AE7 C;  1ZOY C;  5L8R J;  3D71 A;  2WU5 C;  2YIU C;  4KX6 D;  3SFD D;  4H13 B;  3AEB C;  2E76 C;  4OGQ D;  3AE4 D;  1WMK A;  2V7Q J;  4GDO A;  4PV1 C;  4YT0 C;  1RQV A;  2E76 D;  2FXP A;  3P4Q C;  4YSZ D;  4H0L D;  1JB0 J;  1KMI Z;  4H0L B;  1KQG B;  1MKM A;  4I7Z B;  1ZP0 C;  2WDQ C;  2B76 D;  2E76 B;  2IDB A;  4H0L C;  3SFE C;  3VR9 C;  2WU2 C;  2WP9 C;  3P4S C;  2WDR D;  4H13 D;  4OGQ B;  1IK7 A;  3Q5S A;  2WP9 D;  2E74 D;  4H13 C;  3IN6 A;  4U7J A;  1U57 A;  3AEF C;  3Q5P A;  3GF7 A;  3O6Q A;  3AE2 D;  3C8V A;  1K05 A;  3AE8 C;  3D6Z A;  1NEN D;  2ACZ D;  2WQY D;  2E75 D;  2QSI A;  1QLB C;  2J5U A;  4PV1 D;  2WQY C;  2K9Y A;  1NEN C;  3AE8 D;  3VRB D;  3FGA D;  3VRB C;  1GMJ A;  1FDO A;  1ZP0 D;  2WDQ D;  3AE5 C;  3AE9 D;  2H88 C;  2BS2 C;  1PV3 A;  1S5L X;  4YTM D;  4YSY C;  1YQ3 C;  3AE9 C;  3P4S D;  3P4P D;  4YSY D;  3VRA D;  3AE1 C;  4YXD D;  1YQ4 D;  1R8E A;  2ZT9 B;  2YMK A;  4RKU J;  2O01 J;  3AE7 D;  1KFY C;  3AE1 D;  3H25 A;  3D6Y A;  1NEK D;  1DD3 A;  2ZT9 C;  3RL0 g;  3LW5 J;  1KF6 C;  2BS4 C;  3P4R D;  4YT0 D;  5C2T D;  4YSZ C;  2H89 D;  1VF5 D;  4YTN D;  2BEQ D;  3AE6 C;  1ZOY D;  2E75 C;  4YSX C;  4H44 D;  3S9O A;  3AEB D;  4YTN C;  1TU3 F;  1OW8 A;  2D2C D;  2WSF J;  3AE3 D;  1OW7 A;  1L0V C;  3ABV D;  2WSC J;  2D2C C;  3VR8 C;  2NZ2 A;  5M1B A;  3AE5 D;  1L0V D;  3EWK A;  1ZME C;  1KIL E;  1VL2 A;  2QIW A;  2QJP C;  3IAO A;  3VRA C;  3AEF D;  3AEA C;  3G9R A;  5C3J C;  2WDR C;  1KFY D;  1EXJ A;  1DIP A;  4R4L A;  1HJ0 A;  3AED C;  1NEK C;  3AEA D;  3P4R C;  4YSX D;  1FDI A;  1OMI A;  1PIX A;  4KX6 C;  3AED D;  3AE4 C;  2WSE J;  3AEE D;  1AJY A;  2WS3 D;  3AEG C;  2P10 A;  4H44 C;  3AE2 C;  4I7Z C;  2JO1 A;  3AEC C;  2ACZ C;  3RK3 E;  2FBW C;  3AEG D;  2WU5 D;  2B76 C;  2WDV C;  3AEC D;  1RQU A;  3SFE D;  3VR9 D;  3VR8 D;  2D2C B;  2WDV D;  4H44 B;  4IL6 X;  2JP3 A;  2E74 C;  1VF5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...