3AE4C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
rcsb
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae4C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae4C02
2WP9D 2WDRD 3AEAD 3VRBD 2WU5D 4YSZC 2BS2C 2WU2C 3VRAD 3AECC 3ABVC 3SFDD 1NEKC 4YTPD 1L0VC 2WQYC 4KX6C 3AECD 4YXDC 1KF6D 3P4RD 1K05A 2FBWC 1YQ3D 2WP9C 3AEDC 3AE2C 3AE6C 3AE4D 1K04A 3VRAC 3AEGD 1YQ4D 2H88C 3CIRD 5C2TD 3AE2D 3SFDC 3S9OA 2BS4C 3AE9C 3SFED 1OW6A 4YSYD 2WQYD 3AEBC 2WU2D 3AE8D 2WU5C 1YQ3C 3AEBD 3P4PC 4YTMC 3AE4C 3VR8D 3AE3D 1NEND 5C3JC 3B71A 1KFYD 2B76D 2ACZC 2WDQC 4YXDD 1ZOYD 5C3JD 3P4SC 3AE3C 3AEFC 2G3AA 1KFYC 1ZOYC 2ACZD 2WDQD 1KTMA 3AE1D 3AE5D 2H88D 3CIRC 1E7PC 4YTMD 4YSZD 2H89C 3AEDD 3AE1C 3AE7C 2B76C 1ZP0D 4YTNC 4YSYC 2H89D 3P4QC 1YQ4C 3VR9C 1L0VD 4KX6D 3P4SD 1OW7A 4YTPC 3AEFD 3AEAC 3P4QD 3VRBC 5C2TC 3AE5C 1QLBC 2BS3C 3AEED 4YSXD 4YTND 2WDVC 2WS3C 3ABVD 3P4RC 1NENC 3SFEC 3AE8C 3AE6D 3AEGC 4YSXC 1NEKD 3P4PD 2WS3D 1ZP0C 1OW8A 3AE7D 2FBWD 3VR8C 3VR9D 1PV3A 4YT0D 3AE9D 3AEEC 2WDVD 2WDRC 4YT0C 1KF6C
chains in the Genus database with same CATH superfamily
4EYYQ 3IFMA 1VL2A 3VRBD 4C46A 1GW4A 2A45I 2HYNA 2KLVA 3CXHI 1VF5D 2WU2C 2SPZA 1S9KE 1NKNA 3FWNA 4K3AA 3B5NC 3A0BH 4GOFA 1AVOA 2J5UA 5TISH 2G8YA 1LTJA 1HJBA 1VQKP 4QMAA 1LWUB 5B5EH 1VQ8P 2AEMA 4L75A 4N78E 3SFED 4EI2A 1FZCB 1NHLA 3H1JE 3I55P 4GIFA 1GK4A 4OH8B 2E76B 5CJ4A 2P1JA 3U1AA 4BWNA 3AEFC 3CX5H 3RGUA 3P8CE 3JC22 4HKZH 3VMYA 2JWAA 3TSIA 1JCCA 5CCHA 1JOCA 2O3JA 4PV1D 1J1EC 1SQPE 2H89C 2V7QH 3AEDD 1PP9G 2QJYC 3QWOC 3SWKA 1XTGB 2Z4EA 2M5AB 2UWJE 2WPSA 3P4QD 4HB1A 2YO3A 3SFEC 3PJSK 4H13B 2E43A 1BSNA 4RESB 1ZLLA 1YJWP 2J59M 5TJHA 4YT0D 2DW3A 4GKGA 5CCHC 1EQ7A 2HODA 4UB8H 1M90Q 1H88A 5BU5A 1NTMK 4KT0J 1AQ5A 1JY3O 4Y99B 3S4RA 3CCEP 1OVRA 2QIWA 1GL2C 2MJZA 1KN7A 1L4AA 4H13D 3P7KA 1H89A 4BRYB 1T2KC 4JPZB 2OGUA 3E1RA 3HE4A 1L0LK 5AVSB 2N1TB 1S5LE 1DX7A 1NAYA 2QJKC 1W2BO 1YQ3C 3L71E 2NPSC 3W68A 4PD4D 3CWBJ 5TISE 3GW6A 3P4SC 1IFDA 3CCVP 3PLNA 3KPEA 2Y9YA 1GU5A 3AE5D 3V6IA 2M3BA 1E7PC 2Q3EA 2P67A 1MZ9A 1PGJA 3B5NB 3OW2O 3AEFD 3LW5J 2C0XA 1KMIZ 1SQVJ 1PL5A 2WS3C 4ZKUA 2ZT9C 3JCUH 1FOSF 1VQ4P 1M7LA 3RL0C 3H32A 1EZVD 1DIPA 1LT9A 1VQ5P 1BE3J 3FX0A 3VYIA 3CCQP 3FXEA 1KF6C 1LTBC 1Q82Q 3CCMP 1ZR2A 3B4SA 5C39A 2FYZA 3G6EP 2GM4A 3CCLP 1P84D 1SQPK 3L70E 4YTPD 3M06A 1PP9D 2Z5IA 4I2LC 2JWDA 4YXDC 4U3FE 2HG5D 4XA4A 1K04A 2KXPB 3QH9A 1NYHA 1SFCB 1SQQE 3H1JJ 2WQYD 2FFDA 1X8YA 1N7SB 4Z1MH 3CXHD 3AEBD 2WPRA 5C3JC 1LT1A 2KSEA 2B76D 2FKWB 1YTZI 1NU1K 2J58A 1SLQA 2WSSH 2WDQD 2QJPC 2H8PD 1NJIQ 1EXJA 3G4SP 1EDIA 1S3JA 2N9BA 2FYUE 2WWWA 3P4QC 3L73G 3FGAD 3VR9C 1LTIC 1X79B 3TGUJ 3BATA 3VRBC 1KYOI 2P7JA 2R5BA 5AVYB 1YJNP 1GU4A 2BASA 1IFNA 1AVYA 1RF0C 1N73A 4HJGH 1KB9D 3HE5A 1KILA 1N73B 5APUA 3TNUB 3SWFA 3M91A 2YKQA 2YIUB 1S5LX 3CCSP 2NPSB 2E74D 2WP9D 3KYQA 1ZN5A 4I7ZB 1TFFA 3BCCE 1L4AB 3SSUA 1LWUC 1M1JC 2Y0EA 3H1HD 1CI6A 2WTYA 1KF6D 1L0LE 3AE2C 2CK3H 5KLVE 1EXIA 3EFGA 3M9QA 3Q1MA 2IYOA 4IL6H 3BCCG 3CWBE 3KHUA 3PH0A 3HD7A 3II6A 2WITA 3VR8D 3SWYA 5APVA 2ACZC 3D70A 3H1KG 2A06E 2P10A 1IK9A 3H1KJ 1KFYC 1BSHA 2WSCH 5APXA 1RQUA 5GTHE 3CX5E 2OTKE 1H8AA 3WU2H 5B66H 1KILE 1L2PA 3O6QB 4YTND 4M3LA 1J1DC 2OARA 1USEA 1FE6A 3A0BE 1PV3A 3VP9A 4GOEA 5KKZB 1RF0A 5KLVD 1BGYG 3CPWO 3AEAD 3MZWB 4GT1A 1U7MA 1ZR4A 1GZLA 3L72E 1FS0E 3CCUP 3L73D 1OIPA 2W6JH 3RBXA 1EZVI 1Y47A 3AEGD 2OYHB 3L35A 5APYA 2OYHA 3AEBC 1IO4A 1EZVG 5AW8B 1LP1A 3HTKB 3L72D 1NEND 2H43A 2H7HA 1H0TB 1VQNP 2IPPA 4KJMA 3KQGA 2I1KA 2MKVA 2FXPA 3CIRC 1VQ7P 2K9YA 2YKPA 5L8RJ 1JM0A 2IFNA 4H0LB 4YSZD 2KB7P 2WPQA 5AW7B 2E5YA 3CLQA 3RL0B 2BEQD 1RE3C 3AE5C 2WDVC 1LGHB 1KZUB 2W83C 1NTKE 1OVUA 3P4PD 5CCGA 2Y9ZA 2RKLA 2Q7CA 1L0NE 4MN4C 3U1CA 2QA4P 1AQTA 1QVFO 3GF7A 1GD2E 4I6MC 2FYNC 1EC5A 1SQBE 4LC1A 2BS2C 1KORA 1CI6B 4WB4A 2KYVA 2OYIB 1NAFA 3CMEP 5KLIC 4WY4B 1NU1G 2VRSA 2FBWC 2PGDA 4L76A 2V7QJ 1QVGO 1VPCA 3EQ2A 3H1HJ 1USDA 1QGKB 3Q3DA 2FXMA 3HD7B 3V2PA 2Q6QA 2KZIA 4EIJA 3PRJA 3EWKA 2C0WA 3KXDA 4NPDA 4DJGA 1LWUA 1J2JB 5APWA 3T97A 1R5SA 3L70D 3UIAA 3R4YA 2ZFYA 2CPBA 3C9IA 3HRNA 1KTMA 1SQXE 3H1KD 1EDKA 3AE7C 1EDJA 2B76C 1ZP0D 3A5TA 4YSYC 3TGUG 3CI9A 1N73C 4DCKA 4KX6D 3D6ZA 2YIUC 2ZYGA 2K9JB 3CXHH 1SQVK 1LTSC 4YSXD 3NXSA 4C7RA 2B89A 2HODB 2WS3D 1OW8A 2HLOA 1LTJC 2IDBA 2QG4A 3VR8C 1L4AC 1FDOA 1M1JB 2ZVOB 2CPSA 1WMKA 2D2CD 2LR2A 2OYIA 1JTHA 4WY4C 1JY3P 1IFMA 4HH2A 2WZ7A 1M1JA 4NPFX 2A06D 3L75J 4H13C 1YYCA 3FWLA 2BCCE 1FZEA 2RH0A 5KLVG 1DH3A 3JCUE 3AECC 3ABVC 3IF4A 2E76D 3U59A 3Q5RA 1SQPJ 2Q1KA 3VP8A 5K5GB 3H1LG 2C9NY 3AEDC 2ZYDA 5KTBA 1NWQA 1FOSE 3BRTB 3H1IE 4K35A 2D2CB 1S72P 1NTKK 1S1CX 5APQA 5B5EE 1VQ6P 2YMYA 2WU5C 4BRYA 2AXTH 2E75D 3IAOA 2JDIH 3AE3D 5KJ7A 2L5GB 3L75D 3TK1A 2WDQC 1ZOYD 1WT6A 1HGZA 2XDJA 4D6TG 1K9MQ 4PJ0E 5AW5B 3WUTA 4ZMDA 2XKMA 4I7ZC 1OXZA 1KYOD 5DJTB 3A3YB 1JEKA 3CX5I 2H89D 4RJTA 2WSEJ 1KYOH 2BS3C 1IC2A 1KFNA 2AEJA 4TLFA 1MKMA 2ZXEB 1X0TA 1HVVA 3AE7D 2FBWD 1BGYE 3WUVA 2QE7H 3I5CA 3PHLA 2K88A 1SQBJ 2QM7A 3GF3A 1ZV8A 1JO5A 4UB6E 4IL6E 4YSZC 4WWIA 4AUWA 2AEFA 2YO2A 1IFJA 1HWTC 3RK3D 1HH0A 1JY2O 2ZVNB 3PP5A 4OGQB 1JY2N 3TDKA 1FU1A 1TU3F 1M1KQ 1YQ4D 2YNYA 2ZXXA 1EDLA 2XU6A 3T97B 3Q5PA 2KIKA 2Y0DA 5CMZA 1SFCA 2QSIA 5KKZC 1YIJP 2NRGA 1G2CA 4GODA 1U7JA 2I1JA 4YTMD 4W7ZA 2K3RA 2YKOA 3MP7B 1BE3G 3F5HA 5AVQB 1FC2C 3HUSB 1PPJD 4H44B 3ABVD 3N4XA 3L4FA 3MUDC 1ZXGA 3I56P 3O6QA 2P58A 3TGUD 3CC7P 1L0ND 2ZT9D 3EFFK 5M1BA 1YI2P 1Y8AA 4D6TE 1NOHA 1FDMA 4WBAA 2WT7A 4W7YA 1NTZJ 3RK2D 4DHJA 5KAIH 1NTMG 1SQBD 4R4MA 3L70G 1S4XA 2RMZA 2ZAEB 1T2KD 2JKVA 1N7SD 1NU1E 1Y9BA 2WU5D 4U3FJ 1KILD 3NFQA 5H2FH 1KB9H 5EFWB 1CZQA 4PV1C 2FYUJ 1SQQJ 1YQ3D 1SQQG 3AE6C 1KQSO 3L74E 1MFZA 3RK3B 5AW2B 4DDGA 5AVRB 3H1LD 4IL6X 3S1KA 3AE9C 3TYYA 3RK2C 1G2CB 3P32A 4ASWA 2E42A 2KOGA 5BVZA 3B71A 1SVFA 1N8RQ 4YXDD 3CC4P 2KUBA 5C3JD 1KILC 2Q3IA 3CCJP 1BDDA 3HUSC 4TT3H 5CCGD 3ZDMA 2A45G 3M9HA 2H88D 2FYNB 1P84E 1HJ0A 1KQGB 3N7NA 1HGVA 2KNCA 4A7PA 4D6TD 5CBNA 2M8RA 2OYHC 1S5LH 3A0HE 1L0VD 3BRVB 1QL1A 3H32B 4JF7A 1OW7A 1DEEG 4KHXA 4OGQC 4JYCA 2E75C 1ZP0C 3C1LA 4H44D 4CPGA 4LDTA 5KJ7C 1J1DB 2OTLP 2ZT9B 1SQVG 1FJPA 4N78D 3H1LE 3MUDA 2E74C 2KSJA 2WSCJ 2D2CC 1VQPP 3V2NA 1NEKC 1ZW0A 1L0VC 2WQYC 1URQB 2K1AA 1FZCC 2GUVA 1URQA 4L74A 1N7SA 3BASA 1VF5C 2IYPA 5C2TD 3SFDC 3L36A 1XTCC 2KZJA 1X22A 1E5WA 3CXHE 1KB9E 4ZNCA 2W6BA 2AXCA 4GDOA 1NTMD 1SQBG 1RE4A 2JEEA 1URQD 3BCCJ 5AW6B 3CL3D 1GL2D 1BCCJ 2Y0CA 1SQXG 2NZ2A 2R3SA 5AW9B 1HUCA 3VOPA 4U7JA 4IFFA 1AV1A 1VQOP 3HUSA 1YQ4C 4RO0A 5KLVK 1QL2A 5C2TC 3OA7A 4JBZA 5B66E 2Z5HA 1NTZE 4YSXC 3RK3C 2Q5UA 2W6AA 1OMIA 1ZMEC 1GL2B 1IFIA 4DZOA 5CHXA 3P4RC 1KQFB 1Q2NA 5AVXB 1T3JA 2WDRD 5H2FE 2E76C 1BCCD 5AVVB 3KZIH 1BDCA 1MFTA 1A02J 3VONA 2FYUG 3B8EB 2WSFH 2HFED 3AECD 2ZJSE 1GDTA 1J1EB 2B88A 2N1TD 3KDPB 2PP6A 1BE3D 2LXBA 1PPJG 2B87A 3VRAC 3CD6P 4UB8E 1SP4A 2E5TA 3V2RA 5KLIB 3K5BA 1NO4A 2W27A 2HPCB 1NTKJ 3HTKA 4EOTA 1VDFA 5DJUB 4XE5B 2HPCA 1M56D 3ITKA 3P4PC 1P84H 3MIWA 5GTHH 4DHZA 1H0TA 2BCCG 1N7LA 1SS1A 1FZAA 2N9YB 3AE3C 4N3YB 2WVRA 1JUNA 1DEBA 2JR8A 3B5ND 4RKUJ 5GTIE 1HF9A 5AVUB 1FAVA 2XZRA 3H1JD 3A2AA 3OJAB 2ITAA 3AE1C 3H25A 2C9LY 4U3FG 5APSA 1RH5B 4YPCA 1GTWA 1SQQD 3P4SD 4WY4D 3USSA 5E79E 5AW1B 1NENC 1N2DC 1AA0A 2O1KA 4NPEA 2M3EA 1PZQA 2K9JA 5CBOA 3MD0A 3AEEC 1SQBK 3D6YA 1OWAA 3L73J 4PV1B 1QEXA 1Q86Q 4I6LA 3RBZA 1KYOE 3E7KA 1LTJB 4C7NA 4H0LC 3VMXA 1U57A 4PD4H 1SQVD 4IFDK 1PIXA 1SQXJ 1ZRTD 3V4QA 3P4RD 2QRXA 3VMAA 1N7SC 2R44A 1L0LD 3F89A 3L37A 4L73A 1RE3A 3AE4D 1FZCA 2B9BA 2ZYAA 1P84I 1VQLP 4DHIB 2H88C 3S9OA 3L71D 1R5LA 3GHGB 2ZFCA 2N1TA 2IBZD 4DDIA 5E79H 1L0NJ 1OX3A 1FBMA 2LXCB 3Q5SA 1PGPA 1Q7YQ 1OFCX 1PGOA 3BVHA 4JQ0D 4ASVA 2OQQA 2OYIC 3LIDA 2HR3A 1HBWA 4FJVA 3Q2YA 4W80A 3FXDA 5KJ7D 1NGMB 3NTNA 1FDIA 5KAIE 1SQXD 5GTIH 1QLBC 3H1HE 2GUSA 3H1IJ 3AEGC 3RL0D 1NEKD 2NPSD 2E74B 4I1LA 1T3UA 2O1JA 1NVOA 4C7NB 3L71J 2XV5A 1NTZK 2BCCJ 1FJKA 1KD1Q 2WT7B 3MGNA 3CX5D 1BE3E 3TNUA 3JSVC 2K37A 3GMAA 3H1JG 4PD4I 2A06G 1KFMA 1JMMA 2FYUK 1SQQK 3P8CD 2I8DA 1S2EA 2FYUD 1JMBA 2WP9C 3E1IA 2QJYB 4HYTB 1SQVE 2FXOA 3L70J 1WRGA 4EDFA 2BS4C 4AQRD 3AE8D 1RE4C 5AW4B 1D7MA 2KP8A 4IFMA 3AE4C 2IZ1A 4OWFA 1K8AQ 3HD7C 1BCCG 2G3AA 5KAFE 1ZOYC 2KLUA 1JCDA 3L75G 3V5BA 1W2EA 3VN0A 5AVTB 1SFCD 3M0DA 1GK6A 4XFJA 2GA1A 1LT9B 1AFOA 3G3ZA 2JP3A 1LTGC 3L73E 2N1TC 2P2UA 5CCHD 2IBZG 3MHVA 3M9BA 3RL0g 3CCRP 3H6PA 2IZ0A 2O01H 1NH4A 2BCCD 4YT0C 2RN0A 4DOJA 1T6AA 3H1HG 2WSFJ 1PP9J 3IN6A 3A7OA 1LTTC 2IX7C 2NPSA 4Y28J 1NTMJ 1DD3A 1JB0J 5AW3B 1NTZG 1IFPA 1SFCC 1Q81Q 3PTZA 4U3FD 3GLMA 2IBZE 1IJDB 3TGUE 3BCCD 1YHQP 4R4LA 3H1IG 1YBKA 2V4HA 1NTKG 1L0LJ 2JO1A 2WPVB 1SQPG 2WU2D 1BGYJ 1LJ2A 4D6TJ 1M57D 1JY3N 2R32A 3CWBG 1L4AD 3L71G 1IK7A 4BXLA 5AVZB 1KB9I 2OYOA 1CW5A 4DT0A 1R8EA 3RK2B 5AW0B 2PAJA 1URQC 1MUUA 1W5CE 1M8OB 1RQVA 3V4WA 3L72J 2L91A 3LW5H 1JY2P 1KILB 1L0LG 5KLVJ 2XNDH 3L74G 4LGDE 2W8ZA 1FZGA 2AXTE 3L74J 2Q9IA 1RHZB 2WMMA 1VQ9P 3AE6D 2QJKB 1CSBA 1KV4A 1BGYD 2PFXA 3G9RA 4UB6H 1S9KD 3VR9D 3V2QA 3AE9D 1L0NG 2W90A 2WDRC 2O01N 4LLHA 4O9BA 3VMZA 2BEZF 3G71P 3H1KE 2QVAA 3RK3E 1HTLC 2A45H 1IZNB 2IFMA 1LNQA 3SFDD 4IOIH 5APTA 1RY3A 2PRRA 2XNXA 1Q90D 4KX6C 1OZHA 4PD4E 1K05A 4H44C 4ZKPA 1G1IA 1PPJE 3W67A 2KS1A 1E79H 2FFDB 3L72G 3VTPC 2KS1B 3TF5A 4N6JA 4OGQD 2M0BA 1X9VA 2YMKA 3P8MC 4YTMC 1OVVA 2POHA 1ZRTE 1RF1C 1MV8A 1EZVE 1NU1J 3H1LJ 3R2PA 3C8VA 3AE1D 3MTUE 1NTZD 2KNCB 3OAKA 3M0AA 3D71A 4YXWH 3AEAC 1GL2A 1PGQA 2M5AA 3HE5B 3AE8C 1KC8Q 4JYBA 1A02F 5CCGC 1PP9E 4WVZA 3CWBD 1NTME 2QM8A 3KZIE 5CJ0A 4H0LD 1NU1D 2QJPB 2R5DA 3VRAD 2B87B 1JTHB 1YTZT 1YJ9P 1SQXK 2QEXP 4OVNF 4PJ0H 1AJYA 1RF1A 2IBZI 1PFIA 2E75B 1FZFA 1LTAC 1T8ZA 3CIRD 3AE2D 1RF1B 3GG2A 3NMDA 3CMAP 1OW6A 2KK7A 3IR9A 4YSYD 3HE4B 3LIEA 2OTJP 2YXRB 3H1ID 1QLED 1KQLA 1L0NK 1N86A 1NTKD 3GHGA 3A0HH 1G1JA 1YITP 2KI7B 3WU2E 1BCCE 1SQPD 1DD4A 1KFYD 3L75E 1UIIA 4Y99C 3M0DC 1LT9C 1LP1B 1JNMA 2ACZD 2YXQB 3WMM0 5AVWB 3O8ZA 5KAFH 4AYCA 4YTNC 1GW3A 1VF5B 2O01J 3HD7D 1K73Q 4YTPC 1UIXA 3AEED 3B5NA 2FY8A 3GHGC 1GMJA 2JJLA 3WUUA 1FZBA 1NKZB 3L74D 2FFDC 1QX8A 5BU8B 3CC2P 1Z56A 2LKMA 4B86A 2WSEH 2WDVD 4WY4A 2R3CA 1VQMP
chains in the Genus database with same CATH topology
4H13C 4H0LD 2WSFJ 1KQFB 2E74D 3IN6A 2WP9D 1VL2A 2WDRD 2FYNC 2BEZF 2E76C 4I7ZB 3AEAD 3VRBD 1Y9BA 3RK3E 4Y28J 2WU5D 4YSZC 2E74C 1VF5D 2BS2C 2WU2C 1KORA 1DD3A 4H0LC 4KT0J 3VRAD 1JB0J 5C2TC 1U57A 2WSCJ 3GMAA 3AECC 3ABVC 1PIXA 2E76D 2D2CC 2QIWA 5KLIC 3SFDD 3Q5RA 1NEKC 4YTPD 1L0VC 1Q90D 2WQYC 3GLMA 4PV1C 4H13D 3AECD 4KX6C 4YXDC 1KF6D 2J5UA 1K05A 4H44C 3P4RD 2FBWC 2G8YA 1AJYA 1YQ3D 2WP9C 3AEDC 3AE2C 4OGQB 3AE6C 2V7QJ 3AE4D 4R4LA 1K04A 3VRAC 1EXIA 3AEGD 1VF5C 2E75B 1TU3F 1YQ4D 1NYHA 2H88C 3Q1MA 3CIRD 2D2CB 3AE2D 5C2TD 3SFDC 3S9OA 4YT0C 4IL6X 2BS4C 2JO1A 3Q3DA 1S1CX 3AE9C 3SFED 1OW6A 2WPVB 2WQYD 3AEBC 2WU2D 4YSYD 4OGQD 3AE8D 2QJKC 2WU5C 3T97B 2E75D 3EWKA 1YQ3C 3IAOA 2YMKA 4Z1MH 3Q5PA 3AEBD 3P4PC 4YTMC 3AE4C 3Q5SA 3AE3D 1NEND 3VR8D 1IK7A 5C3JC 2E76B 4GDOA 3B71A 1DD4A 1KFYD 1ZRTE 2QSIA 2B76D 2ACZC 2WDQC 3D70A 3R4YA 4YXDD 5KKZC 1ZOYD 5C3JD 3P4SC 2OQQA 3AE3C 2P10A 3AEFC 2G3AA 3C8VA 4TT3H 4RKUJ 1R8EA 1ZOYC 1HF9A 1KFYC 2ACZD 2WDQD 1KTMA 3AE1D 3AE5D 2MKVA 2FXPA 2QJPC 4I7ZC 2H88D 3CIRC 1RQUA 1HJ0A 2K9YA 2NZ2A 1KQGB 4PV1D 1E7PC 4YTMD 3D71A 1RQVA 5L8RJ 4YSZD 1EXJA 4H0LB 2H89C 3Q2YA 4U7JA 3AEDD 3AE1C 3H25A 1NGMB 2QJYC 3AE7C 2B76C 1ZP0D 1FDIA 4YTNC 4YSYC 2H89D 3P4QC 1VF5B 1YQ4C 2BEQD 3FGAD 3VR9C 1L0VD 4KX6D 2O01J 3D6ZA 3P4SD 2WSEJ 1OW7A 4YTPC 1KILE 3AEFD 4XFJA 3LW5J 3AEAC 1UIXA 3P4QD 3VRBC 2YIUC 4H44B 3AE5C 1QLBC 1KMIZ 2BS3C 3AEED 4YSXD 4YTND 1PL5A 2WDVC 2WS3C 3ABVD 3P4RC 1MKMA 1NENC 2ZT9C 3SFEC 3AE8C 4OGQC 3O6QA 1GMJA 4H13B 3AE6D 3AEGC 2E75C 4YSXC 2ZT9D 1NEKD 3P4PD 2JP3A 2WS3D 1ZP0C 5M1BA 1OW8A 3G9RA 3AE7D 2IDBA 2E74B 2FBWD 3VR8C 1DIPA 3VR9D 1PV3A 4H44D 4YT0D 1FDOA 1OMIA 3RL0g 3AE9D 1ZMEC 3AEEC 1WMKA 2D2CD 2WDVD 1S5LX 3D6YA 3GF3A 2WDRC 2ZT9B 3GF7A 4PV1B 4R4MA 1KF6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 D;  2WDR D;  3AEA D;  3VRB D;  2WU5 D;  4YSZ C;  2BS2 C;  2WU2 C;  3VRA D;  3AEC C;  3ABV C;  3SFD D;  1NEK C;  4YTP D;  1L0V C;  2WQY C;  4KX6 C;  3AEC D;  4YXD C;  1KF6 D;  3P4R D;  1K05 A;  2FBW C;  1YQ3 D;  2WP9 C;  3AED C;  3AE2 C;  3AE6 C;  3AE4 D;  1K04 A;  3VRA C;  3AEG D;  1YQ4 D;  2H88 C;  3CIR D;  5C2T D;  3AE2 D;  3SFD C;  3S9O A;  2BS4 C;  3AE9 C;  3SFE D;  1OW6 A;  4YSY D;  2WQY D;  3AEB C;  2WU2 D;  3AE8 D;  2WU5 C;  1YQ3 C;  3AEB D;  3P4P C;  4YTM C;  3AE4 C;  3VR8 D;  3AE3 D;  1NEN D;  5C3J C;  3B71 A;  1KFY D;  2B76 D;  2ACZ C;  2WDQ C;  4YXD D;  1ZOY D;  5C3J D;  3P4S C;  3AE3 C;  3AEF C;  2G3A A;  1KFY C;  1ZOY C;  2ACZ D;  2WDQ D;  1KTM A;  3AE1 D;  3AE5 D;  2H88 D;  3CIR C;  1E7P C;  4YTM D;  4YSZ D;  2H89 C;  3AED D;  3AE1 C;  3AE7 C;  2B76 C;  1ZP0 D;  4YTN C;  4YSY C;  2H89 D;  3P4Q C;  1YQ4 C;  3VR9 C;  1L0V D;  4KX6 D;  3P4S D;  1OW7 A;  4YTP C;  3AEF D;  3AEA C;  3P4Q D;  3VRB C;  5C2T C;  3AE5 C;  1QLB C;  2BS3 C;  3AEE D;  4YSX D;  4YTN D;  2WDV C;  2WS3 C;  3ABV D;  3P4R C;  1NEN C;  3SFE C;  3AE8 C;  3AE6 D;  3AEG C;  4YSX C;  1NEK D;  3P4P D;  2WS3 D;  1ZP0 C;  1OW8 A;  3AE7 D;  2FBW D;  3VR8 C;  3VR9 D;  1PV3 A;  4YT0 D;  3AE9 D;  3AEE C;  2WDV D;  2WDR C;  4YT0 C;  1KF6 C; 
#chains in the Genus database with same CATH topology
 4EYY Q;  3IFM A;  1VL2 A;  3VRB D;  4C46 A;  1GW4 A;  2A45 I;  2HYN A;  2KLV A;  3CXH I;  1VF5 D;  2WU2 C;  2SPZ A;  1S9K E;  1NKN A;  3FWN A;  4K3A A;  3B5N C;  3A0B H;  4GOF A;  1AVO A;  2J5U A;  5TIS H;  2G8Y A;  1LTJ A;  1HJB A;  1VQK P;  4QMA A;  1LWU B;  5B5E H;  1VQ8 P;  2AEM A;  4L75 A;  4N78 E;  3SFE D;  4EI2 A;  1FZC B;  1NHL A;  3H1J E;  3I55 P;  4GIF A;  1GK4 A;  4OH8 B;  2E76 B;  5CJ4 A;  2P1J A;  3U1A A;  4BWN A;  3AEF C;  3CX5 H;  3RGU A;  3P8C E;  3JC2 2;  4HKZ H;  3VMY A;  2JWA A;  3TSI A;  1JCC A;  5CCH A;  1JOC A;  2O3J A;  4PV1 D;  1J1E C;  1SQP E;  2H89 C;  2V7Q H;  3AED D;  1PP9 G;  2QJY C;  3QWO C;  3SWK A;  1XTG B;  2Z4E A;  2M5A B;  2UWJ E;  2WPS A;  3P4Q D;  4HB1 A;  2YO3 A;  3SFE C;  3PJS K;  4H13 B;  2E43 A;  1BSN A;  4RES B;  1ZLL A;  1YJW P;  2J59 M;  5TJH A;  4YT0 D;  2DW3 A;  4GKG A;  5CCH C;  1EQ7 A;  2HOD A;  4UB8 H;  1M90 Q;  1H88 A;  5BU5 A;  1NTM K;  4KT0 J;  1AQ5 A;  1JY3 O;  4Y99 B;  3S4R A;  3CCE P;  1OVR A;  2QIW A;  1GL2 C;  2MJZ A;  1KN7 A;  1L4A A;  4H13 D;  3P7K A;  1H89 A;  4BRY B;  1T2K C;  4JPZ B;  2OGU A;  3E1R A;  3HE4 A;  1L0L K;  5AVS B;  2N1T B;  1S5L E;  1DX7 A;  1NAY A;  2QJK C;  1W2B O;  1YQ3 C;  3L71 E;  2NPS C;  3W68 A;  4PD4 D;  3CWB J;  5TIS E;  3GW6 A;  3P4S C;  1IFD A;  3CCV P;  3PLN A;  3KPE A;  2Y9Y A;  1GU5 A;  3AE5 D;  3V6I A;  2M3B A;  1E7P C;  2Q3E A;  2P67 A;  1MZ9 A;  1PGJ A;  3B5N B;  3OW2 O;  3AEF D;  3LW5 J;  2C0X A;  1KMI Z;  1SQV J;  1PL5 A;  2WS3 C;  4ZKU A;  2ZT9 C;  3JCU H;  1FOS F;  1VQ4 P;  1M7L A;  3RL0 C;  3H32 A;  1EZV D;  1DIP A;  1LT9 A;  1VQ5 P;  1BE3 J;  3FX0 A;  3VYI A;  3CCQ P;  3FXE A;  1KF6 C;  1LTB C;  1Q82 Q;  3CCM P;  1ZR2 A;  3B4S A;  5C39 A;  2FYZ A;  3G6E P;  2GM4 A;  3CCL P;  1P84 D;  1SQP K;  3L70 E;  4YTP D;  3M06 A;  1PP9 D;  2Z5I A;  4I2L C;  2JWD A;  4YXD C;  4U3F E;  2HG5 D;  4XA4 A;  1K04 A;  2KXP B;  3QH9 A;  1NYH A;  1SFC B;  1SQQ E;  3H1J J;  2WQY D;  2FFD A;  1X8Y A;  1N7S B;  4Z1M H;  3CXH D;  3AEB D;  2WPR A;  5C3J C;  1LT1 A;  2KSE A;  2B76 D;  2FKW B;  1YTZ I;  1NU1 K;  2J58 A;  1SLQ A;  2WSS H;  2WDQ D;  2QJP C;  2H8P D;  1NJI Q;  1EXJ A;  3G4S P;  1EDI A;  1S3J A;  2N9B A;  2FYU E;  2WWW A;  3P4Q C;  3L73 G;  3FGA D;  3VR9 C;  1LTI C;  1X79 B;  3TGU J;  3BAT A;  3VRB C;  1KYO I;  2P7J A;  2R5B A;  5AVY B;  1YJN P;  1GU4 A;  2BAS A;  1IFN A;  1AVY A;  1RF0 C;  1N73 A;  4HJG H;  1KB9 D;  3HE5 A;  1KIL A;  1N73 B;  5APU A;  3TNU B;  3SWF A;  3M91 A;  2YKQ A;  2YIU B;  1S5L X;  3CCS P;  2NPS B;  2E74 D;  2WP9 D;  3KYQ A;  1ZN5 A;  4I7Z B;  1TFF A;  3BCC E;  1L4A B;  3SSU A;  1LWU C;  1M1J C;  2Y0E A;  3H1H D;  1CI6 A;  2WTY A;  1KF6 D;  1L0L E;  3AE2 C;  2CK3 H;  5KLV E;  1EXI A;  3EFG A;  3M9Q A;  3Q1M A;  2IYO A;  4IL6 H;  3BCC G;  3CWB E;  3KHU A;  3PH0 A;  3HD7 A;  3II6 A;  2WIT A;  3VR8 D;  3SWY A;  5APV A;  2ACZ C;  3D70 A;  3H1K G;  2A06 E;  2P10 A;  1IK9 A;  3H1K J;  1KFY C;  1BSH A;  2WSC H;  5APX A;  1RQU A;  5GTH E;  3CX5 E;  2OTK E;  1H8A A;  3WU2 H;  5B66 H;  1KIL E;  1L2P A;  3O6Q B;  4YTN D;  4M3L A;  1J1D C;  2OAR A;  1USE A;  1FE6 A;  3A0B E;  1PV3 A;  3VP9 A;  4GOE A;  5KKZ B;  1RF0 A;  5KLV D;  1BGY G;  3CPW O;  3AEA D;  3MZW B;  4GT1 A;  1U7M A;  1ZR4 A;  1GZL A;  3L72 E;  1FS0 E;  3CCU P;  3L73 D;  1OIP A;  2W6J H;  3RBX A;  1EZV I;  1Y47 A;  3AEG D;  2OYH B;  3L35 A;  5APY A;  2OYH A;  3AEB C;  1IO4 A;  1EZV G;  5AW8 B;  1LP1 A;  3HTK B;  3L72 D;  1NEN D;  2H43 A;  2H7H A;  1H0T B;  1VQN P;  2IPP A;  4KJM A;  3KQG A;  2I1K A;  2MKV A;  2FXP A;  3CIR C;  1VQ7 P;  2K9Y A;  2YKP A;  5L8R J;  1JM0 A;  2IFN A;  4H0L B;  4YSZ D;  2KB7 P;  2WPQ A;  5AW7 B;  2E5Y A;  3CLQ A;  3RL0 B;  2BEQ D;  1RE3 C;  3AE5 C;  2WDV C;  1LGH B;  1KZU B;  2W83 C;  1NTK E;  1OVU A;  3P4P D;  5CCG A;  2Y9Z A;  2RKL A;  2Q7C A;  1L0N E;  4MN4 C;  3U1C A;  2QA4 P;  1AQT A;  1QVF O;  3GF7 A;  1GD2 E;  4I6M C;  2FYN C;  1EC5 A;  1SQB E;  4LC1 A;  2BS2 C;  1KOR A;  1CI6 B;  4WB4 A;  2KYV A;  2OYI B;  1NAF A;  3CME P;  5KLI C;  4WY4 B;  1NU1 G;  2VRS A;  2FBW C;  2PGD A;  4L76 A;  2V7Q J;  1QVG O;  1VPC A;  3EQ2 A;  3H1H J;  1USD A;  1QGK B;  3Q3D A;  2FXM A;  3HD7 B;  3V2P A;  2Q6Q A;  2KZI A;  4EIJ A;  3PRJ A;  3EWK A;  2C0W A;  3KXD A;  4NPD A;  4DJG A;  1LWU A;  1J2J B;  5APW A;  3T97 A;  1R5S A;  3L70 D;  3UIA A;  3R4Y A;  2ZFY A;  2CPB A;  3C9I A;  3HRN A;  1KTM A;  1SQX E;  3H1K D;  1EDK A;  3AE7 C;  1EDJ A;  2B76 C;  1ZP0 D;  3A5T A;  4YSY C;  3TGU G;  3CI9 A;  1N73 C;  4DCK A;  4KX6 D;  3D6Z A;  2YIU C;  2ZYG A;  2K9J B;  3CXH H;  1SQV K;  1LTS C;  4YSX D;  3NXS A;  4C7R A;  2B89 A;  2HOD B;  2WS3 D;  1OW8 A;  2HLO A;  1LTJ C;  2IDB A;  2QG4 A;  3VR8 C;  1L4A C;  1FDO A;  1M1J B;  2ZVO B;  2CPS A;  1WMK A;  2D2C D;  2LR2 A;  2OYI A;  1JTH A;  4WY4 C;  1JY3 P;  1IFM A;  4HH2 A;  2WZ7 A;  1M1J A;  4NPF X;  2A06 D;  3L75 J;  4H13 C;  1YYC A;  3FWL A;  2BCC E;  1FZE A;  2RH0 A;  5KLV G;  1DH3 A;  3JCU E;  3AEC C;  3ABV C;  3IF4 A;  2E76 D;  3U59 A;  3Q5R A;  1SQP J;  2Q1K A;  3VP8 A;  5K5G B;  3H1L G;  2C9N Y;  3AED C;  2ZYD A;  5KTB A;  1NWQ A;  1FOS E;  3BRT B;  3H1I E;  4K35 A;  2D2C B;  1S72 P;  1NTK K;  1S1C X;  5APQ A;  5B5E E;  1VQ6 P;  2YMY A;  2WU5 C;  4BRY A;  2AXT H;  2E75 D;  3IAO A;  2JDI H;  3AE3 D;  5KJ7 A;  2L5G B;  3L75 D;  3TK1 A;  2WDQ C;  1ZOY D;  1WT6 A;  1HGZ A;  2XDJ A;  4D6T G;  1K9M Q;  4PJ0 E;  5AW5 B;  3WUT A;  4ZMD A;  2XKM A;  4I7Z C;  1OXZ A;  1KYO D;  5DJT B;  3A3Y B;  1JEK A;  3CX5 I;  2H89 D;  4RJT A;  2WSE J;  1KYO H;  2BS3 C;  1IC2 A;  1KFN A;  2AEJ A;  4TLF A;  1MKM A;  2ZXE B;  1X0T A;  1HVV A;  3AE7 D;  2FBW D;  1BGY E;  3WUV A;  2QE7 H;  3I5C A;  3PHL A;  2K88 A;  1SQB J;  2QM7 A;  3GF3 A;  1ZV8 A;  1JO5 A;  4UB6 E;  4IL6 E;  4YSZ C;  4WWI A;  4AUW A;  2AEF A;  2YO2 A;  1IFJ A;  1HWT C;  3RK3 D;  1HH0 A;  1JY2 O;  2ZVN B;  3PP5 A;  4OGQ B;  1JY2 N;  3TDK A;  1FU1 A;  1TU3 F;  1M1K Q;  1YQ4 D;  2YNY A;  2ZXX A;  1EDL A;  2XU6 A;  3T97 B;  3Q5P A;  2KIK A;  2Y0D A;  5CMZ A;  1SFC A;  2QSI A;  5KKZ C;  1YIJ P;  2NRG A;  1G2C A;  4GOD A;  1U7J A;  2I1J A;  4YTM D;  4W7Z A;  2K3R A;  2YKO A;  3MP7 B;  1BE3 G;  3F5H A;  5AVQ B;  1FC2 C;  3HUS B;  1PPJ D;  4H44 B;  3ABV D;  3N4X A;  3L4F A;  3MUD C;  1ZXG A;  3I56 P;  3O6Q A;  2P58 A;  3TGU D;  3CC7 P;  1L0N D;  2ZT9 D;  3EFF K;  5M1B A;  1YI2 P;  1Y8A A;  4D6T E;  1NOH A;  1FDM A;  4WBA A;  2WT7 A;  4W7Y A;  1NTZ J;  3RK2 D;  4DHJ A;  5KAI H;  1NTM G;  1SQB D;  4R4M A;  3L70 G;  1S4X A;  2RMZ A;  2ZAE B;  1T2K D;  2JKV A;  1N7S D;  1NU1 E;  1Y9B A;  2WU5 D;  4U3F J;  1KIL D;  3NFQ A;  5H2F H;  1KB9 H;  5EFW B;  1CZQ A;  4PV1 C;  2FYU J;  1SQQ J;  1YQ3 D;  1SQQ G;  3AE6 C;  1KQS O;  3L74 E;  1MFZ A;  3RK3 B;  5AW2 B;  4DDG A;  5AVR B;  3H1L D;  4IL6 X;  3S1K A;  3AE9 C;  3TYY A;  3RK2 C;  1G2C B;  3P32 A;  4ASW A;  2E42 A;  2KOG A;  5BVZ A;  3B71 A;  1SVF A;  1N8R Q;  4YXD D;  3CC4 P;  2KUB A;  5C3J D;  1KIL C;  2Q3I A;  3CCJ P;  1BDD A;  3HUS C;  4TT3 H;  5CCG D;  3ZDM A;  2A45 G;  3M9H A;  2H88 D;  2FYN B;  1P84 E;  1HJ0 A;  1KQG B;  3N7N A;  1HGV A;  2KNC A;  4A7P A;  4D6T D;  5CBN A;  2M8R A;  2OYH C;  1S5L H;  3A0H E;  1L0V D;  3BRV B;  1QL1 A;  3H32 B;  4JF7 A;  1OW7 A;  1DEE G;  4KHX A;  4OGQ C;  4JYC A;  2E75 C;  1ZP0 C;  3C1L A;  4H44 D;  4CPG A;  4LDT A;  5KJ7 C;  1J1D B;  2OTL P;  2ZT9 B;  1SQV G;  1FJP A;  4N78 D;  3H1L E;  3MUD A;  2E74 C;  2KSJ A;  2WSC J;  2D2C C;  1VQP P;  3V2N A;  1NEK C;  1ZW0 A;  1L0V C;  2WQY C;  1URQ B;  2K1A A;  1FZC C;  2GUV A;  1URQ A;  4L74 A;  1N7S A;  3BAS A;  1VF5 C;  2IYP A;  5C2T D;  3SFD C;  3L36 A;  1XTC C;  2KZJ A;  1X22 A;  1E5W A;  3CXH E;  1KB9 E;  4ZNC A;  2W6B A;  2AXC A;  4GDO A;  1NTM D;  1SQB G;  1RE4 A;  2JEE A;  1URQ D;  3BCC J;  5AW6 B;  3CL3 D;  1GL2 D;  1BCC J;  2Y0C A;  1SQX G;  2NZ2 A;  2R3S A;  5AW9 B;  1HUC A;  3VOP A;  4U7J A;  4IFF A;  1AV1 A;  1VQO P;  3HUS A;  1YQ4 C;  4RO0 A;  5KLV K;  1QL2 A;  5C2T C;  3OA7 A;  4JBZ A;  5B66 E;  2Z5H A;  1NTZ E;  4YSX C;  3RK3 C;  2Q5U A;  2W6A A;  1OMI A;  1ZME C;  1GL2 B;  1IFI A;  4DZO A;  5CHX A;  3P4R C;  1KQF B;  1Q2N A;  5AVX B;  1T3J A;  2WDR D;  5H2F E;  2E76 C;  1BCC D;  5AVV B;  3KZI H;  1BDC A;  1MFT A;  1A02 J;  3VON A;  2FYU G;  3B8E B;  2WSF H;  2HFE D;  3AEC D;  2ZJS E;  1GDT A;  1J1E B;  2B88 A;  2N1T D;  3KDP B;  2PP6 A;  1BE3 D;  2LXB A;  1PPJ G;  2B87 A;  3VRA C;  3CD6 P;  4UB8 E;  1SP4 A;  2E5T A;  3V2R A;  5KLI B;  3K5B A;  1NO4 A;  2W27 A;  2HPC B;  1NTK J;  3HTK A;  4EOT A;  1VDF A;  5DJU B;  4XE5 B;  2HPC A;  1M56 D;  3ITK A;  3P4P C;  1P84 H;  3MIW A;  5GTH H;  4DHZ A;  1H0T A;  2BCC G;  1N7L A;  1SS1 A;  1FZA A;  2N9Y B;  3AE3 C;  4N3Y B;  2WVR A;  1JUN A;  1DEB A;  2JR8 A;  3B5N D;  4RKU J;  5GTI E;  1HF9 A;  5AVU B;  1FAV A;  2XZR A;  3H1J D;  3A2A A;  3OJA B;  2ITA A;  3AE1 C;  3H25 A;  2C9L Y;  4U3F G;  5APS A;  1RH5 B;  4YPC A;  1GTW A;  1SQQ D;  3P4S D;  4WY4 D;  3USS A;  5E79 E;  5AW1 B;  1NEN C;  1N2D C;  1AA0 A;  2O1K A;  4NPE A;  2M3E A;  1PZQ A;  2K9J A;  5CBO A;  3MD0 A;  3AEE C;  1SQB K;  3D6Y A;  1OWA A;  3L73 J;  4PV1 B;  1QEX A;  1Q86 Q;  4I6L A;  3RBZ A;  1KYO E;  3E7K A;  1LTJ B;  4C7N A;  4H0L C;  3VMX A;  1U57 A;  4PD4 H;  1SQV D;  4IFD K;  1PIX A;  1SQX J;  1ZRT D;  3V4Q A;  3P4R D;  2QRX A;  3VMA A;  1N7S C;  2R44 A;  1L0L D;  3F89 A;  3L37 A;  4L73 A;  1RE3 A;  3AE4 D;  1FZC A;  2B9B A;  2ZYA A;  1P84 I;  1VQL P;  4DHI B;  2H88 C;  3S9O A;  3L71 D;  1R5L A;  3GHG B;  2ZFC A;  2N1T A;  2IBZ D;  4DDI A;  5E79 H;  1L0N J;  1OX3 A;  1FBM A;  2LXC B;  3Q5S A;  1PGP A;  1Q7Y Q;  1OFC X;  1PGO A;  3BVH A;  4JQ0 D;  4ASV A;  2OQQ A;  2OYI C;  3LID A;  2HR3 A;  1HBW A;  4FJV A;  3Q2Y A;  4W80 A;  3FXD A;  5KJ7 D;  1NGM B;  3NTN A;  1FDI A;  5KAI E;  1SQX D;  5GTI H;  1QLB C;  3H1H E;  2GUS A;  3H1I J;  3AEG C;  3RL0 D;  1NEK D;  2NPS D;  2E74 B;  4I1L A;  1T3U A;  2O1J A;  1NVO A;  4C7N B;  3L71 J;  2XV5 A;  1NTZ K;  2BCC J;  1FJK A;  1KD1 Q;  2WT7 B;  3MGN A;  3CX5 D;  1BE3 E;  3TNU A;  3JSV C;  2K37 A;  3GMA A;  3H1J G;  4PD4 I;  2A06 G;  1KFM A;  1JMM A;  2FYU K;  1SQQ K;  3P8C D;  2I8D A;  1S2E A;  2FYU D;  1JMB A;  2WP9 C;  3E1I A;  2QJY B;  4HYT B;  1SQV E;  2FXO A;  3L70 J;  1WRG A;  4EDF A;  2BS4 C;  4AQR D;  3AE8 D;  1RE4 C;  5AW4 B;  1D7M A;  2KP8 A;  4IFM A;  3AE4 C;  2IZ1 A;  4OWF A;  1K8A Q;  3HD7 C;  1BCC G;  2G3A A;  5KAF E;  1ZOY C;  2KLU A;  1JCD A;  3L75 G;  3V5B A;  1W2E A;  3VN0 A;  5AVT B;  1SFC D;  3M0D A;  1GK6 A;  4XFJ A;  2GA1 A;  1LT9 B;  1AFO A;  3G3Z A;  2JP3 A;  1LTG C;  3L73 E;  2N1T C;  2P2U A;  5CCH D;  2IBZ G;  3MHV A;  3M9B A;  3RL0 g;  3CCR P;  3H6P A;  2IZ0 A;  2O01 H;  1NH4 A;  2BCC D;  4YT0 C;  2RN0 A;  4DOJ A;  1T6A A;  3H1H G;  2WSF J;  1PP9 J;  3IN6 A;  3A7O A;  1LTT C;  2IX7 C;  2NPS A;  4Y28 J;  1NTM J;  1DD3 A;  1JB0 J;  5AW3 B;  1NTZ G;  1IFP A;  1SFC C;  1Q81 Q;  3PTZ A;  4U3F D;  3GLM A;  2IBZ E;  1IJD B;  3TGU E;  3BCC D;  1YHQ P;  4R4L A;  3H1I G;  1YBK A;  2V4H A;  1NTK G;  1L0L J;  2JO1 A;  2WPV B;  1SQP G;  2WU2 D;  1BGY J;  1LJ2 A;  4D6T J;  1M57 D;  1JY3 N;  2R32 A;  3CWB G;  1L4A D;  3L71 G;  1IK7 A;  4BXL A;  5AVZ B;  1KB9 I;  2OYO A;  1CW5 A;  4DT0 A;  1R8E A;  3RK2 B;  5AW0 B;  2PAJ A;  1URQ C;  1MUU A;  1W5C E;  1M8O B;  1RQV A;  3V4W A;  3L72 J;  2L91 A;  3LW5 H;  1JY2 P;  1KIL B;  1L0L G;  5KLV J;  2XND H;  3L74 G;  4LGD E;  2W8Z A;  1FZG A;  2AXT E;  3L74 J;  2Q9I A;  1RHZ B;  2WMM A;  1VQ9 P;  3AE6 D;  2QJK B;  1CSB A;  1KV4 A;  1BGY D;  2PFX A;  3G9R A;  4UB6 H;  1S9K D;  3VR9 D;  3V2Q A;  3AE9 D;  1L0N G;  2W90 A;  2WDR C;  2O01 N;  4LLH A;  4O9B A;  3VMZ A;  2BEZ F;  3G71 P;  3H1K E;  2QVA A;  3RK3 E;  1HTL C;  2A45 H;  1IZN B;  2IFM A;  1LNQ A;  3SFD D;  4IOI H;  5APT A;  1RY3 A;  2PRR A;  2XNX A;  1Q90 D;  4KX6 C;  1OZH A;  4PD4 E;  1K05 A;  4H44 C;  4ZKP A;  1G1I A;  1PPJ E;  3W67 A;  2KS1 A;  1E79 H;  2FFD B;  3L72 G;  3VTP C;  2KS1 B;  3TF5 A;  4N6J A;  4OGQ D;  2M0B A;  1X9V A;  2YMK A;  3P8M C;  4YTM C;  1OVV A;  2POH A;  1ZRT E;  1RF1 C;  1MV8 A;  1EZV E;  1NU1 J;  3H1L J;  3R2P A;  3C8V A;  3AE1 D;  3MTU E;  1NTZ D;  2KNC B;  3OAK A;  3M0A A;  3D71 A;  4YXW H;  3AEA C;  1GL2 A;  1PGQ A;  2M5A A;  3HE5 B;  3AE8 C;  1KC8 Q;  4JYB A;  1A02 F;  5CCG C;  1PP9 E;  4WVZ A;  3CWB D;  1NTM E;  2QM8 A;  3KZI E;  5CJ0 A;  4H0L D;  1NU1 D;  2QJP B;  2R5D A;  3VRA D;  2B87 B;  1JTH B;  1YTZ T;  1YJ9 P;  1SQX K;  2QEX P;  4OVN F;  4PJ0 H;  1AJY A;  1RF1 A;  2IBZ I;  1PFI A;  2E75 B;  1FZF A;  1LTA C;  1T8Z A;  3CIR D;  3AE2 D;  1RF1 B;  3GG2 A;  3NMD A;  3CMA P;  1OW6 A;  2KK7 A;  3IR9 A;  4YSY D;  3HE4 B;  3LIE A;  2OTJ P;  2YXR B;  3H1I D;  1QLE D;  1KQL A;  1L0N K;  1N86 A;  1NTK D;  3GHG A;  3A0H H;  1G1J A;  1YIT P;  2KI7 B;  3WU2 E;  1BCC E;  1SQP D;  1DD4 A;  1KFY D;  3L75 E;  1UII A;  4Y99 C;  3M0D C;  1LT9 C;  1LP1 B;  1JNM A;  2ACZ D;  2YXQ B;  3WMM 0;  5AVW B;  3O8Z A;  5KAF H;  4AYC A;  4YTN C;  1GW3 A;  1VF5 B;  2O01 J;  3HD7 D;  1K73 Q;  4YTP C;  1UIX A;  3AEE D;  3B5N A;  2FY8 A;  3GHG C;  1GMJ A;  2JJL A;  3WUU A;  1FZB A;  1NKZ B;  3L74 D;  2FFD C;  1QX8 A;  5BU8 B;  3CC2 P;  1Z56 A;  2LKM A;  4B86 A;  2WSE H;  2WDV D;  4WY4 A;  2R3C A;  1VQM P; 
#chains in the Genus database with same CATH homology
 4H13 C;  4H0L D;  2WSF J;  1KQF B;  2E74 D;  3IN6 A;  2WP9 D;  1VL2 A;  2WDR D;  2FYN C;  2BEZ F;  2E76 C;  4I7Z B;  3AEA D;  3VRB D;  1Y9B A;  3RK3 E;  4Y28 J;  2WU5 D;  4YSZ C;  2E74 C;  1VF5 D;  2BS2 C;  2WU2 C;  1KOR A;  1DD3 A;  4H0L C;  4KT0 J;  3VRA D;  1JB0 J;  5C2T C;  1U57 A;  2WSC J;  3GMA A;  3AEC C;  3ABV C;  1PIX A;  2E76 D;  2D2C C;  2QIW A;  5KLI C;  3SFD D;  3Q5R A;  1NEK C;  4YTP D;  1L0V C;  1Q90 D;  2WQY C;  3GLM A;  4PV1 C;  4H13 D;  3AEC D;  4KX6 C;  4YXD C;  1KF6 D;  2J5U A;  1K05 A;  4H44 C;  3P4R D;  2FBW C;  2G8Y A;  1AJY A;  1YQ3 D;  2WP9 C;  3AED C;  3AE2 C;  4OGQ B;  3AE6 C;  2V7Q J;  3AE4 D;  4R4L A;  1K04 A;  3VRA C;  1EXI A;  3AEG D;  1VF5 C;  2E75 B;  1TU3 F;  1YQ4 D;  1NYH A;  2H88 C;  3Q1M A;  3CIR D;  2D2C B;  3AE2 D;  5C2T D;  3SFD C;  3S9O A;  4YT0 C;  4IL6 X;  2BS4 C;  2JO1 A;  3Q3D A;  1S1C X;  3AE9 C;  3SFE D;  1OW6 A;  2WPV B;  2WQY D;  3AEB C;  2WU2 D;  4YSY D;  4OGQ D;  3AE8 D;  2QJK C;  2WU5 C;  3T97 B;  2E75 D;  3EWK A;  1YQ3 C;  3IAO A;  2YMK A;  4Z1M H;  3Q5P A;  3AEB D;  3P4P C;  4YTM C;  3AE4 C;  3Q5S A;  3AE3 D;  1NEN D;  3VR8 D;  1IK7 A;  5C3J C;  2E76 B;  4GDO A;  3B71 A;  1DD4 A;  1KFY D;  1ZRT E;  2QSI A;  2B76 D;  2ACZ C;  2WDQ C;  3D70 A;  3R4Y A;  4YXD D;  5KKZ C;  1ZOY D;  5C3J D;  3P4S C;  2OQQ A;  3AE3 C;  2P10 A;  3AEF C;  2G3A A;  3C8V A;  4TT3 H;  4RKU J;  1R8E A;  1ZOY C;  1HF9 A;  1KFY C;  2ACZ D;  2WDQ D;  1KTM A;  3AE1 D;  3AE5 D;  2MKV A;  2FXP A;  2QJP C;  4I7Z C;  2H88 D;  3CIR C;  1RQU A;  1HJ0 A;  2K9Y A;  2NZ2 A;  1KQG B;  4PV1 D;  1E7P C;  4YTM D;  3D71 A;  1RQV A;  5L8R J;  4YSZ D;  1EXJ A;  4H0L B;  2H89 C;  3Q2Y A;  4U7J A;  3AED D;  3AE1 C;  3H25 A;  1NGM B;  2QJY C;  3AE7 C;  2B76 C;  1ZP0 D;  1FDI A;  4YTN C;  4YSY C;  2H89 D;  3P4Q C;  1VF5 B;  1YQ4 C;  2BEQ D;  3FGA D;  3VR9 C;  1L0V D;  4KX6 D;  2O01 J;  3D6Z A;  3P4S D;  2WSE J;  1OW7 A;  4YTP C;  1KIL E;  3AEF D;  4XFJ A;  3LW5 J;  3AEA C;  1UIX A;  3P4Q D;  3VRB C;  2YIU C;  4H44 B;  3AE5 C;  1QLB C;  1KMI Z;  2BS3 C;  3AEE D;  4YSX D;  4YTN D;  1PL5 A;  2WDV C;  2WS3 C;  3ABV D;  3P4R C;  1MKM A;  1NEN C;  2ZT9 C;  3SFE C;  3AE8 C;  4OGQ C;  3O6Q A;  1GMJ A;  4H13 B;  3AE6 D;  3AEG C;  2E75 C;  4YSX C;  2ZT9 D;  1NEK D;  3P4P D;  2JP3 A;  2WS3 D;  1ZP0 C;  5M1B A;  1OW8 A;  3G9R A;  3AE7 D;  2IDB A;  2E74 B;  2FBW D;  3VR8 C;  1DIP A;  3VR9 D;  1PV3 A;  4H44 D;  4YT0 D;  1FDO A;  1OMI A;  3RL0 g;  3AE9 D;  1ZME C;  3AEE C;  1WMK A;  2D2C D;  2WDV D;  1S5L X;  3D6Y A;  3GF3 A;  2WDR C;  2ZT9 B;  3GF7 A;  4PV1 B;  4R4M A;  1KF6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...