3AE5B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-methyl-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Methyl-N-(3-isopropoxy-phenyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 48
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae5B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae5B01
4YTNB 5EE9A 3P1MA 1F0ZA 2K9XA 2MJEA 3LXFA 4JX1C 1SB3C 2BT6A 4YSYB 4YSXB 1J7CA 1FM0D 1ZP0B 2WDRB 1QOFA 1WGKA 1NVID 2K22A 4YXDB 2PVOD 1DOXA 1L5PA 2G1EA 1H7XA 1VDVA 2MH7A 1DOYA 1DGJA 1J7AA 1WYGA 1TJEA 3NS1A 1OQQA 1XLPA 2HTME 1N60A 1XLNA 3L4PA 1FMAD 1CZPA 2DBYA 2DWQA 4C80A 1ZUD2 3FC4A 1KF6B 4N58A 5EE0A 2M56B 1NYQA 4WQMA 1YQ4B 1FXAA 1L6UA 3AH7A 2CU3A 3AE2B 3HRDD 3AN1A 3NVYA 1WXQA 1DOIA 3W9CB 1OQRA 1I7HA 2WP9B 1V97A 3AECB 1AYFA 5GXGB 1FO4A 3AE9B 1E9MA 2OHFA 4JWSC 1GT8A 3NVVA 1N5XA 3BIID 3P63A 4USAA 1IUEA 3P4PB 3P4RB 4YTPB 1N62A 3AE7B 3AEFB 4KX6B 3AE8B 2WU5B 5C2TB 1N5WA 2LEKA 2M19A 3AV8A 3AM9A 3KWLA 1QLBB 3RPFC 1GPXA 2Q5WD 3P4SB 2FBWB 1T3QA 2JX5A 4HROA 1JQ4A 3AEAB 1J7BA 4WWMA 2PKOA 3AEDB 1L0VB 2CJNA 2W55A 1N61A 3W5VB 3DWMA 2B76B 3VR8B 1YJJA 3AE3B 3AB5A 1YQ3B 3AEEB 1VJKA 2KAJA 2MJ3A 1E0ZA 3ABVB 1NI3A 3ETRA 1E10A 1SIJA 2MJDA 1GTHA 4YTMB 2BS2B 1FRRA 1QOGA 2QJLA 1A70A 2H88B 2N0SB 3CIRB 3AEGB 1JWAD 1E7PB 1NEKB 1VLBA 1ZXIA 4FXCA 4C7ZA 4LTUA 3HUIA 5AUKA 5H8YE 4A9AA 1QT9A 1R7SA 4IDIA 1E6EB 3AE4B 4ZOHC 3ZYYX 1L6VA 3VRBB 3SFDB 2JQRB 3AMZA 4US9A 1XO3A 1ROEA 2WDQB 2WS3B 1RYJA 5C3JB 2W3RA 1NYRA 1OFFA 1JALA 1RWSA 1XLQA 1N63A 2WLBA 2L52A 3HVZA 1TYGB 3PO0A 1TKGA 1QOAA 1SF0A 1JWBD 1UWMA 1KFYB 1JRPA 1QF6A 3AE1B 3SFEB 3B2FA 3P4QB 2BS4B 2WQYB 3CF4A 1FXIA 1CJEA 2KMMA 1KRHA 2Y5CA 3NRZA 3VRAB 2W54A 1FIQA 2E3TA 3NVWA 1B9RA 2K5PA 3AEBB 3W5UB 1EWYC 3AE5B 1TKYA 5AUIA 4ZHPA 2ACZB 1RFKA 5G5HA 1AWDA 4N6EB 5EE1A 3B2GA 3DWGC 1TKEA 3LB8C 1V8CA 4JWUC 4ITKA 1JW9D 1GAQB 2PVGC 5H92C 2BS3B 1YJIA 5G5GA 3EUB2 4HRSA 4US8A 2H89B 2PIAA 1JROA 2WDVB 3FAHA 3VR9B 1PUTA 1RM6C 1XLOA 3WCQA 1GTEA 2WU2B 5MPOA 2L83A 3B9JA 4YT0B 1FRDA 1WRIA 2AX5A 2CJOA 2EKIA 4C7YA 1NENB 1FFVA 4YSZB 1WWTA 2W3SA 4P6VF 3CWIA 2QIEB 3SR6A 3AE6B 1QOBA 4ZHOA 1PFDA 1ZOYB 1PDXA 3NVZA 5EE3A 1H7WA 1FFUA 4N59A
chains in the Genus database with same CATH superfamily
4OZAA 2ZVOA 2KOXA 3B0AA 4WQOB 1SBBB 4G3XB 2DENB 4M8MA 1VDVA 1DOYA 4H2AA 1EM7A 2WXHA 1GG3A 3E9SA 3WA0A 1E8YA 1D5XC 1E8ZA 1YOVB 1EF1A 2C9WB 4HWIB 3DHHC 3A4SC 2HJ8A 3AE7B 3DOWA 1N5WA 4G0NB 1QLBB 1TIFA 1TS2A 3VTWA 1M4VA 4RGNA 4OHJA 4IC7B 3N32A 2K8CA 1R4NI 1E10A 1WR1A 4KGTA 4YTMB 4MJSA 3PSEB 3QJZA 2W9NA 2MSED 3TBLD 3HUIA 2KACA 2RGFA 4OZCA 1E6EB 5IP4D 1V9JA 4W9IA 3AMZA 2O6VD 2ZEQA 1ROEA 1NYRA 1WR6E 4NAMA 3BWUD 2NR2A 4CO7A 2O6VB 1YQBA 2IGGA 1TS4A 1LM8B 3W2DA 2K5PA 3VAWA 2IGDA 4HDOA 4BKSD 2HE7A 4W9HA 1JW9D 1GB1A 5G5GA 2OJWA 3IT6B 1JROA 2KVRA 3N30A 3RYTA 3ZNID 1L4ZB 2AX5A 4R3DA 3WAPA 4P6VF 3PRMB 3DBRI 4L23A 2KMAA 2E6XA 3AE6B 3ZJUA 3FILA 4UDUC 1H7WA 2MWSB 4A20A 4BBNF 2K22A 5D3DA 2WDRB 4BVUC 4LJOB 4PK1A 3TEWA 2JXTA 2WXIA 3EA6A 1I4PA 2NPTB 3X23A 3M3JA 3BK1A 1YJ1A 2IY0B 3AECB 3LYYA 3TEZA 3NZSA 1E9MA 2CR5A 4JQWC 3TCAA 3NY5A 2XK5A 2NS5A 3OLMD 2WXLA 2N9KA 5GMVA 2G9HD 4GOCA 4EFOA 3W5VB 4G50A 1WGDA 1ET9A 4WJOA 2LASA 1QOGA 2MP2B 4F8CB 2LJ5A 2N0SB 4TMAB 3KH0A 1ENFA 3KW5B 2FCQA 3I9V1 2AWTA 2AL3A 3A4RA 2XK5B 5T8IA 3KUCB 1TY2A 4QAYA 1KFYB 1JRPA 2KYWA 1EUVB 2L76A 2XN9C 2QSDA 4XGAB 2Y5CA 2I1JA 3OJ3A 4KDIC 1Q0WB 4REZA 3AE5B 4WJQA 1IPGA 4GLSC 4RMAA 1TKEA 2ZPYA 4J3OD 2O2VA 4A55A 2PIAA 2WDVB 3VR9B 3VXWA 2LZ6A 3Q14C 2KFKA 3ZRFA 3R8BA 5IA7A 4MT5A 1NENB 4ARIA 2D3GA 4MH0E 1S1QB 4ZHOA 2R2OA 2K6QA 3RFZB 2ON8A 1F2RI 3PHWB 4MDKE 4IKGA 1J7CA 5E6JA 4YXDB 5HI1A 4ANWA 2WYQA 2IO3B 2INCC 1XD3B 3M95A 4LCDE 3VHTC 2GMIC 2V3NA 4E3CA 1XLNA 2XBBC 1FMAD 2LRWA 2D10A 3AULA 2BKRB 4AOFA 1FXAA 2N7DA 3FILB 5D3IB 4CYEA 1K52A 1SE2A 1FO4A 1SGHA 2RDGA 2WXMA 3DVGY 3R66C 1GB4A 2VH1A 1WXMA 3AE8B 1L0XB 2M19A 4HROA 3C8YA 1STEA 1L0VB 1T0SC 3Q8CA 1E90A 3Q3JA 1YQ3B 1L4DB 1ET6A 3GS2A 1YN3A 1Z5SB 3L0WB 5AEKB 5CHFA 4KGRA 4OVZA 2INPE 4DHZB 3CIRB 2B3AA 1E8WA 2ZW0A 2BB6A 1L6VA 4US9A 3VUYA 4KV2A 2J7QB 1V1OA 2IO2B 2YEPF 3MC0B 1V1PA 4FJVB 3R2IA 2ICIA 4PYUA 2G3QB 4N9F4 3CF6E 1WY8A 2FIFA 4II2B 4CHKA 3AU5A 3IBEA 2GB1A 5C1ZA 2KDEB 3I63C 1FNVA 1HTQA 4TUUA 4ZYNA 4KVGB 4JWUC 2MBQA 2Y5BB 1MG4A 2JYTA 1E8XA 3QAQA 2FIDA 4ZRQA 4AJYB 5KHQA 1TY0A 4S0RA 1WRIA 1F9JA 4YSZB 2LHDA 2HDEA 4KKIA 4K3BA 1WJUA 4XE0A 3IXSA 3EECA 4YTNB 2DYOA 2K9XA 3LXFA 4GGQA 2BT6A 1ZKHA 2AQ2B 4IW0A 2M17A 2K8BA 2BF8B 4WQMA 4MJSB 3HRDD 4J6IA 1V49A 3ZRCA 5DCNA 1AYFA 1R4MB 2PLPA 2ZNVC 3CMMB 4MSMB 1T0QC 1SEBD 2KWCA 1SSNA 3N1XC 1ZGUB 3I57A 3JVZX 3VFKA 2C7MB 2LMCA 1GJZA 2CJNA 3AEEB 1VJKA 2KAJA 4XWTA 1SIFA 2KT7A 1GC6A 3VH3B 3AEGB 1TBEA 4C00A 4A9AA 4C56C 3IHPC 2ZVNA 4RM9A 4MGIE 5C3JB 1VD2A 4RGMA 2KLGA 1R4NB 2KTRA 4FADA 4O1NA 2WQYB 2MA9B 1P7FA 3IFWB 1FIQA 3UI3A 3Q8BA 4OZBA 1JMLA 3N3KB 1I4XA 2K8HA 5LLIA 1C4PA 3ZUNA 2JU6X 3LB8C 4RFBA 2BYVE 1V86A 4JL9A 4US8A 2H89B 1NBFC 2BQQA 4XDDA 3EC8A 2QILA 4W9CA 3Q3MC 3DHIC 2EKIA 2PPHA 2QMTA 4IWPA 3TEXA 1WWTA 2J42A 4BOZB 2DZJA 3WAOA 3R3MA 2IYDB 4EKUA 1MHHE 4LNOA 3V60A 4GDKA 3SHQA 2DAFA 1H7XA 4ARCA 3P42A 2JRIB 2KDFB 3NS1A 1K51A 1XLPA 2NTTA 1C3TA 1JWMD 4GIVA 3BVMA 3FC4A 4B9KA 2Y3AA 3PREA 4RGOS 4NQKE 4BBNC 3MTNB 2BTEA 1S3SG 5GXGB 4W9LA 3BIID 4USAA 3AV8A 3DBRB 3ECIA 3DHGC 1BUIC 3K9PB 2ZJDA 3UQAA 2BWFA 2B76B 3C0RB 5BMHA 2MJ3A 1NI3A 2CHZA 1QZEA 5DPTA 3T3NA 3KYDD 1A70A 4GN1A 1JWAD 1VLBA 3PRZA 3R7RA 1UWXA 3ZYYX 3VRBB 3EFCA 1XO3A 2HTHA 2L1AA 3PRPB 3VH4B 4WWOA 5BMIA 1C76A 1YX5B 3W1SA 5TR5A 3M62B 2DAJA 1D5ZC 1B9RA 2JZ3B 4ZHPA 1TKYA 3B1LX 4N6EB 1EF5A 1UGMA 2LGXA 1B1ZA 1V8CA 4ANXA 1T5XD 1YJIA 3Q3FA 1IYFA 3ZNHB 5JHAA 2MX2A 1PUTA 4F1SA 2DYMA 4W9GA 3V62A 2ZNVB 4W9FA 1IGCA 1L2NA 3QWZB 4IG7B 5BMGA 4OVUA 1WRDB 1KOTA 4NZLB 1Q10A 3PHXB 3PLUA 1QOFA 3RMKC 3NS8A 4MH8A 2L7RA 2NPTA 1DGJA 3HIZA 1OQQA 2JT4B 2HTME 3ZTDA 3L4PA 4KZCA 5CHVC 4C80A 3O13A 1V1PB 1MVKA 1I7HA 2L32A 2NTSA 2N4FA 4BAXA 2JUOA 3VTUA 3BYTB 3TJPA 1VRAB 3RZFA 2KTRB 2FBWB 1JQ4A 4M8NA 1WZ0A 4I6LB 1LXDA 3QIJA 4P16A 4KSKC 3ETRA 3V6CB 2VRRB 2NBWB 3V05A 1ZXIA 3KWVA 3ZNGC 1QT9A 2LD9A 4B95A 3RCZA 3SFDB 4XWWA 2YVCA 2KTFA 2IY1B 5D7GA 3UIPB 1RRBA 2KMCA 3NZUA 3MFGA 3PGEA 3WANA 3UINB 3B2FA 1V5OA 2KN5A 4FA6A 1EWCA 3H1UA 2BBCA 2R61A 2BYFA 1AWDA 4K81A 1WX9A 1GAQB 5C23A 1I4GA 3BVGA 4PYZA 4LLGM 1JWUD 5HHDG 5IAAC 4HRSA 4AWJA 3AXCA 5KHOA 3UF8A 2REXA 2LHEA 3EHVA 2N9PC 3APFA 1WXSA 2V4LA 1H8CA 1KM7A 2DZIA 2NMQA 1IP9A 2MBHA 1TTNA 2JRHA 2MJEA 2GBMA 1KLUD 3RNCC 2FE8A 1R4MI 4DK5A 2WWZA 5G2NA 4M02A 3SEBA 2L0FA 2CHWA 2DWQA 2FCMA 4NNJB 2M1MA 4KIKB 2C7NB 2RR9A 3A1QB 4RNAA 1T0YA 3NVYA 3C19A 1OQRA 4P1BC 1V97A 3RN9C 2ONQA 5CTRC 1ISNA 5C2TB 3KWLA 3ZLZA 1AARA 2IBIB 4IWQA 4XC2A 5FR6A 2KK8A 3RD2A 2PKOA 3N1YC 1N61A 2N9LA 3Q69A 1V6EA 4GDLB 2V4IB 2LFIA 4FULA 2KZRA 2D3BA 1JWSD 4FXCA 2WXPA 1VR9A 1LO5D 5D6JB 1OGWA 3KLSX 4AS1A 2DYBA 3M63B 2JYEA 2WDQB 3O65B 1OFFA 3ZKJC 3DBSA 1UH6A 2BVCA 3TSSA 3PLVA 4FHJA 4P1CC 1CJEA 4EUTA 4DQOC 1SE4A 3VUXA 3A9JA 1GC7A 1KH0A 2FAZA 2MHJA 4ASWC 1YX6B 4EOYA 2RSUA 1WXAA 5JZEB 1XCQL 3EUB2 1SXTA 2HD5B 3DQVA 3Q3OC 1TS3A 2WU2B 4HVBA 1WJNA 1BMLC 1I4HA 3FKYA 1JRUA 3SU8X 2G4DB 3KQ4A 1P9DU 2AL6A 1P7EA 1WX8A 1DOXA 2VZKD 3RUIB 3CSTA 3BINA 4HKQA 1C4AA 3GOEA 2V1YA 2WXOA 2KANA 2O6VA 5IO9A 1L6UA 4MGZE 1PYWD 1GT8A 4HLEA 5CHWA 2C60A 3AM9A 1UNSA 4ICUA 2EMTA 2I38A 2JXXA 3VQIA 3GP7A 1VZ8A 1YJJA 2N9EB 1ZXHA 1WSPA 3TIXA 1SJHD 1D4BA 2KDIA 3ZTCA 1Y8RC 2MBEA 1WM2A 2MBOA 2KWDA 5H8YE 3AE4B 4DHJB 2KFJA 2BGFA 3VUWA 2IO0B 1UWMA 2D3AA 4IWOA 4KGSA 3QHTA 2AQ3B 2D11A 1TGZB 1WMHB 3B08A 3VRAB 3NZ3A 3BY4B 2PW9A 4ZRIA 1EWYC 1YMHE 1E7VA 4JPSA 4ITKA 2BPSA 1ACCA 2KO3A 4DXFA 2KDMA 4K7SA 3MC8A 3MJ5A 1SJED 1WE6A 1L0YB 5TSSA 2J53A 2LJIA 4GU2A 3L16A 3UIOB 1RFAA 2EMSA 3L54A 2LGYA 2MEKA 2K6DB 1QOBA 1PQSA 4BKGA 1F0ZA 2DX5B 2Z0DB 1WYWB 3HHMA 1L5PA 1M94A 2G1EA 4GSWA 4RF1A 1UZXB 2N1VA 1TJEA 1CZPA 2DBYA 4FJYA 1Z2MA 2R2QA 2LVPA 2KN4A 2D07B 5JH5C 1I35A 2EKEC 4FBJB 2LWPA 2RDBC 1N62A 3AEFB 1RAXA 2WU5B 2KVZA 1GPXA 4ANUA 4DXGA 3QA8A 1WF9A 3AE3B 4RCOA 2JWUA 4FN2A 1YN4A 2G45B 2J4XA 1OEYJ 4E71A 2LGDA 1UELA 4OW0A 1WH3A 1NEKB 1I4QA 3H7SA 5J2RA 1TZ1A 2DNFA 3H7PB 3DVNU 2K0PA 5L83A 1BXTA 3APCA 1ZDVA 4PS8A 1Y56A 2I1KA 1D3ZA 1TT5B 1IBXA 2ZCBA 3NJTA 2VH2A 1FEHA 3N9YC 4RGTA 1XEEA 4W9KA 3H6NA 1ZE3D 2BS3B 3A9JB 1F77A 1J0GA 2CHXA 1SE9A 2FNJB 2XNAC 4A3OA 4TQ0A 2UU7A 3IT4B 1YNTE 2YLMA 4EZJA 2IGHA 2CS4A 3KUZA 2KKCA 3CWIA 2GLSA 4MEMA 1FNUA 5AZGA 5HFYA 1C9FA 1FFUA 4D2KA 3PTFC 5EE9A 3GE8C 2MRPA 1C4CA 2MBBB 4PS7A 1FM0D 2PVOD 3U30A 1WIAA 4WWNA 2MH7A 2AYOB 1WYGA 2LRUA 2LGSA 1N60A 2MLBA 4DDGD 4E74A 2ZCCA 2PJHA 4N58A 3IVFA 2CU3A 3U7DA 2INDC 1PGAA 4A6QA 4RF0A 1XT9B 2KQSA 3AE9B 1JCKB 3BK2A 1UBIA 1T0RC 3P4PB 1XXGA 4URKA 2MQJA 5E6NA 3KVFB 1QILA 3BYYB 3S2AA 4WWMA 3AEDB 2XEWA 5BYSA 2IDYA 2JZZA 3LJ3A 3DWMA 2FUHB 2KX3A 3DBLI 3ZJVA 3ZDMC 3OJ4B 2JWZA 4A3PA 3ZVVA 4ZOHC 2Z0EB 5AZHA 5DPWA 2JQRB 1IGDA 1XQQA 2WS3B 3L13A 4MELA 1N63A 2WLBA 3HVZA 2N1WA 2GOWA 1TKGA 4M01A 3CF4A 4OVVA 2Z8LA 4IM3A 2CKHB 2IZVB 1FD6A 3VTVA 5JHBA 3QC8B 4P7IA 2RDHA 2QCZA 1CK1A 3ML9A 3KYCD 4XDCA 3H9DA 1HE8A 5I4DA 4MSQB 1WJ6A 4MGYE 1RM6C 1UF0A 3DCGA 3PPAA 2O2VB 5D2MB 2CJOA 3JYUA 1QKZA 4C7YA 4IUMB 1YN5A 4K1RB 3RNGC 2BB5A 4HEA1 2ZPNA 3A9KB 2WXGA 5HKHA 4KKJA 4MM3A 3MP9A 4YSXB 3U4EG 4I6PA 3QK0A 3T9LA 3ENEA 2BW2A 2NBUA 4M0WB 1U4AA 4HK2A 3HM3A 2WX1A 2BYEA 3EFUA 2LUMA 1C1YB 3AN1A 3RI7C 4M00A 3RULA 3W9CB 1WE7A 3A33B 2OHFA 3NVVA 1K53A 1IUEA 3ZW3A 3WALA 3RPFC 3SDLC 3P4SB 1J7BA 1P98A 4ZRPA 4WAFA 2KLCA 2D2QA 1SIJA 5LXIB 1GTHA 1WFYA 1WZ3A 1MHXA 1EO6A 1PGBA 1HXYD 2IPKD 4A8XC 4XX5A 1GOZA 2WXQA 2BWES 2E3TA 3WIMA 2KNBA 2Y5PA 3GE3C 4NPNA 2OOBB 3JSVA 2PVGC 1OQYA 3I5JC 2AEHA 1F1HA 1UD7A 3WAMA 1F2RC 4WWPA 3N20C 3VDZA 1OEYA 2WXRA 1XCTL 5FK9C 4YT0B 5IOIA 1GNUA 3HVDA 3ONSA 3QCAA 2BKFA 1KTKA 3HK0A 2D5GA 4FHKA 4BKTA 1HQRD 1BT0A 3QX1A 4K3CA 3RNBC 1PFDA 3MC9A 5EE3A 4GDKB 4N59A 3EGRA 3AI5A 3P1MA 4JX1C 2PMVA 2UWQA 3RZWC 1ZP0B 3NG0A 3P2BA 1NVID 5DPSA 4NAWA 3ZO5B 3ZIMA 4Q2JA 2M56B 3PZ8A 5IN7A 3RNEC 1DOIA 1WMHA 5BYRA 3L08A 1YIWA 2INNE 3P4RB 5L95C 2WX0A 4ZRJA 4ACFA 1V5TA 2JX5A 3AEAB 1WGYA 2FUG1 4WJNA 2DZKA 4KDLB 4M0WA 1ZPSA 2W82A 4IM0A 1I4RA 2MJDA 3L10B 2QHOA 4XZ4A 3ZXVA 3DBHI 1AN8A 4NY0A 1E7PB 1YD8U 4C7ZA 2L05A 4NAWB 3ZXRA 5AUKA 4LDTD 1R7SA 4IDIA 3H8HA 3PZDA 2VZKB 1FNWA 4ZYSA 5EDSA 1TYGB 4EZKA 1WX7A 4DXAB 2JF5A 2L8JA 3J9CA 2W54A 2MCNB 3AEBB 3W5UB 2KX0A 2X8XX 3UGBB 1KLGD 5G5HA 1UUPA 4NJ7A 2NBVB 3ZNZB 2M0AA 3DVNV 2LI5A 1UGJA 4W9EA 1IBXB 2JY6A 2KQ4X 1GTEA 2BYTA 4HJKA 3Q6BA 3T8MA 2GBKA 5D94A 1UBQA 2W3SA 3SR6A 3W1YA 2M4NA 2ASQA 3Q8FA 4IOIE 4DHJD 1PDXA 4EEWA 1HEZE 2ZZPB 3JSVB 4L2YA 4X57B 4NQLB 3V61A 4TSSA 4WJPA 2V3SA 1J7AA 1VCBA 2J52A 5EE0A 1A5RA 3ZJTA 5AZFA 4TV3A 2WP9B 4K7WA 2LXAA 3R7QA 4ZDVA 2RPVA 5FR3A 2K1FA 2LEKA 4DHZE 2QC8A 2G4SA 4KZ0A 2K3UA 3BVZA 3VR8B 4NJCA 2YEPB 4LJPB 2BS2B 2QJLA 3DVGX 2H88B 1PGXA 2KC2A 3PS6A 2JVCA 4DBGA 2GBJA 4B6WA 4CQNA 2KWVB 2D3CA 1JALA 1XLQA 1FPYA 2L52A 4HCPB 3V6EB 3PO0A 4HDQA 3A9KA 5E6PA 1CQVA 2L0TA 1QF6A 2BS4B 3DBHB 1KLVA 4GB9A 1KRHA 1LFDA 1CMXB 2RMMA 5G55A 3ZGZA 3TEYA 2IO1B 2ACZB 1P3QU 4WAAA 5EE1A 3APDA 2JZPA 1TS5A 4MACA 1I42A 2GI9A 2LGIA 1XLOA 3WCQA 2M8SA 2C5LC 1FRDA 1D6EC 3ZDTA 5LNK1 1HZ6A 3QQ8B 2QIEB 1G6JA 1WGGA 2DZMA 1WJ4A 3Q8EA 2SAKA 4BFRA 4JLCA 4W9DA 4W9JA 4YSYB 5AUIA 4C4VB 1QQRA 3RT3B 4BOSC 3NHEB 2KQ7A 2DLBA 4ICVA 4HCNB 2QDFA 4FLHA 1ZUD2 3NUHB 2WDTB 1NYQA 1MPEA 2A5UA 1YQ4B 2X38A 3AH7A 3AE2B 4LNFA 5LXHA 5E6OA 3P63A 1WGHA 2L00B 2KXJA 2WHIA 4LNKA 3Q3NC 1VZ6A 2Q5WD 1T3QA 4EE2A 2IJ0A 2QEJC 3IAM1 3MHSD 4II3B 5BYQA 5HG2A 2KDBA 1HTOA 2MW5A 3Q2AC 4EZLA 3K9OB 4RM8A 1TZOA 4DWFA 2A4ZA 4JGHB 4KIKA 4L1BA 2N7JA 2W3RA 2WXNA 3CSFA 1RWSA 1WI0A 4AJWA 1V81A 3PT2B 4BKSA 1E5WA 1QOAA 1SF0A 2SEBD 1EU3A 3AE1B 3SFEB 4IM2A 4DDID 3OAWA 4HPPA 2FCSA 1GUAB 2GBNA 3B2GA 3DWGC 5H92C 1RLFA 4MM3B 1ZW7A 2DHZA 4C4VA 3FAHA 4LNNA 2HJ1A 2L83A 1MJDA 3B9JA 1XF5L 1AW7A 1K8RB 4JIOU 3UQBA 3OWEB 1F52A 2GBRA 4AQ7A 1ZOYB 3KUDB 1MG8A 4HXDA 4ANVA 4PS3A 1WGRA 4FJZA 2J0MA 2OEDA 2MP2A 1WGKA 1P1AA 4YL8A 2JPHA 3MHZA 2PE6B 4I6NB 4AP4C 3PVLA 4A90A 1VZ7A 4PT5A 1FCCC 3ALBA 3E56A 5BO4B 3HM6X 1J19A 3N1ZC 4HJGE 1L7YA 4TQ1A 3ML8A 2WGSA 4B0MA 1WXVA 2KJ6A 3BZDB 4JWSC 2NVUI 2V3PA 3D32A 3DPDA 4KX6B 3IG3A 2KD0A 5JXVA 2EELA 2FCNA 4XYCA 2W55A 2I2YA 1WM3A 4S17A 4G11A 3RNAC 3GZNI 2J0KA 5FKAC 4LTUA 4ZRKA 1SE3A 3GB1A 1K50A 3I3TB 1N6ZA 2N9XA 1OTRB 1V2YA 1JWBD 3U7ZA 2PE9A 3R2TA 1KJTA 4LNIA 4MGKE 1ZDXA 2JSVX 1FXIA 3X0WA 3NRZA 4WURA 1RFKA 1X1MA 1J8CA 2KC1A 4AUQC 2K25A 2C7HA 3ZQ4A 1ESFA 3U8ZA 3TUOA 3GZNB 2J0JA 2RD0A 3OG5A 1Q1OA 2RPQA 4GXBA 4HPMB 1FXTB 3Q8AA 1HA5A 4WIPA 2PTLA 4KSLC 1SB3C 2KFKB 3TL5A 2UYZB 3NOBA 4B0EA 2V0GA 4GDLA 2KHWB 2AQ1B 1DYQA 1T6BX 1KF6B 3URYA 3PV1A 5IKCM 2KWUB 1WXQA 3DBLB 2LUEA 3MJWA 2OJRA 1MI0A 1N5XA 2NCNA 3L17A 3H7PA 4YTPB 2WNMA 1Q5WB 1EU4A 4HPLB 1E7UA 2LXCA 2Z59B 4RH6A 1NDDA 5CX3A 1HZ5A 3RNFC 4GMVA 1C79A 1MFWA 3AB5A 3PZ7A 3TMPB 1E0ZA 2GRIA 3ABVB 2ZW1A 3DDCB 4K7UA 1D5MC 1FRRA 4YWGG 3VVWB 4F7ZA 2TSSA 2WXKA 3LDZE 3IAS1 5J18A 1RYJA 2KJRA 1FCLA 5DPRA 4LDTB 2L3ZA 2V9HA 3P4QB 3A1QA 4TKNA 1LGRA 5J17A 2KMMA 3NVWA 1C77A 4JE3B 3W1SC 2CU1A 3JW0X 2LVOA 4WH4A 2KJHB 4HKZE 3T3OA 3AU4A 2PEAA 3V3XA 2WXJA 5MPOA 1P0RA 1H4RA 1C78A 4LK0M 3SD5A 4BZAA 2WXFA 2LVQA 2N7EA 1NI2A 4NJ6A 3QARA 2K39A 1V80A 1LQBA 3U52E 3U2SC 2M0XA 1FFVA 3NVZA
chains in the Genus database with same CATH topology
1HEZE 1MHHE 1F0ZA 4OZAA 4L2YA 1SBBB 4TSSA 1L5PA 2G1EA 4RF1A 1H7XA 4ARCA 1VDVA 1DOYA 3P42A 4H2AA 1J7AA 1EM7A 1TJEA 3NS1A 1K51A 1XLPA 2NTTA 2WXHA 1JWMD 2J52A 3E9SA 1CZPA 2DBYA 3BVMA 3FC4A 5EE0A 3ZJTA 1D5XC 2Y3AA 2KN4A 4RGOS 2BTEA 2WP9B 5GXGB 2RPVA 3BIID 4USAA 5FR3A 1N62A 3AE7B 3AEFB 2LEKA 2WU5B 1N5WA 3AV8A 1GPXA 1QLBB 4DXGA 1TS2A 1M4VA 2K3UA 4RGNA 1BUIC 3BVZA 4OHJA 2B76B 3VR8B 3AE3B 4RCOA 2JWUA 5BMHA 2MJ3A 4NJCA 1YN4A 1NI3A 1E10A 2J4XA 2YEPB 4KGTA 4YTMB 2BS2B 3T3NA 2QJLA 1A70A 2H88B 4OW0A 1PGXA 1VLBA 1JWAD 1NEKB 1I4QA 3HUIA 2KACA 4OZCA 1UWXA 1E6EB 3ZYYX 4CQNA 3AMZA 3VRBB 1XO3A 2K0PA 1ROEA 1BXTA 1NYRA 1JALA 1ZDVA 1XLQA 1Y56A 2L52A 4NAMA 2L1AA 3BWUD 3PO0A 1CQVA 1IBXA 1QF6A 5BMIA 1C76A 2IGGA 2BS4B 3W1SA 1TS4A 1KRHA 1FEHA 1D5ZC 3W2DA 2K5PA 2RMMA 1B9RA 3ZGZA 4ZHPA 3TEYA 1TKYA 2ACZB 3N9YC 4RGTA 4N6EB 1XEEA 5EE1A 2IGDA 2JZPA 1TS5A 1B1ZA 1V8CA 1JW9D 4MACA 1ZE3D 1GB1A 2BS3B 1T5XD 1YJIA 5G5GA 1F77A 3IT6B 2XNAC 1JROA 4TQ0A 2GI9A 2LGIA 1PUTA 1XLOA 3WCQA 3IT4B 2DYMA 1YNTE 1L4ZB 1FRDA 1D6EC 2AX5A 4R3DA 5LNK1 2IGHA 1HZ6A 4P6VF 3CWIA 2QIEB 4L23A 2E6XA 3AE6B 3ZJUA 3FILA 1FNUA 3Q8EA 1IGCA 4UDUC 2SAKA 5HFYA 1C9FA 1H7WA 1FFUA 4D2KA 5EE9A 5BMGA 1C4CA 4NZLB 1Q10A 4YSYB 1FM0D 1QOFA 2K22A 5D3DA 2WDRB 2PVOD 5AUIA 4MH8A 1QQRA 2MH7A 3TEWA 1DGJA 1WYGA 2DLBA 1OQQA 2HTME 2JXTA 1N60A 2WXIA 3L4PA 3EA6A 1I4PA 4C80A 1ZUD2 3NUHB 4N58A 3O13A 1NYQA 1MPEA 1YQ4B 2X38A 3AH7A 1V1PB 2CU3A 3AE2B 3BK1A 1MVKA 1PGAA 4A6QA 1I7HA 4RF0A 3AECB 3LYYA 3TEZA 2L32A 2NTSA 3AE9B 1E9MA 1JCKB 3BK2A 3BYTB 3P63A 3P4PB 1VRAB 1XXGA 1VZ6A 2Q5WD 2FBWB 1T3QA 4EE2A 1JQ4A 1QILA 2WXLA 2IJ0A 3BYYB 2N9KA 4WWMA 2QEJC 3AEDB 3IAM1 5BYQA 5BYSA 2G9HD 2IDYA 5HG2A 3W5VB 3DWMA 4P16A 1ET9A 3ZJVA 3ETRA 1QOGA 3V05A 2N0SB 1TZOA 1ZXIA 4TMAB 1ENFA 3KWVA 1QT9A 4L1BA 3I9V1 4ZOHC 2JQRB 3SFDB 4XWWA 1IGDA 2N7JA 2WS3B 2W3RA 5D7GA 2WXNA 1RWSA 1N63A 2WLBA 5T8IA 3HVZA 3MFGA 1TY2A 1TKGA 1QOAA 1SF0A 1KFYB 1JRPA 2SEBD 1EU3A 3AE1B 3SFEB 3B2FA 2XN9C 2QSDA 3CF4A 1EWCA 2BBCA 2Y5CA 2R61A 2Z8LA 4REZA 3AE5B 1FD6A 1AWDA 4GLSC 3B2GA 2RDHA 1TKEA 3DWGC 5H92C 1GAQB 1CK1A 1I4GA 3BVGA 5HHDG 4LLGM 1JWUD 4MM3B 4HRSA 4J3OD 4XDCA 4A55A 2PIAA 5I4DA 2WDVB 3FAHA 3VR9B 1RM6C 2L83A 3B9JA 1XF5L 2CJOA 2LHEA 1AW7A 1QKZA 3R8BA 4C7YA 4MT5A 1NENB 1YN5A 4ARIA 3OWEB 2BB5A 4HEA1 2NMQA 4ZHOA 4AQ7A 1ZOYB 2WXGA 3RFZB 2ON8A 1F2RI 4KKJA 2MJEA 1E0ZA 3MP9A 1KLUD 2OEDA 4IKGA 4YSXB 1J7CA 3U4EG 2FE8A 1WGKA 5E6JA 4YXDB 5HI1A 3MHZA 2BW2A 4A90A 1VZ7A 2V3NA 3SEBA 4PT5A 1XLNA 1FCCC 1FMAD 2DWQA 3E56A 2LUMA 1FXAA 4RNAA 3NVYA 4HJGE 3AN1A 3FILB 4TQ1A 5D3IB 1K52A 1OQRA 1SE2A 3W9CB 1V97A 4B0MA 1FO4A 2ONQA 2OHFA 3BZDB 2RDGA 2WXMA 3NVVA 4JWSC 1K53A 1IUEA 2V3PA 1GB4A 4KX6B 3AE8B 5C2TB 1L0XB 2M19A 3KWLA 5JXVA 3RPFC 2EELA 3P4SB 4HROA 1J7BA 2PKOA 3C8YA 1STEA 1L0VB 2W55A 1N61A 3Q8CA 4ZRPA 2N9LA 2I2YA 4WAFA 1YQ3B 3Q69A 1L4DB 1ET6A 3GS2A 4GDLB 1YN3A 1SIJA 2V4IB 2LFIA 1GTHA 4KGRA 4OVZA 2INPE 3CIRB 5FKAC 1JWSD 4FXCA 2WXPA 1VR9A 1MHXA 4LTUA 1LO5D 1PGBA 1SE3A 1HXYD 3GB1A 2ZW0A 3KLSX 2BB6A 1L6VA 4US9A 4AS1A 1K50A 2IPKD 2JYEA 2WDQB 4A8XC 1OFFA 1V1OA 2YEPF 3MC0B 1V1PA 1JWBD 3TSSA 3U7ZA 3R2IA 3R2TA 2ICIA 1GOZA 1ZDXA 2JSVX 2WXQA 1FXIA 1CJEA 3NRZA 4DQOC 2E3TA 2GB1A 4WURA 1SE4A 1FNVA 2Y5PA 1RFKA 1KH0A 4JWUC 2PVGC 1XCQL 2JYTA 1ESFA 1F2RC 3EUB2 3TUOA 3ZQ4A 1SXTA 1TS3A 2WXRA 2WU2B 4ZRQA 1XCTL 5FK9C 1TY0A 4YT0B 1WRIA 1BMLC 1I4HA 4YSZB 2LHDA 3HVDA 2HDEA 1KTKA 4KKIA 2D5GA 1HQRD 3Q8AA 3KQ4A 1PFDA 1HA5A 3IXSA 4GDKB 4N59A 4YTNB 4XE0A 5EE3A 3EGRA 3P1MA 2DYOA 2K9XA 4WIPA 2PTLA 3LXFA 4JX1C 1P7EA 2PMVA 1SB3C 2BT6A 1ZP0B 1NVID 2AQ2B 1DOXA 4B0EA 2VZKD 2V0GA 4HKQA 2AQ1B 1C4AA 2WXOA 4Q2JA 1DYQA 1T6BX 1KF6B 3URYA 2M56B 3PZ8A 4WQMA 1L6UA 3HRDD 1WXQA 1DOIA 5BYRA 1AYFA 2PLPA 2INNE 1PYWD 1GT8A 1MI0A 1SEBD 1N5XA 4YTPB 3P4RB 2WNMA 1EU4A 1SSNA 3AM9A 1UNSA 2JX5A 3AEAB 2I38A 2FUG1 3I57A 4RH6A 1HZ5A 2LMCA 3VQIA 3GP7A 2CJNA 1VZ8A 1C79A 1YJJA 1ZXHA 1WSPA 1ZPSA 3AB5A 4M0WA 3AEEB 1SJHD 1VJKA 2GRIA 2KAJA 2W82A 3ABVB 3PZ7A 4XWTA 1D4BA 2ZW1A 1I4RA 2MJDA 1D5MC 1FRRA 4YWGG 3AEGB 1AN8A 1E7PB 4C7ZA 4NAWB 2KWDA 5AUKA 5H8YE 4A9AA 1R7SA 4C56C 4IDIA 3AE4B 2TSSA 2WXKA 3IAS1 3H8HA 1RYJA 5C3JB 2VZKB 1FNWA 4ZYSA 1FCLA 4RGMA 1TYGB 1UWMA 3P4QB 4KGSA 4O1NA 2WQYB 1P7FA 2AQ3B 2KMMA 3J9CA 3VRAB 2W54A 1FIQA 3NZ3A 3UI3A 2PW9A 3NVWA 1C77A 4JE3B 3Q8BA 3AEBB 4OZBA 1EWYC 1JMLA 3W5UB 1YMHE 1I4XA 1KLGD 5G5HA 1C4PA 1UUPA 2JU6X 4JPSA 3LB8C 4RFBA 4ITKA 1ACCA 4DXFA 2M0AA 1UGJA 4US8A 2H89B 2KDMA 4WH4A 1IBXB 2KQ4X 3MJ5A 1SJED 4HKZE 4XDDA 1L0YB 5TSSA 2J53A 2QILA 3T3OA 1GTEA 3V3XA 2BYTA 2LJIA 2WXJA 5MPOA 1C78A 2EKIA 4LK0M 2QMTA 3TEXA 2WXFA 1WWTA 2W3SA 2J42A 2MEKA 3SR6A 3U52E 3U2SC 1QOBA 3Q8FA 4IOIE 1FFVA 1PDXA 3NVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTN B;  5EE9 A;  3P1M A;  1F0Z A;  2K9X A;  2MJE A;  3LXF A;  4JX1 C;  1SB3 C;  2BT6 A;  4YSY B;  4YSX B;  1J7C A;  1FM0 D;  1ZP0 B;  2WDR B;  1QOF A;  1WGK A;  1NVI D;  2K22 A;  4YXD B;  2PVO D;  1DOX A;  1L5P A;  2G1E A;  1H7X A;  1VDV A;  2MH7 A;  1DOY A;  1DGJ A;  1J7A A;  1WYG A;  1TJE A;  3NS1 A;  1OQQ A;  1XLP A;  2HTM E;  1N60 A;  1XLN A;  3L4P A;  1FMA D;  1CZP A;  2DBY A;  2DWQ A;  4C80 A;  1ZUD 2;  3FC4 A;  1KF6 B;  4N58 A;  5EE0 A;  2M56 B;  1NYQ A;  4WQM A;  1YQ4 B;  1FXA A;  1L6U A;  3AH7 A;  2CU3 A;  3AE2 B;  3HRD D;  3AN1 A;  3NVY A;  1WXQ A;  1DOI A;  3W9C B;  1OQR A;  1I7H A;  2WP9 B;  1V97 A;  3AEC B;  1AYF A;  5GXG B;  1FO4 A;  3AE9 B;  1E9M A;  2OHF A;  4JWS C;  1GT8 A;  3NVV A;  1N5X A;  3BII D;  3P63 A;  4USA A;  1IUE A;  3P4P B;  3P4R B;  4YTP B;  1N62 A;  3AE7 B;  3AEF B;  4KX6 B;  3AE8 B;  2WU5 B;  5C2T B;  1N5W A;  2LEK A;  2M19 A;  3AV8 A;  3AM9 A;  3KWL A;  1QLB B;  3RPF C;  1GPX A;  2Q5W D;  3P4S B;  2FBW B;  1T3Q A;  2JX5 A;  4HRO A;  1JQ4 A;  3AEA B;  1J7B A;  4WWM A;  2PKO A;  3AED B;  1L0V B;  2CJN A;  2W55 A;  1N61 A;  3W5V B;  3DWM A;  2B76 B;  3VR8 B;  1YJJ A;  3AE3 B;  3AB5 A;  1YQ3 B;  3AEE B;  1VJK A;  2KAJ A;  2MJ3 A;  1E0Z A;  3ABV B;  1NI3 A;  3ETR A;  1E10 A;  1SIJ A;  2MJD A;  1GTH A;  4YTM B;  2BS2 B;  1FRR A;  1QOG A;  2QJL A;  1A70 A;  2H88 B;  2N0S B;  3CIR B;  3AEG B;  1JWA D;  1E7P B;  1NEK B;  1VLB A;  1ZXI A;  4FXC A;  4C7Z A;  4LTU A;  3HUI A;  5AUK A;  5H8Y E;  4A9A A;  1QT9 A;  1R7S A;  4IDI A;  1E6E B;  3AE4 B;  4ZOH C;  3ZYY X;  1L6V A;  3VRB B;  3SFD B;  2JQR B;  3AMZ A;  4US9 A;  1XO3 A;  1ROE A;  2WDQ B;  2WS3 B;  1RYJ A;  5C3J B;  2W3R A;  1NYR A;  1OFF A;  1JAL A;  1RWS A;  1XLQ A;  1N63 A;  2WLB A;  2L52 A;  3HVZ A;  1TYG B;  3PO0 A;  1TKG A;  1QOA A;  1SF0 A;  1JWB D;  1UWM A;  1KFY B;  1JRP A;  1QF6 A;  3AE1 B;  3SFE B;  3B2F A;  3P4Q B;  2BS4 B;  2WQY B;  3CF4 A;  1FXI A;  1CJE A;  2KMM A;  1KRH A;  2Y5C A;  3NRZ A;  3VRA B;  2W54 A;  1FIQ A;  2E3T A;  3NVW A;  1B9R A;  2K5P A;  3AEB B;  3W5U B;  1EWY C;  3AE5 B;  1TKY A;  5AUI A;  4ZHP A;  2ACZ B;  1RFK A;  5G5H A;  1AWD A;  4N6E B;  5EE1 A;  3B2G A;  3DWG C;  1TKE A;  3LB8 C;  1V8C A;  4JWU C;  4ITK A;  1JW9 D;  1GAQ B;  2PVG C;  5H92 C;  2BS3 B;  1YJI A;  5G5G A;  3EUB 2;  4HRS A;  4US8 A;  2H89 B;  2PIA A;  1JRO A;  2WDV B;  3FAH A;  3VR9 B;  1PUT A;  1RM6 C;  1XLO A;  3WCQ A;  1GTE A;  2WU2 B;  5MPO A;  2L83 A;  3B9J A;  4YT0 B;  1FRD A;  1WRI A;  2AX5 A;  2CJO A;  2EKI A;  4C7Y A;  1NEN B;  1FFV A;  4YSZ B;  1WWT A;  2W3S A;  4P6V F;  3CWI A;  2QIE B;  3SR6 A;  3AE6 B;  1QOB A;  4ZHO A;  1PFD A;  1ZOY B;  1PDX A;  3NVZ A;  5EE3 A;  1H7W A;  1FFU A;  4N59 A; 
#chains in the Genus database with same CATH topology
 4OZA A;  2ZVO A;  2KOX A;  3B0A A;  4WQO B;  1SBB B;  4G3X B;  2DEN B;  4M8M A;  1VDV A;  1DOY A;  4H2A A;  1EM7 A;  2WXH A;  1GG3 A;  3E9S A;  3WA0 A;  1E8Y A;  1D5X C;  1E8Z A;  1YOV B;  1EF1 A;  2C9W B;  4HWI B;  3DHH C;  3A4S C;  2HJ8 A;  3AE7 B;  3DOW A;  1N5W A;  4G0N B;  1QLB B;  1TIF A;  1TS2 A;  3VTW A;  1M4V A;  4RGN A;  4OHJ A;  4IC7 B;  3N32 A;  2K8C A;  1R4N I;  1E10 A;  1WR1 A;  4KGT A;  4YTM B;  4MJS A;  3PSE B;  3QJZ A;  2W9N A;  2MSE D;  3TBL D;  3HUI A;  2KAC A;  2RGF A;  4OZC A;  1E6E B;  5IP4 D;  1V9J A;  4W9I A;  3AMZ A;  2O6V D;  2ZEQ A;  1ROE A;  1NYR A;  1WR6 E;  4NAM A;  3BWU D;  2NR2 A;  4CO7 A;  2O6V B;  1YQB A;  2IGG A;  1TS4 A;  1LM8 B;  3W2D A;  2K5P A;  3VAW A;  2IGD A;  4HDO A;  4BKS D;  2HE7 A;  4W9H A;  1JW9 D;  1GB1 A;  5G5G A;  2OJW A;  3IT6 B;  1JRO A;  2KVR A;  3N30 A;  3RYT A;  3ZNI D;  1L4Z B;  2AX5 A;  4R3D A;  3WAP A;  4P6V F;  3PRM B;  3DBR I;  4L23 A;  2KMA A;  2E6X A;  3AE6 B;  3ZJU A;  3FIL A;  4UDU C;  1H7W A;  2MWS B;  4A20 A;  4BBN F;  2K22 A;  5D3D A;  2WDR B;  4BVU C;  4LJO B;  4PK1 A;  3TEW A;  2JXT A;  2WXI A;  3EA6 A;  1I4P A;  2NPT B;  3X23 A;  3M3J A;  3BK1 A;  1YJ1 A;  2IY0 B;  3AEC B;  3LYY A;  3TEZ A;  3NZS A;  1E9M A;  2CR5 A;  4JQW C;  3TCA A;  3NY5 A;  2XK5 A;  2NS5 A;  3OLM D;  2WXL A;  2N9K A;  5GMV A;  2G9H D;  4GOC A;  4EFO A;  3W5V B;  4G50 A;  1WGD A;  1ET9 A;  4WJO A;  2LAS A;  1QOG A;  2MP2 B;  4F8C B;  2LJ5 A;  2N0S B;  4TMA B;  3KH0 A;  1ENF A;  3KW5 B;  2FCQ A;  3I9V 1;  2AWT A;  2AL3 A;  3A4R A;  2XK5 B;  5T8I A;  3KUC B;  1TY2 A;  4QAY A;  1KFY B;  1JRP A;  2KYW A;  1EUV B;  2L76 A;  2XN9 C;  2QSD A;  4XGA B;  2Y5C A;  2I1J A;  3OJ3 A;  4KDI C;  1Q0W B;  4REZ A;  3AE5 B;  4WJQ A;  1IPG A;  4GLS C;  4RMA A;  1TKE A;  2ZPY A;  4J3O D;  2O2V A;  4A55 A;  2PIA A;  2WDV B;  3VR9 B;  3VXW A;  2LZ6 A;  3Q14 C;  2KFK A;  3ZRF A;  3R8B A;  5IA7 A;  4MT5 A;  1NEN B;  4ARI A;  2D3G A;  4MH0 E;  1S1Q B;  4ZHO A;  2R2O A;  2K6Q A;  3RFZ B;  2ON8 A;  1F2R I;  3PHW B;  4MDK E;  4IKG A;  1J7C A;  5E6J A;  4YXD B;  5HI1 A;  4ANW A;  2WYQ A;  2IO3 B;  2INC C;  1XD3 B;  3M95 A;  4LCD E;  3VHT C;  2GMI C;  2V3N A;  4E3C A;  1XLN A;  2XBB C;  1FMA D;  2LRW A;  2D10 A;  3AUL A;  2BKR B;  4AOF A;  1FXA A;  2N7D A;  3FIL B;  5D3I B;  4CYE A;  1K52 A;  1SE2 A;  1FO4 A;  1SGH A;  2RDG A;  2WXM A;  3DVG Y;  3R66 C;  1GB4 A;  2VH1 A;  1WXM A;  3AE8 B;  1L0X B;  2M19 A;  4HRO A;  3C8Y A;  1STE A;  1L0V B;  1T0S C;  3Q8C A;  1E90 A;  3Q3J A;  1YQ3 B;  1L4D B;  1ET6 A;  3GS2 A;  1YN3 A;  1Z5S B;  3L0W B;  5AEK B;  5CHF A;  4KGR A;  4OVZ A;  2INP E;  4DHZ B;  3CIR B;  2B3A A;  1E8W A;  2ZW0 A;  2BB6 A;  1L6V A;  4US9 A;  3VUY A;  4KV2 A;  2J7Q B;  1V1O A;  2IO2 B;  2YEP F;  3MC0 B;  1V1P A;  4FJV B;  3R2I A;  2ICI A;  4PYU A;  2G3Q B;  4N9F 4;  3CF6 E;  1WY8 A;  2FIF A;  4II2 B;  4CHK A;  3AU5 A;  3IBE A;  2GB1 A;  5C1Z A;  2KDE B;  3I63 C;  1FNV A;  1HTQ A;  4TUU A;  4ZYN A;  4KVG B;  4JWU C;  2MBQ A;  2Y5B B;  1MG4 A;  2JYT A;  1E8X A;  3QAQ A;  2FID A;  4ZRQ A;  4AJY B;  5KHQ A;  1TY0 A;  4S0R A;  1WRI A;  1F9J A;  4YSZ B;  2LHD A;  2HDE A;  4KKI A;  4K3B A;  1WJU A;  4XE0 A;  3IXS A;  3EEC A;  4YTN B;  2DYO A;  2K9X A;  3LXF A;  4GGQ A;  2BT6 A;  1ZKH A;  2AQ2 B;  4IW0 A;  2M17 A;  2K8B A;  2BF8 B;  4WQM A;  4MJS B;  3HRD D;  4J6I A;  1V49 A;  3ZRC A;  5DCN A;  1AYF A;  1R4M B;  2PLP A;  2ZNV C;  3CMM B;  4MSM B;  1T0Q C;  1SEB D;  2KWC A;  1SSN A;  3N1X C;  1ZGU B;  3I57 A;  3JVZ X;  3VFK A;  2C7M B;  2LMC A;  1GJZ A;  2CJN A;  3AEE B;  1VJK A;  2KAJ A;  4XWT A;  1SIF A;  2KT7 A;  1GC6 A;  3VH3 B;  3AEG B;  1TBE A;  4C00 A;  4A9A A;  4C56 C;  3IHP C;  2ZVN A;  4RM9 A;  4MGI E;  5C3J B;  1VD2 A;  4RGM A;  2KLG A;  1R4N B;  2KTR A;  4FAD A;  4O1N A;  2WQY B;  2MA9 B;  1P7F A;  3IFW B;  1FIQ A;  3UI3 A;  3Q8B A;  4OZB A;  1JML A;  3N3K B;  1I4X A;  2K8H A;  5LLI A;  1C4P A;  3ZUN A;  2JU6 X;  3LB8 C;  4RFB A;  2BYV E;  1V86 A;  4JL9 A;  4US8 A;  2H89 B;  1NBF C;  2BQQ A;  4XDD A;  3EC8 A;  2QIL A;  4W9C A;  3Q3M C;  3DHI C;  2EKI A;  2PPH A;  2QMT A;  4IWP A;  3TEX A;  1WWT A;  2J42 A;  4BOZ B;  2DZJ A;  3WAO A;  3R3M A;  2IYD B;  4EKU A;  1MHH E;  4LNO A;  3V60 A;  4GDK A;  3SHQ A;  2DAF A;  1H7X A;  4ARC A;  3P42 A;  2JRI B;  2KDF B;  3NS1 A;  1K51 A;  1XLP A;  2NTT A;  1C3T A;  1JWM D;  4GIV A;  3BVM A;  3FC4 A;  4B9K A;  2Y3A A;  3PRE A;  4RGO S;  4NQK E;  4BBN C;  3MTN B;  2BTE A;  1S3S G;  5GXG B;  4W9L A;  3BII D;  4USA A;  3AV8 A;  3DBR B;  3ECI A;  3DHG C;  1BUI C;  3K9P B;  2ZJD A;  3UQA A;  2BWF A;  2B76 B;  3C0R B;  5BMH A;  2MJ3 A;  1NI3 A;  2CHZ A;  1QZE A;  5DPT A;  3T3N A;  3KYD D;  1A70 A;  4GN1 A;  1JWA D;  1VLB A;  3PRZ A;  3R7R A;  1UWX A;  3ZYY X;  3VRB B;  3EFC A;  1XO3 A;  2HTH A;  2L1A A;  3PRP B;  3VH4 B;  4WWO A;  5BMI A;  1C76 A;  1YX5 B;  3W1S A;  5TR5 A;  3M62 B;  2DAJ A;  1D5Z C;  1B9R A;  2JZ3 B;  4ZHP A;  1TKY A;  3B1L X;  4N6E B;  1EF5 A;  1UGM A;  2LGX A;  1B1Z A;  1V8C A;  4ANX A;  1T5X D;  1YJI A;  3Q3F A;  1IYF A;  3ZNH B;  5JHA A;  2MX2 A;  1PUT A;  4F1S A;  2DYM A;  4W9G A;  3V62 A;  2ZNV B;  4W9F A;  1IGC A;  1L2N A;  3QWZ B;  4IG7 B;  5BMG A;  4OVU A;  1WRD B;  1KOT A;  4NZL B;  1Q10 A;  3PHX B;  3PLU A;  1QOF A;  3RMK C;  3NS8 A;  4MH8 A;  2L7R A;  2NPT A;  1DGJ A;  3HIZ A;  1OQQ A;  2JT4 B;  2HTM E;  3ZTD A;  3L4P A;  4KZC A;  5CHV C;  4C80 A;  3O13 A;  1V1P B;  1MVK A;  1I7H A;  2L32 A;  2NTS A;  2N4F A;  4BAX A;  2JUO A;  3VTU A;  3BYT B;  3TJP A;  1VRA B;  3RZF A;  2KTR B;  2FBW B;  1JQ4 A;  4M8N A;  1WZ0 A;  4I6L B;  1LXD A;  3QIJ A;  4P16 A;  4KSK C;  3ETR A;  3V6C B;  2VRR B;  2NBW B;  3V05 A;  1ZXI A;  3KWV A;  3ZNG C;  1QT9 A;  2LD9 A;  4B95 A;  3RCZ A;  3SFD B;  4XWW A;  2YVC A;  2KTF A;  2IY1 B;  5D7G A;  3UIP B;  1RRB A;  2KMC A;  3NZU A;  3MFG A;  3PGE A;  3WAN A;  3UIN B;  3B2F A;  1V5O A;  2KN5 A;  4FA6 A;  1EWC A;  3H1U A;  2BBC A;  2R61 A;  2BYF A;  1AWD A;  4K81 A;  1WX9 A;  1GAQ B;  5C23 A;  1I4G A;  3BVG A;  4PYZ A;  4LLG M;  1JWU D;  5HHD G;  5IAA C;  4HRS A;  4AWJ A;  3AXC A;  5KHO A;  3UF8 A;  2REX A;  2LHE A;  3EHV A;  2N9P C;  3APF A;  1WXS A;  2V4L A;  1H8C A;  1KM7 A;  2DZI A;  2NMQ A;  1IP9 A;  2MBH A;  1TTN A;  2JRH A;  2MJE A;  2GBM A;  1KLU D;  3RNC C;  2FE8 A;  1R4M I;  4DK5 A;  2WWZ A;  5G2N A;  4M02 A;  3SEB A;  2L0F A;  2CHW A;  2DWQ A;  2FCM A;  4NNJ B;  2M1M A;  4KIK B;  2C7N B;  2RR9 A;  3A1Q B;  4RNA A;  1T0Y A;  3NVY A;  3C19 A;  1OQR A;  4P1B C;  1V97 A;  3RN9 C;  2ONQ A;  5CTR C;  1ISN A;  5C2T B;  3KWL A;  3ZLZ A;  1AAR A;  2IBI B;  4IWQ A;  4XC2 A;  5FR6 A;  2KK8 A;  3RD2 A;  2PKO A;  3N1Y C;  1N61 A;  2N9L A;  3Q69 A;  1V6E A;  4GDL B;  2V4I B;  2LFI A;  4FUL A;  2KZR A;  2D3B A;  1JWS D;  4FXC A;  2WXP A;  1VR9 A;  1LO5 D;  5D6J B;  1OGW A;  3KLS X;  4AS1 A;  2DYB A;  3M63 B;  2JYE A;  2WDQ B;  3O65 B;  1OFF A;  3ZKJ C;  3DBS A;  1UH6 A;  2BVC A;  3TSS A;  3PLV A;  4FHJ A;  4P1C C;  1CJE A;  4EUT A;  4DQO C;  1SE4 A;  3VUX A;  3A9J A;  1GC7 A;  1KH0 A;  2FAZ A;  2MHJ A;  4ASW C;  1YX6 B;  4EOY A;  2RSU A;  1WXA A;  5JZE B;  1XCQ L;  3EUB 2;  1SXT A;  2HD5 B;  3DQV A;  3Q3O C;  1TS3 A;  2WU2 B;  4HVB A;  1WJN A;  1BML C;  1I4H A;  3FKY A;  1JRU A;  3SU8 X;  2G4D B;  3KQ4 A;  1P9D U;  2AL6 A;  1P7E A;  1WX8 A;  1DOX A;  2VZK D;  3RUI B;  3CST A;  3BIN A;  4HKQ A;  1C4A A;  3GOE A;  2V1Y A;  2WXO A;  2KAN A;  2O6V A;  5IO9 A;  1L6U A;  4MGZ E;  1PYW D;  1GT8 A;  4HLE A;  5CHW A;  2C60 A;  3AM9 A;  1UNS A;  4ICU A;  2EMT A;  2I38 A;  2JXX A;  3VQI A;  3GP7 A;  1VZ8 A;  1YJJ A;  2N9E B;  1ZXH A;  1WSP A;  3TIX A;  1SJH D;  1D4B A;  2KDI A;  3ZTC A;  1Y8R C;  2MBE A;  1WM2 A;  2MBO A;  2KWD A;  5H8Y E;  3AE4 B;  4DHJ B;  2KFJ A;  2BGF A;  3VUW A;  2IO0 B;  1UWM A;  2D3A A;  4IWO A;  4KGS A;  3QHT A;  2AQ3 B;  2D11 A;  1TGZ B;  1WMH B;  3B08 A;  3VRA B;  3NZ3 A;  3BY4 B;  2PW9 A;  4ZRI A;  1EWY C;  1YMH E;  1E7V A;  4JPS A;  4ITK A;  2BPS A;  1ACC A;  2KO3 A;  4DXF A;  2KDM A;  4K7S A;  3MC8 A;  3MJ5 A;  1SJE D;  1WE6 A;  1L0Y B;  5TSS A;  2J53 A;  2LJI A;  4GU2 A;  3L16 A;  3UIO B;  1RFA A;  2EMS A;  3L54 A;  2LGY A;  2MEK A;  2K6D B;  1QOB A;  1PQS A;  4BKG A;  1F0Z A;  2DX5 B;  2Z0D B;  1WYW B;  3HHM A;  1L5P A;  1M94 A;  2G1E A;  4GSW A;  4RF1 A;  1UZX B;  2N1V A;  1TJE A;  1CZP A;  2DBY A;  4FJY A;  1Z2M A;  2R2Q A;  2LVP A;  2KN4 A;  2D07 B;  5JH5 C;  1I35 A;  2EKE C;  4FBJ B;  2LWP A;  2RDB C;  1N62 A;  3AEF B;  1RAX A;  2WU5 B;  2KVZ A;  1GPX A;  4ANU A;  4DXG A;  3QA8 A;  1WF9 A;  3AE3 B;  4RCO A;  2JWU A;  4FN2 A;  1YN4 A;  2G45 B;  2J4X A;  1OEY J;  4E71 A;  2LGD A;  1UEL A;  4OW0 A;  1WH3 A;  1NEK B;  1I4Q A;  3H7S A;  5J2R A;  1TZ1 A;  2DNF A;  3H7P B;  3DVN U;  2K0P A;  5L83 A;  1BXT A;  3APC A;  1ZDV A;  4PS8 A;  1Y56 A;  2I1K A;  1D3Z A;  1TT5 B;  1IBX A;  2ZCB A;  3NJT A;  2VH2 A;  1FEH A;  3N9Y C;  4RGT A;  1XEE A;  4W9K A;  3H6N A;  1ZE3 D;  2BS3 B;  3A9J B;  1F77 A;  1J0G A;  2CHX A;  1SE9 A;  2FNJ B;  2XNA C;  4A3O A;  4TQ0 A;  2UU7 A;  3IT4 B;  1YNT E;  2YLM A;  4EZJ A;  2IGH A;  2CS4 A;  3KUZ A;  2KKC A;  3CWI A;  2GLS A;  4MEM A;  1FNU A;  5AZG A;  5HFY A;  1C9F A;  1FFU A;  4D2K A;  3PTF C;  5EE9 A;  3GE8 C;  2MRP A;  1C4C A;  2MBB B;  4PS7 A;  1FM0 D;  2PVO D;  3U30 A;  1WIA A;  4WWN A;  2MH7 A;  2AYO B;  1WYG A;  2LRU A;  2LGS A;  1N60 A;  2MLB A;  4DDG D;  4E74 A;  2ZCC A;  2PJH A;  4N58 A;  3IVF A;  2CU3 A;  3U7D A;  2IND C;  1PGA A;  4A6Q A;  4RF0 A;  1XT9 B;  2KQS A;  3AE9 B;  1JCK B;  3BK2 A;  1UBI A;  1T0R C;  3P4P B;  1XXG A;  4URK A;  2MQJ A;  5E6N A;  3KVF B;  1QIL A;  3BYY B;  3S2A A;  4WWM A;  3AED B;  2XEW A;  5BYS A;  2IDY A;  2JZZ A;  3LJ3 A;  3DWM A;  2FUH B;  2KX3 A;  3DBL I;  3ZJV A;  3ZDM C;  3OJ4 B;  2JWZ A;  4A3P A;  3ZVV A;  4ZOH C;  2Z0E B;  5AZH A;  5DPW A;  2JQR B;  1IGD A;  1XQQ A;  2WS3 B;  3L13 A;  4MEL A;  1N63 A;  2WLB A;  3HVZ A;  2N1W A;  2GOW A;  1TKG A;  4M01 A;  3CF4 A;  4OVV A;  2Z8L A;  4IM3 A;  2CKH B;  2IZV B;  1FD6 A;  3VTV A;  5JHB A;  3QC8 B;  4P7I A;  2RDH A;  2QCZ A;  1CK1 A;  3ML9 A;  3KYC D;  4XDC A;  3H9D A;  1HE8 A;  5I4D A;  4MSQ B;  1WJ6 A;  4MGY E;  1RM6 C;  1UF0 A;  3DCG A;  3PPA A;  2O2V B;  5D2M B;  2CJO A;  3JYU A;  1QKZ A;  4C7Y A;  4IUM B;  1YN5 A;  4K1R B;  3RNG C;  2BB5 A;  4HEA 1;  2ZPN A;  3A9K B;  2WXG A;  5HKH A;  4KKJ A;  4MM3 A;  3MP9 A;  4YSX B;  3U4E G;  4I6P A;  3QK0 A;  3T9L A;  3ENE A;  2BW2 A;  2NBU A;  4M0W B;  1U4A A;  4HK2 A;  3HM3 A;  2WX1 A;  2BYE A;  3EFU A;  2LUM A;  1C1Y B;  3AN1 A;  3RI7 C;  4M00 A;  3RUL A;  3W9C B;  1WE7 A;  3A33 B;  2OHF A;  3NVV A;  1K53 A;  1IUE A;  3ZW3 A;  3WAL A;  3RPF C;  3SDL C;  3P4S B;  1J7B A;  1P98 A;  4ZRP A;  4WAF A;  2KLC A;  2D2Q A;  1SIJ A;  5LXI B;  1GTH A;  1WFY A;  1WZ3 A;  1MHX A;  1EO6 A;  1PGB A;  1HXY D;  2IPK D;  4A8X C;  4XX5 A;  1GOZ A;  2WXQ A;  2BWE S;  2E3T A;  3WIM A;  2KNB A;  2Y5P A;  3GE3 C;  4NPN A;  2OOB B;  3JSV A;  2PVG C;  1OQY A;  3I5J C;  2AEH A;  1F1H A;  1UD7 A;  3WAM A;  1F2R C;  4WWP A;  3N20 C;  3VDZ A;  1OEY A;  2WXR A;  1XCT L;  5FK9 C;  4YT0 B;  5IOI A;  1GNU A;  3HVD A;  3ONS A;  3QCA A;  2BKF A;  1KTK A;  3HK0 A;  2D5G A;  4FHK A;  4BKT A;  1HQR D;  1BT0 A;  3QX1 A;  4K3C A;  3RNB C;  1PFD A;  3MC9 A;  5EE3 A;  4GDK B;  4N59 A;  3EGR A;  3AI5 A;  3P1M A;  4JX1 C;  2PMV A;  2UWQ A;  3RZW C;  1ZP0 B;  3NG0 A;  3P2B A;  1NVI D;  5DPS A;  4NAW A;  3ZO5 B;  3ZIM A;  4Q2J A;  2M56 B;  3PZ8 A;  5IN7 A;  3RNE C;  1DOI A;  1WMH A;  5BYR A;  3L08 A;  1YIW A;  2INN E;  3P4R B;  5L95 C;  2WX0 A;  4ZRJ A;  4ACF A;  1V5T A;  2JX5 A;  3AEA B;  1WGY A;  2FUG 1;  4WJN A;  2DZK A;  4KDL B;  4M0W A;  1ZPS A;  2W82 A;  4IM0 A;  1I4R A;  2MJD A;  3L10 B;  2QHO A;  4XZ4 A;  3ZXV A;  3DBH I;  1AN8 A;  4NY0 A;  1E7P B;  1YD8 U;  4C7Z A;  2L05 A;  4NAW B;  3ZXR A;  5AUK A;  4LDT D;  1R7S A;  4IDI A;  3H8H A;  3PZD A;  2VZK B;  1FNW A;  4ZYS A;  5EDS A;  1TYG B;  4EZK A;  1WX7 A;  4DXA B;  2JF5 A;  2L8J A;  3J9C A;  2W54 A;  2MCN B;  3AEB B;  3W5U B;  2KX0 A;  2X8X X;  3UGB B;  1KLG D;  5G5H A;  1UUP A;  4NJ7 A;  2NBV B;  3ZNZ B;  2M0A A;  3DVN V;  2LI5 A;  1UGJ A;  4W9E A;  1IBX B;  2JY6 A;  2KQ4 X;  1GTE A;  2BYT A;  4HJK A;  3Q6B A;  3T8M A;  2GBK A;  5D94 A;  1UBQ A;  2W3S A;  3SR6 A;  3W1Y A;  2M4N A;  2ASQ A;  3Q8F A;  4IOI E;  4DHJ D;  1PDX A;  4EEW A;  1HEZ E;  2ZZP B;  3JSV B;  4L2Y A;  4X57 B;  4NQL B;  3V61 A;  4TSS A;  4WJP A;  2V3S A;  1J7A A;  1VCB A;  2J52 A;  5EE0 A;  1A5R A;  3ZJT A;  5AZF A;  4TV3 A;  2WP9 B;  4K7W A;  2LXA A;  3R7Q A;  4ZDV A;  2RPV A;  5FR3 A;  2K1F A;  2LEK A;  4DHZ E;  2QC8 A;  2G4S A;  4KZ0 A;  2K3U A;  3BVZ A;  3VR8 B;  4NJC A;  2YEP B;  4LJP B;  2BS2 B;  2QJL A;  3DVG X;  2H88 B;  1PGX A;  2KC2 A;  3PS6 A;  2JVC A;  4DBG A;  2GBJ A;  4B6W A;  4CQN A;  2KWV B;  2D3C A;  1JAL A;  1XLQ A;  1FPY A;  2L52 A;  4HCP B;  3V6E B;  3PO0 A;  4HDQ A;  3A9K A;  5E6P A;  1CQV A;  2L0T A;  1QF6 A;  2BS4 B;  3DBH B;  1KLV A;  4GB9 A;  1KRH A;  1LFD A;  1CMX B;  2RMM A;  5G55 A;  3ZGZ A;  3TEY A;  2IO1 B;  2ACZ B;  1P3Q U;  4WAA A;  5EE1 A;  3APD A;  2JZP A;  1TS5 A;  4MAC A;  1I42 A;  2GI9 A;  2LGI A;  1XLO A;  3WCQ A;  2M8S A;  2C5L C;  1FRD A;  1D6E C;  3ZDT A;  5LNK 1;  1HZ6 A;  3QQ8 B;  2QIE B;  1G6J A;  1WGG A;  2DZM A;  1WJ4 A;  3Q8E A;  2SAK A;  4BFR A;  4JLC A;  4W9D A;  4W9J A;  4YSY B;  5AUI A;  4C4V B;  1QQR A;  3RT3 B;  4BOS C;  3NHE B;  2KQ7 A;  2DLB A;  4ICV A;  4HCN B;  2QDF A;  4FLH A;  1ZUD 2;  3NUH B;  2WDT B;  1NYQ A;  1MPE A;  2A5U A;  1YQ4 B;  2X38 A;  3AH7 A;  3AE2 B;  4LNF A;  5LXH A;  5E6O A;  3P63 A;  1WGH A;  2L00 B;  2KXJ A;  2WHI A;  4LNK A;  3Q3N C;  1VZ6 A;  2Q5W D;  1T3Q A;  4EE2 A;  2IJ0 A;  2QEJ C;  3IAM 1;  3MHS D;  4II3 B;  5BYQ A;  5HG2 A;  2KDB A;  1HTO A;  2MW5 A;  3Q2A C;  4EZL A;  3K9O B;  4RM8 A;  1TZO A;  4DWF A;  2A4Z A;  4JGH B;  4KIK A;  4L1B A;  2N7J A;  2W3R A;  2WXN A;  3CSF A;  1RWS A;  1WI0 A;  4AJW A;  1V81 A;  3PT2 B;  4BKS A;  1E5W A;  1QOA A;  1SF0 A;  2SEB D;  1EU3 A;  3AE1 B;  3SFE B;  4IM2 A;  4DDI D;  3OAW A;  4HPP A;  2FCS A;  1GUA B;  2GBN A;  3B2G A;  3DWG C;  5H92 C;  1RLF A;  4MM3 B;  1ZW7 A;  2DHZ A;  4C4V A;  3FAH A;  4LNN A;  2HJ1 A;  2L83 A;  1MJD A;  3B9J A;  1XF5 L;  1AW7 A;  1K8R B;  4JIO U;  3UQB A;  3OWE B;  1F52 A;  2GBR A;  4AQ7 A;  1ZOY B;  3KUD B;  1MG8 A;  4HXD A;  4ANV A;  4PS3 A;  1WGR A;  4FJZ A;  2J0M A;  2OED A;  2MP2 A;  1WGK A;  1P1A A;  4YL8 A;  2JPH A;  3MHZ A;  2PE6 B;  4I6N B;  4AP4 C;  3PVL A;  4A90 A;  1VZ7 A;  4PT5 A;  1FCC C;  3ALB A;  3E56 A;  5BO4 B;  3HM6 X;  1J19 A;  3N1Z C;  4HJG E;  1L7Y A;  4TQ1 A;  3ML8 A;  2WGS A;  4B0M A;  1WXV A;  2KJ6 A;  3BZD B;  4JWS C;  2NVU I;  2V3P A;  3D32 A;  3DPD A;  4KX6 B;  3IG3 A;  2KD0 A;  5JXV A;  2EEL A;  2FCN A;  4XYC A;  2W55 A;  2I2Y A;  1WM3 A;  4S17 A;  4G11 A;  3RNA C;  3GZN I;  2J0K A;  5FKA C;  4LTU A;  4ZRK A;  1SE3 A;  3GB1 A;  1K50 A;  3I3T B;  1N6Z A;  2N9X A;  1OTR B;  1V2Y A;  1JWB D;  3U7Z A;  2PE9 A;  3R2T A;  1KJT A;  4LNI A;  4MGK E;  1ZDX A;  2JSV X;  1FXI A;  3X0W A;  3NRZ A;  4WUR A;  1RFK A;  1X1M A;  1J8C A;  2KC1 A;  4AUQ C;  2K25 A;  2C7H A;  3ZQ4 A;  1ESF A;  3U8Z A;  3TUO A;  3GZN B;  2J0J A;  2RD0 A;  3OG5 A;  1Q1O A;  2RPQ A;  4GXB A;  4HPM B;  1FXT B;  3Q8A A;  1HA5 A;  4WIP A;  2PTL A;  4KSL C;  1SB3 C;  2KFK B;  3TL5 A;  2UYZ B;  3NOB A;  4B0E A;  2V0G A;  4GDL A;  2KHW B;  2AQ1 B;  1DYQ A;  1T6B X;  1KF6 B;  3URY A;  3PV1 A;  5IKC M;  2KWU B;  1WXQ A;  3DBL B;  2LUE A;  3MJW A;  2OJR A;  1MI0 A;  1N5X A;  2NCN A;  3L17 A;  3H7P A;  4YTP B;  2WNM A;  1Q5W B;  1EU4 A;  4HPL B;  1E7U A;  2LXC A;  2Z59 B;  4RH6 A;  1NDD A;  5CX3 A;  1HZ5 A;  3RNF C;  4GMV A;  1C79 A;  1MFW A;  3AB5 A;  3PZ7 A;  3TMP B;  1E0Z A;  2GRI A;  3ABV B;  2ZW1 A;  3DDC B;  4K7U A;  1D5M C;  1FRR A;  4YWG G;  3VVW B;  4F7Z A;  2TSS A;  2WXK A;  3LDZ E;  3IAS 1;  5J18 A;  1RYJ A;  2KJR A;  1FCL A;  5DPR A;  4LDT B;  2L3Z A;  2V9H A;  3P4Q B;  3A1Q A;  4TKN A;  1LGR A;  5J17 A;  2KMM A;  3NVW A;  1C77 A;  4JE3 B;  3W1S C;  2CU1 A;  3JW0 X;  2LVO A;  4WH4 A;  2KJH B;  4HKZ E;  3T3O A;  3AU4 A;  2PEA A;  3V3X A;  2WXJ A;  5MPO A;  1P0R A;  1H4R A;  1C78 A;  4LK0 M;  3SD5 A;  4BZA A;  2WXF A;  2LVQ A;  2N7E A;  1NI2 A;  4NJ6 A;  3QAR A;  2K39 A;  1V80 A;  1LQB A;  3U52 E;  3U2S C;  2M0X A;  1FFV A;  3NVZ A; 
#chains in the Genus database with same CATH homology
 1HEZ E;  1MHH E;  1F0Z A;  4OZA A;  4L2Y A;  1SBB B;  4TSS A;  1L5P A;  2G1E A;  4RF1 A;  1H7X A;  4ARC A;  1VDV A;  1DOY A;  3P42 A;  4H2A A;  1J7A A;  1EM7 A;  1TJE A;  3NS1 A;  1K51 A;  1XLP A;  2NTT A;  2WXH A;  1JWM D;  2J52 A;  3E9S A;  1CZP A;  2DBY A;  3BVM A;  3FC4 A;  5EE0 A;  3ZJT A;  1D5X C;  2Y3A A;  2KN4 A;  4RGO S;  2BTE A;  2WP9 B;  5GXG B;  2RPV A;  3BII D;  4USA A;  5FR3 A;  1N62 A;  3AE7 B;  3AEF B;  2LEK A;  2WU5 B;  1N5W A;  3AV8 A;  1GPX A;  1QLB B;  4DXG A;  1TS2 A;  1M4V A;  2K3U A;  4RGN A;  1BUI C;  3BVZ A;  4OHJ A;  2B76 B;  3VR8 B;  3AE3 B;  4RCO A;  2JWU A;  5BMH A;  2MJ3 A;  4NJC A;  1YN4 A;  1NI3 A;  1E10 A;  2J4X A;  2YEP B;  4KGT A;  4YTM B;  2BS2 B;  3T3N A;  2QJL A;  1A70 A;  2H88 B;  4OW0 A;  1PGX A;  1VLB A;  1JWA D;  1NEK B;  1I4Q A;  3HUI A;  2KAC A;  4OZC A;  1UWX A;  1E6E B;  3ZYY X;  4CQN A;  3AMZ A;  3VRB B;  1XO3 A;  2K0P A;  1ROE A;  1BXT A;  1NYR A;  1JAL A;  1ZDV A;  1XLQ A;  1Y56 A;  2L52 A;  4NAM A;  2L1A A;  3BWU D;  3PO0 A;  1CQV A;  1IBX A;  1QF6 A;  5BMI A;  1C76 A;  2IGG A;  2BS4 B;  3W1S A;  1TS4 A;  1KRH A;  1FEH A;  1D5Z C;  3W2D A;  2K5P A;  2RMM A;  1B9R A;  3ZGZ A;  4ZHP A;  3TEY A;  1TKY A;  2ACZ B;  3N9Y C;  4RGT A;  4N6E B;  1XEE A;  5EE1 A;  2IGD A;  2JZP A;  1TS5 A;  1B1Z A;  1V8C A;  1JW9 D;  4MAC A;  1ZE3 D;  1GB1 A;  2BS3 B;  1T5X D;  1YJI A;  5G5G A;  1F77 A;  3IT6 B;  2XNA C;  1JRO A;  4TQ0 A;  2GI9 A;  2LGI A;  1PUT A;  1XLO A;  3WCQ A;  3IT4 B;  2DYM A;  1YNT E;  1L4Z B;  1FRD A;  1D6E C;  2AX5 A;  4R3D A;  5LNK 1;  2IGH A;  1HZ6 A;  4P6V F;  3CWI A;  2QIE B;  4L23 A;  2E6X A;  3AE6 B;  3ZJU A;  3FIL A;  1FNU A;  3Q8E A;  1IGC A;  4UDU C;  2SAK A;  5HFY A;  1C9F A;  1H7W A;  1FFU A;  4D2K A;  5EE9 A;  5BMG A;  1C4C A;  4NZL B;  1Q10 A;  4YSY B;  1FM0 D;  1QOF A;  2K22 A;  5D3D A;  2WDR B;  2PVO D;  5AUI A;  4MH8 A;  1QQR A;  2MH7 A;  3TEW A;  1DGJ A;  1WYG A;  2DLB A;  1OQQ A;  2HTM E;  2JXT A;  1N60 A;  2WXI A;  3L4P A;  3EA6 A;  1I4P A;  4C80 A;  1ZUD 2;  3NUH B;  4N58 A;  3O13 A;  1NYQ A;  1MPE A;  1YQ4 B;  2X38 A;  3AH7 A;  1V1P B;  2CU3 A;  3AE2 B;  3BK1 A;  1MVK A;  1PGA A;  4A6Q A;  1I7H A;  4RF0 A;  3AEC B;  3LYY A;  3TEZ A;  2L32 A;  2NTS A;  3AE9 B;  1E9M A;  1JCK B;  3BK2 A;  3BYT B;  3P63 A;  3P4P B;  1VRA B;  1XXG A;  1VZ6 A;  2Q5W D;  2FBW B;  1T3Q A;  4EE2 A;  1JQ4 A;  1QIL A;  2WXL A;  2IJ0 A;  3BYY B;  2N9K A;  4WWM A;  2QEJ C;  3AED B;  3IAM 1;  5BYQ A;  5BYS A;  2G9H D;  2IDY A;  5HG2 A;  3W5V B;  3DWM A;  4P16 A;  1ET9 A;  3ZJV A;  3ETR A;  1QOG A;  3V05 A;  2N0S B;  1TZO A;  1ZXI A;  4TMA B;  1ENF A;  3KWV A;  1QT9 A;  4L1B A;  3I9V 1;  4ZOH C;  2JQR B;  3SFD B;  4XWW A;  1IGD A;  2N7J A;  2WS3 B;  2W3R A;  5D7G A;  2WXN A;  1RWS A;  1N63 A;  2WLB A;  5T8I A;  3HVZ A;  3MFG A;  1TY2 A;  1TKG A;  1QOA A;  1SF0 A;  1KFY B;  1JRP A;  2SEB D;  1EU3 A;  3AE1 B;  3SFE B;  3B2F A;  2XN9 C;  2QSD A;  3CF4 A;  1EWC A;  2BBC A;  2Y5C A;  2R61 A;  2Z8L A;  4REZ A;  3AE5 B;  1FD6 A;  1AWD A;  4GLS C;  3B2G A;  2RDH A;  1TKE A;  3DWG C;  5H92 C;  1GAQ B;  1CK1 A;  1I4G A;  3BVG A;  5HHD G;  4LLG M;  1JWU D;  4MM3 B;  4HRS A;  4J3O D;  4XDC A;  4A55 A;  2PIA A;  5I4D A;  2WDV B;  3FAH A;  3VR9 B;  1RM6 C;  2L83 A;  3B9J A;  1XF5 L;  2CJO A;  2LHE A;  1AW7 A;  1QKZ A;  3R8B A;  4C7Y A;  4MT5 A;  1NEN B;  1YN5 A;  4ARI A;  3OWE B;  2BB5 A;  4HEA 1;  2NMQ A;  4ZHO A;  4AQ7 A;  1ZOY B;  2WXG A;  3RFZ B;  2ON8 A;  1F2R I;  4KKJ A;  2MJE A;  1E0Z A;  3MP9 A;  1KLU D;  2OED A;  4IKG A;  4YSX B;  1J7C A;  3U4E G;  2FE8 A;  1WGK A;  5E6J A;  4YXD B;  5HI1 A;  3MHZ A;  2BW2 A;  4A90 A;  1VZ7 A;  2V3N A;  3SEB A;  4PT5 A;  1XLN A;  1FCC C;  1FMA D;  2DWQ A;  3E56 A;  2LUM A;  1FXA A;  4RNA A;  3NVY A;  4HJG E;  3AN1 A;  3FIL B;  4TQ1 A;  5D3I B;  1K52 A;  1OQR A;  1SE2 A;  3W9C B;  1V97 A;  4B0M A;  1FO4 A;  2ONQ A;  2OHF A;  3BZD B;  2RDG A;  2WXM A;  3NVV A;  4JWS C;  1K53 A;  1IUE A;  2V3P A;  1GB4 A;  4KX6 B;  3AE8 B;  5C2T B;  1L0X B;  2M19 A;  3KWL A;  5JXV A;  3RPF C;  2EEL A;  3P4S B;  4HRO A;  1J7B A;  2PKO A;  3C8Y A;  1STE A;  1L0V B;  2W55 A;  1N61 A;  3Q8C A;  4ZRP A;  2N9L A;  2I2Y A;  4WAF A;  1YQ3 B;  3Q69 A;  1L4D B;  1ET6 A;  3GS2 A;  4GDL B;  1YN3 A;  1SIJ A;  2V4I B;  2LFI A;  1GTH A;  4KGR A;  4OVZ A;  2INP E;  3CIR B;  5FKA C;  1JWS D;  4FXC A;  2WXP A;  1VR9 A;  1MHX A;  4LTU A;  1LO5 D;  1PGB A;  1SE3 A;  1HXY D;  3GB1 A;  2ZW0 A;  3KLS X;  2BB6 A;  1L6V A;  4US9 A;  4AS1 A;  1K50 A;  2IPK D;  2JYE A;  2WDQ B;  4A8X C;  1OFF A;  1V1O A;  2YEP F;  3MC0 B;  1V1P A;  1JWB D;  3TSS A;  3U7Z A;  3R2I A;  3R2T A;  2ICI A;  1GOZ A;  1ZDX A;  2JSV X;  2WXQ A;  1FXI A;  1CJE A;  3NRZ A;  4DQO C;  2E3T A;  2GB1 A;  4WUR A;  1SE4 A;  1FNV A;  2Y5P A;  1RFK A;  1KH0 A;  4JWU C;  2PVG C;  1XCQ L;  2JYT A;  1ESF A;  1F2R C;  3EUB 2;  3TUO A;  3ZQ4 A;  1SXT A;  1TS3 A;  2WXR A;  2WU2 B;  4ZRQ A;  1XCT L;  5FK9 C;  1TY0 A;  4YT0 B;  1WRI A;  1BML C;  1I4H A;  4YSZ B;  2LHD A;  3HVD A;  2HDE A;  1KTK A;  4KKI A;  2D5G A;  1HQR D;  3Q8A A;  3KQ4 A;  1PFD A;  1HA5 A;  3IXS A;  4GDK B;  4N59 A;  4YTN B;  4XE0 A;  5EE3 A;  3EGR A;  3P1M A;  2DYO A;  2K9X A;  4WIP A;  2PTL A;  3LXF A;  4JX1 C;  1P7E A;  2PMV A;  1SB3 C;  2BT6 A;  1ZP0 B;  1NVI D;  2AQ2 B;  1DOX A;  4B0E A;  2VZK D;  2V0G A;  4HKQ A;  2AQ1 B;  1C4A A;  2WXO A;  4Q2J A;  1DYQ A;  1T6B X;  1KF6 B;  3URY A;  2M56 B;  3PZ8 A;  4WQM A;  1L6U A;  3HRD D;  1WXQ A;  1DOI A;  5BYR A;  1AYF A;  2PLP A;  2INN E;  1PYW D;  1GT8 A;  1MI0 A;  1SEB D;  1N5X A;  4YTP B;  3P4R B;  2WNM A;  1EU4 A;  1SSN A;  3AM9 A;  1UNS A;  2JX5 A;  3AEA B;  2I38 A;  2FUG 1;  3I57 A;  4RH6 A;  1HZ5 A;  2LMC A;  3VQI A;  3GP7 A;  2CJN A;  1VZ8 A;  1C79 A;  1YJJ A;  1ZXH A;  1WSP A;  1ZPS A;  3AB5 A;  4M0W A;  3AEE B;  1SJH D;  1VJK A;  2GRI A;  2KAJ A;  2W82 A;  3ABV B;  3PZ7 A;  4XWT A;  1D4B A;  2ZW1 A;  1I4R A;  2MJD A;  1D5M C;  1FRR A;  4YWG G;  3AEG B;  1AN8 A;  1E7P B;  4C7Z A;  4NAW B;  2KWD A;  5AUK A;  5H8Y E;  4A9A A;  1R7S A;  4C56 C;  4IDI A;  3AE4 B;  2TSS A;  2WXK A;  3IAS 1;  3H8H A;  1RYJ A;  5C3J B;  2VZK B;  1FNW A;  4ZYS A;  1FCL A;  4RGM A;  1TYG B;  1UWM A;  3P4Q B;  4KGS A;  4O1N A;  2WQY B;  1P7F A;  2AQ3 B;  2KMM A;  3J9C A;  3VRA B;  2W54 A;  1FIQ A;  3NZ3 A;  3UI3 A;  2PW9 A;  3NVW A;  1C77 A;  4JE3 B;  3Q8B A;  3AEB B;  4OZB A;  1EWY C;  1JML A;  3W5U B;  1YMH E;  1I4X A;  1KLG D;  5G5H A;  1C4P A;  1UUP A;  2JU6 X;  4JPS A;  3LB8 C;  4RFB A;  4ITK A;  1ACC A;  4DXF A;  2M0A A;  1UGJ A;  4US8 A;  2H89 B;  2KDM A;  4WH4 A;  1IBX B;  2KQ4 X;  3MJ5 A;  1SJE D;  4HKZ E;  4XDD A;  1L0Y B;  5TSS A;  2J53 A;  2QIL A;  3T3O A;  1GTE A;  3V3X A;  2BYT A;  2LJI A;  2WXJ A;  5MPO A;  1C78 A;  2EKI A;  4LK0 M;  2QMT A;  3TEX A;  2WXF A;  1WWT A;  2W3S A;  2J42 A;  2MEK A;  3SR6 A;  3U52 E;  3U2S C;  1QOB A;  3Q8F A;  4IOI E;  1FFV A;  1PDX A;  3NVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...