3AE5B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-methyl-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Methyl-N-(3-isopropoxy-phenyl)-benzamide
rcsb
total genus 48
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae5B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae5B01
1N60A 1UWMA 1JWAD 3AB5A 2L83A 2PKOA 5C3JB 1T3QA 5H8YE 3AE5B 1AYFA 2HTME 3W5VB 4P6VF 1GAQB 2BT6A 3AMZA 4YTMB 2Q5WD 2WU2B 3HRDD 2H88B 4YT0B 1F0ZA 5C2TB 2G1EA 1SF0A 1N62A 3NVWA 5EE9A 4HRSA 2FBWB 3VR9B 1FXIA 2E3TA 2ACZB 2JX5A 2DWQA 4USAA 1QT9A 3P4QB 2BS3B 2WDVB 4N6EB 1TYGB 5EE0A 2WQYB 3DWMA 1JWBD 1A70A 1I7HA 1VDVA 1XLPA 4WWMA 1GT8A 1JALA 2W55A 2WP9B 1L6VA 1ZOYB 3HUIA 1L5PA 3NVYA 4N58A 2W3SA 3AH7A 4JX1C 1AWDA 5G5HA 1E9MA 3ETRA 1YJJA 1J7BA 2OHFA 3FAHA 3LXFA 4ZOHC 1FXAA 5MPOA 1JQ4A 1NVID 1CJEA 2W54A 3VRBB 3AEGB 3PO0A 1DOIA 4IDIA 2EKIA 1SIJA 2K22A 2CJNA 2DBYA 4US9A 3EUB2 1QOBA 1CZPA 3NS1A 4US8A 3ABVB 1NYRA 1WXQA 1EWYC 1E0ZA 1NEKB 1RYJA 4C7ZA 1E10A 2KAJA 3KWLA 1QOAA 2WS3B 2M19A 1V8CA 1TJEA 3ZYYX 4HROA 3AE4B 1OQRA 3AEAB 1WRIA 3CIRB 4YSXB 4ITKA 2QIEB 1NENB 2LEKA 3CWIA 2M56B 1N63A 1J7AA 1XLOA 4N59A 2MJ3A 3B9JA 1B9RA 1J7CA 2MJEA 4JWUC 3HVZA 2B76B 1YQ4B 1N5WA 4A9AA 4FXCA 1KFYB 1FO4A 1V97A 2Y5CA 3W5UB 3AEBB 4YXDB 1E6EB 1WWTA 2PVOD 1JW9D 1PDXA 1SB3C 1FRDA 5AUKA 3LB8C 4C80A 1ZXIA 1YQ3B 1XLNA 1QOGA 3B2FA 4LTUA 1PFDA 3L4PA 1ROEA 3AECB 1RWSA 2PIAA 1GTEA 1JROA 1NI3A 3P4RB 2PVGC 1FMAD 1TKGA 2KMMA 3AV8A 1TKEA 1FM0D 1DGJA 1FFUA 1TKYA 3B2GA 1L6UA 1XO3A 1YJIA 1KF6B 3AEEB 4ZHOA 3AE6B 4YSYB 2CU3A 1QLBB 2WU5B 3AE1B 1XLQA 2JQRB 2WDRB 3P63A 5G5GA 1DOYA 1RFKA 1OFFA 1WGKA 4C7YA 3AE9B 3P4SB 3SR6A 1DOXA 2BS4B 3DWGC 3NVZA 1FFVA 1QF6A 4YTPB 1GTHA 2QJLA 2K5PA 3SFDB 5EE3A 1H7XA 2BS2B 5EE1A 3NVVA 3RPFC 5H92C 3AEDB 4JWSC 1FRRA 1N5XA 4YTNB 1ZP0B 1H7WA 3AE3B 1OQQA 2N0SB 1N61A 1VJKA 3NRZA 1R7SA 1L0VB 1JRPA 1ZUD2 3AE8B 1NYQA 1WYGA 3SFEB 1RM6C 2AX5A 3P4PB 2WDQB 1E7PB 2MH7A 2CJOA 2W3RA 3VR8B 1GPXA 4WQMA 1QOFA 3P1MA 1FIQA 1KRHA 5AUIA 3WCQA 1IUEA 3VRAB 5GXGB 3AE2B 4YSZB 4ZHPA 3CF4A 3BIID 3FC4A 3AN1A 2MJDA 2K9XA 2WLBA 1VLBA 4KX6B 2L52A 3AM9A 1PUTA 2H89B 3W9CB 3AEFB 3AE7B
chains in the Genus database with same CATH superfamily
1N60A 3W5VB 2LVOA 3MJWA 3CMMB 2BYTA 4ANUA 1GC6A 3BWUD 3QQ8B 4L2YA 5BYRA 2KZRA 2NTSA 2KD0A 4KDLB 1L5PA 3BVGA 3DVGY 2BQQA 4ZOHC 1HQRD 3PZDA 1A5RA 1CJEA 1WE7A 2JPHA 4O1NA 4MM3A 2EKEC 2PE9A 3JYUA 2MRPA 4NNJB 4ICVA 4M8NA 1RRBA 4A20A 2D2QA 3Q14C 2D3AA 3ZTCA 1HTQA 4YSXB 1NENB 2PTLA 3HVZA 3IHPC 4FXCA 2WYQA 5JHAA 3VUYA 2PVOD 2J4XA 1SJED 4MSMB 3U30A 4BFRA 3LYYA 2D5GA 3AECB 1RWSA 4LDTB 1IGDA 3GB1A 4W9IA 3DPDA 3SU8X 1ZGUB 1KOTA 2DZIA 2WXOA 3MHSD 3A9KA 2KT7A 1C77A 2IO2B 4AQ7A 3KQ4A 1P98A 1YIWA 1C78A 1WYWB 2INPE 3PPAA 2OOBB 2V3NA 4NQLB 5G55A 5EE1A 2ZPYA 2RDGA 2LUMA 1OQQA 3RZFA 4EUTA 1VRAB 3RNCC 2ASQA 3OLMD 1WIAA 4W9LA 2WDQB 4WIPA 3RYTA 1FIQA 4YSZB 1WXMA 3E56A 5BMHA 2J0JA 2GRIA 2L83A 4B0MA 2KWUB 4I6LB 2QC8A 3WANA 3R2TA 1NI2A 3RNAC 3I63C 1XD3B 4K7WA 2JT4B 2WDVB 4WWPA 3U8ZA 1JWBD 1F9JA 1L0YB 1F1HA 3CF6E 3NUHB 2HDEA 4TMAB 4AJWA 3APCA 1V81A 3TEWA 2KJHB 2MEKA 1SIJA 4HKQA 3TBLD 5LXIB 2WXFA 4MM3B 3D32A 4W9KA 1RYJA 4C7ZA 1I4RA 4LNKA 5HHDG 1TJEA 3O65B 1SBBB 3ZDTA 2J0KA 3A9KB 5IP4D 3WALA 4NQKE 2DZMA 1J7CA 2JSVX 2MJEA 4GSWA 1N5WA 3NJTA 1UD7A 3TEXA 1D6EC 2NBUA 4TQ0A 1YQ3B 3I5JC 2WXJA 2PVGC 4E3CA 2R2OA 3DHGC 3MFGA 3O13A 1TKYA 1J0GA 4RM9A 3B0AA 2JQRB 2MP2A 2QMTA 1HTOA 2BKFA 3DBHB 3L16A 1C9FA 3RZWC 3IFWB 2IGHA 3HVDA 4YTNB 1VJKA 2LFIA 2CKHB 4HK2A 5DPTA 5HFYA 4DHZB 2KLGA 2K9XA 1VLBA 4DHJB 1V2YA 3QK0A 2NTTA 4EZLA 2REXA 1LM8B 1C1YB 3N20C 1IP9A 1WJNA 2L0TA 4II2B 1FXIA 1E8YA 2C9WB 2WQYB 3DWMA 2WXGA 1ZOYB 3ONSA 3APDA 5D94A 3DCGA 2KX3A 2KO3A 2W54A 4IDIA 2BB6A 1E10A 3ALBA 3AE4B 1KLUD 2LJIA 1ZW7A 3M63B 4ITKA 4HKZE 4B95A 3GP7A 2GBNA 1UWXA 1IPGA 1EU4A 2NVUI 1B9RA 1L4DB 1WXVA 4W9CA 2B76B 1MG4A 3ZJVA 4GDKB 1EF1A 4MGYE 2DAFA 3Q8FA 3DQVA 1V49A 1WX7A 4M00A 1MHHE 1D5MC 3HM6X 4K7UA 4P7IA 5GMVA 2X8XX 4IWOA 1P1AA 4ZHOA 4ASWC 2LRUA 3HM3A 1UF0A 3P4SB 2BS4B 1K51A 1PGBA 1YJ1A 4OW0A 1I35A 3DBRI 4F8CB 3R8BA 1WZ3A 2FNJB 1UBIA 3E9SA 2PW9A 5D3DA 2CJOA 3L54A 3ZO5B 1CK1A 2KWDA 5T8IA 2MLBA 2IGDA 1QZEA 2KK8A 2PKOA 5C3JB 2HTME 4P6VF 1TZ1A 3L0WB 2Q5WD 2N7DA 3GOEA 1MFWA 2O2VB 4M01A 2FBWB 1JRUA 3B1LX 2OJWA 4N6EB 4Q2JA 1VDVA 5CHVC 3OG5A 1SE9A 4LNOA 3RI7C 2C7NB 2W3SA 4IWQA 1E9MA 1TS2A 4P16A 1I4GA 3UI3A 1JCKB 1YX6B 1DOIA 4LNNA 2PPHA 2K0PA 2I1KA 1NYRA 4JE3B 2K8BA 2WX0A 1J8CA 1FNVA 5L95C 5E6JA 2EMSA 3PS6A 4BKTA 4JWUC 2MBHA 1KFYB 1D5ZC 4BKSA 1YN4A 1BUIC 2KVRA 4MH8A 2TSSA 2N7EA 2IZVB 2KMMA 2KTRB 1ESFA 1F52A 2W9NA 3ECIA 4JPSA 3SHQA 1ZDXA 1SE2A 1RAXA 3P63A 1FNUA 2N9XA 1WGKA 3M62B 4JGHB 3SR6A 4BOSC 1WR1A 1I4PA 4WJNA 2DYMA 1VCBA 4ICUA 2KYWA 2PEAA 2QEJC 3PRZA 1FPYA 1V1PB 3HK0A 4IM3A 4M02A 5D2MB 1OGWA 4MGZE 2L52A 3QJZA 3AEFB 3VXWA 2QHOA 5FK9C 4WWNA 2WXHA 4YTMB 2KC2A 4HCPB 2D07B 5C2TB 4LJPB 1L7YA 4LJOB 4FADA 3HIZA 4UDUC 1TYGB 3NG0A 2ZNVC 3QX1A 2DENB 3H7PB 3KYCD 1K8RB 2KLCA 5E6OA 4GDLB 1YQBA 3RCZA 3PGEA 4MJSB 1I4XA 2ZW0A 3ZNGC 3Q3FA 3IAS1 2ZZPB 3RNFC 2MWSB 2ICIA 1GUAB 2KVZA 4DXGA 3ML9A 4A3PA 3ZXRA 5DPWA 3TIXA 3IBEA 2MP2B 1ZXHA 1E7UA 1PDXA 1SB3C 3Q6BA 2JZ3B 4RGMA 4CYEA 2M0AA 3MC8A 3PT2B 4EZKA 5L83A 2V4IB 2JZPA 2O2VA 4IUMB 3GZNI 4DWFA 1YJIA 1STEA 1F2RI 2WXIA 5G5GA 1S3SG 1QF6A 3DWGC 4K7SA 4REZA 4YTPB 2FAZA 4FULA 2LVPA 1P0RA 3DVGX 3LDZE 4KV2A 3TEZA 1E7VA 3BY4B 2N0SB 1WYGA 5CHFA 1H4RA 4DK5A 3T3OA 3VH3B 3CF4A 2WLBA 2XK5A 3VDZA 1UBQA 4BOZB 4IOIE 2Y3AA 3Q8EA 1GAQB 2BT6A 2WXRA 4K3BA 4PS8A 1SSNA 3AXCA 1MPEA 4NJ7A 3EHVA 4USAA 5BMIA 3P4QB 2YEPB 3L08A 4MEMA 3R7QA 2PLPA 3UINB 4RFBA 1KTKA 4KZ0A 5HI1A 1AWDA 3B08A 1C79A 2N4FA 3PTFC 1WGHA 3NS1A 1CZPA 5D3IB 2KOXA 2LMCA 3V6EB 1ZE3D 2GB1A 2L8JA 1P3QU 2J53A 5J17A 4GIVA 3B9JA 4A6QA 3CSTA 3RT3B 1FXTB 2BPSA 4IM2A 4P1CC 4L23A 2KFKA 5AUKA 3M3JA 1ZXIA 2KHWB 3UQBA 4X57B 1E8XA 2UU7A 3ZNID 2LGDA 1HEZE 1NI3A 3P4RB 2KX0A 3RN9C 4AS1A 1LXDA 3Q3JA 2KFJA 1D3ZA 2NMQA 4J6IA 3NZSA 2GBKA 5HKHA 3NVZA 4FJZA 3FILB 3SFDB 2KFKB 2DX5B 3PRPB 4C00A 4XDDA 3SFEB 2NPTA 1JWSD 2L1AA 1EO6A 1MG8A 2UYZB 2Z0DB 1WGGA 3GE3C 2KN4A 5J18A 4KGSA 3MP9A 3IG3A 3NHEB 3ZNZB 1KLVA 3AMZA 2LVQA 2KJ6A 4EFOA 4GLSC 2J7QB 3L10B 1WGDA 3VR9B 4NJCA 3ZIMA 3SDLC 2VZKB 3KH0A 5DPRA 1NBFC 2MCNB 4HWIB 1XLPA 3MJ5A 2CU1A 4NJ6A 1TS3A 2RDBC 3V62A 2KTFA 3GS2A 2N9KA 4JX1C 4G0NB 1YJJA 5BYSA 3UGBB 2D3CA 2KMCA 2IDYA 2CJNA 3ZTDA 3ZXVA 1K52A 1EWYC 3WAMA 4XZ4A 4W9HA 1MVKA 2KXJA 4YL8A 2C7MB 4A3OA 4PS3A 4N9F4 4MT5A 1V5OA 4B0EA 2LGIA 1MHXA 2D11A 3X23A 1J7AA 3A9JA 1FO4A 2LGXA 3AI5A 3L17A 3PVLA 4KIKA 5IOIA 3S2AA 3N1YC 3ZKJC 3Q8BA 1KF6B 2WDRB 2M1MA 5BYQA 1DOYA 1RFKA 4HDOA 1JMLA 3AE9B 2RD0A 1XT9B 1TGZB 1GG3A 2K5PA 3U7DA 1WXAA 1YN3A 4HPPA 4M8MA 2FUHB 3A1QA 1L4ZB 3NRZA 2EMTA 2KDIA 3W1SA 1NYQA 2C7HA 2J42A 4GB9A 4KDIC 3TJPA 4MSQB 1XCTL 2K39A 2XN9C 1PUTA 3RD2A 2JX5A 3R2IA 5FR3A 3H9DA 3P2BA 1H8CA 1WMHA 4BKGA 4A8XC 1UNSA 1WF9A 3KLSX 2G9HD 3I9V1 2MHJA 3Q2AC 3SD5A 3VH4B 4FBJB 2RPQA 3R3MA 1V80A 5AZHA 1ACCA 1BT0A 2WP9B 4ZRPA 4FLHA 4HXDA 1FXAA 4LCDE 2JF5A 1TTNA 3AEGB 2NPTB 4FN2A 4W9GA 4WAFA 1HZ6A 3TCAA 4WAAA 5JHBA 2LXCA 1JWMD 4G11A 2KJRA 3R66C 3CWIA 3JSVA 2HTHA 4A9AA 2QSDA 2V3PA 3W5UB 1T0RC 3QHTA 1E6EB 3TL5A 3W1SC 4P1BC 2L05A 2J52A 1HZ5A 2KACA 1JW9D 3Q3MC 1PFDA 3TSSA 1ROEA 4YWGG 4FJYA 1FM0D 3BVZA 1I4HA 4WJPA 2CU3A 3AE1B 1DOXA 1S1QB 2BBCA 2Z8LA 4OZBA 2BTEA 2MQJA 1FD6A 1YMHE 1AARA 4BKSD 3MTNB 1UZXB 1H7WA 2KNBA 4LDTD 3V05A 4PT5A 3BK1A 1L0VB 3OWEB 2NBWB 2A4ZA 2NCNA 4ZRJA 1T0QC 2SAKA 1QOFA 1KRHA 3BYYB 4CHKA 1K50A 2L00B 2KDBA 1SE4A 4EEWA 2MJDA 2H89B 3N1XC 1JWAD 2L0FA 3N30A 3AE5B 3QAQA 3VTWA 2WU2B 4ZRQA 4HJKA 1D4BA 2I2YA 4MDKE 5EE9A 3NVWA 2PJHA 1KH0A 4HRSA 5JXVA 4PS7A 2O6VA 5AZGA 1T0SC 3N9YC 3RNBC 4C56C 2W82A 1A70A 3GZNB 4MGIE 1R4NB 1Y8RC 1TS4A 4N58A 1X1MA 2LHDA 1WY8A 2V3SA 3IXSA 4PYZA 2JU6X 2WXMA 4ZYNA 4ACFA 5MPOA 2RGFA 1C76A 1IBXB 2EKIA 1WX9A 2K3UA 1QILA 5HG2A 5C1ZA 1XXGA 2LASA 1WXQA 4NAWA 1QQRA 3A1QB 2RSUA 4OZCA 3J9CA 4WH4A 1LQBA 2O6VD 2G45B 2G4DB 1HA5A 5G2NA 1WJ6A 5AZFA 1KJTA 1GNUA 4LLGM 4DQOC 2IY0B 3LB8C 3ZVVA 4KIKB 1VZ7A 2BYEA 2KANA 2PE6B 3B2GA 4MH0E 3ZNHB 2JRHA 3KUCB 4HPMB 1LFDA 3A9JB 4C7YA 3NS8A 1WGRA 2WGSA 1OEYA 4RF1A 4EOYA 1QKZA 3HHMA 1WE6A 1R7SA 2AQ2B 2WX1A 4MJSA 2K8CA 2K8HA 1E7PB 3JSVB 4ZDVA 1F2RC 3WCQA 2AL3A 3C19A 2E6XA 3V61A 4GDKA 3AN1A 2IPKD 4ANXA 2V9HA 3PREA 4DHZE 5H8YE 1GC7A 3WAOA 2H88B 3NZUA 1VD2A 2G1EA 4MGKE 1GOZA 4A90A 3BYTB 1C4CA 2Y5BB 3X0WA 2BS3B 3VUXA 1G6JA 2LXAA 2INCC 2HJ8A 4LK0M 3FILA 2KN5A 3V60A 3AH7A 5G5HA 1J7BA 2UWQA 3FKYA 1WMHB 2QCZA 2JYEA 3FAHA 3RNEC 3VTUA 1JQ4A 2M4NA 4M0WA 2N9LA 3EA6A 1E0ZA 1VZ6A 4KGTA 3RULA 1XCQL 4G3XB 2BKRB 2LUEA 2IY1B 1EUVB 3UIPB 3BZDB 2J0MA 1OTRB 1TT5B 4HJGE 1WH3A 2MX2A 2KDFB 4BVUC 3W2DA 1FFUA 3L13A 2GOWA 1PGXA 2GBRA 3KUZA 4IKGA 1IGCA 4FJVB 1L0XB 1B1ZA 2BGFA 2LGYA 4PYUA 3T3NA 1NDDA 3K9PB 2GLSA 3RUIB 3QCAA 1V1PA 4NZLB 4KGRA 1RM6C 2GI9A 3ZLZA 1CMXB 4IWPA 4WQMA 1FEHA 5AUIA 1IUEA 2DLBA 4W9JA 2FIDA 3A4SC 5LXHA 4AWJA 3W9CB 1UWMA 2OJRA 4XC2A 3EFCA 5FKAC 2KC1A 2WHIA 3U2SC 1T6BX 4W9EA 2RMMA 2KTRA 4YT0B 5EE0A 3KWVA 2I1JA 3WIMA 4S0RA 2FCSA 4E74A 3A4RA 2MBOA 4OVUA 2W55A 4KSKC 1WXSA 4TUUA 2YVCA 2BVCA 3ETRA 2OHFA 3H6NA 4AOFA 1NVID 3PO0A 3DBLI 4FA6A 3CSFA 2K22A 3OJ3A 4US8A 4TV3A 2ZJDA 2JXTA 2WS3B 4JQWC 1C4PA 1TY2A 4HROA 1OQRA 2L7RA 5BO4B 2ZVNA 2K1FA 1SEBD 1ZDVA 3PV1A 1C4AA 3PSEB 5KHOA 1IBXA 4RMAA 1GB4A 2V1YA 4LTUA 4F1SA 3JVZX 2Z59B 3T8MA 4G50A 4NAWB 1FMAD 2K25A 3OAWA 2FE8A 2KMAA 3Q3OC 4RGNA 4W9FA 1QLBB 1ISNA 2WXPA 4S17A 2NBVB 1GTHA 5EE3A 1H7XA 2M17A 4JL9A 3JW0X 2ZCCA 3GE8C 1KLGD 4BAXA 2VH1A 2KWVB 4IC7B 4HVBA 2AX5A 3ZGZA 2ZNVB 2JVCA 2BYFA 3UIOB 3QWZB 3ZJTA 2RR9A 2SEBD 4KSLC 1C3TA 4KX6B 3AM9A 4HEA1 3AU5A 1V6EA 4GXBA 1E8WA 1AYFA 2NS5A 4WWOA 1UGJA 3N1ZC 3HRDD 4LNIA 2KKCA 2RDHA 3A33B 4XGAB 1SF0A 3APFA 2INDC 1YX5B 2JWZA 1U4AA 4II3B 4EE2A 3ENEA 1RLFA 1EM7A 1I7HA 1LO5D 5CTRC 3HUIA 5LNK1 3NVYA 1E8ZA 1TS5A 1FNWA 3LXFA 2VRRB 2DBYA 4DDGD 1QOBA 4RM8A 3DBLB 1YOVB 3ZYYX 3RFZB 3AEAB 5DCNA 4AJYB 2WNMA 1WX8A 3DVNV 2LEKA 2L32A 4AP4C 4N59A 1Y56A 1Q0WB 1T5XD 3K9OB 1WWTA 2AL6A 2JXXA 1QOGA 3B2FA 3L4PA 3SEBA 2IO1B 1Z5SB 3OJ4B 2CHWA 5IO9A 1TZOA 1TKEA 1V9JA 2AWTA 2VH2A 3ZDMC 3EC8A 2AQ3B 1OFFA 5LLIA 1FFVA 4FHKA 2KDEB 1UELA 3RPFC 3ZW3A 4JWSC 2MSED 2VZKD 1N5XA 1ZP0B 4RGOS 2JY6A 2M0XA 1N61A 1WI0A 1JRPA 2L3ZA 4XX5A 3M95A 2JUOA 2K6QA 2AEHA 3ZQ4A 2DNFA 1WZ0A 1HE8A 3VRAB 4ZHPA 1FCLA 3VUWA 4XDCA 4DXAB 3PHXB 2B3AA 1T3QA 1UUPA 4IM0A 1JWUD 2D3GA 1F77A 4GDLA 3MC0B 2KQSA 4URKA 1N62A 2IBIB 3T9LA 3BK2A 1SJHD 4H2AA 1KM7A 2R2QA 1D5XC 2ZPNA 2ZEQA 2JRIB 3UQAA 1AW7A 3VRBB 2Z0EB 4WURA 2RPVA 1Q1OA 3KWLA 1M94A 4IG7B 2ONQA 3IVFA 1WRIA 3CIRB 4JLCA 4QAYA 3PHWB 3C0RB 2Y5CA 3BVMA 4TQ1A 1V5TA 3KVFB 1I42A 3DDCB 5E6PA 1YD8U 2MBBB 2N9EB 5DPSA 1WGYA 4JIOU 2BYVE 1L6UA 1XO3A 3AEEB 5D6JB 3ZUNA 4MACA 2X38A 2V0GA 2LRWA 1OEYJ 3IT6B 1XQQA 2C60A 2LWPA 1Z2MA 4HDQA 5H92C 3AEDB 2JZZA 3IT4B 4PK1A 3H1UA 3QC8B 4MELA 4HLEA 3Q8AA 1R4MB 1FCCC 2KQ7A 3P1MA 4AUQC 3TEYA 3WAPA 3AE2B 3FC4A 3C8YA 1J19A 1T0YA 1SGHA 1DYQA 2KDMA 4K3CA 4KVGB 4XWWA 1WSPA 2DAJA 5TSSA 4A55A 2GBMA 2BW2A 3AULA 5EDSA 4FHJA 1P9DU 4B9KA 3DHIC 4ZRIA 5BMGA 1QT9A 1R4NI 1SIFA 2L76A 5I4DA 1CQVA 2N1WA 5IN7A 3LJ3A 3DOWA 1JALA 3H8HA 4NY0A 3PLVA 4KZCA 1GB1A 5CX3A 4IW0A 4M0WB 2CHXA 4ZYSA 3QARA 2LHEA 2PMVA 1VR9A 3N32A 4OZAA 2MBEA 3KW5B 2LD9A 5TR5A 2LZ6A 3U52E 1V8CA 1V86A 3PLUA 2LJ5A 1Q10A 2QIEB 1TIFA 2HD5B 1XLOA 2MJ3A 2I38A 5JZEB 2G3QB 4ANVA 2MW5A 1FRDA 4DHJD 2DYBA 3ZRCA 4XE0A 3DBHI 4GN1A 2PIAA 1JROA 3QIJA 1I4QA 2LGSA 2INNE 4B6WA 1E5WA 3EFUA 3UF8A 1SXTA 4YSYB 4I6NB 3TMPB 1WM2A 2XK5B 3VTVA 3AU4A 2XBBC 2BB5A 1OQYA 4ARCA 4GOCA 1GJZA 2BS2B 4EKUA 3V6CB 1L2NA 2IO0B 3AE3B 3W1YA 4RCOA 1IYFA 3V3XA 4C4VB 3AE8B 4DBGA 3VR8B 2ZCBA 4I6PA 3BIID 4LNFA 1R4MI 3QA8A 2IO3B 1WM3A 1PGAA 3ML8A 4OHJA 2G4SA 4GMVA 1EWCA 2EELA 2WDTB 2OEDA 2E3TA 5FR6A 2A5UA 2JYTA 1UGMA 3ZJUA 4WWMA 1GT8A 1YN5A 2FUG1 5D7GA 3IAM1 1L6VA 1WFYA 1ET9A 2WXKA 3DHHC 4HCNB 2AYOB 2BWES 3EUB2 4E71A 2WXQA 2V4LA 1QOAA 2N9PC 2WXNA 1EU3A 4WJOA 3DBSA 1N63A 1EF5A 3RNGC 1YQ4B 4YXDB 2D10A 4GGQA 2DZKA 3MC9A 4XWTA 2ON8A 2HJ1A 5C23A 3DBRB 4K81A 4C80A 4CQNA 1XLNA 4RNAA 2CR5A 1GTEA 1TKGA 3AV8A 3KYDD 5IA7A 1DGJA 2FCQA 2O6VB 4ANWA 3VVWB 2WU5B 1P7EA 1M4VA 4F7ZA 2XNAC 1ET6A 2N7JA 1LGRA 3Q69A 5J2RA 3NVVA 2ZVOA 3PRMB 1XF5L 3EECA 3R7RA 4D2KA 2FCNA 3VAWA 4NAMA 1N6ZA 2KWCA 4XYCA 4C4VA 4DXFA 2GMIC 1P7FA 2MH7A 4BZAA 2W3RA 2N1VA 2YEPF 4CO7A 2WXLA 5GXGB 4HPLB 4WQOB 4RF0A 3AE7B 2IGGA 3AB5A 3H7PA 2CS4A 3DVNU 1WR6E 1TBEA 5CHWA 1F0ZA 2QILA 4W9DA 5IKCM 1UH6A 2LI5A 3NY5A 3U7ZA 2ACZB 2DWQA 3ZRFA 3KUDB 3VHTC 4RGTA 1HXYD 4TSSA 2XEWA 3PZ7A 2GBJA 1BMLC 4ZRKA 1MI0A 5JH5C 1V1OA 3VFKA 3Q3NC 4KKJA 5IAAC 3Q8CA 4US9A 4WJQA 3ABVB 3P42A 3WA0A 2JWUA 2D3BA 1NEKB 2M8SA 2DHZA 2KAJA 2M19A 3I57A 4EZJA 2CHZA 4J3OD 5E6NA 2AQ1B 1WJUA 1YNTE 1WRDB 2KQ4X 1XEEA 2M56B 2K6DB 3NOBA 2IJ0A 1TY0A 3PZ8A 3U4EG 1V97A 1ENFA 3AEBB 3RMKC 2FIFA 3I3TB 3VQIA 2NR2A 1AN8A 4TKNA 1RFAA 2C5LC 1PYWD 2R61A 4OVVA 2DYOA 4ARIA 1ZKHA 3N3KB 5AEKB 3URYA 2FCMA 2YLMA 1ZPSA 4BBNF 3AE6B 4RH6A 1XLQA 2QDFA 1E90A 2BWFA 4KKIA 2Y5PA 2WWZA 4NPNA 4DDID 3H7SA 2QJLA 1SE3A 5KHQA 4GU2A 2ZW1A 1K53A 1VZ8A 1FRRA 1Q5WB 4OVZA 2BF8B 1ZUD2 2DZJA 2MBQA 3BINA 3P4PB 3MHZA 3NZ3A 1GPXA 1PQSA 4L1BA 4BBNC 4K1RB 1MJDA 4R3DA 2IYDB 1WJ4A 3EGRA 3TUOA 1BXTA 2MA9B 2HE7A
chains in the Genus database with same CATH topology
1N60A 1JWAD 1T3QA 3AE5B 5FK9C 1UUPA 1JWUD 3W5VB 2WXHA 2BYTA 4YTMB 2WU2B 4ZRQA 1F77A 5C2TB 1D4BA 3MC0B 2I2YA 3BWUD 4L2YA 1N62A 3NVWA 5EE9A 1KH0A 4HRSA 5BYRA 5JXVA 3BK2A 1SJHD 3N9YC 4UDUC 1TYGB 4H2AA 4C56C 2W82A 1A70A 2NTSA 1L5PA 1TS4A 4N58A 3BVGA 1D5XC 2LHDA 3IXSA 2JU6X 2WXMA 4GDLB 4ZOHC 1HQRD 5MPOA 1AW7A 1CJEA 3VRBB 1C76A 1IBXB 2EKIA 1I4XA 2ZW0A 4O1NA 2K3UA 1QILA 4WURA 5HG2A 2RPVA 1XXGA 1WXQA 3IAS1 1QQRA 3KWLA 4OZCA 2ICIA 2ONQA 1WRIA 3CIRB 4YSXB 3J9CA 4WH4A 1NENB 4DXGA 2PTLA 3HVZA 1HA5A 4FXCA 2Y5CA 3BVMA 2PVOD 4LLGM 4DQOC 2J4XA 1SJED 4TQ1A 1ZXHA 1PDXA 1SB3C 3LB8C 4RGMA 2M0AA 3LYYA 2D5GA 3AECB 1RWSA 1IGDA 3GB1A 2V4IB 2JZPA 1VZ7A 2WXOA 1C77A 3B2GA 1L6UA 1XO3A 1YJIA 1STEA 1F2RI 3AEEB 4AQ7A 2WXIA 3KQ4A 4MACA 2X38A 5G5GA 2V0GA 1C78A 4C7YA 2INPE 1QF6A 3DWGC 4REZA 3IT6B 4YTPB 2V3NA 5EE1A 5H92C 3AEDB 3TEZA 3IT4B 2RDGA 2LUMA 4RF1A 1QKZA 1OQQA 2N0SB 1R7SA 1VRAB 2AQ2B 1WYGA 3Q8AA 2WDQB 1E7PB 4WIPA 1FCCC 1F2RC 1FIQA 3P1MA 3T3OA 3WCQA 3TEYA 2E6XA 3AE2B 4YSZB 3CF4A 3FC4A 3AN1A 2WLBA 3C8YA 2IPKD 3E56A 5BMHA 2KDMA 1DYQA 2GRIA 4XWWA 2L83A 4IOIE 1WSPA 5H8YE 5TSSA 4B0MA 4A55A 2Y3AA 3Q8EA 1GAQB 2BT6A 2BW2A 2WXRA 2H88B 1SSNA 3R2TA 1MPEA 2G1EA 1GOZA 4A90A 3BYTB 5BMGA 1C4CA 4USAA 1QT9A 3P4QB 2BS3B 2WDVB 5BMIA 2YEPB 1CQVA 1JWBD 5I4DA 2PLPA 1JALA 3H8HA 1L0YB 3FILA 4LK0M 4RFBA 1KTKA 3AH7A 3NUHB 5HI1A 2HDEA 1AWDA 5G5HA 1GB1A 4TMAB 1J7BA 3FAHA 1C79A 2JYEA 1JQ4A 3TEWA 2MEKA 4M0WA 1SIJA 2N9LA 4ZYSA 4HKQA 2LHEA 2PMVA 1VR9A 2WXFA 3EA6A 3NS1A 1CZPA 4OZAA 1E0ZA 1VZ6A 4KGTA 4MM3B 2LMCA 5D3IB 1RYJA 4C7ZA 1XCQL 1I4RA 1ZE3D 3U52E 1V8CA 1TJEA 2GB1A 5HHDG 1Q10A 2J53A 2QIEB 1SBBB 1XLOA 2MJ3A 3B9JA 1J7CA 2JSVX 2MJEA 1N5WA 2I38A 3TEXA 4A6QA 1D6EC 3BZDB 4HJGE 4L23A 1FRDA 5AUKA 1ZXIA 1YQ3B 4TQ0A 4XE0A 2WXJA 2PIAA 1JROA 1HEZE 1NI3A 3P4RB 2PVGC 1I4QA 2INNE 4AS1A 3W2DA 3MFGA 3O13A 1FFUA 1TKYA 1PGXA 4IKGA 1SXTA 4YSYB 2NMQA 1IGCA 2JQRB 1L0XB 2QMTA 1B1ZA 2BB5A 3NVZA 1C9FA 3T3NA 4ARCA 3FILB 2IGHA 3SFDB 2BS2B 3HVDA 4YTNB 3AE3B 1V1PA 4RCOA 1VJKA 2LFIA 3V3XA 4NZLB 4XDDA 3AE8B 4KGRA 3SFEB 1RM6C 2GI9A 1JWSD 2L1AA 3VR8B 4WQMA 5AUIA 1FEHA 5HFYA 1IUEA 2DLBA 3BIID 2K9XA 1VLBA 2KN4A 3W9CB 4KGSA 3MP9A 1PGAA 1UWMA 4OHJA 5FKAC 2NTTA 3AMZA 3U2SC 1T6BX 2RMMA 1EWCA 4YT0B 4GLSC 2EELA 3VR9B 1FXIA 2E3TA 2OEDA 5EE0A 3KWVA 4NJCA 2WQYB 2VZKB 3DWMA 2JYTA 3ZJUA 1XLPA 4WWMA 2WXGA 1GT8A 1YN5A 3MJ5A 2FUG1 2W55A 5D7GA 3IAM1 1L6VA 1ZOYB 1TS3A 3GS2A 2N9KA 2WXKA 1ET9A 4JX1C 3ETRA 1YJJA 2OHFA 5BYSA 1NVID 2W54A 3PO0A 4IDIA 2IDYA 2K22A 2CJNA 2BB6A 3EUB2 4US8A 1K52A 2WXQA 1EWYC 1E10A 1MVKA 2JXTA 1QOAA 2WS3B 1C4PA 1TY2A 4HROA 3AE4B 1OQRA 1KLUD 2LJIA 4MT5A 4B0EA 2WXNA 4ITKA 1EU3A 1SEBD 1ZDVA 2LGIA 3GP7A 4HKZE 1UWXA 1MHXA 1EU4A 1C4AA 1N63A 1J7AA 1B9RA 1L4DB 2B76B 1YQ4B 1FO4A 3ZJVA 4GDKB 4YXDB 1IBXA 4XWTA 2ON8A 3Q8FA 1GB4A 4C80A 4CQNA 4LTUA 1XLNA 4RNAA 1MHHE 1D5MC 1GTEA 4NAWB 3Q8BA 1FMAD 1TKGA 3AV8A 1DGJA 2FE8A 4RGNA 1KF6B 4ZHOA 1QLBB 2WU5B 2WDRB 1P7EA 2WXPA 5BYQA 1DOYA 1RFKA 1M4VA 1JMLA 3AE9B 3P4SB 2XNAC 1ET6A 2N7JA 2BS4B 1K51A 1PGBA 1GTHA 4OW0A 2K5PA 5EE3A 1H7XA 3Q69A 1YN3A 3NVVA 1XF5L 4D2KA 1L4ZB 3R8BA 4NAMA 1KLGD 3NRZA 3W1SA 1NYQA 2J42A 2AX5A 3E9SA 3ZGZA 2PW9A 5D3DA 4DXFA 1P7FA 2MH7A 2CJOA 2W3RA 2YEPF 1XCTL 2WXLA 5GXGB 2XN9C 4RF0A 3ZJTA 1CK1A 2SEBD 2KWDA 4KX6B 3AM9A 1PUTA 4HEA1 5T8IA 2JX5A 3AE7B 2IGGA 2IGDA 3AB5A 2PKOA 3R2IA 5C3JB 1AYFA 2HTME 1UGJA 5FR3A 4P6VF 3HRDD 2Q5WD 2RDHA 1F0ZA 1SF0A 2QILA 4A8XC 2FBWB 1UNSA 3U7ZA 2ACZB 2G9HD 2DWQA 3I9V1 3KLSX 4N6EB 4EE2A 1EM7A 4Q2JA 1I7HA 1HXYD 1LO5D 1ACCA 1VDVA 4RGTA 4TSSA 3PZ7A 2WP9B 1BMLC 4ZRPA 3HUIA 5LNK1 3NVYA 1MI0A 1TS5A 2W3SA 1FNWA 1E9MA 1TS2A 1V1OA 3LXFA 4P16A 1FXAA 1I4GA 3UI3A 1JCKB 4KKJA 3AEGB 1DOIA 3Q8CA 2K0PA 2DBYA 4US9A 1QOBA 4WAFA 1HZ6A 3ABVB 1NYRA 3P42A 2JWUA 4JE3B 1NEKB 2KAJA 2M19A 3I57A 3ZYYX 3RFZB 4J3OD 3AEAB 1JWMD 2AQ1B 2WNMA 1FNVA 1YNTE 2LEKA 3CWIA 2L32A 2KQ4X 1XEEA 2M56B 5E6JA 4N59A 1Y56A 4A9AA 4JWUC 2IJ0A 1TY0A 3PZ8A 1KFYB 1T5XD 1V97A 2QSDA 1D5ZC 1ENFA 3AEBB 2V3PA 3U4EG 3W5UB 1E6EB 1WWTA 1YN4A 2J52A 1HZ5A 2KACA 1JW9D 1BUIC 3VQIA 4MH8A 1AN8A 1QOGA 2TSSA 3B2FA 1PFDA 3L4PA 1ROEA 3SEBA 3TSSA 4YWGG 1PYWD 2R61A 1TZOA 2DYOA 2KMMA 1TKEA 4ARIA 1FM0D 1ESFA 4JPSA 3BVZA 3URYA 1I4HA 1ZPSA 3AE6B 4RH6A 2CU3A 1XLQA 3AE1B 1ZDXA 1SE2A 1FNUA 3P63A 2AQ3B 4KKIA 2Y5PA 1OFFA 1WGKA 3SR6A 1DOXA 1FFVA 2BBCA 2QJLA 1I4PA 1SE3A 2Z8LA 4OZBA 2BTEA 2DYMA 1YMHE 1FD6A 3RPFC 1K53A 1VZ8A 2ZW1A 2VZKD 1FRRA 4JWSC 1N5XA 1ZP0B 4RGOS 1H7WA 3V05A 1N61A 4PT5A 3BK1A 1L0VB 1JRPA 2QEJC 1ZUD2 1V1PB 3OWEB 4OVZA 3ZQ4A 3P4PB 3MHZA 3NZ3A 1GPXA 2SAKA 1QOFA 1KRHA 3BYYB 4L1BA 3VRAB 1K50A 4R3DA 4ZHPA 1FCLA 1SE4A 3EGRA 2MJDA 1BXTA 3TUOA 2L52A 4XDCA 2H89B 3AEFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N60 A;  1UWM A;  1JWA D;  3AB5 A;  2L83 A;  2PKO A;  5C3J B;  1T3Q A;  5H8Y E;  3AE5 B;  1AYF A;  2HTM E;  3W5V B;  4P6V F;  1GAQ B;  2BT6 A;  3AMZ A;  4YTM B;  2Q5W D;  2WU2 B;  3HRD D;  2H88 B;  4YT0 B;  1F0Z A;  5C2T B;  2G1E A;  1SF0 A;  1N62 A;  3NVW A;  5EE9 A;  4HRS A;  2FBW B;  3VR9 B;  1FXI A;  2E3T A;  2ACZ B;  2JX5 A;  2DWQ A;  4USA A;  1QT9 A;  3P4Q B;  2BS3 B;  2WDV B;  4N6E B;  1TYG B;  5EE0 A;  2WQY B;  3DWM A;  1JWB D;  1A70 A;  1I7H A;  1VDV A;  1XLP A;  4WWM A;  1GT8 A;  1JAL A;  2W55 A;  2WP9 B;  1L6V A;  1ZOY B;  3HUI A;  1L5P A;  3NVY A;  4N58 A;  2W3S A;  3AH7 A;  4JX1 C;  1AWD A;  5G5H A;  1E9M A;  3ETR A;  1YJJ A;  1J7B A;  2OHF A;  3FAH A;  3LXF A;  4ZOH C;  1FXA A;  5MPO A;  1JQ4 A;  1NVI D;  1CJE A;  2W54 A;  3VRB B;  3AEG B;  3PO0 A;  1DOI A;  4IDI A;  2EKI A;  1SIJ A;  2K22 A;  2CJN A;  2DBY A;  4US9 A;  3EUB 2;  1QOB A;  1CZP A;  3NS1 A;  4US8 A;  3ABV B;  1NYR A;  1WXQ A;  1EWY C;  1E0Z A;  1NEK B;  1RYJ A;  4C7Z A;  1E10 A;  2KAJ A;  3KWL A;  1QOA A;  2WS3 B;  2M19 A;  1V8C A;  1TJE A;  3ZYY X;  4HRO A;  3AE4 B;  1OQR A;  3AEA B;  1WRI A;  3CIR B;  4YSX B;  4ITK A;  2QIE B;  1NEN B;  2LEK A;  3CWI A;  2M56 B;  1N63 A;  1J7A A;  1XLO A;  4N59 A;  2MJ3 A;  3B9J A;  1B9R A;  1J7C A;  2MJE A;  4JWU C;  3HVZ A;  2B76 B;  1YQ4 B;  1N5W A;  4A9A A;  4FXC A;  1KFY B;  1FO4 A;  1V97 A;  2Y5C A;  3W5U B;  3AEB B;  4YXD B;  1E6E B;  1WWT A;  2PVO D;  1JW9 D;  1PDX A;  1SB3 C;  1FRD A;  5AUK A;  3LB8 C;  4C80 A;  1ZXI A;  1YQ3 B;  1XLN A;  1QOG A;  3B2F A;  4LTU A;  1PFD A;  3L4P A;  1ROE A;  3AEC B;  1RWS A;  2PIA A;  1GTE A;  1JRO A;  1NI3 A;  3P4R B;  2PVG C;  1FMA D;  1TKG A;  2KMM A;  3AV8 A;  1TKE A;  1FM0 D;  1DGJ A;  1FFU A;  1TKY A;  3B2G A;  1L6U A;  1XO3 A;  1YJI A;  1KF6 B;  3AEE B;  4ZHO A;  3AE6 B;  4YSY B;  2CU3 A;  1QLB B;  2WU5 B;  3AE1 B;  1XLQ A;  2JQR B;  2WDR B;  3P63 A;  5G5G A;  1DOY A;  1RFK A;  1OFF A;  1WGK A;  4C7Y A;  3AE9 B;  3P4S B;  3SR6 A;  1DOX A;  2BS4 B;  3DWG C;  3NVZ A;  1FFV A;  1QF6 A;  4YTP B;  1GTH A;  2QJL A;  2K5P A;  3SFD B;  5EE3 A;  1H7X A;  2BS2 B;  5EE1 A;  3NVV A;  3RPF C;  5H92 C;  3AED B;  4JWS C;  1FRR A;  1N5X A;  4YTN B;  1ZP0 B;  1H7W A;  3AE3 B;  1OQQ A;  2N0S B;  1N61 A;  1VJK A;  3NRZ A;  1R7S A;  1L0V B;  1JRP A;  1ZUD 2;  3AE8 B;  1NYQ A;  1WYG A;  3SFE B;  1RM6 C;  2AX5 A;  3P4P B;  2WDQ B;  1E7P B;  2MH7 A;  2CJO A;  2W3R A;  3VR8 B;  1GPX A;  4WQM A;  1QOF A;  3P1M A;  1FIQ A;  1KRH A;  5AUI A;  3WCQ A;  1IUE A;  3VRA B;  5GXG B;  3AE2 B;  4YSZ B;  4ZHP A;  3CF4 A;  3BII D;  3FC4 A;  3AN1 A;  2MJD A;  2K9X A;  2WLB A;  1VLB A;  4KX6 B;  2L52 A;  3AM9 A;  1PUT A;  2H89 B;  3W9C B;  3AEF B;  3AE7 B; 
#chains in the Genus database with same CATH topology
 1N60 A;  3W5V B;  2LVO A;  3MJW A;  3CMM B;  2BYT A;  4ANU A;  1GC6 A;  3BWU D;  3QQ8 B;  4L2Y A;  5BYR A;  2KZR A;  2NTS A;  2KD0 A;  4KDL B;  1L5P A;  3BVG A;  3DVG Y;  2BQQ A;  4ZOH C;  1HQR D;  3PZD A;  1A5R A;  1CJE A;  1WE7 A;  2JPH A;  4O1N A;  4MM3 A;  2EKE C;  2PE9 A;  3JYU A;  2MRP A;  4NNJ B;  4ICV A;  4M8N A;  1RRB A;  4A20 A;  2D2Q A;  3Q14 C;  2D3A A;  3ZTC A;  1HTQ A;  4YSX B;  1NEN B;  2PTL A;  3HVZ A;  3IHP C;  4FXC A;  2WYQ A;  5JHA A;  3VUY A;  2PVO D;  2J4X A;  1SJE D;  4MSM B;  3U30 A;  4BFR A;  3LYY A;  2D5G A;  3AEC B;  1RWS A;  4LDT B;  1IGD A;  3GB1 A;  4W9I A;  3DPD A;  3SU8 X;  1ZGU B;  1KOT A;  2DZI A;  2WXO A;  3MHS D;  3A9K A;  2KT7 A;  1C77 A;  2IO2 B;  4AQ7 A;  3KQ4 A;  1P98 A;  1YIW A;  1C78 A;  1WYW B;  2INP E;  3PPA A;  2OOB B;  2V3N A;  4NQL B;  5G55 A;  5EE1 A;  2ZPY A;  2RDG A;  2LUM A;  1OQQ A;  3RZF A;  4EUT A;  1VRA B;  3RNC C;  2ASQ A;  3OLM D;  1WIA A;  4W9L A;  2WDQ B;  4WIP A;  3RYT A;  1FIQ A;  4YSZ B;  1WXM A;  3E56 A;  5BMH A;  2J0J A;  2GRI A;  2L83 A;  4B0M A;  2KWU B;  4I6L B;  2QC8 A;  3WAN A;  3R2T A;  1NI2 A;  3RNA C;  3I63 C;  1XD3 B;  4K7W A;  2JT4 B;  2WDV B;  4WWP A;  3U8Z A;  1JWB D;  1F9J A;  1L0Y B;  1F1H A;  3CF6 E;  3NUH B;  2HDE A;  4TMA B;  4AJW A;  3APC A;  1V81 A;  3TEW A;  2KJH B;  2MEK A;  1SIJ A;  4HKQ A;  3TBL D;  5LXI B;  2WXF A;  4MM3 B;  3D32 A;  4W9K A;  1RYJ A;  4C7Z A;  1I4R A;  4LNK A;  5HHD G;  1TJE A;  3O65 B;  1SBB B;  3ZDT A;  2J0K A;  3A9K B;  5IP4 D;  3WAL A;  4NQK E;  2DZM A;  1J7C A;  2JSV X;  2MJE A;  4GSW A;  1N5W A;  3NJT A;  1UD7 A;  3TEX A;  1D6E C;  2NBU A;  4TQ0 A;  1YQ3 B;  3I5J C;  2WXJ A;  2PVG C;  4E3C A;  2R2O A;  3DHG C;  3MFG A;  3O13 A;  1TKY A;  1J0G A;  4RM9 A;  3B0A A;  2JQR B;  2MP2 A;  2QMT A;  1HTO A;  2BKF A;  3DBH B;  3L16 A;  1C9F A;  3RZW C;  3IFW B;  2IGH A;  3HVD A;  4YTN B;  1VJK A;  2LFI A;  2CKH B;  4HK2 A;  5DPT A;  5HFY A;  4DHZ B;  2KLG A;  2K9X A;  1VLB A;  4DHJ B;  1V2Y A;  3QK0 A;  2NTT A;  4EZL A;  2REX A;  1LM8 B;  1C1Y B;  3N20 C;  1IP9 A;  1WJN A;  2L0T A;  4II2 B;  1FXI A;  1E8Y A;  2C9W B;  2WQY B;  3DWM A;  2WXG A;  1ZOY B;  3ONS A;  3APD A;  5D94 A;  3DCG A;  2KX3 A;  2KO3 A;  2W54 A;  4IDI A;  2BB6 A;  1E10 A;  3ALB A;  3AE4 B;  1KLU D;  2LJI A;  1ZW7 A;  3M63 B;  4ITK A;  4HKZ E;  4B95 A;  3GP7 A;  2GBN A;  1UWX A;  1IPG A;  1EU4 A;  2NVU I;  1B9R A;  1L4D B;  1WXV A;  4W9C A;  2B76 B;  1MG4 A;  3ZJV A;  4GDK B;  1EF1 A;  4MGY E;  2DAF A;  3Q8F A;  3DQV A;  1V49 A;  1WX7 A;  4M00 A;  1MHH E;  1D5M C;  3HM6 X;  4K7U A;  4P7I A;  5GMV A;  2X8X X;  4IWO A;  1P1A A;  4ZHO A;  4ASW C;  2LRU A;  3HM3 A;  1UF0 A;  3P4S B;  2BS4 B;  1K51 A;  1PGB A;  1YJ1 A;  4OW0 A;  1I35 A;  3DBR I;  4F8C B;  3R8B A;  1WZ3 A;  2FNJ B;  1UBI A;  3E9S A;  2PW9 A;  5D3D A;  2CJO A;  3L54 A;  3ZO5 B;  1CK1 A;  2KWD A;  5T8I A;  2MLB A;  2IGD A;  1QZE A;  2KK8 A;  2PKO A;  5C3J B;  2HTM E;  4P6V F;  1TZ1 A;  3L0W B;  2Q5W D;  2N7D A;  3GOE A;  1MFW A;  2O2V B;  4M01 A;  2FBW B;  1JRU A;  3B1L X;  2OJW A;  4N6E B;  4Q2J A;  1VDV A;  5CHV C;  3OG5 A;  1SE9 A;  4LNO A;  3RI7 C;  2C7N B;  2W3S A;  4IWQ A;  1E9M A;  1TS2 A;  4P16 A;  1I4G A;  3UI3 A;  1JCK B;  1YX6 B;  1DOI A;  4LNN A;  2PPH A;  2K0P A;  2I1K A;  1NYR A;  4JE3 B;  2K8B A;  2WX0 A;  1J8C A;  1FNV A;  5L95 C;  5E6J A;  2EMS A;  3PS6 A;  4BKT A;  4JWU C;  2MBH A;  1KFY B;  1D5Z C;  4BKS A;  1YN4 A;  1BUI C;  2KVR A;  4MH8 A;  2TSS A;  2N7E A;  2IZV B;  2KMM A;  2KTR B;  1ESF A;  1F52 A;  2W9N A;  3ECI A;  4JPS A;  3SHQ A;  1ZDX A;  1SE2 A;  1RAX A;  3P63 A;  1FNU A;  2N9X A;  1WGK A;  3M62 B;  4JGH B;  3SR6 A;  4BOS C;  1WR1 A;  1I4P A;  4WJN A;  2DYM A;  1VCB A;  4ICU A;  2KYW A;  2PEA A;  2QEJ C;  3PRZ A;  1FPY A;  1V1P B;  3HK0 A;  4IM3 A;  4M02 A;  5D2M B;  1OGW A;  4MGZ E;  2L52 A;  3QJZ A;  3AEF B;  3VXW A;  2QHO A;  5FK9 C;  4WWN A;  2WXH A;  4YTM B;  2KC2 A;  4HCP B;  2D07 B;  5C2T B;  4LJP B;  1L7Y A;  4LJO B;  4FAD A;  3HIZ A;  4UDU C;  1TYG B;  3NG0 A;  2ZNV C;  3QX1 A;  2DEN B;  3H7P B;  3KYC D;  1K8R B;  2KLC A;  5E6O A;  4GDL B;  1YQB A;  3RCZ A;  3PGE A;  4MJS B;  1I4X A;  2ZW0 A;  3ZNG C;  3Q3F A;  3IAS 1;  2ZZP B;  3RNF C;  2MWS B;  2ICI A;  1GUA B;  2KVZ A;  4DXG A;  3ML9 A;  4A3P A;  3ZXR A;  5DPW A;  3TIX A;  3IBE A;  2MP2 B;  1ZXH A;  1E7U A;  1PDX A;  1SB3 C;  3Q6B A;  2JZ3 B;  4RGM A;  4CYE A;  2M0A A;  3MC8 A;  3PT2 B;  4EZK A;  5L83 A;  2V4I B;  2JZP A;  2O2V A;  4IUM B;  3GZN I;  4DWF A;  1YJI A;  1STE A;  1F2R I;  2WXI A;  5G5G A;  1S3S G;  1QF6 A;  3DWG C;  4K7S A;  4REZ A;  4YTP B;  2FAZ A;  4FUL A;  2LVP A;  1P0R A;  3DVG X;  3LDZ E;  4KV2 A;  3TEZ A;  1E7V A;  3BY4 B;  2N0S B;  1WYG A;  5CHF A;  1H4R A;  4DK5 A;  3T3O A;  3VH3 B;  3CF4 A;  2WLB A;  2XK5 A;  3VDZ A;  1UBQ A;  4BOZ B;  4IOI E;  2Y3A A;  3Q8E A;  1GAQ B;  2BT6 A;  2WXR A;  4K3B A;  4PS8 A;  1SSN A;  3AXC A;  1MPE A;  4NJ7 A;  3EHV A;  4USA A;  5BMI A;  3P4Q B;  2YEP B;  3L08 A;  4MEM A;  3R7Q A;  2PLP A;  3UIN B;  4RFB A;  1KTK A;  4KZ0 A;  5HI1 A;  1AWD A;  3B08 A;  1C79 A;  2N4F A;  3PTF C;  1WGH A;  3NS1 A;  1CZP A;  5D3I B;  2KOX A;  2LMC A;  3V6E B;  1ZE3 D;  2GB1 A;  2L8J A;  1P3Q U;  2J53 A;  5J17 A;  4GIV A;  3B9J A;  4A6Q A;  3CST A;  3RT3 B;  1FXT B;  2BPS A;  4IM2 A;  4P1C C;  4L23 A;  2KFK A;  5AUK A;  3M3J A;  1ZXI A;  2KHW B;  3UQB A;  4X57 B;  1E8X A;  2UU7 A;  3ZNI D;  2LGD A;  1HEZ E;  1NI3 A;  3P4R B;  2KX0 A;  3RN9 C;  4AS1 A;  1LXD A;  3Q3J A;  2KFJ A;  1D3Z A;  2NMQ A;  4J6I A;  3NZS A;  2GBK A;  5HKH A;  3NVZ A;  4FJZ A;  3FIL B;  3SFD B;  2KFK B;  2DX5 B;  3PRP B;  4C00 A;  4XDD A;  3SFE B;  2NPT A;  1JWS D;  2L1A A;  1EO6 A;  1MG8 A;  2UYZ B;  2Z0D B;  1WGG A;  3GE3 C;  2KN4 A;  5J18 A;  4KGS A;  3MP9 A;  3IG3 A;  3NHE B;  3ZNZ B;  1KLV A;  3AMZ A;  2LVQ A;  2KJ6 A;  4EFO A;  4GLS C;  2J7Q B;  3L10 B;  1WGD A;  3VR9 B;  4NJC A;  3ZIM A;  3SDL C;  2VZK B;  3KH0 A;  5DPR A;  1NBF C;  2MCN B;  4HWI B;  1XLP A;  3MJ5 A;  2CU1 A;  4NJ6 A;  1TS3 A;  2RDB C;  3V62 A;  2KTF A;  3GS2 A;  2N9K A;  4JX1 C;  4G0N B;  1YJJ A;  5BYS A;  3UGB B;  2D3C A;  2KMC A;  2IDY A;  2CJN A;  3ZTD A;  3ZXV A;  1K52 A;  1EWY C;  3WAM A;  4XZ4 A;  4W9H A;  1MVK A;  2KXJ A;  4YL8 A;  2C7M B;  4A3O A;  4PS3 A;  4N9F 4;  4MT5 A;  1V5O A;  4B0E A;  2LGI A;  1MHX A;  2D11 A;  3X23 A;  1J7A A;  3A9J A;  1FO4 A;  2LGX A;  3AI5 A;  3L17 A;  3PVL A;  4KIK A;  5IOI A;  3S2A A;  3N1Y C;  3ZKJ C;  3Q8B A;  1KF6 B;  2WDR B;  2M1M A;  5BYQ A;  1DOY A;  1RFK A;  4HDO A;  1JML A;  3AE9 B;  2RD0 A;  1XT9 B;  1TGZ B;  1GG3 A;  2K5P A;  3U7D A;  1WXA A;  1YN3 A;  4HPP A;  4M8M A;  2FUH B;  3A1Q A;  1L4Z B;  3NRZ A;  2EMT A;  2KDI A;  3W1S A;  1NYQ A;  2C7H A;  2J42 A;  4GB9 A;  4KDI C;  3TJP A;  4MSQ B;  1XCT L;  2K39 A;  2XN9 C;  1PUT A;  3RD2 A;  2JX5 A;  3R2I A;  5FR3 A;  3H9D A;  3P2B A;  1H8C A;  1WMH A;  4BKG A;  4A8X C;  1UNS A;  1WF9 A;  3KLS X;  2G9H D;  3I9V 1;  2MHJ A;  3Q2A C;  3SD5 A;  3VH4 B;  4FBJ B;  2RPQ A;  3R3M A;  1V80 A;  5AZH A;  1ACC A;  1BT0 A;  2WP9 B;  4ZRP A;  4FLH A;  4HXD A;  1FXA A;  4LCD E;  2JF5 A;  1TTN A;  3AEG B;  2NPT B;  4FN2 A;  4W9G A;  4WAF A;  1HZ6 A;  3TCA A;  4WAA A;  5JHB A;  2LXC A;  1JWM D;  4G11 A;  2KJR A;  3R66 C;  3CWI A;  3JSV A;  2HTH A;  4A9A A;  2QSD A;  2V3P A;  3W5U B;  1T0R C;  3QHT A;  1E6E B;  3TL5 A;  3W1S C;  4P1B C;  2L05 A;  2J52 A;  1HZ5 A;  2KAC A;  1JW9 D;  3Q3M C;  1PFD A;  3TSS A;  1ROE A;  4YWG G;  4FJY A;  1FM0 D;  3BVZ A;  1I4H A;  4WJP A;  2CU3 A;  3AE1 B;  1DOX A;  1S1Q B;  2BBC A;  2Z8L A;  4OZB A;  2BTE A;  2MQJ A;  1FD6 A;  1YMH E;  1AAR A;  4BKS D;  3MTN B;  1UZX B;  1H7W A;  2KNB A;  4LDT D;  3V05 A;  4PT5 A;  3BK1 A;  1L0V B;  3OWE B;  2NBW B;  2A4Z A;  2NCN A;  4ZRJ A;  1T0Q C;  2SAK A;  1QOF A;  1KRH A;  3BYY B;  4CHK A;  1K50 A;  2L00 B;  2KDB A;  1SE4 A;  4EEW A;  2MJD A;  2H89 B;  3N1X C;  1JWA D;  2L0F A;  3N30 A;  3AE5 B;  3QAQ A;  3VTW A;  2WU2 B;  4ZRQ A;  4HJK A;  1D4B A;  2I2Y A;  4MDK E;  5EE9 A;  3NVW A;  2PJH A;  1KH0 A;  4HRS A;  5JXV A;  4PS7 A;  2O6V A;  5AZG A;  1T0S C;  3N9Y C;  3RNB C;  4C56 C;  2W82 A;  1A70 A;  3GZN B;  4MGI E;  1R4N B;  1Y8R C;  1TS4 A;  4N58 A;  1X1M A;  2LHD A;  1WY8 A;  2V3S A;  3IXS A;  4PYZ A;  2JU6 X;  2WXM A;  4ZYN A;  4ACF A;  5MPO A;  2RGF A;  1C76 A;  1IBX B;  2EKI A;  1WX9 A;  2K3U A;  1QIL A;  5HG2 A;  5C1Z A;  1XXG A;  2LAS A;  1WXQ A;  4NAW A;  1QQR A;  3A1Q B;  2RSU A;  4OZC A;  3J9C A;  4WH4 A;  1LQB A;  2O6V D;  2G45 B;  2G4D B;  1HA5 A;  5G2N A;  1WJ6 A;  5AZF A;  1KJT A;  1GNU A;  4LLG M;  4DQO C;  2IY0 B;  3LB8 C;  3ZVV A;  4KIK B;  1VZ7 A;  2BYE A;  2KAN A;  2PE6 B;  3B2G A;  4MH0 E;  3ZNH B;  2JRH A;  3KUC B;  4HPM B;  1LFD A;  3A9J B;  4C7Y A;  3NS8 A;  1WGR A;  2WGS A;  1OEY A;  4RF1 A;  4EOY A;  1QKZ A;  3HHM A;  1WE6 A;  1R7S A;  2AQ2 B;  2WX1 A;  4MJS A;  2K8C A;  2K8H A;  1E7P B;  3JSV B;  4ZDV A;  1F2R C;  3WCQ A;  2AL3 A;  3C19 A;  2E6X A;  3V61 A;  4GDK A;  3AN1 A;  2IPK D;  4ANX A;  2V9H A;  3PRE A;  4DHZ E;  5H8Y E;  1GC7 A;  3WAO A;  2H88 B;  3NZU A;  1VD2 A;  2G1E A;  4MGK E;  1GOZ A;  4A90 A;  3BYT B;  1C4C A;  2Y5B B;  3X0W A;  2BS3 B;  3VUX A;  1G6J A;  2LXA A;  2INC C;  2HJ8 A;  4LK0 M;  3FIL A;  2KN5 A;  3V60 A;  3AH7 A;  5G5H A;  1J7B A;  2UWQ A;  3FKY A;  1WMH B;  2QCZ A;  2JYE A;  3FAH A;  3RNE C;  3VTU A;  1JQ4 A;  2M4N A;  4M0W A;  2N9L A;  3EA6 A;  1E0Z A;  1VZ6 A;  4KGT A;  3RUL A;  1XCQ L;  4G3X B;  2BKR B;  2LUE A;  2IY1 B;  1EUV B;  3UIP B;  3BZD B;  2J0M A;  1OTR B;  1TT5 B;  4HJG E;  1WH3 A;  2MX2 A;  2KDF B;  4BVU C;  3W2D A;  1FFU A;  3L13 A;  2GOW A;  1PGX A;  2GBR A;  3KUZ A;  4IKG A;  1IGC A;  4FJV B;  1L0X B;  1B1Z A;  2BGF A;  2LGY A;  4PYU A;  3T3N A;  1NDD A;  3K9P B;  2GLS A;  3RUI B;  3QCA A;  1V1P A;  4NZL B;  4KGR A;  1RM6 C;  2GI9 A;  3ZLZ A;  1CMX B;  4IWP A;  4WQM A;  1FEH A;  5AUI A;  1IUE A;  2DLB A;  4W9J A;  2FID A;  3A4S C;  5LXH A;  4AWJ A;  3W9C B;  1UWM A;  2OJR A;  4XC2 A;  3EFC A;  5FKA C;  2KC1 A;  2WHI A;  3U2S C;  1T6B X;  4W9E A;  2RMM A;  2KTR A;  4YT0 B;  5EE0 A;  3KWV A;  2I1J A;  3WIM A;  4S0R A;  2FCS A;  4E74 A;  3A4R A;  2MBO A;  4OVU A;  2W55 A;  4KSK C;  1WXS A;  4TUU A;  2YVC A;  2BVC A;  3ETR A;  2OHF A;  3H6N A;  4AOF A;  1NVI D;  3PO0 A;  3DBL I;  4FA6 A;  3CSF A;  2K22 A;  3OJ3 A;  4US8 A;  4TV3 A;  2ZJD A;  2JXT A;  2WS3 B;  4JQW C;  1C4P A;  1TY2 A;  4HRO A;  1OQR A;  2L7R A;  5BO4 B;  2ZVN A;  2K1F A;  1SEB D;  1ZDV A;  3PV1 A;  1C4A A;  3PSE B;  5KHO A;  1IBX A;  4RMA A;  1GB4 A;  2V1Y A;  4LTU A;  4F1S A;  3JVZ X;  2Z59 B;  3T8M A;  4G50 A;  4NAW B;  1FMA D;  2K25 A;  3OAW A;  2FE8 A;  2KMA A;  3Q3O C;  4RGN A;  4W9F A;  1QLB B;  1ISN A;  2WXP A;  4S17 A;  2NBV B;  1GTH A;  5EE3 A;  1H7X A;  2M17 A;  4JL9 A;  3JW0 X;  2ZCC A;  3GE8 C;  1KLG D;  4BAX A;  2VH1 A;  2KWV B;  4IC7 B;  4HVB A;  2AX5 A;  3ZGZ A;  2ZNV B;  2JVC A;  2BYF A;  3UIO B;  3QWZ B;  3ZJT A;  2RR9 A;  2SEB D;  4KSL C;  1C3T A;  4KX6 B;  3AM9 A;  4HEA 1;  3AU5 A;  1V6E A;  4GXB A;  1E8W A;  1AYF A;  2NS5 A;  4WWO A;  1UGJ A;  3N1Z C;  3HRD D;  4LNI A;  2KKC A;  2RDH A;  3A33 B;  4XGA B;  1SF0 A;  3APF A;  2IND C;  1YX5 B;  2JWZ A;  1U4A A;  4II3 B;  4EE2 A;  3ENE A;  1RLF A;  1EM7 A;  1I7H A;  1LO5 D;  5CTR C;  3HUI A;  5LNK 1;  3NVY A;  1E8Z A;  1TS5 A;  1FNW A;  3LXF A;  2VRR B;  2DBY A;  4DDG D;  1QOB A;  4RM8 A;  3DBL B;  1YOV B;  3ZYY X;  3RFZ B;  3AEA B;  5DCN A;  4AJY B;  2WNM A;  1WX8 A;  3DVN V;  2LEK A;  2L32 A;  4AP4 C;  4N59 A;  1Y56 A;  1Q0W B;  1T5X D;  3K9O B;  1WWT A;  2AL6 A;  2JXX A;  1QOG A;  3B2F A;  3L4P A;  3SEB A;  2IO1 B;  1Z5S B;  3OJ4 B;  2CHW A;  5IO9 A;  1TZO A;  1TKE A;  1V9J A;  2AWT A;  2VH2 A;  3ZDM C;  3EC8 A;  2AQ3 B;  1OFF A;  5LLI A;  1FFV A;  4FHK A;  2KDE B;  1UEL A;  3RPF C;  3ZW3 A;  4JWS C;  2MSE D;  2VZK D;  1N5X A;  1ZP0 B;  4RGO S;  2JY6 A;  2M0X A;  1N61 A;  1WI0 A;  1JRP A;  2L3Z A;  4XX5 A;  3M95 A;  2JUO A;  2K6Q A;  2AEH A;  3ZQ4 A;  2DNF A;  1WZ0 A;  1HE8 A;  3VRA B;  4ZHP A;  1FCL A;  3VUW A;  4XDC A;  4DXA B;  3PHX B;  2B3A A;  1T3Q A;  1UUP A;  4IM0 A;  1JWU D;  2D3G A;  1F77 A;  4GDL A;  3MC0 B;  2KQS A;  4URK A;  1N62 A;  2IBI B;  3T9L A;  3BK2 A;  1SJH D;  4H2A A;  1KM7 A;  2R2Q A;  1D5X C;  2ZPN A;  2ZEQ A;  2JRI B;  3UQA A;  1AW7 A;  3VRB B;  2Z0E B;  4WUR A;  2RPV A;  1Q1O A;  3KWL A;  1M94 A;  4IG7 B;  2ONQ A;  3IVF A;  1WRI A;  3CIR B;  4JLC A;  4QAY A;  3PHW B;  3C0R B;  2Y5C A;  3BVM A;  4TQ1 A;  1V5T A;  3KVF B;  1I42 A;  3DDC B;  5E6P A;  1YD8 U;  2MBB B;  2N9E B;  5DPS A;  1WGY A;  4JIO U;  2BYV E;  1L6U A;  1XO3 A;  3AEE B;  5D6J B;  3ZUN A;  4MAC A;  2X38 A;  2V0G A;  2LRW A;  1OEY J;  3IT6 B;  1XQQ A;  2C60 A;  2LWP A;  1Z2M A;  4HDQ A;  5H92 C;  3AED B;  2JZZ A;  3IT4 B;  4PK1 A;  3H1U A;  3QC8 B;  4MEL A;  4HLE A;  3Q8A A;  1R4M B;  1FCC C;  2KQ7 A;  3P1M A;  4AUQ C;  3TEY A;  3WAP A;  3AE2 B;  3FC4 A;  3C8Y A;  1J19 A;  1T0Y A;  1SGH A;  1DYQ A;  2KDM A;  4K3C A;  4KVG B;  4XWW A;  1WSP A;  2DAJ A;  5TSS A;  4A55 A;  2GBM A;  2BW2 A;  3AUL A;  5EDS A;  4FHJ A;  1P9D U;  4B9K A;  3DHI C;  4ZRI A;  5BMG A;  1QT9 A;  1R4N I;  1SIF A;  2L76 A;  5I4D A;  1CQV A;  2N1W A;  5IN7 A;  3LJ3 A;  3DOW A;  1JAL A;  3H8H A;  4NY0 A;  3PLV A;  4KZC A;  1GB1 A;  5CX3 A;  4IW0 A;  4M0W B;  2CHX A;  4ZYS A;  3QAR A;  2LHE A;  2PMV A;  1VR9 A;  3N32 A;  4OZA A;  2MBE A;  3KW5 B;  2LD9 A;  5TR5 A;  2LZ6 A;  3U52 E;  1V8C A;  1V86 A;  3PLU A;  2LJ5 A;  1Q10 A;  2QIE B;  1TIF A;  2HD5 B;  1XLO A;  2MJ3 A;  2I38 A;  5JZE B;  2G3Q B;  4ANV A;  2MW5 A;  1FRD A;  4DHJ D;  2DYB A;  3ZRC A;  4XE0 A;  3DBH I;  4GN1 A;  2PIA A;  1JRO A;  3QIJ A;  1I4Q A;  2LGS A;  2INN E;  4B6W A;  1E5W A;  3EFU A;  3UF8 A;  1SXT A;  4YSY B;  4I6N B;  3TMP B;  1WM2 A;  2XK5 B;  3VTV A;  3AU4 A;  2XBB C;  2BB5 A;  1OQY A;  4ARC A;  4GOC A;  1GJZ A;  2BS2 B;  4EKU A;  3V6C B;  1L2N A;  2IO0 B;  3AE3 B;  3W1Y A;  4RCO A;  1IYF A;  3V3X A;  4C4V B;  3AE8 B;  4DBG A;  3VR8 B;  2ZCB A;  4I6P A;  3BII D;  4LNF A;  1R4M I;  3QA8 A;  2IO3 B;  1WM3 A;  1PGA A;  3ML8 A;  4OHJ A;  2G4S A;  4GMV A;  1EWC A;  2EEL A;  2WDT B;  2OED A;  2E3T A;  5FR6 A;  2A5U A;  2JYT A;  1UGM A;  3ZJU A;  4WWM A;  1GT8 A;  1YN5 A;  2FUG 1;  5D7G A;  3IAM 1;  1L6V A;  1WFY A;  1ET9 A;  2WXK A;  3DHH C;  4HCN B;  2AYO B;  2BWE S;  3EUB 2;  4E71 A;  2WXQ A;  2V4L A;  1QOA A;  2N9P C;  2WXN A;  1EU3 A;  4WJO A;  3DBS A;  1N63 A;  1EF5 A;  3RNG C;  1YQ4 B;  4YXD B;  2D10 A;  4GGQ A;  2DZK A;  3MC9 A;  4XWT A;  2ON8 A;  2HJ1 A;  5C23 A;  3DBR B;  4K81 A;  4C80 A;  4CQN A;  1XLN A;  4RNA A;  2CR5 A;  1GTE A;  1TKG A;  3AV8 A;  3KYD D;  5IA7 A;  1DGJ A;  2FCQ A;  2O6V B;  4ANW A;  3VVW B;  2WU5 B;  1P7E A;  1M4V A;  4F7Z A;  2XNA C;  1ET6 A;  2N7J A;  1LGR A;  3Q69 A;  5J2R A;  3NVV A;  2ZVO A;  3PRM B;  1XF5 L;  3EEC A;  3R7R A;  4D2K A;  2FCN A;  3VAW A;  4NAM A;  1N6Z A;  2KWC A;  4XYC A;  4C4V A;  4DXF A;  2GMI C;  1P7F A;  2MH7 A;  4BZA A;  2W3R A;  2N1V A;  2YEP F;  4CO7 A;  2WXL A;  5GXG B;  4HPL B;  4WQO B;  4RF0 A;  3AE7 B;  2IGG A;  3AB5 A;  3H7P A;  2CS4 A;  3DVN U;  1WR6 E;  1TBE A;  5CHW A;  1F0Z A;  2QIL A;  4W9D A;  5IKC M;  1UH6 A;  2LI5 A;  3NY5 A;  3U7Z A;  2ACZ B;  2DWQ A;  3ZRF A;  3KUD B;  3VHT C;  4RGT A;  1HXY D;  4TSS A;  2XEW A;  3PZ7 A;  2GBJ A;  1BML C;  4ZRK A;  1MI0 A;  5JH5 C;  1V1O A;  3VFK A;  3Q3N C;  4KKJ A;  5IAA C;  3Q8C A;  4US9 A;  4WJQ A;  3ABV B;  3P42 A;  3WA0 A;  2JWU A;  2D3B A;  1NEK B;  2M8S A;  2DHZ A;  2KAJ A;  2M19 A;  3I57 A;  4EZJ A;  2CHZ A;  4J3O D;  5E6N A;  2AQ1 B;  1WJU A;  1YNT E;  1WRD B;  2KQ4 X;  1XEE A;  2M56 B;  2K6D B;  3NOB A;  2IJ0 A;  1TY0 A;  3PZ8 A;  3U4E G;  1V97 A;  1ENF A;  3AEB B;  3RMK C;  2FIF A;  3I3T B;  3VQI A;  2NR2 A;  1AN8 A;  4TKN A;  1RFA A;  2C5L C;  1PYW D;  2R61 A;  4OVV A;  2DYO A;  4ARI A;  1ZKH A;  3N3K B;  5AEK B;  3URY A;  2FCM A;  2YLM A;  1ZPS A;  4BBN F;  3AE6 B;  4RH6 A;  1XLQ A;  2QDF A;  1E90 A;  2BWF A;  4KKI A;  2Y5P A;  2WWZ A;  4NPN A;  4DDI D;  3H7S A;  2QJL A;  1SE3 A;  5KHQ A;  4GU2 A;  2ZW1 A;  1K53 A;  1VZ8 A;  1FRR A;  1Q5W B;  4OVZ A;  2BF8 B;  1ZUD 2;  2DZJ A;  2MBQ A;  3BIN A;  3P4P B;  3MHZ A;  3NZ3 A;  1GPX A;  1PQS A;  4L1B A;  4BBN C;  4K1R B;  1MJD A;  4R3D A;  2IYD B;  1WJ4 A;  3EGR A;  3TUO A;  1BXT A;  2MA9 B;  2HE7 A; 
#chains in the Genus database with same CATH homology
 1N60 A;  1JWA D;  1T3Q A;  3AE5 B;  5FK9 C;  1UUP A;  1JWU D;  3W5V B;  2WXH A;  2BYT A;  4YTM B;  2WU2 B;  4ZRQ A;  1F77 A;  5C2T B;  1D4B A;  3MC0 B;  2I2Y A;  3BWU D;  4L2Y A;  1N62 A;  3NVW A;  5EE9 A;  1KH0 A;  4HRS A;  5BYR A;  5JXV A;  3BK2 A;  1SJH D;  3N9Y C;  4UDU C;  1TYG B;  4H2A A;  4C56 C;  2W82 A;  1A70 A;  2NTS A;  1L5P A;  1TS4 A;  4N58 A;  3BVG A;  1D5X C;  2LHD A;  3IXS A;  2JU6 X;  2WXM A;  4GDL B;  4ZOH C;  1HQR D;  5MPO A;  1AW7 A;  1CJE A;  3VRB B;  1C76 A;  1IBX B;  2EKI A;  1I4X A;  2ZW0 A;  4O1N A;  2K3U A;  1QIL A;  4WUR A;  5HG2 A;  2RPV A;  1XXG A;  1WXQ A;  3IAS 1;  1QQR A;  3KWL A;  4OZC A;  2ICI A;  2ONQ A;  1WRI A;  3CIR B;  4YSX B;  3J9C A;  4WH4 A;  1NEN B;  4DXG A;  2PTL A;  3HVZ A;  1HA5 A;  4FXC A;  2Y5C A;  3BVM A;  2PVO D;  4LLG M;  4DQO C;  2J4X A;  1SJE D;  4TQ1 A;  1ZXH A;  1PDX A;  1SB3 C;  3LB8 C;  4RGM A;  2M0A A;  3LYY A;  2D5G A;  3AEC B;  1RWS A;  1IGD A;  3GB1 A;  2V4I B;  2JZP A;  1VZ7 A;  2WXO A;  1C77 A;  3B2G A;  1L6U A;  1XO3 A;  1YJI A;  1STE A;  1F2R I;  3AEE B;  4AQ7 A;  2WXI A;  3KQ4 A;  4MAC A;  2X38 A;  5G5G A;  2V0G A;  1C78 A;  4C7Y A;  2INP E;  1QF6 A;  3DWG C;  4REZ A;  3IT6 B;  4YTP B;  2V3N A;  5EE1 A;  5H92 C;  3AED B;  3TEZ A;  3IT4 B;  2RDG A;  2LUM A;  4RF1 A;  1QKZ A;  1OQQ A;  2N0S B;  1R7S A;  1VRA B;  2AQ2 B;  1WYG A;  3Q8A A;  2WDQ B;  1E7P B;  4WIP A;  1FCC C;  1F2R C;  1FIQ A;  3P1M A;  3T3O A;  3WCQ A;  3TEY A;  2E6X A;  3AE2 B;  4YSZ B;  3CF4 A;  3FC4 A;  3AN1 A;  2WLB A;  3C8Y A;  2IPK D;  3E56 A;  5BMH A;  2KDM A;  1DYQ A;  2GRI A;  4XWW A;  2L83 A;  4IOI E;  1WSP A;  5H8Y E;  5TSS A;  4B0M A;  4A55 A;  2Y3A A;  3Q8E A;  1GAQ B;  2BT6 A;  2BW2 A;  2WXR A;  2H88 B;  1SSN A;  3R2T A;  1MPE A;  2G1E A;  1GOZ A;  4A90 A;  3BYT B;  5BMG A;  1C4C A;  4USA A;  1QT9 A;  3P4Q B;  2BS3 B;  2WDV B;  5BMI A;  2YEP B;  1CQV A;  1JWB D;  5I4D A;  2PLP A;  1JAL A;  3H8H A;  1L0Y B;  3FIL A;  4LK0 M;  4RFB A;  1KTK A;  3AH7 A;  3NUH B;  5HI1 A;  2HDE A;  1AWD A;  5G5H A;  1GB1 A;  4TMA B;  1J7B A;  3FAH A;  1C79 A;  2JYE A;  1JQ4 A;  3TEW A;  2MEK A;  4M0W A;  1SIJ A;  2N9L A;  4ZYS A;  4HKQ A;  2LHE A;  2PMV A;  1VR9 A;  2WXF A;  3EA6 A;  3NS1 A;  1CZP A;  4OZA A;  1E0Z A;  1VZ6 A;  4KGT A;  4MM3 B;  2LMC A;  5D3I B;  1RYJ A;  4C7Z A;  1XCQ L;  1I4R A;  1ZE3 D;  3U52 E;  1V8C A;  1TJE A;  2GB1 A;  5HHD G;  1Q10 A;  2J53 A;  2QIE B;  1SBB B;  1XLO A;  2MJ3 A;  3B9J A;  1J7C A;  2JSV X;  2MJE A;  1N5W A;  2I38 A;  3TEX A;  4A6Q A;  1D6E C;  3BZD B;  4HJG E;  4L23 A;  1FRD A;  5AUK A;  1ZXI A;  1YQ3 B;  4TQ0 A;  4XE0 A;  2WXJ A;  2PIA A;  1JRO A;  1HEZ E;  1NI3 A;  3P4R B;  2PVG C;  1I4Q A;  2INN E;  4AS1 A;  3W2D A;  3MFG A;  3O13 A;  1FFU A;  1TKY A;  1PGX A;  4IKG A;  1SXT A;  4YSY B;  2NMQ A;  1IGC A;  2JQR B;  1L0X B;  2QMT A;  1B1Z A;  2BB5 A;  3NVZ A;  1C9F A;  3T3N A;  4ARC A;  3FIL B;  2IGH A;  3SFD B;  2BS2 B;  3HVD A;  4YTN B;  3AE3 B;  1V1P A;  4RCO A;  1VJK A;  2LFI A;  3V3X A;  4NZL B;  4XDD A;  3AE8 B;  4KGR A;  3SFE B;  1RM6 C;  2GI9 A;  1JWS D;  2L1A A;  3VR8 B;  4WQM A;  5AUI A;  1FEH A;  5HFY A;  1IUE A;  2DLB A;  3BII D;  2K9X A;  1VLB A;  2KN4 A;  3W9C B;  4KGS A;  3MP9 A;  1PGA A;  1UWM A;  4OHJ A;  5FKA C;  2NTT A;  3AMZ A;  3U2S C;  1T6B X;  2RMM A;  1EWC A;  4YT0 B;  4GLS C;  2EEL A;  3VR9 B;  1FXI A;  2E3T A;  2OED A;  5EE0 A;  3KWV A;  4NJC A;  2WQY B;  2VZK B;  3DWM A;  2JYT A;  3ZJU A;  1XLP A;  4WWM A;  2WXG A;  1GT8 A;  1YN5 A;  3MJ5 A;  2FUG 1;  2W55 A;  5D7G A;  3IAM 1;  1L6V A;  1ZOY B;  1TS3 A;  3GS2 A;  2N9K A;  2WXK A;  1ET9 A;  4JX1 C;  3ETR A;  1YJJ A;  2OHF A;  5BYS A;  1NVI D;  2W54 A;  3PO0 A;  4IDI A;  2IDY A;  2K22 A;  2CJN A;  2BB6 A;  3EUB 2;  4US8 A;  1K52 A;  2WXQ A;  1EWY C;  1E10 A;  1MVK A;  2JXT A;  1QOA A;  2WS3 B;  1C4P A;  1TY2 A;  4HRO A;  3AE4 B;  1OQR A;  1KLU D;  2LJI A;  4MT5 A;  4B0E A;  2WXN A;  4ITK A;  1EU3 A;  1SEB D;  1ZDV A;  2LGI A;  3GP7 A;  4HKZ E;  1UWX A;  1MHX A;  1EU4 A;  1C4A A;  1N63 A;  1J7A A;  1B9R A;  1L4D B;  2B76 B;  1YQ4 B;  1FO4 A;  3ZJV A;  4GDK B;  4YXD B;  1IBX A;  4XWT A;  2ON8 A;  3Q8F A;  1GB4 A;  4C80 A;  4CQN A;  4LTU A;  1XLN A;  4RNA A;  1MHH E;  1D5M C;  1GTE A;  4NAW B;  3Q8B A;  1FMA D;  1TKG A;  3AV8 A;  1DGJ A;  2FE8 A;  4RGN A;  1KF6 B;  4ZHO A;  1QLB B;  2WU5 B;  2WDR B;  1P7E A;  2WXP A;  5BYQ A;  1DOY A;  1RFK A;  1M4V A;  1JML A;  3AE9 B;  3P4S B;  2XNA C;  1ET6 A;  2N7J A;  2BS4 B;  1K51 A;  1PGB A;  1GTH A;  4OW0 A;  2K5P A;  5EE3 A;  1H7X A;  3Q69 A;  1YN3 A;  3NVV A;  1XF5 L;  4D2K A;  1L4Z B;  3R8B A;  4NAM A;  1KLG D;  3NRZ A;  3W1S A;  1NYQ A;  2J42 A;  2AX5 A;  3E9S A;  3ZGZ A;  2PW9 A;  5D3D A;  4DXF A;  1P7F A;  2MH7 A;  2CJO A;  2W3R A;  2YEP F;  1XCT L;  2WXL A;  5GXG B;  2XN9 C;  4RF0 A;  3ZJT A;  1CK1 A;  2SEB D;  2KWD A;  4KX6 B;  3AM9 A;  1PUT A;  4HEA 1;  5T8I A;  2JX5 A;  3AE7 B;  2IGG A;  2IGD A;  3AB5 A;  2PKO A;  3R2I A;  5C3J B;  1AYF A;  2HTM E;  1UGJ A;  5FR3 A;  4P6V F;  3HRD D;  2Q5W D;  2RDH A;  1F0Z A;  1SF0 A;  2QIL A;  4A8X C;  2FBW B;  1UNS A;  3U7Z A;  2ACZ B;  2G9H D;  2DWQ A;  3I9V 1;  3KLS X;  4N6E B;  4EE2 A;  1EM7 A;  4Q2J A;  1I7H A;  1HXY D;  1LO5 D;  1ACC A;  1VDV A;  4RGT A;  4TSS A;  3PZ7 A;  2WP9 B;  1BML C;  4ZRP A;  3HUI A;  5LNK 1;  3NVY A;  1MI0 A;  1TS5 A;  2W3S A;  1FNW A;  1E9M A;  1TS2 A;  1V1O A;  3LXF A;  4P16 A;  1FXA A;  1I4G A;  3UI3 A;  1JCK B;  4KKJ A;  3AEG B;  1DOI A;  3Q8C A;  2K0P A;  2DBY A;  4US9 A;  1QOB A;  4WAF A;  1HZ6 A;  3ABV B;  1NYR A;  3P42 A;  2JWU A;  4JE3 B;  1NEK B;  2KAJ A;  2M19 A;  3I57 A;  3ZYY X;  3RFZ B;  4J3O D;  3AEA B;  1JWM D;  2AQ1 B;  2WNM A;  1FNV A;  1YNT E;  2LEK A;  3CWI A;  2L32 A;  2KQ4 X;  1XEE A;  2M56 B;  5E6J A;  4N59 A;  1Y56 A;  4A9A A;  4JWU C;  2IJ0 A;  1TY0 A;  3PZ8 A;  1KFY B;  1T5X D;  1V97 A;  2QSD A;  1D5Z C;  1ENF A;  3AEB B;  2V3P A;  3U4E G;  3W5U B;  1E6E B;  1WWT A;  1YN4 A;  2J52 A;  1HZ5 A;  2KAC A;  1JW9 D;  1BUI C;  3VQI A;  4MH8 A;  1AN8 A;  1QOG A;  2TSS A;  3B2F A;  1PFD A;  3L4P A;  1ROE A;  3SEB A;  3TSS A;  4YWG G;  1PYW D;  2R61 A;  1TZO A;  2DYO A;  2KMM A;  1TKE A;  4ARI A;  1FM0 D;  1ESF A;  4JPS A;  3BVZ A;  3URY A;  1I4H A;  1ZPS A;  3AE6 B;  4RH6 A;  2CU3 A;  1XLQ A;  3AE1 B;  1ZDX A;  1SE2 A;  1FNU A;  3P63 A;  2AQ3 B;  4KKI A;  2Y5P A;  1OFF A;  1WGK A;  3SR6 A;  1DOX A;  1FFV A;  2BBC A;  2QJL A;  1I4P A;  1SE3 A;  2Z8L A;  4OZB A;  2BTE A;  2DYM A;  1YMH E;  1FD6 A;  3RPF C;  1K53 A;  1VZ8 A;  2ZW1 A;  2VZK D;  1FRR A;  4JWS C;  1N5X A;  1ZP0 B;  4RGO S;  1H7W A;  3V05 A;  1N61 A;  4PT5 A;  3BK1 A;  1L0V B;  1JRP A;  2QEJ C;  1ZUD 2;  1V1P B;  3OWE B;  4OVZ A;  3ZQ4 A;  3P4P B;  3MHZ A;  3NZ3 A;  1GPX A;  2SAK A;  1QOF A;  1KRH A;  3BYY B;  4L1B A;  3VRA B;  1K50 A;  4R3D A;  4ZHP A;  1FCL A;  1SE4 A;  3EGR A;  2MJD A;  1BXT A;  3TUO A;  2L52 A;  4XDC A;  2H89 B;  3AEF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...