3AE5C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-methyl-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Methyl-N-(3-isopropoxy-phenyl)-benzamide
rcsb
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae5C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae5C02
2H88C 2WQYD 2WS3D 3AEBC 3AEAC 2WDQC 4YSXC 3AE2D 4YTMC 5C2TC 3VRAC 2WDRC 1E7PC 1PV3A 3P4SD 1OW8A 3P4QD 5C3JD 1ZP0C 4YSZD 3AE7C 3VRBC 2WP9C 2WU5C 3SFDC 1ZOYC 1NENC 2B76D 3SFED 4YT0D 3AEGD 3AEDD 3VR8C 3AE6D 3AEDC 3VR8D 3AE8D 4YT0C 3ABVD 2BS3C 2WS3C 3SFEC 4YXDC 1OW6A 1YQ3C 1KFYC 4KX6D 3AE9D 4YTNC 1NEND 4YTND 3AEFC 2BS4C 3VR9D 1KFYD 1YQ3D 3AEFD 4KX6C 1ZP0D 3B71A 4YXDD 4YTMD 3P4SC 3AEBD 4YSXD 2FBWD 5C2TD 2WDRD 2H89C 2WDQD 3AEAD 1KTMA 3P4RD 3AEED 2WQYC 2H88D 3P4PD 3SFDD 4YTPC 1ZOYD 2B76C 2WP9D 1K05A 2WU5D 5C3JC 3AECC 3P4QC 1K04A 3ABVC 4YSZC 3AECD 3VRAD 3AE8C 3AE7D 3VRBD 1L0VC 3AE6C 3CIRD 3AEGC 3AE4C 3AE1D 3AE5C 1KF6C 4YSYC 3AE1C 2WDVC 3AE3C 4YSYD 2BS2C 3AE3D 1L0VD 3AE5D 1KF6D 3AE4D 2FBWC 1YQ4C 1NEKD 1OW7A 2ACZC 3CIRC 2WU2D 1QLBC 2G3AA 1YQ4D 2ACZD 1NEKC 3S9OA 3VR9C 2WU2C 3P4PC 4YTPD 3AE9C 3AE2C 2WDVD 3P4RC 2H89D 3AEEC
chains in the Genus database with same CATH superfamily
1RF0C 2WPSA 2KI7B 2QA4P 1BE3G 2ZFYA 2R5DA 2KSEA 2B88A 1ZW0A 1NTMJ 1HUCA 3BRTB 1S2EA 1NTZJ 1KB9E 4DDIA 2BCCD 2FYZA 3EWKA 5KAIE 1BGYJ 1SQXK 3L36A 1JTHA 1S9KE 2YNYA 1JY3P 2VRSA 4W7ZA 1YBKA 2E75B 4KX6D 2QRXA 3AEFC 1ZMEC 4OGQD 3MTUE 1BGYG 3L74D 5GTHH 3H1IJ 1EDLA 4YXDD 1URQD 2Y0DA 1DIPA 1OZHA 3USSA 2WPQA 2WDQD 1SFCD 1ZV8A 1T2KD 3WU2H 3G6EP 1LP1A 1RE4C 1ZOYD 4LGDE 1JMBA 1J1EC 3TDKA 2K3RA 3H32B 1N7SD 3WU2E 2YMKA 2BCCE 3GG2A 1X22A 2KSJA 1T2KC 3L70E 2HFED 5AW3B 3HTKB 3CWBJ 2N1TA 3BATA 2QEXP 3M91A 2JO1A 3PTZA 2H89D 1SQVK 4PD4D 2IZ0A 1VQ5P 2NPSD 3TGUD 5GTIH 3C9IA 3EFGA 1GL2A 2HR3A 4OWFA 2XU6A 4JYCA 3RK2B 1XTGB 2WSFJ 5TISE 4RKUJ 1H0TB 1L0LD 2A45H 1VQ6P 4YT0C 1LTJA 5APYA 1XTCC 2HYNA 1KQGB 2K9YA 3M0DA 3AEFD 4KJMA 1AV1A 2J5UA 2O1KA 4DT0A 5L8RJ 3D70A 2AEMA 5AVQB 3E1IA 5AW9B 2H88D 1GL2B 3A3YB 3H1ID 1OIPA 5AW5B 2K88A 3RK3E 2L5GB 5CCHA 1LT9A 5C3JC 3P4QC 2QVAA 1FZAA 5CCGC 4U3FD 1BE3J 2WT7B 1VQ8P 4YSYC 1QEXA 1BDCA 1QVFO 2ZXXA 2BS2C 3E7KA 2Q6QA 1KF6D 3ZDMA 4H44B 1DEBA 4D6TD 1IC2A 1NEKC 1FZCA 2Q9IA 1YITP 3CWBD 4WY4C 4C46A 1GTWA 3E1RA 3GHGA 1LP1B 3AEAC 2V4HA 3B5NB 2Z4EA 4KT0J 3GHGC 1HTLC 1HWTC 1UIIA 3H1IG 5KLVD 2WU5C 1EXJA 3I55P 2FFDC 1PP9J 1R5SA 1M57D 1RQUA 3U1CA 4IFMA 1Q81Q 1KZUB 2P2UA 5B66E 1NHLA 2Z5HA 3Q5SA 2OARA 4LLHA 1N73B 4ZMDA 4GT1A 2A06D 5KJ7A 1ZP0D 3WUTA 3VN0A 3CWBG 4U7JA 4OVNF 2A06G 3L70G 2H89C 1KILC 3CCJP 1SS1A 4IFFA 3G4SP 2A45I 3L70D 2KYVA 3AECC 3L72D 3ABVC 4EI2A 1CI6A 4M3LA 3B5NA 2AXCA 1RY3A 2QSIA 3CX5D 2PAJA 1JB0J 1QVGO 4C7NA 3M0AA 2E5YA 2B87B 3M06A 2Y9YA 1L0NK 1YI2P 2FYUD 5CJ0A 2WU2C 1L0LK 5KTBA 1OVRA 2GM4A 4BWNA 1SQQE 2FYUG 2H88C 2V7QH 1FBMA 1LT9B 3CWBE 2W27A 1CW5A 2ZVNB 3HE4B 2PGDA 5CBNA 1U7JA 4YXWH 1KFNA 1LTJC 4HH2A 4BXLA 1KFYD 3MUDC 3HUSA 2HODA 2KZJA 2NPSA 3B71A 3H1IE 1M7LA 2JDIH 4C7RA 2YO2A 1X8YA 3G71P 5EFWB 1BGYE 3SWFA 2D2CC 2WPVB 5KLIC 2LR2A 3NMDA 1SQVG 3RK2D 1JEKA 2XV5A 4PJ0H 1L0VD 3AE5D 1X9VA 3MHVA 2OTLP 2ACZC 3H1HD 1EDJA 1YQ4D 2YKOA 1NTKJ 1E5WA 2WDVD 2E76B 3AEEC 1KILD 3V2RA 1VF5D 2E5TA 3CI9A 1PGOA 1RF0A 1SP4A 1AQTA 1ZP0C 3PH0A 4PD4H 3AE7C 3WUUA 3RL0B 1LWUA 3N7NA 2JP3A 1YYCA 1AA0A 3RK2C 1NAYA 2ZYDA 3VONA 4GKGA 1KB9I 3AEDC 5AW0B 4H0LC 5APXA 1W5CE 3PRJA 4TT3H 4DDGA 4Z1MH 1S5LE 3VR9D 2E75D 1YIJP 2IPPA 4L76A 4WVZA 3D71A 3H1LE 1FZBA 1PPJG 1AJYA 3L71E 3WUVA 3AEBD 1K9MQ 4IFDK 1RE3A 2FBWD 5C2TD 1JY2O 3AEAD 3BRVB 4AYCA 1GU5A 2MKVA 3BASA 1RQVA 2WSCH 4JF7A 3PHLA 3V6IA 3IFMA 2CK3H 5E79E 1T3JA 2FYUE 5B5EE 1GMJA 3GMAA 4I2LC 1NTZE 1NTME 1VL2A 1P84D 2W6BA 1FDOA 1VQPP 3P4PC 2B9BA 2H7HA 1GW3A 2YMYA 4IOIH 1KQLA 4YTMC 3JCUH 3GHGB 3D6YA 2WP9C 3SFDC 1EZVD 2YXRB 2HODB 3L74J 4WY4A 2ITAA 3WMM0 2WSCJ 2IYPA 1D7MA 1SQBD 1NO4A 2L91A 3I56P 3ABVD 3CXHH 2ZJSE 4NPEA 1VQNP 2QJYB 2WT7A 1BE3D 3LW5H 1NAFA 1LT1A 1AFOA 1DH3A 1IZNB 3CC7P 3KZIE 3H1KE 4XE5B 1SQQG 2AXTE 1PPJE 1QL2A 1FZCC 4PV1D 4EYYQ 3H25A 3RL0g 1Y47A 1NVOA 1FU1A 4HYTB 2WSFH 3O6QB 1EZVE 1EZVG 2FFDB 3H1LJ 2KNCB 2YO3A 3AE8C 1KD1Q 1RF1A 3AE1D 1EDKA 1KQFB 1JUNA 1IJDB 5CCGD 2N9BA 1NKNA 1L4AC 2NZ2A 5APUA 1JM0A 4AUWA 3RBXA 2J59M 4U3FE 3L4FA 3AE2C 5KAFH 2IDBA 1Q90D 2J58A 2WDQC 1T3UA 5C2TC 2WDRC 1URQC 2LXBA 1OW8A 1VDFA 2N1TD 1BSHA 5GTHE 1IFDA 2W6JH 2AXTH 3I5CA 1NGMB 2KS1A 1NENC 1NTKE 1S3JA 2ZXEB 5KKZC 2BEQD 4A7PA 2G8YA 1DD3A 1S5LX 2GA1A 3UIAA 3AEDD 3VMAA 4DOJA 3CCMP 4ZKUA 1GL2C 4H44C 1OW6A 2E75C 3TSIA 3CX5H 1EXIA 1P84I 1CI6B 3II6A 1FE6A 1JMMA 5AVYB 2QJKC 2XNDH 1JY2N 1HVVA 3L72E 2Q7CA 1URQA 2WMMA 5CCHD 2KNCA 5APQA 2R3CA 3AEED 2Y9ZA 3FXDA 1LWUB 3H1HG 2B76C 1KILA 3CC4P 1BCCJ 3LIDA 1PIXA 3TNUB 1DX7A 3IAOA 3GF7A 2A06E 5AVXB 1Q7YQ 3L71J 1H8AA 2IBZI 2RN0A 3AE5C 3H1JG 1N7SB 1KF6C 1OFCX 4HB1A 2BASA 1WRGA 3CCLP 2P1JA 1LTTC 2FYNC 1HJBA 1NTKK 5KLIB 2ACZD 2P58A 1ZLLA 3EQ2A 1GL2D 1QLED 5KLVE 2FYNB 2XZRA 3VRAC 4H13C 3IN6A 1OWAA 5AVTB 4DHZA 2O3JA 2QM8A 1S1CX 2C0WA 2I1JA 4ASWA 2B76D 1JY3O 3RBZA 1JO5A 3RL0C 1W2EA 1P84H 2R32A 3SFEC 4D6TE 3NFQA 3H1KG 2ZT9C 4EOTA 1NTMD 4Y99B 1QGKB 2E76C 1P84E 1N7SA 2B89A 3P4SC 1BGYD 2NPSC 1FC2C 1TU3F 2OYIC 3SSUA 1L0LJ 3TNUA 2QG4A 2ZYGA 5APWA 3P7KA 1SQVE 2HG5D 3CXHE 4BRYA 1JY3N 3VRBD 4LDTA 3AE6C 3L35A 4PV1C 2HPCA 3KHUA 1LTJB 1RH5B 2RMZA 1Q86Q 2YIUB 2MJZA 3SWYA 1VQOP 5APVA 4IL6X 5AVUB 3CIRC 3PLNA 2DW3A 2WPRA 2QM7A 1GK4A 3Q5RA 1LGHB 2IFMA 1NTZG 5AW4B 3L73G 1EC5A 1N2DC 2WWWA 1NU1D 2XDJA 2KUBA 1N7LA 3U1AA 2ZYAA 1G2CA 4B86A 3M9HA 2R44A 3VP9A 1FAVA 1L4AA 2IBZD 2PFXA 3Q3DA 2WS3C 1JTHB 4D6TG 3L71G 1VQKP 3AE9D 4ZNCA 1UIXA 2K37A 2K1AA 2W83C 2V7QJ 3H32A 4EIJA 3CCQP 1N86A 3BCCG 4JYBA 5CCGA 3O6QA 3W67A 1MFZA 3G3ZA 2IX7C 2Z5IA 1KYOH 1HJ0A 1LTGC 2KLUA 3HD7B 3CCUP 4TLFA 1BSNA 1Q82Q 3KDPB 1GZLA 3W68A 3AE4C 4JQ0D 2KXPB 5K5GB 3H6PA 4YSYD 3A0HH 2E42A 1KC8Q 2FBWC 3TGUJ 1YQ4C 1Y8AA 1L4AB 2OGUA 3V2QA 2FKWB 2POHA 2WZ7A 2G3AA 1LTSC 3VR9C 2OTJP 3AE9C 1FZFA 3KPEA 2C9NY 3P4RC 1EDIA 2WS3D 3HRNA 1N73C 2CPSA 4QMAA 5AW2B 1E7PC 3P4QD 1GD2E 1TFFA 2OQQA 1WT6A 3A0BH 3P8MC 1SQQD 1VQ4P 1L0LG 3KXDA 5KKZB 2I1KA 1QL1A 1VQLP 4YT0D 3AEGD 1S5LH 1L2PA 1M56D 3H1KD 3RK3C 1ZR4A 5AW7B 1FZGA 4WWIA 5AVVB 1Y9BA 2ZT9D 1SQBK 3VMXA 1PL5A 3VYIA 5BU5A 1IFJA 1S9KD 5H2FH 1NOHA 3CX5E 4BRYB 1VF5B 3CPWO 1H0TA 4I1LA 3KYQA 1OVUA 4PJ0E 4YSXD 3VMYA 3MGNA 5H2FE 1A02F 1IFMA 1NU1G 2Y0CA 5APSA 2ZAEB 3VRAD 3AE7D 4N3YB 1VQ9P 4JBZA 3SWKA 4Y28J 1RHZB 1RE4A 1IFPA 3R2PA 2QIWA 5B66H 3HTKA 2KZIA 2WITA 2Y0EA 1L0NG 4WY4B 1OXZA 3S9OA 1EQ7A 4K35A 5AVSB 1FDMA 1LNQA 3HD7A 1K8AQ 1J2JB 1SFCC 3B8EB 2WQYD 1J1EB 4D6TJ 4YSXC 2M5AA 1KYOD 2I8DA 3OJAB 1OMIA 1SFCA 4L73A 1L0NJ 4XA4A 4H13B 2IYOA 2JWDA 1PV3A 2KIKA 1PP9G 3BCCJ 2QJYC 1GK6A 1S72P 3VRBC 2Q3EA 3M9BA 4O9BA 3OA7A 1ZOYC 1SFCB 4RJTA 5KLVG 2P67A 3T97B 3MUDA 1NTKG 2WSEH 1NTZK 2WSSH 3TYYA 3Q2YA 5KLVJ 2E76D 2SPZA 4OGQC 4WBAA 3L70J 1SQPK 2BS4C 1X0TA 2JWAA 5B5EH 1HBWA 2WTYA 1X79B 1HF9A 2O1JA 2BCCJ 1J1DB 4I6LA 1FZEA 3VMZA 3A5TA 1OX3A 1NU1K 2KB7P 1K73Q 3P4RD 2K9JB 3HD7D 3MD0A 4YTPC 2W6AA 3MP7B 3HUSC 1J1DC 3AECD 1KB9H 1S4XA 2O01H 2E74C 3RK3D 2P10A 2IBZG 3JCUE 1T8ZA 3P32A 3L72G 3HUSB 2O01J 3CMEP 5CCHC 2H43A 4IL6H 2YIUC 2HPCB 2WU2D 1KILE 3FXEA 3L72J 2FXPA 1MKMA 3BCCE 5KAFE 1L0NE 1PP9D 4I7ZC 1WMKA 4HKZH 2N9YB 3CX5I 3CCVP 1GW4A 2R3SA 5C3JD 1PGQA 4R4LA 2E74B 1NTKD 1SQPE 2N1TC 1NU1E 3NTNA 2JJLA 1CZQA 1ZR2A 3L73E 3VR8D 5KAIH 1LWUC 2AEFA 1KFYC 1RF1B 3L75E 3CL3D 2B87A 1QX8A 4C7NB 2GUSA 3CCRP 2NRGA 5DJUB 1PP9E 3L74G 2OYHA 3CLQA 1IFIA 1KTMA 4XFJA 2H8PD 1G1IA 2Q3IA 5CMZA 3SFDD 3ITKA 5DJTB 3D6ZA 2WP9D 2E43A 2YXQB 1NJIQ 1JCCA 3B4SA 2P7JA 5M1BA 2HLOA 1LTIC 1M1JB 3JC22 3AE3D 3L37A 4FJVA 4AQRD 3CXHD 3L71D 3CMAP 1KYOE 3TK1A 5CJ4A 2QE7H 1KB9D 3QWOC 1BE3E 1H88A 3H1LG 1H89A 4UB6E 4ASVA 1G2CB 1HGVA 4PD4I 2FY8A 1URQB 2OYOA 2BCCG 2KLVA 5AW8B 3TGUE 3JSVC 5AVWB 2QJPC 3EFFK 2KK7A 3RL0D 5CHXA 4YPCA 3AE6D 1SQPD 1PGPA 5TJHA 1G1JA 1JOCA 3RGUA 4YTND 1L0LE 1ZXGA 1YQ3D 2UWJE 4I7ZB 1PGJA 1E79H 4GODA 3IF4A 4Y99C 5BU8B 4EDFA 1SQXG 4L74A 2K9JA 4DJGA 1KV4A 2Q1KA 1SLQA 4W7YA 1SQBE 2WU5D 5AVZB 2FYUJ 3B5NC 2C0XA 1HH0A 4GOFA 2OYIA 2ZFCA 3BCCD 3CIRD 3VOPA 2JR8A 4UB8H 1R5LA 2GUVA 1T6AA 1HGZA 2WDVC 3AE3C 4PD4E 3VTPC 2CPBA 3A7OA 4OH8B 1NEKD 5APTA 2PP6A 2KOGA 1A02J 5CBOA 1NTZD 4W80A 1YJNP 3OW2O 1BCCG 5AVRB 2A45G 4N6JA 3PJSK 4H0LD 2FFDA 5AW1B 1SQVD 3QH9A 3A2AA 2OYHB 3P4SD 3H1JJ 4YSZD 1N7SC 1FZCB 2ZVOB 3FX0A 1NWQA 1BDDA 2M8RA 3MZWB 1FOSF 1MV8A 3A0BE 3V2PA 3SFED 1BCCD 1DEEG 2E74D 2M3EA 3F5HA 1CSBA 1SQQJ 1Z56A 4IL6E 1M1JA 4YXDC 4R4MA 1SQBG 3FWNA 1PPJD 3R4YA 1KMIZ 1SQVJ 4U3FG 3HE5B 1W2BO 4DHJA 4UB6H 1SQQK 1SQBJ 3C1LA 3GF3A 1JNMA 1FS0E 2OYHC 3H1LD 1AVOA 4I6MC 3TF5A 3S4RA 2LXCB 1K05A 2OTKE 1GU4A 3KQGA 2M3BA 1ZRTE 4YSZC 1K04A 4RESB 2D2CB 3KZIH 4L75A 3C8VA 3Q1MA 2IBZE 2ZT9B 3AE1C 1AQ5A 2FXMA 2YKQA 1FDIA 1DD4A 3AE4D 1SQXD 1JY2P 4OGQB 2WVRA 1OW7A 2AEJA 2OYIB 1QLBC 3CCEP 1M1KQ 3VP8A 1PFIA 1NKZB 4JPZB 1OVVA 3HD7C 1YTZT 1FJPA 2R5BA 2BEZF 3AE2D 1MZ9A 3CD6P 1LJ2A 1ZN5A 3P8CE 5AW6B 3NXSA 3B5ND 3H1JE 1KILB 1IO4A 3F89A 1RE3C 2FYUK 1YJWP 1EZVI 1LTAC 1SQXJ 2JEEA 3M0DC 4HJGH 4RO0A 1N8RQ 1N73A 1USDA 3H1JD 2N1TB 2XNXA 1AVYA 4H44D 3O8ZA 1NTMK 3AE8D 2IFNA 5KJ7D 4DZOA 1YQ3C 1FOSE 1KORA 1BCCE 4YTNC 1NEND 3T97A 2O01N 5BVZA 5KJ7C 1VQ7P 4KX6C 4CPGA 5GTIE 4NPDA 4YTMD 3BVHA 1PZQA 1IFNA 4LC1A 3Q5PA 1IK7A 3GLMA 2QJKB 1NTMG 2WDRD 4ZKPA 2KS1B 1RF1C 2IZ1A 2WQYC 3P4PD 3L75G 3S1KA 3P8CD 1U7MA 1R8EA 3RK3B 1LTBC 2FXOA 3V4WA 1SVFA 3IR9A 3AEGC 1VQMP 1L4AD 3G9RA 3L75J 3V5BA 3H1HJ 3HE5A 1SQPG 4GDOA 3U59A 3K5BA 1VPCA 3CXHI 3A0HE 1USEA 2RH0A 1FJKA 1MFTA 1M1JC 1SQPJ 4GIFA 5KLVK 5E79H 3H1HE 2Q5UA 1KYOI 3AEBC 4UB8E 3CC2P 3LW5J 1MUUA 2M5AB 4U3FJ 4KHXA 2RKLA 3L75D 2NPSB 1M8OB 3TGUG 4N78D 1L0ND 3V2NA 4DHIB 3FGAD 3GW6A 4WB4A 3N4XA 3VR8C 3OAKA 2BS3C 1Q2NA 1U57A 4WY4D 3V4QA 4MN4C 3M9QA 3PP5A 3CCSP 1YHQP 2JKVA 1NH4A 1GDTA 1ZRTD 3HE4A 2LKMA 1VF5C 4H13D 1KN7A 3H1KJ 3L73D 4GOEA 1SQXE 4H0LB 3MIWA 1LT9C 1M90Q 2M0BA 5TISH 2QJPB 2W8ZA 4PV1B 1IK9A 4NPFX 4N78E 1L0VC 1YJ9P 2PRRA 1KFMA 2D2CD 1NYHA 2W90A 3L74E 3FWLA 5C39A 2XKMA 4DCKA 1KQSO 2C9LY 3L73J 1JCDA 2KP8A 4YTPD 4K3AA 1NU1J 2WSEJ 2YKPA 1YTZI 3LIEA
chains in the Genus database with same CATH topology
2IDBA 1Q90D 4I7ZC 2H88C 4H0LD 1WMKA 2WQYD 2WS3D 3AEBC 3AEAC 2WDQC 4YSXC 2BEZF 3AE2D 1VF5D 4YTMC 5C2TC 3VRAC 4H13C 1OMIA 4KT0J 3LW5J 3IN6A 2WDRC 4H13B 1E7PC 1PV3A 3P4SD 2QJYC 1OW8A 3P4QD 1ZP0C 5C3JD 4YSZD 3AE7C 3VRBC 2OQQA 3D6YA 2WP9C 2WU5C 3SFDC 1EXJA 1S1CX 4R4LA 3VR9D 1ZOYC 2E74B 2JP3A 1NGMB 1NENC 2B76D 2QJPC 3T97B 5KKZC 2BEQD 2WSFJ 3EWKA 3FGAD 2G8YA 2WSCJ 1DD3A 4RKUJ 3SFED 4YT0D 1RQUA 4H44D 3AEGD 1S5LX 3AEDD 3VR8C 3AE6D 2E74D 3AEDC 3Q3DA 3VR8D 3AE8D 4YT0C 3ABVD 4H0LC 4H44C 2BS3C 1U57A 3SFEC 2WS3C 4YXDC 2BS4C 3Q2YA 2E75B 4TT3H 1Y9BA 1OW6A 4R4MA 1KQGB 1YQ3C 2E75C 2K9YA 1KORA 2E76D 2ZT9D 4OGQC 3Q5SA 1KFYC 3AE9D 1PL5A 4YTNC 1NEND 2ZT9C 1UIXA 4YTND 3AEFC 3R4YA 4OGQD 4Z1MH 1EXIA 1ZMEC 2V7QJ 1KMIZ 2E75D 1KFYD 1YQ3D 3AEFD 4KX6C 2QJKC 2E76C 3D71A 4I7ZB 1HF9A 1ZP0D 1VF5B 3B71A 1AJYA 4YXDD 4YTMD 1VF5C 2J5UA 3Q5PA 3P4SC 1IK7A 3AEBD 4YSXD 3GLMA 4H13D 2FBWD 1DIPA 5C2TD 2WDRD 3GF3A 4U7JA 5L8RJ 1TU3F 2H89C 3D70A 2WDQD 1KTMA 3AEAD 3P4RD 4XFJA 3O6QA 3AEED 4PV1D 2WQYC 3H25A 2H88D 4H0LB 3P4PD 2MKVA 3RL0g 3SFDD 1HJ0A 4YTPC 3D6ZA 1ZOYD 2B76C 3RK3E 2WP9D 1K05A 2WU5D 1RQVA 1R8EA 5C3JC 3AECC 1PIXA 1ZRTE 3P4QC 1K04A 3ABVC 3IAOA 3AECD 4YSZC 4PV1B 2D2CB 3GF7A 3VRAD 3AE8C 3AE7D 3VRBD 2E74C 2D2CC 1L0VC 3AE6C 3CIRD 2YMKA 2P10A 3C8VA 3Q1MA 5M1BA 3AEGC 2WPVB 2ZT9B 3AE4C 3AE5C 3G9RA 5KLIC 2QSIA 3AE1D 4Y28J 1GMJA 4PV1C 3GMAA 1KQFB 1KF6C 4YSYC 3AE1C 1JB0J 2WDVC 3AE3C 4GDOA 4YSYD 2BS2C 1FDIA 3AE3D 2O01J 2D2CD 1L0VD 1DD4A 3AE5D 1KF6D 3AE4D 1NYHA 2FBWC 2QIWA 4OGQB 4KX6D 4IL6X 2YIUC 1YQ4C 1VL2A 2NZ2A 1OW7A 1NEKD 2ACZC 3CIRC 2WU2D 4H44B 2FYNC 1KILE 1QLBC 2G3AA 1YQ4D 1FDOA 1MKMA 2FXPA 3Q5RA 3S9OA 1NEKC 2ACZD 3VR9C 2JO1A 2WU2C 3P4PC 4YTPD 3AE9C 3AE2C 2WDVD 3P4RC 2WSEJ 2E76B 2H89D 3AEEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H88 C;  2WQY D;  2WS3 D;  3AEB C;  3AEA C;  2WDQ C;  4YSX C;  3AE2 D;  4YTM C;  5C2T C;  3VRA C;  2WDR C;  1E7P C;  1PV3 A;  3P4S D;  1OW8 A;  3P4Q D;  5C3J D;  1ZP0 C;  4YSZ D;  3AE7 C;  3VRB C;  2WP9 C;  2WU5 C;  3SFD C;  1ZOY C;  1NEN C;  2B76 D;  3SFE D;  4YT0 D;  3AEG D;  3AED D;  3VR8 C;  3AE6 D;  3AED C;  3VR8 D;  3AE8 D;  4YT0 C;  3ABV D;  2BS3 C;  2WS3 C;  3SFE C;  4YXD C;  1OW6 A;  1YQ3 C;  1KFY C;  4KX6 D;  3AE9 D;  4YTN C;  1NEN D;  4YTN D;  3AEF C;  2BS4 C;  3VR9 D;  1KFY D;  1YQ3 D;  3AEF D;  4KX6 C;  1ZP0 D;  3B71 A;  4YXD D;  4YTM D;  3P4S C;  3AEB D;  4YSX D;  2FBW D;  5C2T D;  2WDR D;  2H89 C;  2WDQ D;  3AEA D;  1KTM A;  3P4R D;  3AEE D;  2WQY C;  2H88 D;  3P4P D;  3SFD D;  4YTP C;  1ZOY D;  2B76 C;  2WP9 D;  1K05 A;  2WU5 D;  5C3J C;  3AEC C;  3P4Q C;  1K04 A;  3ABV C;  4YSZ C;  3AEC D;  3VRA D;  3AE8 C;  3AE7 D;  3VRB D;  1L0V C;  3AE6 C;  3CIR D;  3AEG C;  3AE4 C;  3AE1 D;  3AE5 C;  1KF6 C;  4YSY C;  3AE1 C;  2WDV C;  3AE3 C;  4YSY D;  2BS2 C;  3AE3 D;  1L0V D;  3AE5 D;  1KF6 D;  3AE4 D;  2FBW C;  1YQ4 C;  1NEK D;  1OW7 A;  2ACZ C;  3CIR C;  2WU2 D;  1QLB C;  2G3A A;  1YQ4 D;  2ACZ D;  1NEK C;  3S9O A;  3VR9 C;  2WU2 C;  3P4P C;  4YTP D;  3AE9 C;  3AE2 C;  2WDV D;  3P4R C;  2H89 D;  3AEE C; 
#chains in the Genus database with same CATH topology
 1RF0 C;  2WPS A;  2KI7 B;  2QA4 P;  1BE3 G;  2ZFY A;  2R5D A;  2KSE A;  2B88 A;  1ZW0 A;  1NTM J;  1HUC A;  3BRT B;  1S2E A;  1NTZ J;  1KB9 E;  4DDI A;  2BCC D;  2FYZ A;  3EWK A;  5KAI E;  1BGY J;  1SQX K;  3L36 A;  1JTH A;  1S9K E;  2YNY A;  1JY3 P;  2VRS A;  4W7Z A;  1YBK A;  2E75 B;  4KX6 D;  2QRX A;  3AEF C;  1ZME C;  4OGQ D;  3MTU E;  1BGY G;  3L74 D;  5GTH H;  3H1I J;  1EDL A;  4YXD D;  1URQ D;  2Y0D A;  1DIP A;  1OZH A;  3USS A;  2WPQ A;  2WDQ D;  1SFC D;  1ZV8 A;  1T2K D;  3WU2 H;  3G6E P;  1LP1 A;  1RE4 C;  1ZOY D;  4LGD E;  1JMB A;  1J1E C;  3TDK A;  2K3R A;  3H32 B;  1N7S D;  3WU2 E;  2YMK A;  2BCC E;  3GG2 A;  1X22 A;  2KSJ A;  1T2K C;  3L70 E;  2HFE D;  5AW3 B;  3HTK B;  3CWB J;  2N1T A;  3BAT A;  2QEX P;  3M91 A;  2JO1 A;  3PTZ A;  2H89 D;  1SQV K;  4PD4 D;  2IZ0 A;  1VQ5 P;  2NPS D;  3TGU D;  5GTI H;  3C9I A;  3EFG A;  1GL2 A;  2HR3 A;  4OWF A;  2XU6 A;  4JYC A;  3RK2 B;  1XTG B;  2WSF J;  5TIS E;  4RKU J;  1H0T B;  1L0L D;  2A45 H;  1VQ6 P;  4YT0 C;  1LTJ A;  5APY A;  1XTC C;  2HYN A;  1KQG B;  2K9Y A;  3M0D A;  3AEF D;  4KJM A;  1AV1 A;  2J5U A;  2O1K A;  4DT0 A;  5L8R J;  3D70 A;  2AEM A;  5AVQ B;  3E1I A;  5AW9 B;  2H88 D;  1GL2 B;  3A3Y B;  3H1I D;  1OIP A;  5AW5 B;  2K88 A;  3RK3 E;  2L5G B;  5CCH A;  1LT9 A;  5C3J C;  3P4Q C;  2QVA A;  1FZA A;  5CCG C;  4U3F D;  1BE3 J;  2WT7 B;  1VQ8 P;  4YSY C;  1QEX A;  1BDC A;  1QVF O;  2ZXX A;  2BS2 C;  3E7K A;  2Q6Q A;  1KF6 D;  3ZDM A;  4H44 B;  1DEB A;  4D6T D;  1IC2 A;  1NEK C;  1FZC A;  2Q9I A;  1YIT P;  3CWB D;  4WY4 C;  4C46 A;  1GTW A;  3E1R A;  3GHG A;  1LP1 B;  3AEA C;  2V4H A;  3B5N B;  2Z4E A;  4KT0 J;  3GHG C;  1HTL C;  1HWT C;  1UII A;  3H1I G;  5KLV D;  2WU5 C;  1EXJ A;  3I55 P;  2FFD C;  1PP9 J;  1R5S A;  1M57 D;  1RQU A;  3U1C A;  4IFM A;  1Q81 Q;  1KZU B;  2P2U A;  5B66 E;  1NHL A;  2Z5H A;  3Q5S A;  2OAR A;  4LLH A;  1N73 B;  4ZMD A;  4GT1 A;  2A06 D;  5KJ7 A;  1ZP0 D;  3WUT A;  3VN0 A;  3CWB G;  4U7J A;  4OVN F;  2A06 G;  3L70 G;  2H89 C;  1KIL C;  3CCJ P;  1SS1 A;  4IFF A;  3G4S P;  2A45 I;  3L70 D;  2KYV A;  3AEC C;  3L72 D;  3ABV C;  4EI2 A;  1CI6 A;  4M3L A;  3B5N A;  2AXC A;  1RY3 A;  2QSI A;  3CX5 D;  2PAJ A;  1JB0 J;  1QVG O;  4C7N A;  3M0A A;  2E5Y A;  2B87 B;  3M06 A;  2Y9Y A;  1L0N K;  1YI2 P;  2FYU D;  5CJ0 A;  2WU2 C;  1L0L K;  5KTB A;  1OVR A;  2GM4 A;  4BWN A;  1SQQ E;  2FYU G;  2H88 C;  2V7Q H;  1FBM A;  1LT9 B;  3CWB E;  2W27 A;  1CW5 A;  2ZVN B;  3HE4 B;  2PGD A;  5CBN A;  1U7J A;  4YXW H;  1KFN A;  1LTJ C;  4HH2 A;  4BXL A;  1KFY D;  3MUD C;  3HUS A;  2HOD A;  2KZJ A;  2NPS A;  3B71 A;  3H1I E;  1M7L A;  2JDI H;  4C7R A;  2YO2 A;  1X8Y A;  3G71 P;  5EFW B;  1BGY E;  3SWF A;  2D2C C;  2WPV B;  5KLI C;  2LR2 A;  3NMD A;  1SQV G;  3RK2 D;  1JEK A;  2XV5 A;  4PJ0 H;  1L0V D;  3AE5 D;  1X9V A;  3MHV A;  2OTL P;  2ACZ C;  3H1H D;  1EDJ A;  1YQ4 D;  2YKO A;  1NTK J;  1E5W A;  2WDV D;  2E76 B;  3AEE C;  1KIL D;  3V2R A;  1VF5 D;  2E5T A;  3CI9 A;  1PGO A;  1RF0 A;  1SP4 A;  1AQT A;  1ZP0 C;  3PH0 A;  4PD4 H;  3AE7 C;  3WUU A;  3RL0 B;  1LWU A;  3N7N A;  2JP3 A;  1YYC A;  1AA0 A;  3RK2 C;  1NAY A;  2ZYD A;  3VON A;  4GKG A;  1KB9 I;  3AED C;  5AW0 B;  4H0L C;  5APX A;  1W5C E;  3PRJ A;  4TT3 H;  4DDG A;  4Z1M H;  1S5L E;  3VR9 D;  2E75 D;  1YIJ P;  2IPP A;  4L76 A;  4WVZ A;  3D71 A;  3H1L E;  1FZB A;  1PPJ G;  1AJY A;  3L71 E;  3WUV A;  3AEB D;  1K9M Q;  4IFD K;  1RE3 A;  2FBW D;  5C2T D;  1JY2 O;  3AEA D;  3BRV B;  4AYC A;  1GU5 A;  2MKV A;  3BAS A;  1RQV A;  2WSC H;  4JF7 A;  3PHL A;  3V6I A;  3IFM A;  2CK3 H;  5E79 E;  1T3J A;  2FYU E;  5B5E E;  1GMJ A;  3GMA A;  4I2L C;  1NTZ E;  1NTM E;  1VL2 A;  1P84 D;  2W6B A;  1FDO A;  1VQP P;  3P4P C;  2B9B A;  2H7H A;  1GW3 A;  2YMY A;  4IOI H;  1KQL A;  4YTM C;  3JCU H;  3GHG B;  3D6Y A;  2WP9 C;  3SFD C;  1EZV D;  2YXR B;  2HOD B;  3L74 J;  4WY4 A;  2ITA A;  3WMM 0;  2WSC J;  2IYP A;  1D7M A;  1SQB D;  1NO4 A;  2L91 A;  3I56 P;  3ABV D;  3CXH H;  2ZJS E;  4NPE A;  1VQN P;  2QJY B;  2WT7 A;  1BE3 D;  3LW5 H;  1NAF A;  1LT1 A;  1AFO A;  1DH3 A;  1IZN B;  3CC7 P;  3KZI E;  3H1K E;  4XE5 B;  1SQQ G;  2AXT E;  1PPJ E;  1QL2 A;  1FZC C;  4PV1 D;  4EYY Q;  3H25 A;  3RL0 g;  1Y47 A;  1NVO A;  1FU1 A;  4HYT B;  2WSF H;  3O6Q B;  1EZV E;  1EZV G;  2FFD B;  3H1L J;  2KNC B;  2YO3 A;  3AE8 C;  1KD1 Q;  1RF1 A;  3AE1 D;  1EDK A;  1KQF B;  1JUN A;  1IJD B;  5CCG D;  2N9B A;  1NKN A;  1L4A C;  2NZ2 A;  5APU A;  1JM0 A;  4AUW A;  3RBX A;  2J59 M;  4U3F E;  3L4F A;  3AE2 C;  5KAF H;  2IDB A;  1Q90 D;  2J58 A;  2WDQ C;  1T3U A;  5C2T C;  2WDR C;  1URQ C;  2LXB A;  1OW8 A;  1VDF A;  2N1T D;  1BSH A;  5GTH E;  1IFD A;  2W6J H;  2AXT H;  3I5C A;  1NGM B;  2KS1 A;  1NEN C;  1NTK E;  1S3J A;  2ZXE B;  5KKZ C;  2BEQ D;  4A7P A;  2G8Y A;  1DD3 A;  1S5L X;  2GA1 A;  3UIA A;  3AED D;  3VMA A;  4DOJ A;  3CCM P;  4ZKU A;  1GL2 C;  4H44 C;  1OW6 A;  2E75 C;  3TSI A;  3CX5 H;  1EXI A;  1P84 I;  1CI6 B;  3II6 A;  1FE6 A;  1JMM A;  5AVY B;  2QJK C;  2XND H;  1JY2 N;  1HVV A;  3L72 E;  2Q7C A;  1URQ A;  2WMM A;  5CCH D;  2KNC A;  5APQ A;  2R3C A;  3AEE D;  2Y9Z A;  3FXD A;  1LWU B;  3H1H G;  2B76 C;  1KIL A;  3CC4 P;  1BCC J;  3LID A;  1PIX A;  3TNU B;  1DX7 A;  3IAO A;  3GF7 A;  2A06 E;  5AVX B;  1Q7Y Q;  3L71 J;  1H8A A;  2IBZ I;  2RN0 A;  3AE5 C;  3H1J G;  1N7S B;  1KF6 C;  1OFC X;  4HB1 A;  2BAS A;  1WRG A;  3CCL P;  2P1J A;  1LTT C;  2FYN C;  1HJB A;  1NTK K;  5KLI B;  2ACZ D;  2P58 A;  1ZLL A;  3EQ2 A;  1GL2 D;  1QLE D;  5KLV E;  2FYN B;  2XZR A;  3VRA C;  4H13 C;  3IN6 A;  1OWA A;  5AVT B;  4DHZ A;  2O3J A;  2QM8 A;  1S1C X;  2C0W A;  2I1J A;  4ASW A;  2B76 D;  1JY3 O;  3RBZ A;  1JO5 A;  3RL0 C;  1W2E A;  1P84 H;  2R32 A;  3SFE C;  4D6T E;  3NFQ A;  3H1K G;  2ZT9 C;  4EOT A;  1NTM D;  4Y99 B;  1QGK B;  2E76 C;  1P84 E;  1N7S A;  2B89 A;  3P4S C;  1BGY D;  2NPS C;  1FC2 C;  1TU3 F;  2OYI C;  3SSU A;  1L0L J;  3TNU A;  2QG4 A;  2ZYG A;  5APW A;  3P7K A;  1SQV E;  2HG5 D;  3CXH E;  4BRY A;  1JY3 N;  3VRB D;  4LDT A;  3AE6 C;  3L35 A;  4PV1 C;  2HPC A;  3KHU A;  1LTJ B;  1RH5 B;  2RMZ A;  1Q86 Q;  2YIU B;  2MJZ A;  3SWY A;  1VQO P;  5APV A;  4IL6 X;  5AVU B;  3CIR C;  3PLN A;  2DW3 A;  2WPR A;  2QM7 A;  1GK4 A;  3Q5R A;  1LGH B;  2IFM A;  1NTZ G;  5AW4 B;  3L73 G;  1EC5 A;  1N2D C;  2WWW A;  1NU1 D;  2XDJ A;  2KUB A;  1N7L A;  3U1A A;  2ZYA A;  1G2C A;  4B86 A;  3M9H A;  2R44 A;  3VP9 A;  1FAV A;  1L4A A;  2IBZ D;  2PFX A;  3Q3D A;  2WS3 C;  1JTH B;  4D6T G;  3L71 G;  1VQK P;  3AE9 D;  4ZNC A;  1UIX A;  2K37 A;  2K1A A;  2W83 C;  2V7Q J;  3H32 A;  4EIJ A;  3CCQ P;  1N86 A;  3BCC G;  4JYB A;  5CCG A;  3O6Q A;  3W67 A;  1MFZ A;  3G3Z A;  2IX7 C;  2Z5I A;  1KYO H;  1HJ0 A;  1LTG C;  2KLU A;  3HD7 B;  3CCU P;  4TLF A;  1BSN A;  1Q82 Q;  3KDP B;  1GZL A;  3W68 A;  3AE4 C;  4JQ0 D;  2KXP B;  5K5G B;  3H6P A;  4YSY D;  3A0H H;  2E42 A;  1KC8 Q;  2FBW C;  3TGU J;  1YQ4 C;  1Y8A A;  1L4A B;  2OGU A;  3V2Q A;  2FKW B;  2POH A;  2WZ7 A;  2G3A A;  1LTS C;  3VR9 C;  2OTJ P;  3AE9 C;  1FZF A;  3KPE A;  2C9N Y;  3P4R C;  1EDI A;  2WS3 D;  3HRN A;  1N73 C;  2CPS A;  4QMA A;  5AW2 B;  1E7P C;  3P4Q D;  1GD2 E;  1TFF A;  2OQQ A;  1WT6 A;  3A0B H;  3P8M C;  1SQQ D;  1VQ4 P;  1L0L G;  3KXD A;  5KKZ B;  2I1K A;  1QL1 A;  1VQL P;  4YT0 D;  3AEG D;  1S5L H;  1L2P A;  1M56 D;  3H1K D;  3RK3 C;  1ZR4 A;  5AW7 B;  1FZG A;  4WWI A;  5AVV B;  1Y9B A;  2ZT9 D;  1SQB K;  3VMX A;  1PL5 A;  3VYI A;  5BU5 A;  1IFJ A;  1S9K D;  5H2F H;  1NOH A;  3CX5 E;  4BRY B;  1VF5 B;  3CPW O;  1H0T A;  4I1L A;  3KYQ A;  1OVU A;  4PJ0 E;  4YSX D;  3VMY A;  3MGN A;  5H2F E;  1A02 F;  1IFM A;  1NU1 G;  2Y0C A;  5APS A;  2ZAE B;  3VRA D;  3AE7 D;  4N3Y B;  1VQ9 P;  4JBZ A;  3SWK A;  4Y28 J;  1RHZ B;  1RE4 A;  1IFP A;  3R2P A;  2QIW A;  5B66 H;  3HTK A;  2KZI A;  2WIT A;  2Y0E A;  1L0N G;  4WY4 B;  1OXZ A;  3S9O A;  1EQ7 A;  4K35 A;  5AVS B;  1FDM A;  1LNQ A;  3HD7 A;  1K8A Q;  1J2J B;  1SFC C;  3B8E B;  2WQY D;  1J1E B;  4D6T J;  4YSX C;  2M5A A;  1KYO D;  2I8D A;  3OJA B;  1OMI A;  1SFC A;  4L73 A;  1L0N J;  4XA4 A;  4H13 B;  2IYO A;  2JWD A;  1PV3 A;  2KIK A;  1PP9 G;  3BCC J;  2QJY C;  1GK6 A;  1S72 P;  3VRB C;  2Q3E A;  3M9B A;  4O9B A;  3OA7 A;  1ZOY C;  1SFC B;  4RJT A;  5KLV G;  2P67 A;  3T97 B;  3MUD A;  1NTK G;  2WSE H;  1NTZ K;  2WSS H;  3TYY A;  3Q2Y A;  5KLV J;  2E76 D;  2SPZ A;  4OGQ C;  4WBA A;  3L70 J;  1SQP K;  2BS4 C;  1X0T A;  2JWA A;  5B5E H;  1HBW A;  2WTY A;  1X79 B;  1HF9 A;  2O1J A;  2BCC J;  1J1D B;  4I6L A;  1FZE A;  3VMZ A;  3A5T A;  1OX3 A;  1NU1 K;  2KB7 P;  1K73 Q;  3P4R D;  2K9J B;  3HD7 D;  3MD0 A;  4YTP C;  2W6A A;  3MP7 B;  3HUS C;  1J1D C;  3AEC D;  1KB9 H;  1S4X A;  2O01 H;  2E74 C;  3RK3 D;  2P10 A;  2IBZ G;  3JCU E;  1T8Z A;  3P32 A;  3L72 G;  3HUS B;  2O01 J;  3CME P;  5CCH C;  2H43 A;  4IL6 H;  2YIU C;  2HPC B;  2WU2 D;  1KIL E;  3FXE A;  3L72 J;  2FXP A;  1MKM A;  3BCC E;  5KAF E;  1L0N E;  1PP9 D;  4I7Z C;  1WMK A;  4HKZ H;  2N9Y B;  3CX5 I;  3CCV P;  1GW4 A;  2R3S A;  5C3J D;  1PGQ A;  4R4L A;  2E74 B;  1NTK D;  1SQP E;  2N1T C;  1NU1 E;  3NTN A;  2JJL A;  1CZQ A;  1ZR2 A;  3L73 E;  3VR8 D;  5KAI H;  1LWU C;  2AEF A;  1KFY C;  1RF1 B;  3L75 E;  3CL3 D;  2B87 A;  1QX8 A;  4C7N B;  2GUS A;  3CCR P;  2NRG A;  5DJU B;  1PP9 E;  3L74 G;  2OYH A;  3CLQ A;  1IFI A;  1KTM A;  4XFJ A;  2H8P D;  1G1I A;  2Q3I A;  5CMZ A;  3SFD D;  3ITK A;  5DJT B;  3D6Z A;  2WP9 D;  2E43 A;  2YXQ B;  1NJI Q;  1JCC A;  3B4S A;  2P7J A;  5M1B A;  2HLO A;  1LTI C;  1M1J B;  3JC2 2;  3AE3 D;  3L37 A;  4FJV A;  4AQR D;  3CXH D;  3L71 D;  3CMA P;  1KYO E;  3TK1 A;  5CJ4 A;  2QE7 H;  1KB9 D;  3QWO C;  1BE3 E;  1H88 A;  3H1L G;  1H89 A;  4UB6 E;  4ASV A;  1G2C B;  1HGV A;  4PD4 I;  2FY8 A;  1URQ B;  2OYO A;  2BCC G;  2KLV A;  5AW8 B;  3TGU E;  3JSV C;  5AVW B;  2QJP C;  3EFF K;  2KK7 A;  3RL0 D;  5CHX A;  4YPC A;  3AE6 D;  1SQP D;  1PGP A;  5TJH A;  1G1J A;  1JOC A;  3RGU A;  4YTN D;  1L0L E;  1ZXG A;  1YQ3 D;  2UWJ E;  4I7Z B;  1PGJ A;  1E79 H;  4GOD A;  3IF4 A;  4Y99 C;  5BU8 B;  4EDF A;  1SQX G;  4L74 A;  2K9J A;  4DJG A;  1KV4 A;  2Q1K A;  1SLQ A;  4W7Y A;  1SQB E;  2WU5 D;  5AVZ B;  2FYU J;  3B5N C;  2C0X A;  1HH0 A;  4GOF A;  2OYI A;  2ZFC A;  3BCC D;  3CIR D;  3VOP A;  2JR8 A;  4UB8 H;  1R5L A;  2GUV A;  1T6A A;  1HGZ A;  2WDV C;  3AE3 C;  4PD4 E;  3VTP C;  2CPB A;  3A7O A;  4OH8 B;  1NEK D;  5APT A;  2PP6 A;  2KOG A;  1A02 J;  5CBO A;  1NTZ D;  4W80 A;  1YJN P;  3OW2 O;  1BCC G;  5AVR B;  2A45 G;  4N6J A;  3PJS K;  4H0L D;  2FFD A;  5AW1 B;  1SQV D;  3QH9 A;  3A2A A;  2OYH B;  3P4S D;  3H1J J;  4YSZ D;  1N7S C;  1FZC B;  2ZVO B;  3FX0 A;  1NWQ A;  1BDD A;  2M8R A;  3MZW B;  1FOS F;  1MV8 A;  3A0B E;  3V2P A;  3SFE D;  1BCC D;  1DEE G;  2E74 D;  2M3E A;  3F5H A;  1CSB A;  1SQQ J;  1Z56 A;  4IL6 E;  1M1J A;  4YXD C;  4R4M A;  1SQB G;  3FWN A;  1PPJ D;  3R4Y A;  1KMI Z;  1SQV J;  4U3F G;  3HE5 B;  1W2B O;  4DHJ A;  4UB6 H;  1SQQ K;  1SQB J;  3C1L A;  3GF3 A;  1JNM A;  1FS0 E;  2OYH C;  3H1L D;  1AVO A;  4I6M C;  3TF5 A;  3S4R A;  2LXC B;  1K05 A;  2OTK E;  1GU4 A;  3KQG A;  2M3B A;  1ZRT E;  4YSZ C;  1K04 A;  4RES B;  2D2C B;  3KZI H;  4L75 A;  3C8V A;  3Q1M A;  2IBZ E;  2ZT9 B;  3AE1 C;  1AQ5 A;  2FXM A;  2YKQ A;  1FDI A;  1DD4 A;  3AE4 D;  1SQX D;  1JY2 P;  4OGQ B;  2WVR A;  1OW7 A;  2AEJ A;  2OYI B;  1QLB C;  3CCE P;  1M1K Q;  3VP8 A;  1PFI A;  1NKZ B;  4JPZ B;  1OVV A;  3HD7 C;  1YTZ T;  1FJP A;  2R5B A;  2BEZ F;  3AE2 D;  1MZ9 A;  3CD6 P;  1LJ2 A;  1ZN5 A;  3P8C E;  5AW6 B;  3NXS A;  3B5N D;  3H1J E;  1KIL B;  1IO4 A;  3F89 A;  1RE3 C;  2FYU K;  1YJW P;  1EZV I;  1LTA C;  1SQX J;  2JEE A;  3M0D C;  4HJG H;  4RO0 A;  1N8R Q;  1N73 A;  1USD A;  3H1J D;  2N1T B;  2XNX A;  1AVY A;  4H44 D;  3O8Z A;  1NTM K;  3AE8 D;  2IFN A;  5KJ7 D;  4DZO A;  1YQ3 C;  1FOS E;  1KOR A;  1BCC E;  4YTN C;  1NEN D;  3T97 A;  2O01 N;  5BVZ A;  5KJ7 C;  1VQ7 P;  4KX6 C;  4CPG A;  5GTI E;  4NPD A;  4YTM D;  3BVH A;  1PZQ A;  1IFN A;  4LC1 A;  3Q5P A;  1IK7 A;  3GLM A;  2QJK B;  1NTM G;  2WDR D;  4ZKP A;  2KS1 B;  1RF1 C;  2IZ1 A;  2WQY C;  3P4P D;  3L75 G;  3S1K A;  3P8C D;  1U7M A;  1R8E A;  3RK3 B;  1LTB C;  2FXO A;  3V4W A;  1SVF A;  3IR9 A;  3AEG C;  1VQM P;  1L4A D;  3G9R A;  3L75 J;  3V5B A;  3H1H J;  3HE5 A;  1SQP G;  4GDO A;  3U59 A;  3K5B A;  1VPC A;  3CXH I;  3A0H E;  1USE A;  2RH0 A;  1FJK A;  1MFT A;  1M1J C;  1SQP J;  4GIF A;  5KLV K;  5E79 H;  3H1H E;  2Q5U A;  1KYO I;  3AEB C;  4UB8 E;  3CC2 P;  3LW5 J;  1MUU A;  2M5A B;  4U3F J;  4KHX A;  2RKL A;  3L75 D;  2NPS B;  1M8O B;  3TGU G;  4N78 D;  1L0N D;  3V2N A;  4DHI B;  3FGA D;  3GW6 A;  4WB4 A;  3N4X A;  3VR8 C;  3OAK A;  2BS3 C;  1Q2N A;  1U57 A;  4WY4 D;  3V4Q A;  4MN4 C;  3M9Q A;  3PP5 A;  3CCS P;  1YHQ P;  2JKV A;  1NH4 A;  1GDT A;  1ZRT D;  3HE4 A;  2LKM A;  1VF5 C;  4H13 D;  1KN7 A;  3H1K J;  3L73 D;  4GOE A;  1SQX E;  4H0L B;  3MIW A;  1LT9 C;  1M90 Q;  2M0B A;  5TIS H;  2QJP B;  2W8Z A;  4PV1 B;  1IK9 A;  4NPF X;  4N78 E;  1L0V C;  1YJ9 P;  2PRR A;  1KFM A;  2D2C D;  1NYH A;  2W90 A;  3L74 E;  3FWL A;  5C39 A;  2XKM A;  4DCK A;  1KQS O;  2C9L Y;  3L73 J;  1JCD A;  2KP8 A;  4YTP D;  4K3A A;  1NU1 J;  2WSE J;  2YKP A;  1YTZ I;  3LIE A; 
#chains in the Genus database with same CATH homology
 2IDB A;  1Q90 D;  4I7Z C;  2H88 C;  4H0L D;  1WMK A;  2WQY D;  2WS3 D;  3AEB C;  3AEA C;  2WDQ C;  4YSX C;  2BEZ F;  3AE2 D;  1VF5 D;  4YTM C;  5C2T C;  3VRA C;  4H13 C;  1OMI A;  4KT0 J;  3LW5 J;  3IN6 A;  2WDR C;  4H13 B;  1E7P C;  1PV3 A;  3P4S D;  2QJY C;  1OW8 A;  3P4Q D;  1ZP0 C;  5C3J D;  4YSZ D;  3AE7 C;  3VRB C;  2OQQ A;  3D6Y A;  2WP9 C;  2WU5 C;  3SFD C;  1EXJ A;  1S1C X;  4R4L A;  3VR9 D;  1ZOY C;  2E74 B;  2JP3 A;  1NGM B;  1NEN C;  2B76 D;  2QJP C;  3T97 B;  5KKZ C;  2BEQ D;  2WSF J;  3EWK A;  3FGA D;  2G8Y A;  2WSC J;  1DD3 A;  4RKU J;  3SFE D;  4YT0 D;  1RQU A;  4H44 D;  3AEG D;  1S5L X;  3AED D;  3VR8 C;  3AE6 D;  2E74 D;  3AED C;  3Q3D A;  3VR8 D;  3AE8 D;  4YT0 C;  3ABV D;  4H0L C;  4H44 C;  2BS3 C;  1U57 A;  3SFE C;  2WS3 C;  4YXD C;  2BS4 C;  3Q2Y A;  2E75 B;  4TT3 H;  1Y9B A;  1OW6 A;  4R4M A;  1KQG B;  1YQ3 C;  2E75 C;  2K9Y A;  1KOR A;  2E76 D;  2ZT9 D;  4OGQ C;  3Q5S A;  1KFY C;  3AE9 D;  1PL5 A;  4YTN C;  1NEN D;  2ZT9 C;  1UIX A;  4YTN D;  3AEF C;  3R4Y A;  4OGQ D;  4Z1M H;  1EXI A;  1ZME C;  2V7Q J;  1KMI Z;  2E75 D;  1KFY D;  1YQ3 D;  3AEF D;  4KX6 C;  2QJK C;  2E76 C;  3D71 A;  4I7Z B;  1HF9 A;  1ZP0 D;  1VF5 B;  3B71 A;  1AJY A;  4YXD D;  4YTM D;  1VF5 C;  2J5U A;  3Q5P A;  3P4S C;  1IK7 A;  3AEB D;  4YSX D;  3GLM A;  4H13 D;  2FBW D;  1DIP A;  5C2T D;  2WDR D;  3GF3 A;  4U7J A;  5L8R J;  1TU3 F;  2H89 C;  3D70 A;  2WDQ D;  1KTM A;  3AEA D;  3P4R D;  4XFJ A;  3O6Q A;  3AEE D;  4PV1 D;  2WQY C;  3H25 A;  2H88 D;  4H0L B;  3P4P D;  2MKV A;  3RL0 g;  3SFD D;  1HJ0 A;  4YTP C;  3D6Z A;  1ZOY D;  2B76 C;  3RK3 E;  2WP9 D;  1K05 A;  2WU5 D;  1RQV A;  1R8E A;  5C3J C;  3AEC C;  1PIX A;  1ZRT E;  3P4Q C;  1K04 A;  3ABV C;  3IAO A;  3AEC D;  4YSZ C;  4PV1 B;  2D2C B;  3GF7 A;  3VRA D;  3AE8 C;  3AE7 D;  3VRB D;  2E74 C;  2D2C C;  1L0V C;  3AE6 C;  3CIR D;  2YMK A;  2P10 A;  3C8V A;  3Q1M A;  5M1B A;  3AEG C;  2WPV B;  2ZT9 B;  3AE4 C;  3AE5 C;  3G9R A;  5KLI C;  2QSI A;  3AE1 D;  4Y28 J;  1GMJ A;  4PV1 C;  3GMA A;  1KQF B;  1KF6 C;  4YSY C;  3AE1 C;  1JB0 J;  2WDV C;  3AE3 C;  4GDO A;  4YSY D;  2BS2 C;  1FDI A;  3AE3 D;  2O01 J;  2D2C D;  1L0V D;  1DD4 A;  3AE5 D;  1KF6 D;  3AE4 D;  1NYH A;  2FBW C;  2QIW A;  4OGQ B;  4KX6 D;  4IL6 X;  2YIU C;  1YQ4 C;  1VL2 A;  2NZ2 A;  1OW7 A;  1NEK D;  2ACZ C;  3CIR C;  2WU2 D;  4H44 B;  2FYN C;  1KIL E;  1QLB C;  2G3A A;  1YQ4 D;  1FDO A;  1MKM A;  2FXP A;  3Q5R A;  3S9O A;  1NEK C;  2ACZ D;  3VR9 C;  2JO1 A;  2WU2 C;  3P4P C;  4YTP D;  3AE9 C;  3AE2 C;  2WDV D;  3P4R C;  2WSE J;  2E76 B;  2H89 D;  3AEE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...