3AE5C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-methyl-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Methyl-N-(3-isopropoxy-phenyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae5C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae5C02
1QLBC 2G3AA 3ABVC 1YQ4D 1NEND 4YT0D 4YTPD 3SFDD 3P4SC 2ACZC 3AE1C 3AE6C 3AE4C 2WU2D 1E7PC 3VRAC 3P4PC 1OW8A 3CIRC 4KX6C 3AEDC 3AE8C 3AECC 2WQYD 1KF6C 4YSZC 4YT0C 3P4QD 3SFDC 1K05A 3AEEC 3AE3C 3VR9D 2WU5D 3AE4D 2FBWC 1PV3A 3AE7D 3AEFD 2WU2C 2H89C 3P4RD 2BS2C 2WDVD 2WDQC 1OW7A 3AEBD 3CIRD 4KX6D 3AE9C 4YSXD 2WQYC 4YSZD 1KTMA 2WS3D 3AEGD 3P4QC 3ABVD 4YSYD 2BS3C 3AEED 3SFEC 3B71A 5C3JD 2B76D 3AE5C 4YXDC 3AE7C 2BS4C 2H89D 3P4RC 1ZP0C 1KFYC 2WDQD 3AE2D 2WP9D 3P4PD 3AEDD 2WS3C 1L0VD 1YQ3D 4YTPC 2WDRC 3AECD 3AEAD 5C2TC 4YSYC 1NEKC 2ACZD 1ZOYC 3AE1D 5C3JC 3AE5D 4YXDD 4YTMC 3VR8D 3VR9C 2H88C 2WU5C 1ZP0D 1KFYD 3VRBC 3AE2C 4YTNC 2WDVC 3AE8D 2WP9C 1K04A 3S9OA 1KF6D 1YQ3C 1L0VC 2WDRD 3AEAC 1YQ4C 5C2TD 1NENC 3AEGC 1NEKD 3AE3D 1ZOYD 4YTMD 3P4SD 2FBWD 3VR8C 3SFED 3AEFC 2H88D 2B76C 3AE6D 3VRBD 3AEBC 4YTND 3VRAD 1OW6A 3AE9D 4YSXC
chains in the Genus database with same CATH superfamily
1K9MQ 3A2AA 1NTKJ 4Y99C 4YTPD 3L73J 3S1KA 3CXHD 1OWAA 3RBZA 5B5EH 3CWBJ 3RL0D 3NFQA 1DEEG 2E74D 3CL3D 3EWKA 1PP9J 5AW5B 2IZ0A 1JY3N 3KPEA 1LT9A 4M3LA 1L0LK 1NVOA 2QSIA 2Y9ZA 4WVZA 1J1EC 1R5LA 4ASWA 4OGQB 3H1LE 3AE9C 3R4YA 1MV8A 4YSZD 2BCCG 1PPJD 1BE3E 1LP1A 2ZT9C 3Q5PA 4YXDC 3FX0A 3AE7C 3P32A 3H1HJ 3RK2D 1DD4A 4GIFA 2ZFCA 1KORA 2H7HA 4JBZA 1L0VD 2HPCA 3VYIA 1ZOYC 3AE1D 2KI7B 1NTME 3L37A 1SQBG 3VR9C 2M0BA 2JO1A 3MUDC 5KJ7D 2ZXEB 3CLQA 1QL1A 3OJAB 1N73B 1LTTC 1SQQK 2KYVA 1X0TA 1NTKG 2B87B 1RE3C 3AE6D 1RF1C 3L75D 4YSXC 3P8CE 1SQPK 3A5TA 1CW5A 4I6LA 3SFDD 1J2JB 1SFCA 2M3BA 3VRAC 3H1LD 1OIPA 4HKZH 2E75D 3H32B 1DH3A 5E79E 2YXQB 4YT0C 3L70G 1NO4A 5KAFH 3EQ2A 2Q9IA 1KB9E 1J1DC 2B88A 5AVYB 1X22A 2A06E 3JSVC 5BVZA 3LIEA 1KTMA 2E76C 2Z5HA 1KYOH 2A45H 3E7KA 2YO3A 1CI6B 3E1IA 1S2EA 2ZYAA 2KSJA 1N7SC 3WUTA 3SWKA 2R3SA 5CJ4A 4KHXA 3CMAP 1CZQA 4YSYC 2C9LY 4B86A 1CI6A 3SWYA 4W80A 2H43A 2H88C 2V7QJ 1SQVD 2WU5C 1NTMD 3AE2C 1Q86Q 2R5DA 5KLVK 5C2TD 5CHXA 1NENC 5CCGD 3CCEP 2OTLP 2N9BA 2ZAEB 4Y28J 1IO4A 3U1AA 3L71D 2MKVA 2NPSD 5H2FH 3SSUA 4LGDE 1NTKK 2WSFJ 1MFTA 2IX7C 3LW5J 4RJTA 1SFCB 1HWTC 2J5UA 1NTZE 3QWOC 1SQPJ 3TK1A 1LTBC 1L0LJ 3P8MC 3VR9D 1EXJA 3IF4A 4GDOA 5AW1B 4EYYQ 5KJ7C 1AQTA 4XA4A 3AEBD 2E42A 1H0TB 3H1IJ 3GLMA 1XTCC 1YJ9P 2WQYC 4L74A 1FJKA 2A06D 1KD1Q 1URQA 4UB8H 2Q5UA 1L0NG 1LWUA 1Q82Q 1HGVA 1ZXGA 1JMMA 4W7ZA 2HPCB 5KKZC 3N4XA 3FGAD 3II6A 1QVGO 2Y0CA 2I1KA 1S5LH 2OGUA 2K37A 5BU8B 1VQNP 4H0LD 1PGQA 4H44D 4H13C 2IBZG 3M0AA 2QRXA 2P2UA 3CCLP 1NU1G 3HD7C 1URQD 3RK2C 2WDVC 1U7MA 4H44B 3H25A 1USDA 3G3ZA 2WDRD 2HODA 3CXHH 2OTJP 1LT9B 4UB6H 2YIUB 3AEBC 3CCUP 5APVA 2QM8A 1ZR4A 3MD0A 1HF9A 1IFPA 1KV4A 3VMYA 2O01N 3RK3C 2HR3A 2N9YB 4DT0A 3A0BH 3CX5E 1OW8A 5AVWB 2CPSA 1L0ND 2OYIC 1P84E 3CXHI 3SFDC 2HLOA 2W27A 3A7OA 2G8YA 3AEFD 3HRNA 4KX6D 1ZRTE 5AVVB 2Y0EA 5DJTB 4K3AA 2XKMA 1N7LA 3HE5A 1KFYC 2QVAA 5APYA 1VQOP 2P67A 1HTLC 3RK3E 4U3FD 1FE6A 3WMM0 2KS1B 2P1JA 4U7JA 5AW0B 3L71G 4I7ZB 2LXCB 4QMAA 1SQQJ 3CCRP 1KB9I 1L4AC 1ZLLA 2FYUD 3PH0A 1SLQA 1VQ9P 1FZCC 1N8RQ 3AEFC 1M90Q 4U3FJ 2BEQD 1KFNA 1S4XA 4RO0A 1S5LE 5AW3B 2ZVOB 1FZAA 1GZLA 1UIIA 3A0BE 4HYTB 2JR8A 2E76B 2D2CD 1JY3O 2BEZF 1G1IA 2QE7H 2FYUJ 3G9RA 2P7JA 4N6JA 2NPSC 1FDOA 1A02F 1FC2C 2E5TA 4IL6E 1M1JC 3CXHE 2ZVNB 3L75G 4N78D 1FAVA 1JEKA 1L0LE 2XNDH 1FZCB 4WWIA 4DCKA 1DD3A 2FFDC 1T3JA 3M0DA 2WDVD 4OVNF 1PGOA 2OYIA 2GA1A 1JTHA 5AW9B 1EZVE 3ABVD 1OMIA 2A06G 2W90A 3CX5I 3RK3B 3GHGB 2WT7B 5APQA 1FJPA 4JYCA 1VQPP 4ASVA 2L91A 4YTPC 1BGYG 1G2CB 1LTGC 5CMZA 3CCMP 1EDKA 3AE5D 2C0WA 3Q5SA 1FDIA 2YKOA 1YYCA 3VRBC 4GKGA 1PP9G 1EDLA 2GUSA 2WP9C 1JY3P 1YQ3C 2M8RA 3HTKB 3AEAC 1RH5B 1P84I 1SQXK 3I55P 1MKMA 2RKLA 2YKQA 3GHGA 2HG5D 3LW5H 1GD2E 2FKWB 2IBZD 2M3EA 1SQVK 4DHJA 1MUUA 1SQXJ 1NTZJ 2DW3A 4PV1C 3FXEA 2KLUA 2JJLA 4LDTA 3BCCE 3FWLA 5KKZB 4Z1MH 2WU2D 2GM4A 1URQC 3L70D 2WTYA 2WSCH 3OAKA 4GOEA 1FOSE 3P4QD 3CMEP 5AW4B 1BCCD 5AVXB 1K05A 3GF3A 3HE4A 3W68A 2H89C 3P4RD 1VQMP 1OW7A 3HUSA 2XV5A 1N86A 3H1KG 4WB4A 4ZMDA 1GW4A 1TFFA 3CCSP 3G4SP 4AUWA 1RE4A 3CD6P 2PAJA 2W6BA 1L0NE 2LR2A 1LTJA 3L73G 4BRYA 1SQVE 1GK6A 1MZ9A 1SQQD 3H1HE 4HH2A 1YBKA 4IFFA 3H1JE 1JCCA 2O1KA 3C1LA 4YXDD 2KS1A 1SQBD 2IBZE 3V4QA 2FYNB 3A3YB 3JCUH 2Z5IA 4XFJA 1K04A 1NHLA 2XU6A 3PP5A 5GTIH 1LGHB 5KLVG 3C8VA 2FYNC 3IFMA 3BCCD 2JP3A 2IFMA 1UIXA 3H1KE 3ABVC 3NMDA 4L73A 3FWNA 3L74E 2QJPC 1RQUA 3AE6C 1BE3D 3V2QA 3KDPB 3IN6A 1N7SD 1ZMEC 2XDJA 3PJSK 3AE8C 3QH9A 2YO2A 4KJMA 3VP8A 4GODA 4O9BA 3CCQP 4DDIA 4RESB 1IZNB 2WDQC 1SQQE 2KK7A 2K1AA 2E75C 4I7ZC 1JNMA 1S5LX 1FDMA 3RK2B 1KQFB 1LT1A 3CPWO 1AV1A 4C7RA 1SFCC 3TGUG 1NTMK 5TISE 2KLVA 4L75A 5KLVD 1HJ0A 3L73E 1OXZA 3O6QB 4FJVA 1OVUA 3U1CA 2PGDA 1SQPG 1L4AA 2B9BA 5AVSB 3OA7A 1NTKD 1JM0A 1OFCX 2QIWA 3L72G 1KN7A 3MUDA 4DOJA 3G6EP 2C0XA 3GHGC 3MIWA 3PTZA 3GMAA 2RH0A 1OZHA 3CC7P 3VONA 3H1IG 2OYHB 2FXMA 4DHZA 2H88D 2B89A 2ZYGA 1Q90D 3L72D 1LWUB 4EI2A 1KB9D 2FFDB 4KT0J 1IFJA 3BASA 1KYOI 2A45I 3EFGA 3V2PA 4CPGA 3HE4B 3KZIH 2ACZC 3AE4C 5APTA 1M8OB 1NTMG 3L74D 1YTZT 1SQVG 1BCCG 4OGQC 1Y47A 1S3JA 1BDDA 2AXTE 3NTNA 1OVVA 1ZRTD 1NU1J 4H44C 5APXA 2PFXA 2ZT9D 2BCCJ 2WU2C 1YJNP 1IFNA 1QX8A 1FZEA 2VRSA 4L76A 4R4MA 2MJZA 1FU1A 1W2BO 2BS3C 4C46A 3V6IA 1WMKA 4PD4I 2NPSB 2AXTH 1QEXA 2Q3IA 1BCCE 2L5GB 3AECD 1H8AA 5CCGA 3L73D 3H6PA 1PPJG 2KZIA 1CSBA 3BCCJ 2JEEA 1PGJA 3H1JG 1QVFO 1ZP0D 4NPDA 2KXPB 5KLIC 4H0LC 1FBMA 5B66H 5B5EE 2FXPA 3M9BA 3NXSA 1K8AQ 4YTMD 1NTZK 3L35A 2OYIB 3I5CA 2G3AA 3EFFK 1IFDA 3R2PA 4JPZB 3V2NA 4IL6H 1H88A 1SQPE 2D2CB 1SQXD 2XNXA 4AQRD 2PP6A 1HGZA 3CIRC 3L75E 2HYNA 2K3RA 2O1JA 3P8CD 2E75B 5H2FE 3OW2O 2V7QH 2KIKA 1NWQA 5E79H 3H1KD 2NZ2A 5APSA 2QJYC 1PV3A 1LWUC 3PHLA 4ZNCA 3D71A 3ZDMA 2E5YA 1QGKB 3Q2YA 1KMIZ 2J59M 2KUBA 1LTIC 3HE5B 2KNCA 2OTKE 1VF5C 5C3JD 1IC2A 1GK4A 2Y9YA 3T97B 1WRGA 3L74G 2QJPB 2IDBA 3V4WA 1BGYD 3H1JJ 3P4PD 3AEDD 1HJBA 2FYUG 1IK9A 2ACZD 1SFCD 1AQ5A 3BRTB 5C39A 4WY4C 2E43A 1JCDA 1KFYD 4YTNC 1QLED 1GL2A 3TSIA 4NPFX 1Q7YQ 3B5ND 3AEGC 4H13D 2K9JB 4TLFA 1EZVG 1M1JB 3P4SD 5KLVE 1S1CX 1T2KC 1SS1A 1Y9BA 1SQBK 3F89A 1JY2O 2J58A 1QLBC 1KQLA 2RN0A 3V5BA 1DX7A 1YQ4D 1AJYA 1HVVA 1P84H 5AVQB 2SPZA 5CCHC 1KYOE 1EZVI 3L71E 3M0DC 3W67A 2R3CA 3AEDC 3KXDA 3AECC 3JC22 3VMAA 2WQYD 5KAIE 1D7MA 5CBOA 2ZFYA 3RK3D 3CWBG 3AEEC 1N73C 1GMJA 1SQQG 3AE4D 2IYOA 3L70E 1GU5A 5AVZB 4HB1A 4OGQD 1EDIA 3MHVA 1FZGA 3B5NC 4TT3H 3WUUA 1URQB 1VQ4P 3B71A 5AW7B 3M06A 1BE3G 3GW6A 3HD7D 1H0TA 1AA0A 2WSEJ 2HODB 1E79H 2Q6QA 1T3UA 3TNUB 2N1TC 1R8EA 4JQ0D 1JY2P 1N7SB 2WPSA 3D6YA 2WSCJ 3O8ZA 2IZ1A 1L0VC 2AEMA 1PGPA 4UB6E 4AYCA 1ZOYD 2M5AA 4BXLA 4RKUJ 1XTGB 1FS0E 3VTPC 3IR9A 4DDGA 5K5GB 1M57D 3H1ID 1RY3A 1KILE 4WBAA 1VQ6P 3CX5H 3CX5D 3N7NA 3RGUA 1PP9D 3L36A 1GU4A 5KAIH 2WPQA 3P4PC 4KX6C 2ZT9B 2P10A 1KYOD 5AVRB 3CWBE 1RF0A 4YSZC 1KILA 1T8ZA 1LT9C 4PJ0E 1NKZB 1M1JA 2K9JA 1NH4A 1RE4C 1E5WA 2YMKA 3L70J 2QEXP 2WS3D 2WPRA 4H0LB 4OH8B 4EDFA 3LIDA 3SWFA 3AEGD 3P4QC 3H1LJ 1SQXE 1P84D 1RF0C 3B8EB 1NTZG 2H89D 3P4RC 5AW8B 2QG4A 3BATA 3TGUE 3VN0A 1NYHA 1RF1A 1FZFA 2QA4P 4GT1A 3CCJP 2E76D 2Q1KA 3CI9A 1EXIA 2NPSA 3T97A 1YITP 2LKMA 1IK7A 2KNCB 3TYYA 3H32A 4PV1B 1S9KE 4UB8E 1BSNA 2IYPA 2QJYB 3AE8D 1T6AA 5APUA 4DHIB 4U3FG 1J1EB 1VQKP 2Y0DA 2K88A 5APWA 1HH0A 4U3FE 1RE3A 2BCCE 2XZRA 4WY4D 3VRBD 1NU1D 3CC4P 2PRRA 4H13B 3RL0C 3TGUJ 2QJKB 1GW3A 1NEND 4YT0D 4HJGH 5CCGC 2FYUE 1LTJC 2WPVB 4YXWH 1T2KD 5M1BA 1NTZD 5BU5A 1NGMB 1LJ2A 1MFZA 2FFDA 1PP9E 2YXRB 2Z4EA 1ZV8A 2RMZA 3GG2A 2M5AB 3Q5RA 3AE3C 4IOIH 2WITA 2FBWC 4DZOA 1KQSO 4EIJA 3HTKA 1L0LG 2OYHC 4I1LA 1EDJA 2W8ZA 4YSYD 3IAOA 3WU2E 3C9IA 1KILC 3FXDA 5EFWB 3TNUA 2NRGA 3O6QA 1BSHA 1L0LD 1A02J 2WDQD 3AE2D 1JMBA 1NKNA 2AEFA 1L0NJ 4Y99B 1DIPA 1YQ3D 3CCVP 2C9NY 1NTMJ 3ITKA 2KOGA 4BWNA 3E1RA 3KZIE 2V4HA 1LTAC 3BVHA 4PD4H 3VR8D 2WZ7A 1JTHB 1Q81Q 3S9OA 4D6TE 1G1JA 1YJWP 3VOPA 2W6AA 3AE3D 1U7JA 3K5BA 4OWFA 1LP1B 4R4LA 1JO5A 3GF7A 4PJ0H 1W5CE 3VRAD 1OW6A 2FYZA 1VL2A 3H1HG 2N1TA 4JYBA 2N1TD 3AE1C 1BDCA 3VMZA 1AVYA 1E7PC 1ZR2A 1W2EA 2A45G 4YPCA 3UIAA 2JDIH 5KJ7A 2H8PD 3H1IE 2YIUC 1ZN5A 3MTUE 2ZJSE 1GL2B 5CJ0A 3G71P 1HUCA 4N3YB 1ZW0A 4BRYB 1KQGB 2JKVA 1PPJE 1LTJB 2WS3C 3KQGA 5C2TC 1BCCJ 3KHUA 4ZKPA 1BGYE 3A0HH 1OVRA 4LLHA 2W6JH 3M91A 1H89A 1KF6D 2WSSH 1OX3A 1YTZI 3H1HD 2R5BA 2I8DA 2K9YA 2Q7CA 2LXBA 3HD7A 5GTIE 2FBWD 4IL6X 2KZJA 5AVTB 2KB7P 1J1DB 3MZWB 3L74J 5DJUB 4WY4A 4PD4D 1VDFA 3VMXA 1QL2A 1LNQA 2BASA 1KC8Q 1KFMA 1NAFA 2OQQA 2BCCD 2CK3H 3M9QA 3B5NA 3PLNA 3I56P 3HUSC 3D70A 1FZBA 2N1TB 2ZXXA 3CIRD 2WSEH 3D6ZA 4MN4C 5CBNA 3RL0g 2P58A 1LTSC 2QJKC 3P7KA 1G2CA 2BS4C 4ZKUA 2YMYA 4K35A 1TU3F 5TISH 3Q1MA 3WUVA 2WDRC 3L72J 3B4SA 2WT7A 1NEKC 5CCHA 4EOTA 1L2PA 1VF5D 5C3JC 5CCHD 1GDTA 1BGYJ 1SQPD 3MGNA 1SVFA 1X9VA 2JWAA 1FZCA 3TF5A 1R5SA 1N2DC 4PD4E 2YNYA 4D6TJ 1KILD 3VR8C 2ZYDA 3SFED 2QM7A 1IFMA 4C7NB 1RHZB 1Y8AA 4YTND 2OYOA 1NTKE 3AE9D 1VQ5P 1SQVJ 4LC1A 2AEJA 2E74B 1DEBA 5B66E 5TJHA 2WSFH 1NU1K 2Q3EA 1K73Q 1Z56A 2OYHA 5AW6B 2R44A 3AE7D 1RF1B 1FOSF 2YKPA 4XE5B 3CWBD 1IJDB 2IPPA 3A0HE 1AVOA 1L4AB 1X8YA 1L0NK 4JF7A 5KTBA 3AEED 4C7NA 3SFEC 2IFNA 3AE5C 1M56D 2KSEA 1EC5A 2UWJE 1IFIA 1ZP0C 2GUVA 3BCCG 5L8RJ 2KP8A 1S9KD 4N78E 1L4AD 5GTHH 1VPCA 1JUNA 3M9HA 4YTMC 3TGUD 4IFDK 1VQ7P 2ITAA 2FY8A 1PIXA 4D6TG 1SQBE 1EZVD 1PFIA 1YIJP 1JB0J 1NU1E 4WY4B 3V2RA 3L4FA 3S4RA 3CC2P 4GOFA 2D2CC 2B76C 3MP7B 2WMMA 3H1LG 2W83C 5KLVJ 1X79B 1BE3J 2OARA 2O01J 1AFOA 2FYUK 3P4SC 3RBXA 3B5NB 1PL5A 5KAFE 3USSA 1USEA 3F5HA 2HFED 1JY2N 1KILB 3JCUE 1GL2D 5KLIB 1N7SA 1KF6C 3L71J 1VQ8P 4A7PA 2B87A 1JOCA 2JWDA 2AXCA 2O01H 2WU5D 1PZQA 1N73A 3KYQA 2BS2C 4NPEA 2IBZI 1Q2NA 2R32A 4YSXD 5AW2B 1M1KQ 4I6MC 1NAYA 1EQ7A 2B76D 2WVRA 1NOHA 3HD7B 1SQXG 1YHQP 5AVUB 2O3JA 3VP9A 5GTHE 2FXOA 2WP9D 1KB9H 1NJIQ 3WU2H 3AEAD 2POHA 2E74C 4I2LC 3RL0B 1HBWA 4D6TD 4DJGA 3L72E 2WWWA 1KZUB 1VF5B 1WT6A 1S72P 3L75J 1YI2P 1GL2C 3HUSB 1VQLP 2I1JA 1SQBJ 1YQ4C 3Q3DA 1SP4A 1NEKD 4PV1D 3U59A 4W7YA 3H1KJ 2CPBA 1U57A 3TDKA 1RQVA 3PRJA 1M7LA 1GTWA 3H1JD 3BRVB 4IFMA
chains in the Genus database with same CATH topology
1VL2A 1QLBC 1HF9A 2G3AA 2WSFJ 3ABVC 1YQ4D 3LW5J 1AJYA 1NEND 1KILE 4YT0D 4YTPD 2J5UA 4PV1C 2O01J 3SFDD 2WPVB 2E76B 2QJPC 3P4SC 1RQUA 2ACZC 2D2CD 3AE1C 2BEZF 2E74B 2D2CB 1PL5A 3AE4C 3AE6C 3G9RA 5M1BA 4Z1MH 1FDOA 1E7PC 2WU2D 3VRAC 1NGMB 3IN6A 4OGQC 1ZMEC 3P4PC 1OW8A 2E75D 2ZT9B 3AEDC 3CIRC 4KX6C 2P10A 3AE8C 3AECC 2OQQA 2WQYD 1KF6C 2E74D 4YSZC 4YT0C 3EWKA 4H44C 3P4QD 2E75B 3SFDC 1K05A 3Q5RA 3AEEC 3AE3C 1GMJA 2NZ2A 3VR9D 1EXJA 2QJYC 2QSIA 2ZT9D 4GDOA 2WU5D 3AE4D 2FBWC 1PV3A 2G8YA 3GF3A 3AE7D 2YIUC 3AEFD 1DD3A 2WU2C 2H89C 2YMKA 3P4RD 2BS2C 3D70A 2WDVD 2WDQC 1OW7A 3AEBD 4OGQD 3D71A 2E75C 1ZRTE 3CIRD 4KX6D 4OGQB 4I7ZC 3GLMA 4R4MA 1KMIZ 3Q2YA 3AE9C 1S5LX 4YSXD 2WQYC 3R4YA 3D6ZA 4TT3H 4YSZD 1KTMA 4H0LB 2WS3D 2E76C 3AEGD 3P4QC 3ABVD 1KQFB 1OMIA 4YSYD 3IAOA 3RL0g 2BS3C 3AEED 1WMKA 3SFEC 1VF5C 3B71A 2QJKC 2ZT9C 3AE5C 3Q5PA 2B76D 5C3JD 4YXDC 3T97B 3AE7C 2BS4C 3O6QA 2H89D 3P4RC 5KKZC 1ZP0C 1TU3F 3FGAD 1KFYC 2IDBA 2WDQD 2WSEJ 3AE2D 3Q1MA 1NYHA 1KQGB 5L8RJ 1HJ0A 2WP9D 1DD4A 3P4PD 1DIPA 3AEDD 3RK3E 1KORA 2WS3C 1L0VD 1YQ3D 4YTPC 2E76D 2WDRC 3AECD 4H0LD 3AEAD 5C2TC 2E74C 1EXIA 4YSYC 4H44D 4H13C 1NEKC 2ACZD 1ZOYC 1R8EA 1VF5D 3AE1D 5C3JC 3AE5D 4YXDD 4YTMC 1VF5B 4U7JA 3VR8D 1IK7A 3VR9C 2H88C 3Q5SA 2V7QJ 2JO1A 2WU5C 1FDIA 1KFYD 4I7ZB 3D6YA 1ZP0D 3VRBC 2QIWA 1PIXA 2WSCJ 3AE2C 4PV1B 4YTNC 2WDVC 3AE8D 4H44B 3H25A 1JB0J 4XFJA 1K04A 2WP9C 3S9OA 1KF6D 1YQ3C 1L0VC 2WDRD 3GMAA 5KLIC 3AEAC 1YQ4C 4H0LC 5C2TD 3Q3DA 1NENC 2FXPA 3AEGC 4H13D 4PV1D 1NEKD 3AE3D 1ZOYD 3C8VA 2FYNC 2K9YA 1MKMA 4Y28J 4YTMD 3P4SD 2JP3A 4RKUJ 2FBWD 2D2CC 3SFED 1U57A 3AEFC 2H88D 2B76C 4IL6X 3VR8C 1RQVA 1Q90D 3AE6D 2BEQD 1S1CX 4R4LA 2MKVA 3GF7A 1UIXA 3AEBC 3VRBD 4YTND 1Y9BA 3VRAD 4KT0J 4H13B 1OW6A 3AE9D 4YSXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLB C;  2G3A A;  3ABV C;  1YQ4 D;  1NEN D;  4YT0 D;  4YTP D;  3SFD D;  3P4S C;  2ACZ C;  3AE1 C;  3AE6 C;  3AE4 C;  2WU2 D;  1E7P C;  3VRA C;  3P4P C;  1OW8 A;  3CIR C;  4KX6 C;  3AED C;  3AE8 C;  3AEC C;  2WQY D;  1KF6 C;  4YSZ C;  4YT0 C;  3P4Q D;  3SFD C;  1K05 A;  3AEE C;  3AE3 C;  3VR9 D;  2WU5 D;  3AE4 D;  2FBW C;  1PV3 A;  3AE7 D;  3AEF D;  2WU2 C;  2H89 C;  3P4R D;  2BS2 C;  2WDV D;  2WDQ C;  1OW7 A;  3AEB D;  3CIR D;  4KX6 D;  3AE9 C;  4YSX D;  2WQY C;  4YSZ D;  1KTM A;  2WS3 D;  3AEG D;  3P4Q C;  3ABV D;  4YSY D;  2BS3 C;  3AEE D;  3SFE C;  3B71 A;  5C3J D;  2B76 D;  3AE5 C;  4YXD C;  3AE7 C;  2BS4 C;  2H89 D;  3P4R C;  1ZP0 C;  1KFY C;  2WDQ D;  3AE2 D;  2WP9 D;  3P4P D;  3AED D;  2WS3 C;  1L0V D;  1YQ3 D;  4YTP C;  2WDR C;  3AEC D;  3AEA D;  5C2T C;  4YSY C;  1NEK C;  2ACZ D;  1ZOY C;  3AE1 D;  5C3J C;  3AE5 D;  4YXD D;  4YTM C;  3VR8 D;  3VR9 C;  2H88 C;  2WU5 C;  1ZP0 D;  1KFY D;  3VRB C;  3AE2 C;  4YTN C;  2WDV C;  3AE8 D;  2WP9 C;  1K04 A;  3S9O A;  1KF6 D;  1YQ3 C;  1L0V C;  2WDR D;  3AEA C;  1YQ4 C;  5C2T D;  1NEN C;  3AEG C;  1NEK D;  3AE3 D;  1ZOY D;  4YTM D;  3P4S D;  2FBW D;  3VR8 C;  3SFE D;  3AEF C;  2H88 D;  2B76 C;  3AE6 D;  3VRB D;  3AEB C;  4YTN D;  3VRA D;  1OW6 A;  3AE9 D;  4YSX C; 
#chains in the Genus database with same CATH topology
 1K9M Q;  3A2A A;  1NTK J;  4Y99 C;  4YTP D;  3L73 J;  3S1K A;  3CXH D;  1OWA A;  3RBZ A;  5B5E H;  3CWB J;  3RL0 D;  3NFQ A;  1DEE G;  2E74 D;  3CL3 D;  3EWK A;  1PP9 J;  5AW5 B;  2IZ0 A;  1JY3 N;  3KPE A;  1LT9 A;  4M3L A;  1L0L K;  1NVO A;  2QSI A;  2Y9Z A;  4WVZ A;  1J1E C;  1R5L A;  4ASW A;  4OGQ B;  3H1L E;  3AE9 C;  3R4Y A;  1MV8 A;  4YSZ D;  2BCC G;  1PPJ D;  1BE3 E;  1LP1 A;  2ZT9 C;  3Q5P A;  4YXD C;  3FX0 A;  3AE7 C;  3P32 A;  3H1H J;  3RK2 D;  1DD4 A;  4GIF A;  2ZFC A;  1KOR A;  2H7H A;  4JBZ A;  1L0V D;  2HPC A;  3VYI A;  1ZOY C;  3AE1 D;  2KI7 B;  1NTM E;  3L37 A;  1SQB G;  3VR9 C;  2M0B A;  2JO1 A;  3MUD C;  5KJ7 D;  2ZXE B;  3CLQ A;  1QL1 A;  3OJA B;  1N73 B;  1LTT C;  1SQQ K;  2KYV A;  1X0T A;  1NTK G;  2B87 B;  1RE3 C;  3AE6 D;  1RF1 C;  3L75 D;  4YSX C;  3P8C E;  1SQP K;  3A5T A;  1CW5 A;  4I6L A;  3SFD D;  1J2J B;  1SFC A;  2M3B A;  3VRA C;  3H1L D;  1OIP A;  4HKZ H;  2E75 D;  3H32 B;  1DH3 A;  5E79 E;  2YXQ B;  4YT0 C;  3L70 G;  1NO4 A;  5KAF H;  3EQ2 A;  2Q9I A;  1KB9 E;  1J1D C;  2B88 A;  5AVY B;  1X22 A;  2A06 E;  3JSV C;  5BVZ A;  3LIE A;  1KTM A;  2E76 C;  2Z5H A;  1KYO H;  2A45 H;  3E7K A;  2YO3 A;  1CI6 B;  3E1I A;  1S2E A;  2ZYA A;  2KSJ A;  1N7S C;  3WUT A;  3SWK A;  2R3S A;  5CJ4 A;  4KHX A;  3CMA P;  1CZQ A;  4YSY C;  2C9L Y;  4B86 A;  1CI6 A;  3SWY A;  4W80 A;  2H43 A;  2H88 C;  2V7Q J;  1SQV D;  2WU5 C;  1NTM D;  3AE2 C;  1Q86 Q;  2R5D A;  5KLV K;  5C2T D;  5CHX A;  1NEN C;  5CCG D;  3CCE P;  2OTL P;  2N9B A;  2ZAE B;  4Y28 J;  1IO4 A;  3U1A A;  3L71 D;  2MKV A;  2NPS D;  5H2F H;  3SSU A;  4LGD E;  1NTK K;  2WSF J;  1MFT A;  2IX7 C;  3LW5 J;  4RJT A;  1SFC B;  1HWT C;  2J5U A;  1NTZ E;  3QWO C;  1SQP J;  3TK1 A;  1LTB C;  1L0L J;  3P8M C;  3VR9 D;  1EXJ A;  3IF4 A;  4GDO A;  5AW1 B;  4EYY Q;  5KJ7 C;  1AQT A;  4XA4 A;  3AEB D;  2E42 A;  1H0T B;  3H1I J;  3GLM A;  1XTC C;  1YJ9 P;  2WQY C;  4L74 A;  1FJK A;  2A06 D;  1KD1 Q;  1URQ A;  4UB8 H;  2Q5U A;  1L0N G;  1LWU A;  1Q82 Q;  1HGV A;  1ZXG A;  1JMM A;  4W7Z A;  2HPC B;  5KKZ C;  3N4X A;  3FGA D;  3II6 A;  1QVG O;  2Y0C A;  2I1K A;  1S5L H;  2OGU A;  2K37 A;  5BU8 B;  1VQN P;  4H0L D;  1PGQ A;  4H44 D;  4H13 C;  2IBZ G;  3M0A A;  2QRX A;  2P2U A;  3CCL P;  1NU1 G;  3HD7 C;  1URQ D;  3RK2 C;  2WDV C;  1U7M A;  4H44 B;  3H25 A;  1USD A;  3G3Z A;  2WDR D;  2HOD A;  3CXH H;  2OTJ P;  1LT9 B;  4UB6 H;  2YIU B;  3AEB C;  3CCU P;  5APV A;  2QM8 A;  1ZR4 A;  3MD0 A;  1HF9 A;  1IFP A;  1KV4 A;  3VMY A;  2O01 N;  3RK3 C;  2HR3 A;  2N9Y B;  4DT0 A;  3A0B H;  3CX5 E;  1OW8 A;  5AVW B;  2CPS A;  1L0N D;  2OYI C;  1P84 E;  3CXH I;  3SFD C;  2HLO A;  2W27 A;  3A7O A;  2G8Y A;  3AEF D;  3HRN A;  4KX6 D;  1ZRT E;  5AVV B;  2Y0E A;  5DJT B;  4K3A A;  2XKM A;  1N7L A;  3HE5 A;  1KFY C;  2QVA A;  5APY A;  1VQO P;  2P67 A;  1HTL C;  3RK3 E;  4U3F D;  1FE6 A;  3WMM 0;  2KS1 B;  2P1J A;  4U7J A;  5AW0 B;  3L71 G;  4I7Z B;  2LXC B;  4QMA A;  1SQQ J;  3CCR P;  1KB9 I;  1L4A C;  1ZLL A;  2FYU D;  3PH0 A;  1SLQ A;  1VQ9 P;  1FZC C;  1N8R Q;  3AEF C;  1M90 Q;  4U3F J;  2BEQ D;  1KFN A;  1S4X A;  4RO0 A;  1S5L E;  5AW3 B;  2ZVO B;  1FZA A;  1GZL A;  1UII A;  3A0B E;  4HYT B;  2JR8 A;  2E76 B;  2D2C D;  1JY3 O;  2BEZ F;  1G1I A;  2QE7 H;  2FYU J;  3G9R A;  2P7J A;  4N6J A;  2NPS C;  1FDO A;  1A02 F;  1FC2 C;  2E5T A;  4IL6 E;  1M1J C;  3CXH E;  2ZVN B;  3L75 G;  4N78 D;  1FAV A;  1JEK A;  1L0L E;  2XND H;  1FZC B;  4WWI A;  4DCK A;  1DD3 A;  2FFD C;  1T3J A;  3M0D A;  2WDV D;  4OVN F;  1PGO A;  2OYI A;  2GA1 A;  1JTH A;  5AW9 B;  1EZV E;  3ABV D;  1OMI A;  2A06 G;  2W90 A;  3CX5 I;  3RK3 B;  3GHG B;  2WT7 B;  5APQ A;  1FJP A;  4JYC A;  1VQP P;  4ASV A;  2L91 A;  4YTP C;  1BGY G;  1G2C B;  1LTG C;  5CMZ A;  3CCM P;  1EDK A;  3AE5 D;  2C0W A;  3Q5S A;  1FDI A;  2YKO A;  1YYC A;  3VRB C;  4GKG A;  1PP9 G;  1EDL A;  2GUS A;  2WP9 C;  1JY3 P;  1YQ3 C;  2M8R A;  3HTK B;  3AEA C;  1RH5 B;  1P84 I;  1SQX K;  3I55 P;  1MKM A;  2RKL A;  2YKQ A;  3GHG A;  2HG5 D;  3LW5 H;  1GD2 E;  2FKW B;  2IBZ D;  2M3E A;  1SQV K;  4DHJ A;  1MUU A;  1SQX J;  1NTZ J;  2DW3 A;  4PV1 C;  3FXE A;  2KLU A;  2JJL A;  4LDT A;  3BCC E;  3FWL A;  5KKZ B;  4Z1M H;  2WU2 D;  2GM4 A;  1URQ C;  3L70 D;  2WTY A;  2WSC H;  3OAK A;  4GOE A;  1FOS E;  3P4Q D;  3CME P;  5AW4 B;  1BCC D;  5AVX B;  1K05 A;  3GF3 A;  3HE4 A;  3W68 A;  2H89 C;  3P4R D;  1VQM P;  1OW7 A;  3HUS A;  2XV5 A;  1N86 A;  3H1K G;  4WB4 A;  4ZMD A;  1GW4 A;  1TFF A;  3CCS P;  3G4S P;  4AUW A;  1RE4 A;  3CD6 P;  2PAJ A;  2W6B A;  1L0N E;  2LR2 A;  1LTJ A;  3L73 G;  4BRY A;  1SQV E;  1GK6 A;  1MZ9 A;  1SQQ D;  3H1H E;  4HH2 A;  1YBK A;  4IFF A;  3H1J E;  1JCC A;  2O1K A;  3C1L A;  4YXD D;  2KS1 A;  1SQB D;  2IBZ E;  3V4Q A;  2FYN B;  3A3Y B;  3JCU H;  2Z5I A;  4XFJ A;  1K04 A;  1NHL A;  2XU6 A;  3PP5 A;  5GTI H;  1LGH B;  5KLV G;  3C8V A;  2FYN C;  3IFM A;  3BCC D;  2JP3 A;  2IFM A;  1UIX A;  3H1K E;  3ABV C;  3NMD A;  4L73 A;  3FWN A;  3L74 E;  2QJP C;  1RQU A;  3AE6 C;  1BE3 D;  3V2Q A;  3KDP B;  3IN6 A;  1N7S D;  1ZME C;  2XDJ A;  3PJS K;  3AE8 C;  3QH9 A;  2YO2 A;  4KJM A;  3VP8 A;  4GOD A;  4O9B A;  3CCQ P;  4DDI A;  4RES B;  1IZN B;  2WDQ C;  1SQQ E;  2KK7 A;  2K1A A;  2E75 C;  4I7Z C;  1JNM A;  1S5L X;  1FDM A;  3RK2 B;  1KQF B;  1LT1 A;  3CPW O;  1AV1 A;  4C7R A;  1SFC C;  3TGU G;  1NTM K;  5TIS E;  2KLV A;  4L75 A;  5KLV D;  1HJ0 A;  3L73 E;  1OXZ A;  3O6Q B;  4FJV A;  1OVU A;  3U1C A;  2PGD A;  1SQP G;  1L4A A;  2B9B A;  5AVS B;  3OA7 A;  1NTK D;  1JM0 A;  1OFC X;  2QIW A;  3L72 G;  1KN7 A;  3MUD A;  4DOJ A;  3G6E P;  2C0X A;  3GHG C;  3MIW A;  3PTZ A;  3GMA A;  2RH0 A;  1OZH A;  3CC7 P;  3VON A;  3H1I G;  2OYH B;  2FXM A;  4DHZ A;  2H88 D;  2B89 A;  2ZYG A;  1Q90 D;  3L72 D;  1LWU B;  4EI2 A;  1KB9 D;  2FFD B;  4KT0 J;  1IFJ A;  3BAS A;  1KYO I;  2A45 I;  3EFG A;  3V2P A;  4CPG A;  3HE4 B;  3KZI H;  2ACZ C;  3AE4 C;  5APT A;  1M8O B;  1NTM G;  3L74 D;  1YTZ T;  1SQV G;  1BCC G;  4OGQ C;  1Y47 A;  1S3J A;  1BDD A;  2AXT E;  3NTN A;  1OVV A;  1ZRT D;  1NU1 J;  4H44 C;  5APX A;  2PFX A;  2ZT9 D;  2BCC J;  2WU2 C;  1YJN P;  1IFN A;  1QX8 A;  1FZE A;  2VRS A;  4L76 A;  4R4M A;  2MJZ A;  1FU1 A;  1W2B O;  2BS3 C;  4C46 A;  3V6I A;  1WMK A;  4PD4 I;  2NPS B;  2AXT H;  1QEX A;  2Q3I A;  1BCC E;  2L5G B;  3AEC D;  1H8A A;  5CCG A;  3L73 D;  3H6P A;  1PPJ G;  2KZI A;  1CSB A;  3BCC J;  2JEE A;  1PGJ A;  3H1J G;  1QVF O;  1ZP0 D;  4NPD A;  2KXP B;  5KLI C;  4H0L C;  1FBM A;  5B66 H;  5B5E E;  2FXP A;  3M9B A;  3NXS A;  1K8A Q;  4YTM D;  1NTZ K;  3L35 A;  2OYI B;  3I5C A;  2G3A A;  3EFF K;  1IFD A;  3R2P A;  4JPZ B;  3V2N A;  4IL6 H;  1H88 A;  1SQP E;  2D2C B;  1SQX D;  2XNX A;  4AQR D;  2PP6 A;  1HGZ A;  3CIR C;  3L75 E;  2HYN A;  2K3R A;  2O1J A;  3P8C D;  2E75 B;  5H2F E;  3OW2 O;  2V7Q H;  2KIK A;  1NWQ A;  5E79 H;  3H1K D;  2NZ2 A;  5APS A;  2QJY C;  1PV3 A;  1LWU C;  3PHL A;  4ZNC A;  3D71 A;  3ZDM A;  2E5Y A;  1QGK B;  3Q2Y A;  1KMI Z;  2J59 M;  2KUB A;  1LTI C;  3HE5 B;  2KNC A;  2OTK E;  1VF5 C;  5C3J D;  1IC2 A;  1GK4 A;  2Y9Y A;  3T97 B;  1WRG A;  3L74 G;  2QJP B;  2IDB A;  3V4W A;  1BGY D;  3H1J J;  3P4P D;  3AED D;  1HJB A;  2FYU G;  1IK9 A;  2ACZ D;  1SFC D;  1AQ5 A;  3BRT B;  5C39 A;  4WY4 C;  2E43 A;  1JCD A;  1KFY D;  4YTN C;  1QLE D;  1GL2 A;  3TSI A;  4NPF X;  1Q7Y Q;  3B5N D;  3AEG C;  4H13 D;  2K9J B;  4TLF A;  1EZV G;  1M1J B;  3P4S D;  5KLV E;  1S1C X;  1T2K C;  1SS1 A;  1Y9B A;  1SQB K;  3F89 A;  1JY2 O;  2J58 A;  1QLB C;  1KQL A;  2RN0 A;  3V5B A;  1DX7 A;  1YQ4 D;  1AJY A;  1HVV A;  1P84 H;  5AVQ B;  2SPZ A;  5CCH C;  1KYO E;  1EZV I;  3L71 E;  3M0D C;  3W67 A;  2R3C A;  3AED C;  3KXD A;  3AEC C;  3JC2 2;  3VMA A;  2WQY D;  5KAI E;  1D7M A;  5CBO A;  2ZFY A;  3RK3 D;  3CWB G;  3AEE C;  1N73 C;  1GMJ A;  1SQQ G;  3AE4 D;  2IYO A;  3L70 E;  1GU5 A;  5AVZ B;  4HB1 A;  4OGQ D;  1EDI A;  3MHV A;  1FZG A;  3B5N C;  4TT3 H;  3WUU A;  1URQ B;  1VQ4 P;  3B71 A;  5AW7 B;  3M06 A;  1BE3 G;  3GW6 A;  3HD7 D;  1H0T A;  1AA0 A;  2WSE J;  2HOD B;  1E79 H;  2Q6Q A;  1T3U A;  3TNU B;  2N1T C;  1R8E A;  4JQ0 D;  1JY2 P;  1N7S B;  2WPS A;  3D6Y A;  2WSC J;  3O8Z A;  2IZ1 A;  1L0V C;  2AEM A;  1PGP A;  4UB6 E;  4AYC A;  1ZOY D;  2M5A A;  4BXL A;  4RKU J;  1XTG B;  1FS0 E;  3VTP C;  3IR9 A;  4DDG A;  5K5G B;  1M57 D;  3H1I D;  1RY3 A;  1KIL E;  4WBA A;  1VQ6 P;  3CX5 H;  3CX5 D;  3N7N A;  3RGU A;  1PP9 D;  3L36 A;  1GU4 A;  5KAI H;  2WPQ A;  3P4P C;  4KX6 C;  2ZT9 B;  2P10 A;  1KYO D;  5AVR B;  3CWB E;  1RF0 A;  4YSZ C;  1KIL A;  1T8Z A;  1LT9 C;  4PJ0 E;  1NKZ B;  1M1J A;  2K9J A;  1NH4 A;  1RE4 C;  1E5W A;  2YMK A;  3L70 J;  2QEX P;  2WS3 D;  2WPR A;  4H0L B;  4OH8 B;  4EDF A;  3LID A;  3SWF A;  3AEG D;  3P4Q C;  3H1L J;  1SQX E;  1P84 D;  1RF0 C;  3B8E B;  1NTZ G;  2H89 D;  3P4R C;  5AW8 B;  2QG4 A;  3BAT A;  3TGU E;  3VN0 A;  1NYH A;  1RF1 A;  1FZF A;  2QA4 P;  4GT1 A;  3CCJ P;  2E76 D;  2Q1K A;  3CI9 A;  1EXI A;  2NPS A;  3T97 A;  1YIT P;  2LKM A;  1IK7 A;  2KNC B;  3TYY A;  3H32 A;  4PV1 B;  1S9K E;  4UB8 E;  1BSN A;  2IYP A;  2QJY B;  3AE8 D;  1T6A A;  5APU A;  4DHI B;  4U3F G;  1J1E B;  1VQK P;  2Y0D A;  2K88 A;  5APW A;  1HH0 A;  4U3F E;  1RE3 A;  2BCC E;  2XZR A;  4WY4 D;  3VRB D;  1NU1 D;  3CC4 P;  2PRR A;  4H13 B;  3RL0 C;  3TGU J;  2QJK B;  1GW3 A;  1NEN D;  4YT0 D;  4HJG H;  5CCG C;  2FYU E;  1LTJ C;  2WPV B;  4YXW H;  1T2K D;  5M1B A;  1NTZ D;  5BU5 A;  1NGM B;  1LJ2 A;  1MFZ A;  2FFD A;  1PP9 E;  2YXR B;  2Z4E A;  1ZV8 A;  2RMZ A;  3GG2 A;  2M5A B;  3Q5R A;  3AE3 C;  4IOI H;  2WIT A;  2FBW C;  4DZO A;  1KQS O;  4EIJ A;  3HTK A;  1L0L G;  2OYH C;  4I1L A;  1EDJ A;  2W8Z A;  4YSY D;  3IAO A;  3WU2 E;  3C9I A;  1KIL C;  3FXD A;  5EFW B;  3TNU A;  2NRG A;  3O6Q A;  1BSH A;  1L0L D;  1A02 J;  2WDQ D;  3AE2 D;  1JMB A;  1NKN A;  2AEF A;  1L0N J;  4Y99 B;  1DIP A;  1YQ3 D;  3CCV P;  2C9N Y;  1NTM J;  3ITK A;  2KOG A;  4BWN A;  3E1R A;  3KZI E;  2V4H A;  1LTA C;  3BVH A;  4PD4 H;  3VR8 D;  2WZ7 A;  1JTH B;  1Q81 Q;  3S9O A;  4D6T E;  1G1J A;  1YJW P;  3VOP A;  2W6A A;  3AE3 D;  1U7J A;  3K5B A;  4OWF A;  1LP1 B;  4R4L A;  1JO5 A;  3GF7 A;  4PJ0 H;  1W5C E;  3VRA D;  1OW6 A;  2FYZ A;  1VL2 A;  3H1H G;  2N1T A;  4JYB A;  2N1T D;  3AE1 C;  1BDC A;  3VMZ A;  1AVY A;  1E7P C;  1ZR2 A;  1W2E A;  2A45 G;  4YPC A;  3UIA A;  2JDI H;  5KJ7 A;  2H8P D;  3H1I E;  2YIU C;  1ZN5 A;  3MTU E;  2ZJS E;  1GL2 B;  5CJ0 A;  3G71 P;  1HUC A;  4N3Y B;  1ZW0 A;  4BRY B;  1KQG B;  2JKV A;  1PPJ E;  1LTJ B;  2WS3 C;  3KQG A;  5C2T C;  1BCC J;  3KHU A;  4ZKP A;  1BGY E;  3A0H H;  1OVR A;  4LLH A;  2W6J H;  3M91 A;  1H89 A;  1KF6 D;  2WSS H;  1OX3 A;  1YTZ I;  3H1H D;  2R5B A;  2I8D A;  2K9Y A;  2Q7C A;  2LXB A;  3HD7 A;  5GTI E;  2FBW D;  4IL6 X;  2KZJ A;  5AVT B;  2KB7 P;  1J1D B;  3MZW B;  3L74 J;  5DJU B;  4WY4 A;  4PD4 D;  1VDF A;  3VMX A;  1QL2 A;  1LNQ A;  2BAS A;  1KC8 Q;  1KFM A;  1NAF A;  2OQQ A;  2BCC D;  2CK3 H;  3M9Q A;  3B5N A;  3PLN A;  3I56 P;  3HUS C;  3D70 A;  1FZB A;  2N1T B;  2ZXX A;  3CIR D;  2WSE H;  3D6Z A;  4MN4 C;  5CBN A;  3RL0 g;  2P58 A;  1LTS C;  2QJK C;  3P7K A;  1G2C A;  2BS4 C;  4ZKU A;  2YMY A;  4K35 A;  1TU3 F;  5TIS H;  3Q1M A;  3WUV A;  2WDR C;  3L72 J;  3B4S A;  2WT7 A;  1NEK C;  5CCH A;  4EOT A;  1L2P A;  1VF5 D;  5C3J C;  5CCH D;  1GDT A;  1BGY J;  1SQP D;  3MGN A;  1SVF A;  1X9V A;  2JWA A;  1FZC A;  3TF5 A;  1R5S A;  1N2D C;  4PD4 E;  2YNY A;  4D6T J;  1KIL D;  3VR8 C;  2ZYD A;  3SFE D;  2QM7 A;  1IFM A;  4C7N B;  1RHZ B;  1Y8A A;  4YTN D;  2OYO A;  1NTK E;  3AE9 D;  1VQ5 P;  1SQV J;  4LC1 A;  2AEJ A;  2E74 B;  1DEB A;  5B66 E;  5TJH A;  2WSF H;  1NU1 K;  2Q3E A;  1K73 Q;  1Z56 A;  2OYH A;  5AW6 B;  2R44 A;  3AE7 D;  1RF1 B;  1FOS F;  2YKP A;  4XE5 B;  3CWB D;  1IJD B;  2IPP A;  3A0H E;  1AVO A;  1L4A B;  1X8Y A;  1L0N K;  4JF7 A;  5KTB A;  3AEE D;  4C7N A;  3SFE C;  2IFN A;  3AE5 C;  1M56 D;  2KSE A;  1EC5 A;  2UWJ E;  1IFI A;  1ZP0 C;  2GUV A;  3BCC G;  5L8R J;  2KP8 A;  1S9K D;  4N78 E;  1L4A D;  5GTH H;  1VPC A;  1JUN A;  3M9H A;  4YTM C;  3TGU D;  4IFD K;  1VQ7 P;  2ITA A;  2FY8 A;  1PIX A;  4D6T G;  1SQB E;  1EZV D;  1PFI A;  1YIJ P;  1JB0 J;  1NU1 E;  4WY4 B;  3V2R A;  3L4F A;  3S4R A;  3CC2 P;  4GOF A;  2D2C C;  2B76 C;  3MP7 B;  2WMM A;  3H1L G;  2W83 C;  5KLV J;  1X79 B;  1BE3 J;  2OAR A;  2O01 J;  1AFO A;  2FYU K;  3P4S C;  3RBX A;  3B5N B;  1PL5 A;  5KAF E;  3USS A;  1USE A;  3F5H A;  2HFE D;  1JY2 N;  1KIL B;  3JCU E;  1GL2 D;  5KLI B;  1N7S A;  1KF6 C;  3L71 J;  1VQ8 P;  4A7P A;  2B87 A;  1JOC A;  2JWD A;  2AXC A;  2O01 H;  2WU5 D;  1PZQ A;  1N73 A;  3KYQ A;  2BS2 C;  4NPE A;  2IBZ I;  1Q2N A;  2R32 A;  4YSX D;  5AW2 B;  1M1K Q;  4I6M C;  1NAY A;  1EQ7 A;  2B76 D;  2WVR A;  1NOH A;  3HD7 B;  1SQX G;  1YHQ P;  5AVU B;  2O3J A;  3VP9 A;  5GTH E;  2FXO A;  2WP9 D;  1KB9 H;  1NJI Q;  3WU2 H;  3AEA D;  2POH A;  2E74 C;  4I2L C;  3RL0 B;  1HBW A;  4D6T D;  4DJG A;  3L72 E;  2WWW A;  1KZU B;  1VF5 B;  1WT6 A;  1S72 P;  3L75 J;  1YI2 P;  1GL2 C;  3HUS B;  1VQL P;  2I1J A;  1SQB J;  1YQ4 C;  3Q3D A;  1SP4 A;  1NEK D;  4PV1 D;  3U59 A;  4W7Y A;  3H1K J;  2CPB A;  1U57 A;  3TDK A;  1RQV A;  3PRJ A;  1M7L A;  1GTW A;  3H1J D;  3BRV B;  4IFM A; 
#chains in the Genus database with same CATH homology
 1VL2 A;  1QLB C;  1HF9 A;  2G3A A;  2WSF J;  3ABV C;  1YQ4 D;  3LW5 J;  1AJY A;  1NEN D;  1KIL E;  4YT0 D;  4YTP D;  2J5U A;  4PV1 C;  2O01 J;  3SFD D;  2WPV B;  2E76 B;  2QJP C;  3P4S C;  1RQU A;  2ACZ C;  2D2C D;  3AE1 C;  2BEZ F;  2E74 B;  2D2C B;  1PL5 A;  3AE4 C;  3AE6 C;  3G9R A;  5M1B A;  4Z1M H;  1FDO A;  1E7P C;  2WU2 D;  3VRA C;  1NGM B;  3IN6 A;  4OGQ C;  1ZME C;  3P4P C;  1OW8 A;  2E75 D;  2ZT9 B;  3AED C;  3CIR C;  4KX6 C;  2P10 A;  3AE8 C;  3AEC C;  2OQQ A;  2WQY D;  1KF6 C;  2E74 D;  4YSZ C;  4YT0 C;  3EWK A;  4H44 C;  3P4Q D;  2E75 B;  3SFD C;  1K05 A;  3Q5R A;  3AEE C;  3AE3 C;  1GMJ A;  2NZ2 A;  3VR9 D;  1EXJ A;  2QJY C;  2QSI A;  2ZT9 D;  4GDO A;  2WU5 D;  3AE4 D;  2FBW C;  1PV3 A;  2G8Y A;  3GF3 A;  3AE7 D;  2YIU C;  3AEF D;  1DD3 A;  2WU2 C;  2H89 C;  2YMK A;  3P4R D;  2BS2 C;  3D70 A;  2WDV D;  2WDQ C;  1OW7 A;  3AEB D;  4OGQ D;  3D71 A;  2E75 C;  1ZRT E;  3CIR D;  4KX6 D;  4OGQ B;  4I7Z C;  3GLM A;  4R4M A;  1KMI Z;  3Q2Y A;  3AE9 C;  1S5L X;  4YSX D;  2WQY C;  3R4Y A;  3D6Z A;  4TT3 H;  4YSZ D;  1KTM A;  4H0L B;  2WS3 D;  2E76 C;  3AEG D;  3P4Q C;  3ABV D;  1KQF B;  1OMI A;  4YSY D;  3IAO A;  3RL0 g;  2BS3 C;  3AEE D;  1WMK A;  3SFE C;  1VF5 C;  3B71 A;  2QJK C;  2ZT9 C;  3AE5 C;  3Q5P A;  2B76 D;  5C3J D;  4YXD C;  3T97 B;  3AE7 C;  2BS4 C;  3O6Q A;  2H89 D;  3P4R C;  5KKZ C;  1ZP0 C;  1TU3 F;  3FGA D;  1KFY C;  2IDB A;  2WDQ D;  2WSE J;  3AE2 D;  3Q1M A;  1NYH A;  1KQG B;  5L8R J;  1HJ0 A;  2WP9 D;  1DD4 A;  3P4P D;  1DIP A;  3AED D;  3RK3 E;  1KOR A;  2WS3 C;  1L0V D;  1YQ3 D;  4YTP C;  2E76 D;  2WDR C;  3AEC D;  4H0L D;  3AEA D;  5C2T C;  2E74 C;  1EXI A;  4YSY C;  4H44 D;  4H13 C;  1NEK C;  2ACZ D;  1ZOY C;  1R8E A;  1VF5 D;  3AE1 D;  5C3J C;  3AE5 D;  4YXD D;  4YTM C;  1VF5 B;  4U7J A;  3VR8 D;  1IK7 A;  3VR9 C;  2H88 C;  3Q5S A;  2V7Q J;  2JO1 A;  2WU5 C;  1FDI A;  1KFY D;  4I7Z B;  3D6Y A;  1ZP0 D;  3VRB C;  2QIW A;  1PIX A;  2WSC J;  3AE2 C;  4PV1 B;  4YTN C;  2WDV C;  3AE8 D;  4H44 B;  3H25 A;  1JB0 J;  4XFJ A;  1K04 A;  2WP9 C;  3S9O A;  1KF6 D;  1YQ3 C;  1L0V C;  2WDR D;  3GMA A;  5KLI C;  3AEA C;  1YQ4 C;  4H0L C;  5C2T D;  3Q3D A;  1NEN C;  2FXP A;  3AEG C;  4H13 D;  4PV1 D;  1NEK D;  3AE3 D;  1ZOY D;  3C8V A;  2FYN C;  2K9Y A;  1MKM A;  4Y28 J;  4YTM D;  3P4S D;  2JP3 A;  4RKU J;  2FBW D;  2D2C C;  3SFE D;  1U57 A;  3AEF C;  2H88 D;  2B76 C;  4IL6 X;  3VR8 C;  1RQV A;  1Q90 D;  3AE6 D;  2BEQ D;  1S1C X;  4R4L A;  2MKV A;  3GF7 A;  1UIX A;  3AEB C;  3VRB D;  4YTN D;  1Y9B A;  3VRA D;  4KT0 J;  4H13 B;  1OW6 A;  3AE9 D;  4YSX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...