3AE5C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-methyl-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Methyl-N-(3-isopropoxy-phenyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae5C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae5C02
1K04A 1KFYC 3P4QC 4YTND 3S9OA 4KX6C 4YTNC 1YQ4D 2ACZD 1ZOYC 3P4RD 1KF6D 3ABVD 2WU5D 1NEKC 1E7PC 2WU2C 3AE6C 2BS3C 1NEKD 2G3AA 3AECD 3AE5D 3VRBC 3AE4D 4YSYC 2WDVC 1NENC 3SFDC 3AE3D 3AEED 3AE4C 3VR9C 1ZOYD 4YSZD 1OW6A 3P4PC 2WP9C 5C2TC 2BS4C 3CIRC 4YXDC 2B76D 3VRAD 2WP9D 2WQYD 3AECC 1ZP0C 3AEBC 4YTPC 2B76C 2WDQD 3VRAC 3AE7C 2WS3C 3AEEC 3SFDD 1L0VC 1NEND 5C3JC 3VR8D 4KX6D 1K05A 2WU5C 3P4SD 2ACZC 1KTMA 4YSZC 1YQ3C 3ABVC 3P4SC 4YXDD 3AE2D 2WDRC 3AE6D 3AE8D 3B71A 3AEBD 4YTPD 1KFYD 3AE1C 3AEDC 2H88C 3VR8C 3AEFD 1PV3A 2H88D 5C3JD 4YSYD 3AEFC 3P4PD 3AEDD 1KF6C 3P4QD 1YQ3D 5C2TD 1ZP0D 1YQ4C 2WDQC 1OW7A 3AE9C 2WDRD 3CIRD 3AE2C 2H89D 4YSXD 2WQYC 3AEAD 1QLBC 3AEGC 4YT0D 4YSXC 2WDVD 2WS3D 3AE3C 3AE7D 1L0VD 2BS2C 4YTMD 3SFED 3AEGD 4YT0C 3AE9D 1OW8A 3P4RC 4YTMC 3AE5C 3VRBD 2FBWC 3AE8C 3SFEC 2H89C 2WU2D 2FBWD 3AEAC 3AE1D 3VR9D
chains in the Genus database with same CATH superfamily
1K04A 5AVVB 3RK3C 5APQA 3V4QA 1IFNA 4QMAA 2GUVA 3CX5E 1W5CE 5KAFH 2K9YA 4MN4C 5E79H 1BGYE 3JCUH 3U59A 4PD4H 1T2KC 1VQNP 1L0ND 4UB8E 1WRGA 1OVRA 3L4FA 5KAIH 1LTJA 1FZCB 5H2FH 3LW5H 4L76A 1MFTA 1KB9I 1R8EA 2V7QH 3VRAC 3AEEC 3CX5H 2VRSA 4OVNF 2OGUA 5AW8B 1L0LJ 2JWDA 1LP1B 1Q81Q 5CCHD 2FYUD 4W7ZA 2OTLP 4YTPD 1KFYD 5APTA 1LTJC 1Q7YQ 3Q5RA 2H88D 1J1EC 1JY2O 1NTKG 1FOSE 4GKGA 1S1CX 4H44D 4RESB 1OVVA 1CW5A 1SQXK 3CWBE 2BASA 1LTTC 4YSXD 1NTMK 1VQKP 1PGPA 1GW3A 4JBZA 3CLQA 3R4YA 3TSIA 3CWBJ 3CD6P 3BCCG 1NJIQ 1RE4A 3Q1MA 1QL2A 3AE8C 5KAFE 5AW7B 1LWUB 2YO2A 2FBWD 3AEAC 1SQPD 3RL0B 2W6AA 3D6YA 5B5EE 1URQD 1FZFA 3ABVD 3E7KA 5KLVK 1ZN5A 2IYOA 5AW3B 3VRBC 5AVRB 2JKVA 1NTZD 4YPCA 4WY4D 1AA0A 3OJAB 1ZOYD 2C9NY 1YBKA 4YSZD 1BSHA 5C2TC 3M0AA 4DHIB 3L74G 3CCQP 3WMM0 4IL6H 4N6JA 3P8MC 1EC5A 2KLUA 3VR8D 4H0LD 1K05A 1HTLC 1KD1Q 3FXEA 4YSZC 2JDIH 1HUCA 1Q2NA 3V4WA 2H43A 1EZVE 3T97B 2BCCE 3AE6D 3B71A 1L0LG 1G2CB 3HRNA 1S9KD 4L75A 1FU1A 2H88C 2W90A 1NVOA 2NZ2A 2A06G 3A5TA 2V7QJ 3MZWB 1Q86Q 5B5EH 1GZLA 3NMDA 3O6QB 1X22A 1YJNP 4N78D 2XZRA 3H1JE 2OYIC 3O8ZA 4DCKA 3R2PA 1LTGC 2IPPA 3AE3C 3AEGD 2MJZA 4EDFA 1XTCC 3H1KJ 2J5UA 2KIKA 2JJLA 4YTMC 2FYUJ 1MFZA 1A02J 1FC2C 1FDIA 3H1HJ 3CCMP 4GODA 4I6LA 2QVAA 4KX6C 3H1HE 2PP6A 1VQOP 3L75G 4U3FG 2BEQD 2KYVA 1H89A 3M91A 4RJTA 1EZVD 1VL2A 1BGYG 1OFCX 1DEEG 3VTPC 3D6ZA 2OTKE 2PAJA 2YMKA 1YI2P 3HTKB 3RK2D 4IFDK 1RY3A 3HUSA 1BE3J 2WP9D 1VF5B 4PV1C 3G71P 1IJDB 1J1DC 3HD7D 1M57D 2O1KA 3BASA 5TISH 5AVZB 1NH4A 3AEDC 1KV4A 3L70E 2OYHA 3P4PD 1KF6C 2WZ7A 2XKMA 3BCCJ 2N1TB 3H1LD 2R32A 4W80A 3I55P 2KI7B 3IR9A 2QJKC 3HD7C 1USDA 3VP8A 1T8ZA 1FOSF 1L0NE 2IBZD 3HUSB 3IN6A 2BS2C 5AW9B 2KZJA 1BGYD 5APUA 2OQQA 4IL6E 3Q5SA 2KNCB 2IBZG 1LTBC 3L72J 4Y28J 1J1DB 1PZQA 2HLOA 1L2PA 2B87B 1SVFA 2QJPB 1YHQP 3Q2YA 1LTSC 3V5BA 2OYOA 2NPSC 4JQ0D 1GK4A 1P84H 1N7SA 3PJSK 1NENC 1MZ9A 2HG5D 3G3ZA 1PFIA 5CCGD 2IBZE 4L73A 1JCDA 3GLMA 4BRYA 3VRAD 5GTHE 2WQYD 2P67A 5KJ7A 1JUNA 1GMJA 1MUUA 1NHLA 3CL3D 4DDGA 3RBXA 1KILC 2ACZC 3P4SC 3S4RA 1SQQK 3G6EP 3NTNA 1YJ9P 2BCCG 2GA1A 3GG2A 1IFJA 1G1JA 4C46A 3CXHH 2QJYC 5AVYB 1BGYJ 1NAFA 1L0LK 2ZYAA 3A0BH 5CHXA 1H88A 3M9BA 2H89D 1URQA 2I8DA 2FYZA 3RBZA 2E76B 4GDOA 3CC2P 4XE5B 1ZRTE 3FX0A 1LNQA 1HF9A 2CPBA 2M3BA 4DT0A 1FZCC 4PD4E 3TGUE 3TYYA 1OMIA 4WVZA 4WB4A 3L37A 3GMAA 2C0WA 1QLED 1IFMA 1L4AC 1HJ0A 1KFYC 1MKMA 1NO4A 4UB8H 2YKOA 2KOGA 2OYIA 4LC1A 3H1KG 3ITKA 1GTWA 2G8YA 2LXCB 1N73A 5M1BA 3AEED 1NKZB 5CCHA 1E5WA 5C39A 1VPCA 3CXHI 1ZRTD 4AQRD 2BS4C 3CIRC 2B76D 2Y9YA 1UIXA 1AVOA 1TU3F 4YTPC 1DD3A 1J1EB 3PP5A 3BCCD 1W2BO 3P4SD 3RK2C 3L71E 4GOEA 1JM0A 2V4HA 3KPEA 3C9IA 5AW1B 1YTZT 2IDBA 4IL6X 4GT1A 4H44B 1SQPG 1S5LE 4KHXA 3H1KD 3C1LA 1FJKA 2IBZI 3AEFC 1JY3N 4PJ0E 2N9BA 1N86A 2YMYA 2J58A 5KAIE 1FJPA 3B5NB 1AQTA 1NU1J 3FWNA 4YT0D 4OGQB 2JP3A 4A7PA 4I6MC 3GF3A 2E5YA 3FXDA 2ZXXA 2E74B 3AE5C 2KXPB 3CX5D 4RKUJ 1RE4C 4HB1A 2POHA 1SQQJ 3AE1D 3WUTA 3TNUA 3RK2B 3CI9A 2QG4A 3L73J 4OGQD 3LW5J 4WWIA 1NTZG 1LWUC 2PFXA 1ZLLA 3H6PA 3SWFA 1MV8A 4JYBA 2ZVNB 3VN0A 1QEXA 5GTIE 3L73E 5KKZC 1S5LX 2NRGA 3QH9A 3P4PC 2WP9C 3M9QA 1EZVI 2E75C 1GU4A 3KHUA 2K1AA 1RF0C 1CZQA 1KQLA 3SWYA 3H1JD 1GL2C 4KX6D 2WU5C 3RK3B 3ZDMA 3PTZA 5KJ7D 2OYHB 1PP9D 1RF1C 4WY4A 4L74A 1JY3P 2C9LY 2WDRC 2WSEH 1NTMG 4M3LA 2L5GB 1NU1K 3AEFD 2N9YB 1GL2D 1BDCA 2QM7A 3L70D 1PGQA 3M0DA 1YQ4C 3HE4B 4PV1D 3AE2C 1IFDA 4C7NB 2HYNA 1U57A 1QLBC 1Q90D 3IAOA 3AE7D 3BCCE 5CBOA 3OW2O 4AUWA 3P4RC 3NXSA 3P7KA 5KLIB 1NOHA 2NPSB 3KQGA 1LP1A 2H89C 1ZR2A 1BDDA 3OA7A 1P84I 1IC2A 1OXZA 1SQXJ 1X79B 2R5DA 3CCVP 3H1LG 3RL0C 5KKZB 1KB9E 1QL1A 1LTJB 1TFFA 4R4LA 1UIIA 1AV1A 3P4RD 1KF6D 5CMZA 3V2QA 1E7PC 1P84D 3IFMA 3H1KE 4XA4A 2NPSD 4K3AA 4Y99B 1BCCJ 1N7SB 1SQBD 2FY8A 4U3FD 4TLFA 3V2PA 2ZJSE 3U1CA 1IO4A 3H1IG 2ZYGA 2WSSH 1KQFB 3AECC 2GM4A 2W8ZA 2AEMA 3SFDD 2XNXA 3S1KA 4H13D 2WSCJ 2FFDC 1JY2N 1KB9H 1VQMP 2JR8A 3FGAD 3CCJP 4NPEA 1L0LE 3L71D 5APSA 3AEBD 1VQ9P 4DZOA 2I1JA 2PGDA 1JMMA 4H0LB 3KXDA 2FYUE 3KZIH 2O01J 2ZYDA 3C8VA 3F5HA 3HTKA 3HE4A 4ASVA 3JSVC 3CCSP 1SQVG 1PP9J 2WQYC 2RKLA 3VONA 2WMMA 3TF5A 4HJGH 2E76C 2AEJA 3F89A 1NTKD 3EQ2A 2QSIA 3SFEC 2LXBA 4R4MA 2ZFYA 1L0NK 2KZIA 4KJMA 1DX7A 2FFDB 2E43A 2OTJP 3P4QC 2FXPA 3PLNA 3CMEP 1VDFA 1P84E 1SQBJ 2OARA 1NTZE 4DOJA 1ZOYC 1SFCD 1PIXA 1HGZA 2K9JA 2E75B 2O01N 2KSEA 2JWAA 5K5GB 1DD4A 4YSYC 1HH0A 1SQXD 3A3YB 1N7LA 1PGJA 2KS1A 3B8EB 3L72E 4BWNA 4HYTB 1M1JA 2P10A 3L74E 1AQ5A 2C0XA 1NKNA 5AW2B 3OAKA 3GHGC 2K37A 1EDLA 2RMZA 2HPCA 2CPSA 3A2AA 4K35A 3CCRP 3H1HD 2Q3IA 1PV3A 1YITP 1OZHA 3L70J 1OW7A 1Y47A 1N73B 4IOIH 2WDRD 3L72G 1SQPK 1L0NG 4I2LC 2WTYA 4YSXC 3V2RA 3V2NA 1X9VA 4HH2A 5APYA 2WPQA 3L72D 1L0VD 4DHZA 3L70G 3KZIE 2E74C 2YNYA 1NTMD 1EXJA 1BSNA 3Q5PA 5KLVJ 5B66H 3H1LE 1HBWA 1PPJE 4GOFA 1IFIA 1LT9B 1SFCC 2IYPA 3B4SA 1W2EA 2WU5D 2W6BA 1AVYA 5CJ0A 1KFNA 3CCLP 4C7RA 1M8OB 5AVSB 2PRRA 1SQVK 4OH8B 5DJTB 1A02F 4D6TG 1FDMA 5AVUB 2ZAEB 3MGNA 3H1IJ 5AW5B 5CJ4A 1FAVA 2XU6A 4YXWH 4DHJA 1Y8AA 1PPJG 2LKMA 4H0LC 4UB6E 1EZVG 1M1KQ 5AW4B 3CPWO 5B66E 1NU1E 5BVZA 2E5TA 2Q3EA 1JTHB 1YTZI 3L75J 2P7JA 4U3FJ 2FKWB 4H13C 1T6AA 2BEZF 4B86A 3L75D 2IFNA 3EFFK 2P2UA 2WWWA 1KYOD 2A45H 1LTAC 1PP9G 4LLHA 4DDIA 1U7JA 3A0BE 3WUVA 3LIDA 1CSBA 3Q3DA 4U3FE 1RE3A 3H1IE 4AYCA 1YJWP 5KLVD 4LGDE 1SQVD 1IFPA 4ASWA 2O1JA 3E1RA 1JCCA 5APVA 3MUDA 2H8PD 2BS3C 1S2EA 1KN7A 1T2KD 2M3EA 1CI6A 2CK3H 2WPVB 1KC8Q 4I7ZB 1JEKA 1T3UA 2J59M 3BRVB 3L74J 1FDOA 5KLVE 2YXRB 3CX5I 1VQ8P 1S3JA 1JB0J 4WY4B 2WDQD 3GF7A 3H25A 3GHGA 1SP4A 5C3JC 3L71G 2QJKB 4GIFA 1KTMA 1H8AA 2E76D 2HR3A 1GU5A 2RH0A 4EOTA 3VMZA 2FYUK 3AE1C 2Q6QA 1KMIZ 2QIWA 1BCCE 3PH0A 4JF7A 5C3JD 2Y9ZA 2WVRA 4OWFA 3P4QD 2N1TA 2WDQC 3AE9C 3MIWA 3I5CA 1U7MA 2R44A 3TGUD 2AXTH 4HKZH 3M0DC 2WT7B 5BU5A 4D6TJ 2Z5HA 1ZMEC 1PL5A 3B5ND 4PJ0H 2FBWC 5H2FE 1AJYA 2HFED 1K73Q 1JY2P 1FS0E 3GW6A 2A45G 3MD0A 2QJPC 5TISE 4YTNC 1RF0A 1NGMB 5EFWB 1LT9A 2WU2C 2ZFCA 2FXOA 3B5NC 3B5NA 4D6TE 3VMXA 3L73G 1H0TB 3SFDC 3WU2E 3H32B 1LT9C 3AE4C 3U1AA 4JPZB 4U7JA 1OW6A 1QVFO 1SQQG 2AXTE 1BE3D 2W6JH 2I1KA 1SFCB 3AEBC 3UIAA 3TNUB 1BE3E 4IFMA 1VQ6P 1NTZJ 4I1LA 3BRTB 3CXHE 1RHZB 4D6TD 3WU2H 2WSFH 2HPCB 1JTHA 3QWOC 1KILB 5BU8B 3VYIA 4YSYD 4H13B 2KUBA 4PD4I 1SLQA 1SQPJ 1EDIA 1WMKA 2YO3A 1VF5D 1QVGO 1PP9E 5AVTB 3TGUG 1ZW0A 2SPZA 3AEGC 3L36A 2KS1B 2KP8A 3BVHA 2YIUC 4YTMD 2W27A 3VRBD 1L4AB 1RF1B 2D2CC 3S9OA 5AVQB 1LT1A 3I56P 1YQ4D 1VQPP 1HGVA 3H1HG 1BCCD 1SS1A 2FYNB 1NEKD 3AE5D 2Y0CA 5TJHA 3TK1A 2WDVC 3KDPB 3MUDC 4H44C 3PHLA 1Z56A 1KORA 3L73D 1HJBA 2O01H 4N3YB 2Q7CA 2B76C 1GK6A 2ZT9B 2WS3C 2JO1A 2R3CA 4WY4C 1RF1A 4N78E 1L4AA 2Q1KA 3A0HE 4KT0J 4O9BA 2WSEJ 3VMYA 3AE2D 2A06E 3H1JJ 2YIUB 2QA4P 1FZCA 5KLVG 5KLIC 1G2CA 1N2DC 2LR2A 2A06D 1URQB 3RGUA 1YQ3D 2Y0DA 2D2CB 1NTKE 2A45I 1NTME 2P1JA 1USEA 2B89A 2BCCJ 3MP7B 2E74D 1SQBK 3VOPA 1DH3A 3RL0D 2KK7A 1Y9BA 1NTKK 1Q82Q 4YT0C 2FYNC 1BCCG 2Z4EA 3AE9D 1FZEA 2XNDH 3H32A 1XTGB 1FBMA 1NYHA 2W83C 1SQQD 2KNCA 3D71A 3H1LJ 5L8RJ 2M5AA 2E42A 2IX7C 1SQVE 3P8CD 5KJ7C 2B87A 1X8YA 4ZMDA 1FZAA 3V6IA 2YKPA 1NTZK 1IK7A 1H0TA 2G3AA 2K88A 3AECD 4Z1MH 2N1TC 5KTBA 1L0LD 3VMAA 1QX8A 2FXMA 3MTUE 1KFMA 1N7SC 2WSCH 2NPSA 2IZ1A 2QE7H 1K9MQ 3L71J 3L35A 1GD2E 4XFJA 2E75D 3CMAP 2WPRA 1KYOH 2WT7A 1S4XA 5E79E 2N1TD 3USSA 4C7NA 3AE7C 1KYOE 3RK3E 1OIPA 1ZR4A 2XV5A 3ABVC 3G9RA 1VQ4P 1N7SD 3A7OA 2Z5IA 2QRXA 3JCUE 2R3SA 5CBNA 1SQQE 3HE5B 3K5BA 1LTIC 1S5LH 1PGOA 2QM8A 3CCEP 5CCHC 3FWLA 1RQVA 3NFQA 4JYCA 1CI6B 1N73C 2FYUG 1JMBA 3HE5A 1M90Q 2OYHC 3MHVA 3N4XA 4Y99C 2QJYB 1LJ2A 1JO5A 1DIPA 1RE3C 1VF5C 4PV1B 1GDTA 3W67A 3GHGB 2M0BA 3N7NA 1T3JA 4YTND 2Y0EA 3VP9A 1VQ5P 3E1IA 1IZNB 1NU1D 5AW0B 2UWJE 2H7HA 4ZKUA 1JOCA 1K8AQ 4W7YA 5GTHH 3O6QA 3AE4D 1URQC 3AE3D 1J2JB 5APWA 1N8RQ 1VQLP 5AW6B 3IF4A 4YXDC 1ZP0C 3TGUJ 4RO0A 2KB7P 4I7ZC 1NEND 1KZUB 1GL2B 2Q9IA 4YXDD 1KILA 3AE8D 1M7LA 1ZXGA 2ZXEB 3P8CE 1FZGA 3VR8C 2DW3A 1ZP0D 2ZT9C 1X0TA 1S72P 3HD7B 1M1JB 3JC22 4NPDA 4LDTA 2WPSA 1SQXE 1QGKB 1SFCA 2QEXP 2HODB 3M9HA 3RK3D 4UB6H 1HWTC 1OWAA 2WU2D 1L0NJ 1HVVA 2IFMA 2YXQB 1VQ7P 3WUUA 1M56D 3EWKA 2ACZD 4OGQC 1NEKC 1FE6A 3AE6C 4BXLA 1DEBA 1EXIA 1GW4A 2MKVA 1L4AD 3HD7A 1R5LA 1IK9A 1EDKA 3KYQA 3H1ID 1RH5B 1NAYA 2KSJA 2KLVA 3RL0g 3CC7P 1KYOI 1ZV8A 1RQUA 2D2CD 4DJGA 1L0VC 1M1JC 2WITA 4TT3H 2IZ0A 5DJUB 1LGHB 3A0HH 2HODA 1R5SA 1NTMJ 4ZKPA 1NTKJ 3T97A 3HUSC 5C2TD 2ZT9D 3L74D 1KB9D 2M8RA 2ITAA 3CWBG 1AFOA 5APXA 4EIJA 3AEAD 2Q5UA 1YYCA 1KILD 2GUSA 2WS3D 2AEFA 2WSFJ 1OW8A 3G4SP 1JNMA 4NPFX 2ZVOB 2YKQA 1GL2A 1YIJP 1EQ7A 1SQVJ 1JY3O 3VR9D 1S9KE 1EDJA 2AXCA 2BCCD 5GTIH 2OYIB 2XDJA 3SSUA 3H1JG 2JEEA 3PRJA 2P58A 2B9BA 3CCUP 1LWUA 1E79H 2K9JB 3VR9C 3EFGA 1KILE 4EYYQ 2B88A 2O3JA 1FZBA 2FFDA 3P32A 3L75E 3BATA 1OX3A 1NU1G 1KQGB 2RN0A 2K3RA 1YQ3C 3LIEA 3D70A 3TDKA 1WT6A 3CWBD 4WBAA 1SQBG 5CCGA 1SQPE 2L91A 1PPJD 1KQSO 3AEDD 5AVWB 1BE3G 1NWQA 5AVXB 3CIRD 3M06A 4IFFA 1SQXG 3CXHD 4PD4D 1G1IA 3SWKA 3CC4P 2R5BA 3II6A 4BRYB 3W68A 2WDVD 1D7MA 3SFED 4EI2A 5CCGC 2M5AB 4ZNCA 1OVUA 4CPGA 4FJVA 1SQBE
chains in the Genus database with same CATH topology
1K04A 3Q5PA 1HJ0A 4Y28J 1KFYC 3D71A 1MKMA 3P4QC 4YTND 3D6YA 5L8RJ 3S9OA 2QJPC 4KX6C 2FXPA 4R4LA 4YTNC 3EWKA 4OGQD 1NGMB 1YQ4D 2ACZD 1ZOYC 2BEQD 3LW5J 1KF6D 3ABVD 3P4RD 3VRAC 4OGQC 1PIXA 2WU5D 1NEKC 1E7PC 3Q2YA 2WU2C 3AE6C 2BS3C 1VL2A 2K9YA 2E75B 1IK7A 1NEKD 1EXIA 2MKVA 3D6ZA 2G3AA 3AECD 3AE5D 3VRBC 4Z1MH 3O6QA 2G8YA 3AE4D 1DD4A 4YSYC 2WPVB 5M1BA 2WDVC 1NENC 2YMKA 3SFDC 4I7ZB 3AE3D 3AEED 5KKZC 3AE4C 3VR9C 5C2TD 1S5LX 1ZOYD 4H44C 4YSZD 4U7JA 1OW6A 1KILE 4XFJA 1FDOA 3RL0g 2E75D 2WP9C 3P4PC 1KORA 5C2TC 2BS4C 3CIRC 4YXDC 2E75C 2B76D 3GLMA 3VRAD 2WP9D 2WQYD 1UIXA 1RQUA 1VF5B 4PV1C 3VRBD 1KQFB 3AECC 1TU3F 1JB0J 1ZP0C 2D2CD 1GMJA 3AEBC 4YTPC 1R8EA 2B76C 2ZT9B 3AE7C 2WDQD 3AEEC 4H0LC 2WS3C 1L0VC 3SFDD 3GF7A 2JO1A 1DD3A 3H25A 4I7ZC 1NEND 2P10A 3VR8D 1KQGB 4H0LD 3RK3E 4KX6D 1K05A 4H13D 2WU5C 5C3JC 2WSCJ 3P4SD 1KTMA 2ACZC 4YSZC 1YQ3C 3ABVC 3G9RA 3P4SC 4TT3H 2E76D 4KT0J 3D70A 2WSEJ 3FGAD 4YXDD 3AE2D 2WDRC 2IDBA 3T97B 4IL6X 3AE6D 3AE8D 3B71A 4H44B 3AEBD 4YTPD 1KFYD 3AE1C 4YTMC 2QIWA 1KMIZ 2QJYC 5KLIC 3AEDC 2H88C 4H0LB 3VR8C 3AEFD 4H13C 3Q5RA 1PV3A 2NZ2A 2H88D 5C3JD 4YSYD 2O01J 3AEFC 2BEZF 3AEDD 1KF6C 4H13B 1YQ3D 2ZT9D 1ZP0D 3P4PD 1YQ4C 3P4QD 3C8VA 2WDQC 1S1CX 2D2CB 2V7QJ 4H44D 1OW7A 2ZT9C 3AE9C 4PV1D 2WDRD 1RQVA 3CIRD 3AE2C 1WMKA 2H89D 1VF5D 2QJKC 4YSXD 2E74D 2WQYC 2E76B 1U57A 3AEAD 4GDOA 3R4YA 1QLBC 1Q90D 3AEGC 3IAOA 4OGQB 4YSXC 4YT0D 1ZRTE 2JP3A 2WDVD 2WS3D 1Y9BA 2WSFJ 3AE3C 3IN6A 1L0VD 2YIUC 2BS2C 3AE7D 2E76C 1ZMEC 3GF3A 4YTMD 3AEGD 4YT0C 3SFED 2FYNC 2J5UA 1HF9A 3AE9D 2OQQA 1OW8A 3P4RC 1PL5A 3AE5C 2E74B 2FBWC 2QSIA 3AE8C 3SFEC 3Q1MA 2H89C 3Q5SA 1DIPA 1OMIA 1VF5C 4PV1B 1AJYA 2WU2D 4R4MA 3Q3DA 1NYHA 2FBWD 2E74C 3GMAA 1FDIA 2D2CC 4RKUJ 3AEAC 1EXJA 3AE1D 3VR9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K04 A;  1KFY C;  3P4Q C;  4YTN D;  3S9O A;  4KX6 C;  4YTN C;  1YQ4 D;  2ACZ D;  1ZOY C;  3P4R D;  1KF6 D;  3ABV D;  2WU5 D;  1NEK C;  1E7P C;  2WU2 C;  3AE6 C;  2BS3 C;  1NEK D;  2G3A A;  3AEC D;  3AE5 D;  3VRB C;  3AE4 D;  4YSY C;  2WDV C;  1NEN C;  3SFD C;  3AE3 D;  3AEE D;  3AE4 C;  3VR9 C;  1ZOY D;  4YSZ D;  1OW6 A;  3P4P C;  2WP9 C;  5C2T C;  2BS4 C;  3CIR C;  4YXD C;  2B76 D;  3VRA D;  2WP9 D;  2WQY D;  3AEC C;  1ZP0 C;  3AEB C;  4YTP C;  2B76 C;  2WDQ D;  3VRA C;  3AE7 C;  2WS3 C;  3AEE C;  3SFD D;  1L0V C;  1NEN D;  5C3J C;  3VR8 D;  4KX6 D;  1K05 A;  2WU5 C;  3P4S D;  2ACZ C;  1KTM A;  4YSZ C;  1YQ3 C;  3ABV C;  3P4S C;  4YXD D;  3AE2 D;  2WDR C;  3AE6 D;  3AE8 D;  3B71 A;  3AEB D;  4YTP D;  1KFY D;  3AE1 C;  3AED C;  2H88 C;  3VR8 C;  3AEF D;  1PV3 A;  2H88 D;  5C3J D;  4YSY D;  3AEF C;  3P4P D;  3AED D;  1KF6 C;  3P4Q D;  1YQ3 D;  5C2T D;  1ZP0 D;  1YQ4 C;  2WDQ C;  1OW7 A;  3AE9 C;  2WDR D;  3CIR D;  3AE2 C;  2H89 D;  4YSX D;  2WQY C;  3AEA D;  1QLB C;  3AEG C;  4YT0 D;  4YSX C;  2WDV D;  2WS3 D;  3AE3 C;  3AE7 D;  1L0V D;  2BS2 C;  4YTM D;  3SFE D;  3AEG D;  4YT0 C;  3AE9 D;  1OW8 A;  3P4R C;  4YTM C;  3AE5 C;  3VRB D;  2FBW C;  3AE8 C;  3SFE C;  2H89 C;  2WU2 D;  2FBW D;  3AEA C;  3AE1 D;  3VR9 D; 
#chains in the Genus database with same CATH topology
 1K04 A;  5AVV B;  3RK3 C;  5APQ A;  3V4Q A;  1IFN A;  4QMA A;  2GUV A;  3CX5 E;  1W5C E;  5KAF H;  2K9Y A;  4MN4 C;  5E79 H;  1BGY E;  3JCU H;  3U59 A;  4PD4 H;  1T2K C;  1VQN P;  1L0N D;  4UB8 E;  1WRG A;  1OVR A;  3L4F A;  5KAI H;  1LTJ A;  1FZC B;  5H2F H;  3LW5 H;  4L76 A;  1MFT A;  1KB9 I;  1R8E A;  2V7Q H;  3VRA C;  3AEE C;  3CX5 H;  2VRS A;  4OVN F;  2OGU A;  5AW8 B;  1L0L J;  2JWD A;  1LP1 B;  1Q81 Q;  5CCH D;  2FYU D;  4W7Z A;  2OTL P;  4YTP D;  1KFY D;  5APT A;  1LTJ C;  1Q7Y Q;  3Q5R A;  2H88 D;  1J1E C;  1JY2 O;  1NTK G;  1FOS E;  4GKG A;  1S1C X;  4H44 D;  4RES B;  1OVV A;  1CW5 A;  1SQX K;  3CWB E;  2BAS A;  1LTT C;  4YSX D;  1NTM K;  1VQK P;  1PGP A;  1GW3 A;  4JBZ A;  3CLQ A;  3R4Y A;  3TSI A;  3CWB J;  3CD6 P;  3BCC G;  1NJI Q;  1RE4 A;  3Q1M A;  1QL2 A;  3AE8 C;  5KAF E;  5AW7 B;  1LWU B;  2YO2 A;  2FBW D;  3AEA C;  1SQP D;  3RL0 B;  2W6A A;  3D6Y A;  5B5E E;  1URQ D;  1FZF A;  3ABV D;  3E7K A;  5KLV K;  1ZN5 A;  2IYO A;  5AW3 B;  3VRB C;  5AVR B;  2JKV A;  1NTZ D;  4YPC A;  4WY4 D;  1AA0 A;  3OJA B;  1ZOY D;  2C9N Y;  1YBK A;  4YSZ D;  1BSH A;  5C2T C;  3M0A A;  4DHI B;  3L74 G;  3CCQ P;  3WMM 0;  4IL6 H;  4N6J A;  3P8M C;  1EC5 A;  2KLU A;  3VR8 D;  4H0L D;  1K05 A;  1HTL C;  1KD1 Q;  3FXE A;  4YSZ C;  2JDI H;  1HUC A;  1Q2N A;  3V4W A;  2H43 A;  1EZV E;  3T97 B;  2BCC E;  3AE6 D;  3B71 A;  1L0L G;  1G2C B;  3HRN A;  1S9K D;  4L75 A;  1FU1 A;  2H88 C;  2W90 A;  1NVO A;  2NZ2 A;  2A06 G;  3A5T A;  2V7Q J;  3MZW B;  1Q86 Q;  5B5E H;  1GZL A;  3NMD A;  3O6Q B;  1X22 A;  1YJN P;  4N78 D;  2XZR A;  3H1J E;  2OYI C;  3O8Z A;  4DCK A;  3R2P A;  1LTG C;  2IPP A;  3AE3 C;  3AEG D;  2MJZ A;  4EDF A;  1XTC C;  3H1K J;  2J5U A;  2KIK A;  2JJL A;  4YTM C;  2FYU J;  1MFZ A;  1A02 J;  1FC2 C;  1FDI A;  3H1H J;  3CCM P;  4GOD A;  4I6L A;  2QVA A;  4KX6 C;  3H1H E;  2PP6 A;  1VQO P;  3L75 G;  4U3F G;  2BEQ D;  2KYV A;  1H89 A;  3M91 A;  4RJT A;  1EZV D;  1VL2 A;  1BGY G;  1OFC X;  1DEE G;  3VTP C;  3D6Z A;  2OTK E;  2PAJ A;  2YMK A;  1YI2 P;  3HTK B;  3RK2 D;  4IFD K;  1RY3 A;  3HUS A;  1BE3 J;  2WP9 D;  1VF5 B;  4PV1 C;  3G71 P;  1IJD B;  1J1D C;  3HD7 D;  1M57 D;  2O1K A;  3BAS A;  5TIS H;  5AVZ B;  1NH4 A;  3AED C;  1KV4 A;  3L70 E;  2OYH A;  3P4P D;  1KF6 C;  2WZ7 A;  2XKM A;  3BCC J;  2N1T B;  3H1L D;  2R32 A;  4W80 A;  3I55 P;  2KI7 B;  3IR9 A;  2QJK C;  3HD7 C;  1USD A;  3VP8 A;  1T8Z A;  1FOS F;  1L0N E;  2IBZ D;  3HUS B;  3IN6 A;  2BS2 C;  5AW9 B;  2KZJ A;  1BGY D;  5APU A;  2OQQ A;  4IL6 E;  3Q5S A;  2KNC B;  2IBZ G;  1LTB C;  3L72 J;  4Y28 J;  1J1D B;  1PZQ A;  2HLO A;  1L2P A;  2B87 B;  1SVF A;  2QJP B;  1YHQ P;  3Q2Y A;  1LTS C;  3V5B A;  2OYO A;  2NPS C;  4JQ0 D;  1GK4 A;  1P84 H;  1N7S A;  3PJS K;  1NEN C;  1MZ9 A;  2HG5 D;  3G3Z A;  1PFI A;  5CCG D;  2IBZ E;  4L73 A;  1JCD A;  3GLM A;  4BRY A;  3VRA D;  5GTH E;  2WQY D;  2P67 A;  5KJ7 A;  1JUN A;  1GMJ A;  1MUU A;  1NHL A;  3CL3 D;  4DDG A;  3RBX A;  1KIL C;  2ACZ C;  3P4S C;  3S4R A;  1SQQ K;  3G6E P;  3NTN A;  1YJ9 P;  2BCC G;  2GA1 A;  3GG2 A;  1IFJ A;  1G1J A;  4C46 A;  3CXH H;  2QJY C;  5AVY B;  1BGY J;  1NAF A;  1L0L K;  2ZYA A;  3A0B H;  5CHX A;  1H88 A;  3M9B A;  2H89 D;  1URQ A;  2I8D A;  2FYZ A;  3RBZ A;  2E76 B;  4GDO A;  3CC2 P;  4XE5 B;  1ZRT E;  3FX0 A;  1LNQ A;  1HF9 A;  2CPB A;  2M3B A;  4DT0 A;  1FZC C;  4PD4 E;  3TGU E;  3TYY A;  1OMI A;  4WVZ A;  4WB4 A;  3L37 A;  3GMA A;  2C0W A;  1QLE D;  1IFM A;  1L4A C;  1HJ0 A;  1KFY C;  1MKM A;  1NO4 A;  4UB8 H;  2YKO A;  2KOG A;  2OYI A;  4LC1 A;  3H1K G;  3ITK A;  1GTW A;  2G8Y A;  2LXC B;  1N73 A;  5M1B A;  3AEE D;  1NKZ B;  5CCH A;  1E5W A;  5C39 A;  1VPC A;  3CXH I;  1ZRT D;  4AQR D;  2BS4 C;  3CIR C;  2B76 D;  2Y9Y A;  1UIX A;  1AVO A;  1TU3 F;  4YTP C;  1DD3 A;  1J1E B;  3PP5 A;  3BCC D;  1W2B O;  3P4S D;  3RK2 C;  3L71 E;  4GOE A;  1JM0 A;  2V4H A;  3KPE A;  3C9I A;  5AW1 B;  1YTZ T;  2IDB A;  4IL6 X;  4GT1 A;  4H44 B;  1SQP G;  1S5L E;  4KHX A;  3H1K D;  3C1L A;  1FJK A;  2IBZ I;  3AEF C;  1JY3 N;  4PJ0 E;  2N9B A;  1N86 A;  2YMY A;  2J58 A;  5KAI E;  1FJP A;  3B5N B;  1AQT A;  1NU1 J;  3FWN A;  4YT0 D;  4OGQ B;  2JP3 A;  4A7P A;  4I6M C;  3GF3 A;  2E5Y A;  3FXD A;  2ZXX A;  2E74 B;  3AE5 C;  2KXP B;  3CX5 D;  4RKU J;  1RE4 C;  4HB1 A;  2POH A;  1SQQ J;  3AE1 D;  3WUT A;  3TNU A;  3RK2 B;  3CI9 A;  2QG4 A;  3L73 J;  4OGQ D;  3LW5 J;  4WWI A;  1NTZ G;  1LWU C;  2PFX A;  1ZLL A;  3H6P A;  3SWF A;  1MV8 A;  4JYB A;  2ZVN B;  3VN0 A;  1QEX A;  5GTI E;  3L73 E;  5KKZ C;  1S5L X;  2NRG A;  3QH9 A;  3P4P C;  2WP9 C;  3M9Q A;  1EZV I;  2E75 C;  1GU4 A;  3KHU A;  2K1A A;  1RF0 C;  1CZQ A;  1KQL A;  3SWY A;  3H1J D;  1GL2 C;  4KX6 D;  2WU5 C;  3RK3 B;  3ZDM A;  3PTZ A;  5KJ7 D;  2OYH B;  1PP9 D;  1RF1 C;  4WY4 A;  4L74 A;  1JY3 P;  2C9L Y;  2WDR C;  2WSE H;  1NTM G;  4M3L A;  2L5G B;  1NU1 K;  3AEF D;  2N9Y B;  1GL2 D;  1BDC A;  2QM7 A;  3L70 D;  1PGQ A;  3M0D A;  1YQ4 C;  3HE4 B;  4PV1 D;  3AE2 C;  1IFD A;  4C7N B;  2HYN A;  1U57 A;  1QLB C;  1Q90 D;  3IAO A;  3AE7 D;  3BCC E;  5CBO A;  3OW2 O;  4AUW A;  3P4R C;  3NXS A;  3P7K A;  5KLI B;  1NOH A;  2NPS B;  3KQG A;  1LP1 A;  2H89 C;  1ZR2 A;  1BDD A;  3OA7 A;  1P84 I;  1IC2 A;  1OXZ A;  1SQX J;  1X79 B;  2R5D A;  3CCV P;  3H1L G;  3RL0 C;  5KKZ B;  1KB9 E;  1QL1 A;  1LTJ B;  1TFF A;  4R4L A;  1UII A;  1AV1 A;  3P4R D;  1KF6 D;  5CMZ A;  3V2Q A;  1E7P C;  1P84 D;  3IFM A;  3H1K E;  4XA4 A;  2NPS D;  4K3A A;  4Y99 B;  1BCC J;  1N7S B;  1SQB D;  2FY8 A;  4U3F D;  4TLF A;  3V2P A;  2ZJS E;  3U1C A;  1IO4 A;  3H1I G;  2ZYG A;  2WSS H;  1KQF B;  3AEC C;  2GM4 A;  2W8Z A;  2AEM A;  3SFD D;  2XNX A;  3S1K A;  4H13 D;  2WSC J;  2FFD C;  1JY2 N;  1KB9 H;  1VQM P;  2JR8 A;  3FGA D;  3CCJ P;  4NPE A;  1L0L E;  3L71 D;  5APS A;  3AEB D;  1VQ9 P;  4DZO A;  2I1J A;  2PGD A;  1JMM A;  4H0L B;  3KXD A;  2FYU E;  3KZI H;  2O01 J;  2ZYD A;  3C8V A;  3F5H A;  3HTK A;  3HE4 A;  4ASV A;  3JSV C;  3CCS P;  1SQV G;  1PP9 J;  2WQY C;  2RKL A;  3VON A;  2WMM A;  3TF5 A;  4HJG H;  2E76 C;  2AEJ A;  3F89 A;  1NTK D;  3EQ2 A;  2QSI A;  3SFE C;  2LXB A;  4R4M A;  2ZFY A;  1L0N K;  2KZI A;  4KJM A;  1DX7 A;  2FFD B;  2E43 A;  2OTJ P;  3P4Q C;  2FXP A;  3PLN A;  3CME P;  1VDF A;  1P84 E;  1SQB J;  2OAR A;  1NTZ E;  4DOJ A;  1ZOY C;  1SFC D;  1PIX A;  1HGZ A;  2K9J A;  2E75 B;  2O01 N;  2KSE A;  2JWA A;  5K5G B;  1DD4 A;  4YSY C;  1HH0 A;  1SQX D;  3A3Y B;  1N7L A;  1PGJ A;  2KS1 A;  3B8E B;  3L72 E;  4BWN A;  4HYT B;  1M1J A;  2P10 A;  3L74 E;  1AQ5 A;  2C0X A;  1NKN A;  5AW2 B;  3OAK A;  3GHG C;  2K37 A;  1EDL A;  2RMZ A;  2HPC A;  2CPS A;  3A2A A;  4K35 A;  3CCR P;  3H1H D;  2Q3I A;  1PV3 A;  1YIT P;  1OZH A;  3L70 J;  1OW7 A;  1Y47 A;  1N73 B;  4IOI H;  2WDR D;  3L72 G;  1SQP K;  1L0N G;  4I2L C;  2WTY A;  4YSX C;  3V2R A;  3V2N A;  1X9V A;  4HH2 A;  5APY A;  2WPQ A;  3L72 D;  1L0V D;  4DHZ A;  3L70 G;  3KZI E;  2E74 C;  2YNY A;  1NTM D;  1EXJ A;  1BSN A;  3Q5P A;  5KLV J;  5B66 H;  3H1L E;  1HBW A;  1PPJ E;  4GOF A;  1IFI A;  1LT9 B;  1SFC C;  2IYP A;  3B4S A;  1W2E A;  2WU5 D;  2W6B A;  1AVY A;  5CJ0 A;  1KFN A;  3CCL P;  4C7R A;  1M8O B;  5AVS B;  2PRR A;  1SQV K;  4OH8 B;  5DJT B;  1A02 F;  4D6T G;  1FDM A;  5AVU B;  2ZAE B;  3MGN A;  3H1I J;  5AW5 B;  5CJ4 A;  1FAV A;  2XU6 A;  4YXW H;  4DHJ A;  1Y8A A;  1PPJ G;  2LKM A;  4H0L C;  4UB6 E;  1EZV G;  1M1K Q;  5AW4 B;  3CPW O;  5B66 E;  1NU1 E;  5BVZ A;  2E5T A;  2Q3E A;  1JTH B;  1YTZ I;  3L75 J;  2P7J A;  4U3F J;  2FKW B;  4H13 C;  1T6A A;  2BEZ F;  4B86 A;  3L75 D;  2IFN A;  3EFF K;  2P2U A;  2WWW A;  1KYO D;  2A45 H;  1LTA C;  1PP9 G;  4LLH A;  4DDI A;  1U7J A;  3A0B E;  3WUV A;  3LID A;  1CSB A;  3Q3D A;  4U3F E;  1RE3 A;  3H1I E;  4AYC A;  1YJW P;  5KLV D;  4LGD E;  1SQV D;  1IFP A;  4ASW A;  2O1J A;  3E1R A;  1JCC A;  5APV A;  3MUD A;  2H8P D;  2BS3 C;  1S2E A;  1KN7 A;  1T2K D;  2M3E A;  1CI6 A;  2CK3 H;  2WPV B;  1KC8 Q;  4I7Z B;  1JEK A;  1T3U A;  2J59 M;  3BRV B;  3L74 J;  1FDO A;  5KLV E;  2YXR B;  3CX5 I;  1VQ8 P;  1S3J A;  1JB0 J;  4WY4 B;  2WDQ D;  3GF7 A;  3H25 A;  3GHG A;  1SP4 A;  5C3J C;  3L71 G;  2QJK B;  4GIF A;  1KTM A;  1H8A A;  2E76 D;  2HR3 A;  1GU5 A;  2RH0 A;  4EOT A;  3VMZ A;  2FYU K;  3AE1 C;  2Q6Q A;  1KMI Z;  2QIW A;  1BCC E;  3PH0 A;  4JF7 A;  5C3J D;  2Y9Z A;  2WVR A;  4OWF A;  3P4Q D;  2N1T A;  2WDQ C;  3AE9 C;  3MIW A;  3I5C A;  1U7M A;  2R44 A;  3TGU D;  2AXT H;  4HKZ H;  3M0D C;  2WT7 B;  5BU5 A;  4D6T J;  2Z5H A;  1ZME C;  1PL5 A;  3B5N D;  4PJ0 H;  2FBW C;  5H2F E;  1AJY A;  2HFE D;  1K73 Q;  1JY2 P;  1FS0 E;  3GW6 A;  2A45 G;  3MD0 A;  2QJP C;  5TIS E;  4YTN C;  1RF0 A;  1NGM B;  5EFW B;  1LT9 A;  2WU2 C;  2ZFC A;  2FXO A;  3B5N C;  3B5N A;  4D6T E;  3VMX A;  3L73 G;  1H0T B;  3SFD C;  3WU2 E;  3H32 B;  1LT9 C;  3AE4 C;  3U1A A;  4JPZ B;  4U7J A;  1OW6 A;  1QVF O;  1SQQ G;  2AXT E;  1BE3 D;  2W6J H;  2I1K A;  1SFC B;  3AEB C;  3UIA A;  3TNU B;  1BE3 E;  4IFM A;  1VQ6 P;  1NTZ J;  4I1L A;  3BRT B;  3CXH E;  1RHZ B;  4D6T D;  3WU2 H;  2WSF H;  2HPC B;  1JTH A;  3QWO C;  1KIL B;  5BU8 B;  3VYI A;  4YSY D;  4H13 B;  2KUB A;  4PD4 I;  1SLQ A;  1SQP J;  1EDI A;  1WMK A;  2YO3 A;  1VF5 D;  1QVG O;  1PP9 E;  5AVT B;  3TGU G;  1ZW0 A;  2SPZ A;  3AEG C;  3L36 A;  2KS1 B;  2KP8 A;  3BVH A;  2YIU C;  4YTM D;  2W27 A;  3VRB D;  1L4A B;  1RF1 B;  2D2C C;  3S9O A;  5AVQ B;  1LT1 A;  3I56 P;  1YQ4 D;  1VQP P;  1HGV A;  3H1H G;  1BCC D;  1SS1 A;  2FYN B;  1NEK D;  3AE5 D;  2Y0C A;  5TJH A;  3TK1 A;  2WDV C;  3KDP B;  3MUD C;  4H44 C;  3PHL A;  1Z56 A;  1KOR A;  3L73 D;  1HJB A;  2O01 H;  4N3Y B;  2Q7C A;  2B76 C;  1GK6 A;  2ZT9 B;  2WS3 C;  2JO1 A;  2R3C A;  4WY4 C;  1RF1 A;  4N78 E;  1L4A A;  2Q1K A;  3A0H E;  4KT0 J;  4O9B A;  2WSE J;  3VMY A;  3AE2 D;  2A06 E;  3H1J J;  2YIU B;  2QA4 P;  1FZC A;  5KLV G;  5KLI C;  1G2C A;  1N2D C;  2LR2 A;  2A06 D;  1URQ B;  3RGU A;  1YQ3 D;  2Y0D A;  2D2C B;  1NTK E;  2A45 I;  1NTM E;  2P1J A;  1USE A;  2B89 A;  2BCC J;  3MP7 B;  2E74 D;  1SQB K;  3VOP A;  1DH3 A;  3RL0 D;  2KK7 A;  1Y9B A;  1NTK K;  1Q82 Q;  4YT0 C;  2FYN C;  1BCC G;  2Z4E A;  3AE9 D;  1FZE A;  2XND H;  3H32 A;  1XTG B;  1FBM A;  1NYH A;  2W83 C;  1SQQ D;  2KNC A;  3D71 A;  3H1L J;  5L8R J;  2M5A A;  2E42 A;  2IX7 C;  1SQV E;  3P8C D;  5KJ7 C;  2B87 A;  1X8Y A;  4ZMD A;  1FZA A;  3V6I A;  2YKP A;  1NTZ K;  1IK7 A;  1H0T A;  2G3A A;  2K88 A;  3AEC D;  4Z1M H;  2N1T C;  5KTB A;  1L0L D;  3VMA A;  1QX8 A;  2FXM A;  3MTU E;  1KFM A;  1N7S C;  2WSC H;  2NPS A;  2IZ1 A;  2QE7 H;  1K9M Q;  3L71 J;  3L35 A;  1GD2 E;  4XFJ A;  2E75 D;  3CMA P;  2WPR A;  1KYO H;  2WT7 A;  1S4X A;  5E79 E;  2N1T D;  3USS A;  4C7N A;  3AE7 C;  1KYO E;  3RK3 E;  1OIP A;  1ZR4 A;  2XV5 A;  3ABV C;  3G9R A;  1VQ4 P;  1N7S D;  3A7O A;  2Z5I A;  2QRX A;  3JCU E;  2R3S A;  5CBN A;  1SQQ E;  3HE5 B;  3K5B A;  1LTI C;  1S5L H;  1PGO A;  2QM8 A;  3CCE P;  5CCH C;  3FWL A;  1RQV A;  3NFQ A;  4JYC A;  1CI6 B;  1N73 C;  2FYU G;  1JMB A;  3HE5 A;  1M90 Q;  2OYH C;  3MHV A;  3N4X A;  4Y99 C;  2QJY B;  1LJ2 A;  1JO5 A;  1DIP A;  1RE3 C;  1VF5 C;  4PV1 B;  1GDT A;  3W67 A;  3GHG B;  2M0B A;  3N7N A;  1T3J A;  4YTN D;  2Y0E A;  3VP9 A;  1VQ5 P;  3E1I A;  1IZN B;  1NU1 D;  5AW0 B;  2UWJ E;  2H7H A;  4ZKU A;  1JOC A;  1K8A Q;  4W7Y A;  5GTH H;  3O6Q A;  3AE4 D;  1URQ C;  3AE3 D;  1J2J B;  5APW A;  1N8R Q;  1VQL P;  5AW6 B;  3IF4 A;  4YXD C;  1ZP0 C;  3TGU J;  4RO0 A;  2KB7 P;  4I7Z C;  1NEN D;  1KZU B;  1GL2 B;  2Q9I A;  4YXD D;  1KIL A;  3AE8 D;  1M7L A;  1ZXG A;  2ZXE B;  3P8C E;  1FZG A;  3VR8 C;  2DW3 A;  1ZP0 D;  2ZT9 C;  1X0T A;  1S72 P;  3HD7 B;  1M1J B;  3JC2 2;  4NPD A;  4LDT A;  2WPS A;  1SQX E;  1QGK B;  1SFC A;  2QEX P;  2HOD B;  3M9H A;  3RK3 D;  4UB6 H;  1HWT C;  1OWA A;  2WU2 D;  1L0N J;  1HVV A;  2IFM A;  2YXQ B;  1VQ7 P;  3WUU A;  1M56 D;  3EWK A;  2ACZ D;  4OGQ C;  1NEK C;  1FE6 A;  3AE6 C;  4BXL A;  1DEB A;  1EXI A;  1GW4 A;  2MKV A;  1L4A D;  3HD7 A;  1R5L A;  1IK9 A;  1EDK A;  3KYQ A;  3H1I D;  1RH5 B;  1NAY A;  2KSJ A;  2KLV A;  3RL0 g;  3CC7 P;  1KYO I;  1ZV8 A;  1RQU A;  2D2C D;  4DJG A;  1L0V C;  1M1J C;  2WIT A;  4TT3 H;  2IZ0 A;  5DJU B;  1LGH B;  3A0H H;  2HOD A;  1R5S A;  1NTM J;  4ZKP A;  1NTK J;  3T97 A;  3HUS C;  5C2T D;  2ZT9 D;  3L74 D;  1KB9 D;  2M8R A;  2ITA A;  3CWB G;  1AFO A;  5APX A;  4EIJ A;  3AEA D;  2Q5U A;  1YYC A;  1KIL D;  2GUS A;  2WS3 D;  2AEF A;  2WSF J;  1OW8 A;  3G4S P;  1JNM A;  4NPF X;  2ZVO B;  2YKQ A;  1GL2 A;  1YIJ P;  1EQ7 A;  1SQV J;  1JY3 O;  3VR9 D;  1S9K E;  1EDJ A;  2AXC A;  2BCC D;  5GTI H;  2OYI B;  2XDJ A;  3SSU A;  3H1J G;  2JEE A;  3PRJ A;  2P58 A;  2B9B A;  3CCU P;  1LWU A;  1E79 H;  2K9J B;  3VR9 C;  3EFG A;  1KIL E;  4EYY Q;  2B88 A;  2O3J A;  1FZB A;  2FFD A;  3P32 A;  3L75 E;  3BAT A;  1OX3 A;  1NU1 G;  1KQG B;  2RN0 A;  2K3R A;  1YQ3 C;  3LIE A;  3D70 A;  3TDK A;  1WT6 A;  3CWB D;  4WBA A;  1SQB G;  5CCG A;  1SQP E;  2L91 A;  1PPJ D;  1KQS O;  3AED D;  5AVW B;  1BE3 G;  1NWQ A;  5AVX B;  3CIR D;  3M06 A;  4IFF A;  1SQX G;  3CXH D;  4PD4 D;  1G1I A;  3SWK A;  3CC4 P;  2R5B A;  3II6 A;  4BRY B;  3W68 A;  2WDV D;  1D7M A;  3SFE D;  4EI2 A;  5CCG C;  2M5A B;  4ZNC A;  1OVU A;  4CPG A;  4FJV A;  1SQB E; 
#chains in the Genus database with same CATH homology
 1K04 A;  3Q5P A;  1HJ0 A;  4Y28 J;  1KFY C;  3D71 A;  1MKM A;  3P4Q C;  4YTN D;  3D6Y A;  5L8R J;  3S9O A;  2QJP C;  4KX6 C;  2FXP A;  4R4L A;  4YTN C;  3EWK A;  4OGQ D;  1NGM B;  1YQ4 D;  2ACZ D;  1ZOY C;  2BEQ D;  3LW5 J;  1KF6 D;  3ABV D;  3P4R D;  3VRA C;  4OGQ C;  1PIX A;  2WU5 D;  1NEK C;  1E7P C;  3Q2Y A;  2WU2 C;  3AE6 C;  2BS3 C;  1VL2 A;  2K9Y A;  2E75 B;  1IK7 A;  1NEK D;  1EXI A;  2MKV A;  3D6Z A;  2G3A A;  3AEC D;  3AE5 D;  3VRB C;  4Z1M H;  3O6Q A;  2G8Y A;  3AE4 D;  1DD4 A;  4YSY C;  2WPV B;  5M1B A;  2WDV C;  1NEN C;  2YMK A;  3SFD C;  4I7Z B;  3AE3 D;  3AEE D;  5KKZ C;  3AE4 C;  3VR9 C;  5C2T D;  1S5L X;  1ZOY D;  4H44 C;  4YSZ D;  4U7J A;  1OW6 A;  1KIL E;  4XFJ A;  1FDO A;  3RL0 g;  2E75 D;  2WP9 C;  3P4P C;  1KOR A;  5C2T C;  2BS4 C;  3CIR C;  4YXD C;  2E75 C;  2B76 D;  3GLM A;  3VRA D;  2WP9 D;  2WQY D;  1UIX A;  1RQU A;  1VF5 B;  4PV1 C;  3VRB D;  1KQF B;  3AEC C;  1TU3 F;  1JB0 J;  1ZP0 C;  2D2C D;  1GMJ A;  3AEB C;  4YTP C;  1R8E A;  2B76 C;  2ZT9 B;  3AE7 C;  2WDQ D;  3AEE C;  4H0L C;  2WS3 C;  1L0V C;  3SFD D;  3GF7 A;  2JO1 A;  1DD3 A;  3H25 A;  4I7Z C;  1NEN D;  2P10 A;  3VR8 D;  1KQG B;  4H0L D;  3RK3 E;  4KX6 D;  1K05 A;  4H13 D;  2WU5 C;  5C3J C;  2WSC J;  3P4S D;  1KTM A;  2ACZ C;  4YSZ C;  1YQ3 C;  3ABV C;  3G9R A;  3P4S C;  4TT3 H;  2E76 D;  4KT0 J;  3D70 A;  2WSE J;  3FGA D;  4YXD D;  3AE2 D;  2WDR C;  2IDB A;  3T97 B;  4IL6 X;  3AE6 D;  3AE8 D;  3B71 A;  4H44 B;  3AEB D;  4YTP D;  1KFY D;  3AE1 C;  4YTM C;  2QIW A;  1KMI Z;  2QJY C;  5KLI C;  3AED C;  2H88 C;  4H0L B;  3VR8 C;  3AEF D;  4H13 C;  3Q5R A;  1PV3 A;  2NZ2 A;  2H88 D;  5C3J D;  4YSY D;  2O01 J;  3AEF C;  2BEZ F;  3AED D;  1KF6 C;  4H13 B;  1YQ3 D;  2ZT9 D;  1ZP0 D;  3P4P D;  1YQ4 C;  3P4Q D;  3C8V A;  2WDQ C;  1S1C X;  2D2C B;  2V7Q J;  4H44 D;  1OW7 A;  2ZT9 C;  3AE9 C;  4PV1 D;  2WDR D;  1RQV A;  3CIR D;  3AE2 C;  1WMK A;  2H89 D;  1VF5 D;  2QJK C;  4YSX D;  2E74 D;  2WQY C;  2E76 B;  1U57 A;  3AEA D;  4GDO A;  3R4Y A;  1QLB C;  1Q90 D;  3AEG C;  3IAO A;  4OGQ B;  4YSX C;  4YT0 D;  1ZRT E;  2JP3 A;  2WDV D;  2WS3 D;  1Y9B A;  2WSF J;  3AE3 C;  3IN6 A;  1L0V D;  2YIU C;  2BS2 C;  3AE7 D;  2E76 C;  1ZME C;  3GF3 A;  4YTM D;  3AEG D;  4YT0 C;  3SFE D;  2FYN C;  2J5U A;  1HF9 A;  3AE9 D;  2OQQ A;  1OW8 A;  3P4R C;  1PL5 A;  3AE5 C;  2E74 B;  2FBW C;  2QSI A;  3AE8 C;  3SFE C;  3Q1M A;  2H89 C;  3Q5S A;  1DIP A;  1OMI A;  1VF5 C;  4PV1 B;  1AJY A;  2WU2 D;  4R4M A;  3Q3D A;  1NYH A;  2FBW D;  2E74 C;  3GMA A;  1FDI A;  2D2C C;  4RKU J;  3AEA C;  1EXJ A;  3AE1 D;  3VR9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...