3AE5C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-methyl-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Methyl-N-(3-isopropoxy-phenyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae5C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae5C02
3AE1C 1OW7A 3P4PD 4YTND 1K05A 2B76C 2WDVD 1YQ3D 3AE5C 2ACZC 3P4QC 3VRAD 3CIRC 4YSXD 1ZP0C 3P4RD 3VR8D 3AE2D 2WQYD 2WDQD 4YTNC 3AE1D 2FBWC 1YQ4C 2B76D 1NEND 3AE5D 1K04A 3SFDC 2ACZD 3P4SC 4YSXC 5C2TC 3AEGC 1QLBC 3AE6D 3VR8C 3AEDC 4YSYC 3ABVC 4YTMC 3SFED 1OW8A 3AE7C 4YXDD 2FBWD 1NENC 1YQ4D 1E7PC 1PV3A 5C2TD 3SFDD 3P4SD 3AE6C 3AEGD 3SFEC 3AEDD 4YSYD 3AECC 3ABVD 4YTMD 4YXDC 2G3AA 2WDRC 3AE7D 1OW6A 2WU5C 2WU2C 2BS2C 4YTPD 3AEAC 1KFYC 5C3JC 3VRBC 1L0VD 3AEBD 2BS3C 3AEFC 3AECD 3AE3C 1ZOYC 2WDRD 4KX6C 2H88C 3S9OA 2WU5D 2WU2D 4YTPC 1KFYD 3AEAD 1L0VC 3AEBC 5C3JD 3VRBD 2WP9C 1NEKD 2WS3C 3AEFD 3AE3D 1ZOYD 4KX6D 2H88D 3VR9C 2BS4C 2H89C 4YSZC 3AEED 1KF6C 1NEKC 3AE8C 2WP9D 2WS3D 3AE9C 4YT0C 3AE4D 3VR9D 3P4PC 3AEEC 2H89D 2WDVC 1YQ3C 4YSZD 3VRAC 1KF6D 3AE8D 3P4QD 3B71A 3CIRD 3AE9D 3P4RC 1ZP0D 4YT0D 1KTMA 3AE2C 3AE4C 2WQYC 2WDQC
chains in the Genus database with same CATH superfamily
1WRGA 1M8OB 4UB8E 4HJGH 2ACZC 2M5AB 3TF5A 4GKGA 1NYHA 1M1JA 1FDMA 1LT1A 1SFCC 1X22A 5B5EH 2NPSD 3TGUD 2Q5UA 2ZAEB 3BVHA 2W6BA 2O1JA 1GL2B 1OW8A 5AW0B 2FBWD 1CW5A 1E7PC 1UIXA 5AVSB 2JEEA 3NXSA 3H1HG 1EZVG 3ZDMA 1FZGA 3D71A 2KI7B 2E74C 1QL2A 3TNUB 3OW2O 2BCCE 1YHQP 1LTJB 5E79H 3AECD 4QMAA 1USEA 3D6YA 5BVZA 2WSEJ 3H1IG 3BASA 1NEKD 5AVTB 3PJSK 3TGUE 2H88D 2W8ZA 1CSBA 2R44A 3L70D 2XV5A 2KIKA 5KLVK 2KNCB 2C0WA 5CMZA 1AV1A 2KZJA 1RHZB 4OGQD 1A02J 3HUSA 2WQYC 1NU1K 1M90Q 3KZIH 1L4AA 3AE5C 1JMMA 3T97A 1NHLA 3CIRC 2PGDA 1FZFA 4RESB 1RF1A 2FYZA 1PL5A 3PH0A 3M0DA 4YTNC 3AE1D 1GK4A 2Q6QA 1D7MA 1VQLP 5AW3B 3G71P 3AE6D 1EDKA 1SQXE 4YSYC 2M3BA 3AE7C 1RF0C 2E5YA 2Q1KA 1LWUA 3OAKA 5C39A 1YITP 5H2FH 1KFNA 2G3AA 4LGDE 1QVFO 1RQUA 1SFCB 2W90A 1OWAA 5C3JC 1NTMG 1KFMA 5AVXB 2XZRA 2BS3C 3L73G 3TK1A 2KSEA 1IZNB 2YMYA 4KX6C 3CX5D 4YTPC 2AEFA 1AJYA 2ZT9C 1PGPA 4NPDA 3AEAD 1S5LX 3RK3E 1JEKA 2YKPA 5TJHA 3O6QB 2WSSH 2OYIC 1BCCG 2D2CD 2CK3H 4DT0A 2E74B 3L73J 3OJAB 1KYOD 2IBZI 4BXLA 2QEXP 3MZWB 3EQ2A 4GOEA 1SQPE 3VMAA 4YT0C 3O8ZA 2BCCJ 3M91A 3PHLA 3IR9A 3CCEP 3HD7D 1YQ3C 1RE3A 1NU1D 2BASA 1NH4A 1GW4A 1KILC 2J5UA 1GDTA 3BCCG 4DHIB 3P4QC 2OYOA 3CXHH 3G4SP 2O01N 3TGUJ 1ZP0C 4PD4I 2VRSA 1GL2A 4U3FG 5APWA 2IDBA 1E5WA 1CI6A 1M1JC 3S4RA 1RE4A 3HE4B 4WY4C 1NVOA 3V4WA 4EYYQ 3A2AA 4YXDD 2P2UA 3CI9A 1GK6A 1VQMP 2WPQA 3AEDD 1FZCC 3SSUA 2KB7P 1QX8A 3CWBD 2IBZG 3L70G 1DH3A 1VF5C 3P32A 2ZFYA 2QRXA 2MKVA 1OMIA 2DW3A 2WDRD 2WU2D 1TFFA 3GMAA 3CD6P 2PP6A 1BGYD 2KSJA 1LTGC 1EDLA 1JCCA 2FYUE 3GHGC 1BE3D 3KDPB 3QH9A 1VQNP 2KNCA 3GG2A 5CHXA 5APXA 1NAYA 3G9RA 2WSEH 4KT0J 1S5LH 1VQ6P 2ZT9B 3B71A 5CCHA 1HH0A 1QLED 1L0LK 2OYHC 3WUUA 3V2RA 2OYIB 1VQ8P 5CBNA 1Q86Q 2B89A 4JBZA 3I55P 3ITKA 3EFGA 3JCUH 1N8RQ 3MGNA 2WDQD 4D6TG 1BGYE 5AW1B 4GOFA 1YIJP 1RF1C 5C2TC 1J1EC 2FFDC 3M0DC 3SFED 2Q3EA 1KILB 1WMKA 1SFCA 3AEGD 3IF4A 4IFDK 4BRYB 5KLVG 3E1IA 1XTCC 2P58A 1M1JB 1LTBC 1ZRTD 4PV1D 1KC8Q 1ZOYC 3O6QA 5AVVB 4WY4B 1NU1G 4KHXA 2E76D 2C9NY 2Q3IA 2YMKA 1TU3F 1YTZT 1LTTC 1L0VC 3VRBD 1KZUB 3H32A 3HD7A 3BRTB 3AEFD 4IFMA 4RJTA 1FZCB 4IL6X 4W80A 2RKLA 3H25A 3AE8C 1NU1J 2LXBA 1VF5B 5CJ4A 2QVAA 4R4MA 1HVVA 2KK7A 1L0LD 4ASVA 2P7JA 4DCKA 3CPWO 3TDKA 1IFMA 3L71G 3Q3DA 1KN7A 3AE4C 3L74G 2W27A 1RE3C 2HLOA 1JY2P 1U7MA 1R5LA 1OVRA 3GHGB 3U59A 2NPSC 4IFFA 1SS1A 3CWBG 5KAFH 3HE4A 4TT3H 3P8CD 2YXQB 2FBWC 1EXIA 4H44D 1JY3O 3CXHI 1H88A 1L0ND 4DHJA 1FAVA 1PP9E 1N86A 2Z5HA 2R5BA 3CWBJ 2OYHB 1NENC 1RE4C 4RO0A 1L0LE 5GTIE 5KJ7D 1BE3G 3AECC 3GF7A 2KLUA 1OW6A 3T97B 4OVNF 1JO5A 1RF1B 1J1EB 3L35A 2FFDB 5AVYB 1BGYJ 4LC1A 1P84E 3MD0A 2H88C 3C9IA 1NTZE 1BE3J 3L75E 3CCVP 5AW9B 1L0NE 5KAIH 2IX7C 2B9BA 3I56P 2JDIH 2HYNA 1NO4A 4JYBA 2KYVA 2OTJP 1KB9E 1GD2E 4OGQC 1K9MQ 3SWFA 2YNYA 1LNQA 4BWNA 1SQVE 1EZVI 3WU2E 1VQ4P 2ZFCA 3P8MC 3M9QA 3AE1C 4XA4A 5K5GB 4N3YB 5AVQB 4N78D 2IYOA 2WPRA 3LW5J 1SQXK 2E43A 2R5DA 3AE2D 2QE7H 1ZV8A 3B5ND 3MHVA 3R4YA 4BRYA 3WUTA 1AQ5A 3RGUA 1YI2P 2MJZA 2NPSB 3W68A 2G8YA 2K9YA 4GT1A 1IO4A 4WY4A 1OVUA 3A0BE 3GF3A 3M9BA 3AEAC 2OARA 3V4QA 5GTHH 4N78E 1PIXA 1CI6B 2D2CC 1ZLLA 4XE5B 1JCDA 1FZCA 3L72D 3CCMP 2N1TD 1G1JA 1IFNA 1QVGO 1S9KD 1SQPK 1X0TA 3CX5H 4UB6E 3W67A 3HD7C 3JSVC 1L0LJ 5AVWB 1FZEA 1LJ2A 2WITA 2OTKE 1OIPA 1K73Q 1LGHB 1Q7YQ 2B87B 1URQA 1IFDA 1KYOH 1EDIA 5CCGD 3GHGA 2E5TA 3HE5A 1HJBA 1EDJA 1FZBA 2HPCB 2QM8A 1KTMA 1BSHA 1OW7A 1SQXD 3TSIA 2WDVD 1L0NJ 4YSXD 3L72E 4OGQB 3VR8D 3C8VA 1S9KE 1T2KD 2OYHA 2B76D 1RQVA 1HBWA 2J58A 5B66E 3KYQA 3AEDC 1Y9BA 1FE6A 3IFMA 4YPCA 2QSIA 1YQ4D 2P10A 3KHUA 1KQFB 3SFDD 1ZR2A 3H1JE 2AXTE 1FDOA 2FFDA 1NTKK 2O3JA 3RK3D 2KUBA 2WDRC 2WU2C 1FU1A 2BS2C 2R32A 4L73A 3VMXA 2R3SA 1SQBE 4ASWA 3H1KD 1NJIQ 2FXOA 2FYUK 1T8ZA 2Y9ZA 1HWTC 1SQPD 2WMMA 3L4FA 1KFYD 3AEBC 2FKWB 1KQLA 4ZKUA 1GMJA 3WUVA 2WSFJ 2L5GB 1XTGB 1M56D 3VP8A 4DJGA 2D2CB 2NRGA 2BCCG 3AE9D 4DZOA 1X79B 2WDQC 3CC2P 2KS1A 3H1KE 3H32B 2WSCH 3H6PA 3HD7B 2JP3A 1PGJA 5TISH 1MUUA 3TGUG 1G1IA 4B86A 4WBAA 4FJVA 3FXDA 5APTA 5L8RJ 3AEGC 2NPSA 1SQQE 4MN4C 5B5EE 1NTKD 2WPSA 4KJMA 4I7ZC 3P4SD 1KMIZ 4RKUJ 2B88A 2N1TA 3BRVB 1NKNA 3L72J 1NOHA 2FYUD 4ZKPA 3VRBC 5KLIC 2Y0CA 3AEFC 4GDOA 2K37A 1VQPP 3D6ZA 5AW7B 2YKOA 5E79E 1L2PA 4H13C 1SQXG 1W2EA 1IK7A 1FOSF 3H1LD 1N7SD 2B87A 2WT7B 3CCJP 2Y0DA 3WMM0 3VTPC 1NTKE 2V7QJ 3CX5I 2HPCA 3Q1MA 1GZLA 1SP4A 1BDCA 4I1LA 1LT9A 3RL0D 2GUSA 1SQXJ 4EDFA 3UIAA 2H7HA 1PGOA 3KQGA 1DEBA 3CIRD 1JY3N 1URQC 2Z5IA 1S2EA 1KYOI 3A3YB 4YTND 3KXDA 3A0HE 2E75C 3VRAD 3B8EB 3P7KA 1MKMA 3KZIE 5AW4B 1G2CB 2A06E 1T3JA 1IFIA 2PAJA 4EI2A 3MUDA 1K04A 2IPPA 4AUWA 4JYCA 1QLBC 3H1LE 1SQPG 4H0LD 2POHA 1VQ9P 4U7JA 3IN6A 1YJ9P 3PP5A 2GM4A 3H1KJ 2QM7A 2NZ2A 5M1BA 1NTZK 1KV4A 4PJ0H 1SQPJ 4YTPD 5H2FE 1BSNA 2XU6A 3F89A 4WB4A 1L0NK 1FJKA 2YIUC 4I7ZB 1H0TB 4O9BA 1NAFA 4L74A 1SQVK 1AA0A 1SLQA 2GA1A 4ZNCA 2HG5D 5KLIB 1UIIA 1PPJD 1R8EA 3VR9D 1KILD 3AEEC 4GIFA 4YSZD 4UB8H 2Q7CA 3P4QD 1NTKG 4H13B 1ZP0D 3AE2C 1PP9D 4K35A 2PRRA 1KQGB 3B5NC 3L36A 4ZMDA 3GLMA 2L91A 2FYUG 1NTKJ 1LP1B 1ZW0A 4C7NB 2ZYGA 3VMYA 1URQB 3CC7P 2KP8A 2P1JA 1FBMA 1CZQA 1P84D 3HE5B 1GU5A 1PPJE 2FYUJ 2I1JA 1KILE 1NTZD 2E75B 1VF5D 1PZQA 3H1LG 2C9LY 3L75D 2K3RA 3H1HD 4K3AA 2HFED 2XNXA 3Q5RA 2BEQD 4CPGA 2N1TC 1MV8A 5CJ0A 1N2DC 2ITAA 2JR8A 1Y8AA 1ZR4A 1KB9D 3M0AA 1BGYG 1RH5B 2WU5D 3H1LJ 2WT7A 1QL1A 1SQVD 1Q2NA 1VQKP 1NTMK 2LXCB 1S72P 1EQ7A 2IYPA 3H1ID 2W6AA 1JY2O 4WVZA 3CL3D 1NEKC 1NKZB 5B66H 2WDVC 2YIUB 2QJPC 3H1HE 1QEXA 1EZVE 3MIWA 1LT9C 1YJWP 3D70A 2AXTH 1G2CA 1L4AD 1U7JA 1S5LE 1T2KC 2B76C 2V7QH 1YTZI 3E1RA 3LIDA 2I1KA 1VQOP 3CCUP 1YQ4C 3SFDC 1Y47A 3H1IE 2KZIA 3QWOC 4JQ0D 1IFJA 4N6JA 3JCUE 2Q9IA 2QG4A 1OVVA 1Z56A 3MUDC 4I2LC 3RK3C 2OTLP 1M57D 3V5BA 3KPEA 3FWNA 1PV3A 1AFOA 2E42A 2N9BA 3AE6C 3B5NB 1Q90D 5DJTB 1X8YA 1SQBK 1IFPA 4HH2A 3RBZA 4YTMD 5CBOA 2KS1B 1LTSC 3G6EP 1N73A 1KFYC 2C0XA 1L0VD 3RK2D 2IFNA 1IJDB 1H0TA 4R4LA 2YO2A 1NTMD 3PRJA 4NPFX 3SWYA 1PP9G 3CCRP 3RL0g 3AE3D 2H43A 4I6LA 1OZHA 2WWWA 2A45H 4HKZH 2GUVA 2N1TB 1DEEG 1BCCD 1L0LG 3AE9C 2V4HA 4I6MC 1S1CX 3AE4D 1PP9J 1Q82Q 2H89D 1FC2C 3FGAD 4OH8B 4DDGA 3G3ZA 1NTZG 2Y9YA 2ZYAA 2AEJA 3L75G 1DX7A 1LP1A 2WTYA 1NTME 4W7YA 1W5CE 4C7NA 1GL2D 1OXZA 1RY3A 1DIPA 1L0NG 3BCCD 3L73E 3P4RD 1SQQK 3H1JD 3VOPA 1NEND 3P4SC 5KAFE 3CLQA 2QJPB 4U3FD 1IC2A 1NTZJ 4NPEA 1JB0J 1LTIC 1LT9B 3L75J 3S1KA 3FXEA 1A02F 1BCCE 3H1HJ 1SQBD 1SQVG 3VYIA 1GTWA 4OWFA 2QJYC 3ABVD 4YXDC 5KJ7A 1E79H 1SQVJ 2FXMA 1VQ7P 2IBZD 1JM0A 1HF9A 3S9OA 3RK3B 3H1IJ 3BCCE 1N7SC 1Q81Q 4EOTA 1M1KQ 3A0HH 1H8AA 4IOIH 3GW6A 1W2BO 4U3FE 2FYNC 3RL0C 5DJUB 3N7NA 3VONA 1MFTA 5KAIE 3V2PA 2WP9D 2ZXEB 2WS3D 1AVYA 3HTKA 1HGVA 4PD4D 3U1CA 2Z4EA 5CCHD 3VRAC 1KF6D 5APYA 3B4SA 2J59M 1FOSE 3P4PD 1SQQD 2IBZE 3L70E 2QJKC 2ZYDA 2ZXXA 1JMBA 4H0LC 2HR3A 5EFWB 4IL6E 3K5BA 1FZAA 2XNDH 3NMDA 2ACZD 3E7KA 3B5NA 1ZXGA 4D6TD 1JNMA 1HJ0A 2K9JB 2JWAA 1SFCD 4GODA 2YKQA 4PD4E 1NWQA 1J1DC 1USDA 4AQRD 3SFEC 2RMZA 1T3UA 4L76A 5APSA 4LDTA 2IZ1A 1NTMJ 1JTHB 3V2QA 3L72G 5KLVD 1N73C 4M3LA 1AQTA 2E74D 5KKZC 3LW5H 5GTHE 4PV1C 3A5TA 1BCCJ 2M5AA 4AYCA 1FDIA 2QJYB 2W83C 1EXJA 2E76C 4D6TE 5APQA 3VR9C 2QIWA 4YSZC 4Y99C 3H1JG 5APVA 3TYYA 3CX5E 3CMAP 2A45I 2A06D 1N7LA 3V2NA 1N7SB 2O01J 5AW5B 5CCGA 1SQBG 2LKMA 3BCCJ 1KYOE 3H1JJ 1AVOA 5KLVE 3L71D 1K05A 2FYNB 3RL0B 3TNUA 3L74D 1DD3A 1X9VA 4U3FJ 3MP7B 1LTJA 1SVFA 2M3EA 1YJNP 1T6AA 1ZMEC 2WQYD 1NU1E 1SQBJ 3AE5D 1H89A 2K88A 3A7OA 5BU5A 5GTIH 2W6JH 4H44C 3C1LA 1KQSO 5AW6B 2QJKB 4YSYD 2QA4P 1HUCA 1U57A 3L70J 3AE7D 4H0LB 3BATA 2WU5C 2RN0A 1P84H 1R5SA 3H1KG 3CMEP 3USSA 1LTAC 1FS0E 5AVZB 5KJ7C 3AEBD 3L71E 1WT6A 1KD1Q 1JY2N 2A45G 3L74E 3M06A 2ZVOB 5AW2B 2CPBA 1HGZA 4DDIA 5C3JD 1YYCA 5APUA 3HRNA 3CWBE 4C46A 1J1DB 1SQQG 1KB9H 4DHZA 3Q5PA 3M9HA 5KTBA 4KX6D 2JO1A 5AVRB 2BS4C 2ZT9D 4WWIA 4JF7A 2WVRA 3CCLP 3HUSC 2FY8A 1DD4A 3NFQA 1L4AC 4C7RA 3WU2H 1N73B 1SQQJ 2HODB 5KKZB 1PGQA 3OA7A 1S4XA 2AEMA 1GU4A 2Y0EA 3CXHD 1K8AQ 2CPSA 4PV1B 2H8PD 3FWLA 1BE3E 4YT0D 4HYTB 5AVUB 2XKMA 2UWJE 2E76B 1VPCA 1YQ3D 4Y99B 1KORA 3Q2YA 4D6TJ 2I8DA 2OGUA 1EC5A 1JUNA 2K9JA 1LWUC 3EFFK 1MZ9A 1YBKA 5TISE 2R3CA 2JKVA 1MFZA 4YTMC 3V6IA 2WSFH 2WZ7A 1QGKB 1JTHA 3A0BH 1OFCX 3CC4P 4WY4D 3RK2C 5KLVJ 2WPVB 1OX3A 1JY3P 3IAOA 3CXHE 2JJLA 3VMZA 3N4XA 2M0BA 2O1KA 4H13D 1M7LA 3AE3C 2A06G 1VL2A 3VN0A 2LR2A 4H44B 2N9YB 4UB6H 4EIJA 3JC22 2IZ0A 3VP9A 1VDFA 4DOJA 2OQQA 1EZVD 3NTNA 1ZRTE 2H89C 2YXRB 1NGMB 1N7SA 4XFJA 3CCSP 3Q5SA 3F5HA 3L37A 1URQD 3EWKA 3L71J 2PFXA 2E75D 3L74J 1GL2C 2JWDA 3P4RC 2KXPB 5CCGC 3RBXA 3FX0A 3HUSB 1GW3A 1L4AB 2O01H 1LTJC 4YSXC 1RF0A 3PLNA 3PTZA 3MTUE 1PFIA 2YO3A 3HTKB 3VR8C 3ABVC 4W7ZA 1JOCA 4HB1A 2XDJA 1FJPA 2IFMA 5BU8B 5C2TD 1IK9A 4Y28J 3LIEA 3P8CE 1J2JB 1ZN5A 2AXCA 3CCQP 3I5CA 4LLHA 4JPZB 2BEZF 2KOGA 2FXPA 5AW8B 2ZJSE 1LWUB 1VQ5P 4L75A 2WSCJ 4TLFA 1HTLC 4PJ0E 1P84I 2K1AA 2OYIA 2RH0A 2SPZA 2ZVNB 2WP9C 3U1AA 2WS3C 4A7PA 1ZOYD 3RK2B 4YXWH 1S3JA 2HODA 4IL6H 3AEED 5CCHC 1PPJG 2P67A 1KF6C 1KB9I 3P4PC 3L73D 2KLVA 1BDDA 1KILA 3AE8D 3SWKA 3R2PA 2M8RA 3II6A 4PD4H 2BCCD 4Z1MH
chains in the Genus database with same CATH topology
2J5UA 3AE1C 1OW7A 3P4PD 4YTND 1KQGB 2E76B 1K05A 2B76C 2WDVD 1YQ3D 3AE5C 2ACZC 3P4QC 2E75C 3VRAD 2JP3A 2QJKC 3CIRC 4YSXD 1DD3A 3GLMA 1KORA 3Q2YA 1ZP0C 1NYHA 1DIPA 3LW5J 3P4RD 1PL5A 4OGQB 3VR8D 4TT3H 1ZMEC 1MKMA 4H0LC 3AE2D 2WQYD 2WDQD 4YTNC 3AE1D 2FBWC 1EXIA 3C8VA 4H44D 2IDBA 1YQ4C 2B76D 1NEND 3AE5D 1K04A 3SFDC 5L8RJ 2ACZD 3P4SC 4YSXC 3AEGC 5C2TC 1RQVA 1QLBC 3AE6D 3R4YA 3VR8C 1JB0J 3AEDC 4YSYC 1Y9BA 3ABVC 4YTMC 3SFED 1OW8A 4H0LD 4H44C 1HJ0A 3AE7C 4YXDD 2FBWD 4U7JA 2QSIA 1NENC 1YQ4D 1E7PC 1UIXA 2P10A 1PV3A 1WMKA 1KQFB 5C2TD 4I7ZC 3SFDD 3P4SD 3AE6C 3AEGD 4Y28J 1Q90D 3IN6A 1KILE 1FDOA 2E75B 1VF5D 2QJYC 1KMIZ 4RKUJ 3SFEC 3AEDD 4YSYD 2G8YA 3AECC 3ABVD 4YTMD 2WPVB 2K9YA 1U57A 2G3AA 3GF7A 2BEZF 4YXDC 3D71A 1RQUA 3IAOA 2E74C 2WDRC 3AE7D 2FXPA 4H0LB 1OW6A 3Q5RA 2NZ2A 2WU5C 5M1BA 2WU2C 3T97B 2BEQD 3GF3A 2BS2C 4YTPD 3AEAC 1KFYC 1VF5C 5C3JC 3VRBC 1L0VD 3AEBD 2BS3C 4PV1D 2WSCJ 4H13D 5KLIC 2MKVA 3AEFC 3AECD 3AE3C 1ZOYC 3O6QA 1HF9A 1PIXA 1OMIA 1VL2A 4GDOA 2WDRD 2E74D 4KX6C 2H88C 4R4LA 3S9OA 2D2CC 5KKZC 2YIUC 2WU5D 4H44B 2E76D 4YTPC 3D6ZA 3D6YA 1AJYA 2WU2D 2ZT9C 2YMKA 1TU3F 3GMAA 1KFYD 3AEAD 1L0VC 2WSEJ 1S5LX 3AEBC 5C3JD 4PV1C 3RK3E 3VRBD 4I7ZB 4H13C 2WP9C 1NEKD 2WS3C 3AEFD 3RL0g 2OQQA 1FDIA 1ZOYD 3Q5PA 2WDQC 3AE3D 1IK7A 1EXJA 2E76C 2H88D 4KX6D 2FYNC 2D2CD 2JO1A 3VR9C 2QIWA 2E74B 1GMJA 2H89C 1ZRTE 2WSFJ 2ZT9D 4IL6X 2BS4C 4YSZC 3AEED 3H25A 1NGMB 1KF6C 1NEKC 3AE8C 4XFJA 3Q5SA 2V7QJ 2WP9D 4OGQC 1VF5B 2WS3D 3AE9C 3Q1MA 4YT0C 1DD4A 4R4MA 1R8EA 1S1CX 3AE4D 3G9RA 3VR9D 3EWKA 3P4PC 3AEEC 4KT0J 2H89D 2D2CB 2WDVC 1YQ3C 4YSZD 2QJPC 2O01J 3VRAC 1KF6D 2ZT9B 3AE8D 3FGAD 3P4QD 2E75D 3B71A 4OGQD 3CIRD 4PV1B 3AE9D 4H13B 3P4RC 3D70A 1ZP0D 4YT0D 1KTMA 3Q3DA 3AE2C 3AE4C 2WQYC 4Z1MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE1 C;  1OW7 A;  3P4P D;  4YTN D;  1K05 A;  2B76 C;  2WDV D;  1YQ3 D;  3AE5 C;  2ACZ C;  3P4Q C;  3VRA D;  3CIR C;  4YSX D;  1ZP0 C;  3P4R D;  3VR8 D;  3AE2 D;  2WQY D;  2WDQ D;  4YTN C;  3AE1 D;  2FBW C;  1YQ4 C;  2B76 D;  1NEN D;  3AE5 D;  1K04 A;  3SFD C;  2ACZ D;  3P4S C;  4YSX C;  5C2T C;  3AEG C;  1QLB C;  3AE6 D;  3VR8 C;  3AED C;  4YSY C;  3ABV C;  4YTM C;  3SFE D;  1OW8 A;  3AE7 C;  4YXD D;  2FBW D;  1NEN C;  1YQ4 D;  1E7P C;  1PV3 A;  5C2T D;  3SFD D;  3P4S D;  3AE6 C;  3AEG D;  3SFE C;  3AED D;  4YSY D;  3AEC C;  3ABV D;  4YTM D;  4YXD C;  2G3A A;  2WDR C;  3AE7 D;  1OW6 A;  2WU5 C;  2WU2 C;  2BS2 C;  4YTP D;  3AEA C;  1KFY C;  5C3J C;  3VRB C;  1L0V D;  3AEB D;  2BS3 C;  3AEF C;  3AEC D;  3AE3 C;  1ZOY C;  2WDR D;  4KX6 C;  2H88 C;  3S9O A;  2WU5 D;  2WU2 D;  4YTP C;  1KFY D;  3AEA D;  1L0V C;  3AEB C;  5C3J D;  3VRB D;  2WP9 C;  1NEK D;  2WS3 C;  3AEF D;  3AE3 D;  1ZOY D;  4KX6 D;  2H88 D;  3VR9 C;  2BS4 C;  2H89 C;  4YSZ C;  3AEE D;  1KF6 C;  1NEK C;  3AE8 C;  2WP9 D;  2WS3 D;  3AE9 C;  4YT0 C;  3AE4 D;  3VR9 D;  3P4P C;  3AEE C;  2H89 D;  2WDV C;  1YQ3 C;  4YSZ D;  3VRA C;  1KF6 D;  3AE8 D;  3P4Q D;  3B71 A;  3CIR D;  3AE9 D;  3P4R C;  1ZP0 D;  4YT0 D;  1KTM A;  3AE2 C;  3AE4 C;  2WQY C;  2WDQ C; 
#chains in the Genus database with same CATH topology
 1WRG A;  1M8O B;  4UB8 E;  4HJG H;  2ACZ C;  2M5A B;  3TF5 A;  4GKG A;  1NYH A;  1M1J A;  1FDM A;  1LT1 A;  1SFC C;  1X22 A;  5B5E H;  2NPS D;  3TGU D;  2Q5U A;  2ZAE B;  3BVH A;  2W6B A;  2O1J A;  1GL2 B;  1OW8 A;  5AW0 B;  2FBW D;  1CW5 A;  1E7P C;  1UIX A;  5AVS B;  2JEE A;  3NXS A;  3H1H G;  1EZV G;  3ZDM A;  1FZG A;  3D71 A;  2KI7 B;  2E74 C;  1QL2 A;  3TNU B;  3OW2 O;  2BCC E;  1YHQ P;  1LTJ B;  5E79 H;  3AEC D;  4QMA A;  1USE A;  3D6Y A;  5BVZ A;  2WSE J;  3H1I G;  3BAS A;  1NEK D;  5AVT B;  3PJS K;  3TGU E;  2H88 D;  2W8Z A;  1CSB A;  2R44 A;  3L70 D;  2XV5 A;  2KIK A;  5KLV K;  2KNC B;  2C0W A;  5CMZ A;  1AV1 A;  2KZJ A;  1RHZ B;  4OGQ D;  1A02 J;  3HUS A;  2WQY C;  1NU1 K;  1M90 Q;  3KZI H;  1L4A A;  3AE5 C;  1JMM A;  3T97 A;  1NHL A;  3CIR C;  2PGD A;  1FZF A;  4RES B;  1RF1 A;  2FYZ A;  1PL5 A;  3PH0 A;  3M0D A;  4YTN C;  3AE1 D;  1GK4 A;  2Q6Q A;  1D7M A;  1VQL P;  5AW3 B;  3G71 P;  3AE6 D;  1EDK A;  1SQX E;  4YSY C;  2M3B A;  3AE7 C;  1RF0 C;  2E5Y A;  2Q1K A;  1LWU A;  3OAK A;  5C39 A;  1YIT P;  5H2F H;  1KFN A;  2G3A A;  4LGD E;  1QVF O;  1RQU A;  1SFC B;  2W90 A;  1OWA A;  5C3J C;  1NTM G;  1KFM A;  5AVX B;  2XZR A;  2BS3 C;  3L73 G;  3TK1 A;  2KSE A;  1IZN B;  2YMY A;  4KX6 C;  3CX5 D;  4YTP C;  2AEF A;  1AJY A;  2ZT9 C;  1PGP A;  4NPD A;  3AEA D;  1S5L X;  3RK3 E;  1JEK A;  2YKP A;  5TJH A;  3O6Q B;  2WSS H;  2OYI C;  1BCC G;  2D2C D;  2CK3 H;  4DT0 A;  2E74 B;  3L73 J;  3OJA B;  1KYO D;  2IBZ I;  4BXL A;  2QEX P;  3MZW B;  3EQ2 A;  4GOE A;  1SQP E;  3VMA A;  4YT0 C;  3O8Z A;  2BCC J;  3M91 A;  3PHL A;  3IR9 A;  3CCE P;  3HD7 D;  1YQ3 C;  1RE3 A;  1NU1 D;  2BAS A;  1NH4 A;  1GW4 A;  1KIL C;  2J5U A;  1GDT A;  3BCC G;  4DHI B;  3P4Q C;  2OYO A;  3CXH H;  3G4S P;  2O01 N;  3TGU J;  1ZP0 C;  4PD4 I;  2VRS A;  1GL2 A;  4U3F G;  5APW A;  2IDB A;  1E5W A;  1CI6 A;  1M1J C;  3S4R A;  1RE4 A;  3HE4 B;  4WY4 C;  1NVO A;  3V4W A;  4EYY Q;  3A2A A;  4YXD D;  2P2U A;  3CI9 A;  1GK6 A;  1VQM P;  2WPQ A;  3AED D;  1FZC C;  3SSU A;  2KB7 P;  1QX8 A;  3CWB D;  2IBZ G;  3L70 G;  1DH3 A;  1VF5 C;  3P32 A;  2ZFY A;  2QRX A;  2MKV A;  1OMI A;  2DW3 A;  2WDR D;  2WU2 D;  1TFF A;  3GMA A;  3CD6 P;  2PP6 A;  1BGY D;  2KSJ A;  1LTG C;  1EDL A;  1JCC A;  2FYU E;  3GHG C;  1BE3 D;  3KDP B;  3QH9 A;  1VQN P;  2KNC A;  3GG2 A;  5CHX A;  5APX A;  1NAY A;  3G9R A;  2WSE H;  4KT0 J;  1S5L H;  1VQ6 P;  2ZT9 B;  3B71 A;  5CCH A;  1HH0 A;  1QLE D;  1L0L K;  2OYH C;  3WUU A;  3V2R A;  2OYI B;  1VQ8 P;  5CBN A;  1Q86 Q;  2B89 A;  4JBZ A;  3I55 P;  3ITK A;  3EFG A;  3JCU H;  1N8R Q;  3MGN A;  2WDQ D;  4D6T G;  1BGY E;  5AW1 B;  4GOF A;  1YIJ P;  1RF1 C;  5C2T C;  1J1E C;  2FFD C;  3M0D C;  3SFE D;  2Q3E A;  1KIL B;  1WMK A;  1SFC A;  3AEG D;  3IF4 A;  4IFD K;  4BRY B;  5KLV G;  3E1I A;  1XTC C;  2P58 A;  1M1J B;  1LTB C;  1ZRT D;  4PV1 D;  1KC8 Q;  1ZOY C;  3O6Q A;  5AVV B;  4WY4 B;  1NU1 G;  4KHX A;  2E76 D;  2C9N Y;  2Q3I A;  2YMK A;  1TU3 F;  1YTZ T;  1LTT C;  1L0V C;  3VRB D;  1KZU B;  3H32 A;  3HD7 A;  3BRT B;  3AEF D;  4IFM A;  4RJT A;  1FZC B;  4IL6 X;  4W80 A;  2RKL A;  3H25 A;  3AE8 C;  1NU1 J;  2LXB A;  1VF5 B;  5CJ4 A;  2QVA A;  4R4M A;  1HVV A;  2KK7 A;  1L0L D;  4ASV A;  2P7J A;  4DCK A;  3CPW O;  3TDK A;  1IFM A;  3L71 G;  3Q3D A;  1KN7 A;  3AE4 C;  3L74 G;  2W27 A;  1RE3 C;  2HLO A;  1JY2 P;  1U7M A;  1R5L A;  1OVR A;  3GHG B;  3U59 A;  2NPS C;  4IFF A;  1SS1 A;  3CWB G;  5KAF H;  3HE4 A;  4TT3 H;  3P8C D;  2YXQ B;  2FBW C;  1EXI A;  4H44 D;  1JY3 O;  3CXH I;  1H88 A;  1L0N D;  4DHJ A;  1FAV A;  1PP9 E;  1N86 A;  2Z5H A;  2R5B A;  3CWB J;  2OYH B;  1NEN C;  1RE4 C;  4RO0 A;  1L0L E;  5GTI E;  5KJ7 D;  1BE3 G;  3AEC C;  3GF7 A;  2KLU A;  1OW6 A;  3T97 B;  4OVN F;  1JO5 A;  1RF1 B;  1J1E B;  3L35 A;  2FFD B;  5AVY B;  1BGY J;  4LC1 A;  1P84 E;  3MD0 A;  2H88 C;  3C9I A;  1NTZ E;  1BE3 J;  3L75 E;  3CCV P;  5AW9 B;  1L0N E;  5KAI H;  2IX7 C;  2B9B A;  3I56 P;  2JDI H;  2HYN A;  1NO4 A;  4JYB A;  2KYV A;  2OTJ P;  1KB9 E;  1GD2 E;  4OGQ C;  1K9M Q;  3SWF A;  2YNY A;  1LNQ A;  4BWN A;  1SQV E;  1EZV I;  3WU2 E;  1VQ4 P;  2ZFC A;  3P8M C;  3M9Q A;  3AE1 C;  4XA4 A;  5K5G B;  4N3Y B;  5AVQ B;  4N78 D;  2IYO A;  2WPR A;  3LW5 J;  1SQX K;  2E43 A;  2R5D A;  3AE2 D;  2QE7 H;  1ZV8 A;  3B5N D;  3MHV A;  3R4Y A;  4BRY A;  3WUT A;  1AQ5 A;  3RGU A;  1YI2 P;  2MJZ A;  2NPS B;  3W68 A;  2G8Y A;  2K9Y A;  4GT1 A;  1IO4 A;  4WY4 A;  1OVU A;  3A0B E;  3GF3 A;  3M9B A;  3AEA C;  2OAR A;  3V4Q A;  5GTH H;  4N78 E;  1PIX A;  1CI6 B;  2D2C C;  1ZLL A;  4XE5 B;  1JCD A;  1FZC A;  3L72 D;  3CCM P;  2N1T D;  1G1J A;  1IFN A;  1QVG O;  1S9K D;  1SQP K;  1X0T A;  3CX5 H;  4UB6 E;  3W67 A;  3HD7 C;  3JSV C;  1L0L J;  5AVW B;  1FZE A;  1LJ2 A;  2WIT A;  2OTK E;  1OIP A;  1K73 Q;  1LGH B;  1Q7Y Q;  2B87 B;  1URQ A;  1IFD A;  1KYO H;  1EDI A;  5CCG D;  3GHG A;  2E5T A;  3HE5 A;  1HJB A;  1EDJ A;  1FZB A;  2HPC B;  2QM8 A;  1KTM A;  1BSH A;  1OW7 A;  1SQX D;  3TSI A;  2WDV D;  1L0N J;  4YSX D;  3L72 E;  4OGQ B;  3VR8 D;  3C8V A;  1S9K E;  1T2K D;  2OYH A;  2B76 D;  1RQV A;  1HBW A;  2J58 A;  5B66 E;  3KYQ A;  3AED C;  1Y9B A;  1FE6 A;  3IFM A;  4YPC A;  2QSI A;  1YQ4 D;  2P10 A;  3KHU A;  1KQF B;  3SFD D;  1ZR2 A;  3H1J E;  2AXT E;  1FDO A;  2FFD A;  1NTK K;  2O3J A;  3RK3 D;  2KUB A;  2WDR C;  2WU2 C;  1FU1 A;  2BS2 C;  2R32 A;  4L73 A;  3VMX A;  2R3S A;  1SQB E;  4ASW A;  3H1K D;  1NJI Q;  2FXO A;  2FYU K;  1T8Z A;  2Y9Z A;  1HWT C;  1SQP D;  2WMM A;  3L4F A;  1KFY D;  3AEB C;  2FKW B;  1KQL A;  4ZKU A;  1GMJ A;  3WUV A;  2WSF J;  2L5G B;  1XTG B;  1M56 D;  3VP8 A;  4DJG A;  2D2C B;  2NRG A;  2BCC G;  3AE9 D;  4DZO A;  1X79 B;  2WDQ C;  3CC2 P;  2KS1 A;  3H1K E;  3H32 B;  2WSC H;  3H6P A;  3HD7 B;  2JP3 A;  1PGJ A;  5TIS H;  1MUU A;  3TGU G;  1G1I A;  4B86 A;  4WBA A;  4FJV A;  3FXD A;  5APT A;  5L8R J;  3AEG C;  2NPS A;  1SQQ E;  4MN4 C;  5B5E E;  1NTK D;  2WPS A;  4KJM A;  4I7Z C;  3P4S D;  1KMI Z;  4RKU J;  2B88 A;  2N1T A;  3BRV B;  1NKN A;  3L72 J;  1NOH A;  2FYU D;  4ZKP A;  3VRB C;  5KLI C;  2Y0C A;  3AEF C;  4GDO A;  2K37 A;  1VQP P;  3D6Z A;  5AW7 B;  2YKO A;  5E79 E;  1L2P A;  4H13 C;  1SQX G;  1W2E A;  1IK7 A;  1FOS F;  3H1L D;  1N7S D;  2B87 A;  2WT7 B;  3CCJ P;  2Y0D A;  3WMM 0;  3VTP C;  1NTK E;  2V7Q J;  3CX5 I;  2HPC A;  3Q1M A;  1GZL A;  1SP4 A;  1BDC A;  4I1L A;  1LT9 A;  3RL0 D;  2GUS A;  1SQX J;  4EDF A;  3UIA A;  2H7H A;  1PGO A;  3KQG A;  1DEB A;  3CIR D;  1JY3 N;  1URQ C;  2Z5I A;  1S2E A;  1KYO I;  3A3Y B;  4YTN D;  3KXD A;  3A0H E;  2E75 C;  3VRA D;  3B8E B;  3P7K A;  1MKM A;  3KZI E;  5AW4 B;  1G2C B;  2A06 E;  1T3J A;  1IFI A;  2PAJ A;  4EI2 A;  3MUD A;  1K04 A;  2IPP A;  4AUW A;  4JYC A;  1QLB C;  3H1L E;  1SQP G;  4H0L D;  2POH A;  1VQ9 P;  4U7J A;  3IN6 A;  1YJ9 P;  3PP5 A;  2GM4 A;  3H1K J;  2QM7 A;  2NZ2 A;  5M1B A;  1NTZ K;  1KV4 A;  4PJ0 H;  1SQP J;  4YTP D;  5H2F E;  1BSN A;  2XU6 A;  3F89 A;  4WB4 A;  1L0N K;  1FJK A;  2YIU C;  4I7Z B;  1H0T B;  4O9B A;  1NAF A;  4L74 A;  1SQV K;  1AA0 A;  1SLQ A;  2GA1 A;  4ZNC A;  2HG5 D;  5KLI B;  1UII A;  1PPJ D;  1R8E A;  3VR9 D;  1KIL D;  3AEE C;  4GIF A;  4YSZ D;  4UB8 H;  2Q7C A;  3P4Q D;  1NTK G;  4H13 B;  1ZP0 D;  3AE2 C;  1PP9 D;  4K35 A;  2PRR A;  1KQG B;  3B5N C;  3L36 A;  4ZMD A;  3GLM A;  2L91 A;  2FYU G;  1NTK J;  1LP1 B;  1ZW0 A;  4C7N B;  2ZYG A;  3VMY A;  1URQ B;  3CC7 P;  2KP8 A;  2P1J A;  1FBM A;  1CZQ A;  1P84 D;  3HE5 B;  1GU5 A;  1PPJ E;  2FYU J;  2I1J A;  1KIL E;  1NTZ D;  2E75 B;  1VF5 D;  1PZQ A;  3H1L G;  2C9L Y;  3L75 D;  2K3R A;  3H1H D;  4K3A A;  2HFE D;  2XNX A;  3Q5R A;  2BEQ D;  4CPG A;  2N1T C;  1MV8 A;  5CJ0 A;  1N2D C;  2ITA A;  2JR8 A;  1Y8A A;  1ZR4 A;  1KB9 D;  3M0A A;  1BGY G;  1RH5 B;  2WU5 D;  3H1L J;  2WT7 A;  1QL1 A;  1SQV D;  1Q2N A;  1VQK P;  1NTM K;  2LXC B;  1S72 P;  1EQ7 A;  2IYP A;  3H1I D;  2W6A A;  1JY2 O;  4WVZ A;  3CL3 D;  1NEK C;  1NKZ B;  5B66 H;  2WDV C;  2YIU B;  2QJP C;  3H1H E;  1QEX A;  1EZV E;  3MIW A;  1LT9 C;  1YJW P;  3D70 A;  2AXT H;  1G2C A;  1L4A D;  1U7J A;  1S5L E;  1T2K C;  2B76 C;  2V7Q H;  1YTZ I;  3E1R A;  3LID A;  2I1K A;  1VQO P;  3CCU P;  1YQ4 C;  3SFD C;  1Y47 A;  3H1I E;  2KZI A;  3QWO C;  4JQ0 D;  1IFJ A;  4N6J A;  3JCU E;  2Q9I A;  2QG4 A;  1OVV A;  1Z56 A;  3MUD C;  4I2L C;  3RK3 C;  2OTL P;  1M57 D;  3V5B A;  3KPE A;  3FWN A;  1PV3 A;  1AFO A;  2E42 A;  2N9B A;  3AE6 C;  3B5N B;  1Q90 D;  5DJT B;  1X8Y A;  1SQB K;  1IFP A;  4HH2 A;  3RBZ A;  4YTM D;  5CBO A;  2KS1 B;  1LTS C;  3G6E P;  1N73 A;  1KFY C;  2C0X A;  1L0V D;  3RK2 D;  2IFN A;  1IJD B;  1H0T A;  4R4L A;  2YO2 A;  1NTM D;  3PRJ A;  4NPF X;  3SWY A;  1PP9 G;  3CCR P;  3RL0 g;  3AE3 D;  2H43 A;  4I6L A;  1OZH A;  2WWW A;  2A45 H;  4HKZ H;  2GUV A;  2N1T B;  1DEE G;  1BCC D;  1L0L G;  3AE9 C;  2V4H A;  4I6M C;  1S1C X;  3AE4 D;  1PP9 J;  1Q82 Q;  2H89 D;  1FC2 C;  3FGA D;  4OH8 B;  4DDG A;  3G3Z A;  1NTZ G;  2Y9Y A;  2ZYA A;  2AEJ A;  3L75 G;  1DX7 A;  1LP1 A;  2WTY A;  1NTM E;  4W7Y A;  1W5C E;  4C7N A;  1GL2 D;  1OXZ A;  1RY3 A;  1DIP A;  1L0N G;  3BCC D;  3L73 E;  3P4R D;  1SQQ K;  3H1J D;  3VOP A;  1NEN D;  3P4S C;  5KAF E;  3CLQ A;  2QJP B;  4U3F D;  1IC2 A;  1NTZ J;  4NPE A;  1JB0 J;  1LTI C;  1LT9 B;  3L75 J;  3S1K A;  3FXE A;  1A02 F;  1BCC E;  3H1H J;  1SQB D;  1SQV G;  3VYI A;  1GTW A;  4OWF A;  2QJY C;  3ABV D;  4YXD C;  5KJ7 A;  1E79 H;  1SQV J;  2FXM A;  1VQ7 P;  2IBZ D;  1JM0 A;  1HF9 A;  3S9O A;  3RK3 B;  3H1I J;  3BCC E;  1N7S C;  1Q81 Q;  4EOT A;  1M1K Q;  3A0H H;  1H8A A;  4IOI H;  3GW6 A;  1W2B O;  4U3F E;  2FYN C;  3RL0 C;  5DJU B;  3N7N A;  3VON A;  1MFT A;  5KAI E;  3V2P A;  2WP9 D;  2ZXE B;  2WS3 D;  1AVY A;  3HTK A;  1HGV A;  4PD4 D;  3U1C A;  2Z4E A;  5CCH D;  3VRA C;  1KF6 D;  5APY A;  3B4S A;  2J59 M;  1FOS E;  3P4P D;  1SQQ D;  2IBZ E;  3L70 E;  2QJK C;  2ZYD A;  2ZXX A;  1JMB A;  4H0L C;  2HR3 A;  5EFW B;  4IL6 E;  3K5B A;  1FZA A;  2XND H;  3NMD A;  2ACZ D;  3E7K A;  3B5N A;  1ZXG A;  4D6T D;  1JNM A;  1HJ0 A;  2K9J B;  2JWA A;  1SFC D;  4GOD A;  2YKQ A;  4PD4 E;  1NWQ A;  1J1D C;  1USD A;  4AQR D;  3SFE C;  2RMZ A;  1T3U A;  4L76 A;  5APS A;  4LDT A;  2IZ1 A;  1NTM J;  1JTH B;  3V2Q A;  3L72 G;  5KLV D;  1N73 C;  4M3L A;  1AQT A;  2E74 D;  5KKZ C;  3LW5 H;  5GTH E;  4PV1 C;  3A5T A;  1BCC J;  2M5A A;  4AYC A;  1FDI A;  2QJY B;  2W83 C;  1EXJ A;  2E76 C;  4D6T E;  5APQ A;  3VR9 C;  2QIW A;  4YSZ C;  4Y99 C;  3H1J G;  5APV A;  3TYY A;  3CX5 E;  3CMA P;  2A45 I;  2A06 D;  1N7L A;  3V2N A;  1N7S B;  2O01 J;  5AW5 B;  5CCG A;  1SQB G;  2LKM A;  3BCC J;  1KYO E;  3H1J J;  1AVO A;  5KLV E;  3L71 D;  1K05 A;  2FYN B;  3RL0 B;  3TNU A;  3L74 D;  1DD3 A;  1X9V A;  4U3F J;  3MP7 B;  1LTJ A;  1SVF A;  2M3E A;  1YJN P;  1T6A A;  1ZME C;  2WQY D;  1NU1 E;  1SQB J;  3AE5 D;  1H89 A;  2K88 A;  3A7O A;  5BU5 A;  5GTI H;  2W6J H;  4H44 C;  3C1L A;  1KQS O;  5AW6 B;  2QJK B;  4YSY D;  2QA4 P;  1HUC A;  1U57 A;  3L70 J;  3AE7 D;  4H0L B;  3BAT A;  2WU5 C;  2RN0 A;  1P84 H;  1R5S A;  3H1K G;  3CME P;  3USS A;  1LTA C;  1FS0 E;  5AVZ B;  5KJ7 C;  3AEB D;  3L71 E;  1WT6 A;  1KD1 Q;  1JY2 N;  2A45 G;  3L74 E;  3M06 A;  2ZVO B;  5AW2 B;  2CPB A;  1HGZ A;  4DDI A;  5C3J D;  1YYC A;  5APU A;  3HRN A;  3CWB E;  4C46 A;  1J1D B;  1SQQ G;  1KB9 H;  4DHZ A;  3Q5P A;  3M9H A;  5KTB A;  4KX6 D;  2JO1 A;  5AVR B;  2BS4 C;  2ZT9 D;  4WWI A;  4JF7 A;  2WVR A;  3CCL P;  3HUS C;  2FY8 A;  1DD4 A;  3NFQ A;  1L4A C;  4C7R A;  3WU2 H;  1N73 B;  1SQQ J;  2HOD B;  5KKZ B;  1PGQ A;  3OA7 A;  1S4X A;  2AEM A;  1GU4 A;  2Y0E A;  3CXH D;  1K8A Q;  2CPS A;  4PV1 B;  2H8P D;  3FWL A;  1BE3 E;  4YT0 D;  4HYT B;  5AVU B;  2XKM A;  2UWJ E;  2E76 B;  1VPC A;  1YQ3 D;  4Y99 B;  1KOR A;  3Q2Y A;  4D6T J;  2I8D A;  2OGU A;  1EC5 A;  1JUN A;  2K9J A;  1LWU C;  3EFF K;  1MZ9 A;  1YBK A;  5TIS E;  2R3C A;  2JKV A;  1MFZ A;  4YTM C;  3V6I A;  2WSF H;  2WZ7 A;  1QGK B;  1JTH A;  3A0B H;  1OFC X;  3CC4 P;  4WY4 D;  3RK2 C;  5KLV J;  2WPV B;  1OX3 A;  1JY3 P;  3IAO A;  3CXH E;  2JJL A;  3VMZ A;  3N4X A;  2M0B A;  2O1K A;  4H13 D;  1M7L A;  3AE3 C;  2A06 G;  1VL2 A;  3VN0 A;  2LR2 A;  4H44 B;  2N9Y B;  4UB6 H;  4EIJ A;  3JC2 2;  2IZ0 A;  3VP9 A;  1VDF A;  4DOJ A;  2OQQ A;  1EZV D;  3NTN A;  1ZRT E;  2H89 C;  2YXR B;  1NGM B;  1N7S A;  4XFJ A;  3CCS P;  3Q5S A;  3F5H A;  3L37 A;  1URQ D;  3EWK A;  3L71 J;  2PFX A;  2E75 D;  3L74 J;  1GL2 C;  2JWD A;  3P4R C;  2KXP B;  5CCG C;  3RBX A;  3FX0 A;  3HUS B;  1GW3 A;  1L4A B;  2O01 H;  1LTJ C;  4YSX C;  1RF0 A;  3PLN A;  3PTZ A;  3MTU E;  1PFI A;  2YO3 A;  3HTK B;  3VR8 C;  3ABV C;  4W7Z A;  1JOC A;  4HB1 A;  2XDJ A;  1FJP A;  2IFM A;  5BU8 B;  5C2T D;  1IK9 A;  4Y28 J;  3LIE A;  3P8C E;  1J2J B;  1ZN5 A;  2AXC A;  3CCQ P;  3I5C A;  4LLH A;  4JPZ B;  2BEZ F;  2KOG A;  2FXP A;  5AW8 B;  2ZJS E;  1LWU B;  1VQ5 P;  4L75 A;  2WSC J;  4TLF A;  1HTL C;  4PJ0 E;  1P84 I;  2K1A A;  2OYI A;  2RH0 A;  2SPZ A;  2ZVN B;  2WP9 C;  3U1A A;  2WS3 C;  4A7P A;  1ZOY D;  3RK2 B;  4YXW H;  1S3J A;  2HOD A;  4IL6 H;  3AEE D;  5CCH C;  1PPJ G;  2P67 A;  1KF6 C;  1KB9 I;  3P4P C;  3L73 D;  2KLV A;  1BDD A;  1KIL A;  3AE8 D;  3SWK A;  3R2P A;  2M8R A;  3II6 A;  4PD4 H;  2BCC D;  4Z1M H; 
#chains in the Genus database with same CATH homology
 2J5U A;  3AE1 C;  1OW7 A;  3P4P D;  4YTN D;  1KQG B;  2E76 B;  1K05 A;  2B76 C;  2WDV D;  1YQ3 D;  3AE5 C;  2ACZ C;  3P4Q C;  2E75 C;  3VRA D;  2JP3 A;  2QJK C;  3CIR C;  4YSX D;  1DD3 A;  3GLM A;  1KOR A;  3Q2Y A;  1ZP0 C;  1NYH A;  1DIP A;  3LW5 J;  3P4R D;  1PL5 A;  4OGQ B;  3VR8 D;  4TT3 H;  1ZME C;  1MKM A;  4H0L C;  3AE2 D;  2WQY D;  2WDQ D;  4YTN C;  3AE1 D;  2FBW C;  1EXI A;  3C8V A;  4H44 D;  2IDB A;  1YQ4 C;  2B76 D;  1NEN D;  3AE5 D;  1K04 A;  3SFD C;  5L8R J;  2ACZ D;  3P4S C;  4YSX C;  3AEG C;  5C2T C;  1RQV A;  1QLB C;  3AE6 D;  3R4Y A;  3VR8 C;  1JB0 J;  3AED C;  4YSY C;  1Y9B A;  3ABV C;  4YTM C;  3SFE D;  1OW8 A;  4H0L D;  4H44 C;  1HJ0 A;  3AE7 C;  4YXD D;  2FBW D;  4U7J A;  2QSI A;  1NEN C;  1YQ4 D;  1E7P C;  1UIX A;  2P10 A;  1PV3 A;  1WMK A;  1KQF B;  5C2T D;  4I7Z C;  3SFD D;  3P4S D;  3AE6 C;  3AEG D;  4Y28 J;  1Q90 D;  3IN6 A;  1KIL E;  1FDO A;  2E75 B;  1VF5 D;  2QJY C;  1KMI Z;  4RKU J;  3SFE C;  3AED D;  4YSY D;  2G8Y A;  3AEC C;  3ABV D;  4YTM D;  2WPV B;  2K9Y A;  1U57 A;  2G3A A;  3GF7 A;  2BEZ F;  4YXD C;  3D71 A;  1RQU A;  3IAO A;  2E74 C;  2WDR C;  3AE7 D;  2FXP A;  4H0L B;  1OW6 A;  3Q5R A;  2NZ2 A;  2WU5 C;  5M1B A;  2WU2 C;  3T97 B;  2BEQ D;  3GF3 A;  2BS2 C;  4YTP D;  3AEA C;  1KFY C;  1VF5 C;  5C3J C;  3VRB C;  1L0V D;  3AEB D;  2BS3 C;  4PV1 D;  2WSC J;  4H13 D;  5KLI C;  2MKV A;  3AEF C;  3AEC D;  3AE3 C;  1ZOY C;  3O6Q A;  1HF9 A;  1PIX A;  1OMI A;  1VL2 A;  4GDO A;  2WDR D;  2E74 D;  4KX6 C;  2H88 C;  4R4L A;  3S9O A;  2D2C C;  5KKZ C;  2YIU C;  2WU5 D;  4H44 B;  2E76 D;  4YTP C;  3D6Z A;  3D6Y A;  1AJY A;  2WU2 D;  2ZT9 C;  2YMK A;  1TU3 F;  3GMA A;  1KFY D;  3AEA D;  1L0V C;  2WSE J;  1S5L X;  3AEB C;  5C3J D;  4PV1 C;  3RK3 E;  3VRB D;  4I7Z B;  4H13 C;  2WP9 C;  1NEK D;  2WS3 C;  3AEF D;  3RL0 g;  2OQQ A;  1FDI A;  1ZOY D;  3Q5P A;  2WDQ C;  3AE3 D;  1IK7 A;  1EXJ A;  2E76 C;  2H88 D;  4KX6 D;  2FYN C;  2D2C D;  2JO1 A;  3VR9 C;  2QIW A;  2E74 B;  1GMJ A;  2H89 C;  1ZRT E;  2WSF J;  2ZT9 D;  4IL6 X;  2BS4 C;  4YSZ C;  3AEE D;  3H25 A;  1NGM B;  1KF6 C;  1NEK C;  3AE8 C;  4XFJ A;  3Q5S A;  2V7Q J;  2WP9 D;  4OGQ C;  1VF5 B;  2WS3 D;  3AE9 C;  3Q1M A;  4YT0 C;  1DD4 A;  4R4M A;  1R8E A;  1S1C X;  3AE4 D;  3G9R A;  3VR9 D;  3EWK A;  3P4P C;  3AEE C;  4KT0 J;  2H89 D;  2D2C B;  2WDV C;  1YQ3 C;  4YSZ D;  2QJP C;  2O01 J;  3VRA C;  1KF6 D;  2ZT9 B;  3AE8 D;  3FGA D;  3P4Q D;  2E75 D;  3B71 A;  4OGQ D;  3CIR D;  4PV1 B;  3AE9 D;  4H13 B;  3P4R C;  3D70 A;  1ZP0 D;  4YT0 D;  1KTM A;  3Q3D A;  3AE2 C;  3AE4 C;  2WQY C;  4Z1M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...