3AE5C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-methyl-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Methyl-N-(3-isopropoxy-phenyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae5C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae5C02
3P4PD 4YT0C 3VR8D 2WQYC 2WP9D 3AE2C 4YTPC 1YQ3D 2WDRD 3AECC 3AEBC 3P4SC 4YSYC 3ABVC 2WDQD 1E7PC 3AEGD 1K05A 3VRAD 2WU5D 1OW8A 2FBWD 2WP9C 1YQ3C 2WDRC 1ZP0C 5C2TC 4YSXD 3AEGC 3AEFD 3VRAC 2BS3C 2H88D 2WU5C 2FBWC 1L0VD 3AE8C 1YQ4D 3AE7D 2BS4C 1KF6D 3AE4D 4YSXC 3VRBD 1ZP0D 5C2TD 3AEFC 2H88C 2B76C 3AEDD 3CIRD 3B71A 1L0VC 1YQ4C 3AE7C 1KF6C 3AE4C 4YTMD 2H89C 3VRBC 3AE8D 3AE6D 2WU2D 3AEDC 3CIRC 2WS3D 3AEEC 2B76D 4YTMC 1PV3A 3AE6C 1QLBC 2BS2C 3P4RD 3AE1C 3SFDC 2WU2C 1KFYD 1NEKD 2H89D 4KX6D 3SFED 2WS3C 1K04A 3AE3D 3AEAD 3AEED 3P4QC 3P4RC 1KFYC 1NEKC 3SFEC 4YXDC 2ACZC 4KX6C 4YTNC 3AE9D 4YSZD 3AE1D 3SFDD 3VR9D 2G3AA 3AEAC 3AE3C 1NEND 3AE5C 5C3JD 1OW7A 3AE9C 1KTMA 4YSZC 3P4QD 3P4PC 3VR9C 4YXDD 3VR8C 2ACZD 4YTND 2WDVD 1NENC 1ZOYD 1OW6A 4YT0D 2WQYD 5C3JC 3AE5D 2WDQC 3AE2D 4YTPD 3S9OA 3AECD 2WDVC 3AEBD 3P4SD 4YSYD 1ZOYC 3ABVD
chains in the Genus database with same CATH superfamily
1PPJG 2BCCG 5E79H 4D6TJ 4H13B 2AEFA 1YQ3D 1S5LX 4WBAA 2A45H 2O01H 3GW6A 1E7PC 5B66H 3BCCG 1S5LE 1H89A 2E43A 1SQVK 3E7KA 2IBZD 3O6QA 3L73E 3RK2B 2WT7A 2MJZA 1FDIA 3H1HJ 1KF6D 3A0HH 3HUSA 5KAIE 1T8ZA 1YQ4C 5BU5A 2E42A 4C7RA 4DDGA 1N8RQ 1LTBC 3CCVP 1K73Q 3L70G 2ZAEB 1JOCA 4Y99C 3HTKB 3FGAD 1JY3P 3B5ND 5AW6B 2XDJA 3H1HE 1AJYA 4YXDC 1KB9E 3AE1D 2A45I 3ZDMA 2FXMA 1FBMA 4JYCA 3NXSA 4MN4C 1Q2NA 1QVFO 1AQ5A 2ZXEB 1N73A 2C9LY 3P4PD 1N7LA 2BASA 5TISH 2WPRA 4HH2A 1YTZI 3SWKA 1MV8A 1HVVA 1BDCA 2Q5UA 4IL6H 4BRYB 3JSVC 1OW8A 2K9YA 1J1EC 1YQ3C 5C2TC 3CD6P 3EQ2A 1P84H 2LXCB 3A5TA 1M8OB 4R4LA 1FS0E 1L0VD 1J1DB 4N3YB 4RESB 2FFDA 1ZP0D 1SQVD 2O1JA 2ZVOB 5AVRB 1M56D 1KF6C 1S9KE 1M90Q 1FU1A 4OVNF 3FWNA 3L36A 1YJ9P 4W7YA 1SQBJ 2H89D 2D2CC 1PP9J 1NWQA 1RE3C 3HUSC 1GK6A 1KYOH 2QJPC 2GM4A 2OARA 4NPFX 2YNYA 3P4QC 1LTJB 4YTNC 3B5NC 2KK7A 3H1LD 1ZXGA 1PIXA 1X79B 2YMKA 3RL0g 1FC2C 1P84I 2IZ1A 1K8AQ 3M9QA 2AEJA 3RL0D 1FE6A 4H44B 2ZFCA 1KMIZ 2K37A 1EDKA 2H8PD 3HE5A 3Q2YA 1S72P 3LW5H 2WVRA 4U3FJ 4GOEA 1NVOA 2Z5HA 3H1JD 3IF4A 4Y99B 3EWKA 1IZNB 2A06D 2E75C 1P84D 3TGUJ 3A0BH 2YKPA 2QG4A 1BE3E 1K9MQ 4Y28J 5APVA 4OWFA 1KYOI 2Q6QA 1L4AD 1URQA 1S3JA 2WTYA 1FDOA 1L0VC 3V2NA 2HPCB 2Y9ZA 4WY4A 1VQOP 1FJKA 1KQGB 4I1LA 1ZRTD 1NTMD 3KDPB 3L75G 1LT9B 3CC7P 1T2KD 5KLVJ 2BEQD 1G1JA 2BCCJ 4JBZA 1FOSF 2R32A 3MGNA 4WY4D 2FFDC 4H13D 3E1IA 3TGUE 1KYOD 1ZW0A 5AVYB 1ZR2A 3L71D 3CCRP 1VQKP 2H7HA 1IFNA 5APXA 1WMKA 4GDOA 2NPSA 3R2PA 1SQVG 1JTHB 1NEND 3V2RA 1NTZJ 1EC5A 2RKLA 1DD4A 3V2QA 3RK2D 1J1EB 3L73G 5C3JD 2KNCB 2NZ2A 1JUNA 2WSCH 1LTGC 3JCUH 2IFNA 4GOFA 5AVQB 5GTIE 2YMYA 1LWUA 2QJYB 3L70J 4WVZA 3H1IE 1SQQJ 3TF5A 1CI6A 5CCHD 3I5CA 3O6QB 1NTKK 1L0NK 1OMIA 4L74A 3BRVB 1HBWA 2WT7B 1NTZE 3PP5A 4IFMA 2V7QJ 1PGOA 3P32A 3FXEA 4YSXD 2D2CB 5EFWB 3HUSB 1GU4A 2RN0A 2B9BA 2BS3C 1DEEG 2C0WA 4O9BA 3TNUB 2HODA 3H1KG 3OA7A 1QL2A 4DJGA 1SQQE 3N4XA 2FYUJ 1U57A 2Y0EA 1LTAC 2WS3D 2B76D 3H1JG 3OW2O 1YTZT 2A06G 3SFED 1URQC 1T2KC 4HKZH 5AVVB 2GA1A 2KS1A 1G2CA 4WY4C 4ZKPA 3KQGA 3H6PA 1SQXK 2HFED 1RE4A 1QGKB 2M8RA 3CXHE 1AFOA 1N73B 3QWOC 1YIJP 2E75B 1OW7A 3CMEP 2FYUE 1GW3A 1JM0A 1PPJD 1NENC 2Q1KA 3G6EP 3GHGA 3RK2C 1IJDB 5C3JC 3GLMA 4GT1A 2E76C 2NPSC 3SWYA 3AECD 5KKZC 3R4YA 3KPEA 2KXPB 1R5SA 1ZN5A 3BCCD 3VOPA 2WP9D 2OTJP 3V4WA 2PAJA 4NPEA 3AEGD 1X8YA 3HRNA 1LWUC 1SQPK 2QE7H 2FFDB 4N78E 2W6JH 5AW1B 3B4SA 2CPSA 1BGYJ 1OVUA 4KJMA 2R5BA 1HWTC 3Q3DA 2Z5IA 4YSXC 3MD0A 3VMXA 3LIDA 4PJ0H 1JY2N 2R3CA 3CWBE 4TLFA 4YTMD 1KZUB 5H2FH 4H44D 1U7JA 3G3ZA 1AA0A 2JO1A 5AVZB 4RO0A 1MZ9A 4WWIA 2IZ0A 1GD2E 4HYTB 2WS3C 1EXIA 3SWFA 2ZYAA 2Z4EA 1LTTC 1NU1K 1BGYE 1L0LE 1YHQP 5APSA 3SFEC 2N9YB 2WPVB 1R8EA 3E1RA 3T97A 5KTBA 1KTMA 2AXTH 4YXDD 5CHXA 3HE5B 1SQXD 1LJ2A 3L4FA 4YT0D 3L74E 2KLVA 1OZHA 1J1DC 2KP8A 3RK3D 2O01J 3VP9A 1USDA 4B86A 2ZT9C 4UB6H 1FZAA 4PD4H 3V4QA 3MUDA 3KXDA 3AECC 3VRAD 3VMZA 4I6MC 3GMAA 2WP9C 1BCCJ 1JMBA 3A2AA 1KFMA 1URQB 3AEGC 1RHZB 3P8CD 1Q90D 3L72D 1N86A 2Y0CA 4WY4B 5E79E 4L76A 3U1AA 1Q82Q 1LTJC 5C2TD 3FX0A 1FZGA 3NMDA 1FOSE 2IPPA 4EI2A 5DJUB 4LDTA 3V5BA 4YTMC 1BCCE 3JC22 2ZFYA 2OYHA 2E76B 2NPSB 3A0HE 4H44C 3H1IG 5KKZB 1JCDA 1JY2O 2KZJA 4C7NA 1M7LA 1NTKG 3H1LJ 1L0NG 1OX3A 5AVXB 3PJSK 3F5HA 4PD4I 1NAFA 3Q5RA 1ZMEC 4D6TE 3TNUA 2ACZC 4YSZD 3CCEP 2LR2A 2D2CD 4XE5B 3CCQP 1LWUB 1DEBA 2JJLA 5AVWB 1NU1D 3P4QD 3MZWB 3H25A 4YTND 1EDIA 4ZMDA 1FJPA 4BWNA 5AW8B 2WQYD 1CI6B 2CK3H 1KFNA 4DT0A 2I8DA 4KT0J 4YSYD 2PP6A 4PD4D 4YT0C 4JPZB 3CX5I 2WSFH 4AQRD 4GIFA 4RKUJ 2K9JA 2G8YA 4NPDA 3RK3C 2YXQB 4JYBA 1LT9C 1IK7A 2XNDH 2WU5D 2HODB 1KB9H 3S4RA 3VRAC 1IFMA 1NO4A 1SQXG 3AE8C 3M0AA 3AE7D 2BS4C 4IL6X 3CC4P 1NTMJ 5AW7B 3L75D 4UB8E 2E75D 1OVRA 3AEDD 4IL6E 1VL2A 3KHUA 1SP4A 1YITP 1PL5A 2KYVA 5C39A 1W5CE 1VQMP 4N6JA 3AEEC 3L71J 2KS1B 2QSIA 1G2CB 1SVFA 2BEZF 1VQ6P 1K04A 2QJYC 2ZT9B 2ZXXA 1NH4A 3L73D 1VPCA 3L72G 1LNQA 1ZRTE 1YBKA 1SQPG 2G3AA 3GHGB 5M1BA 1VQPP 3AE5C 1QX8A 1Q86Q 2OYHC 1HGZA 4YSZC 1JO5A 1KB9I 5AW9B 3PTZA 1RF1A 1FZBA 4I6LA 2OYOA 3ITKA 3EFGA 3L71E 1USEA 3LW5J 2WDQC 1EDJA 3S9OA 2WSEH 5AVUB 1KILE 2WQYC 4ZNCA 2B87A 1GTWA 1JY2P 4DZOA 3GF3A 3G4SP 1H88A 3W68A 4YSYC 2E5YA 2Q9IA 3Q1MA 2OQQA 5TJHA 2UWJE 1KB9D 3H1KD 5APWA 1SQBE 5GTHH 1NU1G 3WU2H 1PP9E 2WU5C 4EDFA 2W6BA 2WSSH 1Z56A 2V4HA 4H0LC 4IOIH 1KN7A 3AE7C 1IFJA 1N73C 1PGQA 4HB1A 3A0BE 3AEDC 1GU5A 1H8AA 2MKVA 3MIWA 1MFTA 2XV5A 2QRXA 3O8ZA 3P4RD 1KFYD 2CPBA 1NHLA 3T97B 3AEAD 1HTLC 2HG5D 1VF5D 3M06A 4KHXA 2PGDA 1Y9BA 2Q3IA 2WSCJ 1KD1Q 3AE9D 3RK3B 2E74C 4U3FE 1URQD 1OVVA 2KSEA 3KZIH 3H32A 3CC2P 2P7JA 1AQTA 2KB7P 1TU3F 2N1TA 5B5EE 5KAFE 5KJ7A 1ZOYD 3BCCJ 3AE2D 2N1TD 3EFFK 2YO3A 3M0DA 1KILA 4I7ZC 1KC8Q 1IFIA 1EDLA 1CSBA 2E76D 2NPSD 3JCUE 1NJIQ 1K05A 1PPJE 2FXOA 2W6AA 5KLVE 1OFCX 2BCCE 1H0TA 2M5AA 3A7OA 1OXZA 2IDBA 2QJKB 3BCCE 1ZV8A 2M3EA 4EYYQ 2JDIH 1EZVE 1XTGB 3CMAP 1BDDA 3B71A 1N7SA 4OGQB 3NFQA 2OYHB 3CCJP 1NTZK 2IFMA 2WU2D 1QLED 3UIAA 4C7NB 1LT1A 1PV3A 3H1HG 2XNXA 3WMM0 4KX6D 1UIIA 3L70E 5KLIC 1PFIA 1U7MA 4CPGA 1BE3D 3V2PA 3P4RC 1SQQK 1KFYC 1IFPA 3LIEA 2O3JA 3K5BA 3AEAC 1VF5C 2W90A 2IYOA 4XFJA 3AE9C 3FWLA 3HD7A 3VR8C 1T3JA 2JEEA 3IN6A 2K9JB 1KV4A 4DHZA 2AEMA 1FZCA 1JMMA 1ZOYC 4H0LB 2JWAA 4IFDK 2R5DA 3AE2C 2N1TC 2R44A 5DJTB 5KJ7C 1KORA 1GL2A 2FYUK 5AW0B 3IAOA 2J58A 3VYIA 2ZT9D 3L72J 3G71P 2P58A 4EIJA 5CJ4A 2QEXP 4HJGH 4DCKA 1S1CX 1FZFA 3CXHH 1RQUA 1AVYA 3M0DC 3RBZA 3C9IA 2HLOA 2E74B 1IC2A 1QVGO 3H1ID 1LGHB 3V6IA 1NTKD 1L0ND 4BXLA 1Y8AA 4DHIB 1NEKD 2WU2C 3P8MC 1N7SC 4Z1MH 1LP1A 2I1JA 4I7ZB 4AUWA 4WB4A 4KX6C 2ZYGA 5AW4B 2JWDA 2IBZE 1RF1B 1VQLP 3VR9D 5CBNA 1PP9G 1HGVA 2ACZD 4DHJA 1M1KQ 2B87B 2K1AA 2R3SA 3L37A 2OTLP 3CXHI 2Y9YA 1L0LK 3ABVD 2KLUA 1DD3A 3VP8A 4YPCA 2KSJA 1BE3G 2N9BA 3HD7C 2FYNB 2AXTE 2W83C 1KQSO 2FBWD 2XZRA 3BRTB 1FZCC 1MKMA 3L75J 1RE4C 3CXHD 5KLIB 1QL1A 2YKQA 3MHVA 4U3FG 2ZYDA 3BVHA 1GL2C 3M91A 3W67A 3GHGC 1VF5B 3A3YB 3AE8D 2WZ7A 2J59M 3TGUG 1VQ8P 4R4MA 1SQVJ 5APUA 1HUCA 2NRGA 3L73J 3TYYA 3M9HA 4L73A 3MTUE 1SQPD 1CW5A 4L75A 2OTKE 2KOGA 4PV1B 1BSHA 3CX5H 3AE3D 5B66E 3H32B 3AEED 1PGPA 3VMAA 1E5WA 1NEKC 1PGJA 2N1TB 1YJWP 1XTCC 5KLVG 1SLQA 3CL3D 2C9NY 2YKOA 3QH9A 1AVOA 3SSUA 3VR9C 4ASWA 1VQ5P 3CWBD 3Q5PA 1SQVE 3VMYA 1S5LH 2GUSA 2WSFJ 1KILB 3KYQA 4OGQD 4ZKUA 3AE5D 3D71A 1SFCA 1EZVG 3PH0A 2KUBA 3P4SD 3WUVA 1NTZG 1H0TB 2M5AB 3H1KJ 1CZQA 3GG2A 2POHA 1RE3A 1SFCD 3ABVC 5KAIH 2WDQD 1BGYD 1L0LD 3CPWO 1GDTA 2KI7B 4M3LA 2Q3EA 1JEKA 3B5NA 1MUUA 4QMAA 1N7SB 1HJ0A 1SQQG 1IK9A 2FBWC 4YXWH 3H1JJ 3H1LE 3VRBD 1TFFA 1D7MA 2QA4P 3L74D 2HYNA 5CMZA 4AYCA 3CCMP 1JNMA 1BSNA 3H1KE 1DIPA 3BASA 3CI9A 2QM8A 2AXCA 4H0LD 3MUDC 1L2PA 1OWAA 1R5LA 5TISE 2Y0DA 3SFDC 2IYPA 5AW3B 3CX5D 2JKVA 1T3UA 3G9RA 3IR9A 2FYZA 3H1JE 3N7NA 2FYUG 2A06E 3HD7B 3HE4A 4U7JA 1P84E 1S4XA 2FXPA 3AE3C 4ASVA 4UB8H 3PHLA 1Q7YQ 1OIPA 1FZCB 2WSEJ 2WDVD 2E74D 2QJKC 2IX7C 3TK1A 4C46A 4YTPD 3F89A 1NOHA 2QM7A 1NTME 3AEBD 1GL2B 1NTMK 1BCCD 2B89A 2P1JA 2RMZA 3TSIA 4OGQC 5AVSB 2WPSA 3U59A 3P4SC 4I2LC 5AW5B 1KYOE 4D6TD 1JB0J 1NGMB 4OH8B 3M9BA 1X0TA 1SFCC 1M1JA 5BU8B 2H88D 2W27A 1EQ7A 2PFXA 3CWBG 1IO4A 2Q7CA 2IBZG 2PRRA 3OJAB 4JQ0D 2WMMA 5CCGA 3H1HD 1M57D 3VRBC 5GTHE 3WU2E 1SQBK 1LP1B 1BGYG 1L0LG 3U1CA 5CCGD 1RF0A 2OGUA 1YYCA 4XA4A 1BE3J 2BS2C 2XU6A 3AE1C 3CLQA 2P10A 2HR3A 2QIWA 4LGDE 1W2EA 1A02J 1FZEA 1ZR4A 1E79H 3PLNA 4K3AA 3L74G 3I56P 3P4PC 1ZLLA 2OYIA 1NYHA 2M0BA 2DW3A 1L4AA 2WDVC 3VR8D 1HH0A 3KZIE 4YTPC 1WT6A 1VQ9P 2WDRD 3AEBC 1S2EA 1T6AA 3C8VA 4PV1D 1S9KD 4JF7A 4EOTA 4LLHA 1RH5B 3OAKA 1ZP0C 1KQFB 3Q5SA 4RJTA 2A45G 1Y47A 1WRGA 5KJ7D 5B5EH 5CBOA 5KAFH 3H1IJ 5APQA 2H88C 2ZJSE 1RF1C 3CIRD 1RY3A 1NTKJ 1L0NJ 1BCCG 2H89C 1KILD 5KLVK 1M1JC 4DDIA 2YIUC 2O01N 1LTIC 4D6TG 3GF7A 2ITAA 5GTIH 5CCGC 5CCHA 1SQBD 2JR8A 1GZLA 1X9VA 5AVTB 2LXBA 3S1KA 3HTKA 1PP9D 1YJNP 3VN0A 1RQVA 4DOJA 2M3BA 2FYNC 1RF0C 3RL0C 1NTKE 1N7SD 1L0NE 5AW2B 3D70A 2WITA 4W80A 3RGUA 1Q81Q 1SFCB 1QEXA 1FAVA 3IFMA 3RBXA 3H1LG 1VQNP 3PRJA 1JY3N 4K35A 2JP3A 2QJPB 3WUUA 1SQXJ 5APTA 2K88A 2L5GB 1W2BO 3B5NB 2OYIC 5BVZA 3FXDA 2WDRC 1L4AC 4U3FD 2FY8A 1IFDA 1GK4A 2WPQA 3AEFD 3HD7D 2XKMA 2P2UA 4PV1C 4BRYA 3USSA 1NKZB 1PZQA 3WUTA 3AE4D 2V7QH 3TGUD 2KIKA 2P67A 2SPZA 1SQXE 4H13C 3AE6D 1SQPJ 1GW4A 3CIRC 3D6YA 2B88A 1EZVI 2LKMA 1GL2D 4LC1A 3RK3E 1LTSC 1KILC 1VDFA 3MP7B 1NTMG 3HE4B 3II6A 4FJVA 5KLVD 2BCCD 3CCUP 4W7ZA 4GODA 2KZIA 2WWWA 1JCCA 1SS1A 1J2JB 3NTNA 1NAYA 1EXJA 3CWBJ 3L71G 2L91A 2VRSA 2E5TA 1N2DC 3P8CE 3L72E 1EZVD 2YO2A 1LTJA 3C1LA 1SQPE 1NKNA 1NTZD 5CCHC 4IFFA 4PJ0E 1NU1J 2QVAA 3P7KA 3I55P 2H43A 5H2FE 1L0LJ 4TT3H 1SQBG 5APYA 1UIXA 2ZVNB 3L70D 1M1JB 1HJBA 1VQ4P 1SQQD 2YIUB 2YXRB 5L8RJ 1FDMA 1JY3O 1MFZA 2C0XA 3BATA 3L35A 3VTPC 3L74J 1DX7A 1YQ4D 3B8EB 5CJ0A 2I1KA 3AEFC 1NU1E 2B76C 1GMJA 1DH3A 3RL0B 3AE4C 1HF9A 2K3RA 1A02F 2O1KA 1G1IA 4GKGA 4UB6E 4PD4E 3D6ZA 2HPCA 2FYUD 3AE6C 1QLBC 3CCLP 1LT9A 2FKWB 1X22A 1AV1A 1VQ7P 3SFDD 2W8ZA 5K5GB 2OYIB 2GUVA 1L4AB 4A7PA 1KQLA 3L75E 2IBZI 3CX5E 1JTHA 1OW6A 2J5UA 3TDKA 2RH0A 4N78D 1YI2P 3VONA 2KNCA 3CCSP
chains in the Genus database with same CATH topology
1DD3A 3P4PD 2ZT9C 4H0LB 4TT3H 4YT0C 3VR8D 2WQYC 3Q2YA 5KKZC 3GF3A 4RKUJ 4H13B 4OGQC 3AE2C 4YTPC 4I7ZC 2G8YA 1YQ3D 2WP9D 2WDRD 1S5LX 1UIXA 3AECC 3AEBC 3P4SC 4YSYC 1OMIA 3ABVC 2WDQD 2E76D 1KORA 1E7PC 1IK7A 3Q1MA 3AEGD 1K05A 3IAOA 5L8RJ 3VRAD 3C8VA 4PV1D 3EWKA 2WU5D 1JB0J 1OW8A 2K9YA 2OQQA 2ZT9D 3GMAA 1NGMB 2FBWD 1YQ3C 2WP9C 2WDRC 1ZP0C 2E75C 2V7QJ 1KQFB 5C2TC 3Q5SA 3O6QA 4YSXD 2D2CB 1MKMA 1ZOYC 3AEGC 2IDBA 1S1CX 4Y28J 3AEFD 4R4LA 4PV1C 2BS3C 2H88D 1HJ0A 1RQUA 2WU5C 2FBWC 1Q90D 1L0VD 3AE8C 1YQ4D 1FDIA 3AE7D 2BS4C 3Q3DA 1KF6D 3AE4D 4YSXC 4IL6X 3VRBD 2E75D 1ZP0D 5C2TD 2E74B 3AEFC 2H88C 2B76C 3AEDD 1FDOA 4H0LC 3B71A 3CIRD 2JP3A 1GMJA 1L0VC 1YQ4C 1VF5B 3AE7C 1VL2A 3VRAC 4OGQB 1KF6C 3AE4C 1KQGB 4H13C 2H89C 4YTMD 3VRBC 1PL5A 3AE8D 1U57A 3AE6D 1HF9A 2WU2D 4H44D 1DIPA 4R4MA 3AEDC 3CIRC 3D6YA 2WS3D 3P4QC 2JO1A 2BEQD 2YIUC 3AEEC 2B76D 3RK3E 2QSIA 2MKVA 4H0LD 4YTMC 1PV3A 3D6ZA 2BEZF 3AE6C 1QLBC 2BS2C 2E76B 3GF7A 3P4RD 4H13D 3AE1C 3SFDC 1KFYD 2D2CC 4H44C 1NEKD 3FGAD 2H89D 2WS3C 2WU2C 4KX6D 3SFED 1K04A 4PV1B 1EXIA 2QJYC 4YSYD 2ZT9B 5KLIC 2QJPC 4Z1MH 3T97B 3AE3D 3G9RA 3AEAD 1VF5D 2P10A 3AEED 4I7ZB 3Q5RA 1ZMEC 1AJYA 2QIWA 1KFYC 1NEKC 3SFEC 4YXDC 3P4RC 2ACZC 1Y9BA 1WMKA 2WSCJ 4GDOA 1ZRTE 3AE9D 4KX6C 4YTNC 4YSZD 1RQVA 2E74C 4U7JA 2WPVB 3AE1D 3SFDD 2FYNC 2D2CD 3VR9D 2FXPA 3P4SD 2G3AA 1EXJA 3AEAC 3AE3C 1R8EA 1NEND 5M1BA 1DD4A 1VF5C 3AE5C 3D70A 2E75B 4XFJA 5C3JD 1OW7A 3AE9C 2NZ2A 1KTMA 1PIXA 1TU3F 4YSZC 2WSEJ 3P4QD 3P4PC 3VR9C 4YXDD 3H25A 3VR8C 2ACZD 2YMKA 4YTND 3RL0g 2WDVD 1NENC 3Q5PA 2E74D 1ZOYD 1OW6A 2J5UA 2QJKC 4YT0D 2WSFJ 2WQYD 3IN6A 1NYHA 5C3JC 3GLMA 3LW5J 4OGQD 3AE5D 2WDQC 3AE2D 2E76C 4H44B 4YTPD 3D71A 3S9OA 3AECD 1KILE 2WDVC 1KMIZ 3R4YA 3AEBD 4KT0J 2O01J 3ABVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4P D;  4YT0 C;  3VR8 D;  2WQY C;  2WP9 D;  3AE2 C;  4YTP C;  1YQ3 D;  2WDR D;  3AEC C;  3AEB C;  3P4S C;  4YSY C;  3ABV C;  2WDQ D;  1E7P C;  3AEG D;  1K05 A;  3VRA D;  2WU5 D;  1OW8 A;  2FBW D;  2WP9 C;  1YQ3 C;  2WDR C;  1ZP0 C;  5C2T C;  4YSX D;  3AEG C;  3AEF D;  3VRA C;  2BS3 C;  2H88 D;  2WU5 C;  2FBW C;  1L0V D;  3AE8 C;  1YQ4 D;  3AE7 D;  2BS4 C;  1KF6 D;  3AE4 D;  4YSX C;  3VRB D;  1ZP0 D;  5C2T D;  3AEF C;  2H88 C;  2B76 C;  3AED D;  3CIR D;  3B71 A;  1L0V C;  1YQ4 C;  3AE7 C;  1KF6 C;  3AE4 C;  4YTM D;  2H89 C;  3VRB C;  3AE8 D;  3AE6 D;  2WU2 D;  3AED C;  3CIR C;  2WS3 D;  3AEE C;  2B76 D;  4YTM C;  1PV3 A;  3AE6 C;  1QLB C;  2BS2 C;  3P4R D;  3AE1 C;  3SFD C;  2WU2 C;  1KFY D;  1NEK D;  2H89 D;  4KX6 D;  3SFE D;  2WS3 C;  1K04 A;  3AE3 D;  3AEA D;  3AEE D;  3P4Q C;  3P4R C;  1KFY C;  1NEK C;  3SFE C;  4YXD C;  2ACZ C;  4KX6 C;  4YTN C;  3AE9 D;  4YSZ D;  3AE1 D;  3SFD D;  3VR9 D;  2G3A A;  3AEA C;  3AE3 C;  1NEN D;  3AE5 C;  5C3J D;  1OW7 A;  3AE9 C;  1KTM A;  4YSZ C;  3P4Q D;  3P4P C;  3VR9 C;  4YXD D;  3VR8 C;  2ACZ D;  4YTN D;  2WDV D;  1NEN C;  1ZOY D;  1OW6 A;  4YT0 D;  2WQY D;  5C3J C;  3AE5 D;  2WDQ C;  3AE2 D;  4YTP D;  3S9O A;  3AEC D;  2WDV C;  3AEB D;  3P4S D;  4YSY D;  1ZOY C;  3ABV D; 
#chains in the Genus database with same CATH topology
 1PPJ G;  2BCC G;  5E79 H;  4D6T J;  4H13 B;  2AEF A;  1YQ3 D;  1S5L X;  4WBA A;  2A45 H;  2O01 H;  3GW6 A;  1E7P C;  5B66 H;  3BCC G;  1S5L E;  1H89 A;  2E43 A;  1SQV K;  3E7K A;  2IBZ D;  3O6Q A;  3L73 E;  3RK2 B;  2WT7 A;  2MJZ A;  1FDI A;  3H1H J;  1KF6 D;  3A0H H;  3HUS A;  5KAI E;  1T8Z A;  1YQ4 C;  5BU5 A;  2E42 A;  4C7R A;  4DDG A;  1N8R Q;  1LTB C;  3CCV P;  1K73 Q;  3L70 G;  2ZAE B;  1JOC A;  4Y99 C;  3HTK B;  3FGA D;  1JY3 P;  3B5N D;  5AW6 B;  2XDJ A;  3H1H E;  1AJY A;  4YXD C;  1KB9 E;  3AE1 D;  2A45 I;  3ZDM A;  2FXM A;  1FBM A;  4JYC A;  3NXS A;  4MN4 C;  1Q2N A;  1QVF O;  1AQ5 A;  2ZXE B;  1N73 A;  2C9L Y;  3P4P D;  1N7L A;  2BAS A;  5TIS H;  2WPR A;  4HH2 A;  1YTZ I;  3SWK A;  1MV8 A;  1HVV A;  1BDC A;  2Q5U A;  4IL6 H;  4BRY B;  3JSV C;  1OW8 A;  2K9Y A;  1J1E C;  1YQ3 C;  5C2T C;  3CD6 P;  3EQ2 A;  1P84 H;  2LXC B;  3A5T A;  1M8O B;  4R4L A;  1FS0 E;  1L0V D;  1J1D B;  4N3Y B;  4RES B;  2FFD A;  1ZP0 D;  1SQV D;  2O1J A;  2ZVO B;  5AVR B;  1M56 D;  1KF6 C;  1S9K E;  1M90 Q;  1FU1 A;  4OVN F;  3FWN A;  3L36 A;  1YJ9 P;  4W7Y A;  1SQB J;  2H89 D;  2D2C C;  1PP9 J;  1NWQ A;  1RE3 C;  3HUS C;  1GK6 A;  1KYO H;  2QJP C;  2GM4 A;  2OAR A;  4NPF X;  2YNY A;  3P4Q C;  1LTJ B;  4YTN C;  3B5N C;  2KK7 A;  3H1L D;  1ZXG A;  1PIX A;  1X79 B;  2YMK A;  3RL0 g;  1FC2 C;  1P84 I;  2IZ1 A;  1K8A Q;  3M9Q A;  2AEJ A;  3RL0 D;  1FE6 A;  4H44 B;  2ZFC A;  1KMI Z;  2K37 A;  1EDK A;  2H8P D;  3HE5 A;  3Q2Y A;  1S72 P;  3LW5 H;  2WVR A;  4U3F J;  4GOE A;  1NVO A;  2Z5H A;  3H1J D;  3IF4 A;  4Y99 B;  3EWK A;  1IZN B;  2A06 D;  2E75 C;  1P84 D;  3TGU J;  3A0B H;  2YKP A;  2QG4 A;  1BE3 E;  1K9M Q;  4Y28 J;  5APV A;  4OWF A;  1KYO I;  2Q6Q A;  1L4A D;  1URQ A;  1S3J A;  2WTY A;  1FDO A;  1L0V C;  3V2N A;  2HPC B;  2Y9Z A;  4WY4 A;  1VQO P;  1FJK A;  1KQG B;  4I1L A;  1ZRT D;  1NTM D;  3KDP B;  3L75 G;  1LT9 B;  3CC7 P;  1T2K D;  5KLV J;  2BEQ D;  1G1J A;  2BCC J;  4JBZ A;  1FOS F;  2R32 A;  3MGN A;  4WY4 D;  2FFD C;  4H13 D;  3E1I A;  3TGU E;  1KYO D;  1ZW0 A;  5AVY B;  1ZR2 A;  3L71 D;  3CCR P;  1VQK P;  2H7H A;  1IFN A;  5APX A;  1WMK A;  4GDO A;  2NPS A;  3R2P A;  1SQV G;  1JTH B;  1NEN D;  3V2R A;  1NTZ J;  1EC5 A;  2RKL A;  1DD4 A;  3V2Q A;  3RK2 D;  1J1E B;  3L73 G;  5C3J D;  2KNC B;  2NZ2 A;  1JUN A;  2WSC H;  1LTG C;  3JCU H;  2IFN A;  4GOF A;  5AVQ B;  5GTI E;  2YMY A;  1LWU A;  2QJY B;  3L70 J;  4WVZ A;  3H1I E;  1SQQ J;  3TF5 A;  1CI6 A;  5CCH D;  3I5C A;  3O6Q B;  1NTK K;  1L0N K;  1OMI A;  4L74 A;  3BRV B;  1HBW A;  2WT7 B;  1NTZ E;  3PP5 A;  4IFM A;  2V7Q J;  1PGO A;  3P32 A;  3FXE A;  4YSX D;  2D2C B;  5EFW B;  3HUS B;  1GU4 A;  2RN0 A;  2B9B A;  2BS3 C;  1DEE G;  2C0W A;  4O9B A;  3TNU B;  2HOD A;  3H1K G;  3OA7 A;  1QL2 A;  4DJG A;  1SQQ E;  3N4X A;  2FYU J;  1U57 A;  2Y0E A;  1LTA C;  2WS3 D;  2B76 D;  3H1J G;  3OW2 O;  1YTZ T;  2A06 G;  3SFE D;  1URQ C;  1T2K C;  4HKZ H;  5AVV B;  2GA1 A;  2KS1 A;  1G2C A;  4WY4 C;  4ZKP A;  3KQG A;  3H6P A;  1SQX K;  2HFE D;  1RE4 A;  1QGK B;  2M8R A;  3CXH E;  1AFO A;  1N73 B;  3QWO C;  1YIJ P;  2E75 B;  1OW7 A;  3CME P;  2FYU E;  1GW3 A;  1JM0 A;  1PPJ D;  1NEN C;  2Q1K A;  3G6E P;  3GHG A;  3RK2 C;  1IJD B;  5C3J C;  3GLM A;  4GT1 A;  2E76 C;  2NPS C;  3SWY A;  3AEC D;  5KKZ C;  3R4Y A;  3KPE A;  2KXP B;  1R5S A;  1ZN5 A;  3BCC D;  3VOP A;  2WP9 D;  2OTJ P;  3V4W A;  2PAJ A;  4NPE A;  3AEG D;  1X8Y A;  3HRN A;  1LWU C;  1SQP K;  2QE7 H;  2FFD B;  4N78 E;  2W6J H;  5AW1 B;  3B4S A;  2CPS A;  1BGY J;  1OVU A;  4KJM A;  2R5B A;  1HWT C;  3Q3D A;  2Z5I A;  4YSX C;  3MD0 A;  3VMX A;  3LID A;  4PJ0 H;  1JY2 N;  2R3C A;  3CWB E;  4TLF A;  4YTM D;  1KZU B;  5H2F H;  4H44 D;  1U7J A;  3G3Z A;  1AA0 A;  2JO1 A;  5AVZ B;  4RO0 A;  1MZ9 A;  4WWI A;  2IZ0 A;  1GD2 E;  4HYT B;  2WS3 C;  1EXI A;  3SWF A;  2ZYA A;  2Z4E A;  1LTT C;  1NU1 K;  1BGY E;  1L0L E;  1YHQ P;  5APS A;  3SFE C;  2N9Y B;  2WPV B;  1R8E A;  3E1R A;  3T97 A;  5KTB A;  1KTM A;  2AXT H;  4YXD D;  5CHX A;  3HE5 B;  1SQX D;  1LJ2 A;  3L4F A;  4YT0 D;  3L74 E;  2KLV A;  1OZH A;  1J1D C;  2KP8 A;  3RK3 D;  2O01 J;  3VP9 A;  1USD A;  4B86 A;  2ZT9 C;  4UB6 H;  1FZA A;  4PD4 H;  3V4Q A;  3MUD A;  3KXD A;  3AEC C;  3VRA D;  3VMZ A;  4I6M C;  3GMA A;  2WP9 C;  1BCC J;  1JMB A;  3A2A A;  1KFM A;  1URQ B;  3AEG C;  1RHZ B;  3P8C D;  1Q90 D;  3L72 D;  1N86 A;  2Y0C A;  4WY4 B;  5E79 E;  4L76 A;  3U1A A;  1Q82 Q;  1LTJ C;  5C2T D;  3FX0 A;  1FZG A;  3NMD A;  1FOS E;  2IPP A;  4EI2 A;  5DJU B;  4LDT A;  3V5B A;  4YTM C;  1BCC E;  3JC2 2;  2ZFY A;  2OYH A;  2E76 B;  2NPS B;  3A0H E;  4H44 C;  3H1I G;  5KKZ B;  1JCD A;  1JY2 O;  2KZJ A;  4C7N A;  1M7L A;  1NTK G;  3H1L J;  1L0N G;  1OX3 A;  5AVX B;  3PJS K;  3F5H A;  4PD4 I;  1NAF A;  3Q5R A;  1ZME C;  4D6T E;  3TNU A;  2ACZ C;  4YSZ D;  3CCE P;  2LR2 A;  2D2C D;  4XE5 B;  3CCQ P;  1LWU B;  1DEB A;  2JJL A;  5AVW B;  1NU1 D;  3P4Q D;  3MZW B;  3H25 A;  4YTN D;  1EDI A;  4ZMD A;  1FJP A;  4BWN A;  5AW8 B;  2WQY D;  1CI6 B;  2CK3 H;  1KFN A;  4DT0 A;  2I8D A;  4KT0 J;  4YSY D;  2PP6 A;  4PD4 D;  4YT0 C;  4JPZ B;  3CX5 I;  2WSF H;  4AQR D;  4GIF A;  4RKU J;  2K9J A;  2G8Y A;  4NPD A;  3RK3 C;  2YXQ B;  4JYB A;  1LT9 C;  1IK7 A;  2XND H;  2WU5 D;  2HOD B;  1KB9 H;  3S4R A;  3VRA C;  1IFM A;  1NO4 A;  1SQX G;  3AE8 C;  3M0A A;  3AE7 D;  2BS4 C;  4IL6 X;  3CC4 P;  1NTM J;  5AW7 B;  3L75 D;  4UB8 E;  2E75 D;  1OVR A;  3AED D;  4IL6 E;  1VL2 A;  3KHU A;  1SP4 A;  1YIT P;  1PL5 A;  2KYV A;  5C39 A;  1W5C E;  1VQM P;  4N6J A;  3AEE C;  3L71 J;  2KS1 B;  2QSI A;  1G2C B;  1SVF A;  2BEZ F;  1VQ6 P;  1K04 A;  2QJY C;  2ZT9 B;  2ZXX A;  1NH4 A;  3L73 D;  1VPC A;  3L72 G;  1LNQ A;  1ZRT E;  1YBK A;  1SQP G;  2G3A A;  3GHG B;  5M1B A;  1VQP P;  3AE5 C;  1QX8 A;  1Q86 Q;  2OYH C;  1HGZ A;  4YSZ C;  1JO5 A;  1KB9 I;  5AW9 B;  3PTZ A;  1RF1 A;  1FZB A;  4I6L A;  2OYO A;  3ITK A;  3EFG A;  3L71 E;  1USE A;  3LW5 J;  2WDQ C;  1EDJ A;  3S9O A;  2WSE H;  5AVU B;  1KIL E;  2WQY C;  4ZNC A;  2B87 A;  1GTW A;  1JY2 P;  4DZO A;  3GF3 A;  3G4S P;  1H88 A;  3W68 A;  4YSY C;  2E5Y A;  2Q9I A;  3Q1M A;  2OQQ A;  5TJH A;  2UWJ E;  1KB9 D;  3H1K D;  5APW A;  1SQB E;  5GTH H;  1NU1 G;  3WU2 H;  1PP9 E;  2WU5 C;  4EDF A;  2W6B A;  2WSS H;  1Z56 A;  2V4H A;  4H0L C;  4IOI H;  1KN7 A;  3AE7 C;  1IFJ A;  1N73 C;  1PGQ A;  4HB1 A;  3A0B E;  3AED C;  1GU5 A;  1H8A A;  2MKV A;  3MIW A;  1MFT A;  2XV5 A;  2QRX A;  3O8Z A;  3P4R D;  1KFY D;  2CPB A;  1NHL A;  3T97 B;  3AEA D;  1HTL C;  2HG5 D;  1VF5 D;  3M06 A;  4KHX A;  2PGD A;  1Y9B A;  2Q3I A;  2WSC J;  1KD1 Q;  3AE9 D;  3RK3 B;  2E74 C;  4U3F E;  1URQ D;  1OVV A;  2KSE A;  3KZI H;  3H32 A;  3CC2 P;  2P7J A;  1AQT A;  2KB7 P;  1TU3 F;  2N1T A;  5B5E E;  5KAF E;  5KJ7 A;  1ZOY D;  3BCC J;  3AE2 D;  2N1T D;  3EFF K;  2YO3 A;  3M0D A;  1KIL A;  4I7Z C;  1KC8 Q;  1IFI A;  1EDL A;  1CSB A;  2E76 D;  2NPS D;  3JCU E;  1NJI Q;  1K05 A;  1PPJ E;  2FXO A;  2W6A A;  5KLV E;  1OFC X;  2BCC E;  1H0T A;  2M5A A;  3A7O A;  1OXZ A;  2IDB A;  2QJK B;  3BCC E;  1ZV8 A;  2M3E A;  4EYY Q;  2JDI H;  1EZV E;  1XTG B;  3CMA P;  1BDD A;  3B71 A;  1N7S A;  4OGQ B;  3NFQ A;  2OYH B;  3CCJ P;  1NTZ K;  2IFM A;  2WU2 D;  1QLE D;  3UIA A;  4C7N B;  1LT1 A;  1PV3 A;  3H1H G;  2XNX A;  3WMM 0;  4KX6 D;  1UII A;  3L70 E;  5KLI C;  1PFI A;  1U7M A;  4CPG A;  1BE3 D;  3V2P A;  3P4R C;  1SQQ K;  1KFY C;  1IFP A;  3LIE A;  2O3J A;  3K5B A;  3AEA C;  1VF5 C;  2W90 A;  2IYO A;  4XFJ A;  3AE9 C;  3FWL A;  3HD7 A;  3VR8 C;  1T3J A;  2JEE A;  3IN6 A;  2K9J B;  1KV4 A;  4DHZ A;  2AEM A;  1FZC A;  1JMM A;  1ZOY C;  4H0L B;  2JWA A;  4IFD K;  2R5D A;  3AE2 C;  2N1T C;  2R44 A;  5DJT B;  5KJ7 C;  1KOR A;  1GL2 A;  2FYU K;  5AW0 B;  3IAO A;  2J58 A;  3VYI A;  2ZT9 D;  3L72 J;  3G71 P;  2P58 A;  4EIJ A;  5CJ4 A;  2QEX P;  4HJG H;  4DCK A;  1S1C X;  1FZF A;  3CXH H;  1RQU A;  1AVY A;  3M0D C;  3RBZ A;  3C9I A;  2HLO A;  2E74 B;  1IC2 A;  1QVG O;  3H1I D;  1LGH B;  3V6I A;  1NTK D;  1L0N D;  4BXL A;  1Y8A A;  4DHI B;  1NEK D;  2WU2 C;  3P8M C;  1N7S C;  4Z1M H;  1LP1 A;  2I1J A;  4I7Z B;  4AUW A;  4WB4 A;  4KX6 C;  2ZYG A;  5AW4 B;  2JWD A;  2IBZ E;  1RF1 B;  1VQL P;  3VR9 D;  5CBN A;  1PP9 G;  1HGV A;  2ACZ D;  4DHJ A;  1M1K Q;  2B87 B;  2K1A A;  2R3S A;  3L37 A;  2OTL P;  3CXH I;  2Y9Y A;  1L0L K;  3ABV D;  2KLU A;  1DD3 A;  3VP8 A;  4YPC A;  2KSJ A;  1BE3 G;  2N9B A;  3HD7 C;  2FYN B;  2AXT E;  2W83 C;  1KQS O;  2FBW D;  2XZR A;  3BRT B;  1FZC C;  1MKM A;  3L75 J;  1RE4 C;  3CXH D;  5KLI B;  1QL1 A;  2YKQ A;  3MHV A;  4U3F G;  2ZYD A;  3BVH A;  1GL2 C;  3M91 A;  3W67 A;  3GHG C;  1VF5 B;  3A3Y B;  3AE8 D;  2WZ7 A;  2J59 M;  3TGU G;  1VQ8 P;  4R4M A;  1SQV J;  5APU A;  1HUC A;  2NRG A;  3L73 J;  3TYY A;  3M9H A;  4L73 A;  3MTU E;  1SQP D;  1CW5 A;  4L75 A;  2OTK E;  2KOG A;  4PV1 B;  1BSH A;  3CX5 H;  3AE3 D;  5B66 E;  3H32 B;  3AEE D;  1PGP A;  3VMA A;  1E5W A;  1NEK C;  1PGJ A;  2N1T B;  1YJW P;  1XTC C;  5KLV G;  1SLQ A;  3CL3 D;  2C9N Y;  2YKO A;  3QH9 A;  1AVO A;  3SSU A;  3VR9 C;  4ASW A;  1VQ5 P;  3CWB D;  3Q5P A;  1SQV E;  3VMY A;  1S5L H;  2GUS A;  2WSF J;  1KIL B;  3KYQ A;  4OGQ D;  4ZKU A;  3AE5 D;  3D71 A;  1SFC A;  1EZV G;  3PH0 A;  2KUB A;  3P4S D;  3WUV A;  1NTZ G;  1H0T B;  2M5A B;  3H1K J;  1CZQ A;  3GG2 A;  2POH A;  1RE3 A;  1SFC D;  3ABV C;  5KAI H;  2WDQ D;  1BGY D;  1L0L D;  3CPW O;  1GDT A;  2KI7 B;  4M3L A;  2Q3E A;  1JEK A;  3B5N A;  1MUU A;  4QMA A;  1N7S B;  1HJ0 A;  1SQQ G;  1IK9 A;  2FBW C;  4YXW H;  3H1J J;  3H1L E;  3VRB D;  1TFF A;  1D7M A;  2QA4 P;  3L74 D;  2HYN A;  5CMZ A;  4AYC A;  3CCM P;  1JNM A;  1BSN A;  3H1K E;  1DIP A;  3BAS A;  3CI9 A;  2QM8 A;  2AXC A;  4H0L D;  3MUD C;  1L2P A;  1OWA A;  1R5L A;  5TIS E;  2Y0D A;  3SFD C;  2IYP A;  5AW3 B;  3CX5 D;  2JKV A;  1T3U A;  3G9R A;  3IR9 A;  2FYZ A;  3H1J E;  3N7N A;  2FYU G;  2A06 E;  3HD7 B;  3HE4 A;  4U7J A;  1P84 E;  1S4X A;  2FXP A;  3AE3 C;  4ASV A;  4UB8 H;  3PHL A;  1Q7Y Q;  1OIP A;  1FZC B;  2WSE J;  2WDV D;  2E74 D;  2QJK C;  2IX7 C;  3TK1 A;  4C46 A;  4YTP D;  3F89 A;  1NOH A;  2QM7 A;  1NTM E;  3AEB D;  1GL2 B;  1NTM K;  1BCC D;  2B89 A;  2P1J A;  2RMZ A;  3TSI A;  4OGQ C;  5AVS B;  2WPS A;  3U59 A;  3P4S C;  4I2L C;  5AW5 B;  1KYO E;  4D6T D;  1JB0 J;  1NGM B;  4OH8 B;  3M9B A;  1X0T A;  1SFC C;  1M1J A;  5BU8 B;  2H88 D;  2W27 A;  1EQ7 A;  2PFX A;  3CWB G;  1IO4 A;  2Q7C A;  2IBZ G;  2PRR A;  3OJA B;  4JQ0 D;  2WMM A;  5CCG A;  3H1H D;  1M57 D;  3VRB C;  5GTH E;  3WU2 E;  1SQB K;  1LP1 B;  1BGY G;  1L0L G;  3U1C A;  5CCG D;  1RF0 A;  2OGU A;  1YYC A;  4XA4 A;  1BE3 J;  2BS2 C;  2XU6 A;  3AE1 C;  3CLQ A;  2P10 A;  2HR3 A;  2QIW A;  4LGD E;  1W2E A;  1A02 J;  1FZE A;  1ZR4 A;  1E79 H;  3PLN A;  4K3A A;  3L74 G;  3I56 P;  3P4P C;  1ZLL A;  2OYI A;  1NYH A;  2M0B A;  2DW3 A;  1L4A A;  2WDV C;  3VR8 D;  1HH0 A;  3KZI E;  4YTP C;  1WT6 A;  1VQ9 P;  2WDR D;  3AEB C;  1S2E A;  1T6A A;  3C8V A;  4PV1 D;  1S9K D;  4JF7 A;  4EOT A;  4LLH A;  1RH5 B;  3OAK A;  1ZP0 C;  1KQF B;  3Q5S A;  4RJT A;  2A45 G;  1Y47 A;  1WRG A;  5KJ7 D;  5B5E H;  5CBO A;  5KAF H;  3H1I J;  5APQ A;  2H88 C;  2ZJS E;  1RF1 C;  3CIR D;  1RY3 A;  1NTK J;  1L0N J;  1BCC G;  2H89 C;  1KIL D;  5KLV K;  1M1J C;  4DDI A;  2YIU C;  2O01 N;  1LTI C;  4D6T G;  3GF7 A;  2ITA A;  5GTI H;  5CCG C;  5CCH A;  1SQB D;  2JR8 A;  1GZL A;  1X9V A;  5AVT B;  2LXB A;  3S1K A;  3HTK A;  1PP9 D;  1YJN P;  3VN0 A;  1RQV A;  4DOJ A;  2M3B A;  2FYN C;  1RF0 C;  3RL0 C;  1NTK E;  1N7S D;  1L0N E;  5AW2 B;  3D70 A;  2WIT A;  4W80 A;  3RGU A;  1Q81 Q;  1SFC B;  1QEX A;  1FAV A;  3IFM A;  3RBX A;  3H1L G;  1VQN P;  3PRJ A;  1JY3 N;  4K35 A;  2JP3 A;  2QJP B;  3WUU A;  1SQX J;  5APT A;  2K88 A;  2L5G B;  1W2B O;  3B5N B;  2OYI C;  5BVZ A;  3FXD A;  2WDR C;  1L4A C;  4U3F D;  2FY8 A;  1IFD A;  1GK4 A;  2WPQ A;  3AEF D;  3HD7 D;  2XKM A;  2P2U A;  4PV1 C;  4BRY A;  3USS A;  1NKZ B;  1PZQ A;  3WUT A;  3AE4 D;  2V7Q H;  3TGU D;  2KIK A;  2P67 A;  2SPZ A;  1SQX E;  4H13 C;  3AE6 D;  1SQP J;  1GW4 A;  3CIR C;  3D6Y A;  2B88 A;  1EZV I;  2LKM A;  1GL2 D;  4LC1 A;  3RK3 E;  1LTS C;  1KIL C;  1VDF A;  3MP7 B;  1NTM G;  3HE4 B;  3II6 A;  4FJV A;  5KLV D;  2BCC D;  3CCU P;  4W7Z A;  4GOD A;  2KZI A;  2WWW A;  1JCC A;  1SS1 A;  1J2J B;  3NTN A;  1NAY A;  1EXJ A;  3CWB J;  3L71 G;  2L91 A;  2VRS A;  2E5T A;  1N2D C;  3P8C E;  3L72 E;  1EZV D;  2YO2 A;  1LTJ A;  3C1L A;  1SQP E;  1NKN A;  1NTZ D;  5CCH C;  4IFF A;  4PJ0 E;  1NU1 J;  2QVA A;  3P7K A;  3I55 P;  2H43 A;  5H2F E;  1L0L J;  4TT3 H;  1SQB G;  5APY A;  1UIX A;  2ZVN B;  3L70 D;  1M1J B;  1HJB A;  1VQ4 P;  1SQQ D;  2YIU B;  2YXR B;  5L8R J;  1FDM A;  1JY3 O;  1MFZ A;  2C0X A;  3BAT A;  3L35 A;  3VTP C;  3L74 J;  1DX7 A;  1YQ4 D;  3B8E B;  5CJ0 A;  2I1K A;  3AEF C;  1NU1 E;  2B76 C;  1GMJ A;  1DH3 A;  3RL0 B;  3AE4 C;  1HF9 A;  2K3R A;  1A02 F;  2O1K A;  1G1I A;  4GKG A;  4UB6 E;  4PD4 E;  3D6Z A;  2HPC A;  2FYU D;  3AE6 C;  1QLB C;  3CCL P;  1LT9 A;  2FKW B;  1X22 A;  1AV1 A;  1VQ7 P;  3SFD D;  2W8Z A;  5K5G B;  2OYI B;  2GUV A;  1L4A B;  4A7P A;  1KQL A;  3L75 E;  2IBZ I;  3CX5 E;  1JTH A;  1OW6 A;  2J5U A;  3TDK A;  2RH0 A;  4N78 D;  1YI2 P;  3VON A;  2KNC A;  3CCS P; 
#chains in the Genus database with same CATH homology
 1DD3 A;  3P4P D;  2ZT9 C;  4H0L B;  4TT3 H;  4YT0 C;  3VR8 D;  2WQY C;  3Q2Y A;  5KKZ C;  3GF3 A;  4RKU J;  4H13 B;  4OGQ C;  3AE2 C;  4YTP C;  4I7Z C;  2G8Y A;  1YQ3 D;  2WP9 D;  2WDR D;  1S5L X;  1UIX A;  3AEC C;  3AEB C;  3P4S C;  4YSY C;  1OMI A;  3ABV C;  2WDQ D;  2E76 D;  1KOR A;  1E7P C;  1IK7 A;  3Q1M A;  3AEG D;  1K05 A;  3IAO A;  5L8R J;  3VRA D;  3C8V A;  4PV1 D;  3EWK A;  2WU5 D;  1JB0 J;  1OW8 A;  2K9Y A;  2OQQ A;  2ZT9 D;  3GMA A;  1NGM B;  2FBW D;  1YQ3 C;  2WP9 C;  2WDR C;  1ZP0 C;  2E75 C;  2V7Q J;  1KQF B;  5C2T C;  3Q5S A;  3O6Q A;  4YSX D;  2D2C B;  1MKM A;  1ZOY C;  3AEG C;  2IDB A;  1S1C X;  4Y28 J;  3AEF D;  4R4L A;  4PV1 C;  2BS3 C;  2H88 D;  1HJ0 A;  1RQU A;  2WU5 C;  2FBW C;  1Q90 D;  1L0V D;  3AE8 C;  1YQ4 D;  1FDI A;  3AE7 D;  2BS4 C;  3Q3D A;  1KF6 D;  3AE4 D;  4YSX C;  4IL6 X;  3VRB D;  2E75 D;  1ZP0 D;  5C2T D;  2E74 B;  3AEF C;  2H88 C;  2B76 C;  3AED D;  1FDO A;  4H0L C;  3B71 A;  3CIR D;  2JP3 A;  1GMJ A;  1L0V C;  1YQ4 C;  1VF5 B;  3AE7 C;  1VL2 A;  3VRA C;  4OGQ B;  1KF6 C;  3AE4 C;  1KQG B;  4H13 C;  2H89 C;  4YTM D;  3VRB C;  1PL5 A;  3AE8 D;  1U57 A;  3AE6 D;  1HF9 A;  2WU2 D;  4H44 D;  1DIP A;  4R4M A;  3AED C;  3CIR C;  3D6Y A;  2WS3 D;  3P4Q C;  2JO1 A;  2BEQ D;  2YIU C;  3AEE C;  2B76 D;  3RK3 E;  2QSI A;  2MKV A;  4H0L D;  4YTM C;  1PV3 A;  3D6Z A;  2BEZ F;  3AE6 C;  1QLB C;  2BS2 C;  2E76 B;  3GF7 A;  3P4R D;  4H13 D;  3AE1 C;  3SFD C;  1KFY D;  2D2C C;  4H44 C;  1NEK D;  3FGA D;  2H89 D;  2WS3 C;  2WU2 C;  4KX6 D;  3SFE D;  1K04 A;  4PV1 B;  1EXI A;  2QJY C;  4YSY D;  2ZT9 B;  5KLI C;  2QJP C;  4Z1M H;  3T97 B;  3AE3 D;  3G9R A;  3AEA D;  1VF5 D;  2P10 A;  3AEE D;  4I7Z B;  3Q5R A;  1ZME C;  1AJY A;  2QIW A;  1KFY C;  1NEK C;  3SFE C;  4YXD C;  3P4R C;  2ACZ C;  1Y9B A;  1WMK A;  2WSC J;  4GDO A;  1ZRT E;  3AE9 D;  4KX6 C;  4YTN C;  4YSZ D;  1RQV A;  2E74 C;  4U7J A;  2WPV B;  3AE1 D;  3SFD D;  2FYN C;  2D2C D;  3VR9 D;  2FXP A;  3P4S D;  2G3A A;  1EXJ A;  3AEA C;  3AE3 C;  1R8E A;  1NEN D;  5M1B A;  1DD4 A;  1VF5 C;  3AE5 C;  3D70 A;  2E75 B;  4XFJ A;  5C3J D;  1OW7 A;  3AE9 C;  2NZ2 A;  1KTM A;  1PIX A;  1TU3 F;  4YSZ C;  2WSE J;  3P4Q D;  3P4P C;  3VR9 C;  4YXD D;  3H25 A;  3VR8 C;  2ACZ D;  2YMK A;  4YTN D;  3RL0 g;  2WDV D;  1NEN C;  3Q5P A;  2E74 D;  1ZOY D;  1OW6 A;  2J5U A;  2QJK C;  4YT0 D;  2WSF J;  2WQY D;  3IN6 A;  1NYH A;  5C3J C;  3GLM A;  3LW5 J;  4OGQ D;  3AE5 D;  2WDQ C;  3AE2 D;  2E76 C;  4H44 B;  4YTP D;  3D71 A;  3S9O A;  3AEC D;  1KIL E;  2WDV C;  1KMI Z;  3R4Y A;  3AEB D;  4KT0 J;  2O01 J;  3ABV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...