3AE6B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-phthalamicacid
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-phthalamicacid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 56
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae6B01
3P4QB 3AE6B 2BS4B 4ITKA 3AE5B 2WS3B 1N5XA 5EE0A 3LB8C 5C2TB 1QOBA 3VR9B 2E3TA 4C80A 1YJIA 3EUB2 2HTME 1JALA 1DGJA 3PO0A 1DOYA 1N63A 3ABVB 3AEEB 1E6EB 1NVID 1TYGB 3AH7A 5MPOA 3AN1A 5GXGB 1FRDA 3AB5A 3NVZA 2QIEB 1JWBD 1RYJA 3NVYA 3FC4A 2CU3A 1GTEA 1GT8A 5EE1A 3DWMA 4P6VF 3AE7B 2WDQB 3P4RB 1OQQA 2W55A 1QOAA 4FXCA 4C7ZA 1XLPA 2ACZB 1ROEA 3AE2B 3VR8B 2WU2B 4YSXB 1WYGA 1WRIA 2MJ3A 3SFDB 2PVOD 3NRZA 3AMZA 3NS1A 1E0ZA 3CF4A 3W5UB 4KX6B 1VJKA 2DWQA 4ZHPA 4YSZB 2AX5A 3HRDD 3AEBB 1ZOYB 1V8CA 4YSYB 1N62A 1QOGA 2W3RA 3NVWA 2M19A 1VDVA 1YJJA 3DWGC 2FBWB 4A9AA 1E10A 3FAHA 2WDVB 1KRHA 3AECB 1V97A 2KAJA 2EKIA 1R7SA 1E9MA 3AM9A 1KFYB 3VRAB 4ZHOA 2B76B 1FM0D 1L6UA 2WU5B 1JRPA 1J7CA 3AE3B 1FXIA 3AE4B 1N61A 1OFFA 3AE8B 1AWDA 1WGKA 2OHFA 5G5HA 1JQ4A 1EWYC 1FMAD 1ZP0B 3AEGB 1TKGA 4US9A 1YQ3B 1PUTA 5H92C 2M56B 3AV8A 2K5PA 1ZUD2 1FXAA 3P63A 1QT9A 1L5PA 2WQYB 2WDRB 1NI3A 2BT6A 2Q5WD 1XLOA 3AEDB 1UWMA 4WQMA 1XO3A 1FFVA 5EE9A 3VRBB 1F0ZA 1VLBA 1TKYA 2H88B 3AE9B 4HROA 3LXFA 3L4PA 2WLBA 5AUKA 4N58A 3W5VB 3ETRA 3HUIA 3CWIA 4JWSC 5EE3A 4N6EB 2PKOA 2H89B 3AEAB 4US8A 2W3SA 1PFDA 1J7BA 1NYRA 4LTUA 1FO4A 1JW9D 1DOIA 1RFKA 1RM6C 1JROA 4N59A 2CJNA 1QLBB 3SFEB 2KMMA 1QOFA 2PIAA 1SF0A 4C7YA 3P4PB 1WXQA 1J7AA 4IDIA 3B9JA 4ZOHC 3AEFB 4YTPB 1OQRA 1TKEA 3ZYYX 1GAQB 5AUIA 3P4SB 1I7HA 3B2GA 2L83A 2MJEA 1A70A 4HRSA 4YTNB 1YQ4B 2BS2B 4YTMB 1XLNA 2LEKA 2N0SB 4USAA 1T3QA 2L52A 1CJEA 1AYFA 1NYQA 1E7PB 1SB3C 3KWLA 4JX1C 1XLQA 2CJOA 2K9XA 5H8YE 3B2FA 1NENB 4YT0B 1GPXA 3WCQA 2MH7A 2Y5CA 1FRRA 4JWUC 1DOXA 1RWSA 1KF6B 1ZXIA 3AE1B 1PDXA 3BIID 2PVGC 3CIRB 2K22A 3SR6A 2JQRB 4WWMA 1L6VA 1N60A 2G1EA 1IUEA 2MJDA 2BS3B 3NVVA 1WWTA 1JWAD 5G5GA 1N5WA 3P1MA 1H7WA 5C3JB 1FIQA 1H7XA 3RPFC 1NEKB 3W9CB 1B9RA 1TJEA 1L0VB 1GTHA 1QF6A 2QJLA 3HVZA 2JX5A 1SIJA 2W54A 2DBYA 2WP9B 4YXDB 1FFUA 1CZPA
chains in the Genus database with same CATH superfamily
1VZ7A 5EE0A 4BZAA 1M94A 1DGJA 3Q3NC 1N63A 2KLGA 1WGGA 2KC2A 5BMGA 1T0RC 5G55A 2G9HD 3BINA 3U7DA 1RYJA 1GTEA 3EC8A 1ISNA 3R2TA 3DWMA 4PYZA 1C78A 1XLPA 3QK0A 1KJTA 3TL5A 3L54A 3AI5A 3VTVA 3IXSA 3HRDD 4OZBA 2DX5B 1AW7A 3R2IA 3NJTA 2DYBA 1UF0A 3VRAB 1WGHA 2B76B 3A9KB 3VUYA 1N6ZA 2LMCA 4W9JA 2M56B 3TEWA 1I4XA 3VUXA 1I4GA 3VDZA 1L5PA 3TEXA 1D4BA 1YN5A 3AE9B 3EGRA 4DWFA 3Q8AA 3RYTA 5CHFA 4M0WA 3HUIA 1VZ6A 4N6EB 1F77A 1HXYD 3GE8C 2PKOA 1RAXA 1PFDA 2DZJA 3PRPB 1JW9D 2KKCA 1JROA 3RMKC 1KLVA 3N20C 4EZLA 2ZNVB 1SF0A 2HTHA 4AJWA 2YEPB 5FKAC 1TKEA 3P4SB 1R4NI 2LHDA 3UQAA 3BZDB 3BK1A 1A70A 3I5JC 1QILA 2LEKA 3B1LX 2KMAA 1AYFA 3WAOA 2LVQA 2FCNA 4KIKA 4JQWC 1MI0A 4MSMB 4WWNA 3N30A 3L16A 2WXQA 3ZXRA 4OW0A 2BS3B 4M8MA 2GLSA 1J0GA 1QZEA 4RH6A 2ZVNA 1WFYA 2LRWA 2W54A 3AE6B 3VXWA 3WAPA 4XWWA 1N5XA 2Z0EB 5AEKB 5C2TB 3AU5A 3OG5A 1V5TA 3Q3FA 2OJWA 2N9XA 5HHDG 3A9JA 3IBEA 1A5RA 4K7SA 4OHJA 1WSPA 4FXCA 2J0MA 3MTNB 3ZDMC 2HJ1A 5IN7A 1ZE3D 4GDLA 1T0QC 2NTSA 3CSFA 1VJKA 2WX1A 1CMXB 2ZZPB 4YSZB 3A1QA 5LXIB 1TS4A 4ZHOA 2FE8A 3AE3B 4R3DA 4FADA 3AE8B 1HA5A 5FR6A 2JZZA 4F1SA 3TEYA 2K5PA 3ZRCA 2D11A 2HDEA 2WQYB 2QC8A 3AEDB 5EDSA 1VZ8A 4BKSA 4CO7A 1JMLA 4D2KA 2KNBA 3IFWB 3RT3B 1L2NA 3GB1A 4JWSC 2MCNB 3N1ZC 3N3KB 4RCOA 3AEAB 2BKFA 2W3SA 4GB9A 5CHWA 1FO4A 3SFEB 3EA6A 5FR3A 3A4RA 1I4QA 2AEHA 1HZ6A 3BYYB 3KQ4A 5J18A 3ZUNA 4WH4A 3B2GA 3PZDA 1MPEA 3O13A 1WJ6A 3QA8A 4GN1A 3MP9A 1XLQA 1WGDA 1TBEA 2C7HA 5JHBA 2KDIA 4B95A 3NZUA 4MT5A 1WH3A 4JLCA 1Q0WB 1I42A 5HG2A 4GLSC 4KGTA 4LK0M 2V3PA 3QIJA 3P4QB 3DVGX 1KH0A 4WJNA 2BKRB 2HTME 4LNFA 3PO0A 2J4XA 4PYUA 3EFCA 1L0YB 3V6CB 3EECA 2JSVX 2OOBB 3BVGA 2A4ZA 1TS2A 2IGGA 1H8CA 2C7MB 1OQQA 2KANA 2N9LA 2O6VD 3AE2B 1WYGA 4M02A 2MJ3A 1WJ4A 4NAWB 3MHZA 2YLMA 4RGNA 1SE3A 1N62A 3NVWA 1YJJA 1E10A 1UZXB 1KOTA 4XC2A 3PV1A 4KDIC 1FM0D 3MC9A 1PGXA 1AWDA 2FAZA 3KUDB 2GRIA 5J17A 2WDRB 4P1CC 3P42A 2D10A 3U52E 4EUTA 2AWTA 3SEBA 3A9KA 3M3JA 4KZCA 2KTRB 2GBMA 3PZ8A 3DBHI 3K9PB 5BYSA 2K8BA 4XGAB 3OAWA 2L00B 3APDA 3KVFB 1L4DB 4ZRQA 4RF1A 3MJ5A 4FJZA 5IOIA 1B1ZA 2I1KA 3ZYYX 1GAQB 2V9HA 4RGMA 1JWSD 2BS2B 1XLNA 2KWCA 4I6NB 1XCQL 2N9KA 1M4VA 4HLEA 1PDXA 4URKA 3SR6A 4L2YA 2TSSA 4ZDVA 1JWAD 5C3JB 1B9RA 4HPMB 1SGHA 5E6PA 2I1JA 5DPRA 4NQLB 3ZQ4A 4K81A 4WWOA 1E6EB 1L4ZB 3PREA 3KWVA 2CU1A 3FC4A 3SD5A 5BYRA 2CKHB 3URYA 2FIDA 1YX6B 4GGQA 1I4HA 3AMZA 3N1XC 3NS1A 3Q3MC 3TMPB 2JUOA 3AEBB 2IZVB 2BYVE 2SAKA 4AP4C 2OJRA 4DHJD 3AECB 1E9MA 2J42A 1WGKA 2DLBA 2YVCA 3AV8A 1TZOA 3DVNU 4W9FA 1WJNA 2LVOA 3KH0A 4WQMA 2KOXA 1MG8A 1GJZA 1C4CA 2QDFA 5AUKA 1TTNA 1PQSA 1YNTE 4GDKB 3X0WA 2X8XX 2NPTB 4WQOB 5E6OA 2ZVOA 2NMQA 1UD7A 1R4NB 3EHVA 2PIAA 4ZOHC 4YTPB 2IO0B 4A3OA 2DZKA 1JRUA 2KX0A 4G3XB 4S17A 1E7PB 4G11A 2BBCA 3U4EG 4W9LA 1K8RB 1IPGA 3CIRB 3O65B 2PTLA 3M62B 1AN8A 4EE2A 3GP7A 3MC0B 2WP9B 1EU3A 3R3MA 4ITKA 3PTFC 3LB8C 2BWFA 1JALA 2BPSA 3I63C 3HVDA 2FNJB 2BQQA 3PZ7A 3TSSA 2V3NA 4MM3A 2KFJA 2IDYA 1GNUA 1SE4A 3U2SC 2FUG1 3C19A 3DWGC 3IHPC 2JZPA 1YIWA 1P9DU 1TZ1A 1L6UA 1N61A 1FXIA 4IM3A 1GB4A 4NAWA 1FMAD 1TKGA 2CHXA 3DHIC 2W9NA 4IG7B 2L3ZA 4ZYNA 2WDTB 3RNGC 2BVCA 2KD0A 2R61A 3ETRA 1E8YA 1NDDA 2L76A 3R8BA 2KDBA 4DHZB 1BUIC 4LTUA 4BOSC 4K7UA 1IP9A 1LXDA 2BYFA 2MX2A 3BWUD 1IGCA 2IGHA 2G4DB 2WXFA 2KWDA 4ASWC 1WXQA 4M8NA 1J7AA 2KTRA 4ANWA 3WIMA 3B9JA 2J0KA 1OQRA 4HEA1 1HQRD 1P1AA 2N0SB 3H7PB 3UINB 5KHQA 2D07B 4XDCA 4KSLC 3BIID 1V81A 2MP2B 4WWMA 2LUMA 2KFKA 2BF8B 1NEKB 3PT2B 5IKCM 2ON8A 2IYDB 3KW5B 4MACA 4C80A 2IBIB 2DENB 4EFOA 3E9SA 3ABVB 5MPOA 4GU2A 2KJRA 4BKSD 2BB6A 4GIVA 2VZKD 1Y8RC 3PGEA 3R66C 4DDID 3T3OA 2KX3A 3DBLB 3MJWA 3AE7B 5LNK1 2ACZB 5T8IA 2INDC 3UGBB 1EUVB 2DWQA 4TQ1A 3QWZB 5KHOA 2FBWB 1U4AA 3FAHA 2JXTA 4MSQB 4IOIE 2LASA 2KWUB 1RFAA 3RUIB 2KWVB 1WMHA 3RNCC 2XK5A 1VRAB 1FXAA 1WE6A 3RNEC 5LXHA 2KZRA 3L0WB 2DZIA 3QAQA 5C23A 3IAS1 3ZNGC 1MJDA 3UIPB 1TKYA 2H88B 3DBHB 3H9DA 4BKGA 1H4RA 2I38A 4NJCA 4HDOA 1K53A 1Z2MA 1HTOA 2VRRB 3OLMD 3V62A 1ACCA 2AYOB 2CJNA 4LDTD 2QMTA 3PLUA 3NZ3A 4XWTA 3MC8A 3ONSA 2PW9A 2WXMA 4YTMB 1R4MI 2BYTA 3WCQA 1XEEA 2JQRB 1UELA 2KHWB 1FPYA 1HE8A 2KDMA 1YOVB 2LRUA 1G6JA 2DBYA 2M17A 3NVYA 2KO3A 5BMIA 4G50A 4AQ7A 4DHZE 4CHKA 5JHAA 4S0RA 3CMMB 2M8SA 1P0RA 3AH7A 3AEEB 3QC8B 3TJPA 3Q8FA 1JWBD 3DCGA 1C1YB 3HIZA 4HWIB 1HTQA 1LM8B 3BYTB 2WHIA 2WDQB 1KM7A 2NTTA 1C76A 1Q5WB 4II2B 2K0PA 4KX6B 1GUAB 2MRPA 1OEYJ 1LQBA 3U7ZA 4JGHB 2LHEA 1QQRA 4W9EA 2RDGA 4FULA 1J7CA 4MM3B 3JYUA 4DQOC 3KYDD 2JVCA 3VVWB 1GC6A 2QEJC 4WJPA 5EE9A 5D6JB 4B9KA 4ZRPA 1TS5A 4W9HA 4L1BA 1E5WA 2XN9C 4YWGG 1V49A 4MELA 2E6XA 3VTUA 1SIFA 1UGMA 2IO2B 4AOFA 2NR2A 3B08A 3ZIMA 2AL3A 1T0YA 5TSSA 1FNUA 3KWLA 3HM6X 1GPXA 3PSEB 2Y5CA 3C8YA 2WXKA 2PPHA 3DBLI 3AULA 3TCAA 4A90A 1IYFA 5JZEB 3W2DA 2AL6A 3GE3C 3H7PA 3QHTA 1L0VB 2C60A 1F2RI 4YXDB 2MP2A 1YJIA 3HM3A 4EOYA 2GMIC 1UWXA 2ZW0A 1V2YA 4BBNC 2DAFA 4W9CA 3QQ8B 1IGDA 4ANVA 1WXSA 1ZDXA 1JWUD 1GG3A 2PVOD 2JU6X 2Y5PA 4A55A 2WXIA 2W3RA 5CTRC 3V6EB 1QOGA 1TS3A 1KRHA 4LJOB 4DDGD 1WGYA 2RD0A 2RDHA 3ZKJC 1JRPA 1WRDB 1WXVA 4LDTB 2VH2A 1ZP0B 4C00A 2N1VA 2PMVA 1BT0A 2BT6A 2NS5A 4HJGE 1BMLC 1WX9A 1K52A 2RGFA 2HE7A 1QKZA 1P3QU 1WR1A 2EMTA 3IT4B 3QJZA 1TIFA 1OQYA 2D3GA 3GS2A 2C5LC 4XX5A 1L7YA 2HJ8A 4RGTA 2KMMA 4I6LB 2WXJA 1WYWB 2GBNA 2Y5BB 5D3IB 2KDEB 2LUEA 4GXBA 1SB3C 1P7EA 3HK0A 2JXXA 4LCDE 1LGRA 5DPTA 4K3BA 5L95C 5IP4D 4NPNA 4IC7B 2UWQA 2AQ1B 3IG3A 2G1EA 2KQ4X 1F2RC 3APFA 5E6JA 3IT6B 4PT5A 2K6DB 4JL9A 3W9CB 1FIQA 3ZW3A 1SSNA 5D3DA 5IAAC 3VQIA 4KVGB 3HVZA 1SIJA 2JWZA 1YJ1A 4N9F4 4W9DA 1JCKB 3PRZA 1E8XA 1I4RA 2J7QB 4K1RB 3H1UA 4ICVA 1NVID 4DXGA 3AN1A 3V3XA 3AB5A 2MWSB 1J19A 3H7SA 2B3AA 3I3TB 3PHWB 1CK1A 1E8WA 2ZNVC 2ZPNA 2LI5A 2KC1A 4NNJB 2XBBC 3VR8B 3DHGC 1Q1OA 4YSXB 4HK2A 3RN9C 2Z8LA 2KJ6A 4NZLB 3W5UB 1GB1A 3SU8X 2AX5A 1WXAA 3UQBA 3WAMA 2QCZA 2WDVB 1HEZE 1E7VA 2V0GA 1S1QB 1SE9A 1YN4A 2NCNA 3VFKA 2OHFA 2ZCBA 2MBQA 2L0TA 1XXGA 3PHXB 1EWCA 1XCTL 2A5UA 3KUCB 2K3UA 4HKZE 1F0ZA 1D3ZA 3ENEA 2WWZA 4TV3A 2CHWA 4DK5A 4GOCA 2JWUA 4M00A 2JT4B 2L32A 4RNAA 3ZJVA 1YD8U 2MBOA 4ZYSA 2DNFA 1JWMD 1XF5L 2GBJA 4BFRA 4LLGM 3GZNB 3P4PB 1E90A 3DBRI 3I9V1 1F1HA 4X57B 3T3NA 2KN4A 2PE6B 5JH5C 2INCC 4XZ4A 5J2RA 2L52A 4F7ZA 1KLGD 1NYQA 1D5MC 3QCAA 5H8YE 1SJHD 2C7NB 3RI7C 2FUHB 1ESFA 4F8CB 2LXCA 3HHMA 4HCNB 1N60A 1IUEA 3ML9A 2M4NA 3PLVA 3I57A 2GBRA 4XE0A 4IM0A 5HI1A 2JX5A 1J8CA 1YMHE 3FKYA 1WJUA 2LGSA 3P2BA 4P16A 2KQ7A 2BTEA 1ZW7A 3VR9B 4HVBA 1DOYA 3M63B 5GXGB 3Q6BA 1FRDA 4C4VB 4MGZE 1C3TA 4RF0A 1GT8A 1ET6A 2W55A 1I4PA 4C7ZA 1WIAA 1ROEA 2N9EB 2MHJA 4EKUA 4FBJB 3E56A 2I2YA 2W82A 4E71A 4ZHPA 3J9CA 4RMAA 2JPHA 4P1BC 2DZMA 2L8JA 2EKEC 3VUWA 1PGBA 2KAJA 2JF5A 3BY4B 1VD2A 5G2NA 3AEGB 5DCNA 1MHHE 3DVNV 1UWMA 3OJ3A 3VRBB 3A33B 4KGRA 3ZVVA 3ZJTA 4DHJB 3PVLA 1E8ZA 3CWIA 3Q8EA 2PJHA 2MLBA 1UBQA 2BYEA 3W1SA 4EZJA 1QLBB 1WX8A 4BAXA 4IDIA 5IO9A 1IBXB 4PK1A 4FHKA 4IWQA 4KIKB 4K7WA 4YTNB 4USAA 1WF9A 2K9XA 1NENB 4WWPA 3NZSA 1FRRA 2UYZB 1XQQA 2G45B 3A4SC 1KF6B 1V9JA 1ZXIA 3PS6A 2RR9A 2V4IB 3Q14C 2MJDA 2AQ3B 1T0SC 1N5WA 2JY6A 1QF6A 1C4AA 3PPAA 2REXA 2GBKA 1BXTA 1V1PB 4LNIA 4NAMA 4OZCA 4OVVA 1ZGUB 4LNKA 3EFUA 1WM2A 5EE1A 4Q2JA 4GDLB 4IM2A 4P6VF 4ARCA 3P4RB 4W9IA 4CYEA 3JSVA 2D2QA 3KYCD 2K1FA 2NBUA 2N7DA 5BO4B 2WU2B 3A1QB 1E0ZA 5HFYA 5IA7A 1P7FA 2BWES 1WXMA 4A9AA 2ZCCA 1V97A 2J0JA 3UI3A 1R7SA 2WGSA 4KZ0A 2IY0B 1OFFA 2KQSA 2KVRA 3IVFA 4IKGA 2LJIA 4E74A 2LVPA 3DBRB 2LZ6A 3DVGY 3OWEB 1ZUD2 4WURA 3L13A 4A20A 1FXTB 1Z5SB 4HCPB 2Z0DB 4M01A 1XO3A 2IJ0A 4HROA 3FILB 4NQKE 4REZA 4AJYB 2BGFA 4JE3B 2LD9A 3APCA 1WZ3A 5CX3A 3R7RA 1FEHA 1UBIA 1VR9A 4XYCA 2H89B 1OGWA 3TIXA 4OVUA 4B6WA 1CQVA 5D7GA 1UGJA 4MH8A 5HKHA 2BB5A 1VCBA 4HRSA 2LJ5A 4GSWA 1OEYA 4C56C 2R2OA 1NBFC 4JWUC 4DBGA 1DOXA 1RWSA 3AE1B 2O6VB 2BW2A 3UF8A 2CR5A 2DYMA 2WNMA 5JXVA 4TKNA 1H7XA 4PS3A 1FNWA 1TY2A 2WXRA 1KTKA 3ZGZA 2FCMA 2BS4B 4MJSB 3AE5B 2WS3B 1WX7A 3VH3B 2WXLA 1AARA 1WI0A 2JRIB 2D5GA 4J3OD 3AU4A 4KDLB 3NVZA 2R2QA 2QIEB 2QSDA 3ZO5B 3VHTC 2ICIA 4LNNA 1TT5B 1OTRB 4HDQA 2KVZA 3WALA 4C4VA 4PS7A 2RSUA 3ZDTA 2WXHA 3NOBA 4WAFA 2Z59B 2KLCA 2FCSA 3N1YC 4RGOS 3QX1A 1KFYB 4BBNF 4WAAA 5AZGA 3RZWC 3B0AA 2MBHA 2K6QA 1EF1A 2KDFB 3IAM1 4MGKE 3OJ4B 4W9KA 1QT9A 2RPVA 2Q5WD 3DHHC 2SEBD 1XLOA 4OZAA 5L83A 3NS8A 1VLBA 2XNAC 2WXGA 3BVMA 2KXJA 2WLBA 2KYWA 3N32A 3GZNI 3Q69A 4US8A 1DOIA 1RFKA 3BVZA 2G3QB 1TGZB 5BYQA 1GC7A 1T6BX 4MGYE 2MW5A 2IY1B 5AUIA 1ET9A 5D2MB 4BVUC 1EF5A 4TUUA 3KLSX 4WJQA 4LNOA 4H2AA 2PVGC 1IBXA 2LWPA 2YEPF 3DPDA 4BOZB 3ZNHB 1UH6A 4CQNA 2KFKB 2XEWA 1FFUA 3Q8CA 2ZJDA 3NHEB 4ZRJA 3ALBA 2KK8A 3EUB2 2X38A 1XT9B 3U30A 4ACFA 2MSED 1XD3B 3AXCA 2CU3A 3H8HA 3TBLD 1QOAA 2O2VA 1V1PA 4AWJA 4IWPA 1WRIA 3ECIA 5AZHA 2ASQA 1K51A 1VDVA 4J6IA 2JZ3B 3VAWA 4KV2A 3JSVB 2WYQA 2KMCA 2WU5B 1V8CA 2K8HA 3ZXVA 1MFWA 3WANA 5BMHA 2MBBB 1YQ3B 1V80A 1FNVA 2G4SA 2L05A 3MHSD 3P63A 4II3B 1DYQA 1WMHB 2FIFA 3NG0A 4W9GA 2KACA 4WIPA 2PEAA 4GDKA 2K39A 2NPTA 1TY0A 2IPKD 2V4LA 3VH4B 2FCQA 4FJYA 2MEKA 2PE9A 3LDZE 1Q10A 3T8MA 2M0AA 2MBEA 3FILA 3UIOB 1ZPSA 5E6NA 5FK9C 5C1ZA 3RULA 1YQBA 2L83A 2MJEA 1YQ4B 1WM3A 3SDLC 4FLHA 1T3QA 2LXAA 1CJEA 3LJ3A 4LJPB 4ARIA 4WJOA 2GI9A 2CJOA 2N9PC 2D3BA 2V3SA 1UUPA 2IO3B 4NJ7A 2V1YA 1FD6A 2K22A 3P1MA 2HD5B 1GTHA 4XDDA 3TUOA 4UDUC 4HPPA 1QOBA 2O6VA 2E3TA 2EMSA 4TQ0A 3QARA 3D32A 1RRBA 2NBVB 4HKQA 3PRMB 4TMAB 3ZNZB 1FCCC 5I4DA 3MFGA 2QILA 4MJSA 2INNE 2WX0A 1T5XD 1SEBD 1ZXHA 4P7IA 3RD2A 4ICUA 1C4PA 2RPQA 1LFDA 2J53A 3W1YA 2L7RA 4MDKE 3AM9A 2M19A 2M0XA 1GOZA 5G5HA 3RNAC 2WXPA 5D94A 4EEWA 4FN2A 4K3CA 2N7EA 5LLIA 4G0NB 4MGIE 1P98A 5EE3A 5DPWA 2JYTA 1S3SG 3X23A 1NYRA 4OVZA 3M95A 3Q3JA 4L23A 4DXFA 3ZLZA 3Q2AC 4E3CA 2NVUI 2KT7A 4C7YA 3DBSA 1SE2A 3AEFB 3H6NA 3C0RB 3ZTDA 4RFBA 4PS8A 3BK2A 3U8ZA 3ZJUA 1C79A 2PLPA 3B2FA 1YX5B 2MH7A 1WE7A 1K50A 2AQ2B 4HPLB 1STEA 2DYOA 4IWOA 3NUHB 3L17A 5G5GA 1L0XB 3N9YC 4RM9A 4RM8A 3RNBC 1WGRA 2QJLA 4FHJA 2Y3AA 2C9WB 1CZPA 3ZTCA 2DHZA 2MA9B 4IUMB 2LFIA 3V61A 1WY8A 1V5OA 4QAYA 1TYGB 2N4FA 1KLUD 3R7QA 4FJVB 1X1MA 5CHVC 4YL8A 5DPSA 3S2AA 3DDCB 1MG4A 4HJKA 3KUZA 3SFDB 2GOWA 2LGDA 3NRZA 3CF4A 1PGAA 4ANXA 4MEMA 3RCZA 1D6EC 1ZOYB 4YSYB 2OEDA 1WZ0A 2LGIA 3DQVA 2O2VB 2XK5B 2L0FA 3AE4B 1E7UA 2ZPYA 2D3AA 1WR6E 4M0WB 1PUTA 4A3PA 2D3CA 4JPSA 2L1AA 1FFVA 1SJED 1LO5D 4N58A 3W5VB 1ZKHA 2K8CA 3SHQA 1NI2A 1J7BA 4KKIA 5AZFA 4O1NA 4EZKA 4N59A 4DXAB 5GMVA 2DAJA 2WXOA 1I7HA 3JW0X 3ML8A 4FA6A 3CSTA 2N1WA 4JX1C 3W1SC 4KGSA 2LGYA 4A8XC 4YT0B 4B0EA 4HXDA 1L6VA 3NVVA 2RMMA 2WXNA 3L08A 1H7WA 1F52A 2QHOA 3RPFC 3A9JB 3ZRFA 1V86A 4ZRIA 1EO6A 3T9LA 2M1MA 3RZFA 2JYEA 4KSKC 4A6QA 1C77A 4NJ6A 2KN5A 2CHZA 2VZKB 3ZNID 4ZRKA 4TSSA 4NY0A 4I6PA 1V6EA 1RLFA 1MVKA 4KKJA 2INPE 2RDBC 2KJHB 3LYYA 3Q3OC 2UU7A 2J52A 4JIOU 3GOEA 5TR5A 2EKIA 4IW0A 4MH0E 3TEZA 4AUQC 1JQ4A 1YN3A 1EWYC 3NY5A 4US9A 2EELA 3WA0A 5H92C 2VH1A 1Y56A 1PYWD 1NI3A 1UNSA 3CF6E 3V05A 1R4MB 1D5XC 1ENFA 2LGXA 2ZW1A 2ONQA 1D5ZC 1V1OA 3LXFA 3L4PA 3V60A 4AS1A 1F9JA 3DOWA 3K9OB 1EM7A 2N7JA 4BKTA 1ZDVA 4GMVA 1RM6C 4B0MA 1HZ5A 3L10B 1QOFA 3RNFC 3Q8BA 2IGDA 1SXTA 3JVZX 2GB1A 2MQJA 1MHXA 1SBBB 2IO1B 2ZEQA 1EU4A 3VTWA 3RFZB 1FCLA 2KTFA 2K25A 2JRHA 1WWTA 2NBWB 2CS4A 4ANUA 1TJEA 1C9FA 1I35A
chains in the Genus database with same CATH topology
1JCKB 1VZ7A 3Q8CA 4ITKA 5EE0A 3LB8C 1I4RA 2X38A 3EUB2 1JALA 1DGJA 1N63A 1NVID 4DXGA 3AN1A 3V3XA 3AB5A 5BMGA 2G9HD 1RYJA 2CU3A 3HVDA 1GTEA 3R2TA 3H8HA 3DWMA 1CK1A 1QOAA 3PZ7A 1C78A 1V1PA 1XLPA 3TSSA 2V3NA 3VR8B 4YSXB 1WRIA 2IDYA 2Z8LA 4NZLB 1SE4A 3W5UB 1GB1A 1K51A 3IXSA 2AX5A 3HRDD 4OZBA 2FUG1 3U2SC 1VDVA 1AW7A 3DWGC 3R2IA 2WDVB 2JZPA 1HEZE 3VRAB 2V0GA 2B76B 1L6UA 1YN4A 1V8CA 2WU5B 1N61A 1FXIA 2OHFA 2LMCA 1GB4A 5BMHA 1FMAD 1TKGA 1YQ3B 2M56B 1FNVA 3TEWA 1I4XA 1I4GA 3P63A 1L5PA 1XXGA 1DYQA 3TEXA 1EWCA 1XCTL 1D4BA 2K3UA 4HKZE 2KACA 4WIPA 1YN5A 1F0ZA 3AE9B 3EGRA 3Q8AA 2R61A 1TY0A 2IPKD 3ETRA 4M0WA 2JWUA 3HUIA 1VZ6A 4N6EB 1F77A 1HXYD 2L32A 2PKOA 4RNAA 3R8BA 1PFDA 3ZJVA 2MEKA 4ZYSA 1BUIC 4LTUA 1JW9D 1JROA 1JWMD 1XF5L 4LLGM 3BWUD 1Q10A 1IGCA 1SF0A 2IGHA 2M0AA 2KWDA 3P4PB 1WXQA 2WXFA 1J7AA 3FILA 2YEPB 1ZPSA 5FKAC 3B9JA 1OQRA 1TKEA 3I9V1 4HEA1 3T3NA 3P4SB 2LHDA 2KN4A 5FK9C 3BZDB 3BK1A 2L83A 2MJEA 1A70A 1HQRD 1YQ4B 1QILA 2LEKA 2N0SB 1T3QA 2L52A 1CJEA 1AYFA 1KLGD 1NYQA 4ARIA 1D5MC 2GI9A 2CJOA 5H8YE 1SJHD 1UUPA 4XDCA 1MI0A 3BIID 1ESFA 2WXQA 1FD6A 2K22A 4WWMA 2LUMA 1N60A 1IUEA 4OW0A 2BS3B 3I57A 3P1MA 4XE0A 1NEKB 4RH6A 1GTHA 2ON8A 4XDDA 5HI1A 2JX5A 3TUOA 1YMHE 2W54A 4UDUC 3AE6B 4MACA 4P16A 4XWWA 1N5XA 2BTEA 5C2TB 1QOBA 3VR9B 2E3TA 4C80A 4TQ0A 3E9SA 1DOYA 3ABVB 4HKQA 5MPOA 4TMAB 5GXGB 1FRDA 2BB6A 5HHDG 1FCCC 4RF0A 5I4DA 2VZKD 3MFGA 1GT8A 1ET6A 2QILA 4OHJA 3T3OA 2INNE 3AE7B 1WSPA 2W55A 1I4PA 4FXCA 5LNK1 1T5XD 4C7ZA 2ACZB 1ROEA 5T8IA 1SEBD 1ZE3D 2I2YA 1ZXHA 3E56A 2NTSA 1C4PA 2W82A 1VJKA 2DWQA 4ZHPA 2J53A 3J9CA 4YSZB 4TQ1A 2FBWB 3FAHA 1PGBA 2JXTA 2KAJA 1TS4A 3AM9A 4IOIE 4ZHOA 2FE8A 2M19A 3AE3B 4R3DA 3AE8B 1HA5A 1GOZA 5G5HA 2WXPA 3AEGB 3TEYA 2K5PA 1VRAB 1FXAA 1MHHE 2HDEA 2WQYB 3AEDB 1UWMA 3IAS1 3VRBB 1VZ8A 1JMLA 1TKYA 4D2KA 2H88B 4KGRA 3ZJTA 2I38A 3GB1A 4JWSC 3CWIA 4NJCA 5EE3A 4RCOA 3Q8EA 2JYTA 1K53A 3AEAB 2W3SA 1NYRA 1FO4A 4OVZA 1ACCA 4L23A 3W1SA 4DXFA 2CJNA 1QLBB 3SFEB 3EA6A 2QMTA 5FR3A 4C7YA 1I4QA 1HZ6A 3BYYB 3KQ4A 4IDIA 1SE2A 3NZ3A 1IBXB 3AEFB 4XWTA 4WH4A 3B2GA 4RFBA 2PW9A 2WXMA 3BK2A 4YTNB 4YTMB 1MPEA 3O13A 4USAA 3ZJUA 2BYTA 3MP9A 1C79A 1XLQA 2K9XA 2PLPA 3B2FA 1NENB 3WCQA 2MH7A 1FRRA 1K50A 1XEEA 2AQ2B 1KF6B 1ZXIA 2V4IB 1STEA 2JQRB 2DYOA 2MJDA 2AQ3B 3NUHB 5G5GA 4MT5A 1L0XB 1N5WA 2KDMA 3N9YC 1QF6A 1C4AA 2QJLA 5HG2A 4GLSC 4KGTA 2Y3AA 2DBYA 4LK0M 3NVYA 2V3PA 1CZPA 3P4QB 5BMIA 1KH0A 4AQ7A 1BXTA 2LFIA 1V1PB 2HTME 3PO0A 4NAMA 2J4XA 3AH7A 3AEEB 4OZCA 1TYGB 1L0YB 3Q8FA 1KLUD 1JWBD 2JSVX 3BVGA 5EE1A 3BYTB 2IGGA 1TS2A 4GDLB 4P6VF 4Q2JA 4ARCA 2WDQB 3P4RB 1OQQA 2N9LA 3AE2B 2WU2B 1WYGA 2MJ3A 1C76A 2NTTA 3SFDB 3NRZA 2K0PA 4NAWB 1E0ZA 3CF4A 1PGAA 3MHZA 5HFYA 4KX6B 4RGNA 1SE3A 1D6EC 1P7FA 1ZOYB 3U7ZA 4YSYB 1N62A 2OEDA 2LHEA 3NVWA 1YJJA 1QQRA 2LGIA 4A9AA 1E10A 1V97A 3UI3A 1R7SA 1FM0D 2RDGA 1J7CA 4MM3B 1OFFA 3AE4B 1PGXA 4DQOC 1AWDA 4IKGA 2LJIA 1PUTA 4WURA 3OWEB 1ZUD2 2GRIA 4JPSA 2QEJC 2WDRB 3P42A 2L1AA 1XO3A 1FFVA 5EE9A 1SJED 2IJ0A 3U52E 3SEBA 4HROA 3FILB 4REZA 1LO5D 4JE3B 4N58A 3W5VB 4ZRPA 3PZ8A 1FEHA 1VR9A 1TS5A 2H89B 4L1BA 2XN9C 1J7BA 4KKIA 4YWGG 4O1NA 5BYSA 4N59A 2E6XA 1L4DB 4ZRQA 4RF1A 1CQVA 3MJ5A 5D7GA 1B1ZA 1UGJA 4MH8A 2BB5A 3ZYYX 1GAQB 2WXOA 1I7HA 4RGMA 4HRSA 5TSSA 1FNUA 1JWSD 2BS2B 1XLNA 3KWLA 1XCQL 2N9KA 4A8XC 4JX1C 4KGSA 4YT0B 4C56C 1GPXA 4B0EA 2Y5CA 3C8YA 1M4VA 4JWUC 2WXKA 1DOXA 1RWSA 3AE1B 1PDXA 4A90A 2BW2A 3SR6A 4L2YA 1L6VA 2TSSA 3NVVA 2RMMA 1JWAD 2WXNA 2DYMA 3W2DA 2WNMA 5JXVA 1H7WA 5C3JB 1H7XA 3RPFC 1B9RA 1FNWA 1L0VB 1TY2A 2WXRA 1KTKA 1F2RI 3ZGZA 4YXDB 2BS4B 3AE5B 2WS3B 2JYEA 2WXLA 3ZQ4A 1YJIA 1E6EB 1L4ZB 2D5GA 4J3OD 4A6QA 1C77A 1UWXA 3KWVA 3NVZA 2ZW0A 2QIEB 2QSDA 2VZKB 3FC4A 5BYRA 2ICIA 3URYA 4TSSA 1IGDA 1I4HA 1ZDXA 1JWUD 1MVKA 2PVOD 4KKJA 2JU6X 2Y5PA 3AMZA 2INPE 3NS1A 3LYYA 4A55A 2WXIA 2WXHA 4WAFA 3AEBB 2W3RA 1QOGA 2J52A 1TS3A 2SAKA 4RGOS 1KRHA 3AECB 2EKIA 1E9MA 1KFYB 2J42A 2RDHA 1JRPA 1WGKA 2DLBA 3TEZA 1JQ4A 1YN3A 1EWYC 1ZP0B 4US9A 2EELA 5H92C 3AV8A 1TZOA 3IAM1 2PMVA 1QT9A 1Y56A 2RPVA 1PYWD 1NI3A 1UNSA 2BT6A 2Q5WD 2SEBD 1XLOA 4HJGE 4OZAA 1D5XC 1ENFA 1BMLC 4WQMA 3V05A 1VLBA 2XNAC 1K52A 2WXGA 2ZW1A 2ONQA 1D5ZC 3BVMA 1V1OA 3LXFA 3L4PA 1C4CA 2WLBA 5AUKA 4AS1A 1QKZA 1YNTE 1EM7A 4GDKB 3IT4B 2N7JA 3Q69A 4US8A 1ZDVA 1DOIA 1RFKA 1RM6C 2NMQA 3GS2A 3BVZA 4B0MA 1HZ5A 4RGTA 2KMMA 1QOFA 2PIAA 2WXJA 3Q8BA 5BYQA 2IGDA 1T6BX 4ZOHC 4YTPB 1SXTA 5D3IB 5AUIA 1ET9A 2GB1A 1MHXA 1SBBB 1EU4A 1SB3C 1P7EA 1E7PB 2BBCA 3U4EG 3KLSX 3RFZB 1FCLA 4H2AA 2AQ1B 3CIRB 2PVGC 1IBXA 2G1EA 2KQ4X 1F2RC 1WWTA 2PTLA 2YEPF 3IT6B 5E6JA 4PT5A 3W9CB 1FIQA 1AN8A 1SSNA 1TJEA 5D3DA 3VQIA 4EE2A 3HVZA 4CQNA 1C9FA 3GP7A 1SIJA 3MC0B 2WP9B 1EU3A 1FFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4Q B;  3AE6 B;  2BS4 B;  4ITK A;  3AE5 B;  2WS3 B;  1N5X A;  5EE0 A;  3LB8 C;  5C2T B;  1QOB A;  3VR9 B;  2E3T A;  4C80 A;  1YJI A;  3EUB 2;  2HTM E;  1JAL A;  1DGJ A;  3PO0 A;  1DOY A;  1N63 A;  3ABV B;  3AEE B;  1E6E B;  1NVI D;  1TYG B;  3AH7 A;  5MPO A;  3AN1 A;  5GXG B;  1FRD A;  3AB5 A;  3NVZ A;  2QIE B;  1JWB D;  1RYJ A;  3NVY A;  3FC4 A;  2CU3 A;  1GTE A;  1GT8 A;  5EE1 A;  3DWM A;  4P6V F;  3AE7 B;  2WDQ B;  3P4R B;  1OQQ A;  2W55 A;  1QOA A;  4FXC A;  4C7Z A;  1XLP A;  2ACZ B;  1ROE A;  3AE2 B;  3VR8 B;  2WU2 B;  4YSX B;  1WYG A;  1WRI A;  2MJ3 A;  3SFD B;  2PVO D;  3NRZ A;  3AMZ A;  3NS1 A;  1E0Z A;  3CF4 A;  3W5U B;  4KX6 B;  1VJK A;  2DWQ A;  4ZHP A;  4YSZ B;  2AX5 A;  3HRD D;  3AEB B;  1ZOY B;  1V8C A;  4YSY B;  1N62 A;  1QOG A;  2W3R A;  3NVW A;  2M19 A;  1VDV A;  1YJJ A;  3DWG C;  2FBW B;  4A9A A;  1E10 A;  3FAH A;  2WDV B;  1KRH A;  3AEC B;  1V97 A;  2KAJ A;  2EKI A;  1R7S A;  1E9M A;  3AM9 A;  1KFY B;  3VRA B;  4ZHO A;  2B76 B;  1FM0 D;  1L6U A;  2WU5 B;  1JRP A;  1J7C A;  3AE3 B;  1FXI A;  3AE4 B;  1N61 A;  1OFF A;  3AE8 B;  1AWD A;  1WGK A;  2OHF A;  5G5H A;  1JQ4 A;  1EWY C;  1FMA D;  1ZP0 B;  3AEG B;  1TKG A;  4US9 A;  1YQ3 B;  1PUT A;  5H92 C;  2M56 B;  3AV8 A;  2K5P A;  1ZUD 2;  1FXA A;  3P63 A;  1QT9 A;  1L5P A;  2WQY B;  2WDR B;  1NI3 A;  2BT6 A;  2Q5W D;  1XLO A;  3AED B;  1UWM A;  4WQM A;  1XO3 A;  1FFV A;  5EE9 A;  3VRB B;  1F0Z A;  1VLB A;  1TKY A;  2H88 B;  3AE9 B;  4HRO A;  3LXF A;  3L4P A;  2WLB A;  5AUK A;  4N58 A;  3W5V B;  3ETR A;  3HUI A;  3CWI A;  4JWS C;  5EE3 A;  4N6E B;  2PKO A;  2H89 B;  3AEA B;  4US8 A;  2W3S A;  1PFD A;  1J7B A;  1NYR A;  4LTU A;  1FO4 A;  1JW9 D;  1DOI A;  1RFK A;  1RM6 C;  1JRO A;  4N59 A;  2CJN A;  1QLB B;  3SFE B;  2KMM A;  1QOF A;  2PIA A;  1SF0 A;  4C7Y A;  3P4P B;  1WXQ A;  1J7A A;  4IDI A;  3B9J A;  4ZOH C;  3AEF B;  4YTP B;  1OQR A;  1TKE A;  3ZYY X;  1GAQ B;  5AUI A;  3P4S B;  1I7H A;  3B2G A;  2L83 A;  2MJE A;  1A70 A;  4HRS A;  4YTN B;  1YQ4 B;  2BS2 B;  4YTM B;  1XLN A;  2LEK A;  2N0S B;  4USA A;  1T3Q A;  2L52 A;  1CJE A;  1AYF A;  1NYQ A;  1E7P B;  1SB3 C;  3KWL A;  4JX1 C;  1XLQ A;  2CJO A;  2K9X A;  5H8Y E;  3B2F A;  1NEN B;  4YT0 B;  1GPX A;  3WCQ A;  2MH7 A;  2Y5C A;  1FRR A;  4JWU C;  1DOX A;  1RWS A;  1KF6 B;  1ZXI A;  3AE1 B;  1PDX A;  3BII D;  2PVG C;  3CIR B;  2K22 A;  3SR6 A;  2JQR B;  4WWM A;  1L6V A;  1N60 A;  2G1E A;  1IUE A;  2MJD A;  2BS3 B;  3NVV A;  1WWT A;  1JWA D;  5G5G A;  1N5W A;  3P1M A;  1H7W A;  5C3J B;  1FIQ A;  1H7X A;  3RPF C;  1NEK B;  3W9C B;  1B9R A;  1TJE A;  1L0V B;  1GTH A;  1QF6 A;  2QJL A;  3HVZ A;  2JX5 A;  1SIJ A;  2W54 A;  2DBY A;  2WP9 B;  4YXD B;  1FFU A;  1CZP A; 
#chains in the Genus database with same CATH topology
 1VZ7 A;  5EE0 A;  4BZA A;  1M94 A;  1DGJ A;  3Q3N C;  1N63 A;  2KLG A;  1WGG A;  2KC2 A;  5BMG A;  1T0R C;  5G55 A;  2G9H D;  3BIN A;  3U7D A;  1RYJ A;  1GTE A;  3EC8 A;  1ISN A;  3R2T A;  3DWM A;  4PYZ A;  1C78 A;  1XLP A;  3QK0 A;  1KJT A;  3TL5 A;  3L54 A;  3AI5 A;  3VTV A;  3IXS A;  3HRD D;  4OZB A;  2DX5 B;  1AW7 A;  3R2I A;  3NJT A;  2DYB A;  1UF0 A;  3VRA B;  1WGH A;  2B76 B;  3A9K B;  3VUY A;  1N6Z A;  2LMC A;  4W9J A;  2M56 B;  3TEW A;  1I4X A;  3VUX A;  1I4G A;  3VDZ A;  1L5P A;  3TEX A;  1D4B A;  1YN5 A;  3AE9 B;  3EGR A;  4DWF A;  3Q8A A;  3RYT A;  5CHF A;  4M0W A;  3HUI A;  1VZ6 A;  4N6E B;  1F77 A;  1HXY D;  3GE8 C;  2PKO A;  1RAX A;  1PFD A;  2DZJ A;  3PRP B;  1JW9 D;  2KKC A;  1JRO A;  3RMK C;  1KLV A;  3N20 C;  4EZL A;  2ZNV B;  1SF0 A;  2HTH A;  4AJW A;  2YEP B;  5FKA C;  1TKE A;  3P4S B;  1R4N I;  2LHD A;  3UQA A;  3BZD B;  3BK1 A;  1A70 A;  3I5J C;  1QIL A;  2LEK A;  3B1L X;  2KMA A;  1AYF A;  3WAO A;  2LVQ A;  2FCN A;  4KIK A;  4JQW C;  1MI0 A;  4MSM B;  4WWN A;  3N30 A;  3L16 A;  2WXQ A;  3ZXR A;  4OW0 A;  2BS3 B;  4M8M A;  2GLS A;  1J0G A;  1QZE A;  4RH6 A;  2ZVN A;  1WFY A;  2LRW A;  2W54 A;  3AE6 B;  3VXW A;  3WAP A;  4XWW A;  1N5X A;  2Z0E B;  5AEK B;  5C2T B;  3AU5 A;  3OG5 A;  1V5T A;  3Q3F A;  2OJW A;  2N9X A;  5HHD G;  3A9J A;  3IBE A;  1A5R A;  4K7S A;  4OHJ A;  1WSP A;  4FXC A;  2J0M A;  3MTN B;  3ZDM C;  2HJ1 A;  5IN7 A;  1ZE3 D;  4GDL A;  1T0Q C;  2NTS A;  3CSF A;  1VJK A;  2WX1 A;  1CMX B;  2ZZP B;  4YSZ B;  3A1Q A;  5LXI B;  1TS4 A;  4ZHO A;  2FE8 A;  3AE3 B;  4R3D A;  4FAD A;  3AE8 B;  1HA5 A;  5FR6 A;  2JZZ A;  4F1S A;  3TEY A;  2K5P A;  3ZRC A;  2D11 A;  2HDE A;  2WQY B;  2QC8 A;  3AED B;  5EDS A;  1VZ8 A;  4BKS A;  4CO7 A;  1JML A;  4D2K A;  2KNB A;  3IFW B;  3RT3 B;  1L2N A;  3GB1 A;  4JWS C;  2MCN B;  3N1Z C;  3N3K B;  4RCO A;  3AEA B;  2BKF A;  2W3S A;  4GB9 A;  5CHW A;  1FO4 A;  3SFE B;  3EA6 A;  5FR3 A;  3A4R A;  1I4Q A;  2AEH A;  1HZ6 A;  3BYY B;  3KQ4 A;  5J18 A;  3ZUN A;  4WH4 A;  3B2G A;  3PZD A;  1MPE A;  3O13 A;  1WJ6 A;  3QA8 A;  4GN1 A;  3MP9 A;  1XLQ A;  1WGD A;  1TBE A;  2C7H A;  5JHB A;  2KDI A;  4B95 A;  3NZU A;  4MT5 A;  1WH3 A;  4JLC A;  1Q0W B;  1I42 A;  5HG2 A;  4GLS C;  4KGT A;  4LK0 M;  2V3P A;  3QIJ A;  3P4Q B;  3DVG X;  1KH0 A;  4WJN A;  2BKR B;  2HTM E;  4LNF A;  3PO0 A;  2J4X A;  4PYU A;  3EFC A;  1L0Y B;  3V6C B;  3EEC A;  2JSV X;  2OOB B;  3BVG A;  2A4Z A;  1TS2 A;  2IGG A;  1H8C A;  2C7M B;  1OQQ A;  2KAN A;  2N9L A;  2O6V D;  3AE2 B;  1WYG A;  4M02 A;  2MJ3 A;  1WJ4 A;  4NAW B;  3MHZ A;  2YLM A;  4RGN A;  1SE3 A;  1N62 A;  3NVW A;  1YJJ A;  1E10 A;  1UZX B;  1KOT A;  4XC2 A;  3PV1 A;  4KDI C;  1FM0 D;  3MC9 A;  1PGX A;  1AWD A;  2FAZ A;  3KUD B;  2GRI A;  5J17 A;  2WDR B;  4P1C C;  3P42 A;  2D10 A;  3U52 E;  4EUT A;  2AWT A;  3SEB A;  3A9K A;  3M3J A;  4KZC A;  2KTR B;  2GBM A;  3PZ8 A;  3DBH I;  3K9P B;  5BYS A;  2K8B A;  4XGA B;  3OAW A;  2L00 B;  3APD A;  3KVF B;  1L4D B;  4ZRQ A;  4RF1 A;  3MJ5 A;  4FJZ A;  5IOI A;  1B1Z A;  2I1K A;  3ZYY X;  1GAQ B;  2V9H A;  4RGM A;  1JWS D;  2BS2 B;  1XLN A;  2KWC A;  4I6N B;  1XCQ L;  2N9K A;  1M4V A;  4HLE A;  1PDX A;  4URK A;  3SR6 A;  4L2Y A;  2TSS A;  4ZDV A;  1JWA D;  5C3J B;  1B9R A;  4HPM B;  1SGH A;  5E6P A;  2I1J A;  5DPR A;  4NQL B;  3ZQ4 A;  4K81 A;  4WWO A;  1E6E B;  1L4Z B;  3PRE A;  3KWV A;  2CU1 A;  3FC4 A;  3SD5 A;  5BYR A;  2CKH B;  3URY A;  2FID A;  1YX6 B;  4GGQ A;  1I4H A;  3AMZ A;  3N1X C;  3NS1 A;  3Q3M C;  3TMP B;  2JUO A;  3AEB B;  2IZV B;  2BYV E;  2SAK A;  4AP4 C;  2OJR A;  4DHJ D;  3AEC B;  1E9M A;  2J42 A;  1WGK A;  2DLB A;  2YVC A;  3AV8 A;  1TZO A;  3DVN U;  4W9F A;  1WJN A;  2LVO A;  3KH0 A;  4WQM A;  2KOX A;  1MG8 A;  1GJZ A;  1C4C A;  2QDF A;  5AUK A;  1TTN A;  1PQS A;  1YNT E;  4GDK B;  3X0W A;  2X8X X;  2NPT B;  4WQO B;  5E6O A;  2ZVO A;  2NMQ A;  1UD7 A;  1R4N B;  3EHV A;  2PIA A;  4ZOH C;  4YTP B;  2IO0 B;  4A3O A;  2DZK A;  1JRU A;  2KX0 A;  4G3X B;  4S17 A;  1E7P B;  4G11 A;  2BBC A;  3U4E G;  4W9L A;  1K8R B;  1IPG A;  3CIR B;  3O65 B;  2PTL A;  3M62 B;  1AN8 A;  4EE2 A;  3GP7 A;  3MC0 B;  2WP9 B;  1EU3 A;  3R3M A;  4ITK A;  3PTF C;  3LB8 C;  2BWF A;  1JAL A;  2BPS A;  3I63 C;  3HVD A;  2FNJ B;  2BQQ A;  3PZ7 A;  3TSS A;  2V3N A;  4MM3 A;  2KFJ A;  2IDY A;  1GNU A;  1SE4 A;  3U2S C;  2FUG 1;  3C19 A;  3DWG C;  3IHP C;  2JZP A;  1YIW A;  1P9D U;  1TZ1 A;  1L6U A;  1N61 A;  1FXI A;  4IM3 A;  1GB4 A;  4NAW A;  1FMA D;  1TKG A;  2CHX A;  3DHI C;  2W9N A;  4IG7 B;  2L3Z A;  4ZYN A;  2WDT B;  3RNG C;  2BVC A;  2KD0 A;  2R61 A;  3ETR A;  1E8Y A;  1NDD A;  2L76 A;  3R8B A;  2KDB A;  4DHZ B;  1BUI C;  4LTU A;  4BOS C;  4K7U A;  1IP9 A;  1LXD A;  2BYF A;  2MX2 A;  3BWU D;  1IGC A;  2IGH A;  2G4D B;  2WXF A;  2KWD A;  4ASW C;  1WXQ A;  4M8N A;  1J7A A;  2KTR A;  4ANW A;  3WIM A;  3B9J A;  2J0K A;  1OQR A;  4HEA 1;  1HQR D;  1P1A A;  2N0S B;  3H7P B;  3UIN B;  5KHQ A;  2D07 B;  4XDC A;  4KSL C;  3BII D;  1V81 A;  2MP2 B;  4WWM A;  2LUM A;  2KFK A;  2BF8 B;  1NEK B;  3PT2 B;  5IKC M;  2ON8 A;  2IYD B;  3KW5 B;  4MAC A;  4C80 A;  2IBI B;  2DEN B;  4EFO A;  3E9S A;  3ABV B;  5MPO A;  4GU2 A;  2KJR A;  4BKS D;  2BB6 A;  4GIV A;  2VZK D;  1Y8R C;  3PGE A;  3R66 C;  4DDI D;  3T3O A;  2KX3 A;  3DBL B;  3MJW A;  3AE7 B;  5LNK 1;  2ACZ B;  5T8I A;  2IND C;  3UGB B;  1EUV B;  2DWQ A;  4TQ1 A;  3QWZ B;  5KHO A;  2FBW B;  1U4A A;  3FAH A;  2JXT A;  4MSQ B;  4IOI E;  2LAS A;  2KWU B;  1RFA A;  3RUI B;  2KWV B;  1WMH A;  3RNC C;  2XK5 A;  1VRA B;  1FXA A;  1WE6 A;  3RNE C;  5LXH A;  2KZR A;  3L0W B;  2DZI A;  3QAQ A;  5C23 A;  3IAS 1;  3ZNG C;  1MJD A;  3UIP B;  1TKY A;  2H88 B;  3DBH B;  3H9D A;  4BKG A;  1H4R A;  2I38 A;  4NJC A;  4HDO A;  1K53 A;  1Z2M A;  1HTO A;  2VRR B;  3OLM D;  3V62 A;  1ACC A;  2AYO B;  2CJN A;  4LDT D;  2QMT A;  3PLU A;  3NZ3 A;  4XWT A;  3MC8 A;  3ONS A;  2PW9 A;  2WXM A;  4YTM B;  1R4M I;  2BYT A;  3WCQ A;  1XEE A;  2JQR B;  1UEL A;  2KHW B;  1FPY A;  1HE8 A;  2KDM A;  1YOV B;  2LRU A;  1G6J A;  2DBY A;  2M17 A;  3NVY A;  2KO3 A;  5BMI A;  4G50 A;  4AQ7 A;  4DHZ E;  4CHK A;  5JHA A;  4S0R A;  3CMM B;  2M8S A;  1P0R A;  3AH7 A;  3AEE B;  3QC8 B;  3TJP A;  3Q8F A;  1JWB D;  3DCG A;  1C1Y B;  3HIZ A;  4HWI B;  1HTQ A;  1LM8 B;  3BYT B;  2WHI A;  2WDQ B;  1KM7 A;  2NTT A;  1C76 A;  1Q5W B;  4II2 B;  2K0P A;  4KX6 B;  1GUA B;  2MRP A;  1OEY J;  1LQB A;  3U7Z A;  4JGH B;  2LHE A;  1QQR A;  4W9E A;  2RDG A;  4FUL A;  1J7C A;  4MM3 B;  3JYU A;  4DQO C;  3KYD D;  2JVC A;  3VVW B;  1GC6 A;  2QEJ C;  4WJP A;  5EE9 A;  5D6J B;  4B9K A;  4ZRP A;  1TS5 A;  4W9H A;  4L1B A;  1E5W A;  2XN9 C;  4YWG G;  1V49 A;  4MEL A;  2E6X A;  3VTU A;  1SIF A;  1UGM A;  2IO2 B;  4AOF A;  2NR2 A;  3B08 A;  3ZIM A;  2AL3 A;  1T0Y A;  5TSS A;  1FNU A;  3KWL A;  3HM6 X;  1GPX A;  3PSE B;  2Y5C A;  3C8Y A;  2WXK A;  2PPH A;  3DBL I;  3AUL A;  3TCA A;  4A90 A;  1IYF A;  5JZE B;  3W2D A;  2AL6 A;  3GE3 C;  3H7P A;  3QHT A;  1L0V B;  2C60 A;  1F2R I;  4YXD B;  2MP2 A;  1YJI A;  3HM3 A;  4EOY A;  2GMI C;  1UWX A;  2ZW0 A;  1V2Y A;  4BBN C;  2DAF A;  4W9C A;  3QQ8 B;  1IGD A;  4ANV A;  1WXS A;  1ZDX A;  1JWU D;  1GG3 A;  2PVO D;  2JU6 X;  2Y5P A;  4A55 A;  2WXI A;  2W3R A;  5CTR C;  3V6E B;  1QOG A;  1TS3 A;  1KRH A;  4LJO B;  4DDG D;  1WGY A;  2RD0 A;  2RDH A;  3ZKJ C;  1JRP A;  1WRD B;  1WXV A;  4LDT B;  2VH2 A;  1ZP0 B;  4C00 A;  2N1V A;  2PMV A;  1BT0 A;  2BT6 A;  2NS5 A;  4HJG E;  1BML C;  1WX9 A;  1K52 A;  2RGF A;  2HE7 A;  1QKZ A;  1P3Q U;  1WR1 A;  2EMT A;  3IT4 B;  3QJZ A;  1TIF A;  1OQY A;  2D3G A;  3GS2 A;  2C5L C;  4XX5 A;  1L7Y A;  2HJ8 A;  4RGT A;  2KMM A;  4I6L B;  2WXJ A;  1WYW B;  2GBN A;  2Y5B B;  5D3I B;  2KDE B;  2LUE A;  4GXB A;  1SB3 C;  1P7E A;  3HK0 A;  2JXX A;  4LCD E;  1LGR A;  5DPT A;  4K3B A;  5L95 C;  5IP4 D;  4NPN A;  4IC7 B;  2UWQ A;  2AQ1 B;  3IG3 A;  2G1E A;  2KQ4 X;  1F2R C;  3APF A;  5E6J A;  3IT6 B;  4PT5 A;  2K6D B;  4JL9 A;  3W9C B;  1FIQ A;  3ZW3 A;  1SSN A;  5D3D A;  5IAA C;  3VQI A;  4KVG B;  3HVZ A;  1SIJ A;  2JWZ A;  1YJ1 A;  4N9F 4;  4W9D A;  1JCK B;  3PRZ A;  1E8X A;  1I4R A;  2J7Q B;  4K1R B;  3H1U A;  4ICV A;  1NVI D;  4DXG A;  3AN1 A;  3V3X A;  3AB5 A;  2MWS B;  1J19 A;  3H7S A;  2B3A A;  3I3T B;  3PHW B;  1CK1 A;  1E8W A;  2ZNV C;  2ZPN A;  2LI5 A;  2KC1 A;  4NNJ B;  2XBB C;  3VR8 B;  3DHG C;  1Q1O A;  4YSX B;  4HK2 A;  3RN9 C;  2Z8L A;  2KJ6 A;  4NZL B;  3W5U B;  1GB1 A;  3SU8 X;  2AX5 A;  1WXA A;  3UQB A;  3WAM A;  2QCZ A;  2WDV B;  1HEZ E;  1E7V A;  2V0G A;  1S1Q B;  1SE9 A;  1YN4 A;  2NCN A;  3VFK A;  2OHF A;  2ZCB A;  2MBQ A;  2L0T A;  1XXG A;  3PHX B;  1EWC A;  1XCT L;  2A5U A;  3KUC B;  2K3U A;  4HKZ E;  1F0Z A;  1D3Z A;  3ENE A;  2WWZ A;  4TV3 A;  2CHW A;  4DK5 A;  4GOC A;  2JWU A;  4M00 A;  2JT4 B;  2L32 A;  4RNA A;  3ZJV A;  1YD8 U;  2MBO A;  4ZYS A;  2DNF A;  1JWM D;  1XF5 L;  2GBJ A;  4BFR A;  4LLG M;  3GZN B;  3P4P B;  1E90 A;  3DBR I;  3I9V 1;  1F1H A;  4X57 B;  3T3N A;  2KN4 A;  2PE6 B;  5JH5 C;  2INC C;  4XZ4 A;  5J2R A;  2L52 A;  4F7Z A;  1KLG D;  1NYQ A;  1D5M C;  3QCA A;  5H8Y E;  1SJH D;  2C7N B;  3RI7 C;  2FUH B;  1ESF A;  4F8C B;  2LXC A;  3HHM A;  4HCN B;  1N60 A;  1IUE A;  3ML9 A;  2M4N A;  3PLV A;  3I57 A;  2GBR A;  4XE0 A;  4IM0 A;  5HI1 A;  2JX5 A;  1J8C A;  1YMH E;  3FKY A;  1WJU A;  2LGS A;  3P2B A;  4P16 A;  2KQ7 A;  2BTE A;  1ZW7 A;  3VR9 B;  4HVB A;  1DOY A;  3M63 B;  5GXG B;  3Q6B A;  1FRD A;  4C4V B;  4MGZ E;  1C3T A;  4RF0 A;  1GT8 A;  1ET6 A;  2W55 A;  1I4P A;  4C7Z A;  1WIA A;  1ROE A;  2N9E B;  2MHJ A;  4EKU A;  4FBJ B;  3E56 A;  2I2Y A;  2W82 A;  4E71 A;  4ZHP A;  3J9C A;  4RMA A;  2JPH A;  4P1B C;  2DZM A;  2L8J A;  2EKE C;  3VUW A;  1PGB A;  2KAJ A;  2JF5 A;  3BY4 B;  1VD2 A;  5G2N A;  3AEG B;  5DCN A;  1MHH E;  3DVN V;  1UWM A;  3OJ3 A;  3VRB B;  3A33 B;  4KGR A;  3ZVV A;  3ZJT A;  4DHJ B;  3PVL A;  1E8Z A;  3CWI A;  3Q8E A;  2PJH A;  2MLB A;  1UBQ A;  2BYE A;  3W1S A;  4EZJ A;  1QLB B;  1WX8 A;  4BAX A;  4IDI A;  5IO9 A;  1IBX B;  4PK1 A;  4FHK A;  4IWQ A;  4KIK B;  4K7W A;  4YTN B;  4USA A;  1WF9 A;  2K9X A;  1NEN B;  4WWP A;  3NZS A;  1FRR A;  2UYZ B;  1XQQ A;  2G45 B;  3A4S C;  1KF6 B;  1V9J A;  1ZXI A;  3PS6 A;  2RR9 A;  2V4I B;  3Q14 C;  2MJD A;  2AQ3 B;  1T0S C;  1N5W A;  2JY6 A;  1QF6 A;  1C4A A;  3PPA A;  2REX A;  2GBK A;  1BXT A;  1V1P B;  4LNI A;  4NAM A;  4OZC A;  4OVV A;  1ZGU B;  4LNK A;  3EFU A;  1WM2 A;  5EE1 A;  4Q2J A;  4GDL B;  4IM2 A;  4P6V F;  4ARC A;  3P4R B;  4W9I A;  4CYE A;  3JSV A;  2D2Q A;  3KYC D;  2K1F A;  2NBU A;  2N7D A;  5BO4 B;  2WU2 B;  3A1Q B;  1E0Z A;  5HFY A;  5IA7 A;  1P7F A;  2BWE S;  1WXM A;  4A9A A;  2ZCC A;  1V97 A;  2J0J A;  3UI3 A;  1R7S A;  2WGS A;  4KZ0 A;  2IY0 B;  1OFF A;  2KQS A;  2KVR A;  3IVF A;  4IKG A;  2LJI A;  4E74 A;  2LVP A;  3DBR B;  2LZ6 A;  3DVG Y;  3OWE B;  1ZUD 2;  4WUR A;  3L13 A;  4A20 A;  1FXT B;  1Z5S B;  4HCP B;  2Z0D B;  4M01 A;  1XO3 A;  2IJ0 A;  4HRO A;  3FIL B;  4NQK E;  4REZ A;  4AJY B;  2BGF A;  4JE3 B;  2LD9 A;  3APC A;  1WZ3 A;  5CX3 A;  3R7R A;  1FEH A;  1UBI A;  1VR9 A;  4XYC A;  2H89 B;  1OGW A;  3TIX A;  4OVU A;  4B6W A;  1CQV A;  5D7G A;  1UGJ A;  4MH8 A;  5HKH A;  2BB5 A;  1VCB A;  4HRS A;  2LJ5 A;  4GSW A;  1OEY A;  4C56 C;  2R2O A;  1NBF C;  4JWU C;  4DBG A;  1DOX A;  1RWS A;  3AE1 B;  2O6V B;  2BW2 A;  3UF8 A;  2CR5 A;  2DYM A;  2WNM A;  5JXV A;  4TKN A;  1H7X A;  4PS3 A;  1FNW A;  1TY2 A;  2WXR A;  1KTK A;  3ZGZ A;  2FCM A;  2BS4 B;  4MJS B;  3AE5 B;  2WS3 B;  1WX7 A;  3VH3 B;  2WXL A;  1AAR A;  1WI0 A;  2JRI B;  2D5G A;  4J3O D;  3AU4 A;  4KDL B;  3NVZ A;  2R2Q A;  2QIE B;  2QSD A;  3ZO5 B;  3VHT C;  2ICI A;  4LNN A;  1TT5 B;  1OTR B;  4HDQ A;  2KVZ A;  3WAL A;  4C4V A;  4PS7 A;  2RSU A;  3ZDT A;  2WXH A;  3NOB A;  4WAF A;  2Z59 B;  2KLC A;  2FCS A;  3N1Y C;  4RGO S;  3QX1 A;  1KFY B;  4BBN F;  4WAA A;  5AZG A;  3RZW C;  3B0A A;  2MBH A;  2K6Q A;  1EF1 A;  2KDF B;  3IAM 1;  4MGK E;  3OJ4 B;  4W9K A;  1QT9 A;  2RPV A;  2Q5W D;  3DHH C;  2SEB D;  1XLO A;  4OZA A;  5L83 A;  3NS8 A;  1VLB A;  2XNA C;  2WXG A;  3BVM A;  2KXJ A;  2WLB A;  2KYW A;  3N32 A;  3GZN I;  3Q69 A;  4US8 A;  1DOI A;  1RFK A;  3BVZ A;  2G3Q B;  1TGZ B;  5BYQ A;  1GC7 A;  1T6B X;  4MGY E;  2MW5 A;  2IY1 B;  5AUI A;  1ET9 A;  5D2M B;  4BVU C;  1EF5 A;  4TUU A;  3KLS X;  4WJQ A;  4LNO A;  4H2A A;  2PVG C;  1IBX A;  2LWP A;  2YEP F;  3DPD A;  4BOZ B;  3ZNH B;  1UH6 A;  4CQN A;  2KFK B;  2XEW A;  1FFU A;  3Q8C A;  2ZJD A;  3NHE B;  4ZRJ A;  3ALB A;  2KK8 A;  3EUB 2;  2X38 A;  1XT9 B;  3U30 A;  4ACF A;  2MSE D;  1XD3 B;  3AXC A;  2CU3 A;  3H8H A;  3TBL D;  1QOA A;  2O2V A;  1V1P A;  4AWJ A;  4IWP A;  1WRI A;  3ECI A;  5AZH A;  2ASQ A;  1K51 A;  1VDV A;  4J6I A;  2JZ3 B;  3VAW A;  4KV2 A;  3JSV B;  2WYQ A;  2KMC A;  2WU5 B;  1V8C A;  2K8H A;  3ZXV A;  1MFW A;  3WAN A;  5BMH A;  2MBB B;  1YQ3 B;  1V80 A;  1FNV A;  2G4S A;  2L05 A;  3MHS D;  3P63 A;  4II3 B;  1DYQ A;  1WMH B;  2FIF A;  3NG0 A;  4W9G A;  2KAC A;  4WIP A;  2PEA A;  4GDK A;  2K39 A;  2NPT A;  1TY0 A;  2IPK D;  2V4L A;  3VH4 B;  2FCQ A;  4FJY A;  2MEK A;  2PE9 A;  3LDZ E;  1Q10 A;  3T8M A;  2M0A A;  2MBE A;  3FIL A;  3UIO B;  1ZPS A;  5E6N A;  5FK9 C;  5C1Z A;  3RUL A;  1YQB A;  2L83 A;  2MJE A;  1YQ4 B;  1WM3 A;  3SDL C;  4FLH A;  1T3Q A;  2LXA A;  1CJE A;  3LJ3 A;  4LJP B;  4ARI A;  4WJO A;  2GI9 A;  2CJO A;  2N9P C;  2D3B A;  2V3S A;  1UUP A;  2IO3 B;  4NJ7 A;  2V1Y A;  1FD6 A;  2K22 A;  3P1M A;  2HD5 B;  1GTH A;  4XDD A;  3TUO A;  4UDU C;  4HPP A;  1QOB A;  2O6V A;  2E3T A;  2EMS A;  4TQ0 A;  3QAR A;  3D32 A;  1RRB A;  2NBV B;  4HKQ A;  3PRM B;  4TMA B;  3ZNZ B;  1FCC C;  5I4D A;  3MFG A;  2QIL A;  4MJS A;  2INN E;  2WX0 A;  1T5X D;  1SEB D;  1ZXH A;  4P7I A;  3RD2 A;  4ICU A;  1C4P A;  2RPQ A;  1LFD A;  2J53 A;  3W1Y A;  2L7R A;  4MDK E;  3AM9 A;  2M19 A;  2M0X A;  1GOZ A;  5G5H A;  3RNA C;  2WXP A;  5D94 A;  4EEW A;  4FN2 A;  4K3C A;  2N7E A;  5LLI A;  4G0N B;  4MGI E;  1P98 A;  5EE3 A;  5DPW A;  2JYT A;  1S3S G;  3X23 A;  1NYR A;  4OVZ A;  3M95 A;  3Q3J A;  4L23 A;  4DXF A;  3ZLZ A;  3Q2A C;  4E3C A;  2NVU I;  2KT7 A;  4C7Y A;  3DBS A;  1SE2 A;  3AEF B;  3H6N A;  3C0R B;  3ZTD A;  4RFB A;  4PS8 A;  3BK2 A;  3U8Z A;  3ZJU A;  1C79 A;  2PLP A;  3B2F A;  1YX5 B;  2MH7 A;  1WE7 A;  1K50 A;  2AQ2 B;  4HPL B;  1STE A;  2DYO A;  4IWO A;  3NUH B;  3L17 A;  5G5G A;  1L0X B;  3N9Y C;  4RM9 A;  4RM8 A;  3RNB C;  1WGR A;  2QJL A;  4FHJ A;  2Y3A A;  2C9W B;  1CZP A;  3ZTC A;  2DHZ A;  2MA9 B;  4IUM B;  2LFI A;  3V61 A;  1WY8 A;  1V5O A;  4QAY A;  1TYG B;  2N4F A;  1KLU D;  3R7Q A;  4FJV B;  1X1M A;  5CHV C;  4YL8 A;  5DPS A;  3S2A A;  3DDC B;  1MG4 A;  4HJK A;  3KUZ A;  3SFD B;  2GOW A;  2LGD A;  3NRZ A;  3CF4 A;  1PGA A;  4ANX A;  4MEM A;  3RCZ A;  1D6E C;  1ZOY B;  4YSY B;  2OED A;  1WZ0 A;  2LGI A;  3DQV A;  2O2V B;  2XK5 B;  2L0F A;  3AE4 B;  1E7U A;  2ZPY A;  2D3A A;  1WR6 E;  4M0W B;  1PUT A;  4A3P A;  2D3C A;  4JPS A;  2L1A A;  1FFV A;  1SJE D;  1LO5 D;  4N58 A;  3W5V B;  1ZKH A;  2K8C A;  3SHQ A;  1NI2 A;  1J7B A;  4KKI A;  5AZF A;  4O1N A;  4EZK A;  4N59 A;  4DXA B;  5GMV A;  2DAJ A;  2WXO A;  1I7H A;  3JW0 X;  3ML8 A;  4FA6 A;  3CST A;  2N1W A;  4JX1 C;  3W1S C;  4KGS A;  2LGY A;  4A8X C;  4YT0 B;  4B0E A;  4HXD A;  1L6V A;  3NVV A;  2RMM A;  2WXN A;  3L08 A;  1H7W A;  1F52 A;  2QHO A;  3RPF C;  3A9J B;  3ZRF A;  1V86 A;  4ZRI A;  1EO6 A;  3T9L A;  2M1M A;  3RZF A;  2JYE A;  4KSK C;  4A6Q A;  1C77 A;  4NJ6 A;  2KN5 A;  2CHZ A;  2VZK B;  3ZNI D;  4ZRK A;  4TSS A;  4NY0 A;  4I6P A;  1V6E A;  1RLF A;  1MVK A;  4KKJ A;  2INP E;  2RDB C;  2KJH B;  3LYY A;  3Q3O C;  2UU7 A;  2J52 A;  4JIO U;  3GOE A;  5TR5 A;  2EKI A;  4IW0 A;  4MH0 E;  3TEZ A;  4AUQ C;  1JQ4 A;  1YN3 A;  1EWY C;  3NY5 A;  4US9 A;  2EEL A;  3WA0 A;  5H92 C;  2VH1 A;  1Y56 A;  1PYW D;  1NI3 A;  1UNS A;  3CF6 E;  3V05 A;  1R4M B;  1D5X C;  1ENF A;  2LGX A;  2ZW1 A;  2ONQ A;  1D5Z C;  1V1O A;  3LXF A;  3L4P A;  3V60 A;  4AS1 A;  1F9J A;  3DOW A;  3K9O B;  1EM7 A;  2N7J A;  4BKT A;  1ZDV A;  4GMV A;  1RM6 C;  4B0M A;  1HZ5 A;  3L10 B;  1QOF A;  3RNF C;  3Q8B A;  2IGD A;  1SXT A;  3JVZ X;  2GB1 A;  2MQJ A;  1MHX A;  1SBB B;  2IO1 B;  2ZEQ A;  1EU4 A;  3VTW A;  3RFZ B;  1FCL A;  2KTF A;  2K25 A;  2JRH A;  1WWT A;  2NBW B;  2CS4 A;  4ANU A;  1TJE A;  1C9F A;  1I35 A; 
#chains in the Genus database with same CATH homology
 1JCK B;  1VZ7 A;  3Q8C A;  4ITK A;  5EE0 A;  3LB8 C;  1I4R A;  2X38 A;  3EUB 2;  1JAL A;  1DGJ A;  1N63 A;  1NVI D;  4DXG A;  3AN1 A;  3V3X A;  3AB5 A;  5BMG A;  2G9H D;  1RYJ A;  2CU3 A;  3HVD A;  1GTE A;  3R2T A;  3H8H A;  3DWM A;  1CK1 A;  1QOA A;  3PZ7 A;  1C78 A;  1V1P A;  1XLP A;  3TSS A;  2V3N A;  3VR8 B;  4YSX B;  1WRI A;  2IDY A;  2Z8L A;  4NZL B;  1SE4 A;  3W5U B;  1GB1 A;  1K51 A;  3IXS A;  2AX5 A;  3HRD D;  4OZB A;  2FUG 1;  3U2S C;  1VDV A;  1AW7 A;  3DWG C;  3R2I A;  2WDV B;  2JZP A;  1HEZ E;  3VRA B;  2V0G A;  2B76 B;  1L6U A;  1YN4 A;  1V8C A;  2WU5 B;  1N61 A;  1FXI A;  2OHF A;  2LMC A;  1GB4 A;  5BMH A;  1FMA D;  1TKG A;  1YQ3 B;  2M56 B;  1FNV A;  3TEW A;  1I4X A;  1I4G A;  3P63 A;  1L5P A;  1XXG A;  1DYQ A;  3TEX A;  1EWC A;  1XCT L;  1D4B A;  2K3U A;  4HKZ E;  2KAC A;  4WIP A;  1YN5 A;  1F0Z A;  3AE9 B;  3EGR A;  3Q8A A;  2R61 A;  1TY0 A;  2IPK D;  3ETR A;  4M0W A;  2JWU A;  3HUI A;  1VZ6 A;  4N6E B;  1F77 A;  1HXY D;  2L32 A;  2PKO A;  4RNA A;  3R8B A;  1PFD A;  3ZJV A;  2MEK A;  4ZYS A;  1BUI C;  4LTU A;  1JW9 D;  1JRO A;  1JWM D;  1XF5 L;  4LLG M;  3BWU D;  1Q10 A;  1IGC A;  1SF0 A;  2IGH A;  2M0A A;  2KWD A;  3P4P B;  1WXQ A;  2WXF A;  1J7A A;  3FIL A;  2YEP B;  1ZPS A;  5FKA C;  3B9J A;  1OQR A;  1TKE A;  3I9V 1;  4HEA 1;  3T3N A;  3P4S B;  2LHD A;  2KN4 A;  5FK9 C;  3BZD B;  3BK1 A;  2L83 A;  2MJE A;  1A70 A;  1HQR D;  1YQ4 B;  1QIL A;  2LEK A;  2N0S B;  1T3Q A;  2L52 A;  1CJE A;  1AYF A;  1KLG D;  1NYQ A;  4ARI A;  1D5M C;  2GI9 A;  2CJO A;  5H8Y E;  1SJH D;  1UUP A;  4XDC A;  1MI0 A;  3BII D;  1ESF A;  2WXQ A;  1FD6 A;  2K22 A;  4WWM A;  2LUM A;  1N60 A;  1IUE A;  4OW0 A;  2BS3 B;  3I57 A;  3P1M A;  4XE0 A;  1NEK B;  4RH6 A;  1GTH A;  2ON8 A;  4XDD A;  5HI1 A;  2JX5 A;  3TUO A;  1YMH E;  2W54 A;  4UDU C;  3AE6 B;  4MAC A;  4P16 A;  4XWW A;  1N5X A;  2BTE A;  5C2T B;  1QOB A;  3VR9 B;  2E3T A;  4C80 A;  4TQ0 A;  3E9S A;  1DOY A;  3ABV B;  4HKQ A;  5MPO A;  4TMA B;  5GXG B;  1FRD A;  2BB6 A;  5HHD G;  1FCC C;  4RF0 A;  5I4D A;  2VZK D;  3MFG A;  1GT8 A;  1ET6 A;  2QIL A;  4OHJ A;  3T3O A;  2INN E;  3AE7 B;  1WSP A;  2W55 A;  1I4P A;  4FXC A;  5LNK 1;  1T5X D;  4C7Z A;  2ACZ B;  1ROE A;  5T8I A;  1SEB D;  1ZE3 D;  2I2Y A;  1ZXH A;  3E56 A;  2NTS A;  1C4P A;  2W82 A;  1VJK A;  2DWQ A;  4ZHP A;  2J53 A;  3J9C A;  4YSZ B;  4TQ1 A;  2FBW B;  3FAH A;  1PGB A;  2JXT A;  2KAJ A;  1TS4 A;  3AM9 A;  4IOI E;  4ZHO A;  2FE8 A;  2M19 A;  3AE3 B;  4R3D A;  3AE8 B;  1HA5 A;  1GOZ A;  5G5H A;  2WXP A;  3AEG B;  3TEY A;  2K5P A;  1VRA B;  1FXA A;  1MHH E;  2HDE A;  2WQY B;  3AED B;  1UWM A;  3IAS 1;  3VRB B;  1VZ8 A;  1JML A;  1TKY A;  4D2K A;  2H88 B;  4KGR A;  3ZJT A;  2I38 A;  3GB1 A;  4JWS C;  3CWI A;  4NJC A;  5EE3 A;  4RCO A;  3Q8E A;  2JYT A;  1K53 A;  3AEA B;  2W3S A;  1NYR A;  1FO4 A;  4OVZ A;  1ACC A;  4L23 A;  3W1S A;  4DXF A;  2CJN A;  1QLB B;  3SFE B;  3EA6 A;  2QMT A;  5FR3 A;  4C7Y A;  1I4Q A;  1HZ6 A;  3BYY B;  3KQ4 A;  4IDI A;  1SE2 A;  3NZ3 A;  1IBX B;  3AEF B;  4XWT A;  4WH4 A;  3B2G A;  4RFB A;  2PW9 A;  2WXM A;  3BK2 A;  4YTN B;  4YTM B;  1MPE A;  3O13 A;  4USA A;  3ZJU A;  2BYT A;  3MP9 A;  1C79 A;  1XLQ A;  2K9X A;  2PLP A;  3B2F A;  1NEN B;  3WCQ A;  2MH7 A;  1FRR A;  1K50 A;  1XEE A;  2AQ2 B;  1KF6 B;  1ZXI A;  2V4I B;  1STE A;  2JQR B;  2DYO A;  2MJD A;  2AQ3 B;  3NUH B;  5G5G A;  4MT5 A;  1L0X B;  1N5W A;  2KDM A;  3N9Y C;  1QF6 A;  1C4A A;  2QJL A;  5HG2 A;  4GLS C;  4KGT A;  2Y3A A;  2DBY A;  4LK0 M;  3NVY A;  2V3P A;  1CZP A;  3P4Q B;  5BMI A;  1KH0 A;  4AQ7 A;  1BXT A;  2LFI A;  1V1P B;  2HTM E;  3PO0 A;  4NAM A;  2J4X A;  3AH7 A;  3AEE B;  4OZC A;  1TYG B;  1L0Y B;  3Q8F A;  1KLU D;  1JWB D;  2JSV X;  3BVG A;  5EE1 A;  3BYT B;  2IGG A;  1TS2 A;  4GDL B;  4P6V F;  4Q2J A;  4ARC A;  2WDQ B;  3P4R B;  1OQQ A;  2N9L A;  3AE2 B;  2WU2 B;  1WYG A;  2MJ3 A;  1C76 A;  2NTT A;  3SFD B;  3NRZ A;  2K0P A;  4NAW B;  1E0Z A;  3CF4 A;  1PGA A;  3MHZ A;  5HFY A;  4KX6 B;  4RGN A;  1SE3 A;  1D6E C;  1P7F A;  1ZOY B;  3U7Z A;  4YSY B;  1N62 A;  2OED A;  2LHE A;  3NVW A;  1YJJ A;  1QQR A;  2LGI A;  4A9A A;  1E10 A;  1V97 A;  3UI3 A;  1R7S A;  1FM0 D;  2RDG A;  1J7C A;  4MM3 B;  1OFF A;  3AE4 B;  1PGX A;  4DQO C;  1AWD A;  4IKG A;  2LJI A;  1PUT A;  4WUR A;  3OWE B;  1ZUD 2;  2GRI A;  4JPS A;  2QEJ C;  2WDR B;  3P42 A;  2L1A A;  1XO3 A;  1FFV A;  5EE9 A;  1SJE D;  2IJ0 A;  3U52 E;  3SEB A;  4HRO A;  3FIL B;  4REZ A;  1LO5 D;  4JE3 B;  4N58 A;  3W5V B;  4ZRP A;  3PZ8 A;  1FEH A;  1VR9 A;  1TS5 A;  2H89 B;  4L1B A;  2XN9 C;  1J7B A;  4KKI A;  4YWG G;  4O1N A;  5BYS A;  4N59 A;  2E6X A;  1L4D B;  4ZRQ A;  4RF1 A;  1CQV A;  3MJ5 A;  5D7G A;  1B1Z A;  1UGJ A;  4MH8 A;  2BB5 A;  3ZYY X;  1GAQ B;  2WXO A;  1I7H A;  4RGM A;  4HRS A;  5TSS A;  1FNU A;  1JWS D;  2BS2 B;  1XLN A;  3KWL A;  1XCQ L;  2N9K A;  4A8X C;  4JX1 C;  4KGS A;  4YT0 B;  4C56 C;  1GPX A;  4B0E A;  2Y5C A;  3C8Y A;  1M4V A;  4JWU C;  2WXK A;  1DOX A;  1RWS A;  3AE1 B;  1PDX A;  4A90 A;  2BW2 A;  3SR6 A;  4L2Y A;  1L6V A;  2TSS A;  3NVV A;  2RMM A;  1JWA D;  2WXN A;  2DYM A;  3W2D A;  2WNM A;  5JXV A;  1H7W A;  5C3J B;  1H7X A;  3RPF C;  1B9R A;  1FNW A;  1L0V B;  1TY2 A;  2WXR A;  1KTK A;  1F2R I;  3ZGZ A;  4YXD B;  2BS4 B;  3AE5 B;  2WS3 B;  2JYE A;  2WXL A;  3ZQ4 A;  1YJI A;  1E6E B;  1L4Z B;  2D5G A;  4J3O D;  4A6Q A;  1C77 A;  1UWX A;  3KWV A;  3NVZ A;  2ZW0 A;  2QIE B;  2QSD A;  2VZK B;  3FC4 A;  5BYR A;  2ICI A;  3URY A;  4TSS A;  1IGD A;  1I4H A;  1ZDX A;  1JWU D;  1MVK A;  2PVO D;  4KKJ A;  2JU6 X;  2Y5P A;  3AMZ A;  2INP E;  3NS1 A;  3LYY A;  4A55 A;  2WXI A;  2WXH A;  4WAF A;  3AEB B;  2W3R A;  1QOG A;  2J52 A;  1TS3 A;  2SAK A;  4RGO S;  1KRH A;  3AEC B;  2EKI A;  1E9M A;  1KFY B;  2J42 A;  2RDH A;  1JRP A;  1WGK A;  2DLB A;  3TEZ A;  1JQ4 A;  1YN3 A;  1EWY C;  1ZP0 B;  4US9 A;  2EEL A;  5H92 C;  3AV8 A;  1TZO A;  3IAM 1;  2PMV A;  1QT9 A;  1Y56 A;  2RPV A;  1PYW D;  1NI3 A;  1UNS A;  2BT6 A;  2Q5W D;  2SEB D;  1XLO A;  4HJG E;  4OZA A;  1D5X C;  1ENF A;  1BML C;  4WQM A;  3V05 A;  1VLB A;  2XNA C;  1K52 A;  2WXG A;  2ZW1 A;  2ONQ A;  1D5Z C;  3BVM A;  1V1O A;  3LXF A;  3L4P A;  1C4C A;  2WLB A;  5AUK A;  4AS1 A;  1QKZ A;  1YNT E;  1EM7 A;  4GDK B;  3IT4 B;  2N7J A;  3Q69 A;  4US8 A;  1ZDV A;  1DOI A;  1RFK A;  1RM6 C;  2NMQ A;  3GS2 A;  3BVZ A;  4B0M A;  1HZ5 A;  4RGT A;  2KMM A;  1QOF A;  2PIA A;  2WXJ A;  3Q8B A;  5BYQ A;  2IGD A;  1T6B X;  4ZOH C;  4YTP B;  1SXT A;  5D3I B;  5AUI A;  1ET9 A;  2GB1 A;  1MHX A;  1SBB B;  1EU4 A;  1SB3 C;  1P7E A;  1E7P B;  2BBC A;  3U4E G;  3KLS X;  3RFZ B;  1FCL A;  4H2A A;  2AQ1 B;  3CIR B;  2PVG C;  1IBX A;  2G1E A;  2KQ4 X;  1F2R C;  1WWT A;  2PTL A;  2YEP F;  3IT6 B;  5E6J A;  4PT5 A;  3W9C B;  1FIQ A;  1AN8 A;  1SSN A;  1TJE A;  5D3D A;  3VQI A;  4EE2 A;  3HVZ A;  4CQN A;  1C9F A;  3GP7 A;  1SIJ A;  3MC0 B;  2WP9 B;  1EU3 A;  1FFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...