3AE8C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae8C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae8C02
1NEKD 2WDVC 1NEKC 2WDVD 3AEED 3AEBC 1L0VC 1E7PC 1YQ4C 1QLBC 2WP9C 1OW8A 2WS3C 3P4PC 5C3JC 3SFED 3AEAC 4YT0D 3CIRC 3AECC 1KTMA 1OW7A 3AE5C 3P4SD 1ZP0C 2BS4C 1NENC 2WDQC 3AE3C 2WU5C 3AEGD 3AE4C 2H89C 3AE9C 2ACZC 3VR8C 4KX6D 4KX6C 4YSXC 1KF6C 1KFYC 1YQ3D 2FBWD 4YSYD 3AE9D 3AE1D 2H88C 2BS3C 3VR9D 3AEFC 2WDRD 4YXDD 4YTND 3AE5D 1ZOYC 3VRBC 4YSZD 3AE2D 3ABVD 1PV3A 3AE3D 2ACZD 2H89D 3P4QC 3P4RD 4YTNC 4YXDC 2WU2D 4YTMC 4YSZC 2B76D 2WP9D 3P4PD 3AE4D 3AEGC 3AE6C 3VRAC 4YTPC 5C3JD 2WQYD 2BS2C 2H88D 5C2TD 3AEDD 5C2TC 3CIRD 3AEEC 4YT0C 3S9OA 2WU2C 1L0VD 4YSYC 1YQ3C 2B76C 3AE7D 3ABVC 3B71A 2WQYC 3AEDC 3AECD 3AE8D 3AE8C 3VRBD 4YTMD 1ZOYD 2FBWC 2WU5D 1ZP0D 2WDQD 3VRAD 2WS3D 3AE6D 3P4RC 1OW6A 3P4QD 4YSXD 3VR9C 3AEAD 3AEFD 3SFDD 3SFDC 3AEBD 1K04A 1KFYD 1KF6D 2G3AA 1YQ4D 3P4SC 3AE2C 1NEND 1K05A 3AE7C 4YTPD 3AE1C 3VR8D 3SFEC 2WDRC
chains in the Genus database with same CATH superfamily
3AEBC 2WTYA 2G8YA 3BRTB 3M0DA 4GOEA 3CCRP 2NRGA 4GKGA 4DHJA 4IFDK 2WSCJ 2ZVNB 1NTZD 3RK2C 2Q9IA 1GU4A 2FYUJ 2IYPA 2M3EA 1GW3A 1ZP0C 1SQPE 4OWFA 2QJPC 1BE3E 5CCHC 2POHA 2QJPB 1YQ3D 1TFFA 3RGUA 1NTKK 3MHVA 5APUA 2WT7B 2FXPA 2RKLA 1HTLC 3M91A 3CXHD 2BEQD 1BCCD 3D70A 1IZNB 5BU8B 2LR2A 3ABVD 2C9LY 1L0LD 2WPQA 3C8VA 1Z56A 3LIDA 2ZT9D 5KKZB 3R2PA 1SQBK 1KFMA 5DJTB 3AE6C 1J2JB 2XZRA 4TLFA 5CHXA 3L75D 2H88D 4EYYQ 2CPSA 3MUDC 4UB6E 1BSHA 1H0TB 2KSEA 1L0LJ 1OFCX 3IN6A 3H32B 4Y99B 1HBWA 2FYUE 2P7JA 3CCMP 1M1JA 2MKVA 3L71D 1QGKB 4ZKPA 3A3YB 2GUVA 3L71E 3SFDD 1IFNA 2WVRA 5CBNA 4Y28J 3HE5B 3KDPB 2HFED 2FKWB 1BE3D 3CCJP 3V2RA 3HRNA 1YITP 4FJVA 2YKPA 2M0BA 1SQVD 1HVVA 4RKUJ 5KLIC 3CWBG 2D2CC 2YMKA 4RJTA 2H89C 3S4RA 4DHZA 2JKVA 1JY3P 3H1LG 2YNYA 1SQBE 2FYUK 1RE4C 3M0AA 4JYCA 1DD4A 3MP7B 4L76A 2PP6A 2E75D 2YKQA 1A02F 3TK1A 3O8ZA 3N4XA 1QVGO 1PGPA 1EC5A 2FYZA 2N1TA 2Z4EA 4YSZC 2OARA 4AYCA 3V2PA 3A0BE 5AW5B 2E42A 3WU2E 4LC1A 1SQBJ 2HR3A 3CC4P 4UB8E 1HJBA 5KLVD 2GA1A 3AE8D 3VRBD 3RL0B 1L0LK 4KHXA 3V6IA 4GDOA 4M3LA 1ZP0D 1EDLA 1J1DC 3P4QD 1RHZB 3H1JJ 2QA4P 3M0DC 1J1EB 2E75C 3SFEC 4IFMA 3L72E 1J1EC 1A02J 4DHIB 3PRJA 2ITAA 1M56D 1L0VC 3HD7D 3A0BH 3L73E 1LTBC 1EZVE 1SQXK 1KV4A 2HLOA 3L73D 1CI6B 1BDDA 1M1JC 1AVOA 5CJ4A 1NENC 2BS4C 1QLED 1HGZA 4KX6D 1VQPP 4KX6C 1M1JB 4XE5B 1FZCC 2Q5UA 4IFFA 4YSYD 1H8AA 1FDIA 1JTHA 1NTKE 1LWUB 2FFDC 1H0TA 1CSBA 1EZVG 1LT9A 1JO5A 3AE3D 1L4AD 2OYHA 1NU1K 2QM7A 1WT6A 1T2KD 5KAIE 3W68A 2DW3A 2WSFJ 3L74E 2OYIB 4QMAA 2E74D 5GTIH 1LTAC 1PZQA 5CMZA 5KJ7D 2NPSC 3H1KG 2WSFH 2I1KA 2QE7H 5KLVG 3OJAB 2WU5D 1LWUA 4EOTA 2IBZE 1QVFO 1XTCC 3VP9A 3VR9C 1AQ5A 4LDTA 1KF6D 2G3AA 3CC7P 4PD4D 5APQA 4JYBA 1FZFA 3TNUB 1PPJG 3AEED 3OW2O 1P84E 1OZHA 3P8CD 5CBOA 2R3SA 1BGYD 1JTHB 2K9JA 3CMAP 3LW5J 2J5UA 2KUBA 4DZOA 1BE3J 1OWAA 1FS0E 3I56P 3TDKA 2Y0DA 2P2UA 2Z5IA 2AEFA 1DEEG 3OA7A 1NHLA 1JY2N 2ACZC 1JY2O 2Y0EA 1Y9BA 2ZYGA 3MUDA 1PPJE 1WMKA 2ZXEB 1FU1A 3WMM0 1QL2A 3GW6A 2B89A 2IX7C 3VRBC 3AE2D 5AW1B 3VMZA 3CMEP 1NKZB 1YBKA 3IR9A 3P4RD 1L0NE 2A06G 2FXMA 1L4AA 4LGDE 4O9BA 2WPRA 5C39A 2B9BA 1NVOA 1CZQA 2A06D 3SWKA 1KB9I 4YTPC 2FXOA 1L0LE 1MZ9A 2N1TB 3RL0C 1VL2A 2B88A 1NJIQ 3RK2D 1GZLA 4PD4I 2XKMA 1ZMEC 3RK3B 1N2DC 2R5DA 2Q7CA 3L70J 2Q3IA 3KPEA 1ZR2A 1T3JA 3B5ND 2XNXA 1KILC 3H1JD 1BGYE 1JB0J 1YQ4D 4RESB 4WBAA 3BVHA 1NTZE 3QH9A 3CCVP 2WS3C 5AVXB 1NTMJ 1VQMP 4L73A 2H7HA 1NGMB 4YT0D 2C9NY 5KJ7A 3P4SD 3SSUA 1EXIA 1LWUC 3VMYA 2BASA 3PH0A 3KZIE 1UIIA 2A45G 4ASVA 3BCCE 1SQVE 4KT0J 3AE9D 2LKMA 2V4HA 4I2LC 1S5LH 2WDRD 1T8ZA 4K3AA 1NTMG 4YTND 4C7RA 1USEA 1Q81Q 3L72G 1K8AQ 5AVVB 3CXHI 4PJ0H 3CXHE 3P4QC 1EDKA 3A0HH 3HD7A 3VTPC 2J59M 3F89A 4N6JA 4CPGA 1SQQJ 2BEZF 2NPSB 1TU3F 2P10A 1K73Q 3AEEC 4YT0C 1GTWA 3TGUE 1SQQG 1NTME 5KAFE 1P84H 2YIUB 1M8OB 1AJYA 1FZEA 3D6YA 1DH3A 1LTIC 2MJZA 3MIWA 1NTZK 4JPZB 2FBWC 1JY3N 2K9JB 3Q2YA 1IFJA 1QEXA 1KZUB 3SFDC 1K04A 3VMAA 2QM8A 5APWA 1H89A 4ASWA 4PV1D 3F5HA 2W6BA 1XTGB 3RK3E 2KOGA 3U59A 2WDRC 3TSIA 3G4SP 1VQ7P 1W2EA 4NPDA 3RK3D 3H1IG 1E7PC 4DCKA 3RK2B 1GD2E 3EFGA 1KFNA 3H1LE 4H0LB 2E43A 5AW2B 3H1HD 3H1LD 2N1TD 2D2CD 3AE3C 1SQBD 4JQ0D 1SFCD 4HB1A 4YSXC 2HPCB 3H1HE 2ZT9C 1PGQA 4C7NB 1KF6C 3VR9D 1NU1G 3BASA 2B87B 4ZKUA 1M1KQ 3II6A 5CCHD 2ZYAA 3EFFK 3VP8A 2FY8A 3D6ZA 2E74C 4OGQB 5L8RJ 2OTLP 1ZV8A 3CX5D 1G1IA 1L0NG 1R5LA 3RK3C 1L4AC 1VF5C 1IFPA 3Q3DA 1RE3C 1NU1D 1BDCA 1EDJA 3ITKA 3L71G 1AFOA 2QJKC 2HODB 2WDQD 3FXDA 1LTJC 2ZFCA 4D6TE 1MV8A 3AE2C 5K5GB 5B66E 1RH5B 2SPZA 1VQ8P 2WDVD 1NEKC 4C7NA 1NKNA 1BGYG 3CWBE 4DJGA 2RMZA 1L2PA 2H8PD 1RF1C 5KLIB 2W27A 2W90A 1S1CX 1G2CB 1S9KD 3E1RA 2RH0A 3KHUA 4N78E 1R8EA 2M3BA 2UWJE 1RF0A 4PV1B 2GM4A 4U3FG 1YJNP 4W7YA 5AVZB 3R4YA 1HH0A 1LT9B 3Q1MA 5KLVJ 4U3FJ 5APSA 1S4XA 2KP8A 1PGOA 3HUSA 1DX7A 1SQQD 2KLUA 2C0WA 3CIRD 2Q3EA 3H1ID 1JMMA 1FZGA 1YTZI 4HJGH 1SQPK 1RF1A 3A5TA 2JJLA 2KZJA 1HJ0A 3HD7B 4XFJA 3L72D 3VRAD 2ZJSE 1EZVI 1OW6A 1Y8AA 3L73J 3P8MC 3AEBD 2IBZD 2YO3A 2IDBA 3FWLA 1OXZA 2PRRA 1X8YA 3RL0D 2IYOA 2K88A 1KYOE 3H1JE 4ZNCA 2KS1B 3GHGC 3AEAC 1KYOD 3MGNA 4L74A 3H6PA 1PP9D 2XV5A 1D7MA 2OYHB 1GL2B 1KFYC 5TISH 3GF7A 4KJMA 1SFCA 1Q82Q 3H1JG 3CXHH 1DEBA 1PV3A 2R32A 1N7SB 1NU1J 5TJHA 1T2KC 4EDFA 3H1IE 2FYNB 4IL6X 1Q2NA 1L4AB 1FJKA 4K35A 2P1JA 1SP4A 2KS1A 1IJDB 1L0ND 1SQBG 3GG2A 2WQYD 4I6MC 2Q6QA 2WMMA 1YIJP 1E5WA 2WPVB 3WUUA 3W67A 3TGUJ 1GU5A 2QJYB 3M9BA 5CJ0A 4A7PA 4UB8H 5APTA 3G6EP 3CCLP 3OAKA 3MZWB 4RO0A 4YSXD 1URQB 3AEAD 2ZVOB 1LP1B 2FYUD 2NPSD 1MFZA 3K5BA 1RF1B 1OVVA 3AE1C 1KORA 4I7ZB 2JO1A 3PHLA 3USSA 2AEJA 1KILA 1YQ4C 2Q1KA 3V5BA 1N7LA 3H1HJ 3E7KA 1CI6A 3L4FA 1N73B 3BCCG 4H0LC 1EQ7A 1PP9G 4WB4A 1AV1A 4PV1C 1IK7A 3L70G 1X79B 4AQRD 2FBWD 1OX3A 2KSJA 2FYUG 2ZT9B 3N7NA 1HUCA 3O6QA 1ZRTE 2BCCG 2A06E 1P84I 2XDJA 2AEMA 2BCCD 1BCCE 1NH4A 1SQVK 3SWYA 4YXDC 4U3FE 1L0LG 3TF5A 1MUUA 2M5AB 5B5EE 4IL6E 5KLVK 2E74B 2HODA 4OGQC 1MFTA 3HD7C 3Q5SA 2I8DA 4WY4C 2KIKA 3T97A 1RE4A 3WUVA 4WY4B 1L0NK 1VF5B 1KILB 3HE4B 2Y9ZA 1IFMA 2YKOA 1SQPJ 2ZYDA 2W6AA 2QJKB 2E76B 3CCEP 3P4SC 2ZXXA 3IF4A 3NXSA 1PIXA 3LW5H 5GTIE 1LTSC 3G71P 4MN4C 3VONA 4I1LA 3P4PC 3EWKA 3H1HG 3CC2P 2WSEH 1SQXG 1WRGA 3C1LA 3BCCD 1KTMA 1OW7A 3WU2H 3PJSK 1SFCC 2E76D 2N9BA 3JCUH 1K9MQ 1VF5D 2QIWA 2WPSA 1Q90D 1M57D 2R44A 3BRVB 3QWOC 2M8RA 1S9KE 3PLNA 2M5AA 2O01H 3TYYA 3TGUD 1AA0A 3VMXA 1QX8A 3HE4A 3TNUA 1KB9H 2WU2D 4YTMC 1GL2D 3HTKB 3L75G 1LT1A 2Z5HA 4DT0A 1HGVA 3L73G 3AEDD 1IO4A 1W5CE 4AUWA 2KNCA 5BU5A 2E5YA 1SQQE 3L37A 1FZBA 4D6TD 1JY2P 4YTMD 2PGDA 1LNQA 4BWNA 4EI2A 2WITA 2E75B 3O6QB 5AVWB 1CW5A 3B5NA 1SLQA 1BSNA 4U7JA 4BRYA 1JNMA 1OVRA 1KQLA 1VQ9P 2NPSA 3I55P 1FDOA 5CCHA 2KB7P 1QL1A 3FGAD 2PAJA 4JF7A 4N78D 3HUSB 1KYOH 3P8CE 5E79H 4OVNF 2I1JA 1FZCB 1GL2C 2JEEA 4EIJA 2P58A 2WWWA 5GTHE 1VQ6P 3V2QA 2OYHC 3BATA 1BCCJ 2ACZD 4L75A 3L36A 1KC8Q 1KILD 4IL6H 3GMAA 2FYNC 3C9IA 2O1KA 2WP9D 3AE4D 3AEGC 3VRAC 1KILE 3KZIH 2OYIC 4PD4H 2AXTE 4YPCA 3KXDA 2O3JA 3NFQA 2KI7B 2B76C 2E76C 3B71A 3L70E 3L74D 1SQXD 3AECD 1ZOYD 1NTKG 2W83C 5AW9B 2QJYC 4WY4A 1N7SA 1L0NJ 1S3JA 1YJ9P 3A7OA 2HPCA 5TISE 1URQC 3CWBJ 2GUSA 3AE7C 3D71A 1SQXJ 1LTGC 2NZ2A 3GF3A 1YHQP 4NPEA 2R3CA 5APVA 2OTKE 5AVTB 3CCUP 2IBZI 1OW8A 5C3JC 3SFED 1E79H 3Q5RA 2CK3H 1FC2C 1ZXGA 5AVYB 3H1KE 1NTKD 3RBXA 2JWAA 1NYHA 3AEGD 1NTMK 3AE9C 3VR8C 1S2EA 1N8RQ 1JEKA 4OGQD 1GMJA 1SQPG 2V7QJ 1GDTA 1NWQA 2Y0CA 3AE1D 2H88C 4HH2A 1W2BO 1LP1A 1VQ5P 1M7LA 4BXLA 1R5SA 1URQD 3H1IJ 2KXPB 1JCCA 1KQSO 3HE5A 2WSEJ 1VQLP 1Q7YQ 3FX0A 1VPCA 4I6LA 2N9YB 1SQXE 3Q5PA 1NTZG 4R4MA 1FOSF 1FOSE 2JWDA 4H13C 1T3UA 1USDA 1L0VD 4H13B 3PP5A 1YQ3C 1DD3A 2N1TC 3A2AA 2BCCJ 4HYTB 2WQYC 3CX5H 2W6JH 1AQTA 1JUNA 4WY4D 2YXQB 1N7SD 5M1BA 4W7ZA 1NTMD 1P84D 4H44B 2L91A 1PFIA 1PP9J 1JOCA 1IFIA 5E79E 5AW3B 1YTZT 4YTPD 2H43A 1HF9A 2YMYA 1KQFB 4WVZA 2PFXA 2OYIA 1NEKD 2WDVC 4PJ0E 1PP9E 3GHGB 1JY3O 5KTBA 2OGUA 1FZCA 1H88A 2VRSA 3AECC 2OTJP 5DJUB 2WDQC 2WU5C 4B86A 1ZN5A 2FFDA 2YXRB 1VDFA 5APYA 5KJ7C 1ZR4A 3L74G 3CCSP 3AEFC 2XU6A 1VQKP 1SVFA 3JCUE 1VQOP 1KB9D 1UIXA 4OH8B 3LIEA 4U3FD 3WUTA 2J58A 3CX5I 1NO4A 1ZRTD 2H89D 1GK4A 3GLMA 5AW4B 1KN7A 4GOFA 2IBZG 1LT9C 3U1AA 3PTZA 2E5TA 3CPWO 2BS2C 2KZIA 5C2TD 2HG5D 3CI9A 4W80A 1OMIA 4YSYC 2W8ZA 3BCCJ 1KYOI 4GT1A 2KNCB 5APXA 2KK7A 2R5BA 3L72J 2WT7A 5EFWB 4I7ZC 4LLHA 1HWTC 1X9VA 2B87A 1NTZJ 4R4LA 3V4WA 3E1IA 4TT3H 1NU1E 2K3RA 2KLVA 3MTUE 3RBZA 1LTTC 3VR8D 3AEFD 1LJ2A 3L35A 5AW7B 1EDIA 2QG4A 2JR8A 3MD0A 3HTKA 1QLBC 2WP9C 1U7JA 1G2CA 3M06A 2OQQA 3TGUG 1N73C 4HKZH 3KYQA 5KAFH 3AE5C 1PL5A 5B66H 1DIPA 1M90Q 5BVZA 1RY3A 2Y9YA 2K1AA 2QVAA 4IOIH 1N73A 2BCCE 3CLQA 3JSVC 5KKZC 3B8EB 2A45I 3P7KA 1ZOYC 3P32A 4YSZD 2IFNA 5AW0B 3L75E 4N3YB 2K37A 4DOJA 3I5CA 5KAIH 5GTHH 2B76D 3M9HA 1NAYA 1SQVJ 2IPPA 2LXCB 3B4SA 3JC22 3CX5E 5AVUB 3FWNA 4UB6H 3H1KJ 3AE8C 5AVRB 3G3ZA 5KLVE 1S72P 3AE6D 5CCGA 5CCGD 5AW6B 3L70D 4BRYB 1KFYD 2V7QH 3CL3D 4ZMDA 1NEND 2ZFYA 2ZAEB 1EXJA 1FDMA 3S1KA 3T97B 2C0XA 1EZVD 2O01J 1BGYJ 1GW4A 1SFCB 3IAOA 2K9YA 1FAVA 2YO2A 1BE3G 3B5NC 1U7MA 1GL2A 3CWBD 4H0LD 3B5NB 3AE4C 2AXTH 2CPBA 1NOHA 5AVQB 4Z1MH 4D6TG 2IZ0A 1KD1Q 3KQGA 3ZDMA 1X0TA 4YXDD 2QEXP 1YJWP 1NTKJ 2HYNA 2A45H 3A0HE 3FXEA 1VQ4P 2QRXA 3V2NA 2P67A 3G9RA 4D6TJ 4NPFX 3P4PD 2YIUC 1T6AA 3VOPA 1FE6A 5C2TC 1Q86Q 1YYCA 1FZAA 1ZLLA 3S9OA 1S5LX 2WU2C 2WSSH 1JCDA 5AW8B 4YXWH 1LGHB 1OVUA 1BCCG 3EQ2A 1J1DB 1ZW0A 4Y99C 1IC2A 3L75J 1X22A 1Y47A 5B5EH 3V4QA 1K05A 1FJPA 1IK9A 1GK6A 1OIPA 4PD4E 4H44C 4DDIA 1RQVA 2O1JA 1URQA 3L71J 3H25A 1MKMA 1RE3A 3CIRC 3HUSC 2QSIA 3H1LJ 1LTJA 3H1KD 2IFMA 1SQVG 5CCGC 3GHGA 1FBMA 1S5LE 3IFMA 1KQGB 5H2FE 1SS1A 3NTNA 2FFDB 2D2CB 2WZ7A 4C46A 2BS3C 1SQPD 1PPJD 1KMIZ 4GIFA 4GODA 2OYOA 4H44D 3AE5D 1N7SC 1SQQK 3H32A 2XNDH 3NMDA 5AVSB 4YTNC 4XA4A 1KB9E 5C3JD 1AVYA 1RQUA 4DDGA 4H13D 4JBZA 3U1CA 4WWIA 2KYVA 3CD6P 1NAFA 1LTJB 3AE7D 3ABVC 3CCQP 2LXBA 2JDIH 1RF0C 2RN0A 5H2FH 3AEDC 3L74J 1U57A 3SWFA 2L5GB 1G1JA 1PGJA 2AXCA 2WS3D 3VN0A 3P4RC 2JP3A 3RL0g 1YI2P 3M9QA 2WSCH 2O01N 1JM0A 1N86A 1IFDA 1VQNP 3UIAA 3VYIA 1JMBA 2IZ1A
chains in the Genus database with same CATH topology
1NEKD 2WDVC 4U7JA 2JO1A 1NEKC 2WDVD 3AEED 3AEBC 4Y28J 2O01J 4H44C 1L0VC 1RQVA 1YQ4C 2G8YA 1E7PC 1QLBC 2WP9C 1OW8A 2K9YA 3EWKA 3IAOA 2WS3C 3P4PC 3H25A 5C3JC 2WSCJ 2OQQA 3LW5J 1FDOA 3SFED 1NGMB 1MKMA 2J5UA 4H0LB 3Q5RA 3AEAC 4YT0D 3CIRC 3AECC 1KTMA 1OW7A 3AE5C 4H0LD 4RKUJ 4H0LC 1PL5A 3FGAD 5KLIC 3P4SD 2D2CC 2D2CD 1ZP0C 1DIPA 1NENC 1NYHA 2YMKA 1S1CX 3AE3C 4PV1C 2BS4C 3AE4C 2WU5C 2E76D 2QSIA 1EXIA 2H89C 3AE9C 2ACZC 3VR8C 4KX6D 1Y9BA 2QJPC 4KX6C 4YSXC 1IK7A 4OGQD 1GMJA 2ZT9C 1KF6C 1KQGB 4Z1MH 1KFYC 1YQ3D 2V7QJ 2FBWD 4YSYD 1R8EA 1WMKA 2ZT9B 3GF7A 1VF5D 2D2CB 2QIWA 4KT0J 1DD4A 3AE9D 1FDIA 1Q90D 4PV1B 2E75D 2H88C 3AE1D 2BS3C 3VR9D 3AEFC 2WDRD 2FXPA 1KMIZ 3O6QA 5KKZC 4YXDD 1ZRTE 4H44D 4YTND 3R4YA 2BEQD 3AE5D 1ZOYC 3D70A 3Q1MA 3VRBC 1UIXA 4YSZD 3AE2D 3ABVD 1PV3A 3AE3D 3C8VA 2ACZD 2H89D 3P4QC 3P4RD 2WSEJ 4IL6X 3GLMA 4YTNC 2ZT9D 3G9RA 4YXDC 2WU2D 3GMAA 4YTMC 2FYNC 4YSZC 3D6ZA 2BEZF 2E74C 2B76D 1TU3F 2WP9D 2YIUC 3AE4D 3P4PD 3AEGC 3AE6C 4OGQB 3Q5PA 3VRAC 2P10A 4R4MA 4YTPC 1KILE 2WQYD 2BS2C 2E74B 5C3JD 5L8RJ 2H88D 4H13C 1RQUA 3AEDD 4H13D 5C2TD 5C2TC 4OGQC 2WSFJ 3CIRD 3AEEC 4YT0C 3S9OA 3Q5SA 1S5LX 1L0VD 4H13B 2WU2C 1OMIA 4I7ZB 4YSYC 1YQ3C 2E74D 1DD3A 2B76C 1VF5C 1VL2A 3AE7D 3ABVC 3IN6A 2E76C 3B71A 1AJYA 2WPVB 3Q3DA 2WQYC 1VF5B 3D6YA 3AEDC 1U57A 3AECD 3AE8D 3AE8C 1ZMEC 3VRBD 4YTMD 1ZOYD 1HJ0A 2MKVA 2QJKC 2FBWC 2QJYC 5M1BA 4GDOA 4XFJA 2WU5D 1ZP0D 2WDQD 3VRAD 2WS3D 2WDQC 3AE6D 4I7ZC 2E76B 3P4RC 1OW6A 3P4QD 3Q2YA 4YSXD 2JP3A 3AEGD 3VR9C 3RL0g 3AEAD 3AEFD 4H44B 3SFDD 4R4LA 3SFDC 3AEBD 1K04A 1KFYD 4TT3H 1JB0J 1KF6D 2G3AA 1YQ4D 3P4SC 2E75B 3AE2C 4PV1D 1NEND 1K05A 3AE7C 2IDBA 3RK3E 1EXJA 4YTPD 3D71A 3T97B 2E75C 3AE1C 1HF9A 1KORA 2NZ2A 3VR8D 3GF3A 1KQFB 3SFEC 2WDRC 1PIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK D;  2WDV C;  1NEK C;  2WDV D;  3AEE D;  3AEB C;  1L0V C;  1E7P C;  1YQ4 C;  1QLB C;  2WP9 C;  1OW8 A;  2WS3 C;  3P4P C;  5C3J C;  3SFE D;  3AEA C;  4YT0 D;  3CIR C;  3AEC C;  1KTM A;  1OW7 A;  3AE5 C;  3P4S D;  1ZP0 C;  2BS4 C;  1NEN C;  2WDQ C;  3AE3 C;  2WU5 C;  3AEG D;  3AE4 C;  2H89 C;  3AE9 C;  2ACZ C;  3VR8 C;  4KX6 D;  4KX6 C;  4YSX C;  1KF6 C;  1KFY C;  1YQ3 D;  2FBW D;  4YSY D;  3AE9 D;  3AE1 D;  2H88 C;  2BS3 C;  3VR9 D;  3AEF C;  2WDR D;  4YXD D;  4YTN D;  3AE5 D;  1ZOY C;  3VRB C;  4YSZ D;  3AE2 D;  3ABV D;  1PV3 A;  3AE3 D;  2ACZ D;  2H89 D;  3P4Q C;  3P4R D;  4YTN C;  4YXD C;  2WU2 D;  4YTM C;  4YSZ C;  2B76 D;  2WP9 D;  3P4P D;  3AE4 D;  3AEG C;  3AE6 C;  3VRA C;  4YTP C;  5C3J D;  2WQY D;  2BS2 C;  2H88 D;  5C2T D;  3AED D;  5C2T C;  3CIR D;  3AEE C;  4YT0 C;  3S9O A;  2WU2 C;  1L0V D;  4YSY C;  1YQ3 C;  2B76 C;  3AE7 D;  3ABV C;  3B71 A;  2WQY C;  3AED C;  3AEC D;  3AE8 D;  3AE8 C;  3VRB D;  4YTM D;  1ZOY D;  2FBW C;  2WU5 D;  1ZP0 D;  2WDQ D;  3VRA D;  2WS3 D;  3AE6 D;  3P4R C;  1OW6 A;  3P4Q D;  4YSX D;  3VR9 C;  3AEA D;  3AEF D;  3SFD D;  3SFD C;  3AEB D;  1K04 A;  1KFY D;  1KF6 D;  2G3A A;  1YQ4 D;  3P4S C;  3AE2 C;  1NEN D;  1K05 A;  3AE7 C;  4YTP D;  3AE1 C;  3VR8 D;  3SFE C;  2WDR C; 
#chains in the Genus database with same CATH topology
 3AEB C;  2WTY A;  2G8Y A;  3BRT B;  3M0D A;  4GOE A;  3CCR P;  2NRG A;  4GKG A;  4DHJ A;  4IFD K;  2WSC J;  2ZVN B;  1NTZ D;  3RK2 C;  2Q9I A;  1GU4 A;  2FYU J;  2IYP A;  2M3E A;  1GW3 A;  1ZP0 C;  1SQP E;  4OWF A;  2QJP C;  1BE3 E;  5CCH C;  2POH A;  2QJP B;  1YQ3 D;  1TFF A;  3RGU A;  1NTK K;  3MHV A;  5APU A;  2WT7 B;  2FXP A;  2RKL A;  1HTL C;  3M91 A;  3CXH D;  2BEQ D;  1BCC D;  3D70 A;  1IZN B;  5BU8 B;  2LR2 A;  3ABV D;  2C9L Y;  1L0L D;  2WPQ A;  3C8V A;  1Z56 A;  3LID A;  2ZT9 D;  5KKZ B;  3R2P A;  1SQB K;  1KFM A;  5DJT B;  3AE6 C;  1J2J B;  2XZR A;  4TLF A;  5CHX A;  3L75 D;  2H88 D;  4EYY Q;  2CPS A;  3MUD C;  4UB6 E;  1BSH A;  1H0T B;  2KSE A;  1L0L J;  1OFC X;  3IN6 A;  3H32 B;  4Y99 B;  1HBW A;  2FYU E;  2P7J A;  3CCM P;  1M1J A;  2MKV A;  3L71 D;  1QGK B;  4ZKP A;  3A3Y B;  2GUV A;  3L71 E;  3SFD D;  1IFN A;  2WVR A;  5CBN A;  4Y28 J;  3HE5 B;  3KDP B;  2HFE D;  2FKW B;  1BE3 D;  3CCJ P;  3V2R A;  3HRN A;  1YIT P;  4FJV A;  2YKP A;  2M0B A;  1SQV D;  1HVV A;  4RKU J;  5KLI C;  3CWB G;  2D2C C;  2YMK A;  4RJT A;  2H89 C;  3S4R A;  4DHZ A;  2JKV A;  1JY3 P;  3H1L G;  2YNY A;  1SQB E;  2FYU K;  1RE4 C;  3M0A A;  4JYC A;  1DD4 A;  3MP7 B;  4L76 A;  2PP6 A;  2E75 D;  2YKQ A;  1A02 F;  3TK1 A;  3O8Z A;  3N4X A;  1QVG O;  1PGP A;  1EC5 A;  2FYZ A;  2N1T A;  2Z4E A;  4YSZ C;  2OAR A;  4AYC A;  3V2P A;  3A0B E;  5AW5 B;  2E42 A;  3WU2 E;  4LC1 A;  1SQB J;  2HR3 A;  3CC4 P;  4UB8 E;  1HJB A;  5KLV D;  2GA1 A;  3AE8 D;  3VRB D;  3RL0 B;  1L0L K;  4KHX A;  3V6I A;  4GDO A;  4M3L A;  1ZP0 D;  1EDL A;  1J1D C;  3P4Q D;  1RHZ B;  3H1J J;  2QA4 P;  3M0D C;  1J1E B;  2E75 C;  3SFE C;  4IFM A;  3L72 E;  1J1E C;  1A02 J;  4DHI B;  3PRJ A;  2ITA A;  1M56 D;  1L0V C;  3HD7 D;  3A0B H;  3L73 E;  1LTB C;  1EZV E;  1SQX K;  1KV4 A;  2HLO A;  3L73 D;  1CI6 B;  1BDD A;  1M1J C;  1AVO A;  5CJ4 A;  1NEN C;  2BS4 C;  1QLE D;  1HGZ A;  4KX6 D;  1VQP P;  4KX6 C;  1M1J B;  4XE5 B;  1FZC C;  2Q5U A;  4IFF A;  4YSY D;  1H8A A;  1FDI A;  1JTH A;  1NTK E;  1LWU B;  2FFD C;  1H0T A;  1CSB A;  1EZV G;  1LT9 A;  1JO5 A;  3AE3 D;  1L4A D;  2OYH A;  1NU1 K;  2QM7 A;  1WT6 A;  1T2K D;  5KAI E;  3W68 A;  2DW3 A;  2WSF J;  3L74 E;  2OYI B;  4QMA A;  2E74 D;  5GTI H;  1LTA C;  1PZQ A;  5CMZ A;  5KJ7 D;  2NPS C;  3H1K G;  2WSF H;  2I1K A;  2QE7 H;  5KLV G;  3OJA B;  2WU5 D;  1LWU A;  4EOT A;  2IBZ E;  1QVF O;  1XTC C;  3VP9 A;  3VR9 C;  1AQ5 A;  4LDT A;  1KF6 D;  2G3A A;  3CC7 P;  4PD4 D;  5APQ A;  4JYB A;  1FZF A;  3TNU B;  1PPJ G;  3AEE D;  3OW2 O;  1P84 E;  1OZH A;  3P8C D;  5CBO A;  2R3S A;  1BGY D;  1JTH B;  2K9J A;  3CMA P;  3LW5 J;  2J5U A;  2KUB A;  4DZO A;  1BE3 J;  1OWA A;  1FS0 E;  3I56 P;  3TDK A;  2Y0D A;  2P2U A;  2Z5I A;  2AEF A;  1DEE G;  3OA7 A;  1NHL A;  1JY2 N;  2ACZ C;  1JY2 O;  2Y0E A;  1Y9B A;  2ZYG A;  3MUD A;  1PPJ E;  1WMK A;  2ZXE B;  1FU1 A;  3WMM 0;  1QL2 A;  3GW6 A;  2B89 A;  2IX7 C;  3VRB C;  3AE2 D;  5AW1 B;  3VMZ A;  3CME P;  1NKZ B;  1YBK A;  3IR9 A;  3P4R D;  1L0N E;  2A06 G;  2FXM A;  1L4A A;  4LGD E;  4O9B A;  2WPR A;  5C39 A;  2B9B A;  1NVO A;  1CZQ A;  2A06 D;  3SWK A;  1KB9 I;  4YTP C;  2FXO A;  1L0L E;  1MZ9 A;  2N1T B;  3RL0 C;  1VL2 A;  2B88 A;  1NJI Q;  3RK2 D;  1GZL A;  4PD4 I;  2XKM A;  1ZME C;  3RK3 B;  1N2D C;  2R5D A;  2Q7C A;  3L70 J;  2Q3I A;  3KPE A;  1ZR2 A;  1T3J A;  3B5N D;  2XNX A;  1KIL C;  3H1J D;  1BGY E;  1JB0 J;  1YQ4 D;  4RES B;  4WBA A;  3BVH A;  1NTZ E;  3QH9 A;  3CCV P;  2WS3 C;  5AVX B;  1NTM J;  1VQM P;  4L73 A;  2H7H A;  1NGM B;  4YT0 D;  2C9N Y;  5KJ7 A;  3P4S D;  3SSU A;  1EXI A;  1LWU C;  3VMY A;  2BAS A;  3PH0 A;  3KZI E;  1UII A;  2A45 G;  4ASV A;  3BCC E;  1SQV E;  4KT0 J;  3AE9 D;  2LKM A;  2V4H A;  4I2L C;  1S5L H;  2WDR D;  1T8Z A;  4K3A A;  1NTM G;  4YTN D;  4C7R A;  1USE A;  1Q81 Q;  3L72 G;  1K8A Q;  5AVV B;  3CXH I;  4PJ0 H;  3CXH E;  3P4Q C;  1EDK A;  3A0H H;  3HD7 A;  3VTP C;  2J59 M;  3F89 A;  4N6J A;  4CPG A;  1SQQ J;  2BEZ F;  2NPS B;  1TU3 F;  2P10 A;  1K73 Q;  3AEE C;  4YT0 C;  1GTW A;  3TGU E;  1SQQ G;  1NTM E;  5KAF E;  1P84 H;  2YIU B;  1M8O B;  1AJY A;  1FZE A;  3D6Y A;  1DH3 A;  1LTI C;  2MJZ A;  3MIW A;  1NTZ K;  4JPZ B;  2FBW C;  1JY3 N;  2K9J B;  3Q2Y A;  1IFJ A;  1QEX A;  1KZU B;  3SFD C;  1K04 A;  3VMA A;  2QM8 A;  5APW A;  1H89 A;  4ASW A;  4PV1 D;  3F5H A;  2W6B A;  1XTG B;  3RK3 E;  2KOG A;  3U59 A;  2WDR C;  3TSI A;  3G4S P;  1VQ7 P;  1W2E A;  4NPD A;  3RK3 D;  3H1I G;  1E7P C;  4DCK A;  3RK2 B;  1GD2 E;  3EFG A;  1KFN A;  3H1L E;  4H0L B;  2E43 A;  5AW2 B;  3H1H D;  3H1L D;  2N1T D;  2D2C D;  3AE3 C;  1SQB D;  4JQ0 D;  1SFC D;  4HB1 A;  4YSX C;  2HPC B;  3H1H E;  2ZT9 C;  1PGQ A;  4C7N B;  1KF6 C;  3VR9 D;  1NU1 G;  3BAS A;  2B87 B;  4ZKU A;  1M1K Q;  3II6 A;  5CCH D;  2ZYA A;  3EFF K;  3VP8 A;  2FY8 A;  3D6Z A;  2E74 C;  4OGQ B;  5L8R J;  2OTL P;  1ZV8 A;  3CX5 D;  1G1I A;  1L0N G;  1R5L A;  3RK3 C;  1L4A C;  1VF5 C;  1IFP A;  3Q3D A;  1RE3 C;  1NU1 D;  1BDC A;  1EDJ A;  3ITK A;  3L71 G;  1AFO A;  2QJK C;  2HOD B;  2WDQ D;  3FXD A;  1LTJ C;  2ZFC A;  4D6T E;  1MV8 A;  3AE2 C;  5K5G B;  5B66 E;  1RH5 B;  2SPZ A;  1VQ8 P;  2WDV D;  1NEK C;  4C7N A;  1NKN A;  1BGY G;  3CWB E;  4DJG A;  2RMZ A;  1L2P A;  2H8P D;  1RF1 C;  5KLI B;  2W27 A;  2W90 A;  1S1C X;  1G2C B;  1S9K D;  3E1R A;  2RH0 A;  3KHU A;  4N78 E;  1R8E A;  2M3B A;  2UWJ E;  1RF0 A;  4PV1 B;  2GM4 A;  4U3F G;  1YJN P;  4W7Y A;  5AVZ B;  3R4Y A;  1HH0 A;  1LT9 B;  3Q1M A;  5KLV J;  4U3F J;  5APS A;  1S4X A;  2KP8 A;  1PGO A;  3HUS A;  1DX7 A;  1SQQ D;  2KLU A;  2C0W A;  3CIR D;  2Q3E A;  3H1I D;  1JMM A;  1FZG A;  1YTZ I;  4HJG H;  1SQP K;  1RF1 A;  3A5T A;  2JJL A;  2KZJ A;  1HJ0 A;  3HD7 B;  4XFJ A;  3L72 D;  3VRA D;  2ZJS E;  1EZV I;  1OW6 A;  1Y8A A;  3L73 J;  3P8M C;  3AEB D;  2IBZ D;  2YO3 A;  2IDB A;  3FWL A;  1OXZ A;  2PRR A;  1X8Y A;  3RL0 D;  2IYO A;  2K88 A;  1KYO E;  3H1J E;  4ZNC A;  2KS1 B;  3GHG C;  3AEA C;  1KYO D;  3MGN A;  4L74 A;  3H6P A;  1PP9 D;  2XV5 A;  1D7M A;  2OYH B;  1GL2 B;  1KFY C;  5TIS H;  3GF7 A;  4KJM A;  1SFC A;  1Q82 Q;  3H1J G;  3CXH H;  1DEB A;  1PV3 A;  2R32 A;  1N7S B;  1NU1 J;  5TJH A;  1T2K C;  4EDF A;  3H1I E;  2FYN B;  4IL6 X;  1Q2N A;  1L4A B;  1FJK A;  4K35 A;  2P1J A;  1SP4 A;  2KS1 A;  1IJD B;  1L0N D;  1SQB G;  3GG2 A;  2WQY D;  4I6M C;  2Q6Q A;  2WMM A;  1YIJ P;  1E5W A;  2WPV B;  3WUU A;  3W67 A;  3TGU J;  1GU5 A;  2QJY B;  3M9B A;  5CJ0 A;  4A7P A;  4UB8 H;  5APT A;  3G6E P;  3CCL P;  3OAK A;  3MZW B;  4RO0 A;  4YSX D;  1URQ B;  3AEA D;  2ZVO B;  1LP1 B;  2FYU D;  2NPS D;  1MFZ A;  3K5B A;  1RF1 B;  1OVV A;  3AE1 C;  1KOR A;  4I7Z B;  2JO1 A;  3PHL A;  3USS A;  2AEJ A;  1KIL A;  1YQ4 C;  2Q1K A;  3V5B A;  1N7L A;  3H1H J;  3E7K A;  1CI6 A;  3L4F A;  1N73 B;  3BCC G;  4H0L C;  1EQ7 A;  1PP9 G;  4WB4 A;  1AV1 A;  4PV1 C;  1IK7 A;  3L70 G;  1X79 B;  4AQR D;  2FBW D;  1OX3 A;  2KSJ A;  2FYU G;  2ZT9 B;  3N7N A;  1HUC A;  3O6Q A;  1ZRT E;  2BCC G;  2A06 E;  1P84 I;  2XDJ A;  2AEM A;  2BCC D;  1BCC E;  1NH4 A;  1SQV K;  3SWY A;  4YXD C;  4U3F E;  1L0L G;  3TF5 A;  1MUU A;  2M5A B;  5B5E E;  4IL6 E;  5KLV K;  2E74 B;  2HOD A;  4OGQ C;  1MFT A;  3HD7 C;  3Q5S A;  2I8D A;  4WY4 C;  2KIK A;  3T97 A;  1RE4 A;  3WUV A;  4WY4 B;  1L0N K;  1VF5 B;  1KIL B;  3HE4 B;  2Y9Z A;  1IFM A;  2YKO A;  1SQP J;  2ZYD A;  2W6A A;  2QJK B;  2E76 B;  3CCE P;  3P4S C;  2ZXX A;  3IF4 A;  3NXS A;  1PIX A;  3LW5 H;  5GTI E;  1LTS C;  3G71 P;  4MN4 C;  3VON A;  4I1L A;  3P4P C;  3EWK A;  3H1H G;  3CC2 P;  2WSE H;  1SQX G;  1WRG A;  3C1L A;  3BCC D;  1KTM A;  1OW7 A;  3WU2 H;  3PJS K;  1SFC C;  2E76 D;  2N9B A;  3JCU H;  1K9M Q;  1VF5 D;  2QIW A;  2WPS A;  1Q90 D;  1M57 D;  2R44 A;  3BRV B;  3QWO C;  2M8R A;  1S9K E;  3PLN A;  2M5A A;  2O01 H;  3TYY A;  3TGU D;  1AA0 A;  3VMX A;  1QX8 A;  3HE4 A;  3TNU A;  1KB9 H;  2WU2 D;  4YTM C;  1GL2 D;  3HTK B;  3L75 G;  1LT1 A;  2Z5H A;  4DT0 A;  1HGV A;  3L73 G;  3AED D;  1IO4 A;  1W5C E;  4AUW A;  2KNC A;  5BU5 A;  2E5Y A;  1SQQ E;  3L37 A;  1FZB A;  4D6T D;  1JY2 P;  4YTM D;  2PGD A;  1LNQ A;  4BWN A;  4EI2 A;  2WIT A;  2E75 B;  3O6Q B;  5AVW B;  1CW5 A;  3B5N A;  1SLQ A;  1BSN A;  4U7J A;  4BRY A;  1JNM A;  1OVR A;  1KQL A;  1VQ9 P;  2NPS A;  3I55 P;  1FDO A;  5CCH A;  2KB7 P;  1QL1 A;  3FGA D;  2PAJ A;  4JF7 A;  4N78 D;  3HUS B;  1KYO H;  3P8C E;  5E79 H;  4OVN F;  2I1J A;  1FZC B;  1GL2 C;  2JEE A;  4EIJ A;  2P58 A;  2WWW A;  5GTH E;  1VQ6 P;  3V2Q A;  2OYH C;  3BAT A;  1BCC J;  2ACZ D;  4L75 A;  3L36 A;  1KC8 Q;  1KIL D;  4IL6 H;  3GMA A;  2FYN C;  3C9I A;  2O1K A;  2WP9 D;  3AE4 D;  3AEG C;  3VRA C;  1KIL E;  3KZI H;  2OYI C;  4PD4 H;  2AXT E;  4YPC A;  3KXD A;  2O3J A;  3NFQ A;  2KI7 B;  2B76 C;  2E76 C;  3B71 A;  3L70 E;  3L74 D;  1SQX D;  3AEC D;  1ZOY D;  1NTK G;  2W83 C;  5AW9 B;  2QJY C;  4WY4 A;  1N7S A;  1L0N J;  1S3J A;  1YJ9 P;  3A7O A;  2HPC A;  5TIS E;  1URQ C;  3CWB J;  2GUS A;  3AE7 C;  3D71 A;  1SQX J;  1LTG C;  2NZ2 A;  3GF3 A;  1YHQ P;  4NPE A;  2R3C A;  5APV A;  2OTK E;  5AVT B;  3CCU P;  2IBZ I;  1OW8 A;  5C3J C;  3SFE D;  1E79 H;  3Q5R A;  2CK3 H;  1FC2 C;  1ZXG A;  5AVY B;  3H1K E;  1NTK D;  3RBX A;  2JWA A;  1NYH A;  3AEG D;  1NTM K;  3AE9 C;  3VR8 C;  1S2E A;  1N8R Q;  1JEK A;  4OGQ D;  1GMJ A;  1SQP G;  2V7Q J;  1GDT A;  1NWQ A;  2Y0C A;  3AE1 D;  2H88 C;  4HH2 A;  1W2B O;  1LP1 A;  1VQ5 P;  1M7L A;  4BXL A;  1R5S A;  1URQ D;  3H1I J;  2KXP B;  1JCC A;  1KQS O;  3HE5 A;  2WSE J;  1VQL P;  1Q7Y Q;  3FX0 A;  1VPC A;  4I6L A;  2N9Y B;  1SQX E;  3Q5P A;  1NTZ G;  4R4M A;  1FOS F;  1FOS E;  2JWD A;  4H13 C;  1T3U A;  1USD A;  1L0V D;  4H13 B;  3PP5 A;  1YQ3 C;  1DD3 A;  2N1T C;  3A2A A;  2BCC J;  4HYT B;  2WQY C;  3CX5 H;  2W6J H;  1AQT A;  1JUN A;  4WY4 D;  2YXQ B;  1N7S D;  5M1B A;  4W7Z A;  1NTM D;  1P84 D;  4H44 B;  2L91 A;  1PFI A;  1PP9 J;  1JOC A;  1IFI A;  5E79 E;  5AW3 B;  1YTZ T;  4YTP D;  2H43 A;  1HF9 A;  2YMY A;  1KQF B;  4WVZ A;  2PFX A;  2OYI A;  1NEK D;  2WDV C;  4PJ0 E;  1PP9 E;  3GHG B;  1JY3 O;  5KTB A;  2OGU A;  1FZC A;  1H88 A;  2VRS A;  3AEC C;  2OTJ P;  5DJU B;  2WDQ C;  2WU5 C;  4B86 A;  1ZN5 A;  2FFD A;  2YXR B;  1VDF A;  5APY A;  5KJ7 C;  1ZR4 A;  3L74 G;  3CCS P;  3AEF C;  2XU6 A;  1VQK P;  1SVF A;  3JCU E;  1VQO P;  1KB9 D;  1UIX A;  4OH8 B;  3LIE A;  4U3F D;  3WUT A;  2J58 A;  3CX5 I;  1NO4 A;  1ZRT D;  2H89 D;  1GK4 A;  3GLM A;  5AW4 B;  1KN7 A;  4GOF A;  2IBZ G;  1LT9 C;  3U1A A;  3PTZ A;  2E5T A;  3CPW O;  2BS2 C;  2KZI A;  5C2T D;  2HG5 D;  3CI9 A;  4W80 A;  1OMI A;  4YSY C;  2W8Z A;  3BCC J;  1KYO I;  4GT1 A;  2KNC B;  5APX A;  2KK7 A;  2R5B A;  3L72 J;  2WT7 A;  5EFW B;  4I7Z C;  4LLH A;  1HWT C;  1X9V A;  2B87 A;  1NTZ J;  4R4L A;  3V4W A;  3E1I A;  4TT3 H;  1NU1 E;  2K3R A;  2KLV A;  3MTU E;  3RBZ A;  1LTT C;  3VR8 D;  3AEF D;  1LJ2 A;  3L35 A;  5AW7 B;  1EDI A;  2QG4 A;  2JR8 A;  3MD0 A;  3HTK A;  1QLB C;  2WP9 C;  1U7J A;  1G2C A;  3M06 A;  2OQQ A;  3TGU G;  1N73 C;  4HKZ H;  3KYQ A;  5KAF H;  3AE5 C;  1PL5 A;  5B66 H;  1DIP A;  1M90 Q;  5BVZ A;  1RY3 A;  2Y9Y A;  2K1A A;  2QVA A;  4IOI H;  1N73 A;  2BCC E;  3CLQ A;  3JSV C;  5KKZ C;  3B8E B;  2A45 I;  3P7K A;  1ZOY C;  3P32 A;  4YSZ D;  2IFN A;  5AW0 B;  3L75 E;  4N3Y B;  2K37 A;  4DOJ A;  3I5C A;  5KAI H;  5GTH H;  2B76 D;  3M9H A;  1NAY A;  1SQV J;  2IPP A;  2LXC B;  3B4S A;  3JC2 2;  3CX5 E;  5AVU B;  3FWN A;  4UB6 H;  3H1K J;  3AE8 C;  5AVR B;  3G3Z A;  5KLV E;  1S72 P;  3AE6 D;  5CCG A;  5CCG D;  5AW6 B;  3L70 D;  4BRY B;  1KFY D;  2V7Q H;  3CL3 D;  4ZMD A;  1NEN D;  2ZFY A;  2ZAE B;  1EXJ A;  1FDM A;  3S1K A;  3T97 B;  2C0X A;  1EZV D;  2O01 J;  1BGY J;  1GW4 A;  1SFC B;  3IAO A;  2K9Y A;  1FAV A;  2YO2 A;  1BE3 G;  3B5N C;  1U7M A;  1GL2 A;  3CWB D;  4H0L D;  3B5N B;  3AE4 C;  2AXT H;  2CPB A;  1NOH A;  5AVQ B;  4Z1M H;  4D6T G;  2IZ0 A;  1KD1 Q;  3KQG A;  3ZDM A;  1X0T A;  4YXD D;  2QEX P;  1YJW P;  1NTK J;  2HYN A;  2A45 H;  3A0H E;  3FXE A;  1VQ4 P;  2QRX A;  3V2N A;  2P67 A;  3G9R A;  4D6T J;  4NPF X;  3P4P D;  2YIU C;  1T6A A;  3VOP A;  1FE6 A;  5C2T C;  1Q86 Q;  1YYC A;  1FZA A;  1ZLL A;  3S9O A;  1S5L X;  2WU2 C;  2WSS H;  1JCD A;  5AW8 B;  4YXW H;  1LGH B;  1OVU A;  1BCC G;  3EQ2 A;  1J1D B;  1ZW0 A;  4Y99 C;  1IC2 A;  3L75 J;  1X22 A;  1Y47 A;  5B5E H;  3V4Q A;  1K05 A;  1FJP A;  1IK9 A;  1GK6 A;  1OIP A;  4PD4 E;  4H44 C;  4DDI A;  1RQV A;  2O1J A;  1URQ A;  3L71 J;  3H25 A;  1MKM A;  1RE3 A;  3CIR C;  3HUS C;  2QSI A;  3H1L J;  1LTJ A;  3H1K D;  2IFM A;  1SQV G;  5CCG C;  3GHG A;  1FBM A;  1S5L E;  3IFM A;  1KQG B;  5H2F E;  1SS1 A;  3NTN A;  2FFD B;  2D2C B;  2WZ7 A;  4C46 A;  2BS3 C;  1SQP D;  1PPJ D;  1KMI Z;  4GIF A;  4GOD A;  2OYO A;  4H44 D;  3AE5 D;  1N7S C;  1SQQ K;  3H32 A;  2XND H;  3NMD A;  5AVS B;  4YTN C;  4XA4 A;  1KB9 E;  5C3J D;  1AVY A;  1RQU A;  4DDG A;  4H13 D;  4JBZ A;  3U1C A;  4WWI A;  2KYV A;  3CD6 P;  1NAF A;  1LTJ B;  3AE7 D;  3ABV C;  3CCQ P;  2LXB A;  2JDI H;  1RF0 C;  2RN0 A;  5H2F H;  3AED C;  3L74 J;  1U57 A;  3SWF A;  2L5G B;  1G1J A;  1PGJ A;  2AXC A;  2WS3 D;  3VN0 A;  3P4R C;  2JP3 A;  3RL0 g;  1YI2 P;  3M9Q A;  2WSC H;  2O01 N;  1JM0 A;  1N86 A;  1IFD A;  1VQN P;  3UIA A;  3VYI A;  1JMB A;  2IZ1 A; 
#chains in the Genus database with same CATH homology
 1NEK D;  2WDV C;  4U7J A;  2JO1 A;  1NEK C;  2WDV D;  3AEE D;  3AEB C;  4Y28 J;  2O01 J;  4H44 C;  1L0V C;  1RQV A;  1YQ4 C;  2G8Y A;  1E7P C;  1QLB C;  2WP9 C;  1OW8 A;  2K9Y A;  3EWK A;  3IAO A;  2WS3 C;  3P4P C;  3H25 A;  5C3J C;  2WSC J;  2OQQ A;  3LW5 J;  1FDO A;  3SFE D;  1NGM B;  1MKM A;  2J5U A;  4H0L B;  3Q5R A;  3AEA C;  4YT0 D;  3CIR C;  3AEC C;  1KTM A;  1OW7 A;  3AE5 C;  4H0L D;  4RKU J;  4H0L C;  1PL5 A;  3FGA D;  5KLI C;  3P4S D;  2D2C C;  2D2C D;  1ZP0 C;  1DIP A;  1NEN C;  1NYH A;  2YMK A;  1S1C X;  3AE3 C;  4PV1 C;  2BS4 C;  3AE4 C;  2WU5 C;  2E76 D;  2QSI A;  1EXI A;  2H89 C;  3AE9 C;  2ACZ C;  3VR8 C;  4KX6 D;  1Y9B A;  2QJP C;  4KX6 C;  4YSX C;  1IK7 A;  4OGQ D;  1GMJ A;  2ZT9 C;  1KF6 C;  1KQG B;  4Z1M H;  1KFY C;  1YQ3 D;  2V7Q J;  2FBW D;  4YSY D;  1R8E A;  1WMK A;  2ZT9 B;  3GF7 A;  1VF5 D;  2D2C B;  2QIW A;  4KT0 J;  1DD4 A;  3AE9 D;  1FDI A;  1Q90 D;  4PV1 B;  2E75 D;  2H88 C;  3AE1 D;  2BS3 C;  3VR9 D;  3AEF C;  2WDR D;  2FXP A;  1KMI Z;  3O6Q A;  5KKZ C;  4YXD D;  1ZRT E;  4H44 D;  4YTN D;  3R4Y A;  2BEQ D;  3AE5 D;  1ZOY C;  3D70 A;  3Q1M A;  3VRB C;  1UIX A;  4YSZ D;  3AE2 D;  3ABV D;  1PV3 A;  3AE3 D;  3C8V A;  2ACZ D;  2H89 D;  3P4Q C;  3P4R D;  2WSE J;  4IL6 X;  3GLM A;  4YTN C;  2ZT9 D;  3G9R A;  4YXD C;  2WU2 D;  3GMA A;  4YTM C;  2FYN C;  4YSZ C;  3D6Z A;  2BEZ F;  2E74 C;  2B76 D;  1TU3 F;  2WP9 D;  2YIU C;  3AE4 D;  3P4P D;  3AEG C;  3AE6 C;  4OGQ B;  3Q5P A;  3VRA C;  2P10 A;  4R4M A;  4YTP C;  1KIL E;  2WQY D;  2BS2 C;  2E74 B;  5C3J D;  5L8R J;  2H88 D;  4H13 C;  1RQU A;  3AED D;  4H13 D;  5C2T D;  5C2T C;  4OGQ C;  2WSF J;  3CIR D;  3AEE C;  4YT0 C;  3S9O A;  3Q5S A;  1S5L X;  1L0V D;  4H13 B;  2WU2 C;  1OMI A;  4I7Z B;  4YSY C;  1YQ3 C;  2E74 D;  1DD3 A;  2B76 C;  1VF5 C;  1VL2 A;  3AE7 D;  3ABV C;  3IN6 A;  2E76 C;  3B71 A;  1AJY A;  2WPV B;  3Q3D A;  2WQY C;  1VF5 B;  3D6Y A;  3AED C;  1U57 A;  3AEC D;  3AE8 D;  3AE8 C;  1ZME C;  3VRB D;  4YTM D;  1ZOY D;  1HJ0 A;  2MKV A;  2QJK C;  2FBW C;  2QJY C;  5M1B A;  4GDO A;  4XFJ A;  2WU5 D;  1ZP0 D;  2WDQ D;  3VRA D;  2WS3 D;  2WDQ C;  3AE6 D;  4I7Z C;  2E76 B;  3P4R C;  1OW6 A;  3P4Q D;  3Q2Y A;  4YSX D;  2JP3 A;  3AEG D;  3VR9 C;  3RL0 g;  3AEA D;  3AEF D;  4H44 B;  3SFD D;  4R4L A;  3SFD C;  3AEB D;  1K04 A;  1KFY D;  4TT3 H;  1JB0 J;  1KF6 D;  2G3A A;  1YQ4 D;  3P4S C;  2E75 B;  3AE2 C;  4PV1 D;  1NEN D;  1K05 A;  3AE7 C;  2IDB A;  3RK3 E;  1EXJ A;  4YTP D;  3D71 A;  3T97 B;  2E75 C;  3AE1 C;  1HF9 A;  1KOR A;  2NZ2 A;  3VR8 D;  3GF3 A;  1KQF B;  3SFE C;  2WDR C;  1PIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...