3AE8C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae8C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae8C02
2WQYC 3S9OA 3AE9C 2H88D 1PV3A 2B76D 3AE3D 1YQ3C 4YSZD 3VR8D 2ACZC 4YSXD 3AE5D 4YTMC 1OW8A 3P4RD 4YXDD 2WU5C 4KX6C 3CIRD 3AE2C 3AE7D 2WDRC 3VRAD 3SFEC 4YT0C 1YQ4D 3AECD 1NEKC 2WDQD 3AEAC 4YTND 1ZOYD 1ZOYC 2BS4C 3SFDD 2WP9D 3AEDD 3AE4D 3VR9D 2WU2C 4YT0D 1ZP0C 1ZP0D 3P4SD 2WDRD 3CIRC 3AE4C 3AE8D 1NENC 5C2TD 3AEDC 3AE6D 3SFDC 1KFYD 4YTNC 3AEAD 3P4RC 1K04A 3AE6C 2ACZD 2G3AA 1NEND 3VR8C 4YSZC 1KF6D 1KF6C 4YXDC 1QLBC 3AE3C 2H88C 3VR9C 1KFYC 3AE5C 4YTMD 4YSXC 3B71A 3AE8C 5C2TC 3P4SC 1YQ4C 1YQ3D 3SFED 1KTMA 2WU2D 3AE7C 3AE2D 4KX6D 2WU5D 2WP9C 3VRBD 2WQYD 4YSYC 2WDQC 1NEKD 4YTPC 3AECC 3ABVC 1L0VC 3VRAC 3AEEC 3AEFD 3P4PC 2WS3C 1OW6A 3AE9D 3AEGC 1K05A 2BS2C 5C3JC 3AEBD 2WDVD 2B76C 2H89D 3AE1C 1OW7A 5C3JD 3P4QC 2H89C 2WS3D 3P4PD 2FBWC 1L0VD 2BS3C 3ABVD 4YTPD 3P4QD 4YSYD 1E7PC 3AEGD 3VRBC 3AE1D 3AEFC 3AEED 2FBWD 2WDVC 3AEBC
chains in the Genus database with same CATH superfamily
4YPCA 2WPVB 3VMXA 3V2NA 1M1KQ 3H1KE 4DHJA 1S2EA 1SQPK 1JTHB 3L70J 3QWOC 1OWAA 4PJ0H 1N7SD 1IJDB 3AE2C 1YITP 1LTGC 3Q2YA 3SFEC 3AECD 3C8VA 2J58A 2WDQD 2KNCA 1BE3D 1FC2C 1N7SC 4D6TE 4WY4B 3PHLA 1KQSO 3AE6D 4R4LA 3SFDC 1PL5A 5CCHC 1QLED 3FWLA 5KLVJ 5AW3B 4YTMD 5C2TC 2Y9YA 1PP9G 4Z1MH 2WZ7A 3C9IA 1NTZE 1RE3C 2M5AB 3S4RA 3ITKA 1SFCC 3L36A 1L0NE 1VF5B 5C3JC 4AUWA 1H88A 3G4SP 2N1TC 3AEBD 2KSJA 3P8CD 2H89D 1OW7A 1ZW0A 2YNYA 2E75D 3F5HA 1ZN5A 1JTHA 1J1EC 1PPJE 5EFWB 1VQ9P 1HUCA 3H25A 1K8AQ 4L74A 3WUVA 1JMMA 4HYTB 1XTCC 3EQ2A 4AQRD 3TF5A 1GU4A 3LW5J 3VR8D 3MIWA 5KLVG 1QL2A 1BE3E 1OW8A 2XV5A 4KX6C 2PRRA 3VRAD 5B66H 3B5NB 1OXZA 1VL2A 4I2LC 2O01J 3CXHE 4C7NB 2BS4C 1JY3N 3AEDD 3CXHI 3BCCD 5KLIB 1FDOA 3H1JE 1LTIC 3OA7A 3PP5A 2H88C 2RN0A 2FYNC 3HD7C 2N9YB 1KV4A 3A0HH 4NPEA 4CPGA 3HUSA 1H0TB 3H1IE 1FZGA 3GHGC 1M8OB 2ZJSE 2W6JH 1YTZI 1SQVK 1SQBD 1OZHA 3FX0A 1LWUA 1SQBK 2LKMA 3Q5SA 1KMIZ 4U3FD 2K9JB 2QE7H 1SQXG 1S9KE 2W8ZA 1SQXJ 4H0LD 1KC8Q 3A0BH 1U7MA 3RK2C 1L0VD 2BS3C 4H0LB 1OIPA 2Q9IA 1LTTC 1BCCG 2Y0CA 2ZXEB 3AE1D 4AYCA 2JDIH 5B66E 3SWYA 3JCUH 1KYOH 3L73G 3MUDA 4PV1B 2SPZA 4OGQB 1KQFB 2BCCJ 3JC22 3E1IA 3H32A 5KLVK 1S5LE 1JY2O 1BGYJ 1HJ0A 3CWBE 4YT0C 3TYYA 3HE5A 5KKZC 3KZIH 3PRJA 5AW8B 3AE4C 4RESB 1L4AB 1N2DC 2ZAEB 2P2UA 2G3AA 1URQB 2HLOA 4UB6E 2KUBA 4H13D 1MUUA 1KORA 1SQBE 1LTJB 3HD7A 3W68A 1SQVE 1NU1E 1SQPE 3QH9A 2QA4P 1J2JB 3P32A 2JP3A 4W7YA 4BRYB 4H44B 1NU1D 1NYHA 1IFNA 3T97A 2NPSB 3L75D 1HGVA 2ZVOB 2QRXA 1KB9H 3U59A 2YXQB 1W2BO 2R3CA 1IFPA 1E79H 2IYOA 2BCCG 2ZYAA 4MN4C 4DT0A 3ABVD 1RH5B 1SQVJ 2HG5D 1NO4A 1L0LE 5AW2B 1KILE 2KSEA 5H2FH 3H1JD 3BRVB 2IZ0A 5TISE 3HE5B 2WPQA 1FZCC 3R4YA 1ZXGA 2GUSA 1MFTA 1G2CB 1P84E 3TNUA 3M9BA 1JY3P 2E75B 2HFED 2POHA 1SLQA 1LT9C 5M1BA 2OYIC 2FXPA 1RE3A 2IFMA 3H1KD 4XE5B 3HD7D 2AEMA 4WVZA 4WBAA 3VP8A 1GW4A 3JSVC 4OWFA 2KB7P 5AW0B 1X22A 4RKUJ 3GF7A 3L74D 1LGHB 4L76A 3B71A 2AXTH 2XKMA 2QJYC 3M0AA 3VRAC 2Z5HA 3I55P 3AEEC 3TNUB 3AEGC 3KXDA 2BS2C 2DW3A 2W83C 2WDVD 5GTIH 3VN0A 3ZDMA 1KILD 1BCCE 3P4PD 3IN6A 1N7SA 1JUNA 3F89A 1MFZA 4UB8E 1HTLC 1IZNB 2YIUC 2WITA 1W2EA 2K1AA 1GK6A 1FDIA 2I1JA 1HBWA 1NWQA 2XDJA 1VQKP 2ITAA 5KJ7C 2NZ2A 1CI6B 3I5CA 3H1HD 1YQ4D 3FWNA 4DHZA 2LR2A 1W5CE 2YKQA 1IC2A 3II6A 2WDRD 1MV8A 1Q2NA 5C2TD 3WU2H 2IFNA 2JO1A 5CBNA 3KQGA 5DJUB 5AVQB 4JF7A 4ZKPA 2Z5IA 3A5TA 5CCHD 1OVUA 5APXA 1JCCA 4H44D 2Q1KA 2WSFH 2JJLA 3CXHD 1NTKE 5APQA 3N4XA 2R5DA 1JCDA 2WDQC 3AECC 1HH0A 1DD3A 2W6AA 1T3JA 3A0HE 1XTGB 2KZJA 3CCEP 1VQ7P 4EI2A 4HH2A 1X79B 1K9MQ 5AVVB 3CCSP 2CK3H 4ZMDA 2YXRB 4PV1C 3B5NC 4JYCA 4GIFA 3VP9A 1VQOP 3RL0C 2M8RA 5L8RJ 1NJIQ 2C0WA 1VDFA 1LP1A 1FOSE 1USDA 4I6MC 3I56P 1X0TA 4PV1D 2Q7CA 4U3FE 4IFFA 1KB9I 1YQ3C 2O01N 4YSZD 2WSFJ 3Q5PA 3GHGB 1IFDA 1T6AA 2NRGA 1PP9J 1TFFA 5AW4B 1FAVA 3CI9A 3HTKB 2FYUG 3CX5E 1AFOA 4HB1A 1NGMB 1OMIA 1VQLP 3G3ZA 1E5WA 4H13B 3HTKA 1H89A 4YTNC 1KB9E 4EYYQ 1SQPJ 1A02J 2O1KA 1FZEA 5AVUB 1NTKD 2MJZA 2HYNA 3H1LD 5AVSB 1USEA 3VMAA 1HVVA 1YQ4C 3A2AA 1Q81Q 2YO2A 3H1LE 5KAIH 4ASWA 3CWBJ 4YSYC 1LTJA 1JB0J 2QJPC 3RBZA 3M0DA 1FZCB 3M06A 1YHQP 1GK4A 2N1TA 3EWKA 1NTMK 2QM7A 3TSIA 3V5BA 4R4MA 2B76C 3H1HJ 3MUDC 5APTA 4PJ0E 1OVRA 2G8YA 1GDTA 1Y9BA 2OYIA 2WS3D 4LC1A 3V2RA 2IPPA 1KILC 1DX7A 1S5LH 1IFMA 1NAFA 1GD2E 3MD0A 3B5NA 2WDVC 3L35A 3TGUG 2Y0EA 3IR9A 1RF1C 2KP8A 2ZXXA 2P1JA 1GU5A 3BCCE 4N78E 1SQQK 4L73A 1GL2C 3P4RD 4ZKUA 4A7PA 2IX7C 5APYA 3M9HA 4YTND 3LIEA 3Q1MA 2R32A 5AVXB 1EXIA 4PD4H 1T2KD 3FGAD 3HRNA 3P8MC 1PGOA 1EDLA 2ACZD 5KAFE 3P8CE 3H1HG 1S9KD 1LT1A 4UB8H 5BVZA 3L75J 1PGJA 1YQ3D 2ZT9C 1URQA 3L72J 3VRBD 3W67A 2B9BA 1J1EB 1BE3G 1LTJC 1VQ6P 1OW6A 1YTZT 3CPWO 2RMZA 1UIIA 5APWA 4N6JA 1D7MA 2P10A 2KLUA 2NPSA 3B5ND 3PTZA 2A45I 1G1JA 4IFDK 2FFDC 1PP9D 1M7LA 1ZRTD 5KLVE 5TISH 2KI7B 1KN7A 3S1KA 1S72P 1A02F 4DDIA 5APUA 1NKZB 2C9LY 3AE3D 2FXOA 1KFNA 1G2CA 4LGDE 1NTZG 2CPSA 3TDKA 1L0NG 2ZFYA 1CSBA 1KQGB 2JKVA 3H1ID 1S1CX 2GM4A 1L0NJ 1M1JA 4IL6E 1ZOYD 1LWUB 4H13C 3CIRC 2JWAA 2OTJP 1FJPA 1KD1Q 1QL1A 3PLNA 1KF6C 5CCGA 4WY4A 1EZVG 3O8ZA 5CMZA 4GOEA 1KFYC 5APVA 2E76D 2WWWA 3WUTA 1RF0A 4LDTA 2D2CC 3P4SC 2WT7B 1U7JA 2WU2D 2XNDH 1BE3J 2WP9C 2QJKC 2A45H 2YKPA 1J1DC 1NEKD 4YTPC 1SQXE 1ZLLA 4IL6H 1GL2A 2WT7A 1LTBC 2A06D 4DCKA 3L71D 3KZIE 5AW9B 5KJ7A 1QX8A 1L0LK 2K9YA 1OVVA 1HF9A 1RY3A 5B5EE 3AE1C 3L70G 3R2PA 3USSA 2BCCD 2Y0DA 1L4AA 1RHZB 2FBWC 2KNCB 3RK2D 4ASVA 1JY2N 3Q3DA 1JY3O 2P58A 5CJ4A 1GTWA 2I8DA 3AEGD 3JCUE 2OGUA 3AEED 1TU3F 2JWDA 3H1IJ 1M90Q 3E1RA 3OJAB 1NU1G 2OQQA 1PV3A 1URQC 2QG4A 3CWBG 1HWTC 1R5SA 1AVYA 3MP7B 2B88A 1BDCA 1CI6A 1NHLA 1YJ9P 1AA0A 2ZT9B 4WWIA 1T8ZA 1AVOA 3CCMP 3D70A 1FS0E 1DEEG 1NVOA 1YJWP 3L74E 1RF1A 1S4XA 2C0XA 3UIAA 5CHXA 2HPCA 2O3JA 2H43A 3H1LJ 4YXWH 4JYBA 5H2FE 2KS1B 1SQVG 1N73A 5TJHA 3RK3E 2ZYGA 4DZOA 3RK3C 3HE4A 4BXLA 2PGDA 5CBOA 4TT3H 3AE8C 3BRTB 3SWFA 1BSHA 4KX6D 1ZRTE 1SQQG 1NAYA 1YBKA 3L73D 3L74J 3CX5I 1EDJA 1RF1B 2BCCE 4JPZB 4HKZH 1IFJA 1R8EA 1G1IA 2R5BA 3IAOA 2K9JA 1M1JB 5BU8B 1KZUB 4YTPD 2E75C 2WMMA 1SQBJ 5AW7B 2OYIB 1NTMG 3PJSK 1ZR4A 1JO5A 5C39A 2N1TD 3AEBC 2YMKA 2ZYDA 4U3FJ 3RL0B 1SQPG 2E5YA 1YYCA 1IFIA 2OYOA 2WSEJ 2IDBA 1R5LA 4HJGH 4IOIH 4IL6X 4XFJA 4Y28J 5BU5A 4M3LA 3CIRD 3L73J 3CXHH 4Y99C 1DD4A 1AV1A 3M0DC 3LIDA 1ZOYC 1KYOD 5CJ0A 3VMZA 3AE4D 2Q3EA 3NTNA 3L71E 1Q86Q 1IO4A 1PGPA 3L72E 3OW2O 1QVFO 2Q6QA 3AE6C 3IF4A 3G71P 5KKZB 3AE3C 1CW5A 3BCCJ 4QMAA 1L0LJ 1EZVI 5AVTB 1KYOI 1BDDA 5AW5B 1L0ND 4EDFA 3SFED 2JR8A 2IBZE 5KLVD 3AE2D 3MHVA 2QJKB 3FXDA 4DDGA 1N73C 1LP1B 1Q90D 2B87A 5KTBA 4H0LC 1LNQA 3VONA 5KAIE 3G6EP 5K5GB 2FYUK 3BASA 1BGYG 4I6LA 2IYPA 3G9RA 4W80A 3VMYA 1PZQA 1FOSF 3VRBC 2E74D 2P7JA 3CX5H 1ZR2A 2FKWB 1JEKA 1EZVD 3HUSC 4WY4C 2E74B 1YIJP 1GW3A 1P84H 2ACZC 1N8RQ 2QEXP 3KYQA 3L74G 3H32B 5DJTB 1NTZJ 2WSCH 3VYIA 2HPCB 1PGQA 2WTYA 1SVFA 1J1DB 4GOFA 3H1KJ 1EDIA 2P67A 3D71A 3HE4B 2XU6A 3AEDC 5B5EH 4RO0A 3P4RC 2KYVA 3B4SA 1GL2D 2Y9ZA 3M9QA 2WPRA 4D6TG 1LWUC 3U1AA 1KFMA 2K3RA 3CLQA 4D6TJ 3CMEP 3AE7C 2J59M 3A7OA 1NKNA 4PD4I 4U7JA 2HODB 2AEJA 1AJYA 2WS3C 3FXEA 4L75A 2UWJE 1S3JA 2O1JA 2KXPB 2CPBA 3GW6A 2OYHA 1HGZA 1CZQA 1BCCJ 3P4QC 2H89C 3TK1A 4YSYD 1FZFA 1VQ4P 1SFCB 1PIXA 1K73Q 1AQTA 1PP9E 5GTHE 1KB9D 4C7RA 2FXMA 2M3BA 1RQVA 3OAKA 5CCGD 4YTMC 1SP4A 1JMBA 2WSEH 1NH4A 1FU1A 3L75G 3U1CA 3CCJP 3CC7P 2GA1A 4W7ZA 3SFDD 1JOCA 2PFXA 1LTAC 2O01H 3L4FA 1FZCA 4IFMA 1OX3A 2FYUJ 3Q5RA 3IFMA 3PH0A 3EFGA 3A0BE 3P7KA 1PPJG 4XA4A 2PP6A 4GODA 4YSZC 1FZAA 2V7QH 3H1LG 2IZ1A 4DJGA 2L5GB 1PPJD 2OTLP 1L0NK 3H1JG 4LLHA 3TGUE 2K88A 1FZBA 2WU5D 4OVNF 1QGKB 1SQQJ 1T3UA 3AE9D 1LT9A 3RL0D 1Y8AA 1L4AC 3CCVP 1GZLA 2E5TA 2QJYB 4K35A 3CCRP 3VOPA 3RL0g 1QVGO 1Y47A 1SQQD 5AW6B 4C46A 1BCCD 1NTZK 3RBXA 4I1LA 4H44C 3GF3A 2QVAA 3C1LA 1SQBG 3E7KA 4RJTA 1S5LX 1LT9B 2ZVNB 3MZWB 3HUSB 1H0TA 4DHIB 1VQ5P 1VPCA 3L71J 4JQ0D 4YXDD 3CC4P 3B8EB 2WDRC 3K5BA 3EFFK 1VQMP 3VR9D 2M5AA 2M3EA 3H1HE 1QEXA 3AE8D 1NENC 2YMYA 5KJ7D 3RK3D 1DEBA 4OGQC 1K04A 1FE6A 1QLBC 1RF0C 1U57A 4O9BA 4YSXC 5E79H 1SQXK 2WVRA 3CWBD 1WRGA 3L73E 2WQYD 3BCCG 1NTKK 1M56D 4EOTA 2H8PD 1PFIA 3P4PC 2Q5UA 2VRSA 1X8YA 2BASA 1NU1J 1URQD 4BRYA 5AVYB 1IK9A 2I1KA 2IBZI 4C7NA 5AVZB 1E7PC 2XZRA 3AEFC 2A06G 2FBWD 2XNXA 3CC2P 2B89A 4ZNCA 1BGYD 4D6TD 2KZIA 1RE4A 2NPSD 3L75E 4BWNA 2OYHC 4WB4A 3NMDA 1X9VA 4B86A 2HR3A 4KJMA 4KT0J 2KS1A 3VTPC 1N73B 1LTSC 3GLMA 1UIXA 1NEKC 2YKOA 4GKGA 3WUUA 4N78D 3HD7B 2WP9D 1L0LD 1N7LA 2WU2C 1GL2B 1HJBA 1ZP0C 3L70E 1KYOE 2D2CD 2FYZA 3P4SD 1EZVE 1NTZD 3CX5D 2E76C 4EIJA 1KFYD 4I7ZC 3AEAD 2QSIA 4KHXA 1NEND 1KF6D 1L0LG 5AW1B 4FJVA 3T97B 4Y99B 3VR9C 2AXCA 1BSNA 2V7QJ 3AE5C 2A45G 2QIWA 2LXBA 2L91A 2R44A 3D6YA 2RH0A 1YI2P 2M0BA 5AVRB 1VF5D 3V4WA 3ABVC 1KILA 3SSUA 1WT6A 3O6QB 1SS1A 2AXTE 3WMM0 2PAJA 3CCQP 1KQLA 1VQNP 1EXJA 1VQPP 1N86A 3NXSA 5KLIC 2QJPB 1EQ7A 1JY2P 2E43A 2GUVA 3TGUD 2KLVA 4NPDA 1IK7A 1OFCX 2W27A 2ZFCA 2WPSA 1L4AD 3GHGA 1VF5C 3L37A 1SFCA 3AE9C 5CCHA 2N1TB 1NTKJ 3AE5D 4N3YB 3V4QA 1KILB 3KDPB 3M91A 2WU5C 2FY8A 1M57D 3H1KG 1ZMEC 1NU1K 2IBZD 3AEAC 3KHUA 4GDOA 2WSCJ 1N7SB 4YT0D 2ZT9D 1ZP0D 4DOJA 3D6ZA 2H7HA 2KIKA 1Z56A 4GT1A 2AEFA 3CL3D 3A3YB 1ZV8A 3GMAA 5GTIE 5E79E 1DIPA 1P84I 2BEQD 2YIUB 1GMJA 2B87B 1P84D 1SQQE 1MKMA 1NTMJ 3CCUP 3RGUA 2W90A 1KTMA 1T2KC 4JBZA 1RE4C 2NPSC 3H1JJ 1SQPD 1EC5A 1L0VC 3AEFD 5CCGC 1K05A 1RQUA 3RK3B 1AQ5A 1NTMD 2WSSH 3MTUE 4UB6H 3L72D 3CMAP 2BEZF 1NTME 2A06E 3L72G 3TGUJ 1EDKA 2Z4EA 2OTKE 3P4QD 1JNMA 2RKLA 2MKVA 2OARA 2KK7A 2WQYC 4I7ZB 2W6BA 3LW5H 2R3SA 1NTKG 3S9OA 3V2QA 2H88D 2B76D 2V4HA 4YSXD 2J5UA 4K3AA 2OYHB 4TLFA 4U3FG 3L71G 3AE7D 4OGQD 3RK2B 1SQVD 1H8AA 2FYUD 3O6QA 2LXCB 1Q7YQ 3N7NA 2FYUE 3MGNA 1BGYE 2YO3A 2E76B 2QM8A 1MZ9A 3VR8C 2KOGA 2FFDA 2IBZG 4YXDC 3BVHA 1DH3A 5GTHH 3V6IA 1JM0A 2JEEA 1LJ2A 1FJKA 1M1JC 3NFQA 2Q3IA 3SWKA 2K37A 1FDMA 1FBMA 3KPEA 2C9NY 5AVWB 1VQ8P 4OH8B 2D2CB 3H1IG 4NPFX 4WY4D 1WMKA 1Q82Q 1SQXD 5KAFH 4PD4D 3V2PA 3CCLP 5APSA 2FFDB 2E74C 3WU2E 2FYNB 3H6PA 2E42A 5C3JD 2N9BA 1SFCD 1L2PA 4PD4E 3L70D 3GG2A 2HODA 3BATA 3CD6P 1NOHA 1YJNP
chains in the Genus database with same CATH topology
2YMKA 2WQYC 4I7ZB 1VF5C 2WPVB 3R4YA 1S5LX 2E74B 3S9OA 3AE9C 2OQQA 2H88D 2YIUC 1PV3A 1RQVA 2B76D 3AE3D 1YQ3C 2WSEJ 2IDBA 3LW5J 4PV1B 4YSZD 3VR8D 2WSFJ 1FDIA 2ACZC 2J5UA 4YSXD 4IL6X 4OGQB 1KQFB 3Q5PA 3AE5D 4YTMC 1OW8A 4XFJA 3P4RD 4Y28J 4KT0J 2NZ2A 1KQGB 2WU5C 2E75B 4KX6C 3CIRD 3AE2C 3AE7D 1HJ0A 2WDRC 2ZT9B 3VRAD 3GLMA 1ZMEC 1S1CX 5M1BA 3SFEC 3Q2YA 1UIXA 1DD4A 4OGQD 1YQ4D 3AECD 4YT0C 1VL2A 3C8VA 1NEKC 2WDQD 2O01J 3AEAC 3D70A 2FXPA 4YTND 1ZOYD 1ZOYC 3Q1MA 4GDOA 2BS4C 2WP9D 2WSCJ 3O6QA 5KKZC 1NGMB 1OMIA 3AE4D 3AEDD 3SFDD 2WU2C 4H44C 1EXIA 3VR9D 4YT0D 2ZT9D 4H13C 1ZP0C 1ZP0D 3D6ZA 3D71A 2D2CD 3P4SD 2WDRD 3FGAD 3CIRC 3AE4C 3AE8D 1NENC 5C2TD 3AEDC 4H13B 4R4LA 3SFDC 3AE6D 2E76C 1FDOA 2JO1A 1KFYD 3Q5RA 3GMAA 4I7ZC 4YTNC 3AEAD 1PL5A 3P4RC 2QSIA 2E76B 1DIPA 4OGQC 1K04A 3AE6C 2BEQD 2ACZD 2G3AA 1NEND 3VR8C 4YSZC 1GMJA 1KF6D 1KF6C 3T97B 4YXDC 1QLBC 3RK3E 3AE3C 4H13D 2H88C 3VR9C 2FYNC 4RKUJ 1MKMA 3GF7A 1U57A 1KFYC 2E76D 2V7QJ 3AE5C 4TT3H 4YTMD 4YSXC 1KORA 3B71A 3AE8C 5C2TC 2QIWA 2D2CC 1YQ4C 3P4SC 1YQ3D 4Z1MH 3SFED 1KTMA 4H44D 2ZT9C 3D6YA 3AE7C 2WU2D 3AE2D 4KX6D 2WU5D 2WP9C 1ZRTE 3VRBD 2QJKC 1VF5D 2QJYC 2WQYD 2JP3A 4YSYC 2WDQC 1NEKD 4YTPC 3AECC 1JB0J 1DD3A 3ABVC 4PV1D 2QJPC 4H44B 1L0VC 3VRAC 3AEEC 4U7JA 3AEFD 1AJYA 2WS3C 3P4PC 2D2CB 1NYHA 1OW6A 1Q90D 3AEGC 1VF5B 3AE9D 1K05A 3Q5SA 2BS2C 5C3JC 1WMKA 1EXJA 1KMIZ 1RQUA 3EWKA 2K9YA 4PV1C 3AEBD 2WDVD 4R4MA 1HF9A 2B76C 2H89D 5KLIC 4H0LC 4YXDD 2E74C 3AE1C 1OW7A 2P10A 2G8YA 2BEZF 1Y9BA 4H0LD 5L8RJ 2E75D 1R8EA 2H89C 3P4QC 3IAOA 5C3JD 2WS3D 3P4PD 3IN6A 2FBWC 3RL0g 1L0VD 2BS3C 3ABVD 4YTPD 2E75C 3P4QD 4YSYD 3Q3DA 3G9RA 1E7PC 1IK7A 4H0LB 3AEGD 3H25A 3VRBC 1KILE 1PIXA 2E74D 3AEFC 3AEED 1TU3F 3AE1D 2FBWD 2MKVA 3GF3A 2WDVC 3AEBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQY C;  3S9O A;  3AE9 C;  2H88 D;  1PV3 A;  2B76 D;  3AE3 D;  1YQ3 C;  4YSZ D;  3VR8 D;  2ACZ C;  4YSX D;  3AE5 D;  4YTM C;  1OW8 A;  3P4R D;  4YXD D;  2WU5 C;  4KX6 C;  3CIR D;  3AE2 C;  3AE7 D;  2WDR C;  3VRA D;  3SFE C;  4YT0 C;  1YQ4 D;  3AEC D;  1NEK C;  2WDQ D;  3AEA C;  4YTN D;  1ZOY D;  1ZOY C;  2BS4 C;  3SFD D;  2WP9 D;  3AED D;  3AE4 D;  3VR9 D;  2WU2 C;  4YT0 D;  1ZP0 C;  1ZP0 D;  3P4S D;  2WDR D;  3CIR C;  3AE4 C;  3AE8 D;  1NEN C;  5C2T D;  3AED C;  3AE6 D;  3SFD C;  1KFY D;  4YTN C;  3AEA D;  3P4R C;  1K04 A;  3AE6 C;  2ACZ D;  2G3A A;  1NEN D;  3VR8 C;  4YSZ C;  1KF6 D;  1KF6 C;  4YXD C;  1QLB C;  3AE3 C;  2H88 C;  3VR9 C;  1KFY C;  3AE5 C;  4YTM D;  4YSX C;  3B71 A;  3AE8 C;  5C2T C;  3P4S C;  1YQ4 C;  1YQ3 D;  3SFE D;  1KTM A;  2WU2 D;  3AE7 C;  3AE2 D;  4KX6 D;  2WU5 D;  2WP9 C;  3VRB D;  2WQY D;  4YSY C;  2WDQ C;  1NEK D;  4YTP C;  3AEC C;  3ABV C;  1L0V C;  3VRA C;  3AEE C;  3AEF D;  3P4P C;  2WS3 C;  1OW6 A;  3AE9 D;  3AEG C;  1K05 A;  2BS2 C;  5C3J C;  3AEB D;  2WDV D;  2B76 C;  2H89 D;  3AE1 C;  1OW7 A;  5C3J D;  3P4Q C;  2H89 C;  2WS3 D;  3P4P D;  2FBW C;  1L0V D;  2BS3 C;  3ABV D;  4YTP D;  3P4Q D;  4YSY D;  1E7P C;  3AEG D;  3VRB C;  3AE1 D;  3AEF C;  3AEE D;  2FBW D;  2WDV C;  3AEB C; 
#chains in the Genus database with same CATH topology
 4YPC A;  2WPV B;  3VMX A;  3V2N A;  1M1K Q;  3H1K E;  4DHJ A;  1S2E A;  1SQP K;  1JTH B;  3L70 J;  3QWO C;  1OWA A;  4PJ0 H;  1N7S D;  1IJD B;  3AE2 C;  1YIT P;  1LTG C;  3Q2Y A;  3SFE C;  3AEC D;  3C8V A;  2J58 A;  2WDQ D;  2KNC A;  1BE3 D;  1FC2 C;  1N7S C;  4D6T E;  4WY4 B;  3PHL A;  1KQS O;  3AE6 D;  4R4L A;  3SFD C;  1PL5 A;  5CCH C;  1QLE D;  3FWL A;  5KLV J;  5AW3 B;  4YTM D;  5C2T C;  2Y9Y A;  1PP9 G;  4Z1M H;  2WZ7 A;  3C9I A;  1NTZ E;  1RE3 C;  2M5A B;  3S4R A;  3ITK A;  1SFC C;  3L36 A;  1L0N E;  1VF5 B;  5C3J C;  4AUW A;  1H88 A;  3G4S P;  2N1T C;  3AEB D;  2KSJ A;  3P8C D;  2H89 D;  1OW7 A;  1ZW0 A;  2YNY A;  2E75 D;  3F5H A;  1ZN5 A;  1JTH A;  1J1E C;  1PPJ E;  5EFW B;  1VQ9 P;  1HUC A;  3H25 A;  1K8A Q;  4L74 A;  3WUV A;  1JMM A;  4HYT B;  1XTC C;  3EQ2 A;  4AQR D;  3TF5 A;  1GU4 A;  3LW5 J;  3VR8 D;  3MIW A;  5KLV G;  1QL2 A;  1BE3 E;  1OW8 A;  2XV5 A;  4KX6 C;  2PRR A;  3VRA D;  5B66 H;  3B5N B;  1OXZ A;  1VL2 A;  4I2L C;  2O01 J;  3CXH E;  4C7N B;  2BS4 C;  1JY3 N;  3AED D;  3CXH I;  3BCC D;  5KLI B;  1FDO A;  3H1J E;  1LTI C;  3OA7 A;  3PP5 A;  2H88 C;  2RN0 A;  2FYN C;  3HD7 C;  2N9Y B;  1KV4 A;  3A0H H;  4NPE A;  4CPG A;  3HUS A;  1H0T B;  3H1I E;  1FZG A;  3GHG C;  1M8O B;  2ZJS E;  2W6J H;  1YTZ I;  1SQV K;  1SQB D;  1OZH A;  3FX0 A;  1LWU A;  1SQB K;  2LKM A;  3Q5S A;  1KMI Z;  4U3F D;  2K9J B;  2QE7 H;  1SQX G;  1S9K E;  2W8Z A;  1SQX J;  4H0L D;  1KC8 Q;  3A0B H;  1U7M A;  3RK2 C;  1L0V D;  2BS3 C;  4H0L B;  1OIP A;  2Q9I A;  1LTT C;  1BCC G;  2Y0C A;  2ZXE B;  3AE1 D;  4AYC A;  2JDI H;  5B66 E;  3SWY A;  3JCU H;  1KYO H;  3L73 G;  3MUD A;  4PV1 B;  2SPZ A;  4OGQ B;  1KQF B;  2BCC J;  3JC2 2;  3E1I A;  3H32 A;  5KLV K;  1S5L E;  1JY2 O;  1BGY J;  1HJ0 A;  3CWB E;  4YT0 C;  3TYY A;  3HE5 A;  5KKZ C;  3KZI H;  3PRJ A;  5AW8 B;  3AE4 C;  4RES B;  1L4A B;  1N2D C;  2ZAE B;  2P2U A;  2G3A A;  1URQ B;  2HLO A;  4UB6 E;  2KUB A;  4H13 D;  1MUU A;  1KOR A;  1SQB E;  1LTJ B;  3HD7 A;  3W68 A;  1SQV E;  1NU1 E;  1SQP E;  3QH9 A;  2QA4 P;  1J2J B;  3P32 A;  2JP3 A;  4W7Y A;  4BRY B;  4H44 B;  1NU1 D;  1NYH A;  1IFN A;  3T97 A;  2NPS B;  3L75 D;  1HGV A;  2ZVO B;  2QRX A;  1KB9 H;  3U59 A;  2YXQ B;  1W2B O;  2R3C A;  1IFP A;  1E79 H;  2IYO A;  2BCC G;  2ZYA A;  4MN4 C;  4DT0 A;  3ABV D;  1RH5 B;  1SQV J;  2HG5 D;  1NO4 A;  1L0L E;  5AW2 B;  1KIL E;  2KSE A;  5H2F H;  3H1J D;  3BRV B;  2IZ0 A;  5TIS E;  3HE5 B;  2WPQ A;  1FZC C;  3R4Y A;  1ZXG A;  2GUS A;  1MFT A;  1G2C B;  1P84 E;  3TNU A;  3M9B A;  1JY3 P;  2E75 B;  2HFE D;  2POH A;  1SLQ A;  1LT9 C;  5M1B A;  2OYI C;  2FXP A;  1RE3 A;  2IFM A;  3H1K D;  4XE5 B;  3HD7 D;  2AEM A;  4WVZ A;  4WBA A;  3VP8 A;  1GW4 A;  3JSV C;  4OWF A;  2KB7 P;  5AW0 B;  1X22 A;  4RKU J;  3GF7 A;  3L74 D;  1LGH B;  4L76 A;  3B71 A;  2AXT H;  2XKM A;  2QJY C;  3M0A A;  3VRA C;  2Z5H A;  3I55 P;  3AEE C;  3TNU B;  3AEG C;  3KXD A;  2BS2 C;  2DW3 A;  2W83 C;  2WDV D;  5GTI H;  3VN0 A;  3ZDM A;  1KIL D;  1BCC E;  3P4P D;  3IN6 A;  1N7S A;  1JUN A;  3F89 A;  1MFZ A;  4UB8 E;  1HTL C;  1IZN B;  2YIU C;  2WIT A;  1W2E A;  2K1A A;  1GK6 A;  1FDI A;  2I1J A;  1HBW A;  1NWQ A;  2XDJ A;  1VQK P;  2ITA A;  5KJ7 C;  2NZ2 A;  1CI6 B;  3I5C A;  3H1H D;  1YQ4 D;  3FWN A;  4DHZ A;  2LR2 A;  1W5C E;  2YKQ A;  1IC2 A;  3II6 A;  2WDR D;  1MV8 A;  1Q2N A;  5C2T D;  3WU2 H;  2IFN A;  2JO1 A;  5CBN A;  3KQG A;  5DJU B;  5AVQ B;  4JF7 A;  4ZKP A;  2Z5I A;  3A5T A;  5CCH D;  1OVU A;  5APX A;  1JCC A;  4H44 D;  2Q1K A;  2WSF H;  2JJL A;  3CXH D;  1NTK E;  5APQ A;  3N4X A;  2R5D A;  1JCD A;  2WDQ C;  3AEC C;  1HH0 A;  1DD3 A;  2W6A A;  1T3J A;  3A0H E;  1XTG B;  2KZJ A;  3CCE P;  1VQ7 P;  4EI2 A;  4HH2 A;  1X79 B;  1K9M Q;  5AVV B;  3CCS P;  2CK3 H;  4ZMD A;  2YXR B;  4PV1 C;  3B5N C;  4JYC A;  4GIF A;  3VP9 A;  1VQO P;  3RL0 C;  2M8R A;  5L8R J;  1NJI Q;  2C0W A;  1VDF A;  1LP1 A;  1FOS E;  1USD A;  4I6M C;  3I56 P;  1X0T A;  4PV1 D;  2Q7C A;  4U3F E;  4IFF A;  1KB9 I;  1YQ3 C;  2O01 N;  4YSZ D;  2WSF J;  3Q5P A;  3GHG B;  1IFD A;  1T6A A;  2NRG A;  1PP9 J;  1TFF A;  5AW4 B;  1FAV A;  3CI9 A;  3HTK B;  2FYU G;  3CX5 E;  1AFO A;  4HB1 A;  1NGM B;  1OMI A;  1VQL P;  3G3Z A;  1E5W A;  4H13 B;  3HTK A;  1H89 A;  4YTN C;  1KB9 E;  4EYY Q;  1SQP J;  1A02 J;  2O1K A;  1FZE A;  5AVU B;  1NTK D;  2MJZ A;  2HYN A;  3H1L D;  5AVS B;  1USE A;  3VMA A;  1HVV A;  1YQ4 C;  3A2A A;  1Q81 Q;  2YO2 A;  3H1L E;  5KAI H;  4ASW A;  3CWB J;  4YSY C;  1LTJ A;  1JB0 J;  2QJP C;  3RBZ A;  3M0D A;  1FZC B;  3M06 A;  1YHQ P;  1GK4 A;  2N1T A;  3EWK A;  1NTM K;  2QM7 A;  3TSI A;  3V5B A;  4R4M A;  2B76 C;  3H1H J;  3MUD C;  5APT A;  4PJ0 E;  1OVR A;  2G8Y A;  1GDT A;  1Y9B A;  2OYI A;  2WS3 D;  4LC1 A;  3V2R A;  2IPP A;  1KIL C;  1DX7 A;  1S5L H;  1IFM A;  1NAF A;  1GD2 E;  3MD0 A;  3B5N A;  2WDV C;  3L35 A;  3TGU G;  2Y0E A;  3IR9 A;  1RF1 C;  2KP8 A;  2ZXX A;  2P1J A;  1GU5 A;  3BCC E;  4N78 E;  1SQQ K;  4L73 A;  1GL2 C;  3P4R D;  4ZKU A;  4A7P A;  2IX7 C;  5APY A;  3M9H A;  4YTN D;  3LIE A;  3Q1M A;  2R32 A;  5AVX B;  1EXI A;  4PD4 H;  1T2K D;  3FGA D;  3HRN A;  3P8M C;  1PGO A;  1EDL A;  2ACZ D;  5KAF E;  3P8C E;  3H1H G;  1S9K D;  1LT1 A;  4UB8 H;  5BVZ A;  3L75 J;  1PGJ A;  1YQ3 D;  2ZT9 C;  1URQ A;  3L72 J;  3VRB D;  3W67 A;  2B9B A;  1J1E B;  1BE3 G;  1LTJ C;  1VQ6 P;  1OW6 A;  1YTZ T;  3CPW O;  2RMZ A;  1UII A;  5APW A;  4N6J A;  1D7M A;  2P10 A;  2KLU A;  2NPS A;  3B5N D;  3PTZ A;  2A45 I;  1G1J A;  4IFD K;  2FFD C;  1PP9 D;  1M7L A;  1ZRT D;  5KLV E;  5TIS H;  2KI7 B;  1KN7 A;  3S1K A;  1S72 P;  1A02 F;  4DDI A;  5APU A;  1NKZ B;  2C9L Y;  3AE3 D;  2FXO A;  1KFN A;  1G2C A;  4LGD E;  1NTZ G;  2CPS A;  3TDK A;  1L0N G;  2ZFY A;  1CSB A;  1KQG B;  2JKV A;  3H1I D;  1S1C X;  2GM4 A;  1L0N J;  1M1J A;  4IL6 E;  1ZOY D;  1LWU B;  4H13 C;  3CIR C;  2JWA A;  2OTJ P;  1FJP A;  1KD1 Q;  1QL1 A;  3PLN A;  1KF6 C;  5CCG A;  4WY4 A;  1EZV G;  3O8Z A;  5CMZ A;  4GOE A;  1KFY C;  5APV A;  2E76 D;  2WWW A;  3WUT A;  1RF0 A;  4LDT A;  2D2C C;  3P4S C;  2WT7 B;  1U7J A;  2WU2 D;  2XND H;  1BE3 J;  2WP9 C;  2QJK C;  2A45 H;  2YKP A;  1J1D C;  1NEK D;  4YTP C;  1SQX E;  1ZLL A;  4IL6 H;  1GL2 A;  2WT7 A;  1LTB C;  2A06 D;  4DCK A;  3L71 D;  3KZI E;  5AW9 B;  5KJ7 A;  1QX8 A;  1L0L K;  2K9Y A;  1OVV A;  1HF9 A;  1RY3 A;  5B5E E;  3AE1 C;  3L70 G;  3R2P A;  3USS A;  2BCC D;  2Y0D A;  1L4A A;  1RHZ B;  2FBW C;  2KNC B;  3RK2 D;  4ASV A;  1JY2 N;  3Q3D A;  1JY3 O;  2P58 A;  5CJ4 A;  1GTW A;  2I8D A;  3AEG D;  3JCU E;  2OGU A;  3AEE D;  1TU3 F;  2JWD A;  3H1I J;  1M90 Q;  3E1R A;  3OJA B;  1NU1 G;  2OQQ A;  1PV3 A;  1URQ C;  2QG4 A;  3CWB G;  1HWT C;  1R5S A;  1AVY A;  3MP7 B;  2B88 A;  1BDC A;  1CI6 A;  1NHL A;  1YJ9 P;  1AA0 A;  2ZT9 B;  4WWI A;  1T8Z A;  1AVO A;  3CCM P;  3D70 A;  1FS0 E;  1DEE G;  1NVO A;  1YJW P;  3L74 E;  1RF1 A;  1S4X A;  2C0X A;  3UIA A;  5CHX A;  2HPC A;  2O3J A;  2H43 A;  3H1L J;  4YXW H;  4JYB A;  5H2F E;  2KS1 B;  1SQV G;  1N73 A;  5TJH A;  3RK3 E;  2ZYG A;  4DZO A;  3RK3 C;  3HE4 A;  4BXL A;  2PGD A;  5CBO A;  4TT3 H;  3AE8 C;  3BRT B;  3SWF A;  1BSH A;  4KX6 D;  1ZRT E;  1SQQ G;  1NAY A;  1YBK A;  3L73 D;  3L74 J;  3CX5 I;  1EDJ A;  1RF1 B;  2BCC E;  4JPZ B;  4HKZ H;  1IFJ A;  1R8E A;  1G1I A;  2R5B A;  3IAO A;  2K9J A;  1M1J B;  5BU8 B;  1KZU B;  4YTP D;  2E75 C;  2WMM A;  1SQB J;  5AW7 B;  2OYI B;  1NTM G;  3PJS K;  1ZR4 A;  1JO5 A;  5C39 A;  2N1T D;  3AEB C;  2YMK A;  2ZYD A;  4U3F J;  3RL0 B;  1SQP G;  2E5Y A;  1YYC A;  1IFI A;  2OYO A;  2WSE J;  2IDB A;  1R5L A;  4HJG H;  4IOI H;  4IL6 X;  4XFJ A;  4Y28 J;  5BU5 A;  4M3L A;  3CIR D;  3L73 J;  3CXH H;  4Y99 C;  1DD4 A;  1AV1 A;  3M0D C;  3LID A;  1ZOY C;  1KYO D;  5CJ0 A;  3VMZ A;  3AE4 D;  2Q3E A;  3NTN A;  3L71 E;  1Q86 Q;  1IO4 A;  1PGP A;  3L72 E;  3OW2 O;  1QVF O;  2Q6Q A;  3AE6 C;  3IF4 A;  3G71 P;  5KKZ B;  3AE3 C;  1CW5 A;  3BCC J;  4QMA A;  1L0L J;  1EZV I;  5AVT B;  1KYO I;  1BDD A;  5AW5 B;  1L0N D;  4EDF A;  3SFE D;  2JR8 A;  2IBZ E;  5KLV D;  3AE2 D;  3MHV A;  2QJK B;  3FXD A;  4DDG A;  1N73 C;  1LP1 B;  1Q90 D;  2B87 A;  5KTB A;  4H0L C;  1LNQ A;  3VON A;  5KAI E;  3G6E P;  5K5G B;  2FYU K;  3BAS A;  1BGY G;  4I6L A;  2IYP A;  3G9R A;  4W80 A;  3VMY A;  1PZQ A;  1FOS F;  3VRB C;  2E74 D;  2P7J A;  3CX5 H;  1ZR2 A;  2FKW B;  1JEK A;  1EZV D;  3HUS C;  4WY4 C;  2E74 B;  1YIJ P;  1GW3 A;  1P84 H;  2ACZ C;  1N8R Q;  2QEX P;  3KYQ A;  3L74 G;  3H32 B;  5DJT B;  1NTZ J;  2WSC H;  3VYI A;  2HPC B;  1PGQ A;  2WTY A;  1SVF A;  1J1D B;  4GOF A;  3H1K J;  1EDI A;  2P67 A;  3D71 A;  3HE4 B;  2XU6 A;  3AED C;  5B5E H;  4RO0 A;  3P4R C;  2KYV A;  3B4S A;  1GL2 D;  2Y9Z A;  3M9Q A;  2WPR A;  4D6T G;  1LWU C;  3U1A A;  1KFM A;  2K3R A;  3CLQ A;  4D6T J;  3CME P;  3AE7 C;  2J59 M;  3A7O A;  1NKN A;  4PD4 I;  4U7J A;  2HOD B;  2AEJ A;  1AJY A;  2WS3 C;  3FXE A;  4L75 A;  2UWJ E;  1S3J A;  2O1J A;  2KXP B;  2CPB A;  3GW6 A;  2OYH A;  1HGZ A;  1CZQ A;  1BCC J;  3P4Q C;  2H89 C;  3TK1 A;  4YSY D;  1FZF A;  1VQ4 P;  1SFC B;  1PIX A;  1K73 Q;  1AQT A;  1PP9 E;  5GTH E;  1KB9 D;  4C7R A;  2FXM A;  2M3B A;  1RQV A;  3OAK A;  5CCG D;  4YTM C;  1SP4 A;  1JMB A;  2WSE H;  1NH4 A;  1FU1 A;  3L75 G;  3U1C A;  3CCJ P;  3CC7 P;  2GA1 A;  4W7Z A;  3SFD D;  1JOC A;  2PFX A;  1LTA C;  2O01 H;  3L4F A;  1FZC A;  4IFM A;  1OX3 A;  2FYU J;  3Q5R A;  3IFM A;  3PH0 A;  3EFG A;  3A0B E;  3P7K A;  1PPJ G;  4XA4 A;  2PP6 A;  4GOD A;  4YSZ C;  1FZA A;  2V7Q H;  3H1L G;  2IZ1 A;  4DJG A;  2L5G B;  1PPJ D;  2OTL P;  1L0N K;  3H1J G;  4LLH A;  3TGU E;  2K88 A;  1FZB A;  2WU5 D;  4OVN F;  1QGK B;  1SQQ J;  1T3U A;  3AE9 D;  1LT9 A;  3RL0 D;  1Y8A A;  1L4A C;  3CCV P;  1GZL A;  2E5T A;  2QJY B;  4K35 A;  3CCR P;  3VOP A;  3RL0 g;  1QVG O;  1Y47 A;  1SQQ D;  5AW6 B;  4C46 A;  1BCC D;  1NTZ K;  3RBX A;  4I1L A;  4H44 C;  3GF3 A;  2QVA A;  3C1L A;  1SQB G;  3E7K A;  4RJT A;  1S5L X;  1LT9 B;  2ZVN B;  3MZW B;  3HUS B;  1H0T A;  4DHI B;  1VQ5 P;  1VPC A;  3L71 J;  4JQ0 D;  4YXD D;  3CC4 P;  3B8E B;  2WDR C;  3K5B A;  3EFF K;  1VQM P;  3VR9 D;  2M5A A;  2M3E A;  3H1H E;  1QEX A;  3AE8 D;  1NEN C;  2YMY A;  5KJ7 D;  3RK3 D;  1DEB A;  4OGQ C;  1K04 A;  1FE6 A;  1QLB C;  1RF0 C;  1U57 A;  4O9B A;  4YSX C;  5E79 H;  1SQX K;  2WVR A;  3CWB D;  1WRG A;  3L73 E;  2WQY D;  3BCC G;  1NTK K;  1M56 D;  4EOT A;  2H8P D;  1PFI A;  3P4P C;  2Q5U A;  2VRS A;  1X8Y A;  2BAS A;  1NU1 J;  1URQ D;  4BRY A;  5AVY B;  1IK9 A;  2I1K A;  2IBZ I;  4C7N A;  5AVZ B;  1E7P C;  2XZR A;  3AEF C;  2A06 G;  2FBW D;  2XNX A;  3CC2 P;  2B89 A;  4ZNC A;  1BGY D;  4D6T D;  2KZI A;  1RE4 A;  2NPS D;  3L75 E;  4BWN A;  2OYH C;  4WB4 A;  3NMD A;  1X9V A;  4B86 A;  2HR3 A;  4KJM A;  4KT0 J;  2KS1 A;  3VTP C;  1N73 B;  1LTS C;  3GLM A;  1UIX A;  1NEK C;  2YKO A;  4GKG A;  3WUU A;  4N78 D;  3HD7 B;  2WP9 D;  1L0L D;  1N7L A;  2WU2 C;  1GL2 B;  1HJB A;  1ZP0 C;  3L70 E;  1KYO E;  2D2C D;  2FYZ A;  3P4S D;  1EZV E;  1NTZ D;  3CX5 D;  2E76 C;  4EIJ A;  1KFY D;  4I7Z C;  3AEA D;  2QSI A;  4KHX A;  1NEN D;  1KF6 D;  1L0L G;  5AW1 B;  4FJV A;  3T97 B;  4Y99 B;  3VR9 C;  2AXC A;  1BSN A;  2V7Q J;  3AE5 C;  2A45 G;  2QIW A;  2LXB A;  2L91 A;  2R44 A;  3D6Y A;  2RH0 A;  1YI2 P;  2M0B A;  5AVR B;  1VF5 D;  3V4W A;  3ABV C;  1KIL A;  3SSU A;  1WT6 A;  3O6Q B;  1SS1 A;  2AXT E;  3WMM 0;  2PAJ A;  3CCQ P;  1KQL A;  1VQN P;  1EXJ A;  1VQP P;  1N86 A;  3NXS A;  5KLI C;  2QJP B;  1EQ7 A;  1JY2 P;  2E43 A;  2GUV A;  3TGU D;  2KLV A;  4NPD A;  1IK7 A;  1OFC X;  2W27 A;  2ZFC A;  2WPS A;  1L4A D;  3GHG A;  1VF5 C;  3L37 A;  1SFC A;  3AE9 C;  5CCH A;  2N1T B;  1NTK J;  3AE5 D;  4N3Y B;  3V4Q A;  1KIL B;  3KDP B;  3M91 A;  2WU5 C;  2FY8 A;  1M57 D;  3H1K G;  1ZME C;  1NU1 K;  2IBZ D;  3AEA C;  3KHU A;  4GDO A;  2WSC J;  1N7S B;  4YT0 D;  2ZT9 D;  1ZP0 D;  4DOJ A;  3D6Z A;  2H7H A;  2KIK A;  1Z56 A;  4GT1 A;  2AEF A;  3CL3 D;  3A3Y B;  1ZV8 A;  3GMA A;  5GTI E;  5E79 E;  1DIP A;  1P84 I;  2BEQ D;  2YIU B;  1GMJ A;  2B87 B;  1P84 D;  1SQQ E;  1MKM A;  1NTM J;  3CCU P;  3RGU A;  2W90 A;  1KTM A;  1T2K C;  4JBZ A;  1RE4 C;  2NPS C;  3H1J J;  1SQP D;  1EC5 A;  1L0V C;  3AEF D;  5CCG C;  1K05 A;  1RQU A;  3RK3 B;  1AQ5 A;  1NTM D;  2WSS H;  3MTU E;  4UB6 H;  3L72 D;  3CMA P;  2BEZ F;  1NTM E;  2A06 E;  3L72 G;  3TGU J;  1EDK A;  2Z4E A;  2OTK E;  3P4Q D;  1JNM A;  2RKL A;  2MKV A;  2OAR A;  2KK7 A;  2WQY C;  4I7Z B;  2W6B A;  3LW5 H;  2R3S A;  1NTK G;  3S9O A;  3V2Q A;  2H88 D;  2B76 D;  2V4H A;  4YSX D;  2J5U A;  4K3A A;  2OYH B;  4TLF A;  4U3F G;  3L71 G;  3AE7 D;  4OGQ D;  3RK2 B;  1SQV D;  1H8A A;  2FYU D;  3O6Q A;  2LXC B;  1Q7Y Q;  3N7N A;  2FYU E;  3MGN A;  1BGY E;  2YO3 A;  2E76 B;  2QM8 A;  1MZ9 A;  3VR8 C;  2KOG A;  2FFD A;  2IBZ G;  4YXD C;  3BVH A;  1DH3 A;  5GTH H;  3V6I A;  1JM0 A;  2JEE A;  1LJ2 A;  1FJK A;  1M1J C;  3NFQ A;  2Q3I A;  3SWK A;  2K37 A;  1FDM A;  1FBM A;  3KPE A;  2C9N Y;  5AVW B;  1VQ8 P;  4OH8 B;  2D2C B;  3H1I G;  4NPF X;  4WY4 D;  1WMK A;  1Q82 Q;  1SQX D;  5KAF H;  4PD4 D;  3V2P A;  3CCL P;  5APS A;  2FFD B;  2E74 C;  3WU2 E;  2FYN B;  3H6P A;  2E42 A;  5C3J D;  2N9B A;  1SFC D;  1L2P A;  4PD4 E;  3L70 D;  3GG2 A;  2HOD A;  3BAT A;  3CD6 P;  1NOH A;  1YJN P; 
#chains in the Genus database with same CATH homology
 2YMK A;  2WQY C;  4I7Z B;  1VF5 C;  2WPV B;  3R4Y A;  1S5L X;  2E74 B;  3S9O A;  3AE9 C;  2OQQ A;  2H88 D;  2YIU C;  1PV3 A;  1RQV A;  2B76 D;  3AE3 D;  1YQ3 C;  2WSE J;  2IDB A;  3LW5 J;  4PV1 B;  4YSZ D;  3VR8 D;  2WSF J;  1FDI A;  2ACZ C;  2J5U A;  4YSX D;  4IL6 X;  4OGQ B;  1KQF B;  3Q5P A;  3AE5 D;  4YTM C;  1OW8 A;  4XFJ A;  3P4R D;  4Y28 J;  4KT0 J;  2NZ2 A;  1KQG B;  2WU5 C;  2E75 B;  4KX6 C;  3CIR D;  3AE2 C;  3AE7 D;  1HJ0 A;  2WDR C;  2ZT9 B;  3VRA D;  3GLM A;  1ZME C;  1S1C X;  5M1B A;  3SFE C;  3Q2Y A;  1UIX A;  1DD4 A;  4OGQ D;  1YQ4 D;  3AEC D;  4YT0 C;  1VL2 A;  3C8V A;  1NEK C;  2WDQ D;  2O01 J;  3AEA C;  3D70 A;  2FXP A;  4YTN D;  1ZOY D;  1ZOY C;  3Q1M A;  4GDO A;  2BS4 C;  2WP9 D;  2WSC J;  3O6Q A;  5KKZ C;  1NGM B;  1OMI A;  3AE4 D;  3AED D;  3SFD D;  2WU2 C;  4H44 C;  1EXI A;  3VR9 D;  4YT0 D;  2ZT9 D;  4H13 C;  1ZP0 C;  1ZP0 D;  3D6Z A;  3D71 A;  2D2C D;  3P4S D;  2WDR D;  3FGA D;  3CIR C;  3AE4 C;  3AE8 D;  1NEN C;  5C2T D;  3AED C;  4H13 B;  4R4L A;  3SFD C;  3AE6 D;  2E76 C;  1FDO A;  2JO1 A;  1KFY D;  3Q5R A;  3GMA A;  4I7Z C;  4YTN C;  3AEA D;  1PL5 A;  3P4R C;  2QSI A;  2E76 B;  1DIP A;  4OGQ C;  1K04 A;  3AE6 C;  2BEQ D;  2ACZ D;  2G3A A;  1NEN D;  3VR8 C;  4YSZ C;  1GMJ A;  1KF6 D;  1KF6 C;  3T97 B;  4YXD C;  1QLB C;  3RK3 E;  3AE3 C;  4H13 D;  2H88 C;  3VR9 C;  2FYN C;  4RKU J;  1MKM A;  3GF7 A;  1U57 A;  1KFY C;  2E76 D;  2V7Q J;  3AE5 C;  4TT3 H;  4YTM D;  4YSX C;  1KOR A;  3B71 A;  3AE8 C;  5C2T C;  2QIW A;  2D2C C;  1YQ4 C;  3P4S C;  1YQ3 D;  4Z1M H;  3SFE D;  1KTM A;  4H44 D;  2ZT9 C;  3D6Y A;  3AE7 C;  2WU2 D;  3AE2 D;  4KX6 D;  2WU5 D;  2WP9 C;  1ZRT E;  3VRB D;  2QJK C;  1VF5 D;  2QJY C;  2WQY D;  2JP3 A;  4YSY C;  2WDQ C;  1NEK D;  4YTP C;  3AEC C;  1JB0 J;  1DD3 A;  3ABV C;  4PV1 D;  2QJP C;  4H44 B;  1L0V C;  3VRA C;  3AEE C;  4U7J A;  3AEF D;  1AJY A;  2WS3 C;  3P4P C;  2D2C B;  1NYH A;  1OW6 A;  1Q90 D;  3AEG C;  1VF5 B;  3AE9 D;  1K05 A;  3Q5S A;  2BS2 C;  5C3J C;  1WMK A;  1EXJ A;  1KMI Z;  1RQU A;  3EWK A;  2K9Y A;  4PV1 C;  3AEB D;  2WDV D;  4R4M A;  1HF9 A;  2B76 C;  2H89 D;  5KLI C;  4H0L C;  4YXD D;  2E74 C;  3AE1 C;  1OW7 A;  2P10 A;  2G8Y A;  2BEZ F;  1Y9B A;  4H0L D;  5L8R J;  2E75 D;  1R8E A;  2H89 C;  3P4Q C;  3IAO A;  5C3J D;  2WS3 D;  3P4P D;  3IN6 A;  2FBW C;  3RL0 g;  1L0V D;  2BS3 C;  3ABV D;  4YTP D;  2E75 C;  3P4Q D;  4YSY D;  3Q3D A;  3G9R A;  1E7P C;  1IK7 A;  4H0L B;  3AEG D;  3H25 A;  3VRB C;  1KIL E;  1PIX A;  2E74 D;  3AEF C;  3AEE D;  1TU3 F;  3AE1 D;  2FBW D;  2MKV A;  3GF3 A;  2WDV C;  3AEB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...