3AE8C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae8C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae8C02
2WDVC 4YTMC 4YSXD 3AECD 4YTNC 2WS3C 3VR8D 2H89D 4YSYD 1OW7A 3P4PC 3AEEC 2FBWC 3P4QC 5C3JD 4YXDD 3CIRD 3AEGC 1YQ3C 3AE1D 1K04A 2WDQD 2WU2C 3AEFD 1YQ4C 2ACZC 1KF6C 3AE2C 2WQYD 2BS4C 3AE3C 2WP9D 1L0VC 1ZP0D 1OW8A 4KX6D 1NENC 4YTPD 4YSZC 2H88C 3VRBD 3VRAC 5C2TC 3AE8C 1K05A 3VR8C 1ZOYC 1KTMA 3SFED 3P4SC 3AE7D 4YT0D 3SFDC 3AE4D 3AE6D 3VR9D 1NEKC 3AEBC 1KFYD 2WQYC 2WU5D 3AE5C 4YTMD 4YTND 2WDRC 2BS2C 3AE9C 2BS3C 3B71A 2WS3D 1ZP0C 3P4PD 3P4RC 3ABVD 3AEDD 1QLBC 3AEED 3P4QD 4YSXC 3AECC 1E7PC 3AEGD 1YQ3D 2H89C 4YSYC 3AEAD 2WU2D 2ACZD 1KF6D 3AE2D 5C3JC 2G3AA 3SFEC 4YXDC 3AE3D 3CIRC 2B76D 3AE1C 2WDQC 3AEFC 1PV3A 3S9OA 3AE6C 1NEND 2WDVD 4YSZD 2H88D 2WU5C 2WP9C 3VRAD 5C2TD 3AE8D 4KX6C 4YTPC 3ABVC 2FBWD 3AEDC 1ZOYD 3VRBC 3P4SD 3SFDD 1YQ4D 3AEAC 1NEKD 3AEBD 1OW6A 3AE5D 2WDRD 1L0VD 3AE9D 3AE7C 4YT0C 2B76C 3AE4C 3VR9C 3P4RD 1KFYC
chains in the Genus database with same CATH superfamily
2WDVC 2XZRA 1KYOD 1RF0A 3VP8A 4WVZA 5C3JD 3WMM0 2QIWA 2BCCG 2FYUJ 5APSA 1SQXD 1N73A 1OVVA 4DZOA 1PPJD 4C7RA 2HODB 2WZ7A 1DD4A 2I1KA 3IFMA 2A45H 3PJSK 1L0LD 1KQLA 2QJPB 3NFQA 2KZJA 1OX3A 1HJBA 2K1AA 1PGQA 1YIJP 2AXTH 4W7ZA 5KKZB 3FX0A 1NEKC 1JOCA 3W67A 1N73B 2N9BA 4YTND 5KLIB 2ITAA 3H32A 1NTMK 2E74B 2SPZA 1JY2N 2WU2D 4QMAA 1JY2O 5AW5B 2BASA 2P1JA 1L0NE 4A7PA 3RBZA 1BE3G 2OYHA 2FFDC 2JDIH 1RE3C 3L73D 2R32A 2E75D 3BATA 2XNXA 2W83C 2AXTE 2WSEJ 3P32A 5C39A 1A02F 5M1BA 1NU1D 2IYOA 2ZT9D 1S5LH 1SQPG 3H1IJ 2N1TB 2WPRA 4H0LD 5CMZA 3FXDA 2E76D 5AW9B 1IK9A 1IFIA 4YT0C 1XTCC 5KLVG 1JO5A 3BVHA 1VQ9P 1S3JA 2WS3C 1JCDA 2HYNA 1HGVA 3AEGC 3M9BA 5E79H 3E7KA 2W27A 4DHIB 2I8DA 1NTME 1CSBA 5AW8B 1P84E 5C2TC 2WSFJ 1ZOYC 1RE4A 1ZR4A 1MFTA 2E75B 1X8YA 3AE6D 1LWUC 4KJMA 3BCCE 4HKZH 4L74A 3D6YA 1RH5B 2ZT9B 2BS2C 2AXCA 3Q1MA 2JEEA 2XKMA 4H0LB 1BCCG 2E76B 3B5NC 1VF5C 2KLVA 2V4HA 3H1KE 4GODA 2IFMA 2ZYDA 1NJIQ 4B86A 1PP9J 1L0NJ 4WBAA 1IJDB 3OA7A 2WMMA 3L72J 5APXA 3OAKA 4H13B 3MUDA 4KX6C 3CI9A 3D71A 3O6QA 2XU6A 2YMKA 4IL6X 3CC7P 4GKGA 4W80A 2IBZG 2BCCE 1OW6A 1SQBJ 1SQPK 3H1JG 4K3AA 2HG5D 2JR8A 3M9QA 5APWA 1J1EB 4YPCA 2G8YA 2JJLA 1PGPA 2IDBA 4YTMC 1VQLP 4C46A 2V7QH 3AEEC 2N9YB 3CLQA 2E42A 1J2JB 4PD4D 1GW4A 1FZCC 2BS4C 3AE3C 3PRJA 3RBXA 3H1ID 1VQOP 1S9KD 4WY4A 1RF1A 4OWFA 1USEA 4XE5B 1KB9E 4RO0A 1L0LK 1R5SA 1BE3E 3NTNA 2WDRC 4EDFA 3IF4A 4M3LA 3MGNA 3ABVD 3P4QD 3TGUJ 2FYUG 3AECC 1AQ5A 2H89C 5GTIH 2P7JA 2HPCA 2OYIC 1SP4A 1SQPE 1SFCB 1NGMB 3L71D 2WDQC 3L35A 2AEMA 1IC2A 4YSZD 3GF3A 2IBZI 1NO4A 2FBWD 1USDA 1KYOE 3L74J 5H2FH 2O1JA 1YQ4D 4N78E 1LTGC 2P10A 3RK2D 1L0VD 2HPCB 2HR3A 3VR9C 1JNMA 4RKUJ 4YSXD 4YSYD 1OW7A 3L70J 1LTBC 1KFMA 1SQVD 2KSEA 1L0LE 4YXDD 1M1JB 1K04A 3AEFD 1VQMP 1KF6C 3TK1A 2WPSA 2Z5HA 2WSCJ 1R5LA 1ZP0D 3C1LA 2WTYA 4LC1A 4IFMA 3H1IG 1SQBD 1FE6A 3NMDA 4DHJA 2XV5A 3HTKA 4H44D 3WU2E 4UB6E 3CCEP 1LTIC 3O8ZA 3LW5J 1KFYD 4ZMDA 2WU5D 3R2PA 4UB8H 2C9LY 2A06D 3M0DC 3P4RC 5KJ7D 3RK2B 1KC8Q 4HB1A 1WMKA 3AEAD 1FZBA 2FYUK 1GW3A 4TT3H 2NPSA 2M3EA 1N7LA 4BWNA 2OYHC 1GL2C 1N7SA 2R44A 4JYBA 1SQQD 1DEBA 3VRAD 3A2AA 2WT7A 3T97B 3E1RA 5KJ7A 3VRBC 4RESB 2Q1KA 3RL0g 1L4AD 3AE5D 2Q7CA 5TISH 4WB4A 3H1HD 4H44B 1ZMEC 4L73A 3HD7D 1SQXJ 1Y8AA 2GM4A 1VQ7P 2WT7B 1DH3A 2POHA 1PP9G 1L0NG 1YBKA 4AQRD 3IN6A 3L72G 1L4AA 1L0LJ 1MKMA 1G1IA 3L74D 1HWTC 4OVNF 4LDTA 3HD7A 3CXHE 4K35A 1K05A 3VTPC 3V2PA 2FYUE 5TISE 4U3FD 2QJKC 2FY8A 2FYNC 2E43A 3SFDC 2KUBA 3V2NA 1R8EA 2D2CC 1X0TA 3VONA 1L4AB 5DJTB 4R4MA 2W90A 1H0TA 4I6LA 1ZRTE 3G9RA 3C8VA 1ZXGA 2I1JA 2W6JH 1DD3A 1YQ3D 2WSEH 5CJ0A 3B8EB 3L73J 2Y9YA 4I7ZB 4I2LC 1S72P 1LP1A 3AE6C 1NU1J 3L37A 4GIFA 3TF5A 1JEKA 3GLMA 3MUDC 2WP9C 1PGOA 1YITP 4YTPC 2KI7B 1NKNA 3RL0D 4W7YA 1GDTA 5CCGD 1HVVA 1SVFA 3BASA 1QGKB 2P58A 4OGQC 1GD2E 4PV1B 1LGHB 4IL6E 3AE4C 5CBOA 3TGUG 2K3RA 2FKWB 1VQ8P 1RQVA 3H1IE 2B87A 1H89A 2H43A 1AVYA 5CCHD 3G6EP 3CCLP 1KMIZ 1AJYA 1OXZA 1T8ZA 1TFFA 1Z56A 3PH0A 2QJYB 1T6AA 2H88C 4WY4C 2KLUA 1RF1C 2FXPA 1X79B 1M7LA 1DX7A 1KD1Q 2K37A 1SQBK 2P2UA 2B87B 5CCHA 1H88A 3RL0B 1URQD 2MJZA 4Y99C 2ZYGA 1FBMA 3RK3E 4EOTA 3L70G 3L71E 1OVRA 3WUTA 2N1TD 3AEDD 3CCJP 1RY3A 2ACZD 3AE2D 2R3SA 3GMAA 1FZAA 2G3AA 1P84I 3N7NA 3H1LD 1FDIA 3CIRC 1FZFA 5APUA 3MHVA 1KFNA 1VQKP 1URQA 1GU4A 1HBWA 2XNDH 1M56D 4L76A 4ZNCA 4PJ0E 2N1TA 3ABVC 1LTJB 3Q5SA 3KQGA 1SQQK 3P4SD 4OH8B 2AEFA 3AEBD 1PP9E 3D70A 3I55P 3RK3C 3L72E 1AFOA 3TSIA 1SS1A 3QH9A 4U7JA 4JBZA 3G71P 3SWFA 3P4PC 1URQB 1DIPA 2FBWC 1S2EA 2HLOA 1SQBE 1YQ4C 5AVQB 2FYZA 1P84H 1VQ5P 2PRRA 5AW3B 1L0VC 1EXJA 2RMZA 3WUVA 1NTZJ 1Y47A 2BEQD 2A06E 1H8AA 2RN0A 1OFCX 4H13D 3N4XA 1SQXG 1PPJG 1J1DC 3S1KA 1GL2B 1ZP0C 3OJAB 1QLBC 1SQQE 3B4SA 3L71J 2IZ1A 3W68A 1T2KC 3KZIE 1L0LG 3JCUH 5AVTB 2NPSC 2OTKE 4I1LA 1PIXA 1DEEG 1EDIA 3VOPA 1YTZT 1N7SC 5AW6B 2W6AA 3S9OA 1KB9I 2WVRA 1HJ0A 2WU5C 3TGUE 3TNUA 1QVGO 3F5HA 4JF7A 5KJ7C 2QA4P 3KHUA 4DCKA 1FJPA 3KPEA 1QLED 3AEAC 3FWNA 1QL1A 1OMIA 1UIIA 1FAVA 3EQ2A 1SQVJ 2ZVOB 3EFFK 1KILB 3JCUE 3GHGC 1PZQA 3C9IA 3L74E 3L73G 4JYCA 1FDOA 3IAOA 3TNUB 3SWKA 3AE1D 1NU1G 4U3FE 1KYOI 1LT9C 2OQQA 4GOEA 4BRYA 3P8CD 1KB9H 2B88A 3L70E 1K8AQ 4DDGA 1D7MA 1SFCD 2VRSA 2WPQA 5APYA 5CHXA 3SFED 3D6ZA 2Z5IA 3L75D 1NWQA 3HUSB 3R4YA 2YIUB 2FXMA 3BRTB 3CMAP 1SQXK 2ZXEB 1U7JA 3OW2O 4BRYB 2YMYA 2H7HA 1HTLC 1SFCA 1LTAC 1SQQJ 5BU5A 2KP8A 1NTZD 1KYOH 1M57D 5KAIE 2Y9ZA 1GU5A 5APQA 1K9MQ 2P67A 5AVRB 3FGAD 5APVA 3H1HJ 5BVZA 2IZ0A 1LTSC 3CX5E 1NEKD 3U59A 1MFZA 2O3JA 3SSUA 3AE7C 2UWJE 1ZLLA 1KZUB 3II6A 4NPFX 2Q3IA 1EZVD 2JWAA 1M1JA 1HUCA 2IX7C 2Q6QA 1LT1A 4LLHA 1MUUA 2Q3EA 3V2RA 3WU2H 1NU1K 1MZ9A 1SQXE 4U3FJ 4UB6H 2QJPC 1NENC 1PPJE 2KK7A 1RF0C 2Q9IA 3AE8C 2C9NY 3MP7B 1Q90D 1N73C 2JO1A 4YT0D 5CCHC 3H25A 5KLIC 3GW6A 1KN7A 1YTZI 1OVUA 2FFDA 2E74C 1OIPA 3AE9C 3H1LE 2BS3C 2WS3D 3HE4B 3A5TA 1E7PC 2QEXP 1FU1A 4AYCA 3AEGD 2QSIA 1VDFA 5C3JC 3CCMP 1VL2A 2PGDA 3CXHI 5KAFH 1PV3A 5BU8B 2R3CA 4D6TD 3T97A 1CI6A 5C2TD 2FFDB 2N1TC 1BSNA 3AEDC 1ZOYD 4L75A 4LGDE 1NTKD 3L73E 1S5LX 1M90Q 2L91A 1WRGA 4N3YB 1NU1E 1JM0A 1FOSF 5B66E 3F89A 4DOJA 2V7QJ 4ZKUA 3B5ND 3L71G 1VF5D 2O1KA 4YTNC 2YXQB 2YKOA 5B5EE 2OYOA 5KAFE 1CI6B 3Q5PA 4HH2A 2WU2C 1NTMD 3FXEA 1LWUA 2Y0DA 3CXHH 1GK4A 3SWYA 4YXWH 4KT0J 1P84D 1W2EA 4GOFA 1FDMA 4KX6D 2IFNA 1BGYD 5KLVJ 3CL3D 2E75C 3BCCD 1W5CE 1KTMA 4ASVA 2ZT9C 1XTGB 1SQVG 3A0HE 1YJWP 1Y9BA 4H0LC 5AW0B 2E76C 1U57A 4YTMD 3CWBD 1YJ9P 2E5TA 4JQ0D 1LWUB 3H1KD 3V4WA 2ZFYA 4PV1D 5AW7B 3AEED 3H1LJ 5CBNA 4IOIH 2M0BA 1SQBG 3B5NB 1VF5B 1RE4C 2ZVNB 5GTHE 2A45G 3AE3D 2B76D 2GA1A 2GUSA 4H13C 3G3ZA 3KYQA 4NPEA 1FC2C 2O01N 2L5GB 1NTZK 2ZYAA 4IL6H 2BCCD 4GDOA 1BCCJ 2A06G 3GHGB 1ZN5A 2J59M 3Q3DA 1J1EC 1FZCA 1VQ4P 5DJUB 1QVFO 2WDRD 3V5BA 4C7NB 1FOSE 3EFGA 1AQTA 4MN4C 2W6BA 1S4XA 3AECD 2O01J 1SQQG 1EXIA 4JPZB 3P8CE 2H89D 1AA0A 2KB7P 1JTHB 2WDQD 5AW2B 2B9BA 5EFWB 2GUVA 4PD4E 1FZCB 3H1HG 3L75E 1FS0E 4KHXA 2OGUA 3VMYA 2KNCB 3A7OA 1S9KE 1BE3D 2OYIA 5CCGA 5AVZB 2R5BA 2WSFH 3V2QA 3VR9D 3CCSP 5AVYB 1CW5A 1SQVK 1NHLA 1NTZE 3KXDA 3L74G 1JUNA 1SQPD 1TU3F 1BDCA 1KF6D 3P8MC 3SFEC 4U3FG 4PJ0H 5KLVD 3EWKA 2QE7H 2OYIB 3FWLA 3HRNA 4DJGA 2K9YA 1LTJA 3M91A 1AVOA 1QL2A 5AVUB 3L36A 4N78D 2XDJA 1EZVE 3PTZA 1N86A 2KZIA 1NTKK 1M8OB 4CPGA 2LXCB 1BSHA 3P4RD 1IFJA 3CCQP 2M8RA 1L2PA 3VR8D 1IFPA 1M1JC 2QG4A 3Q2YA 3CCUP 1Q7YQ 2ZXXA 3P4QC 3UIAA 1KV4A 3CD6P 1T3UA 1GL2D 3MIWA 2PP6A 1SQVE 1BCCD 1OW8A 4NPDA 1YHQP 3M0DA 4YSZC 3VRBD 1KQFB 1KORA 1FZEA 1N2DC 3L75J 4XA4A 5AVSB 2H8PD 4HYTB 1HF9A 1GL2A 2YO3A 2LR2A 3KZIH 2QVAA 3RK2C 1AV1A 4D6TE 2WPVB 4YSXC 3H32B 2IBZD 3I5CA 4YSYC 3H1JD 1KILD 4YXDC 1NTKE 2MKVA 3AEFC 1FJKA 2OYHB 1Q81Q 1UIXA 4Y28J 1OWAA 4EI2A 3SFDD 3MZWB 4H44C 2D2CD 1JY3P 2YXRB 1KILA 1LJ2A 2YKPA 1E5WA 1YYCA 3H1LG 4N6JA 1KFYC 1S5LE 1MV8A 3PP5A 2B89A 3H1HE 1IFMA 3BRVB 3VYIA 1EC5A 3LIEA 1BGYE 5AVXB 2WITA 4IFFA 2WQYD 3CX5I 2WP9D 3CXHD 1EDJA 2FYUD 4YTPD 2WSCH 3M0AA 5AVWB 3K5BA 1EDKA 4AUWA 1VQPP 3VRAC 3CWBE 5E79E 2OTLP 4OGQD 2IPPA 3G4SP 1IZNB 4FJVA 4EIJA 2LXBA 3HUSA 1ZR2A 5APTA 3AE4D 1L4AC 2QJKB 4R4LA 1ZRTD 2FYNB 3JC22 3WUUA 3PHLA 3AE5C 3CC4P 3LW5H 4XFJA 1OZHA 2D2CB 2ZAEB 3P7KA 3HD7C 2Y0CA 1W2BO 4I7ZC 2C0XA 3CC2P 4D6TJ 1VPCA 5KAIH 2M5AA 2Z4EA 2J5UA 2WWWA 2OTJP 1Q86Q 3Q5RA 2WDVD 1NTKJ 2H88D 1U7MA 1IO4A 4WY4D 3CX5H 3IR9A 5KLVK 2KSJA 4PV1C 3V6IA 1X22A 2Y0EA 1G1JA 1PFIA 2DW3A 3O6QB 2JWDA 1PL5A 2CPSA 4ASWA 4OGQB 1NAYA 2M5AB 2B76C 1EDLA 2RH0A 1NTMJ 2NRGA 4TLFA 1NVOA 3M06A 3VMZA 1RHZB 3CIRD 1YQ3C 1KQGB 4IFDK 2KXPB 2QJYC 5L8RJ 1BGYJ 5AW4B 2IYPA 2CK3H 3BCCJ 1GK6A 3VMAA 3USSA 3CCVP 4DT0A 1PGJA 1JY3N 1JY3O 3TDKA 1QX8A 3CWBJ 4WY4B 3RL0C 4ZKPA 5CCGC 2ZJSE 3H1KJ 3RK3D 1RF1B 3CMEP 1N8RQ 1HGZA 3A0BH 2W8ZA 3PLNA 3QWOC 3TYYA 3HE4A 1IFDA 5KLVE 3P4PD 1EQ7A 4Y99B 3ITKA 1KQSO 5KKZC 1IFNA 2LKMA 1A02J 3NXSA 2BCCJ 2BEZF 5GTIE 1LTJC 1RE3A 3L75G 4Z1MH 1G2CA 1IK7A 1VQ6P 1PP9D 1L0ND 5B66H 2O01H 2OARA 3A0BE 3L72D 1JMMA 2FXOA 1NH4A 5B5EH 4RJTA 4HJGH 2RKLA 5TJHA 1LTTC 1NTZG 5H2FE 1URQC 2QM8A 3RK3B 2KYVA 1SLQA 2ZFCA 1BCCE 3VP9A 1T2KD 2PFXA 3HE5A 1NOHA 2NPSD 2AEJA 1G2CB 1N7SD 2ACZC 2K9JA 3AE2C 2M3BA 2PAJA 2JKVA 1NAFA 1BE3J 1BDDA 5KTBA 1S1CX 2KIKA 3A0HH 3JSVC 1ZV8A 3VR8C 2R5DA 1EZVG 1VQNP 3P4SC 3HTKB 1X9VA 3HE5B 2IBZE 2WSSH 1SQPJ 3AEBC 2KOGA 3H1JE 2CPBA 1KILE 5GTHH 2K9JB 3RGUA 4O9BA 1GZLA 1ZW0A 3B5NA 1J1DB 2KS1A 4PD4I 1NYHA 5AVVB 3ZDMA 4UB8E 1JCCA 4DHZA 3MTUE 3TGUD 1LNQA 3CPWO 2NPSB 1CZQA 1N7SB 3GHGA 3U1AA 2K88A 4I6MC 4EYYQ 2KS1B 4C7NA 1KILC 2J58A 1LT9A 5CJ4A 3VN0A 3L4FA 2NZ2A 1QEXA 4D6TG 5K5GB 1FZGA 2C0WA 1JTHA 3E1IA 4PD4H 1Q82Q 3KDPB 1NTKG 1YJNP 1JMBA 1RQUA 3H6PA 3L70D 1EZVI 3VMXA 1E79H 1JY2P 2YNYA 2KNCA 5AW1B 3MD0A 4WWIA 1LT9B 2E5YA 3GG2A 1M1KQ 4DDIA 3GF7A 3HD7B 3HUSC 1NKZB 1GMJA 2YIUC 4GT1A 3I56P 3AE7D 1GTWA 1K73Q 2WQYC 1NTMG 3B71A 3H1JJ 2QM7A 1T3JA 3V4QA 1KB9D 1JB0J 1H0TB 3M9HA 3S4RA 1BGYG 3A3YB 1YI2P 2QRXA 3BCCG 3AE1C 1NEND 1HH0A 1Q2NA 1LP1B 2A45I 3U1CA 3LIDA 2YKQA 3AE8D 3CWBG 3CX5D 3H1KG 2JP3A 1SFCC 2HODA 2Q5UA 3CCRP 2HFED 1L0NK 4BXLA 2E74D 3AE9D 1WT6A 2YO2A
chains in the Genus database with same CATH topology
1VF5D 2NZ2A 2WDVC 4RKUJ 2IDBA 4YTMC 4YSXD 3AECD 2O01J 4U7JA 4YTNC 1EXIA 1RQVA 2WS3C 3VR8D 2H89D 4YSYD 3Q2YA 1OW7A 3P4PC 1FDOA 1DIPA 3AEEC 2FBWC 3IAOA 3P4QC 5C3JD 3Q5PA 2QIWA 4YXDD 3CIRD 3AEGC 1YQ3C 1KQGB 3AE1D 1K04A 2WDQD 2WU2C 3AEFD 1YQ4C 2ACZC 3IN6A 1RQUA 1KF6C 2QJYC 1MKMA 3AE2C 5L8RJ 2WQYD 2BS4C 2WSCJ 1KMIZ 3AE3C 1AJYA 2OQQA 4KT0J 2WP9D 1L0VC 1ZP0D 1OW8A 1DD4A 2QJPC 4KX6D 1NENC 1EXJA 4YTPD 1S1CX 4YSZC 2H88C 3VRBD 1KQFB 1KORA 4YT0D 3VRAC 5C2TC 3AE8C 1K05A 2BEQD 2E75C 2WSFJ 4H44D 4OGQD 3VR8C 2FXPA 2QJKC 1ZOYC 2FYNC 3GF7A 1KTMA 3D6ZA 1Q90D 3SFED 1ZOYD 3P4SC 1HF9A 2ZT9C 2JO1A 4H13D 2YIUC 1GMJA 2E75B 3SFDC 3AE7D 3LW5J 1Y9BA 5KLIC 3H25A 3AE4D 3AE6D 3VR9D 4R4LA 1NEKC 3AEBC 4H0LC 1KFYD 3D6YA 2E76C 2WQYC 1R8EA 2WU5D 1U57A 1KILE 2D2CC 2ZT9B 3AE5C 3R4YA 4YTMD 4YTND 2E74C 3RK3E 2BS2C 2WDRC 3AE9C 3B71A 2BS3C 3Q1MA 2WS3D 1ZP0C 4R4MA 4H0LB 1ZRTE 3G9RA 4XFJA 3P4PD 3ABVD 2E76B 3P4RC 3AEDD 1VF5C 4PV1D 2D2CB 1QLBC 3AEED 1TU3F 3P4QD 3C8VA 2WPVB 2E74B 3AECC 1JB0J 4YSXC 1E7PC 1NYHA 4I7ZC 1DD3A 3AEGD 1YQ3D 1WMKA 2H89C 4YSYC 3AEAD 2WU2D 2ACZD 5KKZC 2QSIA 1VF5B 1KF6D 2J5UA 4TT3H 3AE2D 5C3JC 3GMAA 2G3AA 1VL2A 3SFEC 1PIXA 4I7ZB 4YXDC 3AE3D 1FDIA 3CIRC 2B76D 3AE1C 2MKVA 4H13C 3AEFC 1NGMB 2WDQC 1PV3A 3EWKA 3S9OA 3AE6C 1NEND 3Q5RA 2WDVD 2BEZF 2K9YA 4YSZD 2H88D 1HJ0A 3GF3A 2WU5C 3GLMA 3VRBC 4H13B 2WP9C 3P4RD 3VRAD 5C2TD 3AE8D 4KX6C 2E75D 4Z1MH 1UIXA 4YTPC 1IK7A 3ABVC 2FBWD 2WSEJ 3AEDC 3FGAD 3O6QA 4GDOA 2YMKA 2JP3A 4PV1C 3T97B 3D71A 3Q5SA 4Y28J 3P4SD 5M1BA 4IL6X 2ZT9D 4OGQC 3SFDD 1YQ4D 4H44C 3RL0g 3AEAC 3Q3DA 1NEKD 1S5LX 4H0LD 3AEBD 4PV1B 3D70A 1PL5A 1OW6A 2E76D 2P10A 1OMIA 2D2CD 3AE5D 2E74D 1L0VD 2WDRD 4OGQB 3AE9D 3AE7C 4YT0C 4H44B 3AE4C 2B76C 1ZMEC 3VR9C 2V7QJ 1KFYC 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDV C;  4YTM C;  4YSX D;  3AEC D;  4YTN C;  2WS3 C;  3VR8 D;  2H89 D;  4YSY D;  1OW7 A;  3P4P C;  3AEE C;  2FBW C;  3P4Q C;  5C3J D;  4YXD D;  3CIR D;  3AEG C;  1YQ3 C;  3AE1 D;  1K04 A;  2WDQ D;  2WU2 C;  3AEF D;  1YQ4 C;  2ACZ C;  1KF6 C;  3AE2 C;  2WQY D;  2BS4 C;  3AE3 C;  2WP9 D;  1L0V C;  1ZP0 D;  1OW8 A;  4KX6 D;  1NEN C;  4YTP D;  4YSZ C;  2H88 C;  3VRB D;  3VRA C;  5C2T C;  3AE8 C;  1K05 A;  3VR8 C;  1ZOY C;  1KTM A;  3SFE D;  3P4S C;  3AE7 D;  4YT0 D;  3SFD C;  3AE4 D;  3AE6 D;  3VR9 D;  1NEK C;  3AEB C;  1KFY D;  2WQY C;  2WU5 D;  3AE5 C;  4YTM D;  4YTN D;  2WDR C;  2BS2 C;  3AE9 C;  2BS3 C;  3B71 A;  2WS3 D;  1ZP0 C;  3P4P D;  3P4R C;  3ABV D;  3AED D;  1QLB C;  3AEE D;  3P4Q D;  4YSX C;  3AEC C;  1E7P C;  3AEG D;  1YQ3 D;  2H89 C;  4YSY C;  3AEA D;  2WU2 D;  2ACZ D;  1KF6 D;  3AE2 D;  5C3J C;  2G3A A;  3SFE C;  4YXD C;  3AE3 D;  3CIR C;  2B76 D;  3AE1 C;  2WDQ C;  3AEF C;  1PV3 A;  3S9O A;  3AE6 C;  1NEN D;  2WDV D;  4YSZ D;  2H88 D;  2WU5 C;  2WP9 C;  3VRA D;  5C2T D;  3AE8 D;  4KX6 C;  4YTP C;  3ABV C;  2FBW D;  3AED C;  1ZOY D;  3VRB C;  3P4S D;  3SFD D;  1YQ4 D;  3AEA C;  1NEK D;  3AEB D;  1OW6 A;  3AE5 D;  2WDR D;  1L0V D;  3AE9 D;  3AE7 C;  4YT0 C;  2B76 C;  3AE4 C;  3VR9 C;  3P4R D;  1KFY C; 
#chains in the Genus database with same CATH topology
 2WDV C;  2XZR A;  1KYO D;  1RF0 A;  3VP8 A;  4WVZ A;  5C3J D;  3WMM 0;  2QIW A;  2BCC G;  2FYU J;  5APS A;  1SQX D;  1N73 A;  1OVV A;  4DZO A;  1PPJ D;  4C7R A;  2HOD B;  2WZ7 A;  1DD4 A;  2I1K A;  3IFM A;  2A45 H;  3PJS K;  1L0L D;  1KQL A;  2QJP B;  3NFQ A;  2KZJ A;  1OX3 A;  1HJB A;  2K1A A;  1PGQ A;  1YIJ P;  2AXT H;  4W7Z A;  5KKZ B;  3FX0 A;  1NEK C;  1JOC A;  3W67 A;  1N73 B;  2N9B A;  4YTN D;  5KLI B;  2ITA A;  3H32 A;  1NTM K;  2E74 B;  2SPZ A;  1JY2 N;  2WU2 D;  4QMA A;  1JY2 O;  5AW5 B;  2BAS A;  2P1J A;  1L0N E;  4A7P A;  3RBZ A;  1BE3 G;  2OYH A;  2FFD C;  2JDI H;  1RE3 C;  3L73 D;  2R32 A;  2E75 D;  3BAT A;  2XNX A;  2W83 C;  2AXT E;  2WSE J;  3P32 A;  5C39 A;  1A02 F;  5M1B A;  1NU1 D;  2IYO A;  2ZT9 D;  1S5L H;  1SQP G;  3H1I J;  2N1T B;  2WPR A;  4H0L D;  5CMZ A;  3FXD A;  2E76 D;  5AW9 B;  1IK9 A;  1IFI A;  4YT0 C;  1XTC C;  5KLV G;  1JO5 A;  3BVH A;  1VQ9 P;  1S3J A;  2WS3 C;  1JCD A;  2HYN A;  1HGV A;  3AEG C;  3M9B A;  5E79 H;  3E7K A;  2W27 A;  4DHI B;  2I8D A;  1NTM E;  1CSB A;  5AW8 B;  1P84 E;  5C2T C;  2WSF J;  1ZOY C;  1RE4 A;  1ZR4 A;  1MFT A;  2E75 B;  1X8Y A;  3AE6 D;  1LWU C;  4KJM A;  3BCC E;  4HKZ H;  4L74 A;  3D6Y A;  1RH5 B;  2ZT9 B;  2BS2 C;  2AXC A;  3Q1M A;  2JEE A;  2XKM A;  4H0L B;  1BCC G;  2E76 B;  3B5N C;  1VF5 C;  2KLV A;  2V4H A;  3H1K E;  4GOD A;  2IFM A;  2ZYD A;  1NJI Q;  4B86 A;  1PP9 J;  1L0N J;  4WBA A;  1IJD B;  3OA7 A;  2WMM A;  3L72 J;  5APX A;  3OAK A;  4H13 B;  3MUD A;  4KX6 C;  3CI9 A;  3D71 A;  3O6Q A;  2XU6 A;  2YMK A;  4IL6 X;  3CC7 P;  4GKG A;  4W80 A;  2IBZ G;  2BCC E;  1OW6 A;  1SQB J;  1SQP K;  3H1J G;  4K3A A;  2HG5 D;  2JR8 A;  3M9Q A;  5APW A;  1J1E B;  4YPC A;  2G8Y A;  2JJL A;  1PGP A;  2IDB A;  4YTM C;  1VQL P;  4C46 A;  2V7Q H;  3AEE C;  2N9Y B;  3CLQ A;  2E42 A;  1J2J B;  4PD4 D;  1GW4 A;  1FZC C;  2BS4 C;  3AE3 C;  3PRJ A;  3RBX A;  3H1I D;  1VQO P;  1S9K D;  4WY4 A;  1RF1 A;  4OWF A;  1USE A;  4XE5 B;  1KB9 E;  4RO0 A;  1L0L K;  1R5S A;  1BE3 E;  3NTN A;  2WDR C;  4EDF A;  3IF4 A;  4M3L A;  3MGN A;  3ABV D;  3P4Q D;  3TGU J;  2FYU G;  3AEC C;  1AQ5 A;  2H89 C;  5GTI H;  2P7J A;  2HPC A;  2OYI C;  1SP4 A;  1SQP E;  1SFC B;  1NGM B;  3L71 D;  2WDQ C;  3L35 A;  2AEM A;  1IC2 A;  4YSZ D;  3GF3 A;  2IBZ I;  1NO4 A;  2FBW D;  1USD A;  1KYO E;  3L74 J;  5H2F H;  2O1J A;  1YQ4 D;  4N78 E;  1LTG C;  2P10 A;  3RK2 D;  1L0V D;  2HPC B;  2HR3 A;  3VR9 C;  1JNM A;  4RKU J;  4YSX D;  4YSY D;  1OW7 A;  3L70 J;  1LTB C;  1KFM A;  1SQV D;  2KSE A;  1L0L E;  4YXD D;  1M1J B;  1K04 A;  3AEF D;  1VQM P;  1KF6 C;  3TK1 A;  2WPS A;  2Z5H A;  2WSC J;  1R5L A;  1ZP0 D;  3C1L A;  2WTY A;  4LC1 A;  4IFM A;  3H1I G;  1SQB D;  1FE6 A;  3NMD A;  4DHJ A;  2XV5 A;  3HTK A;  4H44 D;  3WU2 E;  4UB6 E;  3CCE P;  1LTI C;  3O8Z A;  3LW5 J;  1KFY D;  4ZMD A;  2WU5 D;  3R2P A;  4UB8 H;  2C9L Y;  2A06 D;  3M0D C;  3P4R C;  5KJ7 D;  3RK2 B;  1KC8 Q;  4HB1 A;  1WMK A;  3AEA D;  1FZB A;  2FYU K;  1GW3 A;  4TT3 H;  2NPS A;  2M3E A;  1N7L A;  4BWN A;  2OYH C;  1GL2 C;  1N7S A;  2R44 A;  4JYB A;  1SQQ D;  1DEB A;  3VRA D;  3A2A A;  2WT7 A;  3T97 B;  3E1R A;  5KJ7 A;  3VRB C;  4RES B;  2Q1K A;  3RL0 g;  1L4A D;  3AE5 D;  2Q7C A;  5TIS H;  4WB4 A;  3H1H D;  4H44 B;  1ZME C;  4L73 A;  3HD7 D;  1SQX J;  1Y8A A;  2GM4 A;  1VQ7 P;  2WT7 B;  1DH3 A;  2POH A;  1PP9 G;  1L0N G;  1YBK A;  4AQR D;  3IN6 A;  3L72 G;  1L4A A;  1L0L J;  1MKM A;  1G1I A;  3L74 D;  1HWT C;  4OVN F;  4LDT A;  3HD7 A;  3CXH E;  4K35 A;  1K05 A;  3VTP C;  3V2P A;  2FYU E;  5TIS E;  4U3F D;  2QJK C;  2FY8 A;  2FYN C;  2E43 A;  3SFD C;  2KUB A;  3V2N A;  1R8E A;  2D2C C;  1X0T A;  3VON A;  1L4A B;  5DJT B;  4R4M A;  2W90 A;  1H0T A;  4I6L A;  1ZRT E;  3G9R A;  3C8V A;  1ZXG A;  2I1J A;  2W6J H;  1DD3 A;  1YQ3 D;  2WSE H;  5CJ0 A;  3B8E B;  3L73 J;  2Y9Y A;  4I7Z B;  4I2L C;  1S72 P;  1LP1 A;  3AE6 C;  1NU1 J;  3L37 A;  4GIF A;  3TF5 A;  1JEK A;  3GLM A;  3MUD C;  2WP9 C;  1PGO A;  1YIT P;  4YTP C;  2KI7 B;  1NKN A;  3RL0 D;  4W7Y A;  1GDT A;  5CCG D;  1HVV A;  1SVF A;  3BAS A;  1QGK B;  2P58 A;  4OGQ C;  1GD2 E;  4PV1 B;  1LGH B;  4IL6 E;  3AE4 C;  5CBO A;  3TGU G;  2K3R A;  2FKW B;  1VQ8 P;  1RQV A;  3H1I E;  2B87 A;  1H89 A;  2H43 A;  1AVY A;  5CCH D;  3G6E P;  3CCL P;  1KMI Z;  1AJY A;  1OXZ A;  1T8Z A;  1TFF A;  1Z56 A;  3PH0 A;  2QJY B;  1T6A A;  2H88 C;  4WY4 C;  2KLU A;  1RF1 C;  2FXP A;  1X79 B;  1M7L A;  1DX7 A;  1KD1 Q;  2K37 A;  1SQB K;  2P2U A;  2B87 B;  5CCH A;  1H88 A;  3RL0 B;  1URQ D;  2MJZ A;  4Y99 C;  2ZYG A;  1FBM A;  3RK3 E;  4EOT A;  3L70 G;  3L71 E;  1OVR A;  3WUT A;  2N1T D;  3AED D;  3CCJ P;  1RY3 A;  2ACZ D;  3AE2 D;  2R3S A;  3GMA A;  1FZA A;  2G3A A;  1P84 I;  3N7N A;  3H1L D;  1FDI A;  3CIR C;  1FZF A;  5APU A;  3MHV A;  1KFN A;  1VQK P;  1URQ A;  1GU4 A;  1HBW A;  2XND H;  1M56 D;  4L76 A;  4ZNC A;  4PJ0 E;  2N1T A;  3ABV C;  1LTJ B;  3Q5S A;  3KQG A;  1SQQ K;  3P4S D;  4OH8 B;  2AEF A;  3AEB D;  1PP9 E;  3D70 A;  3I55 P;  3RK3 C;  3L72 E;  1AFO A;  3TSI A;  1SS1 A;  3QH9 A;  4U7J A;  4JBZ A;  3G71 P;  3SWF A;  3P4P C;  1URQ B;  1DIP A;  2FBW C;  1S2E A;  2HLO A;  1SQB E;  1YQ4 C;  5AVQ B;  2FYZ A;  1P84 H;  1VQ5 P;  2PRR A;  5AW3 B;  1L0V C;  1EXJ A;  2RMZ A;  3WUV A;  1NTZ J;  1Y47 A;  2BEQ D;  2A06 E;  1H8A A;  2RN0 A;  1OFC X;  4H13 D;  3N4X A;  1SQX G;  1PPJ G;  1J1D C;  3S1K A;  1GL2 B;  1ZP0 C;  3OJA B;  1QLB C;  1SQQ E;  3B4S A;  3L71 J;  2IZ1 A;  3W68 A;  1T2K C;  3KZI E;  1L0L G;  3JCU H;  5AVT B;  2NPS C;  2OTK E;  4I1L A;  1PIX A;  1DEE G;  1EDI A;  3VOP A;  1YTZ T;  1N7S C;  5AW6 B;  2W6A A;  3S9O A;  1KB9 I;  2WVR A;  1HJ0 A;  2WU5 C;  3TGU E;  3TNU A;  1QVG O;  3F5H A;  4JF7 A;  5KJ7 C;  2QA4 P;  3KHU A;  4DCK A;  1FJP A;  3KPE A;  1QLE D;  3AEA C;  3FWN A;  1QL1 A;  1OMI A;  1UII A;  1FAV A;  3EQ2 A;  1SQV J;  2ZVO B;  3EFF K;  1KIL B;  3JCU E;  3GHG C;  1PZQ A;  3C9I A;  3L74 E;  3L73 G;  4JYC A;  1FDO A;  3IAO A;  3TNU B;  3SWK A;  3AE1 D;  1NU1 G;  4U3F E;  1KYO I;  1LT9 C;  2OQQ A;  4GOE A;  4BRY A;  3P8C D;  1KB9 H;  2B88 A;  3L70 E;  1K8A Q;  4DDG A;  1D7M A;  1SFC D;  2VRS A;  2WPQ A;  5APY A;  5CHX A;  3SFE D;  3D6Z A;  2Z5I A;  3L75 D;  1NWQ A;  3HUS B;  3R4Y A;  2YIU B;  2FXM A;  3BRT B;  3CMA P;  1SQX K;  2ZXE B;  1U7J A;  3OW2 O;  4BRY B;  2YMY A;  2H7H A;  1HTL C;  1SFC A;  1LTA C;  1SQQ J;  5BU5 A;  2KP8 A;  1NTZ D;  1KYO H;  1M57 D;  5KAI E;  2Y9Z A;  1GU5 A;  5APQ A;  1K9M Q;  2P67 A;  5AVR B;  3FGA D;  5APV A;  3H1H J;  5BVZ A;  2IZ0 A;  1LTS C;  3CX5 E;  1NEK D;  3U59 A;  1MFZ A;  2O3J A;  3SSU A;  3AE7 C;  2UWJ E;  1ZLL A;  1KZU B;  3II6 A;  4NPF X;  2Q3I A;  1EZV D;  2JWA A;  1M1J A;  1HUC A;  2IX7 C;  2Q6Q A;  1LT1 A;  4LLH A;  1MUU A;  2Q3E A;  3V2R A;  3WU2 H;  1NU1 K;  1MZ9 A;  1SQX E;  4U3F J;  4UB6 H;  2QJP C;  1NEN C;  1PPJ E;  2KK7 A;  1RF0 C;  2Q9I A;  3AE8 C;  2C9N Y;  3MP7 B;  1Q90 D;  1N73 C;  2JO1 A;  4YT0 D;  5CCH C;  3H25 A;  5KLI C;  3GW6 A;  1KN7 A;  1YTZ I;  1OVU A;  2FFD A;  2E74 C;  1OIP A;  3AE9 C;  3H1L E;  2BS3 C;  2WS3 D;  3HE4 B;  3A5T A;  1E7P C;  2QEX P;  1FU1 A;  4AYC A;  3AEG D;  2QSI A;  1VDF A;  5C3J C;  3CCM P;  1VL2 A;  2PGD A;  3CXH I;  5KAF H;  1PV3 A;  5BU8 B;  2R3C A;  4D6T D;  3T97 A;  1CI6 A;  5C2T D;  2FFD B;  2N1T C;  1BSN A;  3AED C;  1ZOY D;  4L75 A;  4LGD E;  1NTK D;  3L73 E;  1S5L X;  1M90 Q;  2L91 A;  1WRG A;  4N3Y B;  1NU1 E;  1JM0 A;  1FOS F;  5B66 E;  3F89 A;  4DOJ A;  2V7Q J;  4ZKU A;  3B5N D;  3L71 G;  1VF5 D;  2O1K A;  4YTN C;  2YXQ B;  2YKO A;  5B5E E;  2OYO A;  5KAF E;  1CI6 B;  3Q5P A;  4HH2 A;  2WU2 C;  1NTM D;  3FXE A;  1LWU A;  2Y0D A;  3CXH H;  1GK4 A;  3SWY A;  4YXW H;  4KT0 J;  1P84 D;  1W2E A;  4GOF A;  1FDM A;  4KX6 D;  2IFN A;  1BGY D;  5KLV J;  3CL3 D;  2E75 C;  3BCC D;  1W5C E;  1KTM A;  4ASV A;  2ZT9 C;  1XTG B;  1SQV G;  3A0H E;  1YJW P;  1Y9B A;  4H0L C;  5AW0 B;  2E76 C;  1U57 A;  4YTM D;  3CWB D;  1YJ9 P;  2E5T A;  4JQ0 D;  1LWU B;  3H1K D;  3V4W A;  2ZFY A;  4PV1 D;  5AW7 B;  3AEE D;  3H1L J;  5CBN A;  4IOI H;  2M0B A;  1SQB G;  3B5N B;  1VF5 B;  1RE4 C;  2ZVN B;  5GTH E;  2A45 G;  3AE3 D;  2B76 D;  2GA1 A;  2GUS A;  4H13 C;  3G3Z A;  3KYQ A;  4NPE A;  1FC2 C;  2O01 N;  2L5G B;  1NTZ K;  2ZYA A;  4IL6 H;  2BCC D;  4GDO A;  1BCC J;  2A06 G;  3GHG B;  1ZN5 A;  2J59 M;  3Q3D A;  1J1E C;  1FZC A;  1VQ4 P;  5DJU B;  1QVF O;  2WDR D;  3V5B A;  4C7N B;  1FOS E;  3EFG A;  1AQT A;  4MN4 C;  2W6B A;  1S4X A;  3AEC D;  2O01 J;  1SQQ G;  1EXI A;  4JPZ B;  3P8C E;  2H89 D;  1AA0 A;  2KB7 P;  1JTH B;  2WDQ D;  5AW2 B;  2B9B A;  5EFW B;  2GUV A;  4PD4 E;  1FZC B;  3H1H G;  3L75 E;  1FS0 E;  4KHX A;  2OGU A;  3VMY A;  2KNC B;  3A7O A;  1S9K E;  1BE3 D;  2OYI A;  5CCG A;  5AVZ B;  2R5B A;  2WSF H;  3V2Q A;  3VR9 D;  3CCS P;  5AVY B;  1CW5 A;  1SQV K;  1NHL A;  1NTZ E;  3KXD A;  3L74 G;  1JUN A;  1SQP D;  1TU3 F;  1BDC A;  1KF6 D;  3P8M C;  3SFE C;  4U3F G;  4PJ0 H;  5KLV D;  3EWK A;  2QE7 H;  2OYI B;  3FWL A;  3HRN A;  4DJG A;  2K9Y A;  1LTJ A;  3M91 A;  1AVO A;  1QL2 A;  5AVU B;  3L36 A;  4N78 D;  2XDJ A;  1EZV E;  3PTZ A;  1N86 A;  2KZI A;  1NTK K;  1M8O B;  4CPG A;  2LXC B;  1BSH A;  3P4R D;  1IFJ A;  3CCQ P;  2M8R A;  1L2P A;  3VR8 D;  1IFP A;  1M1J C;  2QG4 A;  3Q2Y A;  3CCU P;  1Q7Y Q;  2ZXX A;  3P4Q C;  3UIA A;  1KV4 A;  3CD6 P;  1T3U A;  1GL2 D;  3MIW A;  2PP6 A;  1SQV E;  1BCC D;  1OW8 A;  4NPD A;  1YHQ P;  3M0D A;  4YSZ C;  3VRB D;  1KQF B;  1KOR A;  1FZE A;  1N2D C;  3L75 J;  4XA4 A;  5AVS B;  2H8P D;  4HYT B;  1HF9 A;  1GL2 A;  2YO3 A;  2LR2 A;  3KZI H;  2QVA A;  3RK2 C;  1AV1 A;  4D6T E;  2WPV B;  4YSX C;  3H32 B;  2IBZ D;  3I5C A;  4YSY C;  3H1J D;  1KIL D;  4YXD C;  1NTK E;  2MKV A;  3AEF C;  1FJK A;  2OYH B;  1Q81 Q;  1UIX A;  4Y28 J;  1OWA A;  4EI2 A;  3SFD D;  3MZW B;  4H44 C;  2D2C D;  1JY3 P;  2YXR B;  1KIL A;  1LJ2 A;  2YKP A;  1E5W A;  1YYC A;  3H1L G;  4N6J A;  1KFY C;  1S5L E;  1MV8 A;  3PP5 A;  2B89 A;  3H1H E;  1IFM A;  3BRV B;  3VYI A;  1EC5 A;  3LIE A;  1BGY E;  5AVX B;  2WIT A;  4IFF A;  2WQY D;  3CX5 I;  2WP9 D;  3CXH D;  1EDJ A;  2FYU D;  4YTP D;  2WSC H;  3M0A A;  5AVW B;  3K5B A;  1EDK A;  4AUW A;  1VQP P;  3VRA C;  3CWB E;  5E79 E;  2OTL P;  4OGQ D;  2IPP A;  3G4S P;  1IZN B;  4FJV A;  4EIJ A;  2LXB A;  3HUS A;  1ZR2 A;  5APT A;  3AE4 D;  1L4A C;  2QJK B;  4R4L A;  1ZRT D;  2FYN B;  3JC2 2;  3WUU A;  3PHL A;  3AE5 C;  3CC4 P;  3LW5 H;  4XFJ A;  1OZH A;  2D2C B;  2ZAE B;  3P7K A;  3HD7 C;  2Y0C A;  1W2B O;  4I7Z C;  2C0X A;  3CC2 P;  4D6T J;  1VPC A;  5KAI H;  2M5A A;  2Z4E A;  2J5U A;  2WWW A;  2OTJ P;  1Q86 Q;  3Q5R A;  2WDV D;  1NTK J;  2H88 D;  1U7M A;  1IO4 A;  4WY4 D;  3CX5 H;  3IR9 A;  5KLV K;  2KSJ A;  4PV1 C;  3V6I A;  1X22 A;  2Y0E A;  1G1J A;  1PFI A;  2DW3 A;  3O6Q B;  2JWD A;  1PL5 A;  2CPS A;  4ASW A;  4OGQ B;  1NAY A;  2M5A B;  2B76 C;  1EDL A;  2RH0 A;  1NTM J;  2NRG A;  4TLF A;  1NVO A;  3M06 A;  3VMZ A;  1RHZ B;  3CIR D;  1YQ3 C;  1KQG B;  4IFD K;  2KXP B;  2QJY C;  5L8R J;  1BGY J;  5AW4 B;  2IYP A;  2CK3 H;  3BCC J;  1GK6 A;  3VMA A;  3USS A;  3CCV P;  4DT0 A;  1PGJ A;  1JY3 N;  1JY3 O;  3TDK A;  1QX8 A;  3CWB J;  4WY4 B;  3RL0 C;  4ZKP A;  5CCG C;  2ZJS E;  3H1K J;  3RK3 D;  1RF1 B;  3CME P;  1N8R Q;  1HGZ A;  3A0B H;  2W8Z A;  3PLN A;  3QWO C;  3TYY A;  3HE4 A;  1IFD A;  5KLV E;  3P4P D;  1EQ7 A;  4Y99 B;  3ITK A;  1KQS O;  5KKZ C;  1IFN A;  2LKM A;  1A02 J;  3NXS A;  2BCC J;  2BEZ F;  5GTI E;  1LTJ C;  1RE3 A;  3L75 G;  4Z1M H;  1G2C A;  1IK7 A;  1VQ6 P;  1PP9 D;  1L0N D;  5B66 H;  2O01 H;  2OAR A;  3A0B E;  3L72 D;  1JMM A;  2FXO A;  1NH4 A;  5B5E H;  4RJT A;  4HJG H;  2RKL A;  5TJH A;  1LTT C;  1NTZ G;  5H2F E;  1URQ C;  2QM8 A;  3RK3 B;  2KYV A;  1SLQ A;  2ZFC A;  1BCC E;  3VP9 A;  1T2K D;  2PFX A;  3HE5 A;  1NOH A;  2NPS D;  2AEJ A;  1G2C B;  1N7S D;  2ACZ C;  2K9J A;  3AE2 C;  2M3B A;  2PAJ A;  2JKV A;  1NAF A;  1BE3 J;  1BDD A;  5KTB A;  1S1C X;  2KIK A;  3A0H H;  3JSV C;  1ZV8 A;  3VR8 C;  2R5D A;  1EZV G;  1VQN P;  3P4S C;  3HTK B;  1X9V A;  3HE5 B;  2IBZ E;  2WSS H;  1SQP J;  3AEB C;  2KOG A;  3H1J E;  2CPB A;  1KIL E;  5GTH H;  2K9J B;  3RGU A;  4O9B A;  1GZL A;  1ZW0 A;  3B5N A;  1J1D B;  2KS1 A;  4PD4 I;  1NYH A;  5AVV B;  3ZDM A;  4UB8 E;  1JCC A;  4DHZ A;  3MTU E;  3TGU D;  1LNQ A;  3CPW O;  2NPS B;  1CZQ A;  1N7S B;  3GHG A;  3U1A A;  2K88 A;  4I6M C;  4EYY Q;  2KS1 B;  4C7N A;  1KIL C;  2J58 A;  1LT9 A;  5CJ4 A;  3VN0 A;  3L4F A;  2NZ2 A;  1QEX A;  4D6T G;  5K5G B;  1FZG A;  2C0W A;  1JTH A;  3E1I A;  4PD4 H;  1Q82 Q;  3KDP B;  1NTK G;  1YJN P;  1JMB A;  1RQU A;  3H6P A;  3L70 D;  1EZV I;  3VMX A;  1E79 H;  1JY2 P;  2YNY A;  2KNC A;  5AW1 B;  3MD0 A;  4WWI A;  1LT9 B;  2E5Y A;  3GG2 A;  1M1K Q;  4DDI A;  3GF7 A;  3HD7 B;  3HUS C;  1NKZ B;  1GMJ A;  2YIU C;  4GT1 A;  3I56 P;  3AE7 D;  1GTW A;  1K73 Q;  2WQY C;  1NTM G;  3B71 A;  3H1J J;  2QM7 A;  1T3J A;  3V4Q A;  1KB9 D;  1JB0 J;  1H0T B;  3M9H A;  3S4R A;  1BGY G;  3A3Y B;  1YI2 P;  2QRX A;  3BCC G;  3AE1 C;  1NEN D;  1HH0 A;  1Q2N A;  1LP1 B;  2A45 I;  3U1C A;  3LID A;  2YKQ A;  3AE8 D;  3CWB G;  3CX5 D;  3H1K G;  2JP3 A;  1SFC C;  2HOD A;  2Q5U A;  3CCR P;  2HFE D;  1L0N K;  4BXL A;  2E74 D;  3AE9 D;  1WT6 A;  2YO2 A; 
#chains in the Genus database with same CATH homology
 1VF5 D;  2NZ2 A;  2WDV C;  4RKU J;  2IDB A;  4YTM C;  4YSX D;  3AEC D;  2O01 J;  4U7J A;  4YTN C;  1EXI A;  1RQV A;  2WS3 C;  3VR8 D;  2H89 D;  4YSY D;  3Q2Y A;  1OW7 A;  3P4P C;  1FDO A;  1DIP A;  3AEE C;  2FBW C;  3IAO A;  3P4Q C;  5C3J D;  3Q5P A;  2QIW A;  4YXD D;  3CIR D;  3AEG C;  1YQ3 C;  1KQG B;  3AE1 D;  1K04 A;  2WDQ D;  2WU2 C;  3AEF D;  1YQ4 C;  2ACZ C;  3IN6 A;  1RQU A;  1KF6 C;  2QJY C;  1MKM A;  3AE2 C;  5L8R J;  2WQY D;  2BS4 C;  2WSC J;  1KMI Z;  3AE3 C;  1AJY A;  2OQQ A;  4KT0 J;  2WP9 D;  1L0V C;  1ZP0 D;  1OW8 A;  1DD4 A;  2QJP C;  4KX6 D;  1NEN C;  1EXJ A;  4YTP D;  1S1C X;  4YSZ C;  2H88 C;  3VRB D;  1KQF B;  1KOR A;  4YT0 D;  3VRA C;  5C2T C;  3AE8 C;  1K05 A;  2BEQ D;  2E75 C;  2WSF J;  4H44 D;  4OGQ D;  3VR8 C;  2FXP A;  2QJK C;  1ZOY C;  2FYN C;  3GF7 A;  1KTM A;  3D6Z A;  1Q90 D;  3SFE D;  1ZOY D;  3P4S C;  1HF9 A;  2ZT9 C;  2JO1 A;  4H13 D;  2YIU C;  1GMJ A;  2E75 B;  3SFD C;  3AE7 D;  3LW5 J;  1Y9B A;  5KLI C;  3H25 A;  3AE4 D;  3AE6 D;  3VR9 D;  4R4L A;  1NEK C;  3AEB C;  4H0L C;  1KFY D;  3D6Y A;  2E76 C;  2WQY C;  1R8E A;  2WU5 D;  1U57 A;  1KIL E;  2D2C C;  2ZT9 B;  3AE5 C;  3R4Y A;  4YTM D;  4YTN D;  2E74 C;  3RK3 E;  2BS2 C;  2WDR C;  3AE9 C;  3B71 A;  2BS3 C;  3Q1M A;  2WS3 D;  1ZP0 C;  4R4M A;  4H0L B;  1ZRT E;  3G9R A;  4XFJ A;  3P4P D;  3ABV D;  2E76 B;  3P4R C;  3AED D;  1VF5 C;  4PV1 D;  2D2C B;  1QLB C;  3AEE D;  1TU3 F;  3P4Q D;  3C8V A;  2WPV B;  2E74 B;  3AEC C;  1JB0 J;  4YSX C;  1E7P C;  1NYH A;  4I7Z C;  1DD3 A;  3AEG D;  1YQ3 D;  1WMK A;  2H89 C;  4YSY C;  3AEA D;  2WU2 D;  2ACZ D;  5KKZ C;  2QSI A;  1VF5 B;  1KF6 D;  2J5U A;  4TT3 H;  3AE2 D;  5C3J C;  3GMA A;  2G3A A;  1VL2 A;  3SFE C;  1PIX A;  4I7Z B;  4YXD C;  3AE3 D;  1FDI A;  3CIR C;  2B76 D;  3AE1 C;  2MKV A;  4H13 C;  3AEF C;  1NGM B;  2WDQ C;  1PV3 A;  3EWK A;  3S9O A;  3AE6 C;  1NEN D;  3Q5R A;  2WDV D;  2BEZ F;  2K9Y A;  4YSZ D;  2H88 D;  1HJ0 A;  3GF3 A;  2WU5 C;  3GLM A;  3VRB C;  4H13 B;  2WP9 C;  3P4R D;  3VRA D;  5C2T D;  3AE8 D;  4KX6 C;  2E75 D;  4Z1M H;  1UIX A;  4YTP C;  1IK7 A;  3ABV C;  2FBW D;  2WSE J;  3AED C;  3FGA D;  3O6Q A;  4GDO A;  2YMK A;  2JP3 A;  4PV1 C;  3T97 B;  3D71 A;  3Q5S A;  4Y28 J;  3P4S D;  5M1B A;  4IL6 X;  2ZT9 D;  4OGQ C;  3SFD D;  1YQ4 D;  4H44 C;  3RL0 g;  3AEA C;  3Q3D A;  1NEK D;  1S5L X;  4H0L D;  3AEB D;  4PV1 B;  3D70 A;  1PL5 A;  1OW6 A;  2E76 D;  2P10 A;  1OMI A;  2D2C D;  3AE5 D;  2E74 D;  1L0V D;  2WDR D;  4OGQ B;  3AE9 D;  3AE7 C;  4YT0 C;  4H44 B;  3AE4 C;  2B76 C;  1ZME C;  3VR9 C;  2V7Q J;  1KFY C;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...