3AE8D

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
102
structure length
102
Chain Sequence
b'SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKAAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 35
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae8D00
1NEKC 3AEBD 3AE9D 3AEDD 1L0VD 1ZP0D 4YSZC 5C3JD 1E7PC 2FBWD 2B76D 3P4SC 2H89C 3AECC 4YTPD 3AE7D 3SFDD 1YQ3C 2WDRD 3AE2C 3AE6C 3AEAD 2WDQD 3AEFC 2WS3C 4KX6C 3P4RC 1KF6C 1YQ4C 3AEEC 3VRBD 4YTNC 2ACZC 3P4QC 2H89D 2WU2C 4YSYC 2WU5D 3SFEC 1QLBC 2H88C 3CIRD 3AEGD 1ZOYD 2WQYC 4YT0D 3ABVC 3VRAD 3AE5C 3AE1D 3VR8C 1NENC 3P4PC 3AE8C 3AE2D 3AE6D 3AE4C 4YTMC 1NEKD 4YXDC 4KX6D 2WDVC 3AE3C 1ZP0C 4YSZD 1KF6D 5C2TC 2ACZD 3P4QD 4YSYD 3SFED 2H88D 3P4SD 2B76C 3ABVD 3AECD 1KFYC 3VR8D 4YTPC 4YSXC 1YQ3D 3AE4D 3VR9C 2WDRC 4YXDD 3AEAC 2WDVD 3AE3D 2WDQC 2WP9C 3AEFD 2BS3C 2WS3D 3AEBC 3AE9C 2BS2C 5C2TD 3AEDC 1L0VC 3P4RD 1YQ4D 3AEED 3VRBC 4YTND 5C3JC 2WU2D 2FBWC 2WU5C 3CIRC 1KFYD 2WQYD 3AEGC 1ZOYC 4YT0C 4YSXD 3AE5D 3VRAC 2BS4C 1NEND 3AE1C 3P4PD 3AE8D 3VR9D 3AE7C 4YTMD 3SFDC 2WP9D
chains in the Genus database with same CATH superfamily
1NEKC 3AEBD 3AE9D 4DDIA 4DHIB 3AEDD 1L0VD 1ZP0D 4YSZC 5C3JD 1E7PC 2FBWD 2B76D 3P4SC 4DHZA 2H89C 3AECC 4DDGA 4YTPD 3AE7D 3SFDD 1YQ3C 2WDRD 3AE2C 3AE6C 3AEAD 2WDQD 3AEFC 2WS3C 4KX6C 3P4RC 1KF6C 1YQ4C 3AEEC 3VRBD 1TFFA 4YTNC 2ACZC 3P4QC 2H89D 2WU2C 4YSYC 2WU5D 3SFEC 1QLBC 2H88C 3CIRD 3AEGD 1ZOYD 2WQYC 4YT0D 3ABVC 3VRAD 3AE5C 3AE1D 3VR8C 1NENC 3P4PC 3AE8C 3AE2D 3AE6D 3AE4C 4YTMC 1NEKD 4LDTA 4YXDC 4KX6D 2WDVC 3AE3C 4FJVA 1ZP0C 4YSZD 1KF6D 5C2TC 2ACZD 3P4QD 4YSYD 3SFED 2H88D 3P4SD 2B76C 3ABVD 3AECD 1KFYC 3VR8D 4YTPC 4YSXC 1YQ3D 3AE4D 3VR9C 2WDRC 4YXDD 3AEAC 2WDVD 3AE3D 2WDQC 2WP9C 3AEFD 2BS3C 2WS3D 3AEBC 3AE9C 3VONA 2BS2C 5C2TD 3AEDC 1L0VC 3P4RD 1YQ4D 3AEED 3VRBC 4DHJA 4YTND 5C3JC 2WU2D 2FBWC 2WU5C 3CIRC 4I6LA 1KFYD 2WQYD 3AEGC 1ZOYC 4YT0C 4YSXD 3AE5D 3VRAC 2BS4C 1NEND 3AE1C 3P4PD 3AE8D 3VR9D 3AE7C 4YTMD 3SFDC 2ZFYA 2WP9D
chains in the Genus database with same CATH topology
1NEKC 3AEBD 3AE9D 3AEDD 1L0VD 1ZP0D 4YSZC 5C3JD 1E7PC 2FBWD 2B76D 3P4SC 2H89C 3AECC 4YTPD 3AE7D 3SFDD 1YQ3C 2WDRD 3AE2C 3AE6C 3AEAD 2WDQD 3AEFC 2WS3C 4KX6C 3P4RC 1KF6C 1YQ4C 3AEEC 3VRBD 4YTNC 2ACZC 3P4QC 2H89D 2WU2C 4YSYC 2WU5D 3SFEC 1QLBC 2H88C 3CIRD 3AEGD 1ZOYD 2WQYC 4YT0D 3ABVC 3VRAD 3AE5C 3AE1D 3VR8C 1NENC 3P4PC 3AE8C 3AE2D 3AE6D 3AE4C 4YTMC 1NEKD 4YXDC 4KX6D 2WDVC 3AE3C 1ZP0C 4YSZD 1KF6D 5C2TC 2ACZD 3P4QD 4YSYD 3SFED 2H88D 3P4SD 2B76C 3ABVD 3AECD 1KFYC 3VR8D 4YTPC 4YSXC 1YQ3D 3AE4D 3VR9C 2WDRC 4YXDD 3AEAC 2WDVD 3AE3D 2WDQC 2WP9C 3AEFD 2BS3C 2WS3D 3AEBC 3AE9C 2BS2C 5C2TD 3AEDC 1L0VC 3P4RD 1YQ4D 3AEED 3VRBC 4YTND 5C3JC 2WU2D 2FBWC 2WU5C 3CIRC 1KFYD 2WQYD 3AEGC 1ZOYC 4YT0C 4YSXD 3AE5D 3VRAC 2BS4C 1NEND 3AE1C 3P4PD 3AE8D 3VR9D 3AE7C 4YTMD 3SFDC 2WP9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK C;  3AEB D;  3AE9 D;  3AED D;  1L0V D;  1ZP0 D;  4YSZ C;  5C3J D;  1E7P C;  2FBW D;  2B76 D;  3P4S C;  2H89 C;  3AEC C;  4YTP D;  3AE7 D;  3SFD D;  1YQ3 C;  2WDR D;  3AE2 C;  3AE6 C;  3AEA D;  2WDQ D;  3AEF C;  2WS3 C;  4KX6 C;  3P4R C;  1KF6 C;  1YQ4 C;  3AEE C;  3VRB D;  4YTN C;  2ACZ C;  3P4Q C;  2H89 D;  2WU2 C;  4YSY C;  2WU5 D;  3SFE C;  1QLB C;  2H88 C;  3CIR D;  3AEG D;  1ZOY D;  2WQY C;  4YT0 D;  3ABV C;  3VRA D;  3AE5 C;  3AE1 D;  3VR8 C;  1NEN C;  3P4P C;  3AE8 C;  3AE2 D;  3AE6 D;  3AE4 C;  4YTM C;  1NEK D;  4YXD C;  4KX6 D;  2WDV C;  3AE3 C;  1ZP0 C;  4YSZ D;  1KF6 D;  5C2T C;  2ACZ D;  3P4Q D;  4YSY D;  3SFE D;  2H88 D;  3P4S D;  2B76 C;  3ABV D;  3AEC D;  1KFY C;  3VR8 D;  4YTP C;  4YSX C;  1YQ3 D;  3AE4 D;  3VR9 C;  2WDR C;  4YXD D;  3AEA C;  2WDV D;  3AE3 D;  2WDQ C;  2WP9 C;  3AEF D;  2BS3 C;  2WS3 D;  3AEB C;  3AE9 C;  2BS2 C;  5C2T D;  3AED C;  1L0V C;  3P4R D;  1YQ4 D;  3AEE D;  3VRB C;  4YTN D;  5C3J C;  2WU2 D;  2FBW C;  2WU5 C;  3CIR C;  1KFY D;  2WQY D;  3AEG C;  1ZOY C;  4YT0 C;  4YSX D;  3AE5 D;  3VRA C;  2BS4 C;  1NEN D;  3AE1 C;  3P4P D;  3AE8 D;  3VR9 D;  3AE7 C;  4YTM D;  3SFD C;  2WP9 D; 
#chains in the Genus database with same CATH topology
 1NEK C;  3AEB D;  3AE9 D;  4DDI A;  4DHI B;  3AED D;  1L0V D;  1ZP0 D;  4YSZ C;  5C3J D;  1E7P C;  2FBW D;  2B76 D;  3P4S C;  4DHZ A;  2H89 C;  3AEC C;  4DDG A;  4YTP D;  3AE7 D;  3SFD D;  1YQ3 C;  2WDR D;  3AE2 C;  3AE6 C;  3AEA D;  2WDQ D;  3AEF C;  2WS3 C;  4KX6 C;  3P4R C;  1KF6 C;  1YQ4 C;  3AEE C;  3VRB D;  1TFF A;  4YTN C;  2ACZ C;  3P4Q C;  2H89 D;  2WU2 C;  4YSY C;  2WU5 D;  3SFE C;  1QLB C;  2H88 C;  3CIR D;  3AEG D;  1ZOY D;  2WQY C;  4YT0 D;  3ABV C;  3VRA D;  3AE5 C;  3AE1 D;  3VR8 C;  1NEN C;  3P4P C;  3AE8 C;  3AE2 D;  3AE6 D;  3AE4 C;  4YTM C;  1NEK D;  4LDT A;  4YXD C;  4KX6 D;  2WDV C;  3AE3 C;  4FJV A;  1ZP0 C;  4YSZ D;  1KF6 D;  5C2T C;  2ACZ D;  3P4Q D;  4YSY D;  3SFE D;  2H88 D;  3P4S D;  2B76 C;  3ABV D;  3AEC D;  1KFY C;  3VR8 D;  4YTP C;  4YSX C;  1YQ3 D;  3AE4 D;  3VR9 C;  2WDR C;  4YXD D;  3AEA C;  2WDV D;  3AE3 D;  2WDQ C;  2WP9 C;  3AEF D;  2BS3 C;  2WS3 D;  3AEB C;  3AE9 C;  3VON A;  2BS2 C;  5C2T D;  3AED C;  1L0V C;  3P4R D;  1YQ4 D;  3AEE D;  3VRB C;  4DHJ A;  4YTN D;  5C3J C;  2WU2 D;  2FBW C;  2WU5 C;  3CIR C;  4I6L A;  1KFY D;  2WQY D;  3AEG C;  1ZOY C;  4YT0 C;  4YSX D;  3AE5 D;  3VRA C;  2BS4 C;  1NEN D;  3AE1 C;  3P4P D;  3AE8 D;  3VR9 D;  3AE7 C;  4YTM D;  3SFD C;  2ZFY A;  2WP9 D; 
#chains in the Genus database with same CATH homology
 1NEK C;  3AEB D;  3AE9 D;  3AED D;  1L0V D;  1ZP0 D;  4YSZ C;  5C3J D;  1E7P C;  2FBW D;  2B76 D;  3P4S C;  2H89 C;  3AEC C;  4YTP D;  3AE7 D;  3SFD D;  1YQ3 C;  2WDR D;  3AE2 C;  3AE6 C;  3AEA D;  2WDQ D;  3AEF C;  2WS3 C;  4KX6 C;  3P4R C;  1KF6 C;  1YQ4 C;  3AEE C;  3VRB D;  4YTN C;  2ACZ C;  3P4Q C;  2H89 D;  2WU2 C;  4YSY C;  2WU5 D;  3SFE C;  1QLB C;  2H88 C;  3CIR D;  3AEG D;  1ZOY D;  2WQY C;  4YT0 D;  3ABV C;  3VRA D;  3AE5 C;  3AE1 D;  3VR8 C;  1NEN C;  3P4P C;  3AE8 C;  3AE2 D;  3AE6 D;  3AE4 C;  4YTM C;  1NEK D;  4YXD C;  4KX6 D;  2WDV C;  3AE3 C;  1ZP0 C;  4YSZ D;  1KF6 D;  5C2T C;  2ACZ D;  3P4Q D;  4YSY D;  3SFE D;  2H88 D;  3P4S D;  2B76 C;  3ABV D;  3AEC D;  1KFY C;  3VR8 D;  4YTP C;  4YSX C;  1YQ3 D;  3AE4 D;  3VR9 C;  2WDR C;  4YXD D;  3AEA C;  2WDV D;  3AE3 D;  2WDQ C;  2WP9 C;  3AEF D;  2BS3 C;  2WS3 D;  3AEB C;  3AE9 C;  2BS2 C;  5C2T D;  3AED C;  1L0V C;  3P4R D;  1YQ4 D;  3AEE D;  3VRB C;  4YTN D;  5C3J C;  2WU2 D;  2FBW C;  2WU5 C;  3CIR C;  1KFY D;  2WQY D;  3AEG C;  1ZOY C;  4YT0 C;  4YSX D;  3AE5 D;  3VRA C;  2BS4 C;  1NEN D;  3AE1 C;  3P4P D;  3AE8 D;  3VR9 D;  3AE7 C;  4YTM D;  3SFD C;  2WP9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...