3AE9B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae9B01
1GAQB 2JX5A 3ABVB 1E6EB 3P63A 3AE2B 1OQRA 1GTEA 3ETRA 1N5WA 4YTMB 2L52A 3P4QB 2QJLA 1KFYB 3AM9A 1R7SA 4HRSA 4HROA 1KRHA 1OQQA 3NVWA 4IDIA 2PVOD 3CIRB 3B9JA 1A70A 2N0SB 3P1MA 4YTPB 3AV8A 2CJOA 1XLPA 4YT0B 1E7PB 2DBYA 1NENB 1ZXIA 2LEKA 3L4PA 2B76B 3P4RB 3HUIA 4JWUC 1XO3A 2M19A 3ZYYX 1XLOA 3AE8B 3P4SB 2ACZB 3AECB 4YTNB 2OHFA 3B2GA 3W9CB 1RFKA 2WDRB 2Y5CA 5AUIA 1WYGA 2MJDA 4KX6B 3CWIA 1E10A 3W5UB 3NVYA 2QIEB 1N61A 3HRDD 3VR8B 1J7CA 3VRAB 3FC4A 3WCQA 1ROEA 3FAHA 4N59A 1DOXA 1AYFA 1VDVA 3NS1A 5EE0A 3AE3B 3LXFA 4USAA 1AWDA 1H7WA 4YXDB 1NYQA 3CF4A 1CJEA 3BIID 1NVID 3DWGC 3AE5B 4WQMA 3KWLA 4C7ZA 3SR6A 1KF6B 1J7BA 1FIQA 1JWBD 1VLBA 1DOIA 1L5PA 2CJNA 1JW9D 4JX1C 2MH7A 5G5GA 3W5VB 1ZUD2 2WS3B 3AE7B 3NRZA 3NVZA 4P6VF 3AE6B 1QOBA 2PKOA 4YSYB 3AH7A 5EE9A 1QOFA 2W55A 2W3SA 1YJJA 1JALA 4US9A 1GTHA 1JRPA 1UWMA 2MJ3A 3AN1A 2Q5WD 1TJEA 2BT6A 4ITKA 2K5PA 1JWAD 3AEAB 1N62A 4ZHPA 1QOAA 2KAJA 1GT8A 1JROA 2G1EA 3HVZA 1XLQA 5EE1A 1E9MA 3AE9B 2BS3B 3RPFC 4LTUA 2MJEA 4US8A 1YJIA 1DGJA 4JWSC 4N6EB 5G5HA 3P4PB 2WP9B 1TKYA 3AE1B 3AEEB 3AEBB 1ZP0B 1J7AA 1TKGA 3NVVA 5H8YE 1QF6A 1PFDA 1RWSA 1T3QA 2K9XA 2PIAA 1SB3C 1VJKA 2W3RA 4ZOHC 4A9AA 1FFUA 5EE3A 2JQRB 3PO0A 1I7HA 1TYGB 1NYRA 1N5XA 5H92C 2AX5A 3LB8C 3AEGB 3AE4B 4C7YA 1XLNA 1QOGA 2WDQB 1SIJA 1V8CA 4ZHOA 3AEFB 2PVGC 1NI3A 1FRDA 1FFVA 2WQYB 2BS4B 1FO4A 2WDVB 1IUEA 2M56B 1NEKB 2WU2B 1PDXA 2KMMA 4WWMA 2BS2B 2E3TA 1B9RA 1OFFA 3SFEB 2WLBA 2CU3A 1QLBB 4C80A 1JQ4A 4N58A 1EWYC 1V97A 2H88B 1GPXA 3AMZA 1FRRA 1DOYA 1WXQA 1WWTA 1FXAA 1E0ZA 2WU5B 1FMAD 5C2TB 1TKEA 4FXCA 5GXGB 2H89B 1F0ZA 3AEDB 1RM6C 1WRIA 5AUKA 2W54A 4YSZB 1CZPA 1QT9A 2EKIA 1RYJA 1PUTA 1N63A 1WGKA 3B2FA 1L0VB 1YQ4B 1SF0A 4YSXB 3SFDB 3AB5A 3VR9B 2K22A 1L6UA 2DWQA 2HTME 5C3JB 3VRBB 2L83A 5MPOA 1ZOYB 1FM0D 1N60A 1FXIA 3DWMA 3EUB2 2FBWB 1H7XA 1YQ3B 1L6VA
chains in the Genus database with same CATH superfamily
1STEA 1N5WA 2KWCA 5HI1A 1KRHA 3H7SA 2IGHA 1YN3A 2L0FA 4GB9A 5HHDG 1XLOA 4DWFA 3VH4B 2N1WA 1Y56A 3TSSA 3ZDMC 2NPTB 3NS1A 1AWDA 4C00A 5HKHA 3AE5B 2KC1A 3ZKJC 2JZPA 1K53A 4J6IA 1L5PA 4JX1C 5EE9A 3SR6A 2L00B 2MP2A 1KM7A 2R2OA 1R4MB 4EOYA 2Q5WD 4TKNA 1F9JA 3LJ3A 2K6QA 4IM3A 4P16A 1ESFA 3R2IA 4DHZB 4LTUA 3V60A 2X8XX 2BWES 4JWSC 4WH4A 3AEBB 1J7AA 4MM3B 3U7ZA 5LXIB 3W1YA 4WJQA 3PSEB 4RFBA 4F7ZA 2DLBA 2LD9A 3LB8C 1GB1A 3WANA 4AQ7A 2MA9B 2LGXA 1ZPSA 1SIJA 2LWPA 2R61A 1E8ZA 2I1KA 3ZRFA 2CU3A 2V0GA 1FRRA 1P0RA 1XD3B 3PGEA 5C2TB 4REZA 3ZVVA 3T3OA 1EWCA 1RM6C 2WXIA 4A90A 1AN8A 2N7JA 1ZE3D 4MEMA 2WGSA 4ARCA 1N63A 1YQ4B 1SF0A 2BKFA 2WXJA 1L6UA 4HEA1 1WJ6A 2O6VB 2D3GA 3M63B 1C4AA 2L52A 3P4QB 2XK5B 4RGMA 1F1HA 3ML8A 4DBGA 2PEAA 2RDHA 4GGQA 2CJOA 1NENB 4B0EA 3V6EB 2L1AA 1F2RI 2I1JA 3N30A 3Q8CA 2OHFA 4ACFA 3H6NA 4KX6B 1E10A 1M94A 1V5TA 4ANWA 2REXA 5KHQA 4HPMB 2V4LA 3BIID 4Q2JA 1LM8B 2N4FA 4GMVA 1I4RA 3IFWB 1Q0WB 3AE6B 1WGDA 2O6VD 4MGIE 3DQVA 1GTHA 1OGWA 4FBJB 1GT8A 2GOWA 4YL8A 2MJEA 4WJOA 1MHHE 3M62B 5GMVA 5BMGA 4RM8A 1EO6A 4EE2A 4K7WA 4ZOHC 3ZNGC 2ZJDA 3OJ4B 1N5XA 4RMAA 4C7YA 1XLNA 4LNIA 4MJSA 1MI0A 4EZKA 3H8HA 1FFVA 3WAPA 1C1YB 1E8WA 1L0YB 2KQ7A 1K8RB 2G4SA 3O65B 4M0WA 1JQ4A 2IGGA 3IT4B 2KVRA 3L54A 3N9YC 1E8XA 3DHIC 3PZDA 4MT5A 4CQNA 4P1BC 2VRRB 3PHWB 1XQQA 2C7NB 2D5GA 2PE9A 1P9DU 1KTKA 3PZ8A 4BKGA 1TGZB 2KDEB 1VD2A 1BUIC 3SFDB 4E71A 3VRBB 3R7QA 1XF5L 4JIOU 1Z5SB 4ANUA 3I57A 5DPTA 1JWSD 4TUUA 3P63A 1NBFC 3R2TA 2M1MA 5D3IB 2N0SB 3PREA 4M8MA 3QARA 4I6NB 2FIFA 2K6DB 4EEWA 2RDBC 2ACZB 1IP9A 1HA5A 2RR9A 2CHWA 2LRWA 1ZXHA 3R3MA 2J0MA 1DOXA 1F2RC 3RZWC 3OG5A 3NZSA 4GLSC 1GOZA 4TSSA 2L0TA 2MH7A 1I42A 3QAQA 2D2QA 3A1QA 2D3AA 2RGFA 2JRIB 3MHZA 4XWTA 3APFA 3ML9A 4ZHPA 1SIFA 3DHGC 2HD5B 3KUDB 2KVZA 3BK2A 3SDLC 1EU4A 3BYTB 2OOBB 1PFDA 2K9XA 2LGSA 4BBNF 2N9XA 1Q1OA 1TZOA 1SE9A 4XZ4A 2KTRB 2WDQB 3QIJA 3KYCD 2R2QA 2GBRA 2WU2B 2JYEA 4URKA 4MGYE 3Q8FA 1QLBB 4NAMA 3DBRI 3EECA 4YWGG 4M02A 4RH6A 5D6JB 1WWTA 1T0QC 4IC7B 5AZHA 4WIPA 1BMLC 3JSVA 1L0VB 4E3CA 3BY4B 3EFCA 5MPOA 1WZ3A 2EKEC 4KGRA 2LJ5A 1H7XA 3RI7C 3RNAC 3VVWB 4RF1A 2JX5A 3PHXB 2JF5A 2BWFA 1QQRA 4HRSA 3AM9A 3RMKC 4F1SA 1NDDA 5CHFA 3VDZA 3NHEB 2MWSB 1IGDA 1HTQA 4XC2A 3M95A 3I63C 3Q69A 1MG8A 3ZYYX 2EMTA 1YX5B 3W9CB 3VXWA 5AUIA 3OAWA 1WYGA 1KJTA 3HRDD 5BMHA 2KFJA 3B0AA 2IJ0A 1VDVA 3Q6BA 3VAWA 3PLUA 2WX0A 3V62A 2INPE 1JWBD 2FCQA 3HM6X 2WXLA 2IBIB 3P2BA 3AXCA 2XBBC 1ZW7A 2CHXA 2JYTA 3TCAA 2K0PA 2A5UA 2MHJA 3FILA 1UGJA 3TEWA 2QSDA 4XGAB 4C4VB 1WE7A 1UF0A 1GG3A 4MGKE 2CU1A 2LRUA 3ZW3A 2V9HA 3MJWA 2YEPB 1PDXA 1FD6A 4W9JA 3TMPB 1D6EC 3ZNHB 1ENFA 1XCTL 3A9KA 2FCMA 5BYRA 4BFRA 4N58A 1UBIA 4XWWA 1EWYC 1XCQL 1DOYA 3KQ4A 2V3SA 1TKEA 4RF0A 1PGBA 2AYOB 5EDSA 1PGXA 4A3OA 2PTLA 3TEYA 4HKQA 4BKSA 4BKSD 3CSTA 4LLGM 2RSUA 1WXMA 4ZRPA 5HFYA 1BXTA 3TUOA 1D5ZC 4HJGE 4HWIB 4JE3B 2L8JA 3ETRA 1GTEA 3N1YC 3ZIMA 2IO1B 1OQYA 5J17A 1GC7A 2CS4A 1D3ZA 2RDGA 3AV8A 1WXSA 3OWEB 2B76B 3UQBA 3IAM1 4LDTB 2WNMA 5G55A 1ROEA 3CF4A 3DWGC 4HVBA 4MJSB 2DZJA 2WXPA 2Y5PA 4ZRIA 3A4RA 1DOIA 2WXFA 4GIVA 3Q3MC 3U2SC 1QOFA 2KD0A 4ICUA 2KFKB 1UWMA 3DHHC 1VRAB 4KSLC 1WR6E 4ITKA 2K5PA 1UH6A 3T9LA 2KDMA 2K1FA 2MBHA 1YJIA 5E6JA 5I4DA 2IGDA 5IN7A 4JGHB 3QX1A 3UIOB 2IPKD 2JPHA 2L7RA 4IUMB 1V49A 1WH3A 1Z2MA 3ZTDA 1WJ4A 2LXCA 2WQYB 4DHJB 2D07B 1JCKB 1EF1A 4MGZE 4W9IA 3B1LX 3BVGA 4LJPB 3EC8A 1TS4A 2INDC 1P7EA 3VTVA 3KUZA 3ZJTA 3APDA 2WXHA 3DDCB 3NOBA 2JWUA 4NY0A 3S2AA 1YN4A 2ZPNA 1MPEA 4BKTA 2ZW0A 5DCNA 1T0RC 4OZBA 1WGRA 4K3CA 4II2B 1T6BX 1YQ3B 1L6VA 4KIKB 5BMIA 4W9HA 2DENB 1HEZE 2L3ZA 1GUAB 1E7PB 3L4PA 5TR5A 1ZXIA 3N32A 3GB1A 2C60A 2IY1B 3R66C 4TQ1A 4FJVB 3U7DA 5IKCM 5L83A 2HTHA 2XK5A 3CWIA 3DVNV 3NVYA 3VR8B 2C7MB 2IDYA 1AYFA 1V1PA 4AJWA 2HJ8A 2LGIA 3UI3A 1WMHB 2K8BA 4IW0A 3AE7B 5CHWA 3VUYA 3PZ7A 2G4DB 3L08A 3MHSD 3NY5A 4KGTA 4IWOA 3AEAB 5DPSA 2M4NA 2G1EA 2IO2B 3HVZA 3IG3A 1E7UA 1ZGUB 2CKHB 2FUHB 4US8A 1K52A 4N6EB 2KFKA 3ZNID 1RWSA 1Y8RC 1SB3C 4ZRKA 3A9KB 1UWXA 4AOFA 4WWPA 1QILA 2N9PC 1X1MA 4MELA 1ACCA 2ZNVC 3RT3B 2J7QB 4H2AA 1IUEA 4B0MA 3RFZB 1K50A 5CTRC 1D4BA 3QA8A 3IAS1 3UQAA 2MRPA 4OVZA 4LDTD 3SD5A 2KJHB 3IVFA 3X0WA 1I35A 5AUKA 3GE3C 4FHJA 5FR6A 2LHEA 4RM9A 1ET9A 1WGKA 2LVPA 1UELA 1TS2A 2FE8A 2KJRA 2K25A 4NJCA 1T0SC 3KYDD 3MP9A 3C19A 3UF8A 3WA0A 1H4RA 1P7FA 4M01A 1FCCC 4HPLB 2V3NA 3HIZA 4K1RB 3BZDB 1R7SA 3DBHI 3WALA 4W9FA 2YEPF 1KLUD 4YTPB 2MQJA 3DBRB 3DOWA 5BYQA 2MSED 4B6WA 4BAXA 3PVLA 2VZKB 2WXQA 1N61A 2J53A 5L95C 3Q2AC 3RYTA 2C9WB 4LNFA 3KWLA 2JT4B 4C7ZA 2G9HD 2D10A 4LNKA 2Z59B 2I38A 2DAFA 2G3QB 3VHTC 3VTUA 2W3SA 3DBHB 4WAAA 1Q5WB 2G45B 4A20A 5DPRA 4HDQA 3JSVB 2WXMA 3RNFC 4DK5A 3DCGA 2HJ1A 1P98A 1ZDVA 1S1QB 3AE1B 2MBQA 2W3RA 1KLGD 3RUIB 1UD7A 1S3SG 5HG2A 1U4AA 4AUQC 3AE4B 1XEEA 2INNE 1E90A 2BQQA 1YIWA 2E6XA 1OFFA 2MX2A 3CSFA 4K7SA 1TZ1A 3IBEA 2J52A 1YN5A 3UGBB 1HXYD 5GXGB 2NPTA 2KDIA 2EKIA 4TV3A 4O1NA 3D32A 4KIKA 3VR9B 1IBXB 4KVGB 2OEDA 1N60A 4GSWA 1YQBA 2QILA 4BZAA 3GE8C 4N9F4 1KFYB 4OZAA 1F77A 4FN2A 2JU6X 2NBWB 1M4VA 4OZCA 3CF6E 3MC9A 1JWUD 2J4XA 1V86A 1C3TA 4NAWA 2KKCA 2Y5CA 2WXOA 1C9FA 1RRBA 2M17A 3N3KB 3JW0X 1WX7A 2DHZA 3ALBA 1IBXA 1F52A 1TY2A 1MG4A 3N1XC 1VLBA 5G5GA 4A6QA 3W5VB 2JZZA 3AU4A 2UWQA 1OTRB 4HJKA 3AH7A 3IXSA 2GBKA 4A8XC 1HZ6A 2WX1A 1TIFA 4WWOA 3PLVA 2KAJA 5IA7A 3QJZA 3NZUA 1E9MA 1WZ0A 2MBEA 1V81A 4KDIC 1H8CA 4HLEA 2V3PA 1TKYA 4OVUA 1GJZA 2PIAA 4ZYNA 3PO0A 4S0RA 5AZGA 1YNTE 4II3B 3TJPA 1V8CA 2AQ3B 1QKZA 3Q3FA 4LJOB 2M56B 4DDGD 5C1ZA 1B9RA 3SFEB 5D7GA 3BWUD 1J0GA 2AQ1B 4G50A 1WXQA 1FXAA 1HTOA 1P1AA 2AWTA 3TIXA 4P7IA 3AEDB 4XDDA 2KO3A 1YX6B 2TSSA 2BF8B 2BYVE 2L83A 2WXKA 4MACA 4CYEA 2C7HA 1I4QA 2QCZA 1C76A 5E6NA 3AE2B 2Y5BB 3SHQA 5IAAC 3NG0A 2W9NA 1IGCA 1UZXB 4PYUA 4DXFA 4B95A 1YOVB 3L16A 5T8IA 4AWJA 3AECB 3MJ5A 2UYZB 3RULA 2A4ZA 4RCOA 1AARA 2RD0A 1IPGA 1LFDA 2WS3B 5LXHA 2KOXA 1YJ1A 3RN9C 2NR2A 1JROA 4K7UA 2BS3B 3RPFC 3ZLZA 1VR9A 2J0JA 2KTFA 2BB5A 1VCBA 4GU2A 1C79A 1TKGA 2ON8A 5FK9C 1VJKA 3RCZA 4MH0E 4IWPA 1NYRA 3JYUA 1WYWB 4GN1A 3LDZE 4M8NA 1FNUA 4ASWC 1YD8U 2GRIA 4GXBA 3MTNB 1TT5B 5KHOA 5IOIA 3EHVA 2GB1A 5LNK1 1HQRD 2ZNVB 5D3DA 2ZZPB 3KW5B 2BW2A 3B2FA 1WJNA 3GS2A 2DWQA 5C3JB 1V5OA 2GI9A 2LMCA 3HK0A 4FJZA 1SSNA 3P42A 1GB4A 2FBWB 2VH2A 5JXVA 1E6EB 3ONSA 2WYQA 4ARIA 1OQQA 2KHWB 2JXXA 2PVOD 4OVVA 3CIRB 2WXGA 2QEJC 4WAFA 2GLSA 2LEKA 1TY0A 2Z8LA 4A3PA 1RLFA 3RNBC 1KLVA 4W9GA 2BYFA 2X38A 1L7YA 5JZEB 4DXAB 2WWZA 4G11A 4N59A 4X57B 4RGOS 4ZRQA 1TS5A 2J0KA 1CJEA 1PQSA 1SE4A 1C78A 4TMAB 2N9EB 1FIQA 4EZLA 3I9V1 1QOBA 5C23A 4LCDE 2ZCCA 2LUEA 3VUXA 2KXJA 2KMCA 1NI2A 2HE7A 3AE9B 4GDLB 3P4PB 2WP9B 4MH8A 2NVUI 1ZP0B 2LZ6A 3EGRA 3MC0B 2WHIA 2KYWA 1FFUA 4ZYSA 1ISNA 1TYGB 3RNGC 1C4PA 1EF5A 5JHAA 4WURA 2N9KA 3DVGY 3PS6A 1JMLA 1WGYA 1NEKB 3A1QB 2KANA 3PPAA 3WIMA 3FKYA 1V6EA 3X23A 2OJRA 2N1VA 1E0ZA 3HVDA 1FMAD 1RFAA 4OHJA 2M0AA 3PRZA 3OLMD 2JY6A 4L23A 2IZVB 4J3OD 2ZEQA 4BVUC 2FIDA 2IYDB 4I6LB 3UINB 1LXDA 1WJUA 4WQOB 5BO4B 3ZDTA 4GOCA 1FCLA 5DPWA 3VQIA 2CR5A 4LNNA 2HDEA 3ZRCA 4AS1A 1UBQA 3HHMA 1C4CA 1J19A 3E56A 3L0WB 3LXFA 1NYQA 4PS7A 4DXGA 3A9JB 2FUG1 3J9CA 3PTFC 5FR3A 1R4NI 2PLPA 2XEWA 3GOEA 1JW9D 1WY8A 2NMQA 2BB6A 2PW9A 1SE2A 1YJJA 1JALA 2MCNB 1WR1A 1E7VA 3UIPB 2Y3AA 2MBOA 1I4GA 1CQVA 1WRDB 5LLIA 1XXGA 3H9DA 4S17A 3ZUNA 4R3DA 4LK0M 1SBBB 2FNJB 5FKAC 2LGDA 4HKZE 3AULA 1T3QA 5EE3A 3EFUA 1I7HA 1FXTB 2Z0DB 2FAZA 2VH1A 5BYSA 2DYOA 2O2VB 1CK1A 2BS4B 4IM0A 3FILB 4PT5A 2KZRA 3MFGA 3BYYB 1VZ8A 3RZFA 3A33B 1PYWD 4AP4C 3APCA 1F0ZA 1WRIA 1EUVB 4RGNA 2PJHA 3GZNB 3VFKA 3KLSX 1WI0A 3N20C 5CX3A 2BBCA 5JHBA 2BKRB 2AL6A 2QHOA 3ZTCA 3BVZA 2WXNA 4PS3A 2O2VA 3U30A 4P1CC 2B3AA 3MC8A 2LI5A 3NVWA 4NQLB 5TSSA 2IY0B 2LASA 3HUIA 3PV1A 1XO3A 2EELA 4YTNB 4IM2A 5J18A 1RFKA 2WDRB 1V1OA 2QIEB 2KNBA 4HCPB 2M8SA 1N6ZA 3H1UA 4A55A 3VTWA 1TS3A 3K9OB 4M0WB 3NVZA 2NTTA 4P6VF 2PKOA 4GDLA 3U8ZA 1RAXA 2YVCA 3TEZA 3AN1A 1L4ZB 3C8YA 4NZLB 3LYYA 4C56C 2GBNA 4OW0A 3ZQ4A 2INCC 4HPPA 4PK1A 2K39A 5G5HA 2ZVNA 4XYCA 1FNWA 2AEHA 3QK0A 3URYA 4D2KA 4PS8A 2OJWA 1G6JA 3QC8B 1FO4A 3I5JC 1FEHA 4TQ0A 2DX5B 4NPNA 2E3TA 1EM7A 1WMHA 2QMTA 1GPXA 4F8CB 3Q3JA 1Q10A 4EUTA 2H89B 2MBBB 1B1ZA 4L2YA 2W54A 3Q8EA 4IWQA 2ONQA 2LVOA 5IO9A 2K22A 2PE6B 1MHXA 1D5MC 2C5LC 3EUB2 3ZO5B 2KX3A 2KWVB 3NS8A 2DZKA 4HROA 2KN5A 4IDIA 1A70A 4RNAA 5JH5C 2BGFA 2NBVB 1XLPA 2RMMA 1ET6A 1SJHD 1SE3A 3A9JA 3AE8B 3P4SB 3RNEC 5J2RA 1UUPA 3SEBA 1AW7A 4HCNB 4BBNC 2KTRA 3FC4A 3WCQA 5EE0A 3JVZX 1WM3A 1WM2A 4L1BA 2LXAA 3T3NA 4W9EA 1ZUD2 2W82A 2MW5A 1JRPA 2MJ3A 2BT6A 3U52E 2L32A 1JWAD 1N62A 1KH0A 2KQSA 5EE1A 1XLQA 1WGGA 1V80A 2IO0B 3WAMA 4FJYA 3QWZB 1QF6A 2CHZA 4ZDVA 4A9AA 2KWUB 4NNJB 3AEGB 3ENEA 4AJYB 2DZIA 2ZCBA 3KWVA 4ZHOA 2LFIA 1MJDA 2BPSA 4NJ7A 4WWMA 3T8MA 2BS2B 3V61A 2J42A 2WDTB 4KKIA 1V97A 3SU8X 3C0RB 1LO5D 2GBJA 3KVFB 2LUMA 1CZPA 3R7RA 2RPVA 4JPSA 3VH3B 4GDKA 1LQBA 3H7PB 1EU3A 1I4HA 2JUOA 4KV2A 1R4NB 4JLCA 1ZKHA 1E5WA 1GAQB 1MVKA 2ZPYA 4KKJA 2FCNA 1R4MI 1GNUA 3P1MA 5D2MB 4YT0B 4LNOA 4PYZA 2RPQA 4JWUC 2KN4A 1MFWA 3B2GA 1VZ7A 2JSVX 1E8YA 3VRAB 3Q8AA 2PMVA 4KDLB 3DBLB 2NTSA 3H7PA 4YXDB 4W9DA 4W9KA 3L10B 1WXAA 1NVID 2LVQA 3KUCB 4WQMA 2JRHA 2GBMA 2K8HA 3I3TB 4ANVA 2KC2A 4NQKE 4K81A 3PRMB 2L76A 1WIAA 2PPHA 4BOZB 3W5UB 4MSMB 4UDUC 4YSYB 4FULA 3NZ3A 1WFYA 1TJEA 1V2YA 2JVCA 2N7DA 5E6PA 3DVNU 2BVCA 4GDKB 2KX0A 2ZW1A 1FPYA 3ECIA 3RD2A 1DGJA 2JZ3B 1D5XC 5H8YE 2QC8A 3Q3OC 4MSQB 2JQRB 4ANXA 1P3QU 2AQ2B 2AX5A 2NBUA 3GP7A 2UU7A 4KZ0A 2PVGC 5AEKB 2D3BA 1FRDA 2DYBA 3BINA 4EZJA 1QZEA 2JWZA 1K51A 2MP2B 3B08A 3TL5A 2GMIC 2WXRA 2AL3A 2H88B 3AMZA 1T5XD 2N7EA 3CMMB 1J8CA 3DVGX 1I4PA 4FXCA 3A4SC 4NJ6A 2V4IB 1PUTA 3R8BA 3ZXRA 2LJIA 1FM0D 4FA6A 2I2YA 2XN9C 2N9LA 3N1ZC 4IKGA 2FCSA 3BVMA 3ABVB 2KK8A 1OQRA 4YTMB 1WX9A 4ZRJA 3W1SA 2DBYA 3M3JA 4KZCA 3P4RB 1WSPA 2ASQA 5D94A 4MDKE 2BYEA 1L4DB 2LHDA 2MJDA 1UNSA 3GZNI 3PT2B 1J7CA 3ZJVA 3DBSA 2KQ4X 4G3XB 2KMAA 4IOIE 1XT9B 2KDFB 4KSKC 5AZFA 2L05A 3PRPB 1SGHA 1KOTA 1SXTA 4QAYA 2BTEA 1QOAA 5CHVC 3W2DA 3VUWA 3AU5A 2Z0EB 4I6PA 2MEKA 3L17A 3NVVA 2JXTA 4ICVA 1SEBD 3W1SC 2ICIA 2YLMA 3E9SA 4WWNA 1BT0A 2VZKD 4KGSA 4WJPA 3O13A 1WF9A 1T0YA 2SAKA 1L2NA 1L0XB 1QOGA 3IT6B 2ZVOA 1NI3A 1IYFA 2WDVB 3U4EG 3ZJUA 1GC6A 4BOSC 1C77A 4C4VA 4B9KA 2XNAC 4EKUA 1TTNA 4C80A 4JQWC 1WXVA 3NUHB 4FHKA 4DQOC 4DDID 1FNVA 4YSZB 4W9CA 1UGMA 2M0XA 1TBEA 3KH0A 4YSXB 3AB5A 2IO3B 3NJTA 2KDBA 3BK1A 3K9PB 2HTME 1WGHA 4IG7B 2KLGA 1FXIA 1JWMD 1ZDXA 2D3CA 3RNCC 4EFOA 2V1YA 1OEYJ 3WAOA 2QJLA 2NCNA 3B9JA 4W9LA 1I4XA 3ZXVA 1CMXB 2M19A 3ZGZA 2K8CA 1HZ5A 3IHPC 1A5RA 4G0NB 3V3XA 2DAJA 1PGAA 3FAHA 4HDOA 3AE3B 3TBLD 4USAA 2LGYA 1H7WA 2KLCA 4NAWB 4DHJD 2DZMA 4JL9A 2DNFA 5E6OA 1KF6B 4XE0A 1J7BA 1WX8A 3TEXA 2CJNA 3AI5A 3L13A 3NRZA 4CHKA 3OJ3A 2W55A 4K3BA 4FLHA 2SEBD 4US9A 3QHTA 3V6CB 2NS5A 4XX5A 4RGTA 2KJ6A 1WE6A 2KWDA 2QDFA 2D11A 1JRUA 4HXDA 1LGRA 3AEEB 2MLBA 4FADA 2K3UA 4XDCA 2EMSA 3QCAA 5G2NA 3Q3NC 4WJNA 5H92C 3Q8BA 1V1PB 1V9JA 1SJED 3EA6A 4M00A 3AEFB 2KACA 1OEYA 2BYTA 2KMMA 4E74A 1HE8A 5IP4D 2WLBA 1VZ6A 1DYQA 4DHZE 3QQ8B 1YMHE 3HM3A 4CO7A 2WU5B 2O6VA 3V05A 1QT9A 3ZNZB 1RYJA 4HK2A 3DBLI 2DYMA 3DPDA 1ZOYB 3Q14C 3DWMA 2KT7A 4MM3A
chains in the Genus database with same CATH topology
1D5ZC 4HJGE 4JE3B 3AE2B 1STEA 1GTEA 3ETRA 1N5WA 4HROA 1IGCA 5HI1A 1KRHA 4IDIA 1A70A 4RNAA 4DXFA 2RDGA 3AV8A 1XLPA 2RMMA 2IGHA 1ET6A 1SJHD 1YN3A 3OWEB 2B76B 1SE3A 3IAM1 5HHDG 1XLOA 5T8IA 3AE8B 3P4SB 3AECB 3MJ5A 1UUPA 2WNMA 3SEBA 1AW7A 1Y56A 3TSSA 3FC4A 3WCQA 1ROEA 3NS1A 4RCOA 5EE0A 1AWDA 3CF4A 4L1BA 3DWGC 3AE5B 2WXPA 2Y5PA 2JZPA 1K53A 3T3NA 1DOIA 1L5PA 2WXFA 4JX1C 1ZUD2 2WS3B 5EE9A 3SR6A 2W82A 3U2SC 1QOFA 1JRPA 1UWMA 2MJ3A 1VRAB 2Q5WD 2BT6A 3U52E 4ITKA 2K5PA 2L32A 1JWAD 1N62A 1KH0A 2KDMA 1JROA 5EE1A 4P16A 1XLQA 1ESFA 3R2IA 2BS3B 3RPFC 4LTUA 1YJIA 5E6JA 5I4DA 1VR9A 4JWSC 4WH4A 2IGDA 2BB5A 3AEBB 1J7AA 4MM3B 1C79A 1TKGA 2IPKD 3U7ZA 1QF6A 2ON8A 5FK9C 4A9AA 1VJKA 4RFBA 1NYRA 2DLBA 3LB8C 3AEGB 1GB1A 4AQ7A 1ZPSA 1SIJA 4ZHOA 2R61A 3KWVA 2LFIA 2WQYB 1FNUA 4WWMA 2BS2B 2GRIA 1JCKB 2CU3A 2J42A 4KKIA 1V97A 2V0GA 3BVGA 1FRRA 1TS4A 2GB1A 1P7EA 5LNK1 1LO5D 3T3OA 5C2TB 4REZA 1HQRD 1EWCA 1RM6C 2LUMA 2WXIA 4A90A 5D3DA 1AN8A 1CZPA 3ZJTA 2RPVA 2WXHA 2N7JA 4JPSA 2JWUA 1ZE3D 4ARCA 1N63A 2BW2A 3B2FA 1YQ4B 1SF0A 1YN4A 3GS2A 2WXJA 1EU3A 1L6UA 1MPEA 2DWQA 5C3JB 2GI9A 2LMCA 2ZW0A 1I4HA 1SSNA 4OZBA 3P42A 4HEA1 2FBWB 1GB4A 1T6BX 1YQ3B 1L6VA 1GAQB 5JXVA 1MVKA 1E6EB 4KKJA 4ARIA 5BMIA 1C4AA 2L52A 3P4QB 1HEZE 1OQQA 4RGMA 2PVOD 3CIRB 2WXGA 3P1MA 2RDHA 2QEJC 2CJOA 4WAFA 4YT0B 1E7PB 1TY0A 1NENB 1ZXIA 2LEKA 2Z8LA 3GB1A 3L4PA 4B0EA 4JWUC 2L1AA 1F2RI 2KN4A 2X38A 3Q8CA 3B2GA 4TQ1A 2OHFA 1VZ7A 2JSVX 3CWIA 4KX6B 1E10A 3NVYA 3VR8B 3VRAB 3Q8AA 2IDYA 4N59A 2PMVA 1AYFA 1V1PA 2NTSA 4RGOS 4YXDB 4ZRQA 1TS5A 3BIID 1CJEA 1NVID 1SE4A 4Q2JA 1C78A 4WQMA 2LGIA 4TMAB 3UI3A 1FIQA 1I4RA 3I9V1 3AE7B 3W5UB 3AE6B 1QOBA 3PZ7A 4YSYB 4UDUC 3NZ3A 1GTHA 4KGTA 1TJEA 3AEAB 4GDKB 1GT8A 2G1EA 2ZW1A 3HVZA 3AE9B 2MJEA 4US8A 4GDLB 1DGJA 1MHHE 1K52A 4N6EB 5BMGA 3P4PB 2WP9B 4MH8A 1ZP0B 1D5XC 5H8YE 4EE2A 1RWSA 3EGRA 3MC0B 4ZOHC 1SB3C 1FFUA 2JQRB 4ZYSA 1TYGB 1UWXA 1N5XA 2AQ2B 2AX5A 3GP7A 1C4PA 4C7YA 1XLNA 1QILA 1ACCA 4WURA 1MI0A 2PVGC 3H8HA 1FRDA 2N9KA 1FFVA 1JMLA 4B0MA 4H2AA 1IUEA 3RFZB 1K50A 1D4BA 1NEKB 1L0YB 3IAS1 4M0WA 1K51A 1JQ4A 2IGGA 3IT4B 4OVZA 2WXRA 3N9YC 2H88B 3AMZA 1T5XD 4MT5A 4CQNA 1E0ZA 3HVDA 1I4PA 1FMAD 4FXCA 2D5GA 4OHJA 5AUKA 2M0AA 1KTKA 3PZ8A 2V4IB 2LHEA 1PUTA 4L23A 1ET9A 1WGKA 1BUIC 3SFDB 3R8BA 1TS2A 2FE8A 4J3OD 3VRBB 2LJIA 1XF5L 1FM0D 4NJCA 3I57A 3MP9A 2I2YA 2XN9C 1JWSD 2N9LA 4IKGA 1P7FA 3BVMA 3ABVB 3P63A 1FCCC 2V3NA 1OQRA 4YTMB 3BZDB 1R7SA 3R2TA 5D3IB 2N0SB 1FCLA 3W1SA 2YEPF 1KLUD 4YTPB 2DBYA 3VQIA 5BYQA 3P4RB 2HDEA 1WSPA 2ACZB 4AS1A 1HA5A 2LHDA 1C4CA 1L4DB 2MJDA 2VZKB 1UNSA 2WXQA 1N61A 1J7CA 2J53A 1ZXHA 1DOXA 3E56A 3LXFA 1F2RC 1NYQA 4DXGA 3KWLA 4C7ZA 3ZJVA 4GLSC 2G9HD 2FUG1 1GOZA 3J9CA 4TSSA 5FR3A 2KQ4X 2PLPA 2I38A 4IOIE 1JW9D 2MH7A 2NMQA 2BB6A 2PW9A 1SE2A 2W3SA 1YJJA 1JALA 3MHZA 4XWTA 1SXTA 2Y3AA 1I4GA 2BTEA 1CQVA 4ZHPA 1QOAA 3W2DA 2WXMA 1XXGA 4R3DA 1ZDVA 3BK2A 4LK0M 3AE1B 1SBBB 2MEKA 5FKAC 1EU4A 2JXTA 3BYTB 3NVVA 4HKZE 1SEBD 1PFDA 1T3QA 2ICIA 2K9XA 2W3RA 3E9SA 5EE3A 1KLGD 1TZOA 1I7HA 2VZKD 4KGSA 5HG2A 3O13A 3AE4B 1XEEA 2INNE 2SAKA 5BYSA 1L0XB 2WDQB 1QOGA 2DYOA 3IT6B 2E6XA 1NI3A 1CK1A 2BS4B 2WDVB 3FILB 4PT5A 3U4EG 3ZJUA 2WU2B 1C77A 3MFGA 2JYEA 2XNAC 1OFFA 3BYYB 1VZ8A 3Q8FA 1QLBB 4NAMA 4C80A 2J52A 4YWGG 4RH6A 1PYWD 3NUHB 1YN5A 1WWTA 1HXYD 5GXGB 4DQOC 1F0ZA 1WRIA 4WIPA 1FNVA 4RGNA 4YSZB 2EKIA 4O1NA 1BMLC 3KLSX 1L0VB 4YSXB 3AB5A 3VR9B 2BBCA 1IBXB 3BK1A 2HTME 2OEDA 5MPOA 1N60A 1FXIA 1JWMD 1ZDXA 4KGRA 1H7XA 4RF1A 2QILA 3BVZA 2WXNA 2JX5A 2QJLA 1KFYB 1QQRA 1F77A 3AM9A 2JU6X 3NVWA 4HRSA 4OZAA 3B9JA 1M4VA 4OZCA 5TSSA 1I4XA 1IGDA 3HUIA 1JWUD 1XO3A 2EELA 2M19A 3Q69A 2J4XA 3ZYYX 3ZGZA 4YTNB 3W9CB 1HZ5A 2WDRB 1RFKA 2Y5CA 5AUIA 1WYGA 1V1OA 2WXOA 1C9FA 3V3XA 2QIEB 3HRDD 5BMHA 1PGAA 3FAHA 2IJ0A 1VDVA 3AE3B 4USAA 1IBXA 1H7WA 4NAWB 1TY2A 4A55A 2INPE 1KF6B 4XE0A 1J7BA 3TEXA 1TS3A 1JWBD 1VLBA 5G5GA 2CJNA 4A6QA 3W5VB 2NTTA 3NRZA 3NVZA 4P6VF 3AH7A 2PKOA 3IXSA 2W55A 4A8XC 2WXLA 2SEBD 4US9A 3TEZA 3AN1A 1HZ6A 1L4ZB 3C8YA 4RGTA 4NZLB 3LYYA 2JYTA 2KAJA 2KWDA 4C56C 4OW0A 3ZQ4A 1E9MA 2K0PA 2V3PA 5G5HA 1TKYA 3AEEB 3FILA 1FNWA 2K3UA 1UGJA 3TEWA 2QSDA 2PIAA 4XDCA 3URYA 3PO0A 5H92C 1YNTE 3Q8BA 1V1PB 1SJED 4D2KA 3EA6A 1V8CA 3AEFB 2KACA 2AQ3B 1QKZA 1FO4A 2BYTA 1FEHA 4TQ0A 2YEPB 2M56B 1PDXA 2KMMA 1FD6A 2E3TA 1D6EC 1B9RA 3SFEB 1EM7A 1ENFA 1XCTL 5D7GA 2WLBA 5BYRA 4N58A 1VZ6A 1DYQA 1EWYC 2QMTA 3BWUD 4XWWA 1GPXA 1XCQL 1DOYA 2AQ1B 1WXQA 1YMHE 1FXAA 3KQ4A 2WU5B 1TKEA 1Q10A 4RF0A 1PGBA 2H89B 3AEDB 1B1ZA 4L2YA 4XDDA 2W54A 1QT9A 3V05A 3Q8EA 1RYJA 1PGXA 2TSSA 2ONQA 2PTLA 2DYMA 2K22A 3TEYA 4HKQA 1MHXA 2L83A 4LLGM 2WXKA 1ZOYB 4MACA 1D5MC 3DWMA 3EUB2 4ZRPA 5HFYA 1BXTA 3TUOA 1I4QA 1C76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAQ B;  2JX5 A;  3ABV B;  1E6E B;  3P63 A;  3AE2 B;  1OQR A;  1GTE A;  3ETR A;  1N5W A;  4YTM B;  2L52 A;  3P4Q B;  2QJL A;  1KFY B;  3AM9 A;  1R7S A;  4HRS A;  4HRO A;  1KRH A;  1OQQ A;  3NVW A;  4IDI A;  2PVO D;  3CIR B;  3B9J A;  1A70 A;  2N0S B;  3P1M A;  4YTP B;  3AV8 A;  2CJO A;  1XLP A;  4YT0 B;  1E7P B;  2DBY A;  1NEN B;  1ZXI A;  2LEK A;  3L4P A;  2B76 B;  3P4R B;  3HUI A;  4JWU C;  1XO3 A;  2M19 A;  3ZYY X;  1XLO A;  3AE8 B;  3P4S B;  2ACZ B;  3AEC B;  4YTN B;  2OHF A;  3B2G A;  3W9C B;  1RFK A;  2WDR B;  2Y5C A;  5AUI A;  1WYG A;  2MJD A;  4KX6 B;  3CWI A;  1E10 A;  3W5U B;  3NVY A;  2QIE B;  1N61 A;  3HRD D;  3VR8 B;  1J7C A;  3VRA B;  3FC4 A;  3WCQ A;  1ROE A;  3FAH A;  4N59 A;  1DOX A;  1AYF A;  1VDV A;  3NS1 A;  5EE0 A;  3AE3 B;  3LXF A;  4USA A;  1AWD A;  1H7W A;  4YXD B;  1NYQ A;  3CF4 A;  1CJE A;  3BII D;  1NVI D;  3DWG C;  3AE5 B;  4WQM A;  3KWL A;  4C7Z A;  3SR6 A;  1KF6 B;  1J7B A;  1FIQ A;  1JWB D;  1VLB A;  1DOI A;  1L5P A;  2CJN A;  1JW9 D;  4JX1 C;  2MH7 A;  5G5G A;  3W5V B;  1ZUD 2;  2WS3 B;  3AE7 B;  3NRZ A;  3NVZ A;  4P6V F;  3AE6 B;  1QOB A;  2PKO A;  4YSY B;  3AH7 A;  5EE9 A;  1QOF A;  2W55 A;  2W3S A;  1YJJ A;  1JAL A;  4US9 A;  1GTH A;  1JRP A;  1UWM A;  2MJ3 A;  3AN1 A;  2Q5W D;  1TJE A;  2BT6 A;  4ITK A;  2K5P A;  1JWA D;  3AEA B;  1N62 A;  4ZHP A;  1QOA A;  2KAJ A;  1GT8 A;  1JRO A;  2G1E A;  3HVZ A;  1XLQ A;  5EE1 A;  1E9M A;  3AE9 B;  2BS3 B;  3RPF C;  4LTU A;  2MJE A;  4US8 A;  1YJI A;  1DGJ A;  4JWS C;  4N6E B;  5G5H A;  3P4P B;  2WP9 B;  1TKY A;  3AE1 B;  3AEE B;  3AEB B;  1ZP0 B;  1J7A A;  1TKG A;  3NVV A;  5H8Y E;  1QF6 A;  1PFD A;  1RWS A;  1T3Q A;  2K9X A;  2PIA A;  1SB3 C;  1VJK A;  2W3R A;  4ZOH C;  4A9A A;  1FFU A;  5EE3 A;  2JQR B;  3PO0 A;  1I7H A;  1TYG B;  1NYR A;  1N5X A;  5H92 C;  2AX5 A;  3LB8 C;  3AEG B;  3AE4 B;  4C7Y A;  1XLN A;  1QOG A;  2WDQ B;  1SIJ A;  1V8C A;  4ZHO A;  3AEF B;  2PVG C;  1NI3 A;  1FRD A;  1FFV A;  2WQY B;  2BS4 B;  1FO4 A;  2WDV B;  1IUE A;  2M56 B;  1NEK B;  2WU2 B;  1PDX A;  2KMM A;  4WWM A;  2BS2 B;  2E3T A;  1B9R A;  1OFF A;  3SFE B;  2WLB A;  2CU3 A;  1QLB B;  4C80 A;  1JQ4 A;  4N58 A;  1EWY C;  1V97 A;  2H88 B;  1GPX A;  3AMZ A;  1FRR A;  1DOY A;  1WXQ A;  1WWT A;  1FXA A;  1E0Z A;  2WU5 B;  1FMA D;  5C2T B;  1TKE A;  4FXC A;  5GXG B;  2H89 B;  1F0Z A;  3AED B;  1RM6 C;  1WRI A;  5AUK A;  2W54 A;  4YSZ B;  1CZP A;  1QT9 A;  2EKI A;  1RYJ A;  1PUT A;  1N63 A;  1WGK A;  3B2F A;  1L0V B;  1YQ4 B;  1SF0 A;  4YSX B;  3SFD B;  3AB5 A;  3VR9 B;  2K22 A;  1L6U A;  2DWQ A;  2HTM E;  5C3J B;  3VRB B;  2L83 A;  5MPO A;  1ZOY B;  1FM0 D;  1N60 A;  1FXI A;  3DWM A;  3EUB 2;  2FBW B;  1H7X A;  1YQ3 B;  1L6V A; 
#chains in the Genus database with same CATH topology
 1STE A;  1N5W A;  2KWC A;  5HI1 A;  1KRH A;  3H7S A;  2IGH A;  1YN3 A;  2L0F A;  4GB9 A;  5HHD G;  1XLO A;  4DWF A;  3VH4 B;  2N1W A;  1Y56 A;  3TSS A;  3ZDM C;  2NPT B;  3NS1 A;  1AWD A;  4C00 A;  5HKH A;  3AE5 B;  2KC1 A;  3ZKJ C;  2JZP A;  1K53 A;  4J6I A;  1L5P A;  4JX1 C;  5EE9 A;  3SR6 A;  2L00 B;  2MP2 A;  1KM7 A;  2R2O A;  1R4M B;  4EOY A;  2Q5W D;  4TKN A;  1F9J A;  3LJ3 A;  2K6Q A;  4IM3 A;  4P16 A;  1ESF A;  3R2I A;  4DHZ B;  4LTU A;  3V60 A;  2X8X X;  2BWE S;  4JWS C;  4WH4 A;  3AEB B;  1J7A A;  4MM3 B;  3U7Z A;  5LXI B;  3W1Y A;  4WJQ A;  3PSE B;  4RFB A;  4F7Z A;  2DLB A;  2LD9 A;  3LB8 C;  1GB1 A;  3WAN A;  4AQ7 A;  2MA9 B;  2LGX A;  1ZPS A;  1SIJ A;  2LWP A;  2R61 A;  1E8Z A;  2I1K A;  3ZRF A;  2CU3 A;  2V0G A;  1FRR A;  1P0R A;  1XD3 B;  3PGE A;  5C2T B;  4REZ A;  3ZVV A;  3T3O A;  1EWC A;  1RM6 C;  2WXI A;  4A90 A;  1AN8 A;  2N7J A;  1ZE3 D;  4MEM A;  2WGS A;  4ARC A;  1N63 A;  1YQ4 B;  1SF0 A;  2BKF A;  2WXJ A;  1L6U A;  4HEA 1;  1WJ6 A;  2O6V B;  2D3G A;  3M63 B;  1C4A A;  2L52 A;  3P4Q B;  2XK5 B;  4RGM A;  1F1H A;  3ML8 A;  4DBG A;  2PEA A;  2RDH A;  4GGQ A;  2CJO A;  1NEN B;  4B0E A;  3V6E B;  2L1A A;  1F2R I;  2I1J A;  3N30 A;  3Q8C A;  2OHF A;  4ACF A;  3H6N A;  4KX6 B;  1E10 A;  1M94 A;  1V5T A;  4ANW A;  2REX A;  5KHQ A;  4HPM B;  2V4L A;  3BII D;  4Q2J A;  1LM8 B;  2N4F A;  4GMV A;  1I4R A;  3IFW B;  1Q0W B;  3AE6 B;  1WGD A;  2O6V D;  4MGI E;  3DQV A;  1GTH A;  1OGW A;  4FBJ B;  1GT8 A;  2GOW A;  4YL8 A;  2MJE A;  4WJO A;  1MHH E;  3M62 B;  5GMV A;  5BMG A;  4RM8 A;  1EO6 A;  4EE2 A;  4K7W A;  4ZOH C;  3ZNG C;  2ZJD A;  3OJ4 B;  1N5X A;  4RMA A;  4C7Y A;  1XLN A;  4LNI A;  4MJS A;  1MI0 A;  4EZK A;  3H8H A;  1FFV A;  3WAP A;  1C1Y B;  1E8W A;  1L0Y B;  2KQ7 A;  1K8R B;  2G4S A;  3O65 B;  4M0W A;  1JQ4 A;  2IGG A;  3IT4 B;  2KVR A;  3L54 A;  3N9Y C;  1E8X A;  3DHI C;  3PZD A;  4MT5 A;  4CQN A;  4P1B C;  2VRR B;  3PHW B;  1XQQ A;  2C7N B;  2D5G A;  2PE9 A;  1P9D U;  1KTK A;  3PZ8 A;  4BKG A;  1TGZ B;  2KDE B;  1VD2 A;  1BUI C;  3SFD B;  4E71 A;  3VRB B;  3R7Q A;  1XF5 L;  4JIO U;  1Z5S B;  4ANU A;  3I57 A;  5DPT A;  1JWS D;  4TUU A;  3P63 A;  1NBF C;  3R2T A;  2M1M A;  5D3I B;  2N0S B;  3PRE A;  4M8M A;  3QAR A;  4I6N B;  2FIF A;  2K6D B;  4EEW A;  2RDB C;  2ACZ B;  1IP9 A;  1HA5 A;  2RR9 A;  2CHW A;  2LRW A;  1ZXH A;  3R3M A;  2J0M A;  1DOX A;  1F2R C;  3RZW C;  3OG5 A;  3NZS A;  4GLS C;  1GOZ A;  4TSS A;  2L0T A;  2MH7 A;  1I42 A;  3QAQ A;  2D2Q A;  3A1Q A;  2D3A A;  2RGF A;  2JRI B;  3MHZ A;  4XWT A;  3APF A;  3ML9 A;  4ZHP A;  1SIF A;  3DHG C;  2HD5 B;  3KUD B;  2KVZ A;  3BK2 A;  3SDL C;  1EU4 A;  3BYT B;  2OOB B;  1PFD A;  2K9X A;  2LGS A;  4BBN F;  2N9X A;  1Q1O A;  1TZO A;  1SE9 A;  4XZ4 A;  2KTR B;  2WDQ B;  3QIJ A;  3KYC D;  2R2Q A;  2GBR A;  2WU2 B;  2JYE A;  4URK A;  4MGY E;  3Q8F A;  1QLB B;  4NAM A;  3DBR I;  3EEC A;  4YWG G;  4M02 A;  4RH6 A;  5D6J B;  1WWT A;  1T0Q C;  4IC7 B;  5AZH A;  4WIP A;  1BML C;  3JSV A;  1L0V B;  4E3C A;  3BY4 B;  3EFC A;  5MPO A;  1WZ3 A;  2EKE C;  4KGR A;  2LJ5 A;  1H7X A;  3RI7 C;  3RNA C;  3VVW B;  4RF1 A;  2JX5 A;  3PHX B;  2JF5 A;  2BWF A;  1QQR A;  4HRS A;  3AM9 A;  3RMK C;  4F1S A;  1NDD A;  5CHF A;  3VDZ A;  3NHE B;  2MWS B;  1IGD A;  1HTQ A;  4XC2 A;  3M95 A;  3I63 C;  3Q69 A;  1MG8 A;  3ZYY X;  2EMT A;  1YX5 B;  3W9C B;  3VXW A;  5AUI A;  3OAW A;  1WYG A;  1KJT A;  3HRD D;  5BMH A;  2KFJ A;  3B0A A;  2IJ0 A;  1VDV A;  3Q6B A;  3VAW A;  3PLU A;  2WX0 A;  3V62 A;  2INP E;  1JWB D;  2FCQ A;  3HM6 X;  2WXL A;  2IBI B;  3P2B A;  3AXC A;  2XBB C;  1ZW7 A;  2CHX A;  2JYT A;  3TCA A;  2K0P A;  2A5U A;  2MHJ A;  3FIL A;  1UGJ A;  3TEW A;  2QSD A;  4XGA B;  4C4V B;  1WE7 A;  1UF0 A;  1GG3 A;  4MGK E;  2CU1 A;  2LRU A;  3ZW3 A;  2V9H A;  3MJW A;  2YEP B;  1PDX A;  1FD6 A;  4W9J A;  3TMP B;  1D6E C;  3ZNH B;  1ENF A;  1XCT L;  3A9K A;  2FCM A;  5BYR A;  4BFR A;  4N58 A;  1UBI A;  4XWW A;  1EWY C;  1XCQ L;  1DOY A;  3KQ4 A;  2V3S A;  1TKE A;  4RF0 A;  1PGB A;  2AYO B;  5EDS A;  1PGX A;  4A3O A;  2PTL A;  3TEY A;  4HKQ A;  4BKS A;  4BKS D;  3CST A;  4LLG M;  2RSU A;  1WXM A;  4ZRP A;  5HFY A;  1BXT A;  3TUO A;  1D5Z C;  4HJG E;  4HWI B;  4JE3 B;  2L8J A;  3ETR A;  1GTE A;  3N1Y C;  3ZIM A;  2IO1 B;  1OQY A;  5J17 A;  1GC7 A;  2CS4 A;  1D3Z A;  2RDG A;  3AV8 A;  1WXS A;  3OWE B;  2B76 B;  3UQB A;  3IAM 1;  4LDT B;  2WNM A;  5G55 A;  1ROE A;  3CF4 A;  3DWG C;  4HVB A;  4MJS B;  2DZJ A;  2WXP A;  2Y5P A;  4ZRI A;  3A4R A;  1DOI A;  2WXF A;  4GIV A;  3Q3M C;  3U2S C;  1QOF A;  2KD0 A;  4ICU A;  2KFK B;  1UWM A;  3DHH C;  1VRA B;  4KSL C;  1WR6 E;  4ITK A;  2K5P A;  1UH6 A;  3T9L A;  2KDM A;  2K1F A;  2MBH A;  1YJI A;  5E6J A;  5I4D A;  2IGD A;  5IN7 A;  4JGH B;  3QX1 A;  3UIO B;  2IPK D;  2JPH A;  2L7R A;  4IUM B;  1V49 A;  1WH3 A;  1Z2M A;  3ZTD A;  1WJ4 A;  2LXC A;  2WQY B;  4DHJ B;  2D07 B;  1JCK B;  1EF1 A;  4MGZ E;  4W9I A;  3B1L X;  3BVG A;  4LJP B;  3EC8 A;  1TS4 A;  2IND C;  1P7E A;  3VTV A;  3KUZ A;  3ZJT A;  3APD A;  2WXH A;  3DDC B;  3NOB A;  2JWU A;  4NY0 A;  3S2A A;  1YN4 A;  2ZPN A;  1MPE A;  4BKT A;  2ZW0 A;  5DCN A;  1T0R C;  4OZB A;  1WGR A;  4K3C A;  4II2 B;  1T6B X;  1YQ3 B;  1L6V A;  4KIK B;  5BMI A;  4W9H A;  2DEN B;  1HEZ E;  2L3Z A;  1GUA B;  1E7P B;  3L4P A;  5TR5 A;  1ZXI A;  3N32 A;  3GB1 A;  2C60 A;  2IY1 B;  3R66 C;  4TQ1 A;  4FJV B;  3U7D A;  5IKC M;  5L83 A;  2HTH A;  2XK5 A;  3CWI A;  3DVN V;  3NVY A;  3VR8 B;  2C7M B;  2IDY A;  1AYF A;  1V1P A;  4AJW A;  2HJ8 A;  2LGI A;  3UI3 A;  1WMH B;  2K8B A;  4IW0 A;  3AE7 B;  5CHW A;  3VUY A;  3PZ7 A;  2G4D B;  3L08 A;  3MHS D;  3NY5 A;  4KGT A;  4IWO A;  3AEA B;  5DPS A;  2M4N A;  2G1E A;  2IO2 B;  3HVZ A;  3IG3 A;  1E7U A;  1ZGU B;  2CKH B;  2FUH B;  4US8 A;  1K52 A;  4N6E B;  2KFK A;  3ZNI D;  1RWS A;  1Y8R C;  1SB3 C;  4ZRK A;  3A9K B;  1UWX A;  4AOF A;  4WWP A;  1QIL A;  2N9P C;  1X1M A;  4MEL A;  1ACC A;  2ZNV C;  3RT3 B;  2J7Q B;  4H2A A;  1IUE A;  4B0M A;  3RFZ B;  1K50 A;  5CTR C;  1D4B A;  3QA8 A;  3IAS 1;  3UQA A;  2MRP A;  4OVZ A;  4LDT D;  3SD5 A;  2KJH B;  3IVF A;  3X0W A;  1I35 A;  5AUK A;  3GE3 C;  4FHJ A;  5FR6 A;  2LHE A;  4RM9 A;  1ET9 A;  1WGK A;  2LVP A;  1UEL A;  1TS2 A;  2FE8 A;  2KJR A;  2K25 A;  4NJC A;  1T0S C;  3KYD D;  3MP9 A;  3C19 A;  3UF8 A;  3WA0 A;  1H4R A;  1P7F A;  4M01 A;  1FCC C;  4HPL B;  2V3N A;  3HIZ A;  4K1R B;  3BZD B;  1R7S A;  3DBH I;  3WAL A;  4W9F A;  2YEP F;  1KLU D;  4YTP B;  2MQJ A;  3DBR B;  3DOW A;  5BYQ A;  2MSE D;  4B6W A;  4BAX A;  3PVL A;  2VZK B;  2WXQ A;  1N61 A;  2J53 A;  5L95 C;  3Q2A C;  3RYT A;  2C9W B;  4LNF A;  3KWL A;  2JT4 B;  4C7Z A;  2G9H D;  2D10 A;  4LNK A;  2Z59 B;  2I38 A;  2DAF A;  2G3Q B;  3VHT C;  3VTU A;  2W3S A;  3DBH B;  4WAA A;  1Q5W B;  2G45 B;  4A20 A;  5DPR A;  4HDQ A;  3JSV B;  2WXM A;  3RNF C;  4DK5 A;  3DCG A;  2HJ1 A;  1P98 A;  1ZDV A;  1S1Q B;  3AE1 B;  2MBQ A;  2W3R A;  1KLG D;  3RUI B;  1UD7 A;  1S3S G;  5HG2 A;  1U4A A;  4AUQ C;  3AE4 B;  1XEE A;  2INN E;  1E90 A;  2BQQ A;  1YIW A;  2E6X A;  1OFF A;  2MX2 A;  3CSF A;  4K7S A;  1TZ1 A;  3IBE A;  2J52 A;  1YN5 A;  3UGB B;  1HXY D;  5GXG B;  2NPT A;  2KDI A;  2EKI A;  4TV3 A;  4O1N A;  3D32 A;  4KIK A;  3VR9 B;  1IBX B;  4KVG B;  2OED A;  1N60 A;  4GSW A;  1YQB A;  2QIL A;  4BZA A;  3GE8 C;  4N9F 4;  1KFY B;  4OZA A;  1F77 A;  4FN2 A;  2JU6 X;  2NBW B;  1M4V A;  4OZC A;  3CF6 E;  3MC9 A;  1JWU D;  2J4X A;  1V86 A;  1C3T A;  4NAW A;  2KKC A;  2Y5C A;  2WXO A;  1C9F A;  1RRB A;  2M17 A;  3N3K B;  3JW0 X;  1WX7 A;  2DHZ A;  3ALB A;  1IBX A;  1F52 A;  1TY2 A;  1MG4 A;  3N1X C;  1VLB A;  5G5G A;  4A6Q A;  3W5V B;  2JZZ A;  3AU4 A;  2UWQ A;  1OTR B;  4HJK A;  3AH7 A;  3IXS A;  2GBK A;  4A8X C;  1HZ6 A;  2WX1 A;  1TIF A;  4WWO A;  3PLV A;  2KAJ A;  5IA7 A;  3QJZ A;  3NZU A;  1E9M A;  1WZ0 A;  2MBE A;  1V81 A;  4KDI C;  1H8C A;  4HLE A;  2V3P A;  1TKY A;  4OVU A;  1GJZ A;  2PIA A;  4ZYN A;  3PO0 A;  4S0R A;  5AZG A;  1YNT E;  4II3 B;  3TJP A;  1V8C A;  2AQ3 B;  1QKZ A;  3Q3F A;  4LJO B;  2M56 B;  4DDG D;  5C1Z A;  1B9R A;  3SFE B;  5D7G A;  3BWU D;  1J0G A;  2AQ1 B;  4G50 A;  1WXQ A;  1FXA A;  1HTO A;  1P1A A;  2AWT A;  3TIX A;  4P7I A;  3AED B;  4XDD A;  2KO3 A;  1YX6 B;  2TSS A;  2BF8 B;  2BYV E;  2L83 A;  2WXK A;  4MAC A;  4CYE A;  2C7H A;  1I4Q A;  2QCZ A;  1C76 A;  5E6N A;  3AE2 B;  2Y5B B;  3SHQ A;  5IAA C;  3NG0 A;  2W9N A;  1IGC A;  1UZX B;  4PYU A;  4DXF A;  4B95 A;  1YOV B;  3L16 A;  5T8I A;  4AWJ A;  3AEC B;  3MJ5 A;  2UYZ B;  3RUL A;  2A4Z A;  4RCO A;  1AAR A;  2RD0 A;  1IPG A;  1LFD A;  2WS3 B;  5LXH A;  2KOX A;  1YJ1 A;  3RN9 C;  2NR2 A;  1JRO A;  4K7U A;  2BS3 B;  3RPF C;  3ZLZ A;  1VR9 A;  2J0J A;  2KTF A;  2BB5 A;  1VCB A;  4GU2 A;  1C79 A;  1TKG A;  2ON8 A;  5FK9 C;  1VJK A;  3RCZ A;  4MH0 E;  4IWP A;  1NYR A;  3JYU A;  1WYW B;  4GN1 A;  3LDZ E;  4M8N A;  1FNU A;  4ASW C;  1YD8 U;  2GRI A;  4GXB A;  3MTN B;  1TT5 B;  5KHO A;  5IOI A;  3EHV A;  2GB1 A;  5LNK 1;  1HQR D;  2ZNV B;  5D3D A;  2ZZP B;  3KW5 B;  2BW2 A;  3B2F A;  1WJN A;  3GS2 A;  2DWQ A;  5C3J B;  1V5O A;  2GI9 A;  2LMC A;  3HK0 A;  4FJZ A;  1SSN A;  3P42 A;  1GB4 A;  2FBW B;  2VH2 A;  5JXV A;  1E6E B;  3ONS A;  2WYQ A;  4ARI A;  1OQQ A;  2KHW B;  2JXX A;  2PVO D;  4OVV A;  3CIR B;  2WXG A;  2QEJ C;  4WAF A;  2GLS A;  2LEK A;  1TY0 A;  2Z8L A;  4A3P A;  1RLF A;  3RNB C;  1KLV A;  4W9G A;  2BYF A;  2X38 A;  1L7Y A;  5JZE B;  4DXA B;  2WWZ A;  4G11 A;  4N59 A;  4X57 B;  4RGO S;  4ZRQ A;  1TS5 A;  2J0K A;  1CJE A;  1PQS A;  1SE4 A;  1C78 A;  4TMA B;  2N9E B;  1FIQ A;  4EZL A;  3I9V 1;  1QOB A;  5C23 A;  4LCD E;  2ZCC A;  2LUE A;  3VUX A;  2KXJ A;  2KMC A;  1NI2 A;  2HE7 A;  3AE9 B;  4GDL B;  3P4P B;  2WP9 B;  4MH8 A;  2NVU I;  1ZP0 B;  2LZ6 A;  3EGR A;  3MC0 B;  2WHI A;  2KYW A;  1FFU A;  4ZYS A;  1ISN A;  1TYG B;  3RNG C;  1C4P A;  1EF5 A;  5JHA A;  4WUR A;  2N9K A;  3DVG Y;  3PS6 A;  1JML A;  1WGY A;  1NEK B;  3A1Q B;  2KAN A;  3PPA A;  3WIM A;  3FKY A;  1V6E A;  3X23 A;  2OJR A;  2N1V A;  1E0Z A;  3HVD A;  1FMA D;  1RFA A;  4OHJ A;  2M0A A;  3PRZ A;  3OLM D;  2JY6 A;  4L23 A;  2IZV B;  4J3O D;  2ZEQ A;  4BVU C;  2FID A;  2IYD B;  4I6L B;  3UIN B;  1LXD A;  1WJU A;  4WQO B;  5BO4 B;  3ZDT A;  4GOC A;  1FCL A;  5DPW A;  3VQI A;  2CR5 A;  4LNN A;  2HDE A;  3ZRC A;  4AS1 A;  1UBQ A;  3HHM A;  1C4C A;  1J19 A;  3E56 A;  3L0W B;  3LXF A;  1NYQ A;  4PS7 A;  4DXG A;  3A9J B;  2FUG 1;  3J9C A;  3PTF C;  5FR3 A;  1R4N I;  2PLP A;  2XEW A;  3GOE A;  1JW9 D;  1WY8 A;  2NMQ A;  2BB6 A;  2PW9 A;  1SE2 A;  1YJJ A;  1JAL A;  2MCN B;  1WR1 A;  1E7V A;  3UIP B;  2Y3A A;  2MBO A;  1I4G A;  1CQV A;  1WRD B;  5LLI A;  1XXG A;  3H9D A;  4S17 A;  3ZUN A;  4R3D A;  4LK0 M;  1SBB B;  2FNJ B;  5FKA C;  2LGD A;  4HKZ E;  3AUL A;  1T3Q A;  5EE3 A;  3EFU A;  1I7H A;  1FXT B;  2Z0D B;  2FAZ A;  2VH1 A;  5BYS A;  2DYO A;  2O2V B;  1CK1 A;  2BS4 B;  4IM0 A;  3FIL B;  4PT5 A;  2KZR A;  3MFG A;  3BYY B;  1VZ8 A;  3RZF A;  3A33 B;  1PYW D;  4AP4 C;  3APC A;  1F0Z A;  1WRI A;  1EUV B;  4RGN A;  2PJH A;  3GZN B;  3VFK A;  3KLS X;  1WI0 A;  3N20 C;  5CX3 A;  2BBC A;  5JHB A;  2BKR B;  2AL6 A;  2QHO A;  3ZTC A;  3BVZ A;  2WXN A;  4PS3 A;  2O2V A;  3U30 A;  4P1C C;  2B3A A;  3MC8 A;  2LI5 A;  3NVW A;  4NQL B;  5TSS A;  2IY0 B;  2LAS A;  3HUI A;  3PV1 A;  1XO3 A;  2EEL A;  4YTN B;  4IM2 A;  5J18 A;  1RFK A;  2WDR B;  1V1O A;  2QIE B;  2KNB A;  4HCP B;  2M8S A;  1N6Z A;  3H1U A;  4A55 A;  3VTW A;  1TS3 A;  3K9O B;  4M0W B;  3NVZ A;  2NTT A;  4P6V F;  2PKO A;  4GDL A;  3U8Z A;  1RAX A;  2YVC A;  3TEZ A;  3AN1 A;  1L4Z B;  3C8Y A;  4NZL B;  3LYY A;  4C56 C;  2GBN A;  4OW0 A;  3ZQ4 A;  2INC C;  4HPP A;  4PK1 A;  2K39 A;  5G5H A;  2ZVN A;  4XYC A;  1FNW A;  2AEH A;  3QK0 A;  3URY A;  4D2K A;  4PS8 A;  2OJW A;  1G6J A;  3QC8 B;  1FO4 A;  3I5J C;  1FEH A;  4TQ0 A;  2DX5 B;  4NPN A;  2E3T A;  1EM7 A;  1WMH A;  2QMT A;  1GPX A;  4F8C B;  3Q3J A;  1Q10 A;  4EUT A;  2H89 B;  2MBB B;  1B1Z A;  4L2Y A;  2W54 A;  3Q8E A;  4IWQ A;  2ONQ A;  2LVO A;  5IO9 A;  2K22 A;  2PE6 B;  1MHX A;  1D5M C;  2C5L C;  3EUB 2;  3ZO5 B;  2KX3 A;  2KWV B;  3NS8 A;  2DZK A;  4HRO A;  2KN5 A;  4IDI A;  1A70 A;  4RNA A;  5JH5 C;  2BGF A;  2NBV B;  1XLP A;  2RMM A;  1ET6 A;  1SJH D;  1SE3 A;  3A9J A;  3AE8 B;  3P4S B;  3RNE C;  5J2R A;  1UUP A;  3SEB A;  1AW7 A;  4HCN B;  4BBN C;  2KTR A;  3FC4 A;  3WCQ A;  5EE0 A;  3JVZ X;  1WM3 A;  1WM2 A;  4L1B A;  2LXA A;  3T3N A;  4W9E A;  1ZUD 2;  2W82 A;  2MW5 A;  1JRP A;  2MJ3 A;  2BT6 A;  3U52 E;  2L32 A;  1JWA D;  1N62 A;  1KH0 A;  2KQS A;  5EE1 A;  1XLQ A;  1WGG A;  1V80 A;  2IO0 B;  3WAM A;  4FJY A;  3QWZ B;  1QF6 A;  2CHZ A;  4ZDV A;  4A9A A;  2KWU B;  4NNJ B;  3AEG B;  3ENE A;  4AJY B;  2DZI A;  2ZCB A;  3KWV A;  4ZHO A;  2LFI A;  1MJD A;  2BPS A;  4NJ7 A;  4WWM A;  3T8M A;  2BS2 B;  3V61 A;  2J42 A;  2WDT B;  4KKI A;  1V97 A;  3SU8 X;  3C0R B;  1LO5 D;  2GBJ A;  3KVF B;  2LUM A;  1CZP A;  3R7R A;  2RPV A;  4JPS A;  3VH3 B;  4GDK A;  1LQB A;  3H7P B;  1EU3 A;  1I4H A;  2JUO A;  4KV2 A;  1R4N B;  4JLC A;  1ZKH A;  1E5W A;  1GAQ B;  1MVK A;  2ZPY A;  4KKJ A;  2FCN A;  1R4M I;  1GNU A;  3P1M A;  5D2M B;  4YT0 B;  4LNO A;  4PYZ A;  2RPQ A;  4JWU C;  2KN4 A;  1MFW A;  3B2G A;  1VZ7 A;  2JSV X;  1E8Y A;  3VRA B;  3Q8A A;  2PMV A;  4KDL B;  3DBL B;  2NTS A;  3H7P A;  4YXD B;  4W9D A;  4W9K A;  3L10 B;  1WXA A;  1NVI D;  2LVQ A;  3KUC B;  4WQM A;  2JRH A;  2GBM A;  2K8H A;  3I3T B;  4ANV A;  2KC2 A;  4NQK E;  4K81 A;  3PRM B;  2L76 A;  1WIA A;  2PPH A;  4BOZ B;  3W5U B;  4MSM B;  4UDU C;  4YSY B;  4FUL A;  3NZ3 A;  1WFY A;  1TJE A;  1V2Y A;  2JVC A;  2N7D A;  5E6P A;  3DVN U;  2BVC A;  4GDK B;  2KX0 A;  2ZW1 A;  1FPY A;  3ECI A;  3RD2 A;  1DGJ A;  2JZ3 B;  1D5X C;  5H8Y E;  2QC8 A;  3Q3O C;  4MSQ B;  2JQR B;  4ANX A;  1P3Q U;  2AQ2 B;  2AX5 A;  2NBU A;  3GP7 A;  2UU7 A;  4KZ0 A;  2PVG C;  5AEK B;  2D3B A;  1FRD A;  2DYB A;  3BIN A;  4EZJ A;  1QZE A;  2JWZ A;  1K51 A;  2MP2 B;  3B08 A;  3TL5 A;  2GMI C;  2WXR A;  2AL3 A;  2H88 B;  3AMZ A;  1T5X D;  2N7E A;  3CMM B;  1J8C A;  3DVG X;  1I4P A;  4FXC A;  3A4S C;  4NJ6 A;  2V4I B;  1PUT A;  3R8B A;  3ZXR A;  2LJI A;  1FM0 D;  4FA6 A;  2I2Y A;  2XN9 C;  2N9L A;  3N1Z C;  4IKG A;  2FCS A;  3BVM A;  3ABV B;  2KK8 A;  1OQR A;  4YTM B;  1WX9 A;  4ZRJ A;  3W1S A;  2DBY A;  3M3J A;  4KZC A;  3P4R B;  1WSP A;  2ASQ A;  5D94 A;  4MDK E;  2BYE A;  1L4D B;  2LHD A;  2MJD A;  1UNS A;  3GZN I;  3PT2 B;  1J7C A;  3ZJV A;  3DBS A;  2KQ4 X;  4G3X B;  2KMA A;  4IOI E;  1XT9 B;  2KDF B;  4KSK C;  5AZF A;  2L05 A;  3PRP B;  1SGH A;  1KOT A;  1SXT A;  4QAY A;  2BTE A;  1QOA A;  5CHV C;  3W2D A;  3VUW A;  3AU5 A;  2Z0E B;  4I6P A;  2MEK A;  3L17 A;  3NVV A;  2JXT A;  4ICV A;  1SEB D;  3W1S C;  2ICI A;  2YLM A;  3E9S A;  4WWN A;  1BT0 A;  2VZK D;  4KGS A;  4WJP A;  3O13 A;  1WF9 A;  1T0Y A;  2SAK A;  1L2N A;  1L0X B;  1QOG A;  3IT6 B;  2ZVO A;  1NI3 A;  1IYF A;  2WDV B;  3U4E G;  3ZJU A;  1GC6 A;  4BOS C;  1C77 A;  4C4V A;  4B9K A;  2XNA C;  4EKU A;  1TTN A;  4C80 A;  4JQW C;  1WXV A;  3NUH B;  4FHK A;  4DQO C;  4DDI D;  1FNV A;  4YSZ B;  4W9C A;  1UGM A;  2M0X A;  1TBE A;  3KH0 A;  4YSX B;  3AB5 A;  2IO3 B;  3NJT A;  2KDB A;  3BK1 A;  3K9P B;  2HTM E;  1WGH A;  4IG7 B;  2KLG A;  1FXI A;  1JWM D;  1ZDX A;  2D3C A;  3RNC C;  4EFO A;  2V1Y A;  1OEY J;  3WAO A;  2QJL A;  2NCN A;  3B9J A;  4W9L A;  1I4X A;  3ZXV A;  1CMX B;  2M19 A;  3ZGZ A;  2K8C A;  1HZ5 A;  3IHP C;  1A5R A;  4G0N B;  3V3X A;  2DAJ A;  1PGA A;  3FAH A;  4HDO A;  3AE3 B;  3TBL D;  4USA A;  2LGY A;  1H7W A;  2KLC A;  4NAW B;  4DHJ D;  2DZM A;  4JL9 A;  2DNF A;  5E6O A;  1KF6 B;  4XE0 A;  1J7B A;  1WX8 A;  3TEX A;  2CJN A;  3AI5 A;  3L13 A;  3NRZ A;  4CHK A;  3OJ3 A;  2W55 A;  4K3B A;  4FLH A;  2SEB D;  4US9 A;  3QHT A;  3V6C B;  2NS5 A;  4XX5 A;  4RGT A;  2KJ6 A;  1WE6 A;  2KWD A;  2QDF A;  2D11 A;  1JRU A;  4HXD A;  1LGR A;  3AEE B;  2MLB A;  4FAD A;  2K3U A;  4XDC A;  2EMS A;  3QCA A;  5G2N A;  3Q3N C;  4WJN A;  5H92 C;  3Q8B A;  1V1P B;  1V9J A;  1SJE D;  3EA6 A;  4M00 A;  3AEF B;  2KAC A;  1OEY A;  2BYT A;  2KMM A;  4E74 A;  1HE8 A;  5IP4 D;  2WLB A;  1VZ6 A;  1DYQ A;  4DHZ E;  3QQ8 B;  1YMH E;  3HM3 A;  4CO7 A;  2WU5 B;  2O6V A;  3V05 A;  1QT9 A;  3ZNZ B;  1RYJ A;  4HK2 A;  3DBL I;  2DYM A;  3DPD A;  1ZOY B;  3Q14 C;  3DWM A;  2KT7 A;  4MM3 A; 
#chains in the Genus database with same CATH homology
 1D5Z C;  4HJG E;  4JE3 B;  3AE2 B;  1STE A;  1GTE A;  3ETR A;  1N5W A;  4HRO A;  1IGC A;  5HI1 A;  1KRH A;  4IDI A;  1A70 A;  4RNA A;  4DXF A;  2RDG A;  3AV8 A;  1XLP A;  2RMM A;  2IGH A;  1ET6 A;  1SJH D;  1YN3 A;  3OWE B;  2B76 B;  1SE3 A;  3IAM 1;  5HHD G;  1XLO A;  5T8I A;  3AE8 B;  3P4S B;  3AEC B;  3MJ5 A;  1UUP A;  2WNM A;  3SEB A;  1AW7 A;  1Y56 A;  3TSS A;  3FC4 A;  3WCQ A;  1ROE A;  3NS1 A;  4RCO A;  5EE0 A;  1AWD A;  3CF4 A;  4L1B A;  3DWG C;  3AE5 B;  2WXP A;  2Y5P A;  2JZP A;  1K53 A;  3T3N A;  1DOI A;  1L5P A;  2WXF A;  4JX1 C;  1ZUD 2;  2WS3 B;  5EE9 A;  3SR6 A;  2W82 A;  3U2S C;  1QOF A;  1JRP A;  1UWM A;  2MJ3 A;  1VRA B;  2Q5W D;  2BT6 A;  3U52 E;  4ITK A;  2K5P A;  2L32 A;  1JWA D;  1N62 A;  1KH0 A;  2KDM A;  1JRO A;  5EE1 A;  4P16 A;  1XLQ A;  1ESF A;  3R2I A;  2BS3 B;  3RPF C;  4LTU A;  1YJI A;  5E6J A;  5I4D A;  1VR9 A;  4JWS C;  4WH4 A;  2IGD A;  2BB5 A;  3AEB B;  1J7A A;  4MM3 B;  1C79 A;  1TKG A;  2IPK D;  3U7Z A;  1QF6 A;  2ON8 A;  5FK9 C;  4A9A A;  1VJK A;  4RFB A;  1NYR A;  2DLB A;  3LB8 C;  3AEG B;  1GB1 A;  4AQ7 A;  1ZPS A;  1SIJ A;  4ZHO A;  2R61 A;  3KWV A;  2LFI A;  2WQY B;  1FNU A;  4WWM A;  2BS2 B;  2GRI A;  1JCK B;  2CU3 A;  2J42 A;  4KKI A;  1V97 A;  2V0G A;  3BVG A;  1FRR A;  1TS4 A;  2GB1 A;  1P7E A;  5LNK 1;  1LO5 D;  3T3O A;  5C2T B;  4REZ A;  1HQR D;  1EWC A;  1RM6 C;  2LUM A;  2WXI A;  4A90 A;  5D3D A;  1AN8 A;  1CZP A;  3ZJT A;  2RPV A;  2WXH A;  2N7J A;  4JPS A;  2JWU A;  1ZE3 D;  4ARC A;  1N63 A;  2BW2 A;  3B2F A;  1YQ4 B;  1SF0 A;  1YN4 A;  3GS2 A;  2WXJ A;  1EU3 A;  1L6U A;  1MPE A;  2DWQ A;  5C3J B;  2GI9 A;  2LMC A;  2ZW0 A;  1I4H A;  1SSN A;  4OZB A;  3P42 A;  4HEA 1;  2FBW B;  1GB4 A;  1T6B X;  1YQ3 B;  1L6V A;  1GAQ B;  5JXV A;  1MVK A;  1E6E B;  4KKJ A;  4ARI A;  5BMI A;  1C4A A;  2L52 A;  3P4Q B;  1HEZ E;  1OQQ A;  4RGM A;  2PVO D;  3CIR B;  2WXG A;  3P1M A;  2RDH A;  2QEJ C;  2CJO A;  4WAF A;  4YT0 B;  1E7P B;  1TY0 A;  1NEN B;  1ZXI A;  2LEK A;  2Z8L A;  3GB1 A;  3L4P A;  4B0E A;  4JWU C;  2L1A A;  1F2R I;  2KN4 A;  2X38 A;  3Q8C A;  3B2G A;  4TQ1 A;  2OHF A;  1VZ7 A;  2JSV X;  3CWI A;  4KX6 B;  1E10 A;  3NVY A;  3VR8 B;  3VRA B;  3Q8A A;  2IDY A;  4N59 A;  2PMV A;  1AYF A;  1V1P A;  2NTS A;  4RGO S;  4YXD B;  4ZRQ A;  1TS5 A;  3BII D;  1CJE A;  1NVI D;  1SE4 A;  4Q2J A;  1C78 A;  4WQM A;  2LGI A;  4TMA B;  3UI3 A;  1FIQ A;  1I4R A;  3I9V 1;  3AE7 B;  3W5U B;  3AE6 B;  1QOB A;  3PZ7 A;  4YSY B;  4UDU C;  3NZ3 A;  1GTH A;  4KGT A;  1TJE A;  3AEA B;  4GDK B;  1GT8 A;  2G1E A;  2ZW1 A;  3HVZ A;  3AE9 B;  2MJE A;  4US8 A;  4GDL B;  1DGJ A;  1MHH E;  1K52 A;  4N6E B;  5BMG A;  3P4P B;  2WP9 B;  4MH8 A;  1ZP0 B;  1D5X C;  5H8Y E;  4EE2 A;  1RWS A;  3EGR A;  3MC0 B;  4ZOH C;  1SB3 C;  1FFU A;  2JQR B;  4ZYS A;  1TYG B;  1UWX A;  1N5X A;  2AQ2 B;  2AX5 A;  3GP7 A;  1C4P A;  4C7Y A;  1XLN A;  1QIL A;  1ACC A;  4WUR A;  1MI0 A;  2PVG C;  3H8H A;  1FRD A;  2N9K A;  1FFV A;  1JML A;  4B0M A;  4H2A A;  1IUE A;  3RFZ B;  1K50 A;  1D4B A;  1NEK B;  1L0Y B;  3IAS 1;  4M0W A;  1K51 A;  1JQ4 A;  2IGG A;  3IT4 B;  4OVZ A;  2WXR A;  3N9Y C;  2H88 B;  3AMZ A;  1T5X D;  4MT5 A;  4CQN A;  1E0Z A;  3HVD A;  1I4P A;  1FMA D;  4FXC A;  2D5G A;  4OHJ A;  5AUK A;  2M0A A;  1KTK A;  3PZ8 A;  2V4I B;  2LHE A;  1PUT A;  4L23 A;  1ET9 A;  1WGK A;  1BUI C;  3SFD B;  3R8B A;  1TS2 A;  2FE8 A;  4J3O D;  3VRB B;  2LJI A;  1XF5 L;  1FM0 D;  4NJC A;  3I57 A;  3MP9 A;  2I2Y A;  2XN9 C;  1JWS D;  2N9L A;  4IKG A;  1P7F A;  3BVM A;  3ABV B;  3P63 A;  1FCC C;  2V3N A;  1OQR A;  4YTM B;  3BZD B;  1R7S A;  3R2T A;  5D3I B;  2N0S B;  1FCL A;  3W1S A;  2YEP F;  1KLU D;  4YTP B;  2DBY A;  3VQI A;  5BYQ A;  3P4R B;  2HDE A;  1WSP A;  2ACZ B;  4AS1 A;  1HA5 A;  2LHD A;  1C4C A;  1L4D B;  2MJD A;  2VZK B;  1UNS A;  2WXQ A;  1N61 A;  1J7C A;  2J53 A;  1ZXH A;  1DOX A;  3E56 A;  3LXF A;  1F2R C;  1NYQ A;  4DXG A;  3KWL A;  4C7Z A;  3ZJV A;  4GLS C;  2G9H D;  2FUG 1;  1GOZ A;  3J9C A;  4TSS A;  5FR3 A;  2KQ4 X;  2PLP A;  2I38 A;  4IOI E;  1JW9 D;  2MH7 A;  2NMQ A;  2BB6 A;  2PW9 A;  1SE2 A;  2W3S A;  1YJJ A;  1JAL A;  3MHZ A;  4XWT A;  1SXT A;  2Y3A A;  1I4G A;  2BTE A;  1CQV A;  4ZHP A;  1QOA A;  3W2D A;  2WXM A;  1XXG A;  4R3D A;  1ZDV A;  3BK2 A;  4LK0 M;  3AE1 B;  1SBB B;  2MEK A;  5FKA C;  1EU4 A;  2JXT A;  3BYT B;  3NVV A;  4HKZ E;  1SEB D;  1PFD A;  1T3Q A;  2ICI A;  2K9X A;  2W3R A;  3E9S A;  5EE3 A;  1KLG D;  1TZO A;  1I7H A;  2VZK D;  4KGS A;  5HG2 A;  3O13 A;  3AE4 B;  1XEE A;  2INN E;  2SAK A;  5BYS A;  1L0X B;  2WDQ B;  1QOG A;  2DYO A;  3IT6 B;  2E6X A;  1NI3 A;  1CK1 A;  2BS4 B;  2WDV B;  3FIL B;  4PT5 A;  3U4E G;  3ZJU A;  2WU2 B;  1C77 A;  3MFG A;  2JYE A;  2XNA C;  1OFF A;  3BYY B;  1VZ8 A;  3Q8F A;  1QLB B;  4NAM A;  4C80 A;  2J52 A;  4YWG G;  4RH6 A;  1PYW D;  3NUH B;  1YN5 A;  1WWT A;  1HXY D;  5GXG B;  4DQO C;  1F0Z A;  1WRI A;  4WIP A;  1FNV A;  4RGN A;  4YSZ B;  2EKI A;  4O1N A;  1BML C;  3KLS X;  1L0V B;  4YSX B;  3AB5 A;  3VR9 B;  2BBC A;  1IBX B;  3BK1 A;  2HTM E;  2OED A;  5MPO A;  1N60 A;  1FXI A;  1JWM D;  1ZDX A;  4KGR A;  1H7X A;  4RF1 A;  2QIL A;  3BVZ A;  2WXN A;  2JX5 A;  2QJL A;  1KFY B;  1QQR A;  1F77 A;  3AM9 A;  2JU6 X;  3NVW A;  4HRS A;  4OZA A;  3B9J A;  1M4V A;  4OZC A;  5TSS A;  1I4X A;  1IGD A;  3HUI A;  1JWU D;  1XO3 A;  2EEL A;  2M19 A;  3Q69 A;  2J4X A;  3ZYY X;  3ZGZ A;  4YTN B;  3W9C B;  1HZ5 A;  2WDR B;  1RFK A;  2Y5C A;  5AUI A;  1WYG A;  1V1O A;  2WXO A;  1C9F A;  3V3X A;  2QIE B;  3HRD D;  5BMH A;  1PGA A;  3FAH A;  2IJ0 A;  1VDV A;  3AE3 B;  4USA A;  1IBX A;  1H7W A;  4NAW B;  1TY2 A;  4A55 A;  2INP E;  1KF6 B;  4XE0 A;  1J7B A;  3TEX A;  1TS3 A;  1JWB D;  1VLB A;  5G5G A;  2CJN A;  4A6Q A;  3W5V B;  2NTT A;  3NRZ A;  3NVZ A;  4P6V F;  3AH7 A;  2PKO A;  3IXS A;  2W55 A;  4A8X C;  2WXL A;  2SEB D;  4US9 A;  3TEZ A;  3AN1 A;  1HZ6 A;  1L4Z B;  3C8Y A;  4RGT A;  4NZL B;  3LYY A;  2JYT A;  2KAJ A;  2KWD A;  4C56 C;  4OW0 A;  3ZQ4 A;  1E9M A;  2K0P A;  2V3P A;  5G5H A;  1TKY A;  3AEE B;  3FIL A;  1FNW A;  2K3U A;  1UGJ A;  3TEW A;  2QSD A;  2PIA A;  4XDC A;  3URY A;  3PO0 A;  5H92 C;  1YNT E;  3Q8B A;  1V1P B;  1SJE D;  4D2K A;  3EA6 A;  1V8C A;  3AEF B;  2KAC A;  2AQ3 B;  1QKZ A;  1FO4 A;  2BYT A;  1FEH A;  4TQ0 A;  2YEP B;  2M56 B;  1PDX A;  2KMM A;  1FD6 A;  2E3T A;  1D6E C;  1B9R A;  3SFE B;  1EM7 A;  1ENF A;  1XCT L;  5D7G A;  2WLB A;  5BYR A;  4N58 A;  1VZ6 A;  1DYQ A;  1EWY C;  2QMT A;  3BWU D;  4XWW A;  1GPX A;  1XCQ L;  1DOY A;  2AQ1 B;  1WXQ A;  1YMH E;  1FXA A;  3KQ4 A;  2WU5 B;  1TKE A;  1Q10 A;  4RF0 A;  1PGB A;  2H89 B;  3AED B;  1B1Z A;  4L2Y A;  4XDD A;  2W54 A;  1QT9 A;  3V05 A;  3Q8E A;  1RYJ A;  1PGX A;  2TSS A;  2ONQ A;  2PTL A;  2DYM A;  2K22 A;  3TEY A;  4HKQ A;  1MHX A;  2L83 A;  4LLG M;  2WXK A;  1ZOY B;  4MAC A;  1D5M C;  3DWM A;  3EUB 2;  4ZRP A;  5HFY A;  1BXT A;  3TUO A;  1I4Q A;  1C76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...