3AE9B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae9B01
3B2GA 3NVYA 3AE4B 1L6UA 1VDVA 5MPOA 1EWYC 3P63A 1JW9D 1QOGA 5AUIA 1KRHA 2JX5A 2L52A 2WU2B 1RYJA 2PKOA 4N59A 5EE1A 2AX5A 3AE5B 3AE2B 1XLNA 3NS1A 1JQ4A 1QT9A 1F0ZA 2BS2B 2JQRB 1RFKA 3P4SB 3VRAB 1N62A 3VR9B 1I7HA 2PIAA 2M19A 4US8A 1E0ZA 1SF0A 1N5XA 2K5PA 1KFYB 1DGJA 3HVZA 1FFVA 1DOXA 1GAQB 3AE9B 3DWMA 2BS4B 1V8CA 4YT0B 1JWAD 1FRRA 1N5WA 2QJLA 2WDRB 3FC4A 3W9CB 3AN1A 2W3SA 3AE3B 4N58A 2WS3B 3NVWA 1XLOA 1N63A 2PVGC 3FAHA 1NYQA 2G1EA 4ZHOA 5GXGB 3AEFB 1XLPA 4ZHPA 1H7XA 2MJ3A 2B76B 3AEBB 2H88B 3L4PA 4WWMA 3W5UB 2QIEB 4C7ZA 4KX6B 1N60A 5EE3A 1DOYA 3AMZA 1IUEA 1E10A 1AWDA 2MJEA 4YSYB 5G5GA 3AE6B 1OQRA 3CF4A 1ZOYB 1PUTA 2WDQB 4N6EB 1L5PA 1XLQA 1N61A 2KMMA 2Y5CA 2CU3A 4P6VF 3P4QB 5H92C 1WYGA 1FRDA 1FMAD 3ABVB 3SFEB 3VR8B 1YJJA 4ZOHC 4YSXB 1JWBD 2Q5WD 1YQ3B 4YTMB 1JROA 1R7SA 2CJOA 1JRPA 3NVZA 3NRZA 1TKEA 2L83A 2LEKA 1TJEA 3AE8B 3P4PB 3VRBB 3NVVA 3P4RB 4C80A 1KF6B 1NVID 4US9A 1ROEA 3CIRB 3AE1B 2DBYA 4HROA 1GTHA 1NI3A 4IDIA 1T3QA 3AEAB 2WP9B 2KAJA 1A70A 1QOBA 2N0SB 5EE9A 3AEGB 3AEDB 1WRIA 2W3RA 3BIID 2DWQA 3ETRA 1QOFA 1TKGA 3AE7B 1WGKA 1WXQA 2WLBA 1GT8A 1RWSA 1ZUD2 3W5VB 1PFDA 2BT6A 3WCQA 3DWGC 1YJIA 3B2FA 3PO0A 3LB8C 1QF6A 5G5HA 1J7BA 1J7AA 1SIJA 3HUIA 1TYGB 4FXCA 2H89B 1FFUA 5H8YE 5C2TB 2K9XA 1V97A 1GPXA 1QLBB 4JWSC 1DOIA 3SR6A 4A9AA 4YTNB 1PDXA 1GTEA 1CZPA 3HRDD 3AECB 1FIQA 1VLBA 4HRSA 4C7YA 2MH7A 1NENB 3AM9A 1L0VB 2W54A 4LTUA 2M56B 1AYFA 5C3JB 1FXIA 1E9MA 1E7PB 1ZP0B 2WQYB 1L6VA 2EKIA 3AB5A 1VJKA 2ACZB 2K22A 3CWIA 3P1MA 1ZXIA 2WDVB 2OHFA 1UWMA 1XO3A 1CJEA 4ITKA 5AUKA 4USAA 2MJDA 3AV8A 3ZYYX 1FO4A 1E6EB 1B9RA 1H7WA 1FM0D 4YSZB 2WU5B 1OQQA 3B9JA 1TKYA 3AH7A 3LXFA 4YTPB 1OFFA 2CJNA 1J7CA 4JWUC 1JALA 1QOAA 2W55A 1NYRA 1SB3C 1RM6C 3RPFC 1YQ4B 4YXDB 2HTME 2E3TA 3EUB2 2FBWB 3KWLA 1WWTA 3SFDB 2PVOD 4JX1C 5EE0A 3AEEB 1NEKB 1FXAA 2BS3B 4WQMA
chains in the Genus database with same CATH superfamily
4B95A 2L1AA 1VDVA 3L08A 4M0WA 2NTSA 1GUAB 1QOGA 2MBOA 4ZRJA 2JX5A 3DVNV 1CMXB 2LMCA 1X1MA 2G45B 4W9HA 3N1XC 4TMAB 3ML8A 3UIOB 3VTUA 2JF5A 1H4RA 1XT9B 1AARA 1SF0A 4EZLA 1WM3A 4S0RA 3NY5A 3ZNHB 1AN8A 2N9XA 1N5WA 3BY4B 3NVWA 2BGFA 1Q0WB 4MSQB 4P7IA 2JZ3B 1V1OA 4K7UA 2LRWA 2H88B 3NS8A 1WR1A 3H7PA 1I4QA 3EFCA 1N60A 3ECIA 3VUXA 1ZE3D 2M17A 3TMPB 2G4SA 3GZNB 2NBVB 4RNAA 1FRDA 3SFEB 1LFDA 3IVFA 2M0AA 1YJJA 3OJ3A 4MGIE 4DDID 5IO9A 2AQ3B 3SHQA 3CIRB 3AE1B 2KXJA 3ZKJC 3HIZA 1YX5B 2KYWA 3AEDB 3I57A 4J6IA 3OJ4B 3RFZB 2GOWA 3KUDB 1QKZA 2GBNA 2K9XA 3DBRI 4BKTA 4UDUC 2LASA 1WF9A 4FJVB 5J18A 1BMLC 1L6VA 2DAFA 4KSLC 1VRAB 4RGTA 4HKQA 4C00A 1SJHD 4IWQA 2KVZA 2LVOA 4A3OA 4ICUA 2KK8A 2KLCA 4NAWA 2MBEA 3LXFA 2O6VD 5BYQA 1F2RC 3H7PB 5AZFA 4MM3B 1TGZB 1WZ0A 5EE0A 3EHVA 2BS3B 3U30A 2L76A 1FNVA 3N20C 5DPWA 4WQOB 2IO1B 3MHZA 1KRHA 2LI5A 2HD5B 4XC2A 3H1UA 4AOFA 4KZ0A 1FNWA 2JRIB 3HVZA 3VTVA 1TS2A 2WXJA 2MLBA 2UYZB 3AE3B 2IPKD 4P1CC 4W9JA 3AEFB 3ONSA 3L4PA 4MM3A 1T0QC 1P7EA 3NHEB 3APCA 4LK0M 3P42A 1N61A 2AQ1B 4DXGA 3VAWA 3NZSA 4MACA 2QILA 2CS4A 2G4DB 4IWOA 2NVUI 2I1KA 1WSPA 2WXKA 4WJPA 1KF6B 1Q5WB 2Y5PA 2CU1A 3AEAB 1VR9A 2L05A 1GNUA 3PSEB 2JU6X 3M63B 2ASQA 2Z8LA 1YNTE 2GBMA 4E74A 2WXFA 3PTFC 1QQRA 1OQYA 1MI0A 2C60A 2KC2A 1DOIA 3IBEA 1YN3A 1JWUD 4IWPA 5I4DA 2KWUB 1D5ZC 1YN4A 5D3IB 3RNCC 2IY0B 2JPHA 3A9KA 3VVWB 5HFYA 4M00A 1FM0D 2DLBA 1UH6A 1C78A 3MHSD 1KOTA 3M95A 4RGNA 3VXWA 3QWZB 2FCSA 4BFRA 1IP9A 5T8IA 4HROA 4HDOA 4MH8A 3QIJA 5MPOA 2AQ2B 1LQBA 1V81A 3WANA 2BKRB 3L17A 4N59A 4DHJD 1K8RB 4K3BA 4ICVA 1UNSA 4A90A 2KLGA 4FHKA 3ZNGC 1L7YA 3AE9B 4YT0B 3A9KB 3ZO5B 1N63A 3EA6A 2KDEB 1UUPA 3NG0A 3ZDMC 3AEBB 4WWMA 5BMIA 2KANA 2K3UA 3A1QB 2MJEA 4EZKA 1RFAA 2N7JA 2LFIA 1L5PA 2I2YA 4YL8A 1FMAD 1YJ1A 3LDZE 3R66C 3DBHB 3NRZA 1TJEA 3LJ3A 3BVMA 3WIMA 2PMVA 5AEKB 2KJ6A 5EE9A 4NQKE 2L0FA 3L13A 3KVFB 4FULA 2CHXA 1RWSA 2BT6A 5G5HA 1C4AA 2J7QB 5H8YE 4KV2A 3APFA 1V97A 1WE7A 1SJED 3T9LA 1EUVB 4RMAA 2WQYB 1WJ6A 3GB1A 4LNOA 3SD5A 1IPGA 1ZXIA 2WDVB 2HJ8A 2I38A 4KZCA 2K6DB 2B3AA 4PT5A 2CJNA 3VUYA 3EUB2 2HTME 1Z2MA 3RYTA 4PS8A 3SFDB 3PLVA 1P0RA 1TBEA 1SE2A 2HJ1A 4EFOA 1HZ5A 3CSTA 1EWCA 3ZNID 1JQ4A 4BKSA 2PIAA 1VD2A 4NY0A 1E0ZA 1ZKHA 2JWUA 3Q3NC 4PYZA 2QDFA 4XE0A 3N3KB 1JWAD 2QJLA 4WWOA 3WA0A 1PQSA 1WRDB 4WWPA 3APDA 5L83A 1J0GA 1ZGUB 1WE6A 1V9JA 2N9KA 4GMVA 4ZYSA 4BKSD 4I6NB 1IUEA 1T0RC 1C79A 3E56A 3NJTA 1XLQA 2LVPA 2KMMA 3PZDA 1VZ6A 3OAWA 3Q14C 3V05A 4W9IA 5IP4D 4ANVA 4ZRKA 3VR8B 3TSSA 4LJOB 2CJOA 2RD0A 2KC1A 2I1JA 1KH0A 2DBYA 1E8ZA 2C9WB 5E6NA 1I4XA 1QOBA 3KH0A 1TKGA 3QCAA 2PPHA 2WXGA 1HE8A 2NPTA 4GN1A 3W5VB 3R2TA 2XK5B 3PO0A 4G3XB 4LCDE 4II2B 1C9FA 4DHZB 3HUIA 1ESFA 1I4HA 1QLBB 2BKFA 3L16A 4G50A 3HRDD 3EECA 2DENB 4GXBA 4J3OD 4N9F4 3ZW3A 1R4NI 4NPNA 2CHWA 3CWIA 2OHFA 2A5UA 1CJEA 1DYQA 1K50A 2MHJA 2ZW1A 3A1QA 5AZHA 2KO3A 4K81A 3ZRCA 1NYRA 2WNMA 2J52A 3IFWB 1P98A 4G11A 2MW5A 5AUIA 3DBLB 3DHHC 1AW7A 3R3MA 3PHWB 3PVLA 3AE2B 1QT9A 1WXVA 5JHBA 4L23A 2DYBA 4RM9A 3DHGC 3Q3FA 3H7SA 3W2DA 5G55A 1JMLA 1RRBA 3Q2AC 2WDRB 4M8NA 2KFKB 1UBQA 4B9KA 4AJWA 2LGIA 2Y5BB 3DCGA 4NAWB 3FILA 4IM2A 1V5OA 3P4QB 4ZRIA 2XK5A 1JCKB 3EFUA 2GRIA 2IZVB 4CO7A 2DZKA 2IBIB 4W9GA 2SAKA 3P4PB 1Y56A 4US9A 1GTHA 1P3QU 2WP9B 3EC8A 2DYOA 3AEGB 2W3RA 2RDGA 1WXQA 2J0MA 1GT8A 3V6CB 2BWES 2LUMA 2FNJB 3MJWA 1TIFA 2AEHA 4KKIA 3NUHB 4PYUA 2N7DA 5D3DA 4JPSA 5JH5C 4HK2A 3B0AA 2AYOB 1FXIA 3O65B 4BOSC 2J0JA 3ZJTA 1D5MC 5IAAC 5TR5A 1ET6A 4H2AA 3O13A 1JWMD 4IKGA 2M8SA 1TY2A 1WWTA 2QSDA 4LNFA 3RI7C 3A9JB 3P63A 3U2SC 3IT6B 2MP2A 4Q2JA 1ZDVA 2L52A 3ZJVA 2D11A 2PKOA 2IO2B 1EO6A 3MFGA 4OVVA 4KIKA 1Z5SB 4US8A 1N5XA 2MCNB 4DHJB 4LJPB 2RPQA 4FLHA 4DWFA 4RCOA 1FRRA 3UF8A 4BKGA 1HEZE 3FC4A 4GGQA 4CQNA 2QC8A 4XWWA 4TQ0A 4ZHOA 1I4PA 3W1SA 2LXCA 1C4PA 3Q3OC 1L0XB 1WMHB 1OQRA 2IO0B 5GMVA 2M1MA 3BZDB 2NBWB 1TS4A 3P2BA 4EUTA 2WWZA 3ZGZA 2BYEA 2REXA 3M62B 2O2VB 2PEAA 1ZXHA 4LDTD 4IDIA 4WAAA 4KKJA 3RT3B 1WRIA 1QOFA 4MSMB 3T3NA 4HEA1 3Q3JA 4KGTA 1YJIA 2RDBC 4HCNB 4W9CA 3U7DA 4JQWC 5BO4B 2H89B 2N9EB 2LHEA 2NBUA 5C2TB 3UINB 4MEMA 2LGYA 1GTEA 1FIQA 5HG2A 3AM9A 1L0VB 4E3CA 3C8YA 1E9MA 2YEPB 2V3NA 3OG5A 3ZNZB 4K7WA 3RNGC 1F9JA 4ITKA 3MC9A 2LXAA 3Q3MC 1OQQA 3GS2A 3SDLC 1WX7A 3AXCA 2M4NA 1J8CA 4ZRPA 3FKYA 5FK9C 3PS6A 4WURA 4JX1C 1MHXA 2HDEA 1L2NA 3V6EB 2BYFA 2KDBA 1PGXA 1C1YB 1R4MB 2ZVNA 4PS7A 4WIPA 2KFJA 1WX8A 3DPDA 2G9HD 3Q8FA 3VH3B 2KWVB 4FJZA 2BTEA 5C23A 5J17A 2JYTA 2L3ZA 1KFYB 4KDIC 2ZW0A 1WYWB 4DK5A 2V3PA 4KVGB 1T6BX 3I5JC 2FCNA 3TEZA 3AMZA 3GE3C 2PE9A 4BOZB 3TCAA 2D07B 2WXHA 3Q8BA 2ZJDA 3GZNI 2WDTB 3PV1A 1LGRA 2K8BA 2ZVOA 1YQ3B 4YTMB 3NVZA 1S1QB 1V1PB 3P4RB 5JXVA 1L4ZB 3TL5A 4DQOC 2O2VA 2L00B 1STEA 3BINA 3AE7B 2N9LA 1P7FA 3PRMB 3RD2A 2A4ZA 1LM8B 1ZUD2 4DDGD 2Y3AA 1H8CA 2IO3B 4W9KA 3AU4A 4WWNA 4AWJA 3ZVVA 3OWEB 5E6OA 2X8XX 3HK0A 3UIPB 3BWUD 2LUEA 2JY6A 2WX0A 2PW9A 4XWTA 4A3PA 3ZTDA 3E9SA 1ZPSA 2OJRA 5AUKA 1FO4A 4KGSA 2LRUA 3ZYYX 1E6EB 4OW0A 3IHPC 4I6PA 4YSZB 2IYDB 4MH0E 2D5GA 3B9JA 4W9EA 2KQ4X 1WXSA 1XXGA 1UF0A 1P9DU 3T8MA 3VTWA 1UBIA 4K7SA 5G2NA 3GE8C 1JW9D 3A9JA 4XYCA 2GMIC 3IXSA 3OLMD 2UU7A 1TZOA 4WAFA 2GBKA 3H9DA 2JQRB 1WJ4A 2KTRB 3AI5A 4IW0A 2J4XA 2K5PA 1FFVA 4RH6A 4ANUA 2CKHB 4II3B 1F77A 2LJIA 3FAHA 2MRPA 3Q69A 4HXDA 2IY1B 4KX6B 1QZEA 4M02A 1ET9A 4FN2A 4ZRQA 5EDSA 1A5RA 2V4IB 1I4RA 3LYYA 2NMQA 2TSSA 1BT0A 1V80A 3MJ5A 2Q5WD 1R7SA 5DPTA 3NVVA 2JVCA 1T3QA 1EM7A 4BBNC 1NBFC 2FIDA 2BQQA 1A70A 4B0MA 3PPAA 5E6PA 1V49A 2ONQA 4AJYB 1KLVA 2W9NA 3DHIC 1ACCA 1V5TA 1QF6A 4HJGE 3CMMB 2W82A 1UGMA 1GOZA 1SSNA 1ISNA 1ZW7A 2IDYA 3AECB 5C3JB 1DOYA 1E7PB 1YIWA 5D2MB 2VZKB 5TSSA 4USAA 3R8BA 4A55A 1T0SC 4FJYA 5D7GA 1J7CA 2W55A 4K1RB 1JWSD 4MGKE 3NVYA 4IM3A 4GU2A 1TY0A 2C7MB 5EE1A 1MG8A 3AE5B 3QJZA 1SEBD 2FUHB 2N7EA 3VRAB 4P16A 1WFYA 4LLGM 2JWZA 2KDMA 3U7ZA 2KDFB 1HXYD 3N1ZC 2INCC 4C56C 2WS3B 4AQ7A 1XD3B 1P1AA 1XLPA 2KHWB 2LWPA 5AZGA 1PGBA 4DXAB 4M01A 4GDLA 3HHMA 3CF4A 2RDHA 4DBGA 2JXXA 2MEKA 3PZ8A 1J19A 2V0GA 1C4CA 1WYGA 1GG3A 3ABVB 2ZCBA 4WJQA 2KZRA 4FHJA 3ENEA 2KMCA 1TKEA 1NVID 2J53A 3NZ3A 3RNBC 2LGDA 2N0SB 1SIFA 3BIID 3QHTA 2WLBA 4TUUA 4CYEA 3DWGC 3L54A 3KYDD 3R7QA 1J7BA 2IGHA 4EZJA 2VZKD 2D3CA 2Z0DB 5HHDG 1WM2A 3SU8X 2AWTA 2L7RA 3PGEA 1PDXA 1VLBA 1CK1A 4HPPA 2W54A 1OGWA 2KX0A 3C19A 3L0WB 4F1SA 3RULA 2GB1A 1ENFA 3MC8A 1UWMA 3BYTB 2XNAC 1WMHA 2K39A 2K8CA 3AH7A 4B0EA 1IBXA 5FKAC 3TUOA 3UQBA 1N6ZA 2KX3A 1NEKB 2X38A 4LNNA 3R2IA 5DCNA 4NJ7A 2KKCA 1TTNA 4NQLB 3TJPA 3VDZA 4RM8A 2PJHA 2MX2A 1I7HA 2INPE 2GBJA 4IOIE 4BZAA 1DOXA 1V8CA 3V60A 4NAMA 1F1HA 2N1VA 3AN1A 1XCTL 3HVDA 1YN5A 5IOIA 1R4MI 4W9LA 2ZPYA 4MJSB 4HKZE 4EKUA 1XQQA 2RMMA 3W5UB 1YD8U 1E10A 2K1FA 2EMTA 5G5GA 1E8YA 2NCNA 1E5WA 3BK2A 5LXHA 1YX6B 2XN9C 3QAQA 4C4VB 4WJNA 1JROA 1JRPA 3H6NA 3KYCD 4LNIA 3VRBB 1GJZA 4URKA 5CHVC 2AL6A 3MP9A 3ZTCA 1V1PA 2JZZA 1L0YB 4OHJA 2BYVE 2YLMA 3JW0X 4C4VA 3NZUA 4FA6A 2LD9A 4RF0A 2FIFA 1RLFA 4GOCA 4HJKA 3TEXA 1XF5L 2K0PA 3M3JA 2MQJA 3JYUA 2EMSA 4A9AA 1NENB 1TT5B 4NJ6A 4LTUA 4NNJB 4EE2A 2MBHA 1XO3A 3KW5B 1H7WA 1L4DB 2WU5B 1I42A 2INNE 1SB3C 4YXDB 3UI3A 5C1ZA 2KFKA 4WQMA 3B2GA 5HKHA 2MP2B 2N9PC 3KQ4A 4E71A 4JLCA 2FCMA 2NTTA 2AX5A 1XLNA 2RGFA 2WXRA 3EGRA 1N62A 3VR9B 2D3BA 2MBQA 2C7NB 4YWGG 2JT4B 1E8XA 2KNBA 2YEPF 3N32A 2WHIA 5D6JB 1MG4A 4M0WB 2WXLA 1E8WA 2ZPNA 3T3OA 2G3QB 2QIEB 3WAMA 3IAS1 3AE6B 4NJCA 4N6EB 3KUZA 4OVZA 3QA8A 4KDLB 4L2YA 2MBBB 2JUOA 5CX3A 5CHFA 4HCPB 4ANWA 2KT7A 2LZ6A 5L95C 2KQSA 4W9FA 1FCLA 1FNUA 2JXTA 2DWQA 4O1NA 3VHTC 2WGSA 1PFDA 4GDKA 3B2FA 3W1SC 2R2OA 2QEJC 3ZIMA 2K8HA 1PYWD 2V9HA 3FILB 1GPXA 2LGSA 4X57B 3I63C 2KQ7A 2KMAA 4MELA 2M56B 2MSED 4A6QA 2EKIA 2ACZB 3I3TB 4JE3B 2MJDA 1M4VA 1K52A 2ZEQA 4JIOU 1ZDXA 3DBHI 4OZCA 1OFFA 1RM6C 3RPFC 1C77A 2OOBB 2FBWB 3HM6X 3AEEB 5JHAA 1L6UA 1EWYC 2BW2A 2R61A 1B1ZA 3PLUA 3NS1A 1F0ZA 2BS2B 3N9YC 2WYQA 2DZJA 2L8JA 2KD0A 3TEYA 3DWMA 3BVZA 1UELA 3W9CB 1WGRA 1XLOA 2R2QA 1NYQA 2N1WA 3PT2B 1M94A 1H7XA 5EE3A 3QARA 1AWDA 4GLSC 2WDQB 1D3ZA 2Y5CA 1F52A 3JVZX 2ZZPB 2DHZA 2KOXA 4DHZE 4C80A 4FADA 5DPSA 2DX5B 2MWSB 4MT5A 1FCCC 2RPVA 1E7VA 3ZXVA 1SE4A 2L0TA 3DBLI 1YOVB 4NZLB 3JSVA 4JL9A 1J7AA 2CHZA 4BBNF 4GDLB 5LLIA 1V86A 3DVNU 1NI2A 4HRSA 1HTOA 1WGHA 4C7YA 2J0KA 2KJHB 5DPRA 2IGGA 3AV8A 3CF6E 1OEYJ 4KSKC 1MFWA 3RN9C 3B08A 1UWXA 2JZPA 3U52E 1VZ7A 3H8HA 3K9PB 2KN5A 2HTHA 2WX1A 2V3SA 1RAXA 3X23A 3VH4B 2K6QA 3DOWA 4REZA 2BYTA 3QK0A 4XGAB 3SEBA 2M19A 1BXTA 4W9DA 4LDTB 1G6JA 2LGXA 3GP7A 1FEHA 2NS5A 2NR2A 4R3DA 5GXGB 3RNAC 4PK1A 3VUWA 3PRPB 2C5LC 3ZQ4A 3WAPA 4YSYB 2Z0EB 1KLGD 3DVGY 4XDDA 2CU3A 3URYA 3TIXA 3Q8EA 2PTLA 4GDKB 4RGOS 4YSXB 2WXOA 4ARCA 2D3AA 4ZHPA 1KLUD 3W1YA 1SXTA 2KWDA 2LEKA 1Y8RC 1BUIC 1Q1OA 4MGYE 4TSSA 2YVCA 4HPLB 3TBLD 2GLSA 4IC7B 1OEYA 3WCQA 2KWCA 1MJDA 1HA5A 1HQRD 3VFKA 3L10B 3QC8B 4HVBA 2VRRB 1TYGB 1D4BA 2FE8A 1IGDA 2PE6B 3A33B 3V3XA 3ZDTA 5IA7A 1F2RI 5BYSA 3HM3A 4S17A 2L32A 1UGJA 1SE9A 3P1MA 2K22A 2JRHA 4ZDVA 4D2KA 3DDCB 2UWQA 1MVKA 1U4AA 1TKYA 1WXAA 2DZMA 2KTRA 1JALA 1QOAA 3ALBA 1YQ4B 4MDKE 3AU5A 4OZBA 5CHWA 4XZ4A 3AE4B 2VH1A 1VCBA 1QILA 4M8MA 4RFBA 3KWVA 2DZIA 1LO5D 4HDQA 2FCQA 3J9CA 3NOBA 4CHKA 3IAM1 2O6VB 4MGZE 4TV3A 4AUQC 1WGGA 2EELA 2EKEC 2BS4B 4N58A 2W3SA 2OEDA 3RUIB 3V62A 2PVGC 3R7RA 2MJ3A 4P1BC 4BVUC 3N30A 2BPSA 2WXMA 1YMHE 5FR3A 1EU4A 1LXDA 5FR6A 3ZRFA 4C7ZA 5D94A 2E6XA 3MTNB 2GI9A 4GIVA 1ZOYB 1PUTA 2QCZA 1E90A 1K53A 1EF5A 1TS5A 1XCQL 4ZOHC 1JWBD 3ZXRA 3TEWA 4PS3A 3RNEC 3U4EG 2JYEA 2BF8B 4EEWA 4AS1A 1ROEA 1NI3A 1GC6A 5LNK1 1WIAA 3KLSX 3Q8CA 3PZ7A 1T0YA 2J42A 1K51A 5BMHA 3ML9A 1S3SG 2NPTB 2ICIA 1FFUA 1E7UA 3I9V1 1I35A 2FAZA 5BMGA 2M0XA 4F8CB 3SR6A 1FPYA 3DVGX 5JZEB 1T5XD 1IGCA 5KHOA 1Q10A 3DBRB 3UQAA 1IYFA 2ZNVB 1EU3A 5BYRA 1SE3A 1R4NB 1VJKA 1XEEA 2K25A 3QQ8B 1WJUA 3IT4B 2QHOA 1EF1A 3PREA 5E6JA 2SEBD 1OTRB 3A4SC 4XX5A 3GOEA 2O6VA 4ACFA 1WH3A 2E3TA 4IM0A 4HWIB 1GC7A 4WH4A 1SGHA 3B1LX 1KTKA 1RYJA 4IG7B 4B6WA 3X0WA 1V2YA 4GB9A 5KHQA 2RR9A 3P4SB 3BVGA 3UGBB 1IBXB 1GB4A 2AL3A 1C3TA 1WI0A 2BWFA 5IN7A 2V4LA 2G1EA 4GSWA 1HZ6A 2LHDA 4ZYNA 3RMKC 1PGAA 1WXMA 4ANXA 4WJOA 4LNKA 3RZWC 1B9RA 2D2QA 2L83A 4EOYA 3AE8B 4RGMA 3Q6BA 1TZ1A 1FXTB 2KAJA 2CR5A 3ETRA 1SBBB 2KVRA 2ZNVC 5CTRC 2QMTA 2PLPA 2BBCA 3LB8C 3U8ZA 1SIJA 2KDIA 3PHXB 4TQ1A 2XEWA 3QX1A 4QAYA 4L1BA 3Q8AA 2KACA 4OVUA 3V61A 1VZ8A 4A8XC 4HLEA 1UD7A 1ZP0B 2N4FA 3AB5A 1YQBA 2V1YA 1C76A 2C7HA 2WXQA 1NDDA 1JRUA 5LXIB 3BYYB 4YTPB 4KIKB 1D5XC 3A4RA 1D6EC 2VH2A 2PVOD 1FXAA 2KTFA 2HE7A 1WR6E 3RCZA 1WGYA 3WAOA 4DXFA 3S2AA 3VQIA 3IG3A 2WU2B 1UZXB 1RFKA 2WXIA 2ZCCA 1WGDA 3DBSA 3RZFA 1KM7A 1DGJA 3BK1A 1GAQB 2OJWA 4I6LB 2DYMA 2WXPA 4F7ZA 2Z59B 4RF1A 3CSFA 3AULA 5IKCM 2IGDA 1V6EA 2DAJA 2B76B 2D3GA 2FUG1 5HI1A 4AP4C 1TS3A 2BVCA 4XDCA 4KGRA 4IUMB 2ON8A 1MPEA 3KUCB 4HPMB 1WZ3A 4P6VF 5H92C 2KJRA 3JSVB 4A20A 4K3CA 2JSVX 2IJ0A 3ZLZA 4ARIA 2D10A 1KJTA 3PRZA 3N1YC 1GB1A 3MC0B 3K9OB 1FD6A 1I4GA 3ZJUA 1WGKA 2DNFA 2XBBC 1WJNA 4G0NB 4FXCA 2LVQA 4FBJB 2BB5A 5J2RA 4JWSC 2LJ5A 4YTNB 3ZUNA 1HTQA 1CZPA 2MA9B 3C0RB 2KN4A 2MH7A 4BAXA 2WXNA 1AYFA 1WX9A 2BB6A 1WY8A 4JGHB 4TKNA 1CQVA 1MHHE 3D32A 3RNFC 4OZAA 3DQVA 2RSUA 4ASWC 3WALA 2INDC 4JWUC 2GBRA 4MJSA 3KWLA
chains in the Genus database with same CATH topology
3NVYA 3H8HA 2L1AA 1VDVA 4M0WA 2NTSA 1QOGA 1TY0A 5AUIA 2JX5A 1AW7A 5EE1A 3AE5B 3AE2B 2LMCA 1QT9A 4L23A 1SEBD 4TMAB 4REZA 2BYTA 3VRAB 3SEBA 2M19A 1BXTA 4P16A 1SF0A 3W2DA 4LLGM 1JMLA 3GP7A 1FEHA 1AN8A 2KDMA 3U7ZA 1N5WA 2WDRB 1HXYD 4C56C 2WS3B 3NVWA 4AQ7A 4R3DA 1V1OA 5GXGB 1XLPA 2H88B 1PGBA 2LGIA 1I4QA 1N60A 3ZQ4A 4NAWB 3FILA 1ZE3D 4YSYB 3CF4A 2RDHA 1KLGD 4XDDA 2CU3A 2MEKA 3PZ8A 3URYA 3P4QB 2V0GA 1C4CA 4RNAA 3Q8EA 1WYGA 1FRDA 2PTLA 3ABVB 4GDKB 3SFEB 1JCKB 2GRIA 2M0AA 1YJJA 4RGOS 4YSXB 2WXOA 4ARCA 4ZHPA 1KLUD 1TKEA 1SXTA 2AQ3B 2KWDA 3P4PB 2LEKA 2SAKA 1Y56A 1NVID 2J53A 3NZ3A 4US9A 3CIRB 3AE1B 1GTHA 1BUIC 2WP9B 2N0SB 4TSSA 2DYOA 3AEGB 3AEDB 3I57A 2W3RA 3BIID 2RDGA 1WXQA 2WLBA 1GT8A 3WCQA 2LUMA 3DWGC 1HA5A 3RFZB 1HQRD 1J7BA 2IGHA 1TYGB 1QKZA 2VZKD 1D4BA 2FE8A 1IGDA 4KKIA 2K9XA 3NUHB 5HHDG 3V3XA 1F2RI 4UDUC 5D3DA 4JPSA 1PDXA 5BYSA 1VLBA 1CK1A 2L32A 2W54A 1UGJA 1FXIA 1BMLC 1L6VA 3P1MA 2K22A 1VRAB 2GB1A 1ENFA 4RGTA 4HKQA 1UWMA 3BYTB 3ZJTA 2XNAC 4D2KA 1SJHD 1D5MC 1MVKA 1TKYA 3AH7A 3LXFA 1ET6A 4H2AA 4B0EA 5BYQA 3O13A 1JALA 1F2RC 1JWMD 1IBXA 1QOAA 4MM3B 4IKGA 5FKAC 1YQ4B 3TUOA 5EE0A 1TY2A 1WWTA 2QSDA 1NEKB 2X38A 2BS3B 4OZBA 1FNVA 3AE4B 3R2IA 3P63A 1QILA 3U2SC 3IT6B 3MHZA 4Q2JA 1ZDVA 1KRHA 2L52A 3ZJVA 2PKOA 4RFBA 3KWVA 1LO5D 3MFGA 3J9CA 3IAM1 1I7HA 2INPE 1FNWA 4US8A 4IOIE 1N5XA 2EELA 3HVZA 1DOXA 1TS2A 2BS4B 1V8CA 2WXJA 4RCOA 1FRRA 4NAMA 1HEZE 3FC4A 3HVDA 3AN1A 1XCTL 3AE3B 2OEDA 2W3SA 4N58A 1YN5A 4CQNA 4XWWA 2IPKD 4TQ0A 2PVGC 4ZHOA 3AEFB 2MJ3A 4HKZE 2RMMA 1I4PA 2WXMA 1YMHE 3L4PA 3W5UB 5FR3A 1EU4A 3W1SA 4C7ZA 1E10A 1P7EA 2E6XA 4LK0M 1C4PA 1L0XB 2GI9A 5G5GA 1OQRA 1ZOYB 1PUTA 3P42A 1N61A 2AQ1B 3BK2A 3BZDB 4DXGA 1TS4A 1K53A 4MACA 2QILA 1TS5A 2XN9C 1XCQL 4ZOHC 3ZGZA 1JWBD 3TEWA 1JROA 1WSPA 1JRPA 3U4EG 2WXKA 2JYEA 3VRBB 4AS1A 1KF6B 1ROEA 1ZXHA 4IDIA 1NI3A 2Y5PA 3AEAB 1VR9A 2WNMA 5LNK1 3MP9A 4KKJA 1V1PA 1WRIA 2JU6X 1QOFA 3KLSX 1L0YB 3Q8CA 3T3NA 3PZ7A 4OHJA 4HEA1 2J42A 1K51A 2Z8LA 4KGTA 5BMHA 4RF0A 1YJIA 1YNTE 2ICIA 2WXFA 1QQRA 2H89B 1FFUA 3TEXA 1XF5L 2K0PA 1MI0A 3I9V1 2LHEA 5C2TB 5BMGA 1DOIA 3SR6A 4A9AA 1GTEA 1FIQA 1IGCA 1T5XD 1Q10A 5HG2A 1NENB 3AM9A 1YN3A 1L0VB 1JWUD 5I4DA 4LTUA 3C8YA 1D5ZC 1E9MA 1EU3A 2YEPB 5BYRA 1YN4A 4EE2A 1SE3A 1VJKA 2V3NA 5D3IB 1XEEA 5HFYA 1XO3A 4ITKA 3IT4B 1H7WA 1FM0D 1L4DB 5E6JA 2WU5B 2SEBD 1OQQA 2DLBA 3GS2A 1C78A 4RGNA 2INNE 4ZRPA 1SB3C 5FK9C 4YXDB 2E3TA 4WURA 4JX1C 3UI3A 1MHXA 2HDEA 5T8IA 4HROA 4WQMA 3B2GA 4MH8A 1PGXA 5MPOA 2AQ2B 4WIPA 3KQ4A 2G9HD 4WH4A 1KTKA 4N59A 1RYJA 3Q8FA 2NTTA 2AX5A 1XLNA 2WXRA 2BTEA 3P4SB 1UNSA 3BVGA 3EGRA 1IBXB 1N62A 2JYTA 4A90A 1GB4A 3VR9B 4YWGG 1KFYB 2YEPF 3AE9B 4YT0B 2ZW0A 2V3PA 2WXLA 1N63A 3EA6A 1T6BX 2G1EA 1UUPA 3T3OA 3AEBB 4WWMA 5BMIA 3TEZA 2QIEB 2K3UA 3AMZA 1HZ6A 2MJEA 2LHDA 3IAS1 2WXHA 2N7JA 3AE6B 2LFIA 4N6EB 4NJCA 3Q8BA 1L5PA 2I2YA 1PGAA 4OVZA 1FMAD 1YQ3B 4YTMB 1B9RA 3NVZA 3NRZA 2L83A 4L2YA 1TJEA 3AE8B 1V1PB 3P4RB 4RGMA 5JXVA 3BVMA 1L4ZB 2PMVA 2KAJA 4DQOC 1FCLA 1FNUA 5EE9A 1STEA 2JXTA 2DWQA 3ETRA 1SBBB 3AE7B 4O1NA 2N9LA 1P7FA 1RWSA 1ZUD2 2PLPA 2QMTA 1PFDA 2BT6A 3B2FA 2BBCA 3LB8C 5G5HA 2Y3AA 1C4AA 1SIJA 2QEJC 4TQ1A 5H8YE 1PYWD 3FILB 1V97A 1GPXA 3OWEB 4L1BA 3Q8AA 2KACA 1SJED 3BWUD 2M56B 1VZ8A 2PW9A 4A8XC 1ZP0B 2WQYB 2EKIA 3AB5A 4XWTA 4A6QA 2ACZB 3GB1A 3E9SA 1ZPSA 1ZXIA 1C76A 2WDVB 4JE3B 5AUKA 1FO4A 4KGSA 2I38A 2MJDA 2WXQA 3ZYYX 1E6EB 1M4VA 4OW0A 4YSZB 1K52A 4PT5A 2D5GA 3B9JA 1ZDXA 3BYYB 4YTPB 1OFFA 2CJNA 2KQ4X 4OZCA 1XXGA 1RM6C 3RPFC 1D5XC 1C77A 2HTME 3EUB2 2FBWB 1D6EC 3SFDB 2PVOD 3AEEB 1FXAA 1L6UA 4DXFA 3VQIA 1EWYC 2BW2A 1SE2A 2R61A 1B1ZA 1JW9D 1HZ5A 2WU2B 3IXSA 1EWCA 3NS1A 1TZOA 4WAFA 1JQ4A 1F0ZA 2BS2B 2JQRB 1RFKA 2WXIA 3N9YC 2PIAA 1E0ZA 2J4XA 2JWUA 2K5PA 3TEYA 1DGJA 3BK1A 1FFVA 1GAQB 4XE0A 4RH6A 3DWMA 3BVZA 2DYMA 2WXPA 1JWAD 2QJLA 3W9CB 1F77A 2LJIA 1XLOA 4RF1A 3FAHA 1NYQA 2IGDA 1H7XA 3Q69A 2B76B 2FUG1 5HI1A 2N9KA 1TS3A 4ZYSA 4KX6B 5EE3A 1IUEA 4XDCA 1AWDA 1ET9A 4ZRQA 4KGRA 4GLSC 1C79A 3E56A 2V4IB 2WDQB 2ON8A 1XLQA 1MPEA 2KMMA 2Y5CA 1I4RA 4P6VF 5H92C 1VZ6A 3LYYA 2NMQA 3V05A 2TSSA 3VR8B 3TSSA 3MJ5A 2JSVX 1R7SA 2Q5WD 2CJOA 2IJ0A 3NVVA 4C80A 4ARIA 4MT5A 2DBYA 1KH0A 1FCCC 1T3QA 1EM7A 2RPVA 1I4XA 1SE4A 1GB1A 1A70A 1QOBA 3MC0B 4B0MA 1FD6A 2ONQA 1TKGA 1I4GA 3ZJUA 1WGKA 2WXGA 4NZLB 3W5VB 3R2TA 1ACCA 3PO0A 1QF6A 4HJGE 1C9FA 1J7AA 3HUIA 4FXCA 2W82A 4GDLB 2BB5A 1ESFA 1GOZA 1I4HA 1SSNA 1QLBB 4JWSC 4YTNB 1CZPA 2IDYA 3AECB 3HRDD 4HRSA 4C7YA 2KN4A 2MH7A 4J3OD 2WXNA 1AYFA 2BB6A 5C3JB 1DOYA 1E7PB 1CQVA 3CWIA 1MHHE 2VZKB 4OZAA 2IGGA 2OHFA 5TSSA 1CJEA 1DYQA 4USAA 3AV8A 3R8BA 1K50A 4A55A 2ZW1A 5D7GA 4JWUC 1J7CA 2W55A 1NYRA 3KWLA 1UWXA 2JZPA 1JWSD 3U52E 1VZ7A 2J52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2G A;  3NVY A;  3AE4 B;  1L6U A;  1VDV A;  5MPO A;  1EWY C;  3P63 A;  1JW9 D;  1QOG A;  5AUI A;  1KRH A;  2JX5 A;  2L52 A;  2WU2 B;  1RYJ A;  2PKO A;  4N59 A;  5EE1 A;  2AX5 A;  3AE5 B;  3AE2 B;  1XLN A;  3NS1 A;  1JQ4 A;  1QT9 A;  1F0Z A;  2BS2 B;  2JQR B;  1RFK A;  3P4S B;  3VRA B;  1N62 A;  3VR9 B;  1I7H A;  2PIA A;  2M19 A;  4US8 A;  1E0Z A;  1SF0 A;  1N5X A;  2K5P A;  1KFY B;  1DGJ A;  3HVZ A;  1FFV A;  1DOX A;  1GAQ B;  3AE9 B;  3DWM A;  2BS4 B;  1V8C A;  4YT0 B;  1JWA D;  1FRR A;  1N5W A;  2QJL A;  2WDR B;  3FC4 A;  3W9C B;  3AN1 A;  2W3S A;  3AE3 B;  4N58 A;  2WS3 B;  3NVW A;  1XLO A;  1N63 A;  2PVG C;  3FAH A;  1NYQ A;  2G1E A;  4ZHO A;  5GXG B;  3AEF B;  1XLP A;  4ZHP A;  1H7X A;  2MJ3 A;  2B76 B;  3AEB B;  2H88 B;  3L4P A;  4WWM A;  3W5U B;  2QIE B;  4C7Z A;  4KX6 B;  1N60 A;  5EE3 A;  1DOY A;  3AMZ A;  1IUE A;  1E10 A;  1AWD A;  2MJE A;  4YSY B;  5G5G A;  3AE6 B;  1OQR A;  3CF4 A;  1ZOY B;  1PUT A;  2WDQ B;  4N6E B;  1L5P A;  1XLQ A;  1N61 A;  2KMM A;  2Y5C A;  2CU3 A;  4P6V F;  3P4Q B;  5H92 C;  1WYG A;  1FRD A;  1FMA D;  3ABV B;  3SFE B;  3VR8 B;  1YJJ A;  4ZOH C;  4YSX B;  1JWB D;  2Q5W D;  1YQ3 B;  4YTM B;  1JRO A;  1R7S A;  2CJO A;  1JRP A;  3NVZ A;  3NRZ A;  1TKE A;  2L83 A;  2LEK A;  1TJE A;  3AE8 B;  3P4P B;  3VRB B;  3NVV A;  3P4R B;  4C80 A;  1KF6 B;  1NVI D;  4US9 A;  1ROE A;  3CIR B;  3AE1 B;  2DBY A;  4HRO A;  1GTH A;  1NI3 A;  4IDI A;  1T3Q A;  3AEA B;  2WP9 B;  2KAJ A;  1A70 A;  1QOB A;  2N0S B;  5EE9 A;  3AEG B;  3AED B;  1WRI A;  2W3R A;  3BII D;  2DWQ A;  3ETR A;  1QOF A;  1TKG A;  3AE7 B;  1WGK A;  1WXQ A;  2WLB A;  1GT8 A;  1RWS A;  1ZUD 2;  3W5V B;  1PFD A;  2BT6 A;  3WCQ A;  3DWG C;  1YJI A;  3B2F A;  3PO0 A;  3LB8 C;  1QF6 A;  5G5H A;  1J7B A;  1J7A A;  1SIJ A;  3HUI A;  1TYG B;  4FXC A;  2H89 B;  1FFU A;  5H8Y E;  5C2T B;  2K9X A;  1V97 A;  1GPX A;  1QLB B;  4JWS C;  1DOI A;  3SR6 A;  4A9A A;  4YTN B;  1PDX A;  1GTE A;  1CZP A;  3HRD D;  3AEC B;  1FIQ A;  1VLB A;  4HRS A;  4C7Y A;  2MH7 A;  1NEN B;  3AM9 A;  1L0V B;  2W54 A;  4LTU A;  2M56 B;  1AYF A;  5C3J B;  1FXI A;  1E9M A;  1E7P B;  1ZP0 B;  2WQY B;  1L6V A;  2EKI A;  3AB5 A;  1VJK A;  2ACZ B;  2K22 A;  3CWI A;  3P1M A;  1ZXI A;  2WDV B;  2OHF A;  1UWM A;  1XO3 A;  1CJE A;  4ITK A;  5AUK A;  4USA A;  2MJD A;  3AV8 A;  3ZYY X;  1FO4 A;  1E6E B;  1B9R A;  1H7W A;  1FM0 D;  4YSZ B;  2WU5 B;  1OQQ A;  3B9J A;  1TKY A;  3AH7 A;  3LXF A;  4YTP B;  1OFF A;  2CJN A;  1J7C A;  4JWU C;  1JAL A;  1QOA A;  2W55 A;  1NYR A;  1SB3 C;  1RM6 C;  3RPF C;  1YQ4 B;  4YXD B;  2HTM E;  2E3T A;  3EUB 2;  2FBW B;  3KWL A;  1WWT A;  3SFD B;  2PVO D;  4JX1 C;  5EE0 A;  3AEE B;  1NEK B;  1FXA A;  2BS3 B;  4WQM A; 
#chains in the Genus database with same CATH topology
 4B95 A;  2L1A A;  1VDV A;  3L08 A;  4M0W A;  2NTS A;  1GUA B;  1QOG A;  2MBO A;  4ZRJ A;  2JX5 A;  3DVN V;  1CMX B;  2LMC A;  1X1M A;  2G45 B;  4W9H A;  3N1X C;  4TMA B;  3ML8 A;  3UIO B;  3VTU A;  2JF5 A;  1H4R A;  1XT9 B;  1AAR A;  1SF0 A;  4EZL A;  1WM3 A;  4S0R A;  3NY5 A;  3ZNH B;  1AN8 A;  2N9X A;  1N5W A;  3BY4 B;  3NVW A;  2BGF A;  1Q0W B;  4MSQ B;  4P7I A;  2JZ3 B;  1V1O A;  4K7U A;  2LRW A;  2H88 B;  3NS8 A;  1WR1 A;  3H7P A;  1I4Q A;  3EFC A;  1N60 A;  3ECI A;  3VUX A;  1ZE3 D;  2M17 A;  3TMP B;  2G4S A;  3GZN B;  2NBV B;  4RNA A;  1FRD A;  3SFE B;  1LFD A;  3IVF A;  2M0A A;  1YJJ A;  3OJ3 A;  4MGI E;  4DDI D;  5IO9 A;  2AQ3 B;  3SHQ A;  3CIR B;  3AE1 B;  2KXJ A;  3ZKJ C;  3HIZ A;  1YX5 B;  2KYW A;  3AED B;  3I57 A;  4J6I A;  3OJ4 B;  3RFZ B;  2GOW A;  3KUD B;  1QKZ A;  2GBN A;  2K9X A;  3DBR I;  4BKT A;  4UDU C;  2LAS A;  1WF9 A;  4FJV B;  5J18 A;  1BML C;  1L6V A;  2DAF A;  4KSL C;  1VRA B;  4RGT A;  4HKQ A;  4C00 A;  1SJH D;  4IWQ A;  2KVZ A;  2LVO A;  4A3O A;  4ICU A;  2KK8 A;  2KLC A;  4NAW A;  2MBE A;  3LXF A;  2O6V D;  5BYQ A;  1F2R C;  3H7P B;  5AZF A;  4MM3 B;  1TGZ B;  1WZ0 A;  5EE0 A;  3EHV A;  2BS3 B;  3U30 A;  2L76 A;  1FNV A;  3N20 C;  5DPW A;  4WQO B;  2IO1 B;  3MHZ A;  1KRH A;  2LI5 A;  2HD5 B;  4XC2 A;  3H1U A;  4AOF A;  4KZ0 A;  1FNW A;  2JRI B;  3HVZ A;  3VTV A;  1TS2 A;  2WXJ A;  2MLB A;  2UYZ B;  3AE3 B;  2IPK D;  4P1C C;  4W9J A;  3AEF B;  3ONS A;  3L4P A;  4MM3 A;  1T0Q C;  1P7E A;  3NHE B;  3APC A;  4LK0 M;  3P42 A;  1N61 A;  2AQ1 B;  4DXG A;  3VAW A;  3NZS A;  4MAC A;  2QIL A;  2CS4 A;  2G4D B;  4IWO A;  2NVU I;  2I1K A;  1WSP A;  2WXK A;  4WJP A;  1KF6 B;  1Q5W B;  2Y5P A;  2CU1 A;  3AEA B;  1VR9 A;  2L05 A;  1GNU A;  3PSE B;  2JU6 X;  3M63 B;  2ASQ A;  2Z8L A;  1YNT E;  2GBM A;  4E74 A;  2WXF A;  3PTF C;  1QQR A;  1OQY A;  1MI0 A;  2C60 A;  2KC2 A;  1DOI A;  3IBE A;  1YN3 A;  1JWU D;  4IWP A;  5I4D A;  2KWU B;  1D5Z C;  1YN4 A;  5D3I B;  3RNC C;  2IY0 B;  2JPH A;  3A9K A;  3VVW B;  5HFY A;  4M00 A;  1FM0 D;  2DLB A;  1UH6 A;  1C78 A;  3MHS D;  1KOT A;  3M95 A;  4RGN A;  3VXW A;  3QWZ B;  2FCS A;  4BFR A;  1IP9 A;  5T8I A;  4HRO A;  4HDO A;  4MH8 A;  3QIJ A;  5MPO A;  2AQ2 B;  1LQB A;  1V81 A;  3WAN A;  2BKR B;  3L17 A;  4N59 A;  4DHJ D;  1K8R B;  4K3B A;  4ICV A;  1UNS A;  4A90 A;  2KLG A;  4FHK A;  3ZNG C;  1L7Y A;  3AE9 B;  4YT0 B;  3A9K B;  3ZO5 B;  1N63 A;  3EA6 A;  2KDE B;  1UUP A;  3NG0 A;  3ZDM C;  3AEB B;  4WWM A;  5BMI A;  2KAN A;  2K3U A;  3A1Q B;  2MJE A;  4EZK A;  1RFA A;  2N7J A;  2LFI A;  1L5P A;  2I2Y A;  4YL8 A;  1FMA D;  1YJ1 A;  3LDZ E;  3R66 C;  3DBH B;  3NRZ A;  1TJE A;  3LJ3 A;  3BVM A;  3WIM A;  2PMV A;  5AEK B;  2KJ6 A;  5EE9 A;  4NQK E;  2L0F A;  3L13 A;  3KVF B;  4FUL A;  2CHX A;  1RWS A;  2BT6 A;  5G5H A;  1C4A A;  2J7Q B;  5H8Y E;  4KV2 A;  3APF A;  1V97 A;  1WE7 A;  1SJE D;  3T9L A;  1EUV B;  4RMA A;  2WQY B;  1WJ6 A;  3GB1 A;  4LNO A;  3SD5 A;  1IPG A;  1ZXI A;  2WDV B;  2HJ8 A;  2I38 A;  4KZC A;  2K6D B;  2B3A A;  4PT5 A;  2CJN A;  3VUY A;  3EUB 2;  2HTM E;  1Z2M A;  3RYT A;  4PS8 A;  3SFD B;  3PLV A;  1P0R A;  1TBE A;  1SE2 A;  2HJ1 A;  4EFO A;  1HZ5 A;  3CST A;  1EWC A;  3ZNI D;  1JQ4 A;  4BKS A;  2PIA A;  1VD2 A;  4NY0 A;  1E0Z A;  1ZKH A;  2JWU A;  3Q3N C;  4PYZ A;  2QDF A;  4XE0 A;  3N3K B;  1JWA D;  2QJL A;  4WWO A;  3WA0 A;  1PQS A;  1WRD B;  4WWP A;  3APD A;  5L83 A;  1J0G A;  1ZGU B;  1WE6 A;  1V9J A;  2N9K A;  4GMV A;  4ZYS A;  4BKS D;  4I6N B;  1IUE A;  1T0R C;  1C79 A;  3E56 A;  3NJT A;  1XLQ A;  2LVP A;  2KMM A;  3PZD A;  1VZ6 A;  3OAW A;  3Q14 C;  3V05 A;  4W9I A;  5IP4 D;  4ANV A;  4ZRK A;  3VR8 B;  3TSS A;  4LJO B;  2CJO A;  2RD0 A;  2KC1 A;  2I1J A;  1KH0 A;  2DBY A;  1E8Z A;  2C9W B;  5E6N A;  1I4X A;  1QOB A;  3KH0 A;  1TKG A;  3QCA A;  2PPH A;  2WXG A;  1HE8 A;  2NPT A;  4GN1 A;  3W5V B;  3R2T A;  2XK5 B;  3PO0 A;  4G3X B;  4LCD E;  4II2 B;  1C9F A;  4DHZ B;  3HUI A;  1ESF A;  1I4H A;  1QLB B;  2BKF A;  3L16 A;  4G50 A;  3HRD D;  3EEC A;  2DEN B;  4GXB A;  4J3O D;  4N9F 4;  3ZW3 A;  1R4N I;  4NPN A;  2CHW A;  3CWI A;  2OHF A;  2A5U A;  1CJE A;  1DYQ A;  1K50 A;  2MHJ A;  2ZW1 A;  3A1Q A;  5AZH A;  2KO3 A;  4K81 A;  3ZRC A;  1NYR A;  2WNM A;  2J52 A;  3IFW B;  1P98 A;  4G11 A;  2MW5 A;  5AUI A;  3DBL B;  3DHH C;  1AW7 A;  3R3M A;  3PHW B;  3PVL A;  3AE2 B;  1QT9 A;  1WXV A;  5JHB A;  4L23 A;  2DYB A;  4RM9 A;  3DHG C;  3Q3F A;  3H7S A;  3W2D A;  5G55 A;  1JML A;  1RRB A;  3Q2A C;  2WDR B;  4M8N A;  2KFK B;  1UBQ A;  4B9K A;  4AJW A;  2LGI A;  2Y5B B;  3DCG A;  4NAW B;  3FIL A;  4IM2 A;  1V5O A;  3P4Q B;  4ZRI A;  2XK5 A;  1JCK B;  3EFU A;  2GRI A;  2IZV B;  4CO7 A;  2DZK A;  2IBI B;  4W9G A;  2SAK A;  3P4P B;  1Y56 A;  4US9 A;  1GTH A;  1P3Q U;  2WP9 B;  3EC8 A;  2DYO A;  3AEG B;  2W3R A;  2RDG A;  1WXQ A;  2J0M A;  1GT8 A;  3V6C B;  2BWE S;  2LUM A;  2FNJ B;  3MJW A;  1TIF A;  2AEH A;  4KKI A;  3NUH B;  4PYU A;  2N7D A;  5D3D A;  4JPS A;  5JH5 C;  4HK2 A;  3B0A A;  2AYO B;  1FXI A;  3O65 B;  4BOS C;  2J0J A;  3ZJT A;  1D5M C;  5IAA C;  5TR5 A;  1ET6 A;  4H2A A;  3O13 A;  1JWM D;  4IKG A;  2M8S A;  1TY2 A;  1WWT A;  2QSD A;  4LNF A;  3RI7 C;  3A9J B;  3P63 A;  3U2S C;  3IT6 B;  2MP2 A;  4Q2J A;  1ZDV A;  2L52 A;  3ZJV A;  2D11 A;  2PKO A;  2IO2 B;  1EO6 A;  3MFG A;  4OVV A;  4KIK A;  1Z5S B;  4US8 A;  1N5X A;  2MCN B;  4DHJ B;  4LJP B;  2RPQ A;  4FLH A;  4DWF A;  4RCO A;  1FRR A;  3UF8 A;  4BKG A;  1HEZ E;  3FC4 A;  4GGQ A;  4CQN A;  2QC8 A;  4XWW A;  4TQ0 A;  4ZHO A;  1I4P A;  3W1S A;  2LXC A;  1C4P A;  3Q3O C;  1L0X B;  1WMH B;  1OQR A;  2IO0 B;  5GMV A;  2M1M A;  3BZD B;  2NBW B;  1TS4 A;  3P2B A;  4EUT A;  2WWZ A;  3ZGZ A;  2BYE A;  2REX A;  3M62 B;  2O2V B;  2PEA A;  1ZXH A;  4LDT D;  4IDI A;  4WAA A;  4KKJ A;  3RT3 B;  1WRI A;  1QOF A;  4MSM B;  3T3N A;  4HEA 1;  3Q3J A;  4KGT A;  1YJI A;  2RDB C;  4HCN B;  4W9C A;  3U7D A;  4JQW C;  5BO4 B;  2H89 B;  2N9E B;  2LHE A;  2NBU A;  5C2T B;  3UIN B;  4MEM A;  2LGY A;  1GTE A;  1FIQ A;  5HG2 A;  3AM9 A;  1L0V B;  4E3C A;  3C8Y A;  1E9M A;  2YEP B;  2V3N A;  3OG5 A;  3ZNZ B;  4K7W A;  3RNG C;  1F9J A;  4ITK A;  3MC9 A;  2LXA A;  3Q3M C;  1OQQ A;  3GS2 A;  3SDL C;  1WX7 A;  3AXC A;  2M4N A;  1J8C A;  4ZRP A;  3FKY A;  5FK9 C;  3PS6 A;  4WUR A;  4JX1 C;  1MHX A;  2HDE A;  1L2N A;  3V6E B;  2BYF A;  2KDB A;  1PGX A;  1C1Y B;  1R4M B;  2ZVN A;  4PS7 A;  4WIP A;  2KFJ A;  1WX8 A;  3DPD A;  2G9H D;  3Q8F A;  3VH3 B;  2KWV B;  4FJZ A;  2BTE A;  5C23 A;  5J17 A;  2JYT A;  2L3Z A;  1KFY B;  4KDI C;  2ZW0 A;  1WYW B;  4DK5 A;  2V3P A;  4KVG B;  1T6B X;  3I5J C;  2FCN A;  3TEZ A;  3AMZ A;  3GE3 C;  2PE9 A;  4BOZ B;  3TCA A;  2D07 B;  2WXH A;  3Q8B A;  2ZJD A;  3GZN I;  2WDT B;  3PV1 A;  1LGR A;  2K8B A;  2ZVO A;  1YQ3 B;  4YTM B;  3NVZ A;  1S1Q B;  1V1P B;  3P4R B;  5JXV A;  1L4Z B;  3TL5 A;  4DQO C;  2O2V A;  2L00 B;  1STE A;  3BIN A;  3AE7 B;  2N9L A;  1P7F A;  3PRM B;  3RD2 A;  2A4Z A;  1LM8 B;  1ZUD 2;  4DDG D;  2Y3A A;  1H8C A;  2IO3 B;  4W9K A;  3AU4 A;  4WWN A;  4AWJ A;  3ZVV A;  3OWE B;  5E6O A;  2X8X X;  3HK0 A;  3UIP B;  3BWU D;  2LUE A;  2JY6 A;  2WX0 A;  2PW9 A;  4XWT A;  4A3P A;  3ZTD A;  3E9S A;  1ZPS A;  2OJR A;  5AUK A;  1FO4 A;  4KGS A;  2LRU A;  3ZYY X;  1E6E B;  4OW0 A;  3IHP C;  4I6P A;  4YSZ B;  2IYD B;  4MH0 E;  2D5G A;  3B9J A;  4W9E A;  2KQ4 X;  1WXS A;  1XXG A;  1UF0 A;  1P9D U;  3T8M A;  3VTW A;  1UBI A;  4K7S A;  5G2N A;  3GE8 C;  1JW9 D;  3A9J A;  4XYC A;  2GMI C;  3IXS A;  3OLM D;  2UU7 A;  1TZO A;  4WAF A;  2GBK A;  3H9D A;  2JQR B;  1WJ4 A;  2KTR B;  3AI5 A;  4IW0 A;  2J4X A;  2K5P A;  1FFV A;  4RH6 A;  4ANU A;  2CKH B;  4II3 B;  1F77 A;  2LJI A;  3FAH A;  2MRP A;  3Q69 A;  4HXD A;  2IY1 B;  4KX6 B;  1QZE A;  4M02 A;  1ET9 A;  4FN2 A;  4ZRQ A;  5EDS A;  1A5R A;  2V4I B;  1I4R A;  3LYY A;  2NMQ A;  2TSS A;  1BT0 A;  1V80 A;  3MJ5 A;  2Q5W D;  1R7S A;  5DPT A;  3NVV A;  2JVC A;  1T3Q A;  1EM7 A;  4BBN C;  1NBF C;  2FID A;  2BQQ A;  1A70 A;  4B0M A;  3PPA A;  5E6P A;  1V49 A;  2ONQ A;  4AJY B;  1KLV A;  2W9N A;  3DHI C;  1ACC A;  1V5T A;  1QF6 A;  4HJG E;  3CMM B;  2W82 A;  1UGM A;  1GOZ A;  1SSN A;  1ISN A;  1ZW7 A;  2IDY A;  3AEC B;  5C3J B;  1DOY A;  1E7P B;  1YIW A;  5D2M B;  2VZK B;  5TSS A;  4USA A;  3R8B A;  4A55 A;  1T0S C;  4FJY A;  5D7G A;  1J7C A;  2W55 A;  4K1R B;  1JWS D;  4MGK E;  3NVY A;  4IM3 A;  4GU2 A;  1TY0 A;  2C7M B;  5EE1 A;  1MG8 A;  3AE5 B;  3QJZ A;  1SEB D;  2FUH B;  2N7E A;  3VRA B;  4P16 A;  1WFY A;  4LLG M;  2JWZ A;  2KDM A;  3U7Z A;  2KDF B;  1HXY D;  3N1Z C;  2INC C;  4C56 C;  2WS3 B;  4AQ7 A;  1XD3 B;  1P1A A;  1XLP A;  2KHW B;  2LWP A;  5AZG A;  1PGB A;  4DXA B;  4M01 A;  4GDL A;  3HHM A;  3CF4 A;  2RDH A;  4DBG A;  2JXX A;  2MEK A;  3PZ8 A;  1J19 A;  2V0G A;  1C4C A;  1WYG A;  1GG3 A;  3ABV B;  2ZCB A;  4WJQ A;  2KZR A;  4FHJ A;  3ENE A;  2KMC A;  1TKE A;  1NVI D;  2J53 A;  3NZ3 A;  3RNB C;  2LGD A;  2N0S B;  1SIF A;  3BII D;  3QHT A;  2WLB A;  4TUU A;  4CYE A;  3DWG C;  3L54 A;  3KYD D;  3R7Q A;  1J7B A;  2IGH A;  4EZJ A;  2VZK D;  2D3C A;  2Z0D B;  5HHD G;  1WM2 A;  3SU8 X;  2AWT A;  2L7R A;  3PGE A;  1PDX A;  1VLB A;  1CK1 A;  4HPP A;  2W54 A;  1OGW A;  2KX0 A;  3C19 A;  3L0W B;  4F1S A;  3RUL A;  2GB1 A;  1ENF A;  3MC8 A;  1UWM A;  3BYT B;  2XNA C;  1WMH A;  2K39 A;  2K8C A;  3AH7 A;  4B0E A;  1IBX A;  5FKA C;  3TUO A;  3UQB A;  1N6Z A;  2KX3 A;  1NEK B;  2X38 A;  4LNN A;  3R2I A;  5DCN A;  4NJ7 A;  2KKC A;  1TTN A;  4NQL B;  3TJP A;  3VDZ A;  4RM8 A;  2PJH A;  2MX2 A;  1I7H A;  2INP E;  2GBJ A;  4IOI E;  4BZA A;  1DOX A;  1V8C A;  3V60 A;  4NAM A;  1F1H A;  2N1V A;  3AN1 A;  1XCT L;  3HVD A;  1YN5 A;  5IOI A;  1R4M I;  4W9L A;  2ZPY A;  4MJS B;  4HKZ E;  4EKU A;  1XQQ A;  2RMM A;  3W5U B;  1YD8 U;  1E10 A;  2K1F A;  2EMT A;  5G5G A;  1E8Y A;  2NCN A;  1E5W A;  3BK2 A;  5LXH A;  1YX6 B;  2XN9 C;  3QAQ A;  4C4V B;  4WJN A;  1JRO A;  1JRP A;  3H6N A;  3KYC D;  4LNI A;  3VRB B;  1GJZ A;  4URK A;  5CHV C;  2AL6 A;  3MP9 A;  3ZTC A;  1V1P A;  2JZZ A;  1L0Y B;  4OHJ A;  2BYV E;  2YLM A;  3JW0 X;  4C4V A;  3NZU A;  4FA6 A;  2LD9 A;  4RF0 A;  2FIF A;  1RLF A;  4GOC A;  4HJK A;  3TEX A;  1XF5 L;  2K0P A;  3M3J A;  2MQJ A;  3JYU A;  2EMS A;  4A9A A;  1NEN B;  1TT5 B;  4NJ6 A;  4LTU A;  4NNJ B;  4EE2 A;  2MBH A;  1XO3 A;  3KW5 B;  1H7W A;  1L4D B;  2WU5 B;  1I42 A;  2INN E;  1SB3 C;  4YXD B;  3UI3 A;  5C1Z A;  2KFK A;  4WQM A;  3B2G A;  5HKH A;  2MP2 B;  2N9P C;  3KQ4 A;  4E71 A;  4JLC A;  2FCM A;  2NTT A;  2AX5 A;  1XLN A;  2RGF A;  2WXR A;  3EGR A;  1N62 A;  3VR9 B;  2D3B A;  2MBQ A;  2C7N B;  4YWG G;  2JT4 B;  1E8X A;  2KNB A;  2YEP F;  3N32 A;  2WHI A;  5D6J B;  1MG4 A;  4M0W B;  2WXL A;  1E8W A;  2ZPN A;  3T3O A;  2G3Q B;  2QIE B;  3WAM A;  3IAS 1;  3AE6 B;  4NJC A;  4N6E B;  3KUZ A;  4OVZ A;  3QA8 A;  4KDL B;  4L2Y A;  2MBB B;  2JUO A;  5CX3 A;  5CHF A;  4HCP B;  4ANW A;  2KT7 A;  2LZ6 A;  5L95 C;  2KQS A;  4W9F A;  1FCL A;  1FNU A;  2JXT A;  2DWQ A;  4O1N A;  3VHT C;  2WGS A;  1PFD A;  4GDK A;  3B2F A;  3W1S C;  2R2O A;  2QEJ C;  3ZIM A;  2K8H A;  1PYW D;  2V9H A;  3FIL B;  1GPX A;  2LGS A;  4X57 B;  3I63 C;  2KQ7 A;  2KMA A;  4MEL A;  2M56 B;  2MSE D;  4A6Q A;  2EKI A;  2ACZ B;  3I3T B;  4JE3 B;  2MJD A;  1M4V A;  1K52 A;  2ZEQ A;  4JIO U;  1ZDX A;  3DBH I;  4OZC A;  1OFF A;  1RM6 C;  3RPF C;  1C77 A;  2OOB B;  2FBW B;  3HM6 X;  3AEE B;  5JHA A;  1L6U A;  1EWY C;  2BW2 A;  2R61 A;  1B1Z A;  3PLU A;  3NS1 A;  1F0Z A;  2BS2 B;  3N9Y C;  2WYQ A;  2DZJ A;  2L8J A;  2KD0 A;  3TEY A;  3DWM A;  3BVZ A;  1UEL A;  3W9C B;  1WGR A;  1XLO A;  2R2Q A;  1NYQ A;  2N1W A;  3PT2 B;  1M94 A;  1H7X A;  5EE3 A;  3QAR A;  1AWD A;  4GLS C;  2WDQ B;  1D3Z A;  2Y5C A;  1F52 A;  3JVZ X;  2ZZP B;  2DHZ A;  2KOX A;  4DHZ E;  4C80 A;  4FAD A;  5DPS A;  2DX5 B;  2MWS B;  4MT5 A;  1FCC C;  2RPV A;  1E7V A;  3ZXV A;  1SE4 A;  2L0T A;  3DBL I;  1YOV B;  4NZL B;  3JSV A;  4JL9 A;  1J7A A;  2CHZ A;  4BBN F;  4GDL B;  5LLI A;  1V86 A;  3DVN U;  1NI2 A;  4HRS A;  1HTO A;  1WGH A;  4C7Y A;  2J0K A;  2KJH B;  5DPR A;  2IGG A;  3AV8 A;  3CF6 E;  1OEY J;  4KSK C;  1MFW A;  3RN9 C;  3B08 A;  1UWX A;  2JZP A;  3U52 E;  1VZ7 A;  3H8H A;  3K9P B;  2KN5 A;  2HTH A;  2WX1 A;  2V3S A;  1RAX A;  3X23 A;  3VH4 B;  2K6Q A;  3DOW A;  4REZ A;  2BYT A;  3QK0 A;  4XGA B;  3SEB A;  2M19 A;  1BXT A;  4W9D A;  4LDT B;  1G6J A;  2LGX A;  3GP7 A;  1FEH A;  2NS5 A;  2NR2 A;  4R3D A;  5GXG B;  3RNA C;  4PK1 A;  3VUW A;  3PRP B;  2C5L C;  3ZQ4 A;  3WAP A;  4YSY B;  2Z0E B;  1KLG D;  3DVG Y;  4XDD A;  2CU3 A;  3URY A;  3TIX A;  3Q8E A;  2PTL A;  4GDK B;  4RGO S;  4YSX B;  2WXO A;  4ARC A;  2D3A A;  4ZHP A;  1KLU D;  3W1Y A;  1SXT A;  2KWD A;  2LEK A;  1Y8R C;  1BUI C;  1Q1O A;  4MGY E;  4TSS A;  2YVC A;  4HPL B;  3TBL D;  2GLS A;  4IC7 B;  1OEY A;  3WCQ A;  2KWC A;  1MJD A;  1HA5 A;  1HQR D;  3VFK A;  3L10 B;  3QC8 B;  4HVB A;  2VRR B;  1TYG B;  1D4B A;  2FE8 A;  1IGD A;  2PE6 B;  3A33 B;  3V3X A;  3ZDT A;  5IA7 A;  1F2R I;  5BYS A;  3HM3 A;  4S17 A;  2L32 A;  1UGJ A;  1SE9 A;  3P1M A;  2K22 A;  2JRH A;  4ZDV A;  4D2K A;  3DDC B;  2UWQ A;  1MVK A;  1U4A A;  1TKY A;  1WXA A;  2DZM A;  2KTR A;  1JAL A;  1QOA A;  3ALB A;  1YQ4 B;  4MDK E;  3AU5 A;  4OZB A;  5CHW A;  4XZ4 A;  3AE4 B;  2VH1 A;  1VCB A;  1QIL A;  4M8M A;  4RFB A;  3KWV A;  2DZI A;  1LO5 D;  4HDQ A;  2FCQ A;  3J9C A;  3NOB A;  4CHK A;  3IAM 1;  2O6V B;  4MGZ E;  4TV3 A;  4AUQ C;  1WGG A;  2EEL A;  2EKE C;  2BS4 B;  4N58 A;  2W3S A;  2OED A;  3RUI B;  3V62 A;  2PVG C;  3R7R A;  2MJ3 A;  4P1B C;  4BVU C;  3N30 A;  2BPS A;  2WXM A;  1YMH E;  5FR3 A;  1EU4 A;  1LXD A;  5FR6 A;  3ZRF A;  4C7Z A;  5D94 A;  2E6X A;  3MTN B;  2GI9 A;  4GIV A;  1ZOY B;  1PUT A;  2QCZ A;  1E90 A;  1K53 A;  1EF5 A;  1TS5 A;  1XCQ L;  4ZOH C;  1JWB D;  3ZXR A;  3TEW A;  4PS3 A;  3RNE C;  3U4E G;  2JYE A;  2BF8 B;  4EEW A;  4AS1 A;  1ROE A;  1NI3 A;  1GC6 A;  5LNK 1;  1WIA A;  3KLS X;  3Q8C A;  3PZ7 A;  1T0Y A;  2J42 A;  1K51 A;  5BMH A;  3ML9 A;  1S3S G;  2NPT B;  2ICI A;  1FFU A;  1E7U A;  3I9V 1;  1I35 A;  2FAZ A;  5BMG A;  2M0X A;  4F8C B;  3SR6 A;  1FPY A;  3DVG X;  5JZE B;  1T5X D;  1IGC A;  5KHO A;  1Q10 A;  3DBR B;  3UQA A;  1IYF A;  2ZNV B;  1EU3 A;  5BYR A;  1SE3 A;  1R4N B;  1VJK A;  1XEE A;  2K25 A;  3QQ8 B;  1WJU A;  3IT4 B;  2QHO A;  1EF1 A;  3PRE A;  5E6J A;  2SEB D;  1OTR B;  3A4S C;  4XX5 A;  3GOE A;  2O6V A;  4ACF A;  1WH3 A;  2E3T A;  4IM0 A;  4HWI B;  1GC7 A;  4WH4 A;  1SGH A;  3B1L X;  1KTK A;  1RYJ A;  4IG7 B;  4B6W A;  3X0W A;  1V2Y A;  4GB9 A;  5KHQ A;  2RR9 A;  3P4S B;  3BVG A;  3UGB B;  1IBX B;  1GB4 A;  2AL3 A;  1C3T A;  1WI0 A;  2BWF A;  5IN7 A;  2V4L A;  2G1E A;  4GSW A;  1HZ6 A;  2LHD A;  4ZYN A;  3RMK C;  1PGA A;  1WXM A;  4ANX A;  4WJO A;  4LNK A;  3RZW C;  1B9R A;  2D2Q A;  2L83 A;  4EOY A;  3AE8 B;  4RGM A;  3Q6B A;  1TZ1 A;  1FXT B;  2KAJ A;  2CR5 A;  3ETR A;  1SBB B;  2KVR A;  2ZNV C;  5CTR C;  2QMT A;  2PLP A;  2BBC A;  3LB8 C;  3U8Z A;  1SIJ A;  2KDI A;  3PHX B;  4TQ1 A;  2XEW A;  3QX1 A;  4QAY A;  4L1B A;  3Q8A A;  2KAC A;  4OVU A;  3V61 A;  1VZ8 A;  4A8X C;  4HLE A;  1UD7 A;  1ZP0 B;  2N4F A;  3AB5 A;  1YQB A;  2V1Y A;  1C76 A;  2C7H A;  2WXQ A;  1NDD A;  1JRU A;  5LXI B;  3BYY B;  4YTP B;  4KIK B;  1D5X C;  3A4R A;  1D6E C;  2VH2 A;  2PVO D;  1FXA A;  2KTF A;  2HE7 A;  1WR6 E;  3RCZ A;  1WGY A;  3WAO A;  4DXF A;  3S2A A;  3VQI A;  3IG3 A;  2WU2 B;  1UZX B;  1RFK A;  2WXI A;  2ZCC A;  1WGD A;  3DBS A;  3RZF A;  1KM7 A;  1DGJ A;  3BK1 A;  1GAQ B;  2OJW A;  4I6L B;  2DYM A;  2WXP A;  4F7Z A;  2Z59 B;  4RF1 A;  3CSF A;  3AUL A;  5IKC M;  2IGD A;  1V6E A;  2DAJ A;  2B76 B;  2D3G A;  2FUG 1;  5HI1 A;  4AP4 C;  1TS3 A;  2BVC A;  4XDC A;  4KGR A;  4IUM B;  2ON8 A;  1MPE A;  3KUC B;  4HPM B;  1WZ3 A;  4P6V F;  5H92 C;  2KJR A;  3JSV B;  4A20 A;  4K3C A;  2JSV X;  2IJ0 A;  3ZLZ A;  4ARI A;  2D10 A;  1KJT A;  3PRZ A;  3N1Y C;  1GB1 A;  3MC0 B;  3K9O B;  1FD6 A;  1I4G A;  3ZJU A;  1WGK A;  2DNF A;  2XBB C;  1WJN A;  4G0N B;  4FXC A;  2LVQ A;  4FBJ B;  2BB5 A;  5J2R A;  4JWS C;  2LJ5 A;  4YTN B;  3ZUN A;  1HTQ A;  1CZP A;  2MA9 B;  3C0R B;  2KN4 A;  2MH7 A;  4BAX A;  2WXN A;  1AYF A;  1WX9 A;  2BB6 A;  1WY8 A;  4JGH B;  4TKN A;  1CQV A;  1MHH E;  3D32 A;  3RNF C;  4OZA A;  3DQV A;  2RSU A;  4ASW C;  3WAL A;  2IND C;  4JWU C;  2GBR A;  4MJS A;  3KWL A; 
#chains in the Genus database with same CATH homology
 3NVY A;  3H8H A;  2L1A A;  1VDV A;  4M0W A;  2NTS A;  1QOG A;  1TY0 A;  5AUI A;  2JX5 A;  1AW7 A;  5EE1 A;  3AE5 B;  3AE2 B;  2LMC A;  1QT9 A;  4L23 A;  1SEB D;  4TMA B;  4REZ A;  2BYT A;  3VRA B;  3SEB A;  2M19 A;  1BXT A;  4P16 A;  1SF0 A;  3W2D A;  4LLG M;  1JML A;  3GP7 A;  1FEH A;  1AN8 A;  2KDM A;  3U7Z A;  1N5W A;  2WDR B;  1HXY D;  4C56 C;  2WS3 B;  3NVW A;  4AQ7 A;  4R3D A;  1V1O A;  5GXG B;  1XLP A;  2H88 B;  1PGB A;  2LGI A;  1I4Q A;  1N60 A;  3ZQ4 A;  4NAW B;  3FIL A;  1ZE3 D;  4YSY B;  3CF4 A;  2RDH A;  1KLG D;  4XDD A;  2CU3 A;  2MEK A;  3PZ8 A;  3URY A;  3P4Q B;  2V0G A;  1C4C A;  4RNA A;  3Q8E A;  1WYG A;  1FRD A;  2PTL A;  3ABV B;  4GDK B;  3SFE B;  1JCK B;  2GRI A;  2M0A A;  1YJJ A;  4RGO S;  4YSX B;  2WXO A;  4ARC A;  4ZHP A;  1KLU D;  1TKE A;  1SXT A;  2AQ3 B;  2KWD A;  3P4P B;  2LEK A;  2SAK A;  1Y56 A;  1NVI D;  2J53 A;  3NZ3 A;  4US9 A;  3CIR B;  3AE1 B;  1GTH A;  1BUI C;  2WP9 B;  2N0S B;  4TSS A;  2DYO A;  3AEG B;  3AED B;  3I57 A;  2W3R A;  3BII D;  2RDG A;  1WXQ A;  2WLB A;  1GT8 A;  3WCQ A;  2LUM A;  3DWG C;  1HA5 A;  3RFZ B;  1HQR D;  1J7B A;  2IGH A;  1TYG B;  1QKZ A;  2VZK D;  1D4B A;  2FE8 A;  1IGD A;  4KKI A;  2K9X A;  3NUH B;  5HHD G;  3V3X A;  1F2R I;  4UDU C;  5D3D A;  4JPS A;  1PDX A;  5BYS A;  1VLB A;  1CK1 A;  2L32 A;  2W54 A;  1UGJ A;  1FXI A;  1BML C;  1L6V A;  3P1M A;  2K22 A;  1VRA B;  2GB1 A;  1ENF A;  4RGT A;  4HKQ A;  1UWM A;  3BYT B;  3ZJT A;  2XNA C;  4D2K A;  1SJH D;  1D5M C;  1MVK A;  1TKY A;  3AH7 A;  3LXF A;  1ET6 A;  4H2A A;  4B0E A;  5BYQ A;  3O13 A;  1JAL A;  1F2R C;  1JWM D;  1IBX A;  1QOA A;  4MM3 B;  4IKG A;  5FKA C;  1YQ4 B;  3TUO A;  5EE0 A;  1TY2 A;  1WWT A;  2QSD A;  1NEK B;  2X38 A;  2BS3 B;  4OZB A;  1FNV A;  3AE4 B;  3R2I A;  3P63 A;  1QIL A;  3U2S C;  3IT6 B;  3MHZ A;  4Q2J A;  1ZDV A;  1KRH A;  2L52 A;  3ZJV A;  2PKO A;  4RFB A;  3KWV A;  1LO5 D;  3MFG A;  3J9C A;  3IAM 1;  1I7H A;  2INP E;  1FNW A;  4US8 A;  4IOI E;  1N5X A;  2EEL A;  3HVZ A;  1DOX A;  1TS2 A;  2BS4 B;  1V8C A;  2WXJ A;  4RCO A;  1FRR A;  4NAM A;  1HEZ E;  3FC4 A;  3HVD A;  3AN1 A;  1XCT L;  3AE3 B;  2OED A;  2W3S A;  4N58 A;  1YN5 A;  4CQN A;  4XWW A;  2IPK D;  4TQ0 A;  2PVG C;  4ZHO A;  3AEF B;  2MJ3 A;  4HKZ E;  2RMM A;  1I4P A;  2WXM A;  1YMH E;  3L4P A;  3W5U B;  5FR3 A;  1EU4 A;  3W1S A;  4C7Z A;  1E10 A;  1P7E A;  2E6X A;  4LK0 M;  1C4P A;  1L0X B;  2GI9 A;  5G5G A;  1OQR A;  1ZOY B;  1PUT A;  3P42 A;  1N61 A;  2AQ1 B;  3BK2 A;  3BZD B;  4DXG A;  1TS4 A;  1K53 A;  4MAC A;  2QIL A;  1TS5 A;  2XN9 C;  1XCQ L;  4ZOH C;  3ZGZ A;  1JWB D;  3TEW A;  1JRO A;  1WSP A;  1JRP A;  3U4E G;  2WXK A;  2JYE A;  3VRB B;  4AS1 A;  1KF6 B;  1ROE A;  1ZXH A;  4IDI A;  1NI3 A;  2Y5P A;  3AEA B;  1VR9 A;  2WNM A;  5LNK 1;  3MP9 A;  4KKJ A;  1V1P A;  1WRI A;  2JU6 X;  1QOF A;  3KLS X;  1L0Y B;  3Q8C A;  3T3N A;  3PZ7 A;  4OHJ A;  4HEA 1;  2J42 A;  1K51 A;  2Z8L A;  4KGT A;  5BMH A;  4RF0 A;  1YJI A;  1YNT E;  2ICI A;  2WXF A;  1QQR A;  2H89 B;  1FFU A;  3TEX A;  1XF5 L;  2K0P A;  1MI0 A;  3I9V 1;  2LHE A;  5C2T B;  5BMG A;  1DOI A;  3SR6 A;  4A9A A;  1GTE A;  1FIQ A;  1IGC A;  1T5X D;  1Q10 A;  5HG2 A;  1NEN B;  3AM9 A;  1YN3 A;  1L0V B;  1JWU D;  5I4D A;  4LTU A;  3C8Y A;  1D5Z C;  1E9M A;  1EU3 A;  2YEP B;  5BYR A;  1YN4 A;  4EE2 A;  1SE3 A;  1VJK A;  2V3N A;  5D3I B;  1XEE A;  5HFY A;  1XO3 A;  4ITK A;  3IT4 B;  1H7W A;  1FM0 D;  1L4D B;  5E6J A;  2WU5 B;  2SEB D;  1OQQ A;  2DLB A;  3GS2 A;  1C78 A;  4RGN A;  2INN E;  4ZRP A;  1SB3 C;  5FK9 C;  4YXD B;  2E3T A;  4WUR A;  4JX1 C;  3UI3 A;  1MHX A;  2HDE A;  5T8I A;  4HRO A;  4WQM A;  3B2G A;  4MH8 A;  1PGX A;  5MPO A;  2AQ2 B;  4WIP A;  3KQ4 A;  2G9H D;  4WH4 A;  1KTK A;  4N59 A;  1RYJ A;  3Q8F A;  2NTT A;  2AX5 A;  1XLN A;  2WXR A;  2BTE A;  3P4S B;  1UNS A;  3BVG A;  3EGR A;  1IBX B;  1N62 A;  2JYT A;  4A90 A;  1GB4 A;  3VR9 B;  4YWG G;  1KFY B;  2YEP F;  3AE9 B;  4YT0 B;  2ZW0 A;  2V3P A;  2WXL A;  1N63 A;  3EA6 A;  1T6B X;  2G1E A;  1UUP A;  3T3O A;  3AEB B;  4WWM A;  5BMI A;  3TEZ A;  2QIE B;  2K3U A;  3AMZ A;  1HZ6 A;  2MJE A;  2LHD A;  3IAS 1;  2WXH A;  2N7J A;  3AE6 B;  2LFI A;  4N6E B;  4NJC A;  3Q8B A;  1L5P A;  2I2Y A;  1PGA A;  4OVZ A;  1FMA D;  1YQ3 B;  4YTM B;  1B9R A;  3NVZ A;  3NRZ A;  2L83 A;  4L2Y A;  1TJE A;  3AE8 B;  1V1P B;  3P4R B;  4RGM A;  5JXV A;  3BVM A;  1L4Z B;  2PMV A;  2KAJ A;  4DQO C;  1FCL A;  1FNU A;  5EE9 A;  1STE A;  2JXT A;  2DWQ A;  3ETR A;  1SBB B;  3AE7 B;  4O1N A;  2N9L A;  1P7F A;  1RWS A;  1ZUD 2;  2PLP A;  2QMT A;  1PFD A;  2BT6 A;  3B2F A;  2BBC A;  3LB8 C;  5G5H A;  2Y3A A;  1C4A A;  1SIJ A;  2QEJ C;  4TQ1 A;  5H8Y E;  1PYW D;  3FIL B;  1V97 A;  1GPX A;  3OWE B;  4L1B A;  3Q8A A;  2KAC A;  1SJE D;  3BWU D;  2M56 B;  1VZ8 A;  2PW9 A;  4A8X C;  1ZP0 B;  2WQY B;  2EKI A;  3AB5 A;  4XWT A;  4A6Q A;  2ACZ B;  3GB1 A;  3E9S A;  1ZPS A;  1ZXI A;  1C76 A;  2WDV B;  4JE3 B;  5AUK A;  1FO4 A;  4KGS A;  2I38 A;  2MJD A;  2WXQ A;  3ZYY X;  1E6E B;  1M4V A;  4OW0 A;  4YSZ B;  1K52 A;  4PT5 A;  2D5G A;  3B9J A;  1ZDX A;  3BYY B;  4YTP B;  1OFF A;  2CJN A;  2KQ4 X;  4OZC A;  1XXG A;  1RM6 C;  3RPF C;  1D5X C;  1C77 A;  2HTM E;  3EUB 2;  2FBW B;  1D6E C;  3SFD B;  2PVO D;  3AEE B;  1FXA A;  1L6U A;  4DXF A;  3VQI A;  1EWY C;  2BW2 A;  1SE2 A;  2R61 A;  1B1Z A;  1JW9 D;  1HZ5 A;  2WU2 B;  3IXS A;  1EWC A;  3NS1 A;  1TZO A;  4WAF A;  1JQ4 A;  1F0Z A;  2BS2 B;  2JQR B;  1RFK A;  2WXI A;  3N9Y C;  2PIA A;  1E0Z A;  2J4X A;  2JWU A;  2K5P A;  3TEY A;  1DGJ A;  3BK1 A;  1FFV A;  1GAQ B;  4XE0 A;  4RH6 A;  3DWM A;  3BVZ A;  2DYM A;  2WXP A;  1JWA D;  2QJL A;  3W9C B;  1F77 A;  2LJI A;  1XLO A;  4RF1 A;  3FAH A;  1NYQ A;  2IGD A;  1H7X A;  3Q69 A;  2B76 B;  2FUG 1;  5HI1 A;  2N9K A;  1TS3 A;  4ZYS A;  4KX6 B;  5EE3 A;  1IUE A;  4XDC A;  1AWD A;  1ET9 A;  4ZRQ A;  4KGR A;  4GLS C;  1C79 A;  3E56 A;  2V4I B;  2WDQ B;  2ON8 A;  1XLQ A;  1MPE A;  2KMM A;  2Y5C A;  1I4R A;  4P6V F;  5H92 C;  1VZ6 A;  3LYY A;  2NMQ A;  3V05 A;  2TSS A;  3VR8 B;  3TSS A;  3MJ5 A;  2JSV X;  1R7S A;  2Q5W D;  2CJO A;  2IJ0 A;  3NVV A;  4C80 A;  4ARI A;  4MT5 A;  2DBY A;  1KH0 A;  1FCC C;  1T3Q A;  1EM7 A;  2RPV A;  1I4X A;  1SE4 A;  1GB1 A;  1A70 A;  1QOB A;  3MC0 B;  4B0M A;  1FD6 A;  2ONQ A;  1TKG A;  1I4G A;  3ZJU A;  1WGK A;  2WXG A;  4NZL B;  3W5V B;  3R2T A;  1ACC A;  3PO0 A;  1QF6 A;  4HJG E;  1C9F A;  1J7A A;  3HUI A;  4FXC A;  2W82 A;  4GDL B;  2BB5 A;  1ESF A;  1GOZ A;  1I4H A;  1SSN A;  1QLB B;  4JWS C;  4YTN B;  1CZP A;  2IDY A;  3AEC B;  3HRD D;  4HRS A;  4C7Y A;  2KN4 A;  2MH7 A;  4J3O D;  2WXN A;  1AYF A;  2BB6 A;  5C3J B;  1DOY A;  1E7P B;  1CQV A;  3CWI A;  1MHH E;  2VZK B;  4OZA A;  2IGG A;  2OHF A;  5TSS A;  1CJE A;  1DYQ A;  4USA A;  3AV8 A;  3R8B A;  1K50 A;  4A55 A;  2ZW1 A;  5D7G A;  4JWU C;  1J7C A;  2W55 A;  1NYR A;  3KWL A;  1UWX A;  2JZP A;  1JWS D;  3U52 E;  1VZ7 A;  2J52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...