3AE9B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae9B01
1KRHA 1ZXIA 5AUKA 3P4PB 5EE9A 1H7WA 4P6VF 1TKYA 2G1EA 1SIJA 3VRBB 3AE1B 1E6EB 1N60A 2OHFA 3DWMA 2QIEB 1H7XA 1EWYC 3NVYA 2M19A 3AE5B 1DOIA 1N61A 5EE3A 1SF0A 4JX1C 5EE0A 1L6VA 5C2TB 2PKOA 2WU2B 3AE2B 3AECB 1DGJA 1TKGA 1JRPA 1FM0D 5MPOA 3CWIA 1I7HA 1N5WA 2ACZB 5C3JB 1XLQA 1YJJA 1IUEA 3AH7A 2N0SB 4N59A 1FO4A 1FFVA 1OQQA 4WQMA 3W5UB 1WRIA 2WDQB 3AE8B 2CJNA 2CU3A 5EE1A 1PUTA 2KMMA 4HROA 3P4RB 1GTEA 3AMZA 4YSXB 1L6UA 2LEKA 2PVOD 1JWAD 4C80A 4HRSA 2H89B 1NYQA 4ZOHC 2W55A 1JQ4A 2M56B 1WWTA 4JWSC 1OFFA 3ABVB 1PDXA 3P63A 1N63A 1JW9D 1TYGB 2K9XA 2W3RA 1YJIA 2QJLA 4YSYB 3AEGB 1T3QA 3NS1A 3P4QB 3P1MA 4US9A 4YSZB 1CJEA 1J7CA 2MJEA 1RM6C 4WWMA 4KX6B 3B2FA 1JROA 1E0ZA 2MH7A 3VR9B 1L5PA 2MJ3A 2MJDA 1XLOA 2PIAA 1TJEA 1NENB 3SFEB 3DWGC 3LB8C 1GTHA 5H8YE 4C7YA 2WDRB 4YT0B 3AV8A 1RYJA 1WXQA 1KF6B 3NRZA 3AEAB 3BIID 2WDVB 1J7AA 3AM9A 2H88B 2FBWB 4N58A 3ZYYX 2DBYA 1L0VB 1DOYA 1A70A 2BS3B 1TKEA 2L83A 3AN1A 3CF4A 4YTNB 1FXIA 2WS3B 2WP9B 1QT9A 2JX5A 2DWQA 3HVZA 3NVZA 5G5HA 3SFDB 1QOGA 2EKIA 1YQ3B 3AEBB 1FRRA 1RWSA 2K22A 3HUIA 1E10A 2K5PA 1XLNA 3NVVA 1AWDA 3W5VB 1ZUD2 2L52A 3FC4A 3W9CB 4YTMB 1B9RA 4IDIA 2BS2B 1JALA 3SR6A 4ZHOA 2W54A 1E9MA 2WLBA 1KFYB 1QLBB 2CJOA 5H92C 3ETRA 3AE6B 1R7SA 4USAA 2PVGC 3AEFB 1E7PB 3AE3B 1XLPA 2E3TA 1QF6A 1F0ZA 1FXAA 1GAQB 4ITKA 4N6EB 1FIQA 3PO0A 2BS4B 4JWUC 1SB3C 1NI3A 1NVID 1PFDA 1V8CA 2AX5A 1GPXA 3HRDD 3CIRB 1ZOYB 2W3SA 3EUB2 5GXGB 3P4SB 3LXFA 3RPFC 1N62A 2KAJA 3AE9B 3VRAB 1FMAD 1VJKA 3NVWA 1XO3A 5G5GA 1UWMA 1YQ4B 2WU5B 3AE7B 1NEKB 1V97A 4C7ZA 4YXDB 1DOXA 3AE4B 1VLBA 1QOAA 3VR8B 1VDVA 2B76B 1NYRA 1N5XA 4LTUA 1J7BA 1ROEA 4FXCA 3FAHA 2WQYB 3AEDB 3L4PA 5AUIA 4ZHPA 1QOFA 1RFKA 1FRDA 3B2GA 1JWBD 4US8A 2Y5CA 3WCQA 2Q5WD 1ZP0B 1AYFA 1WYGA 2JQRB 3KWLA 3AEEB 4YTPB 1WGKA 1FFUA 1OQRA 1CZPA 3AB5A 1QOBA 4A9AA 2BT6A 3B9JA 1GT8A 2HTME
chains in the Genus database with same CATH superfamily
3P4PB 5FR6A 2R2QA 4RNAA 3E56A 1SIJA 4KIKA 1H7XA 1I4HA 3E9SA 2RDHA 2JT4B 1D5MC 3UQAA 2WWZA 3PPAA 3ZTCA 1I7HA 1PGBA 2Z59B 3AH7A 3VUWA 3L10B 1LM8B 1WRIA 4EZJA 3VDZA 1PUTA 1E90A 4RMAA 1L6UA 3ZLZA 3ZTDA 2INDC 4DQOC 4LCDE 3ZVVA 3P4QB 3KYDD 1CJEA 4AOFA 1C4AA 1HZ5A 3VR9B 2K6QA 2GLSA 4JE3B 3ZRCA 2I1JA 5TSSA 1E8WA 2IO2B 3AEAB 2MBBB 2INCC 1J7AA 3AM9A 2H88B 2BWES 3ZYYX 1FNUA 3MP9A 4YTNB 2JZPA 3HUIA 2K5PA 3R3MA 3MHZA 3H9DA 4DHJB 2IDYA 2M17A 1KFYB 3R7QA 2DX5B 4DDGD 4G0NB 5IO9A 2FCMA 2GI9A 3AE9B 1R4NB 2N9LA 3PLUA 1C79A 3UF8A 3VAWA 1FNWA 1NYRA 4ZHPA 2LGIA 2Q5WD 1FD6A 2JQRB 2WXRA 3V60A 3T9LA 3KVFB 4W9HA 1WXAA 2MCNB 3TMPB 2OOBB 5CX3A 4NAWB 3HM6X 2KDIA 4K1RB 2O6VD 3OJ3A 1DOIA 2WXOA 2VZKD 2BYFA 3H6NA 3H7SA 1YIWA 2JF5A 1K51A 5CHWA 5FKAC 5C23A 5C3JB 2N0SB 1OQQA 5IP4D 1U4AA 4WQMA 4TUUA 1TZ1A 5LXIB 4AS1A 4C80A 1UF0A 2ZW1A 3ABVB 1WMHA 4KDLB 3UGBB 2W3RA 3IHPC 4WIPA 1GB1A 3TUOA 4X57B 4PK1A 2ZJDA 5D3DA 5JH5C 4PT5A 3QQ8B 5G2NA 4EOYA 3W1SA 1KJTA 3DCGA 2J0KA 3IT4B 4IM0A 4RF1A 1TZOA 3SD5A 1L0VB 4M01A 1ZGUB 1K53A 2EKIA 3QA8A 1YN3A 2NTSA 1CMXB 1B9RA 3NY5A 2W54A 3U30A 4ZRJA 2K39A 3ETRA 1UGMA 5HG2A 1QF6A 1PQSA 1HZ6A 1XXGA 1L4ZB 1IPGA 2DYBA 1GPXA 3HRDD 1WE7A 3N32A 1WYWB 5GXGB 4NAWA 4AJWA 3A4RA 2MBQA 1GNUA 1WY8A 2C5LC 3B1LX 4GSWA 2JYTA 3R66C 2LASA 4LDTD 2MA9B 4C4VB 1UH6A 3AB5A 1GC7A 2DZJA 1WR6E 2KVZA 5J17A 2HTME 5AUKA 1ZXIA 3Q8FA 3FILB 3KW5B 2KT7A 4MJSB 4LJPB 4GOCA 4RCOA 2BW2A 2BQQA 4HDQA 4A55A 3M3JA 1VZ6A 3DHIC 1IUEA 1FFVA 2INNE 4IM3A 2EELA 2LGDA 3AMZA 1J8CA 2X8XX 3HIZA 1WGHA 4II2B 3UI3A 1N63A 3NZUA 3DBRI 1JWSD 3AEGB 3RFZB 1SE3A 2KKCA 2NBWB 3DVGX 1HE8A 3PHWB 4ZDVA 1GTHA 3PZ8A 3RNFC 1ESFA 1SXTA 2ZPNA 3T3OA 1T6BX 3AN1A 1TGZB 4WURA 3GZNI 3Q3JA 4GDKB 3DBRB 3IAM1 1ZUD2 4WJPA 4I6PA 1TTNA 1VCBA 4ZHOA 1C4CA 2WXKA 2J0JA 2LHEA 3H7PB 4C4VA 2D5GA 4WWNA 2YEPF 2BPSA 1KLGD 1C76A 4B0EA 2V4LA 1V8CA 2NVUI 2LGYA 3FILA 1XF5L 3HM3A 4IUMB 4MJSA 3PRZA 3GZNB 2KX0A 1J7BA 1QOFA 3VTWA 1TS4A 2KQ7A 1PYWD 1EO6A 2B3AA 2V9HA 2HTHA 1P98A 1FFUA 4NQKE 4XGAB 5D7GA 1HQRD 3VXWA 4K7UA 4W9CA 1FXIA 1F1HA 5EE9A 1OEYA 3EGRA 3Q6BA 2G1EA 2OHFA 2E6XA 1SEBD 1YQBA 3KLSX 3NVYA 4J3OD 2M19A 3EC8A 3PV1A 1JWUD 3OLMD 5EE0A 1L6VA 5C2TB 3BZDB 2PW9A 3H8HA 1EWCA 1TKGA 4F7ZA 3APCA 2KDBA 3LDZE 2KMMA 4MEMA 4EZLA 2ZNVC 1GUAB 4ZOHC 1E7UA 3M63B 1JQ4A 4JWSC 3HVDA 3DPDA 5BYQA 1JW9D 2N9XA 4GDKA 1T3QA 4GIVA 4EUTA 3ZNHB 3QCAA 3H7PA 4MDKE 1QZEA 3ECIA 5H8YE 2GBRA 5G55A 4C7YA 5BO4B 2QCZA 2RGFA 2KTRA 2WXIA 2WXHA 3TEWA 1Q1OA 1TY2A 2L32A 2LRUA 2DHZA 1C9FA 2KZRA 3DHHC 3W1YA 2LVOA 5T8IA 1JALA 4OVZA 1K8RB 4RF0A 1SE9A 5BYRA 4KZ0A 1E7PB 2GBKA 4K3CA 2DAFA 4DHJD 2HJ8A 3NJTA 4W9JA 2L05A 3N3KB 4A20A 4AJYB 3WAOA 2ONQA 3IAS1 1MFWA 4MM3B 1RLFA 3GS2A 3ML8A 2V1YA 2Y3AA 4MSMB 3RD2A 4FXCA 2D11A 1ACCA 2LI5A 2EMTA 5AEKB 3B2GA 2MRPA 2WXPA 1XT9B 4JIOU 1GT8A 2J52A 4BKSA 3PLVA 1TIFA 4G3XB 4EE2A 3MC9A 1SSNA 4XDCA 2K8BA 3KYCD 2KD0A 1EF5A 1YX5B 3GB1A 3N9YC 4FA6A 4B6WA 3QK0A 3JW0X 3KWVA 4XWWA 1JWAD 2LJ5A 4IWPA 3IBEA 3P63A 1OGWA 4HPMB 1MPEA 2LUMA 2VRRB 4YSZB 3NS8A 2XN9C 1RFAA 1C3TA 3DVNV 4BOSC 1E0ZA 2G9HD 2AQ1B 4II3B 1XLOA 4UDUC 3RI7C 2JYEA 2LUEA 3ONSA 2SEBD 2L0FA 1E8ZA 2K8CA 3RZWC 1H8CA 5CHFA 2N7DA 3N1ZC 2WDTB 3OJ4B 3DBHB 4ANVA 2BTEA 5I4DA 3RUIB 1HXYD 3NVZA 4MM3A 2KNBA 2WXNA 1F9JA 1WE6A 3UINB 4PYZA 4A3OA 2YEPB 4OZCA 1ZDVA 3L16A 4WJNA 4IOIE 2C60A 3I57A 4GDLB 2Z8LA 1ZDXA 2KN4A 2O2VB 4N6EB 1V5OA 2N4FA 2IGGA 4LNNA 2K0PA 3CIRB 2KANA 1L0XB 3RPFC 2PTLA 2LRWA 4XE0A 1VR9A 1ZPSA 3U4EG 2WXMA 1G6JA 1N6ZA 1VLBA 2D2QA 3Q3FA 1B1ZA 2ZVOA 3L4PA 2DLBA 5FK9C 2M8SA 3RYTA 4HXDA 4P1CC 3AU4A 3BWUD 2ASQA 1OQRA 3VH3B 1AARA 4FHKA 4HPLB 3AE1B 4FULA 1WF9A 4RGMA 1I42A 3KUZA 2MLBA 3TEZA 4JGHB 5KHOA 1YNTE 1N5WA 5EDSA 1T0YA 2GRIA 3BK1A 3APFA 2XBBC 2V3NA 3KH0A 1TYGB 1UBQA 1YJIA 1LO5D 3A33B 3LYYA 4KSLC 2MH7A 2LMCA 4BAXA 4GB9A 2WDRB 1BUIC 3NRZA 4GDLA 4BKTA 2O2VA 3BIID 3WAPA 4NQLB 1P0RA 4S17A 1TS5A 4JQWC 2L83A 5IAAC 5G5HA 2K22A 4RH6A 1XLNA 3MC0B 2KWUB 1V1PB 4XDDA 3FC4A 5IKCM 3M95A 2Y5BB 1ZKHA 2N1WA 2AWTA 5BMIA 5H92C 4KZCA 2IPKD 2QILA 3APDA 2RR9A 3VFKA 3PO0A 1IBXA 4BVUC 3JSVB 4HLEA 2NBUA 1R4NI 1N62A 1FMAD 2FUG1 2UWQA 1WMHB 4LJOB 2PMVA 3NUHB 1CQVA 1WJ4A 5JZEB 4LTUA 2L76A 1FRDA 1WRDB 1XQQA 4EEWA 3KWLA 3Q69A 4RM8A 3WAMA 3N1XC 3VUXA 2Z0EB 3VH4B 1N60A 4TQ1A 2QIEB 1DYQA 2MBEA 3PT2B 1PGAA 3PS6A 5EE3A 1JMLA 3H1UA 4LNOA 4K7SA 3CWIA 2ACZB 1YJJA 1FO4A 2WDQB 2CJNA 2TSSA 3P4RB 3DHGC 1EUVB 1H4RA 5LXHA 2OJWA 2QEJC 2H89B 2ZW0A 4BKGA 1D6EC 1UGJA 2JXXA 1PDXA 3HK0A 5L83A 2JPHA 3NOBA 1V1PA 1JROA 2RPVA 2GBMA 4BKSD 5DCNA 1V2YA 3KUCB 2BYEA 5E6NA 3Q3NC 4JLCA 3R2IA 2HD5B 5AZGA 3JSVA 3CF6E 1A5RA 2WS3B 3ZJTA 4KKIA 1FRRA 1KM7A 1WGGA 3V3XA 1AWDA 1WGDA 2MSED 1I35A 2KC1A 3SR6A 1WX8A 2D3CA 2J0MA 3AE6B 1IGCA 3M62B 1XLPA 2GMIC 3RNCC 4DXGA 1GAQB 1JCKB 3ZKJC 2K3UA 1WX7A 1FPYA 4EFOA 1J19A 2WU5B 3QIJA 3GP7A 4LNKA 5AUIA 3FAHA 2J53A 3A9KB 2N9KA 3L54A 1JWBD 2A4ZA 4W9DA 2XK5B 2WXQA 4A9AA 1YMHE 3PREA 4QAYA 2KX3A 2XNAC 5JXVA 1C77A 3N1YC 3DWMA 2ZPYA 4BBNF 2G3QB 4DHZE 1WI0A 3RNBC 3B0AA 2PKOA 3EA6A 2N7EA 3BYTB 4KGSA 2DZKA 2K1FA 3RNEC 2ZCCA 3K9OB 2N7JA 1GJZA 2XEWA 1L7YA 4MH0E 4E3CA 5JHBA 1OFFA 1PGXA 1KLUD 1E8YA 4XZ4A 1RM6C 4WWMA 4Q2JA 2MW5A 2G45B 3ZIMA 3IVFA 3SU8X 4M8NA 4ZYSA 1NENB 3SFEB 4ACFA 3ML9A 2K25A 1IYFA 3CMMB 4HCPB 2HJ1A 4BBNC 3Q2AC 2DZMA 1Y56A 1ET6A 2FCQA 2QMTA 1WJ6A 3HVZA 1RWSA 2D3AA 1F77A 1MJDA 2RD0A 1NDDA 3A9KA 2JRIB 4HKZE 2XK5A 5KHQA 4ITKA 2M4NA 2MX2A 3U8ZA 1PFDA 1YOVB 2EKEC 4A8XC 1T0RC 2MQJA 3P4SB 4OZBA 3AE7B 4IM2A 4C7ZA 1SGHA 3AE4B 3W5VB 2L7RA 4LNFA 4N9F4 3TL5A 3GE3C 3Q3OC 1WJUA 5IN7A 2JWUA 4HWIB 1YJ1A 4L1BA 1KRHA 2KTRB 1H7WA 1OQYA 3VRBB 2G4SA 2CU1A 1SE4A 2KC2A 3I9V1 2ZZPB 2LFIA 3ZJVA 2FE8A 2UYZB 3X23A 4YL8A 3AE2B 3PRPB 2IO0B 1ISNA 1DGJA 2MBOA 1LGRA 1UUPA 3I63C 1LQBA 3W5UB 4HK2A 3AE8B 3PGEA 1BXTA 2V0GA 4DXAB 3DBLI 4HRSA 4ARIA 1NYQA 1QQRA 4NNJB 2KDFB 4WWOA 1WIAA 3DQVA 2MJEA 3QWZB 3IFWB 4K81A 1WZ0A 4PS7A 4XX5A 3Q14C 3TJPA 1D3ZA 1C4PA 4W9EA 3AV8A 1RYJA 1UELA 1VRAB 2I1KA 3O13A 3MHSD 1DOYA 1TS2A 1A70A 2BS3B 4ANUA 5DPSA 3DBLB 2KHWB 3BYYB 2MP2B 1YX6B 2LVPA 1E10A 2W9NA 4NY0A 3W9CB 4IDIA 3VUYA 2BS2B 1TBEA 2DYOA 3IG3A 2WLBA 1P7EA 4O1NA 5CHVC 3ZGZA 2WXFA 2E3TA 3DBSA 1WR1A 4LK0M 1NVID 4URKA 3CSFA 4AUQC 2KQ4X 2WNMA 3T8MA 1DOXA 4LNIA 4GLSC 3OAWA 3ZDTA 2BF8B 2IO3B 2N1VA 5L95C 4W9IA 4YTPB 1P3QU 4YWGG 3A4SC 2KXJA 1SBBB 2WX1A 1OEYJ 1TKYA 1EU3A 1E6EB 2GB1A 1WGRA 2PPHA 3CSTA 2JZZA 4OZAA 1R4MI 2BGFA 1V81A 5J2RA 5GMVA 1XLQA 4AP4C 4NZLB 4ZRQA 1Z2MA 2L0TA 3BINA 1WXVA 2PLPA 2LEKA 3QC8B 1WM3A 2MP2A 2GBJA 4RM9A 1WH3A 2IBIB 2JY6A 1GC6A 2JZ3B 1TJEA 3RN9C 1I4XA 1R4MB 1NBFC 3RCZA 2EMSA 2KWVB 5HHDG 3DBHI 4HJGE 1TKEA 3MTNB 3NHEB 2JX5A 3SFDB 1MG4A 1WM2A 4DDID 4YTMB 3PZDA 2D3GA 1WSPA 2KN5A 2KMAA 1ZW7A 4J6IA 2FIFA 1IGDA 3BVMA 3W1SC 2R2OA 4JWUC 4KGRA 2AEHA 3MFGA 1HTQA 1GOZA 2L00B 1V1OA 1L0YB 1QOAA 4ARCA 3VR8B 1VDVA 4MELA 4RGTA 1XCTL 1OTRB 3ENEA 2Y5CA 2IGDA 4PS8A 4HDOA 4B95A 2KJHB 2QC8A 5HKHA 1S3SG 2KOXA 1EF1A 1K50A 4XYCA 1FNVA 4DXFA 2GBNA 4W9KA 4FBJB 2D10A 2WXLA 4MGIE 3MJ5A 3PSEB 1GTEA 2BB6A 2WGSA 4MACA 1KH0A 4NJ7A 1IBXB 4EKUA 5D6JB 4HVBA 1WFYA 1P1AA 2DAJA 1WZ3A 4CO7A 3B2FA 3BK2A 2MJ3A 3QJZA 2VH2A 4FJZA 3GOEA 4CHKA 2MHJA 1LXDA 4G11A 3IT6B 3ZXVA 1UWXA 1WXQA 1MI0A 2JRHA 1YD8U 3D32A 2M1MA 3CF4A 2NPTA 1MHHE 2Y5PA 1QT9A 2RDBC 4IWOA 1P7FA 2WHIA 5DPWA 4PS3A 2KMCA 1STEA 4P1BC 1XEEA 2RSUA 4OVUA 1NI3A 3LXFA 3ZNID 4DK5A 3NVWA 5CTRC 2QHOA 4D2KA 1NEKB 3AI5A 3Q8EA 2DYMA 2B76B 1E8XA 2HDEA 4FJYA 3OWEB 3MJWA 1RFKA 2MWSB 4XC2A 1WYGA 2DNFA 1WGKA 1J0GA 3QAQA 3QX1A 4IWQA 4KSKC 4BZAA 1D5XC 1I4RA 3ZXRA 4MGKE 3VTVA 4F8CB 3RULA 1JWMD 2BYTA 2FAZA 1GG3A 2FCSA 4ASWC 2JSVX 4JX1C 4IC7B 1M4VA 4JPSA 2M0XA 2RDGA 3DOWA 5MPOA 3IXSA 2BVCA 4ZRIA 4N59A 3EFUA 2UU7A 3ZRFA 1Q0WB 1MG8A 3C19A 4ZRKA 4WAFA 4GMVA 1FCLA 1YN5A 2M56B 2OJRA 2K9XA 3PRMB 4US9A 4IW0A 2CS4A 3C8YA 2INPE 3O65B 4B0MA 3NG0A 2KDMA 3TEXA 4KDIC 4FN2A 3RZFA 2WDVB 2AYOB 2IYDB 1WXMA 4C56C 1S1QB 4A90A 3A1QB 1YQ3B 3P2BA 2NBVB 2ZVNA 2SAKA 2V3PA 2FCNA 3TCAA 5D94A 5LNK1 4HCNB 2KFKB 4M02A 2PVGC 1V49A 1D4BA 2KQSA 1UBIA 3OG5A 4R3DA 2WX0A 1SB3C 4NJ6A 2ON8A 1ZE3D 5IA7A 1GB4A 2W3SA 5HI1A 2BYVE 1VJKA 2IY0B 3KQ4A 1YQ4B 4YXDB 1TT5B 4A6QA 4MGZE 2BWFA 1WGYA 1N5XA 2NTTA 4WH4A 2IJ0A 3TEYA 3I3TB 3SDLC 3WCQA 3JYUA 1ZP0B 1RAXA 3AEEB 4KKJA 2RMMA 5E6JA 4W9FA 1QOBA 4S0RA 2BT6A 1WJNA 2CHZA 4DBGA 3GE8C 4WJOA 3L13A 3DDCB 2BKFA 4NPNA 1HEZE 3WA0A 3UIPB 2KWCA 1N61A 1ZXHA 3V62A 3RMKC 2WU2B 2KDEB 2LXCA 3U52E 2W82A 3TSSA 1F52A 1JRPA 4FHJA 3VVWB 2ZCBA 1EU4A 4HROA 2PVOD 1Z5SB 3ZO5B 1V5TA 3ALBA 3LJ3A 1WWTA 4I6LB 2C7HA 3FKYA 3A1QA 4C00A 1FCCC 2X38A 4YSYB 4NAMA 1E5WA 3V05A 4L2YA 4OHJA 2LHDA 1C1YB 3UQBA 3NZSA 2HE7A 4ANWA 4RGOS 1V9JA 1L5PA 2MJDA 1LFDA 2LGSA 2KFKA 3BVGA 4YT0B 2NR2A 2R61A 1KF6B 4WJQA 1IP9A 2QDFA 3R2TA 1AN8A 3RT3B 3QHTA 1UZXB 1BT0A 1T0QC 2MBHA 4P7IA 4KGTA 4E74A 3L08A 3SEBA 4GU2A 2JWZA 3Q8BA 1P9DU 2K8HA 1FXTB 2KJRA 3KUDB 4TMAB 3WANA 1QLBB 1R7SA 3EECA 2DZIA 4PYUA 4LLGM 3AEFB 2N9EB 2A5UA 2C7NB 1FIQA 4KVGB 2D07B 5AZHA 3WIMA 2AX5A 4E71A 1ZOYB 3ZNGC 3ZDMC 2CHXA 3RNGC 4GGQA 2K6DB 3JVZX 2CKHB 3V6CB 1V6EA 2OEDA 4TSSA 1I4QA 1WX9A 4AQ7A 3AU5A 2LGXA 2FNJB 3R8BA 2KVRA 2G4DB 1V86A 2PE9A 3A9JB 4HEA1 1UNSA 4MGYE 5D2MB 2LD9A 1SIFA 2J42A 2NMQA 3VQIA 2DENB 1EWYC 2FUHB 4AWJA 3EFCA 2CR5A 2NCNA 4F1SA 1BMLC 3Q3MC 2KACA 2WXGA 1SJHD 5IOIA 3X0WA 1JRUA 3L17A 4ANXA 4MSQB 2QJLA 3P1MA 1QKZA 1EM7A 2CHWA 4DHZB 5C1ZA 2L8JA 2AQ3B 1X1MA 2ICIA 5DPRA 2PIAA 3LB8C 4TQ0A 2KTFA 4I6NB 4ZYNA 1Y8RC 2ZEQA 1HTOA 2DBYA 2IY1B 4L23A 4HPPA 3N20C 4M00A 1M94A 4OVVA 3NVVA 5BMGA 2L52A 3ZW3A 2JVCA 4K3BA 4NJCA 2AL6A 4USAA 1NI2A 1MHXA 3A9JA 2I2YA 4FLHA 3K9PB 2J4XA 4HJKA 2AL3A 3B08A 3S2AA 1UD7A 3VRAB 1XO3A 4K7WA 3J9CA 4P16A 3URYA 2D3BA 4M0WB 2LXAA 3Q8CA 1YN4A 1QILA 2BKRB 1T5XD 3B9JA 2C7MB 2O6VB 3I5JC 2YLMA 4DWFA 2VZKB 3WALA 2Z0DB 1XD3B 2KLGA 3AE5B 3QARA 4G50A 5DPTA 3UIOB 1SF0A 1T0SC 3DVGY 3MC8A 5J18A 2FIDA 5BMHA 1FM0D 5D3IB 5TR5A 4HKQA 5EE1A 3DVNU 3P42A 3VHTC 3NS1A 5E6OA 1SJED 1I4PA 4BOZB 4KX6B 3U7DA 1L4DB 4IKGA 2KK8A 3DWGC 3W2DA 2PJHA 3BY4B 1TY0A 4WQOB 4FJVB 3HHMA 1I4GA 4N58A 3AULA 3PVLA 3L0WB 4IG7B 2PE6B 1QOGA 4W9GA 2V3SA 4M0WA 3TBLD 4RGNA 5E6PA 1AW7A 3EHVA 1ET9A 4ICUA 4WWPA 3PTFC 1E9MA 2CJOA 1MVKA 1E7VA 3C0RB 4W9LA 1F2RC 1K52A 1FXAA 4A3PA 2O6VA 2BS4B 1KLVA 1XCQL 2KFJA 3EUB2 3N30A 4CYEA 2KAJA 2GOWA 4MT5A 2N9PC 2NS5A 1V97A 2KWDA 4ICVA 1V80A 4LDTB 1VD2A 2LZ6A 1SE2A 3U2SC 2C9WB 2WQYB 3AEDB 4WAAA 2I38A 4EZKA 4GXBA 4CQNA 1L2NA 1CZPA 2REXA 2V4IB 3V61A 3RNAC 2L1AA 4P6VF 2M0AA 4KV2A 2NPTB 3V6EB 2VH1A 2KO3A 1KOTA 3AECB 1RRBA 5BYSA 1Q10A 4TV3A 1D5ZC 2CU3A 4BFRA 2WXJA 4YSXB 1HA5A 3ZJUA 2RPQA 2W55A 3SHQA 2WYQA 4KIKB 5LLIA 3T3NA 2JU6X 1J7CA 2MEKA 1ENFA 2IZVB 2BBCA 4XWTA 2QSDA 4OW0A 2KYWA 3VTUA 1Q5WB 5FR3A 1CK1A 4MH8A 2ZNVB 4H2AA 2FBWB 2KJ6A 4FADA 2LVQA 4REZA 2WP9B 2YVCA 2DWQA 3AEBB 2IO1B 4ZRPA 2BB5A 4M8MA 4JL9A 4B9KA 2JUOA 3Q8AA 1WXSA 1C78A 3ZUNA 2J7QB 3U7ZA 2PEAA 3AE3B 1F0ZA 2IGHA 1KTKA 3R7RA 4GN1A 3ZQ4A 3PZ7A 5G5GA 4RFBA 1UWMA 4TKNA 3BVZA 1VZ8A 2LJIA 5HFYA 3TIXA 1ROEA 3AXCA 5JHAA 2AQ2B 2L3ZA 1VZ7A 2JXTA 3PHXB 4US8A 1FEHA 2KLCA 3NZ3A 1AYFA 1F2RI 3ZNZB 1TS3A 2LWPA 5AZFA
chains in the Genus database with same CATH topology
1KRHA 3P4PB 2J52A 4RNAA 1H7WA 3E56A 1SIJA 3VRBB 1SE4A 1H7XA 1HEZE 1I4HA 3I9V1 4EE2A 2LFIA 3E9SA 3ZJVA 2RDHA 1SSNA 2FE8A 1N61A 1ZXHA 4XDCA 1D5MC 2WU2B 3AE2B 3U52E 1DGJA 2W82A 3TSSA 1JRPA 1UUPA 1I7HA 1PGBA 3AH7A 3GB1A 3N9YC 3W5UB 1EU4A 1WRIA 3AE8B 1BXTA 2V0GA 1PUTA 4HROA 1L6UA 3KWVA 4XWWA 2PVOD 1JWAD 4HRSA 4ARIA 1NYQA 1WWTA 4DQOC 3P63A 1QQRA 1MPEA 1FCCC 2LUMA 4YSYB 2X38A 4NAMA 3P4QB 4YSZB 1CJEA 2XN9C 2MJEA 4L2YA 4OHJA 3V05A 2LHDA 1C4AA 1HZ5A 1E0ZA 3VR9B 2G9HD 4RGOS 1L5PA 2AQ1B 2MJDA 1XLOA 4JE3B 4UDUC 2JYEA 1C4PA 3BVGA 5TSSA 2SEBD 4YT0B 3AV8A 1RYJA 2R61A 1KF6B 3AEAB 1VRAB 1J7AA 3AM9A 2H88B 3O13A 3R2TA 2BTEA 1AN8A 1FNUA 3ZYYX 5I4DA 1DOYA 1TS2A 1A70A 2BS3B 3MP9A 4YTNB 1HXYD 2JZPA 3NVZA 3BYYB 4KGTA 1E10A 2WXNA 3HUIA 3SEBA 2K5PA 3MHZA 3Q8BA 3W9CB 4IDIA 2BS2B 2DYOA 2YEPB 2IDYA 2WLBA 1P7EA 4TMAB 1KFYB 1QLBB 4OZCA 1ZDVA 4O1NA 1R7SA 3ZGZA 2WXFA 4IOIE 3AEFB 4LLGM 2E3TA 3I57A 4GDLB 2Z8LA 1ZDXA 1FIQA 2KN4A 4N6EB 2IGGA 4LK0M 1NVID 2AX5A 2K0PA 3CIRB 1ZOYB 2GI9A 1L0XB 3RPFC 3AE9B 2PTLA 2KQ4X 2N9LA 4XE0A 2WNMA 1VR9A 1ZPSA 3U4EG 2WXMA 1DOXA 1C79A 4GLSC 1VLBA 1FNWA 1B1ZA 1NYRA 2OEDA 4ZHPA 3L4PA 2DLBA 2LGIA 4TSSA 5FK9C 1I4QA 4AQ7A 2Q5WD 1FD6A 2JQRB 2WXRA 3BWUD 4YTPB 3R8BA 1OQRA 4YWGG 4HEA1 1UNSA 1SBBB 2J42A 1TKYA 1EU3A 2NMQA 3AE1B 1E6EB 2GB1A 3VQIA 1EWYC 4RGMA 4NAWB 1BMLC 1DOIA 2WXOA 3TEZA 2VZKD 4OZAA 2KACA 1K51A 1YNTE 5FKAC 1N5WA 1XLQA 5C3JB 1SJHD 2WXGA 2N0SB 1OQQA 2GRIA 4NZLB 4WQMA 4ZRQA 3BK1A 2PLPA 2LEKA 4AS1A 4C80A 2V3NA 2ZW1A 3ABVB 1TYGB 2W3RA 1YJIA 2QJLA 3P1MA 4WIPA 1GB1A 1QKZA 1LO5D 1EM7A 3TUOA 3LYYA 2AQ3B 2ICIA 2LMCA 2MH7A 2PIAA 5D3DA 1TJEA 4PT5A 1I4XA 3LB8C 3W1SA 2WDRB 4TQ0A 1BUIC 3NRZA 3IT4B 3BIID 5HHDG 4RF1A 1TZOA 2DBYA 1L0VB 4HJGE 1TS5A 1TKEA 2L83A 4L23A 2JX5A 1K53A 5G5HA 3SFDB 2EKIA 2K22A 4RH6A 1XLNA 1YN3A 3NVVA 3MC0B 5BMGA 1V1PB 4XDDA 2L52A 2NTSA 3FC4A 4YTMB 1B9RA 4NJCA 2W54A 5BMIA 1WSPA 5H92C 3ETRA 2IPKD 2QILA 4USAA 5HG2A 1MHXA 2I2YA 1QF6A 1IGDA 3BVMA 1HZ6A 3PO0A 1XXGA 1L4ZB 1IBXA 2J4XA 4JWUC 4KGRA 1GPXA 3MFGA 3HRDD 1GOZA 5GXGB 1N62A 1V1OA 3VRAB 1FMAD 2FUG1 1XO3A 2PMVA 3J9CA 1L0YB 3NUHB 4P16A 3URYA 1QOAA 1CQVA 4ARCA 3VR8B 1VDVA 4LTUA 4RGTA 3Q8CA 1FRDA 1XCTL 1YN4A 2JYTA 2Y5CA 2IGDA 3KWLA 3Q69A 3AB5A 1QILA 1T5XD 3B9JA 2HTME 5AUKA 1ZXIA 3Q8FA 2VZKB 1N60A 4TQ1A 2QIEB 3FILB 1DYQA 1PGAA 3AE5B 5EE3A 1SF0A 1JMLA 1K50A 1FNVA 4DXFA 4RCOA 2BW2A 4A55A 5BMHA 1FM0D 1VZ6A 3CWIA 2ACZB 1YJJA 5D3IB 1IUEA 1FO4A 1FFVA 4HKQA 2INNE 2WDQB 2CJNA 2EELA 2WXLA 5EE1A 3MJ5A 2TSSA 3P4RB 1GTEA 2BB6A 3AMZA 3P42A 4MACA 2QEJC 1KH0A 1IBXB 2H89B 2ZW0A 1D6EC 1UGJA 1PDXA 3UI3A 1N63A 1JWSD 3NS1A 3AEGB 1SJED 3RFZB 1SE3A 1V1PA 1I4PA 4KX6B 3B2FA 1JROA 3BK2A 2RPVA 1L4DB 2MJ3A 4IKGA 3DWGC 3W2DA 1GTHA 3IT6B 3PZ8A 1UWXA 1TY0A 1WXQA 3R2IA 1ESFA 1SXTA 1MI0A 1I4GA 4N58A 3T3OA 1T6BX 3AN1A 3CF4A 1MHHE 2Y5PA 2WS3B 1QT9A 3ZJTA 4WURA 1QOGA 4KKIA 1FRRA 4GDKB 4M0WA 3V3XA 1P7FA 1AWDA 3IAM1 1ZUD2 4RGNA 1AW7A 1ET9A 3SR6A 4ZHOA 1C4CA 1E9MA 2WXKA 2CJOA 2LHEA 1MVKA 3AE6B 1IGCA 1STEA 2D5GA 1XLPA 4DXGA 1F2RC 1K52A 1FXAA 1GAQB 1JCKB 1XEEA 2YEPF 1KLGD 2K3UA 2BS4B 1C76A 4B0EA 1NI3A 1XCQL 1V8CA 3EUB2 3FILA 3LXFA 2KAJA 3NVWA 1XF5L 4MT5A 4D2KA 2WU5B 1NEKB 1V97A 2KWDA 3Q8EA 1SE2A 3U2SC 2DYMA 2B76B 3GP7A 2HDEA 1J7BA 5AUIA 3FAHA 2WQYB 3AEDB 3OWEB 1QOFA 1RFKA 2I38A 2J53A 2N9KA 1JWBD 1TS4A 1PYWD 1WYGA 4CQNA 1WGKA 1FFUA 1CZPA 5D7GA 1HQRD 4A9AA 2WXQA 1FXIA 1YMHE 2V4IB 2L1AA 2XNAC 5EE9A 1D5XC 3EGRA 1I4RA 4P6VF 2G1EA 1C77A 5JXVA 2OHFA 2E6XA 1SEBD 2M0AA 3DWMA 3KLSX 3NVYA 1JWMD 4J3OD 2BYTA 2M19A 1JWUD 2JSVX 4JX1C 5EE0A 1M4VA 1L6VA 5C2TB 2PKOA 3BZDB 3EA6A 4JPSA 3AECB 2PW9A 2RDGA 3BYTB 3H8HA 1EWCA 1TKGA 4KGSA 5MPOA 3IXSA 5BYSA 1Q10A 2N7JA 4N59A 1D5ZC 2CU3A 2KMMA 2WXJA 4YSXB 4WAFA 1FCLA 1YN5A 1HA5A 3ZJUA 4ZOHC 2W55A 1JQ4A 2M56B 4JWSC 1OFFA 1PGXA 3HVDA 5BYQA 1JW9D 2K9XA 1KLUD 1T3QA 4US9A 3T3NA 2JU6X 1J7CA 2MEKA 1RM6C 1ENFA 3C8YA 4WWMA 2BBCA 4Q2JA 2INPE 4XWTA 4B0MA 2QSDA 4OW0A 4ZYSA 1NENB 3SFEB 2KDMA 5H8YE 3TEXA 4C7YA 5FR3A 1CK1A 2WDVB 4MH8A 4H2AA 2WXIA 2FBWB 2WXHA 3TEWA 1Y56A 1ET6A 4C56C 2QMTA 4REZA 4A90A 1TY2A 2L32A 2WP9B 2DWQA 3HVZA 1YQ3B 3AEBB 1RWSA 1C9FA 4ZRPA 2BB5A 2SAKA 1F77A 2V3PA 5T8IA 1JALA 3Q8AA 4OVZA 1C78A 4RF0A 5LNK1 3U7ZA 4HKZE 5BYRA 2PVGC 1E7PB 3AE3B 1D4BA 1F0ZA 2IGHA 4ITKA 1KTKA 4R3DA 1GB4A 1SB3C 2ON8A 1ZE3D 1PFDA 2W3SA 4A8XC 3ZQ4A 5HI1A 3P4SB 1VJKA 2ONQA 4OZBA 3PZ7A 3IAS1 4MM3B 5G5GA 4RFBA 1UWMA 3GS2A 3KQ4A 1YQ4B 3AE7B 4C7ZA 4YXDB 3BVZA 3AE4B 4A6QA 1VZ8A 2Y3AA 2LJIA 5HFYA 3W5VB 1N5XA 1ROEA 4FXCA 2NTTA 4WH4A 2IJ0A 1ACCA 2AQ2B 3TEYA 1VZ7A 2JXTA 3B2GA 4US8A 1FEHA 3WCQA 3NZ3A 1ZP0B 1AYFA 1F2RI 3AEEB 4KKJA 2RMMA 5E6JA 2WXPA 1QOBA 1TS3A 2JWUA 2BT6A 1GT8A 4L1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRH A;  1ZXI A;  5AUK A;  3P4P B;  5EE9 A;  1H7W A;  4P6V F;  1TKY A;  2G1E A;  1SIJ A;  3VRB B;  3AE1 B;  1E6E B;  1N60 A;  2OHF A;  3DWM A;  2QIE B;  1H7X A;  1EWY C;  3NVY A;  2M19 A;  3AE5 B;  1DOI A;  1N61 A;  5EE3 A;  1SF0 A;  4JX1 C;  5EE0 A;  1L6V A;  5C2T B;  2PKO A;  2WU2 B;  3AE2 B;  3AEC B;  1DGJ A;  1TKG A;  1JRP A;  1FM0 D;  5MPO A;  3CWI A;  1I7H A;  1N5W A;  2ACZ B;  5C3J B;  1XLQ A;  1YJJ A;  1IUE A;  3AH7 A;  2N0S B;  4N59 A;  1FO4 A;  1FFV A;  1OQQ A;  4WQM A;  3W5U B;  1WRI A;  2WDQ B;  3AE8 B;  2CJN A;  2CU3 A;  5EE1 A;  1PUT A;  2KMM A;  4HRO A;  3P4R B;  1GTE A;  3AMZ A;  4YSX B;  1L6U A;  2LEK A;  2PVO D;  1JWA D;  4C80 A;  4HRS A;  2H89 B;  1NYQ A;  4ZOH C;  2W55 A;  1JQ4 A;  2M56 B;  1WWT A;  4JWS C;  1OFF A;  3ABV B;  1PDX A;  3P63 A;  1N63 A;  1JW9 D;  1TYG B;  2K9X A;  2W3R A;  1YJI A;  2QJL A;  4YSY B;  3AEG B;  1T3Q A;  3NS1 A;  3P4Q B;  3P1M A;  4US9 A;  4YSZ B;  1CJE A;  1J7C A;  2MJE A;  1RM6 C;  4WWM A;  4KX6 B;  3B2F A;  1JRO A;  1E0Z A;  2MH7 A;  3VR9 B;  1L5P A;  2MJ3 A;  2MJD A;  1XLO A;  2PIA A;  1TJE A;  1NEN B;  3SFE B;  3DWG C;  3LB8 C;  1GTH A;  5H8Y E;  4C7Y A;  2WDR B;  4YT0 B;  3AV8 A;  1RYJ A;  1WXQ A;  1KF6 B;  3NRZ A;  3AEA B;  3BII D;  2WDV B;  1J7A A;  3AM9 A;  2H88 B;  2FBW B;  4N58 A;  3ZYY X;  2DBY A;  1L0V B;  1DOY A;  1A70 A;  2BS3 B;  1TKE A;  2L83 A;  3AN1 A;  3CF4 A;  4YTN B;  1FXI A;  2WS3 B;  2WP9 B;  1QT9 A;  2JX5 A;  2DWQ A;  3HVZ A;  3NVZ A;  5G5H A;  3SFD B;  1QOG A;  2EKI A;  1YQ3 B;  3AEB B;  1FRR A;  1RWS A;  2K22 A;  3HUI A;  1E10 A;  2K5P A;  1XLN A;  3NVV A;  1AWD A;  3W5V B;  1ZUD 2;  2L52 A;  3FC4 A;  3W9C B;  4YTM B;  1B9R A;  4IDI A;  2BS2 B;  1JAL A;  3SR6 A;  4ZHO A;  2W54 A;  1E9M A;  2WLB A;  1KFY B;  1QLB B;  2CJO A;  5H92 C;  3ETR A;  3AE6 B;  1R7S A;  4USA A;  2PVG C;  3AEF B;  1E7P B;  3AE3 B;  1XLP A;  2E3T A;  1QF6 A;  1F0Z A;  1FXA A;  1GAQ B;  4ITK A;  4N6E B;  1FIQ A;  3PO0 A;  2BS4 B;  4JWU C;  1SB3 C;  1NI3 A;  1NVI D;  1PFD A;  1V8C A;  2AX5 A;  1GPX A;  3HRD D;  3CIR B;  1ZOY B;  2W3S A;  3EUB 2;  5GXG B;  3P4S B;  3LXF A;  3RPF C;  1N62 A;  2KAJ A;  3AE9 B;  3VRA B;  1FMA D;  1VJK A;  3NVW A;  1XO3 A;  5G5G A;  1UWM A;  1YQ4 B;  2WU5 B;  3AE7 B;  1NEK B;  1V97 A;  4C7Z A;  4YXD B;  1DOX A;  3AE4 B;  1VLB A;  1QOA A;  3VR8 B;  1VDV A;  2B76 B;  1NYR A;  1N5X A;  4LTU A;  1J7B A;  1ROE A;  4FXC A;  3FAH A;  2WQY B;  3AED B;  3L4P A;  5AUI A;  4ZHP A;  1QOF A;  1RFK A;  1FRD A;  3B2G A;  1JWB D;  4US8 A;  2Y5C A;  3WCQ A;  2Q5W D;  1ZP0 B;  1AYF A;  1WYG A;  2JQR B;  3KWL A;  3AEE B;  4YTP B;  1WGK A;  1FFU A;  1OQR A;  1CZP A;  3AB5 A;  1QOB A;  4A9A A;  2BT6 A;  3B9J A;  1GT8 A;  2HTM E; 
#chains in the Genus database with same CATH topology
 3P4P B;  5FR6 A;  2R2Q A;  4RNA A;  3E56 A;  1SIJ A;  4KIK A;  1H7X A;  1I4H A;  3E9S A;  2RDH A;  2JT4 B;  1D5M C;  3UQA A;  2WWZ A;  3PPA A;  3ZTC A;  1I7H A;  1PGB A;  2Z59 B;  3AH7 A;  3VUW A;  3L10 B;  1LM8 B;  1WRI A;  4EZJ A;  3VDZ A;  1PUT A;  1E90 A;  4RMA A;  1L6U A;  3ZLZ A;  3ZTD A;  2IND C;  4DQO C;  4LCD E;  3ZVV A;  3P4Q B;  3KYD D;  1CJE A;  4AOF A;  1C4A A;  1HZ5 A;  3VR9 B;  2K6Q A;  2GLS A;  4JE3 B;  3ZRC A;  2I1J A;  5TSS A;  1E8W A;  2IO2 B;  3AEA B;  2MBB B;  2INC C;  1J7A A;  3AM9 A;  2H88 B;  2BWE S;  3ZYY X;  1FNU A;  3MP9 A;  4YTN B;  2JZP A;  3HUI A;  2K5P A;  3R3M A;  3MHZ A;  3H9D A;  4DHJ B;  2IDY A;  2M17 A;  1KFY B;  3R7Q A;  2DX5 B;  4DDG D;  4G0N B;  5IO9 A;  2FCM A;  2GI9 A;  3AE9 B;  1R4N B;  2N9L A;  3PLU A;  1C79 A;  3UF8 A;  3VAW A;  1FNW A;  1NYR A;  4ZHP A;  2LGI A;  2Q5W D;  1FD6 A;  2JQR B;  2WXR A;  3V60 A;  3T9L A;  3KVF B;  4W9H A;  1WXA A;  2MCN B;  3TMP B;  2OOB B;  5CX3 A;  4NAW B;  3HM6 X;  2KDI A;  4K1R B;  2O6V D;  3OJ3 A;  1DOI A;  2WXO A;  2VZK D;  2BYF A;  3H6N A;  3H7S A;  1YIW A;  2JF5 A;  1K51 A;  5CHW A;  5FKA C;  5C23 A;  5C3J B;  2N0S B;  1OQQ A;  5IP4 D;  1U4A A;  4WQM A;  4TUU A;  1TZ1 A;  5LXI B;  4AS1 A;  4C80 A;  1UF0 A;  2ZW1 A;  3ABV B;  1WMH A;  4KDL B;  3UGB B;  2W3R A;  3IHP C;  4WIP A;  1GB1 A;  3TUO A;  4X57 B;  4PK1 A;  2ZJD A;  5D3D A;  5JH5 C;  4PT5 A;  3QQ8 B;  5G2N A;  4EOY A;  3W1S A;  1KJT A;  3DCG A;  2J0K A;  3IT4 B;  4IM0 A;  4RF1 A;  1TZO A;  3SD5 A;  1L0V B;  4M01 A;  1ZGU B;  1K53 A;  2EKI A;  3QA8 A;  1YN3 A;  2NTS A;  1CMX B;  1B9R A;  3NY5 A;  2W54 A;  3U30 A;  4ZRJ A;  2K39 A;  3ETR A;  1UGM A;  5HG2 A;  1QF6 A;  1PQS A;  1HZ6 A;  1XXG A;  1L4Z B;  1IPG A;  2DYB A;  1GPX A;  3HRD D;  1WE7 A;  3N32 A;  1WYW B;  5GXG B;  4NAW A;  4AJW A;  3A4R A;  2MBQ A;  1GNU A;  1WY8 A;  2C5L C;  3B1L X;  4GSW A;  2JYT A;  3R66 C;  2LAS A;  4LDT D;  2MA9 B;  4C4V B;  1UH6 A;  3AB5 A;  1GC7 A;  2DZJ A;  1WR6 E;  2KVZ A;  5J17 A;  2HTM E;  5AUK A;  1ZXI A;  3Q8F A;  3FIL B;  3KW5 B;  2KT7 A;  4MJS B;  4LJP B;  4GOC A;  4RCO A;  2BW2 A;  2BQQ A;  4HDQ A;  4A55 A;  3M3J A;  1VZ6 A;  3DHI C;  1IUE A;  1FFV A;  2INN E;  4IM3 A;  2EEL A;  2LGD A;  3AMZ A;  1J8C A;  2X8X X;  3HIZ A;  1WGH A;  4II2 B;  3UI3 A;  1N63 A;  3NZU A;  3DBR I;  1JWS D;  3AEG B;  3RFZ B;  1SE3 A;  2KKC A;  2NBW B;  3DVG X;  1HE8 A;  3PHW B;  4ZDV A;  1GTH A;  3PZ8 A;  3RNF C;  1ESF A;  1SXT A;  2ZPN A;  3T3O A;  1T6B X;  3AN1 A;  1TGZ B;  4WUR A;  3GZN I;  3Q3J A;  4GDK B;  3DBR B;  3IAM 1;  1ZUD 2;  4WJP A;  4I6P A;  1TTN A;  1VCB A;  4ZHO A;  1C4C A;  2WXK A;  2J0J A;  2LHE A;  3H7P B;  4C4V A;  2D5G A;  4WWN A;  2YEP F;  2BPS A;  1KLG D;  1C76 A;  4B0E A;  2V4L A;  1V8C A;  2NVU I;  2LGY A;  3FIL A;  1XF5 L;  3HM3 A;  4IUM B;  4MJS A;  3PRZ A;  3GZN B;  2KX0 A;  1J7B A;  1QOF A;  3VTW A;  1TS4 A;  2KQ7 A;  1PYW D;  1EO6 A;  2B3A A;  2V9H A;  2HTH A;  1P98 A;  1FFU A;  4NQK E;  4XGA B;  5D7G A;  1HQR D;  3VXW A;  4K7U A;  4W9C A;  1FXI A;  1F1H A;  5EE9 A;  1OEY A;  3EGR A;  3Q6B A;  2G1E A;  2OHF A;  2E6X A;  1SEB D;  1YQB A;  3KLS X;  3NVY A;  4J3O D;  2M19 A;  3EC8 A;  3PV1 A;  1JWU D;  3OLM D;  5EE0 A;  1L6V A;  5C2T B;  3BZD B;  2PW9 A;  3H8H A;  1EWC A;  1TKG A;  4F7Z A;  3APC A;  2KDB A;  3LDZ E;  2KMM A;  4MEM A;  4EZL A;  2ZNV C;  1GUA B;  4ZOH C;  1E7U A;  3M63 B;  1JQ4 A;  4JWS C;  3HVD A;  3DPD A;  5BYQ A;  1JW9 D;  2N9X A;  4GDK A;  1T3Q A;  4GIV A;  4EUT A;  3ZNH B;  3QCA A;  3H7P A;  4MDK E;  1QZE A;  3ECI A;  5H8Y E;  2GBR A;  5G55 A;  4C7Y A;  5BO4 B;  2QCZ A;  2RGF A;  2KTR A;  2WXI A;  2WXH A;  3TEW A;  1Q1O A;  1TY2 A;  2L32 A;  2LRU A;  2DHZ A;  1C9F A;  2KZR A;  3DHH C;  3W1Y A;  2LVO A;  5T8I A;  1JAL A;  4OVZ A;  1K8R B;  4RF0 A;  1SE9 A;  5BYR A;  4KZ0 A;  1E7P B;  2GBK A;  4K3C A;  2DAF A;  4DHJ D;  2HJ8 A;  3NJT A;  4W9J A;  2L05 A;  3N3K B;  4A20 A;  4AJY B;  3WAO A;  2ONQ A;  3IAS 1;  1MFW A;  4MM3 B;  1RLF A;  3GS2 A;  3ML8 A;  2V1Y A;  2Y3A A;  4MSM B;  3RD2 A;  4FXC A;  2D11 A;  1ACC A;  2LI5 A;  2EMT A;  5AEK B;  3B2G A;  2MRP A;  2WXP A;  1XT9 B;  4JIO U;  1GT8 A;  2J52 A;  4BKS A;  3PLV A;  1TIF A;  4G3X B;  4EE2 A;  3MC9 A;  1SSN A;  4XDC A;  2K8B A;  3KYC D;  2KD0 A;  1EF5 A;  1YX5 B;  3GB1 A;  3N9Y C;  4FA6 A;  4B6W A;  3QK0 A;  3JW0 X;  3KWV A;  4XWW A;  1JWA D;  2LJ5 A;  4IWP A;  3IBE A;  3P63 A;  1OGW A;  4HPM B;  1MPE A;  2LUM A;  2VRR B;  4YSZ B;  3NS8 A;  2XN9 C;  1RFA A;  1C3T A;  3DVN V;  4BOS C;  1E0Z A;  2G9H D;  2AQ1 B;  4II3 B;  1XLO A;  4UDU C;  3RI7 C;  2JYE A;  2LUE A;  3ONS A;  2SEB D;  2L0F A;  1E8Z A;  2K8C A;  3RZW C;  1H8C A;  5CHF A;  2N7D A;  3N1Z C;  2WDT B;  3OJ4 B;  3DBH B;  4ANV A;  2BTE A;  5I4D A;  3RUI B;  1HXY D;  3NVZ A;  4MM3 A;  2KNB A;  2WXN A;  1F9J A;  1WE6 A;  3UIN B;  4PYZ A;  4A3O A;  2YEP B;  4OZC A;  1ZDV A;  3L16 A;  4WJN A;  4IOI E;  2C60 A;  3I57 A;  4GDL B;  2Z8L A;  1ZDX A;  2KN4 A;  2O2V B;  4N6E B;  1V5O A;  2N4F A;  2IGG A;  4LNN A;  2K0P A;  3CIR B;  2KAN A;  1L0X B;  3RPF C;  2PTL A;  2LRW A;  4XE0 A;  1VR9 A;  1ZPS A;  3U4E G;  2WXM A;  1G6J A;  1N6Z A;  1VLB A;  2D2Q A;  3Q3F A;  1B1Z A;  2ZVO A;  3L4P A;  2DLB A;  5FK9 C;  2M8S A;  3RYT A;  4HXD A;  4P1C C;  3AU4 A;  3BWU D;  2ASQ A;  1OQR A;  3VH3 B;  1AAR A;  4FHK A;  4HPL B;  3AE1 B;  4FUL A;  1WF9 A;  4RGM A;  1I42 A;  3KUZ A;  2MLB A;  3TEZ A;  4JGH B;  5KHO A;  1YNT E;  1N5W A;  5EDS A;  1T0Y A;  2GRI A;  3BK1 A;  3APF A;  2XBB C;  2V3N A;  3KH0 A;  1TYG B;  1UBQ A;  1YJI A;  1LO5 D;  3A33 B;  3LYY A;  4KSL C;  2MH7 A;  2LMC A;  4BAX A;  4GB9 A;  2WDR B;  1BUI C;  3NRZ A;  4GDL A;  4BKT A;  2O2V A;  3BII D;  3WAP A;  4NQL B;  1P0R A;  4S17 A;  1TS5 A;  4JQW C;  2L83 A;  5IAA C;  5G5H A;  2K22 A;  4RH6 A;  1XLN A;  3MC0 B;  2KWU B;  1V1P B;  4XDD A;  3FC4 A;  5IKC M;  3M95 A;  2Y5B B;  1ZKH A;  2N1W A;  2AWT A;  5BMI A;  5H92 C;  4KZC A;  2IPK D;  2QIL A;  3APD A;  2RR9 A;  3VFK A;  3PO0 A;  1IBX A;  4BVU C;  3JSV B;  4HLE A;  2NBU A;  1R4N I;  1N62 A;  1FMA D;  2FUG 1;  2UWQ A;  1WMH B;  4LJO B;  2PMV A;  3NUH B;  1CQV A;  1WJ4 A;  5JZE B;  4LTU A;  2L76 A;  1FRD A;  1WRD B;  1XQQ A;  4EEW A;  3KWL A;  3Q69 A;  4RM8 A;  3WAM A;  3N1X C;  3VUX A;  2Z0E B;  3VH4 B;  1N60 A;  4TQ1 A;  2QIE B;  1DYQ A;  2MBE A;  3PT2 B;  1PGA A;  3PS6 A;  5EE3 A;  1JML A;  3H1U A;  4LNO A;  4K7S A;  3CWI A;  2ACZ B;  1YJJ A;  1FO4 A;  2WDQ B;  2CJN A;  2TSS A;  3P4R B;  3DHG C;  1EUV B;  1H4R A;  5LXH A;  2OJW A;  2QEJ C;  2H89 B;  2ZW0 A;  4BKG A;  1D6E C;  1UGJ A;  2JXX A;  1PDX A;  3HK0 A;  5L83 A;  2JPH A;  3NOB A;  1V1P A;  1JRO A;  2RPV A;  2GBM A;  4BKS D;  5DCN A;  1V2Y A;  3KUC B;  2BYE A;  5E6N A;  3Q3N C;  4JLC A;  3R2I A;  2HD5 B;  5AZG A;  3JSV A;  3CF6 E;  1A5R A;  2WS3 B;  3ZJT A;  4KKI A;  1FRR A;  1KM7 A;  1WGG A;  3V3X A;  1AWD A;  1WGD A;  2MSE D;  1I35 A;  2KC1 A;  3SR6 A;  1WX8 A;  2D3C A;  2J0M A;  3AE6 B;  1IGC A;  3M62 B;  1XLP A;  2GMI C;  3RNC C;  4DXG A;  1GAQ B;  1JCK B;  3ZKJ C;  2K3U A;  1WX7 A;  1FPY A;  4EFO A;  1J19 A;  2WU5 B;  3QIJ A;  3GP7 A;  4LNK A;  5AUI A;  3FAH A;  2J53 A;  3A9K B;  2N9K A;  3L54 A;  1JWB D;  2A4Z A;  4W9D A;  2XK5 B;  2WXQ A;  4A9A A;  1YMH E;  3PRE A;  4QAY A;  2KX3 A;  2XNA C;  5JXV A;  1C77 A;  3N1Y C;  3DWM A;  2ZPY A;  4BBN F;  2G3Q B;  4DHZ E;  1WI0 A;  3RNB C;  3B0A A;  2PKO A;  3EA6 A;  2N7E A;  3BYT B;  4KGS A;  2DZK A;  2K1F A;  3RNE C;  2ZCC A;  3K9O B;  2N7J A;  1GJZ A;  2XEW A;  1L7Y A;  4MH0 E;  4E3C A;  5JHB A;  1OFF A;  1PGX A;  1KLU D;  1E8Y A;  4XZ4 A;  1RM6 C;  4WWM A;  4Q2J A;  2MW5 A;  2G45 B;  3ZIM A;  3IVF A;  3SU8 X;  4M8N A;  4ZYS A;  1NEN B;  3SFE B;  4ACF A;  3ML9 A;  2K25 A;  1IYF A;  3CMM B;  4HCP B;  2HJ1 A;  4BBN C;  3Q2A C;  2DZM A;  1Y56 A;  1ET6 A;  2FCQ A;  2QMT A;  1WJ6 A;  3HVZ A;  1RWS A;  2D3A A;  1F77 A;  1MJD A;  2RD0 A;  1NDD A;  3A9K A;  2JRI B;  4HKZ E;  2XK5 A;  5KHQ A;  4ITK A;  2M4N A;  2MX2 A;  3U8Z A;  1PFD A;  1YOV B;  2EKE C;  4A8X C;  1T0R C;  2MQJ A;  3P4S B;  4OZB A;  3AE7 B;  4IM2 A;  4C7Z A;  1SGH A;  3AE4 B;  3W5V B;  2L7R A;  4LNF A;  4N9F 4;  3TL5 A;  3GE3 C;  3Q3O C;  1WJU A;  5IN7 A;  2JWU A;  4HWI B;  1YJ1 A;  4L1B A;  1KRH A;  2KTR B;  1H7W A;  1OQY A;  3VRB B;  2G4S A;  2CU1 A;  1SE4 A;  2KC2 A;  3I9V 1;  2ZZP B;  2LFI A;  3ZJV A;  2FE8 A;  2UYZ B;  3X23 A;  4YL8 A;  3AE2 B;  3PRP B;  2IO0 B;  1ISN A;  1DGJ A;  2MBO A;  1LGR A;  1UUP A;  3I63 C;  1LQB A;  3W5U B;  4HK2 A;  3AE8 B;  3PGE A;  1BXT A;  2V0G A;  4DXA B;  3DBL I;  4HRS A;  4ARI A;  1NYQ A;  1QQR A;  4NNJ B;  2KDF B;  4WWO A;  1WIA A;  3DQV A;  2MJE A;  3QWZ B;  3IFW B;  4K81 A;  1WZ0 A;  4PS7 A;  4XX5 A;  3Q14 C;  3TJP A;  1D3Z A;  1C4P A;  4W9E A;  3AV8 A;  1RYJ A;  1UEL A;  1VRA B;  2I1K A;  3O13 A;  3MHS D;  1DOY A;  1TS2 A;  1A70 A;  2BS3 B;  4ANU A;  5DPS A;  3DBL B;  2KHW B;  3BYY B;  2MP2 B;  1YX6 B;  2LVP A;  1E10 A;  2W9N A;  4NY0 A;  3W9C B;  4IDI A;  3VUY A;  2BS2 B;  1TBE A;  2DYO A;  3IG3 A;  2WLB A;  1P7E A;  4O1N A;  5CHV C;  3ZGZ A;  2WXF A;  2E3T A;  3DBS A;  1WR1 A;  4LK0 M;  1NVI D;  4URK A;  3CSF A;  4AUQ C;  2KQ4 X;  2WNM A;  3T8M A;  1DOX A;  4LNI A;  4GLS C;  3OAW A;  3ZDT A;  2BF8 B;  2IO3 B;  2N1V A;  5L95 C;  4W9I A;  4YTP B;  1P3Q U;  4YWG G;  3A4S C;  2KXJ A;  1SBB B;  2WX1 A;  1OEY J;  1TKY A;  1EU3 A;  1E6E B;  2GB1 A;  1WGR A;  2PPH A;  3CST A;  2JZZ A;  4OZA A;  1R4M I;  2BGF A;  1V81 A;  5J2R A;  5GMV A;  1XLQ A;  4AP4 C;  4NZL B;  4ZRQ A;  1Z2M A;  2L0T A;  3BIN A;  1WXV A;  2PLP A;  2LEK A;  3QC8 B;  1WM3 A;  2MP2 A;  2GBJ A;  4RM9 A;  1WH3 A;  2IBI B;  2JY6 A;  1GC6 A;  2JZ3 B;  1TJE A;  3RN9 C;  1I4X A;  1R4M B;  1NBF C;  3RCZ A;  2EMS A;  2KWV B;  5HHD G;  3DBH I;  4HJG E;  1TKE A;  3MTN B;  3NHE B;  2JX5 A;  3SFD B;  1MG4 A;  1WM2 A;  4DDI D;  4YTM B;  3PZD A;  2D3G A;  1WSP A;  2KN5 A;  2KMA A;  1ZW7 A;  4J6I A;  2FIF A;  1IGD A;  3BVM A;  3W1S C;  2R2O A;  4JWU C;  4KGR A;  2AEH A;  3MFG A;  1HTQ A;  1GOZ A;  2L00 B;  1V1O A;  1L0Y B;  1QOA A;  4ARC A;  3VR8 B;  1VDV A;  4MEL A;  4RGT A;  1XCT L;  1OTR B;  3ENE A;  2Y5C A;  2IGD A;  4PS8 A;  4HDO A;  4B95 A;  2KJH B;  2QC8 A;  5HKH A;  1S3S G;  2KOX A;  1EF1 A;  1K50 A;  4XYC A;  1FNV A;  4DXF A;  2GBN A;  4W9K A;  4FBJ B;  2D10 A;  2WXL A;  4MGI E;  3MJ5 A;  3PSE B;  1GTE A;  2BB6 A;  2WGS A;  4MAC A;  1KH0 A;  4NJ7 A;  1IBX B;  4EKU A;  5D6J B;  4HVB A;  1WFY A;  1P1A A;  2DAJ A;  1WZ3 A;  4CO7 A;  3B2F A;  3BK2 A;  2MJ3 A;  3QJZ A;  2VH2 A;  4FJZ A;  3GOE A;  4CHK A;  2MHJ A;  1LXD A;  4G11 A;  3IT6 B;  3ZXV A;  1UWX A;  1WXQ A;  1MI0 A;  2JRH A;  1YD8 U;  3D32 A;  2M1M A;  3CF4 A;  2NPT A;  1MHH E;  2Y5P A;  1QT9 A;  2RDB C;  4IWO A;  1P7F A;  2WHI A;  5DPW A;  4PS3 A;  2KMC A;  1STE A;  4P1B C;  1XEE A;  2RSU A;  4OVU A;  1NI3 A;  3LXF A;  3ZNI D;  4DK5 A;  3NVW A;  5CTR C;  2QHO A;  4D2K A;  1NEK B;  3AI5 A;  3Q8E A;  2DYM A;  2B76 B;  1E8X A;  2HDE A;  4FJY A;  3OWE B;  3MJW A;  1RFK A;  2MWS B;  4XC2 A;  1WYG A;  2DNF A;  1WGK A;  1J0G A;  3QAQ A;  3QX1 A;  4IWQ A;  4KSK C;  4BZA A;  1D5X C;  1I4R A;  3ZXR A;  4MGK E;  3VTV A;  4F8C B;  3RUL A;  1JWM D;  2BYT A;  2FAZ A;  1GG3 A;  2FCS A;  4ASW C;  2JSV X;  4JX1 C;  4IC7 B;  1M4V A;  4JPS A;  2M0X A;  2RDG A;  3DOW A;  5MPO A;  3IXS A;  2BVC A;  4ZRI A;  4N59 A;  3EFU A;  2UU7 A;  3ZRF A;  1Q0W B;  1MG8 A;  3C19 A;  4ZRK A;  4WAF A;  4GMV A;  1FCL A;  1YN5 A;  2M56 B;  2OJR A;  2K9X A;  3PRM B;  4US9 A;  4IW0 A;  2CS4 A;  3C8Y A;  2INP E;  3O65 B;  4B0M A;  3NG0 A;  2KDM A;  3TEX A;  4KDI C;  4FN2 A;  3RZF A;  2WDV B;  2AYO B;  2IYD B;  1WXM A;  4C56 C;  1S1Q B;  4A90 A;  3A1Q B;  1YQ3 B;  3P2B A;  2NBV B;  2ZVN A;  2SAK A;  2V3P A;  2FCN A;  3TCA A;  5D94 A;  5LNK 1;  4HCN B;  2KFK B;  4M02 A;  2PVG C;  1V49 A;  1D4B A;  2KQS A;  1UBI A;  3OG5 A;  4R3D A;  2WX0 A;  1SB3 C;  4NJ6 A;  2ON8 A;  1ZE3 D;  5IA7 A;  1GB4 A;  2W3S A;  5HI1 A;  2BYV E;  1VJK A;  2IY0 B;  3KQ4 A;  1YQ4 B;  4YXD B;  1TT5 B;  4A6Q A;  4MGZ E;  2BWF A;  1WGY A;  1N5X A;  2NTT A;  4WH4 A;  2IJ0 A;  3TEY A;  3I3T B;  3SDL C;  3WCQ A;  3JYU A;  1ZP0 B;  1RAX A;  3AEE B;  4KKJ A;  2RMM A;  5E6J A;  4W9F A;  1QOB A;  4S0R A;  2BT6 A;  1WJN A;  2CHZ A;  4DBG A;  3GE8 C;  4WJO A;  3L13 A;  3DDC B;  2BKF A;  4NPN A;  1HEZ E;  3WA0 A;  3UIP B;  2KWC A;  1N61 A;  1ZXH A;  3V62 A;  3RMK C;  2WU2 B;  2KDE B;  2LXC A;  3U52 E;  2W82 A;  3TSS A;  1F52 A;  1JRP A;  4FHJ A;  3VVW B;  2ZCB A;  1EU4 A;  4HRO A;  2PVO D;  1Z5S B;  3ZO5 B;  1V5T A;  3ALB A;  3LJ3 A;  1WWT A;  4I6L B;  2C7H A;  3FKY A;  3A1Q A;  4C00 A;  1FCC C;  2X38 A;  4YSY B;  4NAM A;  1E5W A;  3V05 A;  4L2Y A;  4OHJ A;  2LHD A;  1C1Y B;  3UQB A;  3NZS A;  2HE7 A;  4ANW A;  4RGO S;  1V9J A;  1L5P A;  2MJD A;  1LFD A;  2LGS A;  2KFK A;  3BVG A;  4YT0 B;  2NR2 A;  2R61 A;  1KF6 B;  4WJQ A;  1IP9 A;  2QDF A;  3R2T A;  1AN8 A;  3RT3 B;  3QHT A;  1UZX B;  1BT0 A;  1T0Q C;  2MBH A;  4P7I A;  4KGT A;  4E74 A;  3L08 A;  3SEB A;  4GU2 A;  2JWZ A;  3Q8B A;  1P9D U;  2K8H A;  1FXT B;  2KJR A;  3KUD B;  4TMA B;  3WAN A;  1QLB B;  1R7S A;  3EEC A;  2DZI A;  4PYU A;  4LLG M;  3AEF B;  2N9E B;  2A5U A;  2C7N B;  1FIQ A;  4KVG B;  2D07 B;  5AZH A;  3WIM A;  2AX5 A;  4E71 A;  1ZOY B;  3ZNG C;  3ZDM C;  2CHX A;  3RNG C;  4GGQ A;  2K6D B;  3JVZ X;  2CKH B;  3V6C B;  1V6E A;  2OED A;  4TSS A;  1I4Q A;  1WX9 A;  4AQ7 A;  3AU5 A;  2LGX A;  2FNJ B;  3R8B A;  2KVR A;  2G4D B;  1V86 A;  2PE9 A;  3A9J B;  4HEA 1;  1UNS A;  4MGY E;  5D2M B;  2LD9 A;  1SIF A;  2J42 A;  2NMQ A;  3VQI A;  2DEN B;  1EWY C;  2FUH B;  4AWJ A;  3EFC A;  2CR5 A;  2NCN A;  4F1S A;  1BML C;  3Q3M C;  2KAC A;  2WXG A;  1SJH D;  5IOI A;  3X0W A;  1JRU A;  3L17 A;  4ANX A;  4MSQ B;  2QJL A;  3P1M A;  1QKZ A;  1EM7 A;  2CHW A;  4DHZ B;  5C1Z A;  2L8J A;  2AQ3 B;  1X1M A;  2ICI A;  5DPR A;  2PIA A;  3LB8 C;  4TQ0 A;  2KTF A;  4I6N B;  4ZYN A;  1Y8R C;  2ZEQ A;  1HTO A;  2DBY A;  2IY1 B;  4L23 A;  4HPP A;  3N20 C;  4M00 A;  1M94 A;  4OVV A;  3NVV A;  5BMG A;  2L52 A;  3ZW3 A;  2JVC A;  4K3B A;  4NJC A;  2AL6 A;  4USA A;  1NI2 A;  1MHX A;  3A9J A;  2I2Y A;  4FLH A;  3K9P B;  2J4X A;  4HJK A;  2AL3 A;  3B08 A;  3S2A A;  1UD7 A;  3VRA B;  1XO3 A;  4K7W A;  3J9C A;  4P16 A;  3URY A;  2D3B A;  4M0W B;  2LXA A;  3Q8C A;  1YN4 A;  1QIL A;  2BKR B;  1T5X D;  3B9J A;  2C7M B;  2O6V B;  3I5J C;  2YLM A;  4DWF A;  2VZK B;  3WAL A;  2Z0D B;  1XD3 B;  2KLG A;  3AE5 B;  3QAR A;  4G50 A;  5DPT A;  3UIO B;  1SF0 A;  1T0S C;  3DVG Y;  3MC8 A;  5J18 A;  2FID A;  5BMH A;  1FM0 D;  5D3I B;  5TR5 A;  4HKQ A;  5EE1 A;  3DVN U;  3P42 A;  3VHT C;  3NS1 A;  5E6O A;  1SJE D;  1I4P A;  4BOZ B;  4KX6 B;  3U7D A;  1L4D B;  4IKG A;  2KK8 A;  3DWG C;  3W2D A;  2PJH A;  3BY4 B;  1TY0 A;  4WQO B;  4FJV B;  3HHM A;  1I4G A;  4N58 A;  3AUL A;  3PVL A;  3L0W B;  4IG7 B;  2PE6 B;  1QOG A;  4W9G A;  2V3S A;  4M0W A;  3TBL D;  4RGN A;  5E6P A;  1AW7 A;  3EHV A;  1ET9 A;  4ICU A;  4WWP A;  3PTF C;  1E9M A;  2CJO A;  1MVK A;  1E7V A;  3C0R B;  4W9L A;  1F2R C;  1K52 A;  1FXA A;  4A3P A;  2O6V A;  2BS4 B;  1KLV A;  1XCQ L;  2KFJ A;  3EUB 2;  3N30 A;  4CYE A;  2KAJ A;  2GOW A;  4MT5 A;  2N9P C;  2NS5 A;  1V97 A;  2KWD A;  4ICV A;  1V80 A;  4LDT B;  1VD2 A;  2LZ6 A;  1SE2 A;  3U2S C;  2C9W B;  2WQY B;  3AED B;  4WAA A;  2I38 A;  4EZK A;  4GXB A;  4CQN A;  1L2N A;  1CZP A;  2REX A;  2V4I B;  3V61 A;  3RNA C;  2L1A A;  4P6V F;  2M0A A;  4KV2 A;  2NPT B;  3V6E B;  2VH1 A;  2KO3 A;  1KOT A;  3AEC B;  1RRB A;  5BYS A;  1Q10 A;  4TV3 A;  1D5Z C;  2CU3 A;  4BFR A;  2WXJ A;  4YSX B;  1HA5 A;  3ZJU A;  2RPQ A;  2W55 A;  3SHQ A;  2WYQ A;  4KIK B;  5LLI A;  3T3N A;  2JU6 X;  1J7C A;  2MEK A;  1ENF A;  2IZV B;  2BBC A;  4XWT A;  2QSD A;  4OW0 A;  2KYW A;  3VTU A;  1Q5W B;  5FR3 A;  1CK1 A;  4MH8 A;  2ZNV B;  4H2A A;  2FBW B;  2KJ6 A;  4FAD A;  2LVQ A;  4REZ A;  2WP9 B;  2YVC A;  2DWQ A;  3AEB B;  2IO1 B;  4ZRP A;  2BB5 A;  4M8M A;  4JL9 A;  4B9K A;  2JUO A;  3Q8A A;  1WXS A;  1C78 A;  3ZUN A;  2J7Q B;  3U7Z A;  2PEA A;  3AE3 B;  1F0Z A;  2IGH A;  1KTK A;  3R7R A;  4GN1 A;  3ZQ4 A;  3PZ7 A;  5G5G A;  4RFB A;  1UWM A;  4TKN A;  3BVZ A;  1VZ8 A;  2LJI A;  5HFY A;  3TIX A;  1ROE A;  3AXC A;  5JHA A;  2AQ2 B;  2L3Z A;  1VZ7 A;  2JXT A;  3PHX B;  4US8 A;  1FEH A;  2KLC A;  3NZ3 A;  1AYF A;  1F2R I;  3ZNZ B;  1TS3 A;  2LWP A;  5AZF A; 
#chains in the Genus database with same CATH homology
 1KRH A;  3P4P B;  2J52 A;  4RNA A;  1H7W A;  3E56 A;  1SIJ A;  3VRB B;  1SE4 A;  1H7X A;  1HEZ E;  1I4H A;  3I9V 1;  4EE2 A;  2LFI A;  3E9S A;  3ZJV A;  2RDH A;  1SSN A;  2FE8 A;  1N61 A;  1ZXH A;  4XDC A;  1D5M C;  2WU2 B;  3AE2 B;  3U52 E;  1DGJ A;  2W82 A;  3TSS A;  1JRP A;  1UUP A;  1I7H A;  1PGB A;  3AH7 A;  3GB1 A;  3N9Y C;  3W5U B;  1EU4 A;  1WRI A;  3AE8 B;  1BXT A;  2V0G A;  1PUT A;  4HRO A;  1L6U A;  3KWV A;  4XWW A;  2PVO D;  1JWA D;  4HRS A;  4ARI A;  1NYQ A;  1WWT A;  4DQO C;  3P63 A;  1QQR A;  1MPE A;  1FCC C;  2LUM A;  4YSY B;  2X38 A;  4NAM A;  3P4Q B;  4YSZ B;  1CJE A;  2XN9 C;  2MJE A;  4L2Y A;  4OHJ A;  3V05 A;  2LHD A;  1C4A A;  1HZ5 A;  1E0Z A;  3VR9 B;  2G9H D;  4RGO S;  1L5P A;  2AQ1 B;  2MJD A;  1XLO A;  4JE3 B;  4UDU C;  2JYE A;  1C4P A;  3BVG A;  5TSS A;  2SEB D;  4YT0 B;  3AV8 A;  1RYJ A;  2R61 A;  1KF6 B;  3AEA B;  1VRA B;  1J7A A;  3AM9 A;  2H88 B;  3O13 A;  3R2T A;  2BTE A;  1AN8 A;  1FNU A;  3ZYY X;  5I4D A;  1DOY A;  1TS2 A;  1A70 A;  2BS3 B;  3MP9 A;  4YTN B;  1HXY D;  2JZP A;  3NVZ A;  3BYY B;  4KGT A;  1E10 A;  2WXN A;  3HUI A;  3SEB A;  2K5P A;  3MHZ A;  3Q8B A;  3W9C B;  4IDI A;  2BS2 B;  2DYO A;  2YEP B;  2IDY A;  2WLB A;  1P7E A;  4TMA B;  1KFY B;  1QLB B;  4OZC A;  1ZDV A;  4O1N A;  1R7S A;  3ZGZ A;  2WXF A;  4IOI E;  3AEF B;  4LLG M;  2E3T A;  3I57 A;  4GDL B;  2Z8L A;  1ZDX A;  1FIQ A;  2KN4 A;  4N6E B;  2IGG A;  4LK0 M;  1NVI D;  2AX5 A;  2K0P A;  3CIR B;  1ZOY B;  2GI9 A;  1L0X B;  3RPF C;  3AE9 B;  2PTL A;  2KQ4 X;  2N9L A;  4XE0 A;  2WNM A;  1VR9 A;  1ZPS A;  3U4E G;  2WXM A;  1DOX A;  1C79 A;  4GLS C;  1VLB A;  1FNW A;  1B1Z A;  1NYR A;  2OED A;  4ZHP A;  3L4P A;  2DLB A;  2LGI A;  4TSS A;  5FK9 C;  1I4Q A;  4AQ7 A;  2Q5W D;  1FD6 A;  2JQR B;  2WXR A;  3BWU D;  4YTP B;  3R8B A;  1OQR A;  4YWG G;  4HEA 1;  1UNS A;  1SBB B;  2J42 A;  1TKY A;  1EU3 A;  2NMQ A;  3AE1 B;  1E6E B;  2GB1 A;  3VQI A;  1EWY C;  4RGM A;  4NAW B;  1BML C;  1DOI A;  2WXO A;  3TEZ A;  2VZK D;  4OZA A;  2KAC A;  1K51 A;  1YNT E;  5FKA C;  1N5W A;  1XLQ A;  5C3J B;  1SJH D;  2WXG A;  2N0S B;  1OQQ A;  2GRI A;  4NZL B;  4WQM A;  4ZRQ A;  3BK1 A;  2PLP A;  2LEK A;  4AS1 A;  4C80 A;  2V3N A;  2ZW1 A;  3ABV B;  1TYG B;  2W3R A;  1YJI A;  2QJL A;  3P1M A;  4WIP A;  1GB1 A;  1QKZ A;  1LO5 D;  1EM7 A;  3TUO A;  3LYY A;  2AQ3 B;  2ICI A;  2LMC A;  2MH7 A;  2PIA A;  5D3D A;  1TJE A;  4PT5 A;  1I4X A;  3LB8 C;  3W1S A;  2WDR B;  4TQ0 A;  1BUI C;  3NRZ A;  3IT4 B;  3BII D;  5HHD G;  4RF1 A;  1TZO A;  2DBY A;  1L0V B;  4HJG E;  1TS5 A;  1TKE A;  2L83 A;  4L23 A;  2JX5 A;  1K53 A;  5G5H A;  3SFD B;  2EKI A;  2K22 A;  4RH6 A;  1XLN A;  1YN3 A;  3NVV A;  3MC0 B;  5BMG A;  1V1P B;  4XDD A;  2L52 A;  2NTS A;  3FC4 A;  4YTM B;  1B9R A;  4NJC A;  2W54 A;  5BMI A;  1WSP A;  5H92 C;  3ETR A;  2IPK D;  2QIL A;  4USA A;  5HG2 A;  1MHX A;  2I2Y A;  1QF6 A;  1IGD A;  3BVM A;  1HZ6 A;  3PO0 A;  1XXG A;  1L4Z B;  1IBX A;  2J4X A;  4JWU C;  4KGR A;  1GPX A;  3MFG A;  3HRD D;  1GOZ A;  5GXG B;  1N62 A;  1V1O A;  3VRA B;  1FMA D;  2FUG 1;  1XO3 A;  2PMV A;  3J9C A;  1L0Y B;  3NUH B;  4P16 A;  3URY A;  1QOA A;  1CQV A;  4ARC A;  3VR8 B;  1VDV A;  4LTU A;  4RGT A;  3Q8C A;  1FRD A;  1XCT L;  1YN4 A;  2JYT A;  2Y5C A;  2IGD A;  3KWL A;  3Q69 A;  3AB5 A;  1QIL A;  1T5X D;  3B9J A;  2HTM E;  5AUK A;  1ZXI A;  3Q8F A;  2VZK B;  1N60 A;  4TQ1 A;  2QIE B;  3FIL B;  1DYQ A;  1PGA A;  3AE5 B;  5EE3 A;  1SF0 A;  1JML A;  1K50 A;  1FNV A;  4DXF A;  4RCO A;  2BW2 A;  4A55 A;  5BMH A;  1FM0 D;  1VZ6 A;  3CWI A;  2ACZ B;  1YJJ A;  5D3I B;  1IUE A;  1FO4 A;  1FFV A;  4HKQ A;  2INN E;  2WDQ B;  2CJN A;  2EEL A;  2WXL A;  5EE1 A;  3MJ5 A;  2TSS A;  3P4R B;  1GTE A;  2BB6 A;  3AMZ A;  3P42 A;  4MAC A;  2QEJ C;  1KH0 A;  1IBX B;  2H89 B;  2ZW0 A;  1D6E C;  1UGJ A;  1PDX A;  3UI3 A;  1N63 A;  1JWS D;  3NS1 A;  3AEG B;  1SJE D;  3RFZ B;  1SE3 A;  1V1P A;  1I4P A;  4KX6 B;  3B2F A;  1JRO A;  3BK2 A;  2RPV A;  1L4D B;  2MJ3 A;  4IKG A;  3DWG C;  3W2D A;  1GTH A;  3IT6 B;  3PZ8 A;  1UWX A;  1TY0 A;  1WXQ A;  3R2I A;  1ESF A;  1SXT A;  1MI0 A;  1I4G A;  4N58 A;  3T3O A;  1T6B X;  3AN1 A;  3CF4 A;  1MHH E;  2Y5P A;  2WS3 B;  1QT9 A;  3ZJT A;  4WUR A;  1QOG A;  4KKI A;  1FRR A;  4GDK B;  4M0W A;  3V3X A;  1P7F A;  1AWD A;  3IAM 1;  1ZUD 2;  4RGN A;  1AW7 A;  1ET9 A;  3SR6 A;  4ZHO A;  1C4C A;  1E9M A;  2WXK A;  2CJO A;  2LHE A;  1MVK A;  3AE6 B;  1IGC A;  1STE A;  2D5G A;  1XLP A;  4DXG A;  1F2R C;  1K52 A;  1FXA A;  1GAQ B;  1JCK B;  1XEE A;  2YEP F;  1KLG D;  2K3U A;  2BS4 B;  1C76 A;  4B0E A;  1NI3 A;  1XCQ L;  1V8C A;  3EUB 2;  3FIL A;  3LXF A;  2KAJ A;  3NVW A;  1XF5 L;  4MT5 A;  4D2K A;  2WU5 B;  1NEK B;  1V97 A;  2KWD A;  3Q8E A;  1SE2 A;  3U2S C;  2DYM A;  2B76 B;  3GP7 A;  2HDE A;  1J7B A;  5AUI A;  3FAH A;  2WQY B;  3AED B;  3OWE B;  1QOF A;  1RFK A;  2I38 A;  2J53 A;  2N9K A;  1JWB D;  1TS4 A;  1PYW D;  1WYG A;  4CQN A;  1WGK A;  1FFU A;  1CZP A;  5D7G A;  1HQR D;  4A9A A;  2WXQ A;  1FXI A;  1YMH E;  2V4I B;  2L1A A;  2XNA C;  5EE9 A;  1D5X C;  3EGR A;  1I4R A;  4P6V F;  2G1E A;  1C77 A;  5JXV A;  2OHF A;  2E6X A;  1SEB D;  2M0A A;  3DWM A;  3KLS X;  3NVY A;  1JWM D;  4J3O D;  2BYT A;  2M19 A;  1JWU D;  2JSV X;  4JX1 C;  5EE0 A;  1M4V A;  1L6V A;  5C2T B;  2PKO A;  3BZD B;  3EA6 A;  4JPS A;  3AEC B;  2PW9 A;  2RDG A;  3BYT B;  3H8H A;  1EWC A;  1TKG A;  4KGS A;  5MPO A;  3IXS A;  5BYS A;  1Q10 A;  2N7J A;  4N59 A;  1D5Z C;  2CU3 A;  2KMM A;  2WXJ A;  4YSX B;  4WAF A;  1FCL A;  1YN5 A;  1HA5 A;  3ZJU A;  4ZOH C;  2W55 A;  1JQ4 A;  2M56 B;  4JWS C;  1OFF A;  1PGX A;  3HVD A;  5BYQ A;  1JW9 D;  2K9X A;  1KLU D;  1T3Q A;  4US9 A;  3T3N A;  2JU6 X;  1J7C A;  2MEK A;  1RM6 C;  1ENF A;  3C8Y A;  4WWM A;  2BBC A;  4Q2J A;  2INP E;  4XWT A;  4B0M A;  2QSD A;  4OW0 A;  4ZYS A;  1NEN B;  3SFE B;  2KDM A;  5H8Y E;  3TEX A;  4C7Y A;  5FR3 A;  1CK1 A;  2WDV B;  4MH8 A;  4H2A A;  2WXI A;  2FBW B;  2WXH A;  3TEW A;  1Y56 A;  1ET6 A;  4C56 C;  2QMT A;  4REZ A;  4A90 A;  1TY2 A;  2L32 A;  2WP9 B;  2DWQ A;  3HVZ A;  1YQ3 B;  3AEB B;  1RWS A;  1C9F A;  4ZRP A;  2BB5 A;  2SAK A;  1F77 A;  2V3P A;  5T8I A;  1JAL A;  3Q8A A;  4OVZ A;  1C78 A;  4RF0 A;  5LNK 1;  3U7Z A;  4HKZ E;  5BYR A;  2PVG C;  1E7P B;  3AE3 B;  1D4B A;  1F0Z A;  2IGH A;  4ITK A;  1KTK A;  4R3D A;  1GB4 A;  1SB3 C;  2ON8 A;  1ZE3 D;  1PFD A;  2W3S A;  4A8X C;  3ZQ4 A;  5HI1 A;  3P4S B;  1VJK A;  2ONQ A;  4OZB A;  3PZ7 A;  3IAS 1;  4MM3 B;  5G5G A;  4RFB A;  1UWM A;  3GS2 A;  3KQ4 A;  1YQ4 B;  3AE7 B;  4C7Z A;  4YXD B;  3BVZ A;  3AE4 B;  4A6Q A;  1VZ8 A;  2Y3A A;  2LJI A;  5HFY A;  3W5V B;  1N5X A;  1ROE A;  4FXC A;  2NTT A;  4WH4 A;  2IJ0 A;  1ACC A;  2AQ2 B;  3TEY A;  1VZ7 A;  2JXT A;  3B2G A;  4US8 A;  1FEH A;  3WCQ A;  3NZ3 A;  1ZP0 B;  1AYF A;  1F2R I;  3AEE B;  4KKJ A;  2RMM A;  5E6J A;  2WXP A;  1QOB A;  1TS3 A;  2JWU A;  2BT6 A;  1GT8 A;  4L1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...