3AE9B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae9B01
2DWQA 1RYJA 2K22A 4ZHPA 2AX5A 1PDXA 3FC4A 3SFEB 1QLBB 5C3JB 4WQMA 3P1MA 2MJEA 1JWBD 3AE5B 3P4RB 4YSYB 1A70A 2M19A 3AEEB 1FXIA 3PO0A 1FM0D 3ETRA 4HRSA 3ABVB 2Q5WD 3LB8C 2WDQB 2L52A 1DOXA 5G5GA 1XLPA 4USAA 1JWAD 3AEFB 1VJKA 2CJNA 3CWIA 3AECB 4YTNB 1ZOYB 1XLNA 1QT9A 1V97A 2QIEB 1J7BA 1TKGA 2CU3A 3NRZA 3NVZA 4N58A 1J7AA 4JX1C 5EE1A 1IUEA 3L4PA 3SR6A 1KRHA 2DBYA 2N0SB 2WP9B 3AE4B 1GTEA 3AE9B 2KMMA 2W54A 2OHFA 3P63A 4JWUC 1QOAA 3AB5A 4C80A 3W9CB 2ACZB 1FRDA 3WCQA 1JROA 1SB3C 1R7SA 1TYGB 2K9XA 3ZYYX 1E9MA 1FXAA 3CF4A 1N63A 1XLOA 4ZOHC 3W5UB 1N60A 3DWMA 1NYRA 1JW9D 3CIRB 2PVOD 3VR9B 1TJEA 2WDRB 2PVGC 2W3SA 1TKYA 2MH7A 1V8CA 4C7YA 1QF6A 1H7WA 2JX5A 2WQYB 4LTUA 2L83A 3NS1A 2KAJA 1YQ3B 2H88B 3AEDB 3KWLA 2BS2B 1L6UA 1E7PB 3P4PB 1CJEA 3AH7A 1NYQA 1OQQA 3B9JA 1GAQB 3RPFC 1XO3A 3W5VB 1NENB 2W55A 1GPXA 4JWSC 1I7HA 1VDVA 1EWYC 1ZP0B 1WGKA 2Y5CA 3VRAB 1JALA 2B76B 2EKIA 4HROA 1OFFA 4YSXB 1JRPA 1CZPA 4YTPB 2W3RA 3AM9A 3LXFA 3HVZA 2HTME 1N5WA 1DOYA 2BS3B 1NI3A 1SF0A 3SFDB 3EUB2 2M56B 1E6EB 4YXDB 1FFVA 2LEKA 3AE3B 3FAHA 2BT6A 1DGJA 2MJ3A 4N59A 2PIAA 4YTMB 3B2GA 5MPOA 1VLBA 2CJOA 4N6EB 5H92C 3AEBB 1FO4A 4YT0B 1F0ZA 1J7CA 3P4SB 2H89B 1FFUA 2BS4B 1PFDA 2E3TA 1L5PA 5EE0A 3AE8B 4YSZB 1N61A 1XLQA 1YJIA 1KFYB 1RWSA 5AUIA 1NEKB 2WDVB 3AE6B 3HUIA 4WWMA 1L6VA 3DWGC 1ROEA 3P4QB 3NVVA 1FMAD 5GXGB 1RFKA 2K5PA 1RM6C 1QOBA 3NVYA 3BIID 1KF6B 1QOFA 1FIQA 3AE2B 2MJDA 1GT8A 3AMZA 3AE7B 1E0ZA 1GTHA 4KX6B 4P6VF 5C2TB 3VR8B 3AN1A 4IDIA 1N5XA 1AYFA 1L0VB 1NVID 2QJLA 3AE1B 1DOIA 5EE3A 5G5HA 1WXQA 2JQRB 3B2FA 1QOGA 1B9RA 3AV8A 4A9AA 1ZUD2 1ZXIA 5EE9A 1WRIA 1TKEA 2G1EA 2WU2B 2PKOA 1JQ4A 4ZHOA 1SIJA 4US8A 4FXCA 2WU5B 2FBWB 2WS3B 1E10A 2WLBA 1YJJA 4ITKA 1FRRA 1YQ4B 1PUTA 4US9A 1OQRA 3AEGB 5AUKA 4C7ZA 1AWDA 3AEAB 1WYGA 1H7XA 1N62A 1T3QA 1WWTA 3HRDD 3NVWA 3VRBB 1UWMA 5H8YE
chains in the Genus database with same CATH superfamily
2LFIA 4WQMA 3P1MA 2MJEA 2N4FA 3C8YA 3ABVB 2WXIA 2AL3A 5FKAC 3APCA 2KT7A 4F1SA 5HI1A 3WAOA 3LJ3A 2ZPNA 4JX1C 3SEBA 4BFRA 3H7SA 4XX5A 2N0SB 1TS3A 2KXJA 4AOFA 3ZTDA 1Q5WB 1FRDA 1N63A 1P98A 2MW5A 4ZRIA 4MEMA 4FBJB 1ZDVA 3NHEB 1WGGA 4RMAA 1ZDXA 3NS1A 1YQ3B 2H88B 4DQOC 1E7PB 1CJEA 2J7QB 2KOXA 2DYMA 1PGAA 4K7UA 5CHVC 3EFCA 3PRPB 1IPGA 2BS3B 3KYDD 1SF0A 4AP4C 3PGEA 3N20C 3IG3A 3ZUNA 4NJCA 1WXAA 4UDUC 3JSVA 4C4VB 1VLBA 3GOEA 3ZNID 3AEBB 1LM8B 3NG0A 1YIWA 3I5JC 3ML9A 1C9FA 5LXHA 3DVNU 4M8MA 1L6VA 3RMKC 3R7QA 2CR5A 3LDZE 4P7IA 5HG2A 4MSMB 5JZEB 2AQ1B 3SDLC 3EGRA 2DZJA 2QJLA 1LQBA 1XD3B 3AXCA 3R3MA 2NR2A 4JQWC 4OHJA 1JWSD 2WS3B 2PE9A 3AEGB 2NTSA 1M4VA 1FNUA 4W9JA 2RR9A 4HK2A 1Y56A 4BOZB 3CSFA 3GB1A 5G55A 4B9KA 1S3SG 2L52A 1WZ3A 3U7DA 3ZJVA 1KM7A 1V97A 2X8XX 4XC2A 1J7BA 1IUEA 3AE9B 4K81A 1WX7A 2BF8B 3DBRB 2MWSB 2KDEB 4A8XC 3IFWB 1FXAA 3FILA 2LMCA 1V81A 4I6LB 4M0WB 3CIRB 3C0RB 3HM3A 2EMSA 3PT2B 1OGWA 4HEA1 4FHJA 1L6UA 2KMAA 1NENB 5BYSA 2IGHA 4TSSA 3W1YA 2IO0B 1YMHE 3Q8BA 1WRDB 4ANXA 4LNKA 2Z0EB 4DBGA 2JVCA 4CHKA 4AS1A 1E6EB 2BB6A 4DHJD 3ENEA 4EZLA 4WURA 3DHHC 2LWPA 1FO4A 3L08A 2KC2A 3ZJUA 4YL8A 3N3KB 3NUHB 1JWUD 3AE6B 1FMAD 2KTRB 1TS5A 3TBLD 2QSDA 3HK0A 3V61A 1X1MA 3D32A 1SE9A 4K3BA 3X0WA 1I4QA 4HJKA 2M0XA 2N9LA 2KLCA 4A55A 4W9FA 2JY6A 1V9JA 2CJOA 1R4NI 3VRBB 3FC4A 3SFEB 3ZXVA 2LVQA 1ET9A 5AEKB 3DDCB 1MG8A 2MX2A 3APDA 2WDQB 2A4ZA 1L2NA 2FCQA 4HPPA 2BWES 1GUAB 2BKRB 1IYFA 3NVZA 4GDKA 2JSVX 3KLSX 4NY0A 5MPOA 4W9IA 2GBRA 4FN2A 3E9SA 1K8RB 3Q8FA 2O6VB 2K9XA 3TEZA 4II3B 2MCNB 2WXHA 5IP4D 2JYEA 4RF0A 1NYRA 1IBXB 3N1XC 2R2QA 1TJEA 2WDRB 4C56C 1E7VA 3TCAA 1LXDA 5E6NA 3W5VB 1DYQA 4J3OD 3OJ3A 3ECIA 3QQ8B 1XCQL 2J52A 1UGJA 2EKEC 3N1ZC 3PPAA 3IAS1 3VDZA 3PVLA 3I3TB 4KZCA 4B6WA 1F2RI 1E8XA 3UQBA 3PZ7A 1EM7A 1FFVA 4LJPB 4TV3A 2MJ3A 2SEBD 2FUG1 2M17A 3VTWA 1J7CA 3A4SC 5J17A 5EE0A 4PYZA 3V3XA 1ZKHA 1BXTA 1NEKB 4AJWA 1U4AA 4F7ZA 5CHFA 3NVYA 2KJHB 5GMVA 1FIQA 2IDYA 4MSQB 1UGMA 2KDFB 3AN1A 4URKA 2VZKB 3RZWC 1DOIA 3MC9A 3S2AA 1V5TA 2I2YA 5EE9A 1J8CA 4KDIC 1E10A 2WLBA 3PSEB 3K9PB 3DVGX 2BGFA 4GDLA 4MT5A 2DWQA 4GDLB 1WM3A 4W9DA 1KH0A 4HWIB 2ZCBA 4ZDVA 4WJPA 3E56A 2FAZA 2CJNA 3CWIA 2CHXA 1R4NB 3NRZA 4S0RA 3WA0A 3QK0A 4DDGD 3SR6A 1C3TA 2RD0A 4DXAB 1Q1OA 4EEWA 3TEWA 3RUIB 1D5ZC 2K1FA 3W1SA 1BUIC 2RPQA 4ZOHC 1HTOA 2RDBC 1V8CA 4C7YA 5BMHA 4MDKE 3CF6E 2WQYB 5D6JB 4EOYA 2D3BA 3DHGC 3B9JA 1JMLA 1XO3A 4L1BA 3BK1A 2EELA 2BQQA 1SXTA 5KHOA 2Y5CA 3ZDMC 4YTPB 2WXLA 3LXFA 3A9JB 2Y5PA 3OG5A 3SFDB 1P7FA 3DVGY 2G4DB 4I6NB 3ZRFA 2IJ0A 2DZMA 3MC8A 5L95C 1T0QC 3PZ8A 2C9WB 4LNNA 2QEJC 4RNAA 1N61A 3VTUA 2YEPF 4WIPA 3P4QB 4B0EA 4NZLB 4GXBA 4WAFA 2KD0A 2UYZB 1SJED 3M62B 2SAKA 5DPRA 4AWJA 2DYOA 3ZLZA 1EF5A 2IGDA 1N5XA 4WWNA 2CHZA 5LNK1 5EE3A 1WXQA 3DBLI 1B9RA 1TKEA 4G3XB 4LDTD 3N1YC 2RSUA 4W9HA 2ASQA 3MHSD 2UU7A 3R2IA 1H7XA 2NPTA 4HKQA 3TUOA 2D11A 4EZKA 1A70A 1FXIA 2K8CA 5IO9A 3PHWB 3LB8C 1GOZA 3V6CB 3ZGZA 3V62A 3ZNZB 1ZGUB 3AU4A 1YJ1A 1WGRA 2GBKA 4HDOA 2KYWA 3A9KA 2B3AA 2ONQA 1MFWA 2TSSA 3DWMA 2JZ3B 4K3CA 2JX5A 2AL6A 2JRIB 2L83A 1VR9A 4EFOA 4A20A 2OJWA 2N7DA 3BINA 4W9GA 2HE7A 2IBIB 1CZPA 2ZJDA 3BVMA 1WX8A 1N5WA 2KVRA 2C5LC 3OLMD 4MGKE 1K50A 3I9V1 2LEKA 1FCLA 1ENFA 4FJYA 4KKJA 2MBHA 4O1NA 2MEKA 2KKCA 3JYUA 1JCKB 4ACFA 2IGGA 4LNFA 1RAXA 4MGZE 1R4MB 1MG4A 3RD2A 5D7GA 1AARA 3BIID 2OOBB 1P7EA 5FK9C 4MM3A 4EZJA 2J42A 1E0ZA 1OQYA 3KYCD 3IXSA 3ZRCA 3H1UA 2WU2B 3RULA 4HCNB 4NJ6A 3R66C 3DBLB 3EFUA 3VH3B 3ZVVA 1SE3A 1JWBD 2G4SA 3RNBC 4MGYE 1NBFC 4M00A 2AQ2B 4BKGA 1ZOYB 1QT9A 3GE3C 3MC0B 1I42A 2JWZA 4HLEA 4BKSA 2DBYA 1VZ7A 1MJDA 2M0AA 3H7PA 2ACZB 3WCQA 2GMIC 1WX9A 1TYGB 4BKSD 3PZDA 1M94A 2L0TA 1V49A 1C4PA 4XYCA 4GIVA 3AEDB 1YX5B 5JHBA 1WGYA 2BPSA 2KNBA 3LYYA 1YQBA 2BB5A 1T0RC 4BZAA 3HVZA 3KQ4A 2DZIA 1NI3A 1WSPA 1CQVA 3Q8CA 3C19A 2BT6A 1DGJA 1T5XD 4YTMB 2YEPB 4RGMA 1GC6A 1WXVA 4TKNA 1FFUA 4K7WA 3K9OB 3BVGA 4WWOA 1PGBA 1KFYB 1JWMD 2K3UA 3NVVA 1KLUD 2DZKA 1GNUA 1WGHA 1RLFA 2PLPA 2K5PA 2RMMA 2KWCA 1V5OA 4J6IA 2WXQA 1WJNA 1L0VB 4OVZA 4Q2JA 4XDDA 2JQRB 3JSVB 1WE6A 3KWVA 1XQQA 3KUDB 1TS4A 3NVWA 1WWTA 3DBHI 3GZNB 4E71A 1MVKA 2WXGA 5C1ZA 3NS8A 3Q8EA 1QZEA 1IGDA 3P4RB 2C7HA 2PJHA 3AEEB 2L05A 2PEAA 3N32A 2LUMA 2KWUB 2CU3A 2INCC 2BWFA 1WR1A 4FADA 4CO7A 2QDFA 2O2VA 3I57A 3W9CB 3L16A 2K6QA 3UIOB 3JVZX 2GBMA 5BYRA 2RPVA 2WXNA 1WR6E 5DCNA 2VH2A 2C7MB 4FJVB 1GPXA 1QILA 2CKHB 1WJ4A 4RM8A 1ZP0B 1V1OA 2WXKA 3R2TA 2Z8LA 4MJSA 1TIFA 2INNE 4AQ7A 2KLGA 4WH4A 3RNGC 4XWTA 3FAHA 2LHDA 4HXDA 3FILB 5D3DA 4QAYA 3IAM1 4DXGA 2WX0A 1L5PA 1E8ZA 2RGFA 1TT5B 1XCTL 2DENB 4S17A 4KKIA 3DPDA 2BTEA 4LNOA 3FKYA 3M3JA 3KH0A 1RFKA 3Q3JA 4A3OA 4HPLB 4DK5A 1KJTA 1NDDA 1KF6B 5CHWA 5E6PA 1GT8A 2NBUA 4DHJB 1I4RA 1WM2A 3AMZA 3UGBB 3L10B 3T9LA 2REXA 3MTNB 3ZO5B 2R61A 2MA9B 1I4PA 2ON8A 4M02A 3AE1B 1WRIA 2G1EA 2PKOA 1SIJA 4JLCA 4RH6A 4US9A 1XLQA 2WXRA 2NMQA 4IWQA 2JF5A 5C3JB 3U8ZA 2JPHA 4YSYB 2EMTA 3QJZA 1VD2A 4PS8A 5G5GA 1V2YA 4PS7A 3AEFB 3DBHB 2KHWB 1Z2MA 4ZYSA 1UUPA 4ZRQA 4KSKC 1VRAB 5IA7A 3ZDTA 2D5GA 1WXMA 1ZE3D 2NCNA 1ET6A 3O65B 4OZAA 3PS6A 1QKZA 1CK1A 5C23A 3R8BA 2LGXA 4D2KA 5I4DA 2W3SA 4HCPB 1TKYA 1SGHA 3TEXA 5D2MB 1H7WA 3DVNV 2XNAC 4MH8A 1GAQB 2KZRA 2W55A 2WDTB 4G0NB 1EWYC 1WGKA 4GDKB 2EKIA 1D5XC 4B0MA 1P0RA 4RM9A 4IW0A 1FEHA 3BVZA 4WQOB 1E8YA 4LJOB 3N30A 3EECA 3Q3OC 3Q8AA 4KGTA 3ALBA 3EHVA 4KSLC 2LD9A 2KX0A 5LXIB 1TY0A 5AUIA 2YLMA 3DHIC 5E6OA 2ZNVB 2D07B 1V1PA 1D5MC 2DAJA 2QC8A 4NPNA 4W9EA 2WYQA 3R7RA 3RNFC 3KVFB 4R3DA 3HIZA 3ZQ4A 4IDIA 1UD7A 1AYFA 3GE8C 5TSSA 2FBWB 1YJJA 2FUHB 1FRRA 1PUTA 4C7ZA 2KWDA 5IAAC 1F77A 2C60A 5H8YE 4WWPA 3U2SC 3VH4B 1EUVB 2J0KA 2KVZA 4LNIA 1BT0A 3NJTA 3VFKA 4BBNC 3IVFA 2Q5WD 1ZW7A 2L3ZA 4EUTA 2MBEA 1JWAD 4IUMB 3L4PA 1OEYA 5BMGA 1D6EC 2W54A 3Q2AC 1HEZE 2KQSA 4WJOA 2VRRB 4RF1A 1CMXB 4FHKA 1L7YA 3WIMA 4B95A 1TGZB 4L2YA 4XWWA 3KW5B 1EO6A 1DOYA 3B0AA 1H4RA 3ZTCA 1HA5A 2PPHA 2Y5BB 1Q10A 2INDC 4N6EB 2E3TA 4DDID 2L0FA 3AE8B 1L4DB 2C7NB 1YJIA 3TEYA 4K1RB 3DWGC 1C78A 4REZA 4WAAA 1TBEA 1YOVB 1WMHA 3VQIA 1YX6B 1UH6A 4KGSA 2JU6X 4P1CC 3VUYA 1P3QU 1SJHD 3Q6BA 5G5HA 2BYTA 2L00B 5BO4B 3MJWA 2ZPYA 4US8A 5DPTA 1Y8RC 3KUCB 1KOTA 1ACCA 1LO5D 3TSSA 3AULA 3RI7C 2OJRA 2KMCA 4HRSA 3ETRA 2ZCCA 4FJZA 4HKZE 1XLPA 4USAA 3T3NA 3MP9A 4LDTB 4KDLB 3HVDA 1KLGD 4N58A 4IC7B 3UINB 3VHTC 2WP9B 2MP2A 2IY1B 4JWUC 2KFKA 3Q3NC 2MP2B 2WXMA 3UIPB 4NQLB 1WJUA 2NPTB 2DHZA 3ZW3A 1WY8A 2PVGC 2XN9C 2GI9A 3U4EG 1WIAA 1K52A 2J53A 2V1YA 2INPE 1C79A 4TUUA 3RPFC 3OJ4B 1T0YA 4GSWA 3GP7A 2B76B 2D10A 2KJRA 2YVCA 1GC7A 3UF8A 4NNJB 2HJ8A 4BKTA 3EUB2 2JZZA 1VCBA 3A9KB 1YN3A 3QC8B 2WHIA 1F0ZA 2MHJA 1PFDA 2H89B 2BS4B 4P16A 1FD6A 4YSZB 4A3PA 5AZHA 5BMIA 2MBBB 3HUIA 1ROEA 1C1YB 3GS2A 4RGNA 1QOBA 4NQKE 1TY2A 1OTRB 3TIXA 1WZ0A 2WXOA 1UELA 4ANVA 4BVUC 4IOIE 2J4XA 1GTHA 1C4AA 1WE7A 3VR8B 3RN9C 3WANA 1NVID 3U7ZA 2NBWB 2QCZA 3B2FA 5BYQA 4ICUA 3AV8A 1VZ6A 1GB1A 1F9JA 3NY5A 3UQAA 1RFAA 3Q14C 2X38A 5AUKA 1AWDA 4XZ4A 1HQRD 2BKFA 4FLHA 4KGRA 2AX5A 3OWEB 4IM3A 1QLBB 5G2NA 2MBOA 1J19A 3CMMB 3H8HA 5AZGA 2MSED 4MM3B 4MELA 3L54A 4ANWA 2K25A 5IOIA 1VJKA 2J0JA 2I1KA 4XGAB 2QIEB 2JXXA 1L4ZB 2NS5A 2V9HA 1KRHA 3CSTA 5IN7A 2IO2B 3O13A 3PRZA 4GMVA 4E3CA 1SB3C 1R7SA 2GBNA 2DX5B 2KFJA 1JW9D 4ARCA 3L17A 2DAFA 3VTVA 2MH7A 2N1VA 2V3NA 2I38A 3Q3MC 2KAJA 2N9PC 3KWLA 2IYDB 1HE8A 4ZRJA 3Q69A 3AM9A 3HM6X 2KDBA 1PQSA 3H7PB 3EC8A 2M4NA 2CS4A 3KUZA 2PIAA 3RT3B 1EU4A 3ZXRA 2IO3B 1ZXHA 5H92C 3NZUA 3BWUD 4NAMA 3P4SB 4LK0M 2JXTA 4BAXA 2LVPA 4IKGA 4HDQA 2WDVB 2ICIA 1SE4A 2K6DB 5TR5A 3J9CA 2W9NA 3AE2B 4AJYB 3WAMA 2KQ4X 3U52E 5C2TB 1YNTE 3DBRI 1Q0WB 4GU2A 1P9DU 2UWQA 5J18A 1WYWB 1QOGA 2LVOA 2D3CA 1ZUD2 1TZ1A 1F52A 2KANA 2KX3A 4GN1A 2E6XA 2J0MA 1YQ4B 1HXYD 2WGSA 2FIDA 1VZ8A 4LCDE 2K22A 1PDXA 3H6NA 2KQ7A 4RFBA 1H8CA 2Y3AA 4GB9A 2M19A 3VXWA 4TQ0A 2BBCA 3WAPA 1I4HA 1MHXA 4TQ1A 3AECB 1XLNA 2L76A 1YN5A 1J7AA 5EE1A 2K8HA 4RGTA 3ZIMA 2LASA 2KMMA 2LJ5A 2BYFA 3IT6B 1GB4A 2DLBA 3Q3FA 4HVBA 3CF4A 4C4VA 4ZRPA 1XLOA 2IPKD 3W5UB 3NZSA 2JUOA 3BYTB 4II2B 2KDMA 1RRBA 3RNAC 1AW7A 1TS2A 4KZ0A 3AH7A 1NYQA 2KDIA 1VDVA 1TTNA 2MLBA 4YSXB 2W3RA 3VUWA 3ZNGC 1IGCA 2O2VB 2LZ6A 2WXPA 1HZ5A 4N59A 3MFGA 1I4GA 4HPMB 4MH0E 3MJ5A 4MACA 1RWSA 5JH5C 1SIFA 1UBQA 1WGDA 2ZW1A 1E5WA 4GLSC 2CU1A 1L0XB 1KLVA 2L7RA 4MJSB 2ZVNA 4KX6B 4PYUA 4FULA 2MBQA 2LHEA 1D4BA 2V4IB 4A9AA 3AU5A 2DYBA 4JPSA 1JQ4A 3ML8A 2LUEA 3AI5A 4KIKA 4P1BC 4KIKB 2Z0DB 4HJGE 1T3QA 5AZFA 2JT4B 1Z5SB 1YN4A 3I63C 1YD8U 4M0WA 4OZBA 3B1LX 4X57B 3PO0A 4ICVA 5HHDG 4ZYNA 2RDGA 2GLSA 3SU8X 3TJPA 2FNJB 3VUXA 1WXSA 3L0WB 1ISNA 4IG7B 2L8JA 4H2AA 1OEYJ 2GB1A 2GOWA 2N7JA 4NJ7A 1FCCC 3RCZA 4GOCA 3IT4B 3PTFC 2NTTA 4OW0A 3WALA 3HHMA 2KO3A 2PVOD 3VR9B 5DPWA 3QIJA 2HTHA 3QARA 4LTUA 2LXAA 2XBBC 1OQQA 2AWTA 2LJIA 4ARIA 1D3ZA 2KTRA 3APFA 1FPYA 2LGSA 5FR6A 4F8CB 2PW9A 2M56B 4YXDB 3QA8A 2FCMA 3AE3B 4JGHB 2V3SA 2V4LA 2LXCA 2CHWA 2IZVB 2FIFA 4YT0B 4IWOA 4W9CA 1I35A 4ANUA 2JWUA 3A4RA 2M1MA 1C4CA 1UF0A 2HD5B 3V05A 2I1JA 4E74A 2PTLA 1ESFA 4XE0A 1QOFA 1PYWD 4G50A 3P42A 2LRUA 4P6VF 3ZNHB 3DBSA 4JIOU 1WF9A 2WXJA 5KHQA 2LGIA 2FCNA 4DXFA 4JE3B 2O6VA 3TL5A 1OQRA 2V0GA 1JRUA 1UWMA 2XK5A 2QMTA 1IBXA 1V1PB 1G6JA 2G45B 4KV2A 2O6VD 1GG3A 2XK5B 4AUQC 2DNFA 3L13A 5EDSA 1DOXA 1HZ6A 2NVUI 5DPSA 3DQVA 3ZKJC 3UI3A 3A1QA 1UZXB 3A1QB 5CX3A 4I6PA 3PLUA 2HDEA 4DWFA 1WI0A 4DHZB 1V86A 1JROA 1E9MA 4BOSC 3BY4B 2G9HD 2NBVB 3DOWA 2MRPA 2KN5A 4ZRKA 2BS2B 3P4PB 1ZPSA 1SBBB 2MQJA 2KK8A 2LGDA 2M8SA 3IHPC 2HTME 1V6EA 2D3AA 2JZPA 2KACA 1WJ6A 5T8IA 2KN4A 1E8WA 2VZKD 1FNWA 1BMLC 4OVUA 2FCSA 3MHZA 4K7SA 2D2QA 1C77A 3V60A 4WJNA 2VH1A 5D94A 4G11A 2IY0B 1K53A 2N9EB 1SSNA 2L32A 2ZZPB 1XXGA 3SD5A 1HTQA 3RZFA 4IWPA 1T0SC 2AYOB 2W82A 4W9KA 4C00A 4M01A 4FXCA 2HJ1A 2N1WA 2BW2A 3BZDB 5IKCM 2ZW0A 2ZNVC 4WJQA 3M95A 4ZHPA 3QX1A 2AEHA 2WXFA 3PREA 2GBJA 3AE5B 1WMHB 5FR3A 2K8BA 1FM0D 3QWZB 1K51A 2A5UA 4YTNB 2QILA 4DHZE 2K39A 1TKGA 2KC1A 2KWVB 4N9F4 3A9JA 3P63A 3AE4B 4M8NA 3URYA 3T3OA 2KTFA 1QOAA 4C80A 3VAWA 1P1AA 5D3IB 2L1AA 2R2OA 1R4MI 1UWXA 5JHAA 4YWGG 3BYYB 4PT5A 2K0PA 3V6EB 3TMPB 1MPEA 1IP9A 2XEWA 1XT9B 1JALA 1OFFA 1JRPA 5LLIA 1SEBD 1EU3A 1GJZA 3EA6A 2KFKB 1B1ZA 2PE6B 1WFYA 2GRIA 3X23A 3B08A 1E90A 1F1HA 5HKHA 5CTRC 1XEEA 3JW0X 2PMVA 5GXGB 1J0GA 1WH3A 1UBIA 4W9LA 1L0YB 1FNVA 5L83A 3T8MA 1XF5L 3W1SC 2ZEQA 4KVGB 2BVCA 1LGRA 1QF6A 1ZXIA 4ZHOA 2RDHA 4A90A 3A33B 4CQNA 1MHHE 3QAQA 3IBEA 2V3PA 3HRDD 1RYJA 3U30A 2OEDA 5J2RA 2AQ3B 1E7UA 5JXVA 2QHOA 3ONSA 4NAWA 2WX1A 4NAWB 1F2RC 3VVWB 1GTEA 2OHFA 3OAWA 1EWCA 2IO1B 3W2DA 3AB5A 3ZYYX 1N60A 4IM2A 2BYEA 2BYVE 4GGQA 4JL9A 1MI0A 3ZJTA 5E6JA 1S1QB 2LI5A 4FA6A 3N9YC 4MGIE 3QCAA 1T6BX 3BK2A 1PGXA 4JWSC 1I4XA 1I7HA 3H9DA 1A5RA 4XDCA 3VRAB 2N9KA 4HROA 4TMAB 2N7EA 3RYTA 4PS3A 3P2BA 1N6ZA 3NZ3A 1FXTB 4EKUA 3PV1A 3M63B 3B2GA 4A6QA 3RFZB 3GZNI 2JRHA 1KTKA 1C76A 4L23A 2Z59B 4ASWC 1UNSA 1SE2A 2LRWA 2G3QB 2ZVOA 2JYTA 1QQRA 3PLVA 1EF1A 2LGYA 4WWMA 4IM0A 1RM6C 4OVVA 1TZOA 4RCOA 4CYEA 4OZCA 2MJDA 1NI2A 3AE7B 4EE2A 1V80A 3QHTA 2KJ6A 3RNCC 1AN8A 3RNEC 1LFDA 3DCGA 2WNMA 3SHQA 2D3GA 3PHXB 2WWZA 3NOBA 4RGOS 4BBNF 3PRMB 2WU5B 4PK1A 2FE8A 2N9XA 4ITKA 1STEA 3AEAB 1WYGA 1N62A 5HFYA 4LLGM
chains in the Genus database with same CATH topology
4M0WA 2LFIA 4OZBA 4WQMA 3P1MA 3TUOA 2MJEA 4HKQA 1A70A 3PO0A 1FXIA 3C8YA 3ABVB 2Q5WD 5HHDG 2WXIA 3LB8C 2RDGA 1GOZA 5FKAC 3ZGZA 1JWAD 5HI1A 4JX1C 3L4PA 3SEBA 2N0SB 1TS3A 5BMGA 1D6EC 2W54A 4H2AA 2GB1A 2N7JA 1FRDA 1FCCC 3IT4B 1HEZE 4OW0A 2NTTA 1N63A 2ONQA 2TSSA 3DWMA 4RF1A 2PVOD 3VR9B 1ZDVA 2JX5A 4LTUA 1ZDXA 2L83A 3NS1A 1YQ3B 2H88B 4DQOC 1E7PB 1VR9A 1CJEA 1OQQA 4ARIA 2LJIA 4L2YA 4XWWA 2DYMA 1PGAA 1CZPA 3BVMA 1N5WA 2PW9A 2BS3B 1DOYA 1SF0A 1K50A 2M56B 3I9V1 4YXDB 1HA5A 3AE3B 2LEKA 1FCLA 4NJCA 4UDUC 1Q10A 1ENFA 1VLBA 4N6EB 3AEBB 4YT0B 4KKJA 4O1NA 2MEKA 2E3TA 1JCKB 2JWUA 3AE8B 1C9FA 1L4DB 1YJIA 1C4CA 3TEYA 2IGGA 1L6VA 3DWGC 3V05A 1C78A 4REZA 2PTLA 5D7GA 1ESFA 3BIID 3VQIA 1P7EA 1QOFA 4XE0A 5HG2A 1PYWD 4KGSA 2JU6X 3P42A 5FK9C 2J42A 1E0ZA 2AQ1B 3EGRA 4P6VF 1SJHD 3IXSA 2QJLA 5G5HA 2BYTA 4OHJA 2WU2B 2WXJA 4US8A 1JWSD 2WS3B 2LGIA 4DXFA 4JE3B 2V0GA 1OQRA 3AEGB 2NTSA 1ACCA 1M4VA 1LO5D 1UWMA 3TSSA 1FNUA 2QMTA 1IBXA 1V1PB 1SE3A 1JWBD 1Y56A 4HRSA 3ETRA 3GB1A 2L52A 1DOXA 1HZ6A 1XLPA 4HKZE 4USAA 3T3NA 3ZJVA 3MP9A 2AQ2B 1V97A 1ZOYB 1QT9A 3HVDA 1J7BA 1KLGD 3UI3A 4N58A 3MC0B 1IUEA 2DBYA 1VZ7A 2WP9B 2M0AA 3AE9B 2HDEA 4JWUC 2WXMA 2ACZB 3WCQA 1JROA 1TYGB 4A8XC 1E9MA 1FXAA 3FILA 2LMCA 3CIRB 2PVGC 2G9HD 2XN9C 4HEA1 1C4PA 2GI9A 3U4EG 1K52A 2J53A 3AEDB 2BS2B 1L6UA 3P4PB 2INPE 1C79A 3RPFC 1NENB 5BYSA 1ZPSA 2IGHA 3GP7A 4TSSA 2B76B 1YMHE 3Q8BA 3LYYA 1SBBB 2BB5A 3HVZA 2HTME 3KQ4A 1NI3A 2JZPA 2KACA 1WSPA 3EUB2 1CQVA 1E6EB 4AS1A 2BB6A 3Q8CA 2BT6A 1DGJA 1T5XD 4YTMB 4WURA 2YEPB 4RGMA 1YN3A 5T8IA 2KN4A 1FO4A 1F0ZA 2VZKD 1FNWA 3ZJUA 1PFDA 2H89B 1FFUA 2BS4B 4P16A 1BMLC 3BVGA 1FD6A 4YSZB 1PGBA 3NUHB 5BMIA 1KFYB 1JWUD 3MHZA 3AE6B 3HUIA 1JWMD 1ROEA 2K3UA 3GS2A 3NVVA 1FMAD 1C77A 1KLUD 2PLPA 4RGNA 1TS5A 2K5PA 1QOBA 1TY2A 2RMMA 2WXOA 2WXQA 2QSDA 1K53A 4IOIE 2J4XA 1GTHA 1C4AA 1SSNA 2L32A 1XXGA 3VR8B 1L0VB 1NVID 4OVZA 3U7ZA 4Q2JA 4XDDA 2JQRB 2W82A 3B2FA 5BYQA 3AV8A 3KWVA 1I4QA 2N9LA 4FXCA 4A55A 1TS4A 1VZ6A 1GB1A 4LLGM 2BW2A 3BZDB 2X38A 2ZW0A 5AUKA 1AWDA 3NVWA 1HQRD 1WWTA 2CJOA 3VRBB 4KGRA 1MVKA 2AX5A 2WXGA 3FC4A 3SFEB 3OWEB 1QLBB 2WXFA 4ZHPA 3Q8EA 1IGDA 3AE5B 3P4RB 5FR3A 1ET9A 3AEEB 3H8HA 1FM0D 4MM3B 2WDQB 1K51A 2LUMA 1VJKA 4YTNB 2QILA 2QIEB 1TKGA 2CU3A 3NVZA 1L4ZB 2JSVX 3KLSX 1KRHA 5MPOA 3P63A 3AE4B 3URYA 3O13A 3T3OA 1QOAA 3E9SA 3I57A 4C80A 3W9CB 3Q8FA 1SB3C 1R7SA 5D3IB 2K9XA 3TEZA 2L1AA 2WXHA 1UWXA 2JYEA 4RF0A 1NYRA 1JW9D 4YWGG 1IBXB 3BYYB 4ARCA 4C56C 1TJEA 2WDRB 4PT5A 2MH7A 5BYRA 2V3NA 2RPVA 2WXNA 2I38A 2K0PA 2KAJA 3KWLA 1MPEA 3W5VB 1GPXA 1DYQA 1QILA 4J3OD 1ZP0B 1V1OA 1JALA 1OFFA 1XCQL 1JRPA 1UGJA 2J52A 2WXKA 3AM9A 1SEBD 2Z8LA 3Q69A 3R2TA 3IAS1 1EU3A 2INNE 4AQ7A 1F2RI 4WH4A 3EA6A 1B1ZA 4XWTA 3PZ7A 1EM7A 1FFVA 3FAHA 2MJ3A 2LHDA 2SEBD 2PIAA 2GRIA 3FILB 1EU4A 5D3DA 2FUG1 1ZXHA 3IAM1 4DXGA 5H92C 1J7CA 3BWUD 4NAMA 3P4SB 4LK0M 5EE0A 1L5PA 3V3XA 1XCTL 4KKIA 2JXTA 2BTEA 4IKGA 1BXTA 1NEKB 2WDVB 2ICIA 1XEEA 2PMVA 1SE4A 5GXGB 1RFKA 3NVYA 1KF6B 3J9CA 1L0YB 1FNVA 1FIQA 2IDYA 3AE2B 1GT8A 1I4RA 3AMZA 2KQ4X 1XF5L 3U52E 5C2TB 1YNTE 2R61A 3AN1A 1I4PA 2ON8A 2VZKB 3AE1B 1DOIA 1QOGA 1QF6A 1ZUD2 1ZXIA 5EE9A 1WRIA 2G1EA 2PKOA 2I2YA 4ZHOA 1SIJA 2RDHA 4A90A 2E6XA 1MHHE 4CQNA 2WLBA 1E10A 5HFYA 4RH6A 1YQ4B 1HXYD 4US9A 2V3PA 4MT5A 3HRDD 1XLQA 2WXRA 2NMQA 1VZ8A 2DWQA 1RYJA 2K22A 4GDLB 1PDXA 5C3JB 4RFBA 2Y3AA 2OEDA 4YSYB 1KH0A 2AQ3B 2M19A 4TQ0A 2BBCA 5G5GA 3E56A 5JXVA 1I4HA 1MHXA 3AEFB 2CJNA 3CWIA 4TQ1A 3AECB 1XLNA 3NRZA 1YN5A 1J7AA 5EE1A 4ZYSA 4NAWB 1UUPA 1F2RC 4ZRQA 3SR6A 1VRAB 4RGTA 2KMMA 1GTEA 2D5GA 2OHFA 3W2DA 1EWCA 3AB5A 3TEWA 1ZE3D 3IT6B 1GB4A 1D5ZC 1ET6A 2DLBA 4OZAA 3W1SA 3ZYYX 1BUIC 3CF4A 1CK1A 1QKZA 4ZRPA 3R8BA 1XLOA 4ZOHC 2IPKD 1N60A 3W5UB 4D2KA 3BYTB 5I4DA 1MI0A 2KDMA 2W3SA 1TKYA 3TEXA 1V8CA 5E6JA 4C7YA 1H7WA 5BMHA 3ZJTA 2WQYB 2XNAC 1AW7A 3N9YC 1TS2A 3AH7A 3B9JA 1NYQA 4MH8A 1GAQB 1JMLA 1XO3A 1T6BX 3BK2A 2W55A 2EELA 3BK1A 1PGXA 4L1BA 4JWSC 1I4XA 1I7HA 1VDVA 1SXTA 1EWYC 1WGKA 4XDCA 4GDKB 2Y5CA 3VRAB 1D5XC 2EKIA 2N9KA 4HROA 4TMAB 4YSXB 2W3RA 4B0MA 4YTPB 2WXLA 3LXFA 2Y5PA 1IGCA 3SFDB 1P7FA 3NZ3A 1FEHA 3BVZA 2WXPA 1HZ5A 4N59A 2IJ0A 3B2GA 4A6QA 3MFGA 1I4GA 3RFZB 3Q8AA 1KTKA 1C76A 3PZ8A 4L23A 4KGTA 2QEJC 4RNAA 1UNSA 1SE2A 3MJ5A 1N61A 2JYTA 4MACA 1RWSA 1QQRA 1TY0A 5AUIA 2YEPF 4WIPA 4WWMA 3P4QB 2ZW1A 4B0EA 4NZLB 1V1PA 1D5MC 4GLSC 4WAFA 1RM6C 1SJED 1TZOA 4RCOA 1L0XB 4OZCA 2MJDA 2SAKA 3AE7B 2DYOA 4EE2A 4KX6B 4R3DA 3ZQ4A 2IGDA 4IDIA 1N5XA 1AYFA 1AN8A 2LHEA 1D4BA 5LNK1 5EE3A 1WXQA 2V4IB 1B9RA 4A9AA 2WNMA 1TKEA 4JPSA 1JQ4A 4RGOS 5TSSA 2WU5B 2FBWB 1YJJA 2FE8A 4ITKA 1FRRA 4HJGE 1PUTA 4C7ZA 1STEA 2KWDA 3AEAB 1F77A 1H7XA 1N62A 1T3QA 1WYGA 1YN4A 3R2IA 5H8YE 3U2SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWQ A;  1RYJ A;  2K22 A;  4ZHP A;  2AX5 A;  1PDX A;  3FC4 A;  3SFE B;  1QLB B;  5C3J B;  4WQM A;  3P1M A;  2MJE A;  1JWB D;  3AE5 B;  3P4R B;  4YSY B;  1A70 A;  2M19 A;  3AEE B;  1FXI A;  3PO0 A;  1FM0 D;  3ETR A;  4HRS A;  3ABV B;  2Q5W D;  3LB8 C;  2WDQ B;  2L52 A;  1DOX A;  5G5G A;  1XLP A;  4USA A;  1JWA D;  3AEF B;  1VJK A;  2CJN A;  3CWI A;  3AEC B;  4YTN B;  1ZOY B;  1XLN A;  1QT9 A;  1V97 A;  2QIE B;  1J7B A;  1TKG A;  2CU3 A;  3NRZ A;  3NVZ A;  4N58 A;  1J7A A;  4JX1 C;  5EE1 A;  1IUE A;  3L4P A;  3SR6 A;  1KRH A;  2DBY A;  2N0S B;  2WP9 B;  3AE4 B;  1GTE A;  3AE9 B;  2KMM A;  2W54 A;  2OHF A;  3P63 A;  4JWU C;  1QOA A;  3AB5 A;  4C80 A;  3W9C B;  2ACZ B;  1FRD A;  3WCQ A;  1JRO A;  1SB3 C;  1R7S A;  1TYG B;  2K9X A;  3ZYY X;  1E9M A;  1FXA A;  3CF4 A;  1N63 A;  1XLO A;  4ZOH C;  3W5U B;  1N60 A;  3DWM A;  1NYR A;  1JW9 D;  3CIR B;  2PVO D;  3VR9 B;  1TJE A;  2WDR B;  2PVG C;  2W3S A;  1TKY A;  2MH7 A;  1V8C A;  4C7Y A;  1QF6 A;  1H7W A;  2JX5 A;  2WQY B;  4LTU A;  2L83 A;  3NS1 A;  2KAJ A;  1YQ3 B;  2H88 B;  3AED B;  3KWL A;  2BS2 B;  1L6U A;  1E7P B;  3P4P B;  1CJE A;  3AH7 A;  1NYQ A;  1OQQ A;  3B9J A;  1GAQ B;  3RPF C;  1XO3 A;  3W5V B;  1NEN B;  2W55 A;  1GPX A;  4JWS C;  1I7H A;  1VDV A;  1EWY C;  1ZP0 B;  1WGK A;  2Y5C A;  3VRA B;  1JAL A;  2B76 B;  2EKI A;  4HRO A;  1OFF A;  4YSX B;  1JRP A;  1CZP A;  4YTP B;  2W3R A;  3AM9 A;  3LXF A;  3HVZ A;  2HTM E;  1N5W A;  1DOY A;  2BS3 B;  1NI3 A;  1SF0 A;  3SFD B;  3EUB 2;  2M56 B;  1E6E B;  4YXD B;  1FFV A;  2LEK A;  3AE3 B;  3FAH A;  2BT6 A;  1DGJ A;  2MJ3 A;  4N59 A;  2PIA A;  4YTM B;  3B2G A;  5MPO A;  1VLB A;  2CJO A;  4N6E B;  5H92 C;  3AEB B;  1FO4 A;  4YT0 B;  1F0Z A;  1J7C A;  3P4S B;  2H89 B;  1FFU A;  2BS4 B;  1PFD A;  2E3T A;  1L5P A;  5EE0 A;  3AE8 B;  4YSZ B;  1N61 A;  1XLQ A;  1YJI A;  1KFY B;  1RWS A;  5AUI A;  1NEK B;  2WDV B;  3AE6 B;  3HUI A;  4WWM A;  1L6V A;  3DWG C;  1ROE A;  3P4Q B;  3NVV A;  1FMA D;  5GXG B;  1RFK A;  2K5P A;  1RM6 C;  1QOB A;  3NVY A;  3BII D;  1KF6 B;  1QOF A;  1FIQ A;  3AE2 B;  2MJD A;  1GT8 A;  3AMZ A;  3AE7 B;  1E0Z A;  1GTH A;  4KX6 B;  4P6V F;  5C2T B;  3VR8 B;  3AN1 A;  4IDI A;  1N5X A;  1AYF A;  1L0V B;  1NVI D;  2QJL A;  3AE1 B;  1DOI A;  5EE3 A;  5G5H A;  1WXQ A;  2JQR B;  3B2F A;  1QOG A;  1B9R A;  3AV8 A;  4A9A A;  1ZUD 2;  1ZXI A;  5EE9 A;  1WRI A;  1TKE A;  2G1E A;  2WU2 B;  2PKO A;  1JQ4 A;  4ZHO A;  1SIJ A;  4US8 A;  4FXC A;  2WU5 B;  2FBW B;  2WS3 B;  1E10 A;  2WLB A;  1YJJ A;  4ITK A;  1FRR A;  1YQ4 B;  1PUT A;  4US9 A;  1OQR A;  3AEG B;  5AUK A;  4C7Z A;  1AWD A;  3AEA B;  1WYG A;  1H7X A;  1N62 A;  1T3Q A;  1WWT A;  3HRD D;  3NVW A;  3VRB B;  1UWM A;  5H8Y E; 
#chains in the Genus database with same CATH topology
 2LFI A;  4WQM A;  3P1M A;  2MJE A;  2N4F A;  3C8Y A;  3ABV B;  2WXI A;  2AL3 A;  5FKA C;  3APC A;  2KT7 A;  4F1S A;  5HI1 A;  3WAO A;  3LJ3 A;  2ZPN A;  4JX1 C;  3SEB A;  4BFR A;  3H7S A;  4XX5 A;  2N0S B;  1TS3 A;  2KXJ A;  4AOF A;  3ZTD A;  1Q5W B;  1FRD A;  1N63 A;  1P98 A;  2MW5 A;  4ZRI A;  4MEM A;  4FBJ B;  1ZDV A;  3NHE B;  1WGG A;  4RMA A;  1ZDX A;  3NS1 A;  1YQ3 B;  2H88 B;  4DQO C;  1E7P B;  1CJE A;  2J7Q B;  2KOX A;  2DYM A;  1PGA A;  4K7U A;  5CHV C;  3EFC A;  3PRP B;  1IPG A;  2BS3 B;  3KYD D;  1SF0 A;  4AP4 C;  3PGE A;  3N20 C;  3IG3 A;  3ZUN A;  4NJC A;  1WXA A;  4UDU C;  3JSV A;  4C4V B;  1VLB A;  3GOE A;  3ZNI D;  3AEB B;  1LM8 B;  3NG0 A;  1YIW A;  3I5J C;  3ML9 A;  1C9F A;  5LXH A;  3DVN U;  4M8M A;  1L6V A;  3RMK C;  3R7Q A;  2CR5 A;  3LDZ E;  4P7I A;  5HG2 A;  4MSM B;  5JZE B;  2AQ1 B;  3SDL C;  3EGR A;  2DZJ A;  2QJL A;  1LQB A;  1XD3 B;  3AXC A;  3R3M A;  2NR2 A;  4JQW C;  4OHJ A;  1JWS D;  2WS3 B;  2PE9 A;  3AEG B;  2NTS A;  1M4V A;  1FNU A;  4W9J A;  2RR9 A;  4HK2 A;  1Y56 A;  4BOZ B;  3CSF A;  3GB1 A;  5G55 A;  4B9K A;  1S3S G;  2L52 A;  1WZ3 A;  3U7D A;  3ZJV A;  1KM7 A;  1V97 A;  2X8X X;  4XC2 A;  1J7B A;  1IUE A;  3AE9 B;  4K81 A;  1WX7 A;  2BF8 B;  3DBR B;  2MWS B;  2KDE B;  4A8X C;  3IFW B;  1FXA A;  3FIL A;  2LMC A;  1V81 A;  4I6L B;  4M0W B;  3CIR B;  3C0R B;  3HM3 A;  2EMS A;  3PT2 B;  1OGW A;  4HEA 1;  4FHJ A;  1L6U A;  2KMA A;  1NEN B;  5BYS A;  2IGH A;  4TSS A;  3W1Y A;  2IO0 B;  1YMH E;  3Q8B A;  1WRD B;  4ANX A;  4LNK A;  2Z0E B;  4DBG A;  2JVC A;  4CHK A;  4AS1 A;  1E6E B;  2BB6 A;  4DHJ D;  3ENE A;  4EZL A;  4WUR A;  3DHH C;  2LWP A;  1FO4 A;  3L08 A;  2KC2 A;  3ZJU A;  4YL8 A;  3N3K B;  3NUH B;  1JWU D;  3AE6 B;  1FMA D;  2KTR B;  1TS5 A;  3TBL D;  2QSD A;  3HK0 A;  3V61 A;  1X1M A;  3D32 A;  1SE9 A;  4K3B A;  3X0W A;  1I4Q A;  4HJK A;  2M0X A;  2N9L A;  2KLC A;  4A55 A;  4W9F A;  2JY6 A;  1V9J A;  2CJO A;  1R4N I;  3VRB B;  3FC4 A;  3SFE B;  3ZXV A;  2LVQ A;  1ET9 A;  5AEK B;  3DDC B;  1MG8 A;  2MX2 A;  3APD A;  2WDQ B;  2A4Z A;  1L2N A;  2FCQ A;  4HPP A;  2BWE S;  1GUA B;  2BKR B;  1IYF A;  3NVZ A;  4GDK A;  2JSV X;  3KLS X;  4NY0 A;  5MPO A;  4W9I A;  2GBR A;  4FN2 A;  3E9S A;  1K8R B;  3Q8F A;  2O6V B;  2K9X A;  3TEZ A;  4II3 B;  2MCN B;  2WXH A;  5IP4 D;  2JYE A;  4RF0 A;  1NYR A;  1IBX B;  3N1X C;  2R2Q A;  1TJE A;  2WDR B;  4C56 C;  1E7V A;  3TCA A;  1LXD A;  5E6N A;  3W5V B;  1DYQ A;  4J3O D;  3OJ3 A;  3ECI A;  3QQ8 B;  1XCQ L;  2J52 A;  1UGJ A;  2EKE C;  3N1Z C;  3PPA A;  3IAS 1;  3VDZ A;  3PVL A;  3I3T B;  4KZC A;  4B6W A;  1F2R I;  1E8X A;  3UQB A;  3PZ7 A;  1EM7 A;  1FFV A;  4LJP B;  4TV3 A;  2MJ3 A;  2SEB D;  2FUG 1;  2M17 A;  3VTW A;  1J7C A;  3A4S C;  5J17 A;  5EE0 A;  4PYZ A;  3V3X A;  1ZKH A;  1BXT A;  1NEK B;  4AJW A;  1U4A A;  4F7Z A;  5CHF A;  3NVY A;  2KJH B;  5GMV A;  1FIQ A;  2IDY A;  4MSQ B;  1UGM A;  2KDF B;  3AN1 A;  4URK A;  2VZK B;  3RZW C;  1DOI A;  3MC9 A;  3S2A A;  1V5T A;  2I2Y A;  5EE9 A;  1J8C A;  4KDI C;  1E10 A;  2WLB A;  3PSE B;  3K9P B;  3DVG X;  2BGF A;  4GDL A;  4MT5 A;  2DWQ A;  4GDL B;  1WM3 A;  4W9D A;  1KH0 A;  4HWI B;  2ZCB A;  4ZDV A;  4WJP A;  3E56 A;  2FAZ A;  2CJN A;  3CWI A;  2CHX A;  1R4N B;  3NRZ A;  4S0R A;  3WA0 A;  3QK0 A;  4DDG D;  3SR6 A;  1C3T A;  2RD0 A;  4DXA B;  1Q1O A;  4EEW A;  3TEW A;  3RUI B;  1D5Z C;  2K1F A;  3W1S A;  1BUI C;  2RPQ A;  4ZOH C;  1HTO A;  2RDB C;  1V8C A;  4C7Y A;  5BMH A;  4MDK E;  3CF6 E;  2WQY B;  5D6J B;  4EOY A;  2D3B A;  3DHG C;  3B9J A;  1JML A;  1XO3 A;  4L1B A;  3BK1 A;  2EEL A;  2BQQ A;  1SXT A;  5KHO A;  2Y5C A;  3ZDM C;  4YTP B;  2WXL A;  3LXF A;  3A9J B;  2Y5P A;  3OG5 A;  3SFD B;  1P7F A;  3DVG Y;  2G4D B;  4I6N B;  3ZRF A;  2IJ0 A;  2DZM A;  3MC8 A;  5L95 C;  1T0Q C;  3PZ8 A;  2C9W B;  4LNN A;  2QEJ C;  4RNA A;  1N61 A;  3VTU A;  2YEP F;  4WIP A;  3P4Q B;  4B0E A;  4NZL B;  4GXB A;  4WAF A;  2KD0 A;  2UYZ B;  1SJE D;  3M62 B;  2SAK A;  5DPR A;  4AWJ A;  2DYO A;  3ZLZ A;  1EF5 A;  2IGD A;  1N5X A;  4WWN A;  2CHZ A;  5LNK 1;  5EE3 A;  1WXQ A;  3DBL I;  1B9R A;  1TKE A;  4G3X B;  4LDT D;  3N1Y C;  2RSU A;  4W9H A;  2ASQ A;  3MHS D;  2UU7 A;  3R2I A;  1H7X A;  2NPT A;  4HKQ A;  3TUO A;  2D11 A;  4EZK A;  1A70 A;  1FXI A;  2K8C A;  5IO9 A;  3PHW B;  3LB8 C;  1GOZ A;  3V6C B;  3ZGZ A;  3V62 A;  3ZNZ B;  1ZGU B;  3AU4 A;  1YJ1 A;  1WGR A;  2GBK A;  4HDO A;  2KYW A;  3A9K A;  2B3A A;  2ONQ A;  1MFW A;  2TSS A;  3DWM A;  2JZ3 B;  4K3C A;  2JX5 A;  2AL6 A;  2JRI B;  2L83 A;  1VR9 A;  4EFO A;  4A20 A;  2OJW A;  2N7D A;  3BIN A;  4W9G A;  2HE7 A;  2IBI B;  1CZP A;  2ZJD A;  3BVM A;  1WX8 A;  1N5W A;  2KVR A;  2C5L C;  3OLM D;  4MGK E;  1K50 A;  3I9V 1;  2LEK A;  1FCL A;  1ENF A;  4FJY A;  4KKJ A;  2MBH A;  4O1N A;  2MEK A;  2KKC A;  3JYU A;  1JCK B;  4ACF A;  2IGG A;  4LNF A;  1RAX A;  4MGZ E;  1R4M B;  1MG4 A;  3RD2 A;  5D7G A;  1AAR A;  3BII D;  2OOB B;  1P7E A;  5FK9 C;  4MM3 A;  4EZJ A;  2J42 A;  1E0Z A;  1OQY A;  3KYC D;  3IXS A;  3ZRC A;  3H1U A;  2WU2 B;  3RUL A;  4HCN B;  4NJ6 A;  3R66 C;  3DBL B;  3EFU A;  3VH3 B;  3ZVV A;  1SE3 A;  1JWB D;  2G4S A;  3RNB C;  4MGY E;  1NBF C;  4M00 A;  2AQ2 B;  4BKG A;  1ZOY B;  1QT9 A;  3GE3 C;  3MC0 B;  1I42 A;  2JWZ A;  4HLE A;  4BKS A;  2DBY A;  1VZ7 A;  1MJD A;  2M0A A;  3H7P A;  2ACZ B;  3WCQ A;  2GMI C;  1WX9 A;  1TYG B;  4BKS D;  3PZD A;  1M94 A;  2L0T A;  1V49 A;  1C4P A;  4XYC A;  4GIV A;  3AED B;  1YX5 B;  5JHB A;  1WGY A;  2BPS A;  2KNB A;  3LYY A;  1YQB A;  2BB5 A;  1T0R C;  4BZA A;  3HVZ A;  3KQ4 A;  2DZI A;  1NI3 A;  1WSP A;  1CQV A;  3Q8C A;  3C19 A;  2BT6 A;  1DGJ A;  1T5X D;  4YTM B;  2YEP B;  4RGM A;  1GC6 A;  1WXV A;  4TKN A;  1FFU A;  4K7W A;  3K9O B;  3BVG A;  4WWO A;  1PGB A;  1KFY B;  1JWM D;  2K3U A;  3NVV A;  1KLU D;  2DZK A;  1GNU A;  1WGH A;  1RLF A;  2PLP A;  2K5P A;  2RMM A;  2KWC A;  1V5O A;  4J6I A;  2WXQ A;  1WJN A;  1L0V B;  4OVZ A;  4Q2J A;  4XDD A;  2JQR B;  3JSV B;  1WE6 A;  3KWV A;  1XQQ A;  3KUD B;  1TS4 A;  3NVW A;  1WWT A;  3DBH I;  3GZN B;  4E71 A;  1MVK A;  2WXG A;  5C1Z A;  3NS8 A;  3Q8E A;  1QZE A;  1IGD A;  3P4R B;  2C7H A;  2PJH A;  3AEE B;  2L05 A;  2PEA A;  3N32 A;  2LUM A;  2KWU B;  2CU3 A;  2INC C;  2BWF A;  1WR1 A;  4FAD A;  4CO7 A;  2QDF A;  2O2V A;  3I57 A;  3W9C B;  3L16 A;  2K6Q A;  3UIO B;  3JVZ X;  2GBM A;  5BYR A;  2RPV A;  2WXN A;  1WR6 E;  5DCN A;  2VH2 A;  2C7M B;  4FJV B;  1GPX A;  1QIL A;  2CKH B;  1WJ4 A;  4RM8 A;  1ZP0 B;  1V1O A;  2WXK A;  3R2T A;  2Z8L A;  4MJS A;  1TIF A;  2INN E;  4AQ7 A;  2KLG A;  4WH4 A;  3RNG C;  4XWT A;  3FAH A;  2LHD A;  4HXD A;  3FIL B;  5D3D A;  4QAY A;  3IAM 1;  4DXG A;  2WX0 A;  1L5P A;  1E8Z A;  2RGF A;  1TT5 B;  1XCT L;  2DEN B;  4S17 A;  4KKI A;  3DPD A;  2BTE A;  4LNO A;  3FKY A;  3M3J A;  3KH0 A;  1RFK A;  3Q3J A;  4A3O A;  4HPL B;  4DK5 A;  1KJT A;  1NDD A;  1KF6 B;  5CHW A;  5E6P A;  1GT8 A;  2NBU A;  4DHJ B;  1I4R A;  1WM2 A;  3AMZ A;  3UGB B;  3L10 B;  3T9L A;  2REX A;  3MTN B;  3ZO5 B;  2R61 A;  2MA9 B;  1I4P A;  2ON8 A;  4M02 A;  3AE1 B;  1WRI A;  2G1E A;  2PKO A;  1SIJ A;  4JLC A;  4RH6 A;  4US9 A;  1XLQ A;  2WXR A;  2NMQ A;  4IWQ A;  2JF5 A;  5C3J B;  3U8Z A;  2JPH A;  4YSY B;  2EMT A;  3QJZ A;  1VD2 A;  4PS8 A;  5G5G A;  1V2Y A;  4PS7 A;  3AEF B;  3DBH B;  2KHW B;  1Z2M A;  4ZYS A;  1UUP A;  4ZRQ A;  4KSK C;  1VRA B;  5IA7 A;  3ZDT A;  2D5G A;  1WXM A;  1ZE3 D;  2NCN A;  1ET6 A;  3O65 B;  4OZA A;  3PS6 A;  1QKZ A;  1CK1 A;  5C23 A;  3R8B A;  2LGX A;  4D2K A;  5I4D A;  2W3S A;  4HCP B;  1TKY A;  1SGH A;  3TEX A;  5D2M B;  1H7W A;  3DVN V;  2XNA C;  4MH8 A;  1GAQ B;  2KZR A;  2W55 A;  2WDT B;  4G0N B;  1EWY C;  1WGK A;  4GDK B;  2EKI A;  1D5X C;  4B0M A;  1P0R A;  4RM9 A;  4IW0 A;  1FEH A;  3BVZ A;  4WQO B;  1E8Y A;  4LJO B;  3N30 A;  3EEC A;  3Q3O C;  3Q8A A;  4KGT A;  3ALB A;  3EHV A;  4KSL C;  2LD9 A;  2KX0 A;  5LXI B;  1TY0 A;  5AUI A;  2YLM A;  3DHI C;  5E6O A;  2ZNV B;  2D07 B;  1V1P A;  1D5M C;  2DAJ A;  2QC8 A;  4NPN A;  4W9E A;  2WYQ A;  3R7R A;  3RNF C;  3KVF B;  4R3D A;  3HIZ A;  3ZQ4 A;  4IDI A;  1UD7 A;  1AYF A;  3GE8 C;  5TSS A;  2FBW B;  1YJJ A;  2FUH B;  1FRR A;  1PUT A;  4C7Z A;  2KWD A;  5IAA C;  1F77 A;  2C60 A;  5H8Y E;  4WWP A;  3U2S C;  3VH4 B;  1EUV B;  2J0K A;  2KVZ A;  4LNI A;  1BT0 A;  3NJT A;  3VFK A;  4BBN C;  3IVF A;  2Q5W D;  1ZW7 A;  2L3Z A;  4EUT A;  2MBE A;  1JWA D;  4IUM B;  3L4P A;  1OEY A;  5BMG A;  1D6E C;  2W54 A;  3Q2A C;  1HEZ E;  2KQS A;  4WJO A;  2VRR B;  4RF1 A;  1CMX B;  4FHK A;  1L7Y A;  3WIM A;  4B95 A;  1TGZ B;  4L2Y A;  4XWW A;  3KW5 B;  1EO6 A;  1DOY A;  3B0A A;  1H4R A;  3ZTC A;  1HA5 A;  2PPH A;  2Y5B B;  1Q10 A;  2IND C;  4N6E B;  2E3T A;  4DDI D;  2L0F A;  3AE8 B;  1L4D B;  2C7N B;  1YJI A;  3TEY A;  4K1R B;  3DWG C;  1C78 A;  4REZ A;  4WAA A;  1TBE A;  1YOV B;  1WMH A;  3VQI A;  1YX6 B;  1UH6 A;  4KGS A;  2JU6 X;  4P1C C;  3VUY A;  1P3Q U;  1SJH D;  3Q6B A;  5G5H A;  2BYT A;  2L00 B;  5BO4 B;  3MJW A;  2ZPY A;  4US8 A;  5DPT A;  1Y8R C;  3KUC B;  1KOT A;  1ACC A;  1LO5 D;  3TSS A;  3AUL A;  3RI7 C;  2OJR A;  2KMC A;  4HRS A;  3ETR A;  2ZCC A;  4FJZ A;  4HKZ E;  1XLP A;  4USA A;  3T3N A;  3MP9 A;  4LDT B;  4KDL B;  3HVD A;  1KLG D;  4N58 A;  4IC7 B;  3UIN B;  3VHT C;  2WP9 B;  2MP2 A;  2IY1 B;  4JWU C;  2KFK A;  3Q3N C;  2MP2 B;  2WXM A;  3UIP B;  4NQL B;  1WJU A;  2NPT B;  2DHZ A;  3ZW3 A;  1WY8 A;  2PVG C;  2XN9 C;  2GI9 A;  3U4E G;  1WIA A;  1K52 A;  2J53 A;  2V1Y A;  2INP E;  1C79 A;  4TUU A;  3RPF C;  3OJ4 B;  1T0Y A;  4GSW A;  3GP7 A;  2B76 B;  2D10 A;  2KJR A;  2YVC A;  1GC7 A;  3UF8 A;  4NNJ B;  2HJ8 A;  4BKT A;  3EUB 2;  2JZZ A;  1VCB A;  3A9K B;  1YN3 A;  3QC8 B;  2WHI A;  1F0Z A;  2MHJ A;  1PFD A;  2H89 B;  2BS4 B;  4P16 A;  1FD6 A;  4YSZ B;  4A3P A;  5AZH A;  5BMI A;  2MBB B;  3HUI A;  1ROE A;  1C1Y B;  3GS2 A;  4RGN A;  1QOB A;  4NQK E;  1TY2 A;  1OTR B;  3TIX A;  1WZ0 A;  2WXO A;  1UEL A;  4ANV A;  4BVU C;  4IOI E;  2J4X A;  1GTH A;  1C4A A;  1WE7 A;  3VR8 B;  3RN9 C;  3WAN A;  1NVI D;  3U7Z A;  2NBW B;  2QCZ A;  3B2F A;  5BYQ A;  4ICU A;  3AV8 A;  1VZ6 A;  1GB1 A;  1F9J A;  3NY5 A;  3UQA A;  1RFA A;  3Q14 C;  2X38 A;  5AUK A;  1AWD A;  4XZ4 A;  1HQR D;  2BKF A;  4FLH A;  4KGR A;  2AX5 A;  3OWE B;  4IM3 A;  1QLB B;  5G2N A;  2MBO A;  1J19 A;  3CMM B;  3H8H A;  5AZG A;  2MSE D;  4MM3 B;  4MEL A;  3L54 A;  4ANW A;  2K25 A;  5IOI A;  1VJK A;  2J0J A;  2I1K A;  4XGA B;  2QIE B;  2JXX A;  1L4Z B;  2NS5 A;  2V9H A;  1KRH A;  3CST A;  5IN7 A;  2IO2 B;  3O13 A;  3PRZ A;  4GMV A;  4E3C A;  1SB3 C;  1R7S A;  2GBN A;  2DX5 B;  2KFJ A;  1JW9 D;  4ARC A;  3L17 A;  2DAF A;  3VTV A;  2MH7 A;  2N1V A;  2V3N A;  2I38 A;  3Q3M C;  2KAJ A;  2N9P C;  3KWL A;  2IYD B;  1HE8 A;  4ZRJ A;  3Q69 A;  3AM9 A;  3HM6 X;  2KDB A;  1PQS A;  3H7P B;  3EC8 A;  2M4N A;  2CS4 A;  3KUZ A;  2PIA A;  3RT3 B;  1EU4 A;  3ZXR A;  2IO3 B;  1ZXH A;  5H92 C;  3NZU A;  3BWU D;  4NAM A;  3P4S B;  4LK0 M;  2JXT A;  4BAX A;  2LVP A;  4IKG A;  4HDQ A;  2WDV B;  2ICI A;  1SE4 A;  2K6D B;  5TR5 A;  3J9C A;  2W9N A;  3AE2 B;  4AJY B;  3WAM A;  2KQ4 X;  3U52 E;  5C2T B;  1YNT E;  3DBR I;  1Q0W B;  4GU2 A;  1P9D U;  2UWQ A;  5J18 A;  1WYW B;  1QOG A;  2LVO A;  2D3C A;  1ZUD 2;  1TZ1 A;  1F52 A;  2KAN A;  2KX3 A;  4GN1 A;  2E6X A;  2J0M A;  1YQ4 B;  1HXY D;  2WGS A;  2FID A;  1VZ8 A;  4LCD E;  2K22 A;  1PDX A;  3H6N A;  2KQ7 A;  4RFB A;  1H8C A;  2Y3A A;  4GB9 A;  2M19 A;  3VXW A;  4TQ0 A;  2BBC A;  3WAP A;  1I4H A;  1MHX A;  4TQ1 A;  3AEC B;  1XLN A;  2L76 A;  1YN5 A;  1J7A A;  5EE1 A;  2K8H A;  4RGT A;  3ZIM A;  2LAS A;  2KMM A;  2LJ5 A;  2BYF A;  3IT6 B;  1GB4 A;  2DLB A;  3Q3F A;  4HVB A;  3CF4 A;  4C4V A;  4ZRP A;  1XLO A;  2IPK D;  3W5U B;  3NZS A;  2JUO A;  3BYT B;  4II2 B;  2KDM A;  1RRB A;  3RNA C;  1AW7 A;  1TS2 A;  4KZ0 A;  3AH7 A;  1NYQ A;  2KDI A;  1VDV A;  1TTN A;  2MLB A;  4YSX B;  2W3R A;  3VUW A;  3ZNG C;  1IGC A;  2O2V B;  2LZ6 A;  2WXP A;  1HZ5 A;  4N59 A;  3MFG A;  1I4G A;  4HPM B;  4MH0 E;  3MJ5 A;  4MAC A;  1RWS A;  5JH5 C;  1SIF A;  1UBQ A;  1WGD A;  2ZW1 A;  1E5W A;  4GLS C;  2CU1 A;  1L0X B;  1KLV A;  2L7R A;  4MJS B;  2ZVN A;  4KX6 B;  4PYU A;  4FUL A;  2MBQ A;  2LHE A;  1D4B A;  2V4I B;  4A9A A;  3AU5 A;  2DYB A;  4JPS A;  1JQ4 A;  3ML8 A;  2LUE A;  3AI5 A;  4KIK A;  4P1B C;  4KIK B;  2Z0D B;  4HJG E;  1T3Q A;  5AZF A;  2JT4 B;  1Z5S B;  1YN4 A;  3I63 C;  1YD8 U;  4M0W A;  4OZB A;  3B1L X;  4X57 B;  3PO0 A;  4ICV A;  5HHD G;  4ZYN A;  2RDG A;  2GLS A;  3SU8 X;  3TJP A;  2FNJ B;  3VUX A;  1WXS A;  3L0W B;  1ISN A;  4IG7 B;  2L8J A;  4H2A A;  1OEY J;  2GB1 A;  2GOW A;  2N7J A;  4NJ7 A;  1FCC C;  3RCZ A;  4GOC A;  3IT4 B;  3PTF C;  2NTT A;  4OW0 A;  3WAL A;  3HHM A;  2KO3 A;  2PVO D;  3VR9 B;  5DPW A;  3QIJ A;  2HTH A;  3QAR A;  4LTU A;  2LXA A;  2XBB C;  1OQQ A;  2AWT A;  2LJI A;  4ARI A;  1D3Z A;  2KTR A;  3APF A;  1FPY A;  2LGS A;  5FR6 A;  4F8C B;  2PW9 A;  2M56 B;  4YXD B;  3QA8 A;  2FCM A;  3AE3 B;  4JGH B;  2V3S A;  2V4L A;  2LXC A;  2CHW A;  2IZV B;  2FIF A;  4YT0 B;  4IWO A;  4W9C A;  1I35 A;  4ANU A;  2JWU A;  3A4R A;  2M1M A;  1C4C A;  1UF0 A;  2HD5 B;  3V05 A;  2I1J A;  4E74 A;  2PTL A;  1ESF A;  4XE0 A;  1QOF A;  1PYW D;  4G50 A;  3P42 A;  2LRU A;  4P6V F;  3ZNH B;  3DBS A;  4JIO U;  1WF9 A;  2WXJ A;  5KHQ A;  2LGI A;  2FCN A;  4DXF A;  4JE3 B;  2O6V A;  3TL5 A;  1OQR A;  2V0G A;  1JRU A;  1UWM A;  2XK5 A;  2QMT A;  1IBX A;  1V1P B;  1G6J A;  2G45 B;  4KV2 A;  2O6V D;  1GG3 A;  2XK5 B;  4AUQ C;  2DNF A;  3L13 A;  5EDS A;  1DOX A;  1HZ6 A;  2NVU I;  5DPS A;  3DQV A;  3ZKJ C;  3UI3 A;  3A1Q A;  1UZX B;  3A1Q B;  5CX3 A;  4I6P A;  3PLU A;  2HDE A;  4DWF A;  1WI0 A;  4DHZ B;  1V86 A;  1JRO A;  1E9M A;  4BOS C;  3BY4 B;  2G9H D;  2NBV B;  3DOW A;  2MRP A;  2KN5 A;  4ZRK A;  2BS2 B;  3P4P B;  1ZPS A;  1SBB B;  2MQJ A;  2KK8 A;  2LGD A;  2M8S A;  3IHP C;  2HTM E;  1V6E A;  2D3A A;  2JZP A;  2KAC A;  1WJ6 A;  5T8I A;  2KN4 A;  1E8W A;  2VZK D;  1FNW A;  1BML C;  4OVU A;  2FCS A;  3MHZ A;  4K7S A;  2D2Q A;  1C77 A;  3V60 A;  4WJN A;  2VH1 A;  5D94 A;  4G11 A;  2IY0 B;  1K53 A;  2N9E B;  1SSN A;  2L32 A;  2ZZP B;  1XXG A;  3SD5 A;  1HTQ A;  3RZF A;  4IWP A;  1T0S C;  2AYO B;  2W82 A;  4W9K A;  4C00 A;  4M01 A;  4FXC A;  2HJ1 A;  2N1W A;  2BW2 A;  3BZD B;  5IKC M;  2ZW0 A;  2ZNV C;  4WJQ A;  3M95 A;  4ZHP A;  3QX1 A;  2AEH A;  2WXF A;  3PRE A;  2GBJ A;  3AE5 B;  1WMH B;  5FR3 A;  2K8B A;  1FM0 D;  3QWZ B;  1K51 A;  2A5U A;  4YTN B;  2QIL A;  4DHZ E;  2K39 A;  1TKG A;  2KC1 A;  2KWV B;  4N9F 4;  3A9J A;  3P63 A;  3AE4 B;  4M8N A;  3URY A;  3T3O A;  2KTF A;  1QOA A;  4C80 A;  3VAW A;  1P1A A;  5D3I B;  2L1A A;  2R2O A;  1R4M I;  1UWX A;  5JHA A;  4YWG G;  3BYY B;  4PT5 A;  2K0P A;  3V6E B;  3TMP B;  1MPE A;  1IP9 A;  2XEW A;  1XT9 B;  1JAL A;  1OFF A;  1JRP A;  5LLI A;  1SEB D;  1EU3 A;  1GJZ A;  3EA6 A;  2KFK B;  1B1Z A;  2PE6 B;  1WFY A;  2GRI A;  3X23 A;  3B08 A;  1E90 A;  1F1H A;  5HKH A;  5CTR C;  1XEE A;  3JW0 X;  2PMV A;  5GXG B;  1J0G A;  1WH3 A;  1UBI A;  4W9L A;  1L0Y B;  1FNV A;  5L83 A;  3T8M A;  1XF5 L;  3W1S C;  2ZEQ A;  4KVG B;  2BVC A;  1LGR A;  1QF6 A;  1ZXI A;  4ZHO A;  2RDH A;  4A90 A;  3A33 B;  4CQN A;  1MHH E;  3QAQ A;  3IBE A;  2V3P A;  3HRD D;  1RYJ A;  3U30 A;  2OED A;  5J2R A;  2AQ3 B;  1E7U A;  5JXV A;  2QHO A;  3ONS A;  4NAW A;  2WX1 A;  4NAW B;  1F2R C;  3VVW B;  1GTE A;  2OHF A;  3OAW A;  1EWC A;  2IO1 B;  3W2D A;  3AB5 A;  3ZYY X;  1N60 A;  4IM2 A;  2BYE A;  2BYV E;  4GGQ A;  4JL9 A;  1MI0 A;  3ZJT A;  5E6J A;  1S1Q B;  2LI5 A;  4FA6 A;  3N9Y C;  4MGI E;  3QCA A;  1T6B X;  3BK2 A;  1PGX A;  4JWS C;  1I4X A;  1I7H A;  3H9D A;  1A5R A;  4XDC A;  3VRA B;  2N9K A;  4HRO A;  4TMA B;  2N7E A;  3RYT A;  4PS3 A;  3P2B A;  1N6Z A;  3NZ3 A;  1FXT B;  4EKU A;  3PV1 A;  3M63 B;  3B2G A;  4A6Q A;  3RFZ B;  3GZN I;  2JRH A;  1KTK A;  1C76 A;  4L23 A;  2Z59 B;  4ASW C;  1UNS A;  1SE2 A;  2LRW A;  2G3Q B;  2ZVO A;  2JYT A;  1QQR A;  3PLV A;  1EF1 A;  2LGY A;  4WWM A;  4IM0 A;  1RM6 C;  4OVV A;  1TZO A;  4RCO A;  4CYE A;  4OZC A;  2MJD A;  1NI2 A;  3AE7 B;  4EE2 A;  1V80 A;  3QHT A;  2KJ6 A;  3RNC C;  1AN8 A;  3RNE C;  1LFD A;  3DCG A;  2WNM A;  3SHQ A;  2D3G A;  3PHX B;  2WWZ A;  3NOB A;  4RGO S;  4BBN F;  3PRM B;  2WU5 B;  4PK1 A;  2FE8 A;  2N9X A;  4ITK A;  1STE A;  3AEA B;  1WYG A;  1N62 A;  5HFY A;  4LLG M; 
#chains in the Genus database with same CATH homology
 4M0W A;  2LFI A;  4OZB A;  4WQM A;  3P1M A;  3TUO A;  2MJE A;  4HKQ A;  1A70 A;  3PO0 A;  1FXI A;  3C8Y A;  3ABV B;  2Q5W D;  5HHD G;  2WXI A;  3LB8 C;  2RDG A;  1GOZ A;  5FKA C;  3ZGZ A;  1JWA D;  5HI1 A;  4JX1 C;  3L4P A;  3SEB A;  2N0S B;  1TS3 A;  5BMG A;  1D6E C;  2W54 A;  4H2A A;  2GB1 A;  2N7J A;  1FRD A;  1FCC C;  3IT4 B;  1HEZ E;  4OW0 A;  2NTT A;  1N63 A;  2ONQ A;  2TSS A;  3DWM A;  4RF1 A;  2PVO D;  3VR9 B;  1ZDV A;  2JX5 A;  4LTU A;  1ZDX A;  2L83 A;  3NS1 A;  1YQ3 B;  2H88 B;  4DQO C;  1E7P B;  1VR9 A;  1CJE A;  1OQQ A;  4ARI A;  2LJI A;  4L2Y A;  4XWW A;  2DYM A;  1PGA A;  1CZP A;  3BVM A;  1N5W A;  2PW9 A;  2BS3 B;  1DOY A;  1SF0 A;  1K50 A;  2M56 B;  3I9V 1;  4YXD B;  1HA5 A;  3AE3 B;  2LEK A;  1FCL A;  4NJC A;  4UDU C;  1Q10 A;  1ENF A;  1VLB A;  4N6E B;  3AEB B;  4YT0 B;  4KKJ A;  4O1N A;  2MEK A;  2E3T A;  1JCK B;  2JWU A;  3AE8 B;  1C9F A;  1L4D B;  1YJI A;  1C4C A;  3TEY A;  2IGG A;  1L6V A;  3DWG C;  3V05 A;  1C78 A;  4REZ A;  2PTL A;  5D7G A;  1ESF A;  3BII D;  3VQI A;  1P7E A;  1QOF A;  4XE0 A;  5HG2 A;  1PYW D;  4KGS A;  2JU6 X;  3P42 A;  5FK9 C;  2J42 A;  1E0Z A;  2AQ1 B;  3EGR A;  4P6V F;  1SJH D;  3IXS A;  2QJL A;  5G5H A;  2BYT A;  4OHJ A;  2WU2 B;  2WXJ A;  4US8 A;  1JWS D;  2WS3 B;  2LGI A;  4DXF A;  4JE3 B;  2V0G A;  1OQR A;  3AEG B;  2NTS A;  1ACC A;  1M4V A;  1LO5 D;  1UWM A;  3TSS A;  1FNU A;  2QMT A;  1IBX A;  1V1P B;  1SE3 A;  1JWB D;  1Y56 A;  4HRS A;  3ETR A;  3GB1 A;  2L52 A;  1DOX A;  1HZ6 A;  1XLP A;  4HKZ E;  4USA A;  3T3N A;  3ZJV A;  3MP9 A;  2AQ2 B;  1V97 A;  1ZOY B;  1QT9 A;  3HVD A;  1J7B A;  1KLG D;  3UI3 A;  4N58 A;  3MC0 B;  1IUE A;  2DBY A;  1VZ7 A;  2WP9 B;  2M0A A;  3AE9 B;  2HDE A;  4JWU C;  2WXM A;  2ACZ B;  3WCQ A;  1JRO A;  1TYG B;  4A8X C;  1E9M A;  1FXA A;  3FIL A;  2LMC A;  3CIR B;  2PVG C;  2G9H D;  2XN9 C;  4HEA 1;  1C4P A;  2GI9 A;  3U4E G;  1K52 A;  2J53 A;  3AED B;  2BS2 B;  1L6U A;  3P4P B;  2INP E;  1C79 A;  3RPF C;  1NEN B;  5BYS A;  1ZPS A;  2IGH A;  3GP7 A;  4TSS A;  2B76 B;  1YMH E;  3Q8B A;  3LYY A;  1SBB B;  2BB5 A;  3HVZ A;  2HTM E;  3KQ4 A;  1NI3 A;  2JZP A;  2KAC A;  1WSP A;  3EUB 2;  1CQV A;  1E6E B;  4AS1 A;  2BB6 A;  3Q8C A;  2BT6 A;  1DGJ A;  1T5X D;  4YTM B;  4WUR A;  2YEP B;  4RGM A;  1YN3 A;  5T8I A;  2KN4 A;  1FO4 A;  1F0Z A;  2VZK D;  1FNW A;  3ZJU A;  1PFD A;  2H89 B;  1FFU A;  2BS4 B;  4P16 A;  1BML C;  3BVG A;  1FD6 A;  4YSZ B;  1PGB A;  3NUH B;  5BMI A;  1KFY B;  1JWU D;  3MHZ A;  3AE6 B;  3HUI A;  1JWM D;  1ROE A;  2K3U A;  3GS2 A;  3NVV A;  1FMA D;  1C77 A;  1KLU D;  2PLP A;  4RGN A;  1TS5 A;  2K5P A;  1QOB A;  1TY2 A;  2RMM A;  2WXO A;  2WXQ A;  2QSD A;  1K53 A;  4IOI E;  2J4X A;  1GTH A;  1C4A A;  1SSN A;  2L32 A;  1XXG A;  3VR8 B;  1L0V B;  1NVI D;  4OVZ A;  3U7Z A;  4Q2J A;  4XDD A;  2JQR B;  2W82 A;  3B2F A;  5BYQ A;  3AV8 A;  3KWV A;  1I4Q A;  2N9L A;  4FXC A;  4A55 A;  1TS4 A;  1VZ6 A;  1GB1 A;  4LLG M;  2BW2 A;  3BZD B;  2X38 A;  2ZW0 A;  5AUK A;  1AWD A;  3NVW A;  1HQR D;  1WWT A;  2CJO A;  3VRB B;  4KGR A;  1MVK A;  2AX5 A;  2WXG A;  3FC4 A;  3SFE B;  3OWE B;  1QLB B;  2WXF A;  4ZHP A;  3Q8E A;  1IGD A;  3AE5 B;  3P4R B;  5FR3 A;  1ET9 A;  3AEE B;  3H8H A;  1FM0 D;  4MM3 B;  2WDQ B;  1K51 A;  2LUM A;  1VJK A;  4YTN B;  2QIL A;  2QIE B;  1TKG A;  2CU3 A;  3NVZ A;  1L4Z B;  2JSV X;  3KLS X;  1KRH A;  5MPO A;  3P63 A;  3AE4 B;  3URY A;  3O13 A;  3T3O A;  1QOA A;  3E9S A;  3I57 A;  4C80 A;  3W9C B;  3Q8F A;  1SB3 C;  1R7S A;  5D3I B;  2K9X A;  3TEZ A;  2L1A A;  2WXH A;  1UWX A;  2JYE A;  4RF0 A;  1NYR A;  1JW9 D;  4YWG G;  1IBX B;  3BYY B;  4ARC A;  4C56 C;  1TJE A;  2WDR B;  4PT5 A;  2MH7 A;  5BYR A;  2V3N A;  2RPV A;  2WXN A;  2I38 A;  2K0P A;  2KAJ A;  3KWL A;  1MPE A;  3W5V B;  1GPX A;  1DYQ A;  1QIL A;  4J3O D;  1ZP0 B;  1V1O A;  1JAL A;  1OFF A;  1XCQ L;  1JRP A;  1UGJ A;  2J52 A;  2WXK A;  3AM9 A;  1SEB D;  2Z8L A;  3Q69 A;  3R2T A;  3IAS 1;  1EU3 A;  2INN E;  4AQ7 A;  1F2R I;  4WH4 A;  3EA6 A;  1B1Z A;  4XWT A;  3PZ7 A;  1EM7 A;  1FFV A;  3FAH A;  2MJ3 A;  2LHD A;  2SEB D;  2PIA A;  2GRI A;  3FIL B;  1EU4 A;  5D3D A;  2FUG 1;  1ZXH A;  3IAM 1;  4DXG A;  5H92 C;  1J7C A;  3BWU D;  4NAM A;  3P4S B;  4LK0 M;  5EE0 A;  1L5P A;  3V3X A;  1XCT L;  4KKI A;  2JXT A;  2BTE A;  4IKG A;  1BXT A;  1NEK B;  2WDV B;  2ICI A;  1XEE A;  2PMV A;  1SE4 A;  5GXG B;  1RFK A;  3NVY A;  1KF6 B;  3J9C A;  1L0Y B;  1FNV A;  1FIQ A;  2IDY A;  3AE2 B;  1GT8 A;  1I4R A;  3AMZ A;  2KQ4 X;  1XF5 L;  3U52 E;  5C2T B;  1YNT E;  2R61 A;  3AN1 A;  1I4P A;  2ON8 A;  2VZK B;  3AE1 B;  1DOI A;  1QOG A;  1QF6 A;  1ZUD 2;  1ZXI A;  5EE9 A;  1WRI A;  2G1E A;  2PKO A;  2I2Y A;  4ZHO A;  1SIJ A;  2RDH A;  4A90 A;  2E6X A;  1MHH E;  4CQN A;  2WLB A;  1E10 A;  5HFY A;  4RH6 A;  1YQ4 B;  1HXY D;  4US9 A;  2V3P A;  4MT5 A;  3HRD D;  1XLQ A;  2WXR A;  2NMQ A;  1VZ8 A;  2DWQ A;  1RYJ A;  2K22 A;  4GDL B;  1PDX A;  5C3J B;  4RFB A;  2Y3A A;  2OED A;  4YSY B;  1KH0 A;  2AQ3 B;  2M19 A;  4TQ0 A;  2BBC A;  5G5G A;  3E56 A;  5JXV A;  1I4H A;  1MHX A;  3AEF B;  2CJN A;  3CWI A;  4TQ1 A;  3AEC B;  1XLN A;  3NRZ A;  1YN5 A;  1J7A A;  5EE1 A;  4ZYS A;  4NAW B;  1UUP A;  1F2R C;  4ZRQ A;  3SR6 A;  1VRA B;  4RGT A;  2KMM A;  1GTE A;  2D5G A;  2OHF A;  3W2D A;  1EWC A;  3AB5 A;  3TEW A;  1ZE3 D;  3IT6 B;  1GB4 A;  1D5Z C;  1ET6 A;  2DLB A;  4OZA A;  3W1S A;  3ZYY X;  1BUI C;  3CF4 A;  1CK1 A;  1QKZ A;  4ZRP A;  3R8B A;  1XLO A;  4ZOH C;  2IPK D;  1N60 A;  3W5U B;  4D2K A;  3BYT B;  5I4D A;  1MI0 A;  2KDM A;  2W3S A;  1TKY A;  3TEX A;  1V8C A;  5E6J A;  4C7Y A;  1H7W A;  5BMH A;  3ZJT A;  2WQY B;  2XNA C;  1AW7 A;  3N9Y C;  1TS2 A;  3AH7 A;  3B9J A;  1NYQ A;  4MH8 A;  1GAQ B;  1JML A;  1XO3 A;  1T6B X;  3BK2 A;  2W55 A;  2EEL A;  3BK1 A;  1PGX A;  4L1B A;  4JWS C;  1I4X A;  1I7H A;  1VDV A;  1SXT A;  1EWY C;  1WGK A;  4XDC A;  4GDK B;  2Y5C A;  3VRA B;  1D5X C;  2EKI A;  2N9K A;  4HRO A;  4TMA B;  4YSX B;  2W3R A;  4B0M A;  4YTP B;  2WXL A;  3LXF A;  2Y5P A;  1IGC A;  3SFD B;  1P7F A;  3NZ3 A;  1FEH A;  3BVZ A;  2WXP A;  1HZ5 A;  4N59 A;  2IJ0 A;  3B2G A;  4A6Q A;  3MFG A;  1I4G A;  3RFZ B;  3Q8A A;  1KTK A;  1C76 A;  3PZ8 A;  4L23 A;  4KGT A;  2QEJ C;  4RNA A;  1UNS A;  1SE2 A;  3MJ5 A;  1N61 A;  2JYT A;  4MAC A;  1RWS A;  1QQR A;  1TY0 A;  5AUI A;  2YEP F;  4WIP A;  4WWM A;  3P4Q B;  2ZW1 A;  4B0E A;  4NZL B;  1V1P A;  1D5M C;  4GLS C;  4WAF A;  1RM6 C;  1SJE D;  1TZO A;  4RCO A;  1L0X B;  4OZC A;  2MJD A;  2SAK A;  3AE7 B;  2DYO A;  4EE2 A;  4KX6 B;  4R3D A;  3ZQ4 A;  2IGD A;  4IDI A;  1N5X A;  1AYF A;  1AN8 A;  2LHE A;  1D4B A;  5LNK 1;  5EE3 A;  1WXQ A;  2V4I B;  1B9R A;  4A9A A;  2WNM A;  1TKE A;  4JPS A;  1JQ4 A;  4RGO S;  5TSS A;  2WU5 B;  2FBW B;  1YJJ A;  2FE8 A;  4ITK A;  1FRR A;  4HJG E;  1PUT A;  4C7Z A;  1STE A;  2KWD A;  3AEA B;  1F77 A;  1H7X A;  1N62 A;  1T3Q A;  1WYG A;  1YN4 A;  3R2I A;  5H8Y E;  3U2S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...