3AE9B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae9B01
3SR6A 1YJIA 2CJNA 1UWMA 1L6VA 1JW9D 1N5WA 4KX6B 1QT9A 3W9CB 3NVVA 1H7XA 1NYQA 1PFDA 2K5PA 1DOIA 4WWMA 1E10A 2MJ3A 4WQMA 4LTUA 1XO3A 2QIEB 3AEAB 1N62A 1YQ4B 1NEKB 2FBWB 3AEBB 4YXDB 1QOFA 2G1EA 2MJDA 1QLBB 2H88B 3AE8B 1FIQA 1WYGA 3NRZA 4N6EB 5AUIA 1JRPA 1H7WA 4JWSC 1B9RA 1NYRA 2CU3A 2W3SA 5C3JB 1ROEA 3AE3B 4YTNB 2M56B 2WP9B 4HRSA 4C80A 2PVOD 2Y5CA 3HUIA 1N61A 2BT6A 1QOBA 4JX1C 3AEGB 2W55A 1YQ3B 3NVYA 3AE9B 2CJOA 2QJLA 3AE7B 1N63A 2PKOA 1FM0D 3B2FA 1OFFA 2L52A 1FXIA 3NVZA 2BS2B 3AEDB 2M19A 5EE1A 1E0ZA 1KFYB 1TYGB 2WU2B 2WQYB 4YTPB 1CZPA 1TKGA 1SIJA 1OQQA 2MH7A 3AB5A 5C2TB 1RM6C 3HRDD 1J7CA 2Q5WD 1V8CA 3WCQA 1L5PA 3VRBB 3BIID 3AE6B 3AECB 3PO0A 3AE5B 1FO4A 2WDRB 3ETRA 5AUKA 4IDIA 3NVWA 2WU5B 1JWBD 2N0SB 2KAJA 3DWGC 2HTME 4YSYB 1E6EB 1R7SA 1SB3C 3KWLA 2B76B 4ZOHC 2K22A 3W5VB 1XLOA 3AE2B 1KRHA 4YSZB 1ZUD2 1XLNA 2BS3B 1TJEA 2W3RA 3AV8A 3HVZA 3SFDB 3AMZA 1QF6A 2PIAA 4N58A 2KMMA 3AE1B 3VRAB 1QOGA 3LXFA 3VR9B 3AE4B 5GXGB 1TKYA 3B9JA 4N59A 2L83A 1RWSA 2W54A 3P4PB 2DWQA 4US8A 1TKEA 1GTHA 1JWAD 3LB8C 1J7AA 1FMAD 1A70A 1GTEA 1GAQB 2EKIA 4YT0B 1WRIA 3L4PA 4A9AA 3AEFB 1NI3A 1VLBA 3P4QB 4US9A 3FAHA 1NENB 1JROA 5H92C 1PDXA 1ZXIA 3ZYYX 4USAA 1WXQA 2WS3B 1XLQA 3RPFC 1YJJA 1J7BA 3NS1A 1XLPA 3P4SB 3VR8B 3SFEB 1FXAA 4ZHPA 1L6UA 3EUB2 1RYJA 1EWYC 1OQRA 1IUEA 3P4RB 3FC4A 1PUTA 2BS4B 5EE9A 1FRRA 1JQ4A 4P6VF 4FXCA 1GT8A 1ZP0B 3CWIA 1FFUA 3AM9A 1DOYA 2MJEA 1WGKA 3B2GA 1VDVA 1JALA 1RFKA 2H89B 2PVGC 1SF0A 5EE3A 5H8YE 2ACZB 4ZHOA 3AN1A 2LEKA 1DGJA 2AX5A 3P1MA 4YSXB 2DBYA 2JX5A 2E3TA 4JWUC 2WDVB 4YTMB 4HROA 5EE0A 1AYFA 5MPOA 1KF6B 2JQRB 1L0VB 3P63A 1WWTA 2K9XA 2WDQB 1AWDA 1ZOYB 1N60A 3AH7A 5G5HA 1VJKA 1NVID 4C7ZA 1GPXA 3AEEB 1I7HA 1FFVA 3CF4A 1CJEA 1E7PB 3ABVB 3CIRB 2WLBA 3DWMA 3W5UB 1F0ZA 4C7YA 1QOAA 1E9MA 1T3QA 1N5XA 5G5GA 1V97A 1DOXA 1FRDA 2OHFA 4ITKA
chains in the Genus database with same CATH superfamily
2JUOA 4W9FA 1C9FA 1K8RB 2FNJB 2K5PA 1I4HA 4WQMA 2QIEB 2KJ6A 5D3IB 2GLSA 4YXDB 4ANXA 1E8WA 2MEKA 2DYOA 4IWOA 5C1ZA 1GNUA 4K7SA 4ARIA 2ZEQA 1SE3A 4KIKB 2M56B 4MEMA 3HUIA 2CR5A 3WANA 2ONQA 3I9V1 1AARA 2CJOA 4MACA 3V61A 2KO3A 2MCNB 3VXWA 4PS3A 2G4SA 3A9JA 3RULA 4DBGA 4AJWA 4FJYA 1TY2A 1P7EA 4ICUA 2L8JA 2MA9B 2PLPA 3ML9A 4OZCA 3ZTDA 3VHTC 3VR9B 3M63B 4M00A 1Q0WB 1WGRA 2EKEC 1UF0A 2NBVB 3NG0A 2ON8A 2C9WB 4KGTA 1VLBA 3DVNV 2YEPB 3FAHA 3DBHI 3JSVA 1FNVA 3KLSX 1OGWA 2SAKA 1QKZA 3ZYYX 4DHJD 2IJ0A 2JRHA 1HXYD 4XC2A 2KDIA 1ET6A 3Q8BA 2C7HA 2KTRB 1IYFA 1T0YA 4FXCA 5BYSA 3QCAA 3Q8CA 5EE3A 1P9DU 3AN1A 2IO1B 3PHXB 4YSXB 2WDVB 2LUMA 4S17A 4NY0A 2JQRB 1L0VB 4FN2A 1HQRD 2QHOA 3LJ3A 4C7ZA 1SSNA 1C79A 4BBNC 1TBEA 3DBHB 4HVBA 4DXGA 4KZCA 2EMSA 2UYZB 4F8CB 4EFOA 2QSDA 4JE3B 2DYBA 1KTKA 3NVVA 4I6NB 3ZQ4A 2PMVA 1ZDXA 3RNAC 1QLBB 1WYGA 4PS8A 4JWSC 4IWPA 4PS7A 1NYRA 1LGRA 3DVGY 3M3JA 2AQ3B 4FADA 2NBWB 3AULA 2IDYA 1LO5D 3ZW3A 3T8MA 1C77A 2GBMA 5LNK1 3P42A 1TYGB 3DHHC 4YTPB 1YOVB 4DXFA 4LCDE 1J7CA 3UI3A 1MHXA 1TS3A 5C23A 2PPHA 4IKGA 2KAJA 4F7ZA 4JL9A 3W5VB 3AE2B 1KRHA 3Q3MC 2ZCBA 5D94A 1C3TA 3QK0A 5GXGB 3W1YA 3NS8A 1WZ0A 1MVKA 2DAJA 4KKIA 3TEXA 1NENB 1EU4A 1V1PA 2K6DB 4USAA 1WXQA 4K3CA 4NJ6A 4KIKA 4N9F4 1XLQA 2KVZA 4LK0M 1IP9A 4IUMB 1FNWA 3EUB2 1OQRA 2KK8A 2NVUI 1ZKHA 4RGNA 1FFUA 1VRAB 1RFKA 1UD7A 4BAXA 4DDGD 1GB1A 5J18A 4BBNF 3K9PB 1AWDA 1LFDA 4MJSB 1TT5B 2LXCA 1I7HA 1F0ZA 3RNFC 1DOXA 1Q1OA 4G50A 2L0FA 1D5XC 3NHEB 1UWMA 2C7MB 3JYUA 4XYCA 4I6PA 4LTUA 4GGQA 2J0JA 1HTOA 2AYOB 4GDKB 3ZVVA 4RCOA 3ZLZA 1HE8A 2W3SA 3N1ZC 3OG5A 3UIPB 5KHQA 5BO4B 2Z59B 1ZE3D 3PGEA 3ZGZA 1FXIA 1SIJA 2IY0B 3AB5A 3BWUD 3Q8FA 5HFYA 4RF0A 2WXRA 3PO0A 5HG2A 3ETRA 1MJDA 2JXXA 3PSEB 5AZFA 3O13A 4II2B 3ZJTA 3CF6E 3TCAA 3PLUA 3Q3OC 4II3B 4N58A 5E6JA 3LXFA 1YQBA 2TSSA 3P4PB 5BYRA 4WAAA 5AZGA 3GS2A 1JROA 4BKSA 4HCNB 1L7YA 1L0YB 3PHWB 3TSSA 2LXAA 4MM3B 3P4RB 2GBNA 1J8CA 1FRRA 3DDCB 1I35A 4JQWC 5H8YE 1K53A 1DGJA 4MGZE 3C0RB 1UGMA 5DPTA 2BGFA 3EFUA 3A9JB 1PGAA 1VJKA 1NVID 5JH5C 1GUAB 3DWMA 4EZJA 3W2DA 2WWZA 3L0WB 5IA7A 5CHVC 4Q2JA 1GC7A 2GBJA 4R3DA 5D7GA 1UH6A 3OJ4B 4QAYA 2L00B 4OZBA 1XO3A 2K8CA 1UUPA 3I3TB 2KWDA 1JWMD 3ONSA 2WP9B 1NI2A 4P16A 3RZFA 3H1UA 2GOWA 1D4BA 2IBIB 1AW7A 1FM0D 1YJ1A 1E0ZA 2N7JA 1VD2A 1R4NI 2KXJA 1OQQA 5C2TB 2Q5WD 2N9LA 3ZNHB 2WNMA 3ALBA 3AE5B 1WX7A 2A4ZA 4KSKC 3A4RA 2E6XA 3VTUA 3IBEA 2HTME 2KFKA 2B76B 1SIFA 2IO0B 2ZW1A 2BS3B 3Q8EA 3VQIA 1STEA 2KNBA 3QC8B 3AE4B 1FCCC 1WGHA 1HZ6A 3LB8C 4NQKE 3WIMA 3CSTA 2KC2A 2J0MA 5CTRC 3ZRFA 4ZRQA 5DPWA 3RNEC 2FCQA 2JT4B 5EE9A 2M17A 4WWNA 2OEDA 3CWIA 5JZEB 2MJEA 4ACFA 3BVZA 4FBJB 5D6JB 3PV1A 1TZ1A 3UGBB 2KQSA 3DBLI 2BYTA 2ASQA 2QC8A 4J3OD 4WJNA 2RPVA 2WLBA 1ZXHA 1FRDA 4ITKA 4TUUA 4XWTA 2CJNA 5IO9A 4WWPA 3U52E 2MJ3A 4XX5A 1C78A 1XQQA 3EFCA 1YN4A 2G1EA 1B9RA 3Q69A 4S0RA 1FPYA 2ZVNA 5C3JB 1E90A 1ROEA 2FCSA 1XEEA 2M0XA 1V6EA 2INCC 4OVUA 1HTQA 3AEDB 1VZ7A 2DZKA 4WJQA 3A9KA 3WCQA 2J42A 3DBRI 3NVWA 2KANA 1E6EB 2J53A 3ZNID 3KQ4A 2ZNVC 2L76A 4A3OA 1L4DB 3QX1A 4N59A 4RFBA 1TKEA 1GTHA 4NJCA 2C60A 2PE9A 3PRMB 1I4PA 1S1QB 1XD3B 4MH8A 4GDKA 3TBLD 2IY1B 5EDSA 4YL8A 4W9KA 1PGBA 1FXAA 2GBKA 2KACA 1D6EC 2CKHB 2W9NA 3T3NA 3VTWA 3I57A 3R7QA 3HIZA 2LVQA 1WXVA 2KTRA 3X23A 4W9GA 2WXPA 4B95A 4K1RB 1MG4A 4W9JA 2LRUA 1WWTA 4WAFA 1S3SG 1KLVA 2RDHA 2ZNVB 4RNAA 4FHJA 1N5XA 1YNTE 1V97A 2IPKD 2HE7A 4TV3A 2MBQA 2LHEA 1F2RC 4F1SA 4WWMA 2KMCA 2B3AA 4HWIB 2R2OA 1KJTA 2JXTA 3A1QB 1VR9A 3PRZA 2INPE 1H7WA 2KN4A 2LWPA 2OJWA 4HKZE 4HRSA 2MW5A 2N9XA 1C4CA 2KDMA 4NAMA 3VUWA 2QJLA 1GC6A 2LGXA 2JZ3B 4CYEA 2L52A 5T8IA 1UZXB 1WXMA 1WXSA 2XK5B 3MC9A 1WY8A 3AECB 5IP4D 2I1JA 4GN1A 1JWBD 3KUDB 1UWXA 2DZJA 3OJ3A 1TGZB 1T5XD 2O6VA 1H8CA 2BB5A 1VZ6A 1WJNA 2FUHB 3DCGA 2VZKB 1ENFA 4KVGB 2DX5B 5LLIA 4BKGA 1ZDVA 2NPTB 1F52A 3N32A 3BYTB 1D5MC 1V1PB 4AUQC 1XLPA 3QWZB 1UELA 2D3CA 1RYJA 2YLMA 3APFA 3AI5A 3R7RA 2LJ5A 3B2GA 4M02A 1HEZE 4A20A 2ACZB 3KVFB 2AWTA 4JWUC 2JF5A 3H7PA 5MPOA 3GP7A 1ZOYB 2N1WA 2XNAC 1C4PA 4OZAA 5IKCM 3ABVB 2BBCA 1JWUD 3MHZA 2BQQA 2V3PA 2INNE 4FA6A 4KX6B 4G0NB 2NBUA 2BKRB 3NJTA 4EZLA 2HTHA 3PTFC 4LLGM 4RGOS 2JY6A 5CX3A 1QQRA 1CMXB 4WH4A 2PVOD 5TR5A 3NVYA 3QA8A 5AEKB 2V4IB 4B6WA 1D3ZA 4WJOA 3SD5A 1LM8B 1GJZA 1Z5SB 4EUTA 3TIXA 1XLOA 3U8ZA 1GB4A 2MBHA 2OJRA 1AN8A 1H4RA 3V60A 4MELA 3FILB 5L95C 3KUCB 3MC0B 2Y5PA 3Q6BA 2REXA 2KVRA 1SXTA 1R4NB 1JWSD 1OQYA 2CHXA 1SEBD 4W9CA 4OHJA 3P4SB 4DDID 3QIJA 2KT7A 4JGHB 2KZRA 3O65B 1GT8A 4IM2A 3VUXA 1JALA 2XK5A 3ECIA 4KDLB 4ZHOA 2DZIA 3V62A 1KLUD 1K51A 2PJHA 1JMLA 1GG3A 1DYQA 1E7PB 1JRUA 3CIRB 1E5WA 4B0EA 2M1MA 2NTTA 3H6NA 1R4MB 4FLHA 2X38A 2BB6A 3IG3A 1JW9D 3R2TA 4DXAB 2KQ4X 1QT9A 4RGMA 2BWFA 1NYQA 1WE6A 3N1YC 2KYWA 1IGDA 3Q3FA 4M01A 3SHQA 1QOFA 1WYWB 2KHWB 5CHWA 1MPEA 2AL6A 3BY4B 4KV2A 2W55A 1YQ3B 3ZXRA 4P1BC 1Q10A 1WJUA 3RNBC 2BYEA 4E3CA 2WU2B 2KWVB 2V3SA 1ISNA 4M8MA 3PZ7A 4MH0E 4ANWA 2RDGA 3N3KB 3MHSD 2KWCA 3AU4A 2WU5B 2XN9C 4L2YA 3DWGC 1IPGA 3W1SC 4YSZB 1ZUD2 1XLNA 3KYDD 2PIAA 3MJ5A 4FJZA 1MFWA 1WMHA 2KKCA 4NAWB 4G11A 2WX1A 1PDXA 1I4GA 1RRBA 2J7QB 4ZRIA 1J7BA 1K50A 3NS1A 4GDLA 3SFEB 3OAWA 2AQ2B 1Z2MA 3WA0A 4RGTA 2RGFA 1QILA 2KJHB 4K7UA 2JRIB 1FD6A 2VZKD 2AQ1B 5J2RA 4XWWA 1V5OA 3NZUA 2BW2A 4IOIE 1J0GA 5BMIA 2LI5A 2K9XA 3DHIC 2WXHA 4C7YA 1V9JA 3BINA 3FILA 3SR6A 4M0WA 4ASWC 4EKUA 3W9CB 1H7XA 5DCNA 1JCKB 2G3QB 4RM9A 2BTEA 2D5GA 1PQSA 2FBWB 3KWVA 1L0XB 3DPDA 3OLMD 2KN5A 1M94A 4NNJB 1ET9A 3KW5B 2PEAA 1XF5L 1WI0A 3UQBA 2D10A 4LDTD 3MFGA 5LXHA 2M19A 5HHDG 5IAAC 4RMAA 2MH7A 2WX0A 2W82A 4L1BA 4PYZA 4LJPB 3RUIB 3A33B 2BWES 2ZPYA 2IGHA 2NMQA 3PLVA 3V3XA 2DLBA 4ZYSA 1E8YA 3SFDB 2J0KA 1G6JA 3GE3C 4M8NA 3EHVA 3APDA 4A3PA 2HDEA 5BMGA 1P1AA 3H9DA 2CS4A 4KSLC 2LGSA 4YT0B 1WGDA 1WRIA 5JXVA 1SE4A 4IM0A 2MWSB 4MGKE 2MX2A 2R61A 2FE8A 5H92C 1FXTB 4GIVA 2WXNA 1TS2A 4HPMB 4AP4C 1PYWD 2DYMA 4LDTB 4G3XB 2HD5B 2O2VB 1DOYA 2L1AA 4FULA 1R4MI 4KDIC 2O2VA 3DBSA 1TS4A 4JPSA 1TS5A 3P1MA 2DBYA 4TKNA 2EELA 3A4SC 3P2BA 1XCQL 1MI0A 3HVDA 2WDQB 2PE6B 1WE7A 2BYVE 2FUG1 3WAOA 1LQBA 2QDFA 3X0WA 3CMMB 4AWJA 3HK0A 2MRPA 4DK5A 4REZA 2NCNA 3E56A 2MP2B 1N6ZA 1F1HA 2JWUA 2K0PA 3NRZA 1KLGD 1WRDB 1T0QC 1YX6B 4C80A 1C4AA 4MJSA 2LJIA 3DBRB 4E74A 2V3NA 3WALA 3AXCA 2Z0EB 3AE9B 2K39A 3B2FA 4PK1A 3BK2A 4ANVA 3ZO5B 3IT6B 2V1YA 3ZUNA 4JLCA 1EUVB 1L5PA 3BIID 1SJED 3N9YC 1RLFA 3Q8AA 3ZXVA 3TEYA 3T9LA 2CU1A 4HEA1 4PYUA 2Y3AA 3B08A 2J4XA 3IFWB 4TMAB 4C4VA 2KX3A 4XZ4A 1RWSA 4HXDA 1YMHE 2JZZA 1GAQB 2JPHA 1Q5WB 5HI1A 1T6BX 3KH0A 3ZKJC 3PPAA 2GBRA 5BMHA 4GSWA 2N4FA 1ZPSA 1WFYA 4AOFA 2D2QA 4DHJB 2BS4B 1WX9A 3K9OB 1ZP0B 1YX5B 3GE8C 4TQ0A 2RPQA 3SEBA 5EE0A 4YTMB 3TMPB 2ZZPB 2BF8B 1CQVA 2GRIA 2CHWA 1GPXA 3R3MA 4ARCA 1EWCA 4BOSC 1I4QA 4DWFA 1E9MA 1T3QA 1BUIC 5D3DA 1RFAA 3URYA 2JYEA 1F77A 1V49A 4GLSC 4CQNA 3AEAB 2DZMA 3AEBB 3HM6X 5CHFA 5DPSA 3A9KB 2YVCA 3AU5A 4N6EB 2AL3A 1K52A 1WH3A 2LRWA 2O6VD 4RH6A 1N61A 4JX1C 2KTFA 3TL5A 4MGIE 3ZNZB 3TEZA 3EECA 2G45B 1UGJA 4H2AA 4IM3A 2WQYB 5IOIA 2ZCCA 3T3OA 1RM6C 3JVZX 4BZAA 2EMTA 1FO4A 3L10B 5AUKA 2YEPF 3UIOB 4IDIA 3BYYB 3VH4B 2KJRA 2N0SB 4YSYB 2G9HD 2QMTA 2WXQA 2IYDB 3L13A 3I5JC 4NPNA 3AMZA 3KUZA 1GOZA 1TIFA 2J52A 2KMMA 2V4LA 4HPLB 4B0MA 2MP2A 3ZNGC 2N1VA 3L4PA 1NI3A 2X8XX 2KQ7A 2RSUA 3OWEB 3PRPB 4IG7B 5FR6A 2BKFA 3VDZA 1VZ8A 1FCLA 4ZRKA 5GMVA 1EO6A 1EWYC 4HDQA 4E71A 2LMCA 1XT9B 1P7FA 1ZW7A 3QQ8B 2PW9A 2FIDA 1WR1A 3I63C 3QJZA 3JSVB 5FKAC 3PREA 3R8BA 3A1QA 3U7DA 2JVCA 3AEEB 2LUEA 4WURA 2N9KA 3RT3B 2K3UA 4GU2A 1RAXA 1WM2A 4C00A 2BYFA 2XBBC 2D11A 4EZKA 2LVPA 2UWQA 2KX0A 3IT4B 2MJDA 3VUYA 2H88B 3AE8B 2MBOA 2K25A 5AUIA 3Q14C 1JRPA 2DAFA 5JHAA 3IXSA 4AQ7A 1QOBA 2GMIC 4OW0A 2HJ1A 1L2NA 3L08A 2O6VB 5EE1A 1WGGA 4LNKA 3BVGA 3GZNB 1LXDA 4ZYNA 4CHKA 1QZEA 1SB3C 3MP9A 2WDTB 1T0RC 4JIOU 2KC1A 2I38A 1SJHD 4L23A 1CK1A 2Z8LA 3AE1B 3VRAB 2MQJA 1EU3A 3ZIMA 2KLGA 3ZDMC 1TKYA 3B9JA 3Q2AC 3EA6A 3GZNI 1A70A 2XEWA 4US9A 4HDOA 4X57B 3IAS1 2MHJA 3APCA 3RMKC 2WS3B 4LNNA 3NY5A 2UU7A 5IN7A 5HKHA 1L6UA 2D3AA 1PUTA 2RDBC 2JSVX 3AM9A 1C1YB 4WJPA 2K8BA 2QEJC 4K3BA 4WQOB 2E3TA 1IBXB 5G2NA 1KOTA 3AH7A 1N60A 2INDC 4NJ7A 2QILA 1WR6E 2L7RA 4P7IA 3W5UB 2KOXA 3GOEA 3V6EB 4IW0A 3NZ3A 3UINB 2OHFA 4A90A 3H7SA 1A5RA 3LYYA 1YN5A 4M0WB 2LHDA 1ESFA 3MC8A 3RD2A 3W1SA 4D2KA 2N7DA 1UBIA 1F2RI 2CU3A 4AS1A 4WWOA 4CO7A 2BT6A 3L16A 3AEGB 3UF8A 3N20C 1OEYA 4LNFA 4IC7B 1IGCA 3FKYA 2I2YA 4MSMB 2KFJA 2NR2A 4OVVA 4NQLB 3HRDD 2L3ZA 4RM8A 1KH0A 3TJPA 4KGRA 1WZ3A 4DHZB 2DHZA 4BKSD 4ZDVA 1V81A 4ZOHC 3RFZB 3AV8A 3M62B 2GB1A 1WSPA 2MLBA 4MM3A 1QOGA 5BYQA 3B1LX 1I4RA 2L83A 3WAMA 1MHHE 1FMAD 3AEFB 2K8HA 4DQOC 1U4AA 3DBLB 4MSQB 3BZDB 3Q3JA 2JU6X 2IO2B 3MTNB 3Q3NC 1WJ4A 1B1ZA 2KDEB 2I1KA 3RNCC 4LNOA 1J19A 4HK2A 1P98A 4MDKE 2IO3B 5E6NA 2VH2A 3C8YA 4P6VF 3SU8X 1KM7A 2KDFB 2H89B 1BT0A 3V05A 3ZTCA 1AYFA 4WIPA 2V0GA 4LJOB 2NPTA 1HZ5A 3BVMA 5G5HA 3SDLC 3TUOA 2WXLA 4ICVA 1FFVA 4LNIA 5FR3A 1QOAA 2RR9A 5G5GA 1TZOA 3ML8A 3IAM1 4TQ1A 1VCBA 1YJIA 2LVOA 1L6VA 1N5WA 3JW0X 1E7UA 1DOIA 2D3BA 3PZ8A 2IGDA 3BK1A 4EOYA 1UBQA 1T0SC 3J9CA 1SE2A 3IHPC 3L54A 1SE9A 1V1OA 3LDZE 3AE3B 4YTNB 4MT5A 4W9DA 5I4DA 1D5ZC 1M4VA 1F9JA 2BPSA 1L4ZB 1N63A 2D3GA 2BS2B 1EF5A 4BKTA 1WIAA 1KFYB 1TKGA 2K1FA 3U7ZA 1TY0A 4BFRA 4NAWA 5AZHA 2WDRB 2WXIA 4XGAB 3HHMA 3PZDA 3KWLA 1C76A 1I4XA 1R7SA 1X1MA 4GDLB 4UDUC 1TJEA 1QF6A 4URKA 1WM3A 3M95A 4C4VB 2SEBD 2W54A 4XDCA 2CHZA 1J7AA 2EKIA 3R66C 2KMAA 3U4EG 1MG8A 3P4QB 3VVWB 1WGYA 2FIFA 3B0AA 1ZXIA 2LZ6A 2WXKA 4FHKA 1E7VA 3WAPA 3E9SA 1V2YA 4W9IA 1WMHB 2LGYA 5G55A 3VFKA 1SF0A 2LEKA 3S2AA 2AEHA 3QHTA 1KF6B 3NOBA 4GOCA 3NZSA 1P0RA 2LGDA 4OVZA 1OEYJ 1SGHA 3VH3B 2N9EB 1P3QU 1PFDA 4GB9A 4KGSA 3DVNU 4B9KA 1E10A 3DOWA 1YQ4B 1NEKB 2LASA 2ZW0A 1BMLC 1SBBB 3GB1A 3RN9C 2VH1A 5FK9C 1ZGUB 2K6QA 4A8XC 5D2MB 1WX8A 3PS6A 2KLCA 4HPPA 2NTSA 4I6LB 1XCTL 2ICIA 1OTRB 2PKOA 1OFFA 1V80A 3ZJUA 2RMMA 2OOBB 3RZWC 2MSED 2C5LC 4GMVA 2IZVB 3D32A 1NBFC 1Y8RC 3AE6B 3C19A 1IBXA 2WXGA 2ZJDA 3DQVA 2V9HA 4HJKA 2WHIA 4ZRPA 2DENB 1XXGA 2LGIA 2RD0A 2ZPNA 1BXTA 3NUHB 2DWQA 1PGXA 1JWAD 3R2IA 1GTEA 2MBBB 4BVUC 2N9PC 4XE0A 4NZLB 2QCZA 4W9EA 2R2QA 4IWQA 4KKJA 1ACCA 4KZ0A 4TSSA 4XDDA 4HJGE 1YJJA 3ZRCA 3VR8B 4MGYE 3FC4A 3L17A 2WXMA 3U2SC 1JQ4A 3N1XC 1I42A 3HM3A 3RI7C 2L0TA 1VDVA 2PVGC 4HLEA 2KD0A 4FJVB 3ZJVA 1E8XA 5L83A 3RNGC 2Z0DB 2KWUB 2G4DB 3P63A 1YIWA 2WXJA 1YN3A 2FCNA 2MBEA 1V5TA 4BOZB 2JYTA 2ZVOA 1V86A 2WYQA 1NDDA 3PT2B 2VRRB 3RYTA 3ENEA 4AJYB 1N62A 1TTNA 2PTLA 3N30A 1HA5A 1FIQA 4A6QA 2DNFA 2HJ8A 4W9LA 5LXIB 3TEWA 4RF1A 5KHOA 3QAQA 2Y5CA 1WF9A 2D07B 2LFIA 3AE7B 1EM7A 4K7WA 1YD8U 3NVZA 1E8ZA 3RCZA 2JZPA 1CZPA 3IVFA 3VAWA 4PT5A 3DVGX 1V8CA 3VRBB 3MJWA 4W9HA 3V6CB 2KFKB 4GXBA 1UNSA 2NS5A 2L32A 2N7EA 4EEWA 2K22A 3EC8A 5E6PA 2W3RA 4HCPB 1WJ6A 3HVZA 3PVLA 4A55A 2WGSA 2GI9A 4C56C 2L05A 5E6OA 4US8A 3QARA 2JWZA 4ZRJA 5JHBA 1Y56A 3H8HA 2WXOA 4A9AA 2WXFA 4J6IA 1EF1A 3H7PB 2BVCA 2Y5BB 3RPFC 1FEHA 2IGGA 4ZHPA 2M8SA 1WXAA 1IUEA 1FNUA 3U30A 3VTVA 4HKQA 3UQAA 1WGKA 5J17A 4YWGG 4DHZE 5TSSA 2M0AA 2LD9A 2M4NA 2AX5A 2C7NB 2JX5A 2KDBA 4HROA 5DPRA 3EGRA 4K81A 3CSFA 4EE2A 3KYCD 2A5UA 2FCMA 3CF4A 1CJEA 4ANUA 2FAZA 3ZDTA 3DHGC 4O1NA 4P1CC
chains in the Genus database with same CATH topology
4XWTA 3SR6A 2CJNA 4M0WA 1C9FA 3LYYA 3W9CB 1YN5A 1H7XA 3U52E 2K5PA 2LHDA 1I4HA 1JCKB 2MJ3A 4WQMA 2BTEA 2QIEB 1ESFA 2D5GA 1C78A 5D3IB 4YXDB 1YN4A 2FBWB 2G1EA 3W1SA 4D2KA 3KWVA 1L0XB 2MEKA 2DYOA 1B9RA 1F2RI 3Q69A 2CU3A 4ARIA 5C3JB 1ROEA 1SE3A 2M56B 4AS1A 1ET9A 3HUIA 1XEEA 2BT6A 2ONQA 1XF5L 3AEGB 3I9V1 2CJOA 4MACA 3MFGA 1IGCA 3AEDB 2M19A 1VZ7A 2I2YA 5HHDG 2MH7A 3HRDD 2W82A 1KH0A 4L1BA 4KGRA 3WCQA 2J42A 2IGHA 2NMQA 3NVWA 3V3XA 1TY2A 1P7EA 1E6EB 2DLBA 2J53A 4ZOHC 3RFZB 4ZYSA 3KQ4A 3AV8A 4O1NA 2GB1A 2PLPA 3SFDB 4OZCA 1WSPA 1QOGA 3VR9B 5BYQA 1L4DB 2HDEA 5BMGA 4N59A 1I4RA 2L83A 4RFBA 1TKEA 1MHHE 1GTHA 4NJCA 1FMAD 4YT0B 1WRIA 5JXVA 2ON8A 3AEFB 1SE4A 4KGTA 1VLBA 4DQOC 2YEPB 3FAHA 2R61A 2FE8A 5H92C 1FNVA 3BZDB 3KLSX 2SAKA 1QKZA 1I4PA 2JU6X 3ZYYX 4MH8A 1B1ZA 2WXNA 1TS2A 2IJ0A 1PGBA 1HXYD 1FXAA 2KACA 1ET6A 1D6EC 3Q8BA 1PYWD 3T3NA 2DYMA 3C8YA 3I57A 4P6VF 4FXCA 5BYSA 1DOYA 3Q8CA 2H89B 2L1AA 5EE3A 2WXPA 1TS4A 3AN1A 4JPSA 3V05A 1TS5A 3P1MA 4YSXB 2DBYA 2WDVB 2LUMA 1AYFA 4WIPA 2V0GA 2EELA 2JQRB 1L0VB 1XCQL 1WWTA 1HQRD 4WAFA 1MI0A 1HZ5A 3HVDA 2WDQB 3BVMA 5G5HA 4C7ZA 1C79A 1SSNA 3TUOA 2FUG1 2WXLA 1FFVA 2RDHA 4RNAA 4DXGA 5FR3A 1QOAA 1N5XA 5G5GA 1YNTE 1V97A 1TZOA 2IPKD 2QSDA 3IAM1 4JE3B 4TQ1A 1YJIA 1L6VA 1KTKA 1N5WA 4REZA 2LHEA 3NVVA 1F2RC 1DOIA 3E56A 3PZ8A 4WWMA 2IGDA 3BK1A 2JWUA 3ZQ4A 2PMVA 1ZDXA 2JXTA 2K0PA 1SE2A 1VR9A 3J9CA 1QLBB 1WYGA 3NRZA 2INPE 1KLGD 1H7WA 4JWSC 1V1OA 1NYRA 2KN4A 4HKZE 3AE3B 4YTNB 4HRSA 4MT5A 4C80A 1C4AA 5I4DA 2AQ3B 2LJIA 1D5ZC 1M4VA 2V3NA 1C4CA 2KDMA 2IDYA 1LO5D 4NAMA 3AE9B 1L4ZB 1C77A 1N63A 2QJLA 3B2FA 5LNK1 2L52A 2BS2B 3P42A 5T8IA 1KFYB 1TYGB 3BK2A 4YTPB 1TKGA 3IT6B 3U7ZA 4DXFA 1TY0A 1J7CA 3UI3A 1MHXA 1TS3A 1L5PA 3BIID 3AECB 1SJED 2WDRB 2WXIA 4IKGA 1JWBD 1UWXA 2KAJA 3N9YC 3TEYA 3Q8AA 1I4XA 1C76A 1R7SA 3KWLA 3W5VB 3AE2B 1KRHA 4GDLB 4HEA1 1T5XD 1TJEA 4UDUC 2Y3AA 2J4XA 1QF6A 4TMAB 2BB5A 5GXGB 1VZ6A 1RWSA 2SEBD 1ENFA 2VZKB 2W54A 1YMHE 4XDCA 1J7AA 1GAQB 1MVKA 2EKIA 4KKIA 3TEXA 3U4EG 3P4QB 5HI1A 1ZDVA 1NENB 1EU4A 1T6BX 1V1PA 3BYTB 1D5MC 1ZXIA 4USAA 1WXQA 5BMHA 1V1PB 1XLQA 4LK0M 1XLPA 2WXKA 1ZPSA 1FNWA 3EUB2 1RYJA 1OQRA 3E9SA 2BS4B 4RGNA 1ZP0B 1FFUA 1VRAB 3B2GA 1RFKA 1SF0A 1HEZE 2ACZB 4TQ0A 2LEKA 3SEBA 4JWUC 5EE0A 4YTMB 1GB1A 1CQVA 5MPOA 1KF6B 3GP7A 2GRIA 1AWDA 1ZOYB 1GPXA 2XNAC 1C4PA 4ARCA 1EWCA 1I7HA 4OZAA 1F0ZA 3ABVB 1I4QA 4OVZA 2BBCA 1E9MA 1T3QA 1DOXA 1JWUD 1BUIC 1D5XC 3MHZA 5D3DA 2V3PA 1UWMA 3URYA 2INNE 2JYEA 4KX6B 1F77A 1PFDA 4GLSC 4KGSA 4CQNA 1E10A 4LTUA 3AEAB 1YQ4B 1NEKB 3AEBB 4GDKB 2ZW0A 4N6EB 4LLGM 4RCOA 1BMLC 1SBBB 1K52A 3GB1A 4RGOS 2W3SA 5FK9C 1QQRA 4A8XC 4WH4A 2PVOD 4RH6A 1N61A 4JX1C 3NVYA 3TEZA 2V4IB 2NTSA 1XCTL 1ZE3D 2ICIA 2PKOA 1UGJA 4H2AA 3ZGZA 1OFFA 1FXIA 3ZJUA 1SIJA 2WQYB 2RMMA 3T3OA 3AB5A 3BWUD 1RM6C 3Q8FA 5HFYA 4RF0A 1FO4A 2WXRA 3AE6B 3PO0A 5HG2A 3ETRA 5AUKA 2YEPF 1IBXA 4IDIA 3BYYB 2WXGA 2N0SB 4YSYB 2G9HD 2QMTA 2WXQA 3O13A 1XLOA 3ZJTA 4ZRPA 1XXGA 3AMZA 2LGIA 1GB4A 1GOZA 2J52A 2KMMA 1AN8A 4N58A 3LXFA 5E6JA 4B0MA 3FILB 1BXTA 2TSSA 3NUHB 3P4PB 2DWQA 5BYRA 1PGXA 1JWAD 3R2IA 3L4PA 1GTEA 3MC0B 2Y5PA 1NI3A 3GS2A 1JROA 1SXTA 1JWSD 3OWEB 4XE0A 4NZLB 4XDDA 4KKJA 4TSSA 1ACCA 1SEBD 4HJGE 1YJJA 1L0YB 3P4SB 4OHJA 1VZ8A 3FILA 3VR8B 1FCLA 3TSSA 1EWYC 4MM3B 3FC4A 3P4RB 2WXMA 2LMCA 1FRRA 3U2SC 1P7FA 1JQ4A 1GT8A 2PW9A 1VDVA 1JALA 2PVGC 5H8YE 4ZHOA 1K53A 3ZJVA 1DGJA 5FKAC 3R8BA 3P63A 1KLUD 2WXJA 1YN3A 1K51A 1PGAA 1JMLA 1NVID 1VJKA 1DYQA 3AEEB 4WURA 2N9KA 1E7PB 3DWMA 3CIRB 3W2DA 2JYTA 2NTTA 4B0EA 4Q2JA 2K3UA 2X38A 5D7GA 4R3DA 2BB6A 3R2TA 1JW9D 2KQ4X 1QT9A 4RGMA 1NYQA 4OZBA 1XO3A 1N62A 1IGDA 2PTLA 3IT4B 2MJDA 1QOFA 1UUPA 1HA5A 2H88B 3AE8B 1FIQA 2KWDA 5AUIA 1JRPA 1JWMD 4A6QA 3TEWA 4RF1A 2WP9B 1MPEA 3IXSA 4P16A 2Y5CA 4AQ7A 1QOBA 2W55A 1D4BA 1YQ3B 4OW0A 2LFIA 1AW7A 3AE7B 1EM7A 1FM0D 1Q10A 1E0ZA 3NVZA 2N7JA 5EE1A 2WU2B 2JZPA 1CZPA 1OQQA 5C2TB 3BVGA 4PT5A 3PZ7A 2Q5WD 1V8CA 2N9LA 2RDGA 2WNMA 3VRBB 3AE5B 2E6XA 1UNSA 2WU5B 2XN9C 4L2YA 3DWGC 2HTME 2L32A 1SB3C 2B76B 3MP9A 2K22A 2ZW1A 4YSZB 1ZUD2 1XLNA 2BS3B 2W3RA 3HVZA 2I38A 1SJHD 3Q8EA 4L23A 1STEA 1CK1A 2PIAA 3VQIA 2Z8LA 3AE1B 3VRAB 3MJ5A 4A55A 3AE4B 1EU3A 1FCCC 1TKYA 3B9JA 2GI9A 3EA6A 4C56C 4US8A 4NAWB 1HZ6A 3LB8C 1A70A 1Y56A 3H8HA 2WXOA 4A9AA 2WXFA 4US9A 3IAS1 1PDXA 1I4GA 4ZRQA 2WS3B 3RPFC 1J7BA 1FEHA 1K50A 3NS1A 2IGGA 3SFEB 4ZHPA 1L6UA 1IUEA 2AQ2B 1FNUA 1PUTA 5EE9A 4HKQA 2JSVX 2OEDA 3CWIA 3AM9A 4RGTA 2MJEA 1WGKA 1QILA 4YWGG 3BVZA 5TSSA 2M0AA 2QEJC 2AX5A 2JX5A 2E3TA 2AQ1B 2VZKD 1FD6A 1IBXB 4HROA 4XWWA 3EGRA 2BW2A 4IOIE 2BYTA 5BMIA 2K9XA 4EE2A 3AH7A 1N60A 4J3OD 2QILA 2RPVA 2WXHA 3CF4A 1CJEA 2WLBA 3W5UB 1ZXHA 4C7YA 1FRDA 3NZ3A 2OHFA 4ITKA 4A90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR6 A;  1YJI A;  2CJN A;  1UWM A;  1L6V A;  1JW9 D;  1N5W A;  4KX6 B;  1QT9 A;  3W9C B;  3NVV A;  1H7X A;  1NYQ A;  1PFD A;  2K5P A;  1DOI A;  4WWM A;  1E10 A;  2MJ3 A;  4WQM A;  4LTU A;  1XO3 A;  2QIE B;  3AEA B;  1N62 A;  1YQ4 B;  1NEK B;  2FBW B;  3AEB B;  4YXD B;  1QOF A;  2G1E A;  2MJD A;  1QLB B;  2H88 B;  3AE8 B;  1FIQ A;  1WYG A;  3NRZ A;  4N6E B;  5AUI A;  1JRP A;  1H7W A;  4JWS C;  1B9R A;  1NYR A;  2CU3 A;  2W3S A;  5C3J B;  1ROE A;  3AE3 B;  4YTN B;  2M56 B;  2WP9 B;  4HRS A;  4C80 A;  2PVO D;  2Y5C A;  3HUI A;  1N61 A;  2BT6 A;  1QOB A;  4JX1 C;  3AEG B;  2W55 A;  1YQ3 B;  3NVY A;  3AE9 B;  2CJO A;  2QJL A;  3AE7 B;  1N63 A;  2PKO A;  1FM0 D;  3B2F A;  1OFF A;  2L52 A;  1FXI A;  3NVZ A;  2BS2 B;  3AED B;  2M19 A;  5EE1 A;  1E0Z A;  1KFY B;  1TYG B;  2WU2 B;  2WQY B;  4YTP B;  1CZP A;  1TKG A;  1SIJ A;  1OQQ A;  2MH7 A;  3AB5 A;  5C2T B;  1RM6 C;  3HRD D;  1J7C A;  2Q5W D;  1V8C A;  3WCQ A;  1L5P A;  3VRB B;  3BII D;  3AE6 B;  3AEC B;  3PO0 A;  3AE5 B;  1FO4 A;  2WDR B;  3ETR A;  5AUK A;  4IDI A;  3NVW A;  2WU5 B;  1JWB D;  2N0S B;  2KAJ A;  3DWG C;  2HTM E;  4YSY B;  1E6E B;  1R7S A;  1SB3 C;  3KWL A;  2B76 B;  4ZOH C;  2K22 A;  3W5V B;  1XLO A;  3AE2 B;  1KRH A;  4YSZ B;  1ZUD 2;  1XLN A;  2BS3 B;  1TJE A;  2W3R A;  3AV8 A;  3HVZ A;  3SFD B;  3AMZ A;  1QF6 A;  2PIA A;  4N58 A;  2KMM A;  3AE1 B;  3VRA B;  1QOG A;  3LXF A;  3VR9 B;  3AE4 B;  5GXG B;  1TKY A;  3B9J A;  4N59 A;  2L83 A;  1RWS A;  2W54 A;  3P4P B;  2DWQ A;  4US8 A;  1TKE A;  1GTH A;  1JWA D;  3LB8 C;  1J7A A;  1FMA D;  1A70 A;  1GTE A;  1GAQ B;  2EKI A;  4YT0 B;  1WRI A;  3L4P A;  4A9A A;  3AEF B;  1NI3 A;  1VLB A;  3P4Q B;  4US9 A;  3FAH A;  1NEN B;  1JRO A;  5H92 C;  1PDX A;  1ZXI A;  3ZYY X;  4USA A;  1WXQ A;  2WS3 B;  1XLQ A;  3RPF C;  1YJJ A;  1J7B A;  3NS1 A;  1XLP A;  3P4S B;  3VR8 B;  3SFE B;  1FXA A;  4ZHP A;  1L6U A;  3EUB 2;  1RYJ A;  1EWY C;  1OQR A;  1IUE A;  3P4R B;  3FC4 A;  1PUT A;  2BS4 B;  5EE9 A;  1FRR A;  1JQ4 A;  4P6V F;  4FXC A;  1GT8 A;  1ZP0 B;  3CWI A;  1FFU A;  3AM9 A;  1DOY A;  2MJE A;  1WGK A;  3B2G A;  1VDV A;  1JAL A;  1RFK A;  2H89 B;  2PVG C;  1SF0 A;  5EE3 A;  5H8Y E;  2ACZ B;  4ZHO A;  3AN1 A;  2LEK A;  1DGJ A;  2AX5 A;  3P1M A;  4YSX B;  2DBY A;  2JX5 A;  2E3T A;  4JWU C;  2WDV B;  4YTM B;  4HRO A;  5EE0 A;  1AYF A;  5MPO A;  1KF6 B;  2JQR B;  1L0V B;  3P63 A;  1WWT A;  2K9X A;  2WDQ B;  1AWD A;  1ZOY B;  1N60 A;  3AH7 A;  5G5H A;  1VJK A;  1NVI D;  4C7Z A;  1GPX A;  3AEE B;  1I7H A;  1FFV A;  3CF4 A;  1CJE A;  1E7P B;  3ABV B;  3CIR B;  2WLB A;  3DWM A;  3W5U B;  1F0Z A;  4C7Y A;  1QOA A;  1E9M A;  1T3Q A;  1N5X A;  5G5G A;  1V97 A;  1DOX A;  1FRD A;  2OHF A;  4ITK A; 
#chains in the Genus database with same CATH topology
 2JUO A;  4W9F A;  1C9F A;  1K8R B;  2FNJ B;  2K5P A;  1I4H A;  4WQM A;  2QIE B;  2KJ6 A;  5D3I B;  2GLS A;  4YXD B;  4ANX A;  1E8W A;  2MEK A;  2DYO A;  4IWO A;  5C1Z A;  1GNU A;  4K7S A;  4ARI A;  2ZEQ A;  1SE3 A;  4KIK B;  2M56 B;  4MEM A;  3HUI A;  2CR5 A;  3WAN A;  2ONQ A;  3I9V 1;  1AAR A;  2CJO A;  4MAC A;  3V61 A;  2KO3 A;  2MCN B;  3VXW A;  4PS3 A;  2G4S A;  3A9J A;  3RUL A;  4DBG A;  4AJW A;  4FJY A;  1TY2 A;  1P7E A;  4ICU A;  2L8J A;  2MA9 B;  2PLP A;  3ML9 A;  4OZC A;  3ZTD A;  3VHT C;  3VR9 B;  3M63 B;  4M00 A;  1Q0W B;  1WGR A;  2EKE C;  1UF0 A;  2NBV B;  3NG0 A;  2ON8 A;  2C9W B;  4KGT A;  1VLB A;  3DVN V;  2YEP B;  3FAH A;  3DBH I;  3JSV A;  1FNV A;  3KLS X;  1OGW A;  2SAK A;  1QKZ A;  3ZYY X;  4DHJ D;  2IJ0 A;  2JRH A;  1HXY D;  4XC2 A;  2KDI A;  1ET6 A;  3Q8B A;  2C7H A;  2KTR B;  1IYF A;  1T0Y A;  4FXC A;  5BYS A;  3QCA A;  3Q8C A;  5EE3 A;  1P9D U;  3AN1 A;  2IO1 B;  3PHX B;  4YSX B;  2WDV B;  2LUM A;  4S17 A;  4NY0 A;  2JQR B;  1L0V B;  4FN2 A;  1HQR D;  2QHO A;  3LJ3 A;  4C7Z A;  1SSN A;  1C79 A;  4BBN C;  1TBE A;  3DBH B;  4HVB A;  4DXG A;  4KZC A;  2EMS A;  2UYZ B;  4F8C B;  4EFO A;  2QSD A;  4JE3 B;  2DYB A;  1KTK A;  3NVV A;  4I6N B;  3ZQ4 A;  2PMV A;  1ZDX A;  3RNA C;  1QLB B;  1WYG A;  4PS8 A;  4JWS C;  4IWP A;  4PS7 A;  1NYR A;  1LGR A;  3DVG Y;  3M3J A;  2AQ3 B;  4FAD A;  2NBW B;  3AUL A;  2IDY A;  1LO5 D;  3ZW3 A;  3T8M A;  1C77 A;  2GBM A;  5LNK 1;  3P42 A;  1TYG B;  3DHH C;  4YTP B;  1YOV B;  4DXF A;  4LCD E;  1J7C A;  3UI3 A;  1MHX A;  1TS3 A;  5C23 A;  2PPH A;  4IKG A;  2KAJ A;  4F7Z A;  4JL9 A;  3W5V B;  3AE2 B;  1KRH A;  3Q3M C;  2ZCB A;  5D94 A;  1C3T A;  3QK0 A;  5GXG B;  3W1Y A;  3NS8 A;  1WZ0 A;  1MVK A;  2DAJ A;  4KKI A;  3TEX A;  1NEN B;  1EU4 A;  1V1P A;  2K6D B;  4USA A;  1WXQ A;  4K3C A;  4NJ6 A;  4KIK A;  4N9F 4;  1XLQ A;  2KVZ A;  4LK0 M;  1IP9 A;  4IUM B;  1FNW A;  3EUB 2;  1OQR A;  2KK8 A;  2NVU I;  1ZKH A;  4RGN A;  1FFU A;  1VRA B;  1RFK A;  1UD7 A;  4BAX A;  4DDG D;  1GB1 A;  5J18 A;  4BBN F;  3K9P B;  1AWD A;  1LFD A;  4MJS B;  1TT5 B;  2LXC A;  1I7H A;  1F0Z A;  3RNF C;  1DOX A;  1Q1O A;  4G50 A;  2L0F A;  1D5X C;  3NHE B;  1UWM A;  2C7M B;  3JYU A;  4XYC A;  4I6P A;  4LTU A;  4GGQ A;  2J0J A;  1HTO A;  2AYO B;  4GDK B;  3ZVV A;  4RCO A;  3ZLZ A;  1HE8 A;  2W3S A;  3N1Z C;  3OG5 A;  3UIP B;  5KHQ A;  5BO4 B;  2Z59 B;  1ZE3 D;  3PGE A;  3ZGZ A;  1FXI A;  1SIJ A;  2IY0 B;  3AB5 A;  3BWU D;  3Q8F A;  5HFY A;  4RF0 A;  2WXR A;  3PO0 A;  5HG2 A;  3ETR A;  1MJD A;  2JXX A;  3PSE B;  5AZF A;  3O13 A;  4II2 B;  3ZJT A;  3CF6 E;  3TCA A;  3PLU A;  3Q3O C;  4II3 B;  4N58 A;  5E6J A;  3LXF A;  1YQB A;  2TSS A;  3P4P B;  5BYR A;  4WAA A;  5AZG A;  3GS2 A;  1JRO A;  4BKS A;  4HCN B;  1L7Y A;  1L0Y B;  3PHW B;  3TSS A;  2LXA A;  4MM3 B;  3P4R B;  2GBN A;  1J8C A;  1FRR A;  3DDC B;  1I35 A;  4JQW C;  5H8Y E;  1K53 A;  1DGJ A;  4MGZ E;  3C0R B;  1UGM A;  5DPT A;  2BGF A;  3EFU A;  3A9J B;  1PGA A;  1VJK A;  1NVI D;  5JH5 C;  1GUA B;  3DWM A;  4EZJ A;  3W2D A;  2WWZ A;  3L0W B;  5IA7 A;  5CHV C;  4Q2J A;  1GC7 A;  2GBJ A;  4R3D A;  5D7G A;  1UH6 A;  3OJ4 B;  4QAY A;  2L00 B;  4OZB A;  1XO3 A;  2K8C A;  1UUP A;  3I3T B;  2KWD A;  1JWM D;  3ONS A;  2WP9 B;  1NI2 A;  4P16 A;  3RZF A;  3H1U A;  2GOW A;  1D4B A;  2IBI B;  1AW7 A;  1FM0 D;  1YJ1 A;  1E0Z A;  2N7J A;  1VD2 A;  1R4N I;  2KXJ A;  1OQQ A;  5C2T B;  2Q5W D;  2N9L A;  3ZNH B;  2WNM A;  3ALB A;  3AE5 B;  1WX7 A;  2A4Z A;  4KSK C;  3A4R A;  2E6X A;  3VTU A;  3IBE A;  2HTM E;  2KFK A;  2B76 B;  1SIF A;  2IO0 B;  2ZW1 A;  2BS3 B;  3Q8E A;  3VQI A;  1STE A;  2KNB A;  3QC8 B;  3AE4 B;  1FCC C;  1WGH A;  1HZ6 A;  3LB8 C;  4NQK E;  3WIM A;  3CST A;  2KC2 A;  2J0M A;  5CTR C;  3ZRF A;  4ZRQ A;  5DPW A;  3RNE C;  2FCQ A;  2JT4 B;  5EE9 A;  2M17 A;  4WWN A;  2OED A;  3CWI A;  5JZE B;  2MJE A;  4ACF A;  3BVZ A;  4FBJ B;  5D6J B;  3PV1 A;  1TZ1 A;  3UGB B;  2KQS A;  3DBL I;  2BYT A;  2ASQ A;  2QC8 A;  4J3O D;  4WJN A;  2RPV A;  2WLB A;  1ZXH A;  1FRD A;  4ITK A;  4TUU A;  4XWT A;  2CJN A;  5IO9 A;  4WWP A;  3U52 E;  2MJ3 A;  4XX5 A;  1C78 A;  1XQQ A;  3EFC A;  1YN4 A;  2G1E A;  1B9R A;  3Q69 A;  4S0R A;  1FPY A;  2ZVN A;  5C3J B;  1E90 A;  1ROE A;  2FCS A;  1XEE A;  2M0X A;  1V6E A;  2INC C;  4OVU A;  1HTQ A;  3AED B;  1VZ7 A;  2DZK A;  4WJQ A;  3A9K A;  3WCQ A;  2J42 A;  3DBR I;  3NVW A;  2KAN A;  1E6E B;  2J53 A;  3ZNI D;  3KQ4 A;  2ZNV C;  2L76 A;  4A3O A;  1L4D B;  3QX1 A;  4N59 A;  4RFB A;  1TKE A;  1GTH A;  4NJC A;  2C60 A;  2PE9 A;  3PRM B;  1I4P A;  1S1Q B;  1XD3 B;  4MH8 A;  4GDK A;  3TBL D;  2IY1 B;  5EDS A;  4YL8 A;  4W9K A;  1PGB A;  1FXA A;  2GBK A;  2KAC A;  1D6E C;  2CKH B;  2W9N A;  3T3N A;  3VTW A;  3I57 A;  3R7Q A;  3HIZ A;  2LVQ A;  1WXV A;  2KTR A;  3X23 A;  4W9G A;  2WXP A;  4B95 A;  4K1R B;  1MG4 A;  4W9J A;  2LRU A;  1WWT A;  4WAF A;  1S3S G;  1KLV A;  2RDH A;  2ZNV B;  4RNA A;  4FHJ A;  1N5X A;  1YNT E;  1V97 A;  2IPK D;  2HE7 A;  4TV3 A;  2MBQ A;  2LHE A;  1F2R C;  4F1S A;  4WWM A;  2KMC A;  2B3A A;  4HWI B;  2R2O A;  1KJT A;  2JXT A;  3A1Q B;  1VR9 A;  3PRZ A;  2INP E;  1H7W A;  2KN4 A;  2LWP A;  2OJW A;  4HKZ E;  4HRS A;  2MW5 A;  2N9X A;  1C4C A;  2KDM A;  4NAM A;  3VUW A;  2QJL A;  1GC6 A;  2LGX A;  2JZ3 B;  4CYE A;  2L52 A;  5T8I A;  1UZX B;  1WXM A;  1WXS A;  2XK5 B;  3MC9 A;  1WY8 A;  3AEC B;  5IP4 D;  2I1J A;  4GN1 A;  1JWB D;  3KUD B;  1UWX A;  2DZJ A;  3OJ3 A;  1TGZ B;  1T5X D;  2O6V A;  1H8C A;  2BB5 A;  1VZ6 A;  1WJN A;  2FUH B;  3DCG A;  2VZK B;  1ENF A;  4KVG B;  2DX5 B;  5LLI A;  4BKG A;  1ZDV A;  2NPT B;  1F52 A;  3N32 A;  3BYT B;  1D5M C;  1V1P B;  4AUQ C;  1XLP A;  3QWZ B;  1UEL A;  2D3C A;  1RYJ A;  2YLM A;  3APF A;  3AI5 A;  3R7R A;  2LJ5 A;  3B2G A;  4M02 A;  1HEZ E;  4A20 A;  2ACZ B;  3KVF B;  2AWT A;  4JWU C;  2JF5 A;  3H7P A;  5MPO A;  3GP7 A;  1ZOY B;  2N1W A;  2XNA C;  1C4P A;  4OZA A;  5IKC M;  3ABV B;  2BBC A;  1JWU D;  3MHZ A;  2BQQ A;  2V3P A;  2INN E;  4FA6 A;  4KX6 B;  4G0N B;  2NBU A;  2BKR B;  3NJT A;  4EZL A;  2HTH A;  3PTF C;  4LLG M;  4RGO S;  2JY6 A;  5CX3 A;  1QQR A;  1CMX B;  4WH4 A;  2PVO D;  5TR5 A;  3NVY A;  3QA8 A;  5AEK B;  2V4I B;  4B6W A;  1D3Z A;  4WJO A;  3SD5 A;  1LM8 B;  1GJZ A;  1Z5S B;  4EUT A;  3TIX A;  1XLO A;  3U8Z A;  1GB4 A;  2MBH A;  2OJR A;  1AN8 A;  1H4R A;  3V60 A;  4MEL A;  3FIL B;  5L95 C;  3KUC B;  3MC0 B;  2Y5P A;  3Q6B A;  2REX A;  2KVR A;  1SXT A;  1R4N B;  1JWS D;  1OQY A;  2CHX A;  1SEB D;  4W9C A;  4OHJ A;  3P4S B;  4DDI D;  3QIJ A;  2KT7 A;  4JGH B;  2KZR A;  3O65 B;  1GT8 A;  4IM2 A;  3VUX A;  1JAL A;  2XK5 A;  3ECI A;  4KDL B;  4ZHO A;  2DZI A;  3V62 A;  1KLU D;  1K51 A;  2PJH A;  1JML A;  1GG3 A;  1DYQ A;  1E7P B;  1JRU A;  3CIR B;  1E5W A;  4B0E A;  2M1M A;  2NTT A;  3H6N A;  1R4M B;  4FLH A;  2X38 A;  2BB6 A;  3IG3 A;  1JW9 D;  3R2T A;  4DXA B;  2KQ4 X;  1QT9 A;  4RGM A;  2BWF A;  1NYQ A;  1WE6 A;  3N1Y C;  2KYW A;  1IGD A;  3Q3F A;  4M01 A;  3SHQ A;  1QOF A;  1WYW B;  2KHW B;  5CHW A;  1MPE A;  2AL6 A;  3BY4 B;  4KV2 A;  2W55 A;  1YQ3 B;  3ZXR A;  4P1B C;  1Q10 A;  1WJU A;  3RNB C;  2BYE A;  4E3C A;  2WU2 B;  2KWV B;  2V3S A;  1ISN A;  4M8M A;  3PZ7 A;  4MH0 E;  4ANW A;  2RDG A;  3N3K B;  3MHS D;  2KWC A;  3AU4 A;  2WU5 B;  2XN9 C;  4L2Y A;  3DWG C;  1IPG A;  3W1S C;  4YSZ B;  1ZUD 2;  1XLN A;  3KYD D;  2PIA A;  3MJ5 A;  4FJZ A;  1MFW A;  1WMH A;  2KKC A;  4NAW B;  4G11 A;  2WX1 A;  1PDX A;  1I4G A;  1RRB A;  2J7Q B;  4ZRI A;  1J7B A;  1K50 A;  3NS1 A;  4GDL A;  3SFE B;  3OAW A;  2AQ2 B;  1Z2M A;  3WA0 A;  4RGT A;  2RGF A;  1QIL A;  2KJH B;  4K7U A;  2JRI B;  1FD6 A;  2VZK D;  2AQ1 B;  5J2R A;  4XWW A;  1V5O A;  3NZU A;  2BW2 A;  4IOI E;  1J0G A;  5BMI A;  2LI5 A;  2K9X A;  3DHI C;  2WXH A;  4C7Y A;  1V9J A;  3BIN A;  3FIL A;  3SR6 A;  4M0W A;  4ASW C;  4EKU A;  3W9C B;  1H7X A;  5DCN A;  1JCK B;  2G3Q B;  4RM9 A;  2BTE A;  2D5G A;  1PQS A;  2FBW B;  3KWV A;  1L0X B;  3DPD A;  3OLM D;  2KN5 A;  1M94 A;  4NNJ B;  1ET9 A;  3KW5 B;  2PEA A;  1XF5 L;  1WI0 A;  3UQB A;  2D10 A;  4LDT D;  3MFG A;  5LXH A;  2M19 A;  5HHD G;  5IAA C;  4RMA A;  2MH7 A;  2WX0 A;  2W82 A;  4L1B A;  4PYZ A;  4LJP B;  3RUI B;  3A33 B;  2BWE S;  2ZPY A;  2IGH A;  2NMQ A;  3PLV A;  3V3X A;  2DLB A;  4ZYS A;  1E8Y A;  3SFD B;  2J0K A;  1G6J A;  3GE3 C;  4M8N A;  3EHV A;  3APD A;  4A3P A;  2HDE A;  5BMG A;  1P1A A;  3H9D A;  2CS4 A;  4KSL C;  2LGS A;  4YT0 B;  1WGD A;  1WRI A;  5JXV A;  1SE4 A;  4IM0 A;  2MWS B;  4MGK E;  2MX2 A;  2R61 A;  2FE8 A;  5H92 C;  1FXT B;  4GIV A;  2WXN A;  1TS2 A;  4HPM B;  4AP4 C;  1PYW D;  2DYM A;  4LDT B;  4G3X B;  2HD5 B;  2O2V B;  1DOY A;  2L1A A;  4FUL A;  1R4M I;  4KDI C;  2O2V A;  3DBS A;  1TS4 A;  4JPS A;  1TS5 A;  3P1M A;  2DBY A;  4TKN A;  2EEL A;  3A4S C;  3P2B A;  1XCQ L;  1MI0 A;  3HVD A;  2WDQ B;  2PE6 B;  1WE7 A;  2BYV E;  2FUG 1;  3WAO A;  1LQB A;  2QDF A;  3X0W A;  3CMM B;  4AWJ A;  3HK0 A;  2MRP A;  4DK5 A;  4REZ A;  2NCN A;  3E56 A;  2MP2 B;  1N6Z A;  1F1H A;  2JWU A;  2K0P A;  3NRZ A;  1KLG D;  1WRD B;  1T0Q C;  1YX6 B;  4C80 A;  1C4A A;  4MJS A;  2LJI A;  3DBR B;  4E74 A;  2V3N A;  3WAL A;  3AXC A;  2Z0E B;  3AE9 B;  2K39 A;  3B2F A;  4PK1 A;  3BK2 A;  4ANV A;  3ZO5 B;  3IT6 B;  2V1Y A;  3ZUN A;  4JLC A;  1EUV B;  1L5P A;  3BII D;  1SJE D;  3N9Y C;  1RLF A;  3Q8A A;  3ZXV A;  3TEY A;  3T9L A;  2CU1 A;  4HEA 1;  4PYU A;  2Y3A A;  3B08 A;  2J4X A;  3IFW B;  4TMA B;  4C4V A;  2KX3 A;  4XZ4 A;  1RWS A;  4HXD A;  1YMH E;  2JZZ A;  1GAQ B;  2JPH A;  1Q5W B;  5HI1 A;  1T6B X;  3KH0 A;  3ZKJ C;  3PPA A;  2GBR A;  5BMH A;  4GSW A;  2N4F A;  1ZPS A;  1WFY A;  4AOF A;  2D2Q A;  4DHJ B;  2BS4 B;  1WX9 A;  3K9O B;  1ZP0 B;  1YX5 B;  3GE8 C;  4TQ0 A;  2RPQ A;  3SEB A;  5EE0 A;  4YTM B;  3TMP B;  2ZZP B;  2BF8 B;  1CQV A;  2GRI A;  2CHW A;  1GPX A;  3R3M A;  4ARC A;  1EWC A;  4BOS C;  1I4Q A;  4DWF A;  1E9M A;  1T3Q A;  1BUI C;  5D3D A;  1RFA A;  3URY A;  2JYE A;  1F77 A;  1V49 A;  4GLS C;  4CQN A;  3AEA B;  2DZM A;  3AEB B;  3HM6 X;  5CHF A;  5DPS A;  3A9K B;  2YVC A;  3AU5 A;  4N6E B;  2AL3 A;  1K52 A;  1WH3 A;  2LRW A;  2O6V D;  4RH6 A;  1N61 A;  4JX1 C;  2KTF A;  3TL5 A;  4MGI E;  3ZNZ B;  3TEZ A;  3EEC A;  2G45 B;  1UGJ A;  4H2A A;  4IM3 A;  2WQY B;  5IOI A;  2ZCC A;  3T3O A;  1RM6 C;  3JVZ X;  4BZA A;  2EMT A;  1FO4 A;  3L10 B;  5AUK A;  2YEP F;  3UIO B;  4IDI A;  3BYY B;  3VH4 B;  2KJR A;  2N0S B;  4YSY B;  2G9H D;  2QMT A;  2WXQ A;  2IYD B;  3L13 A;  3I5J C;  4NPN A;  3AMZ A;  3KUZ A;  1GOZ A;  1TIF A;  2J52 A;  2KMM A;  2V4L A;  4HPL B;  4B0M A;  2MP2 A;  3ZNG C;  2N1V A;  3L4P A;  1NI3 A;  2X8X X;  2KQ7 A;  2RSU A;  3OWE B;  3PRP B;  4IG7 B;  5FR6 A;  2BKF A;  3VDZ A;  1VZ8 A;  1FCL A;  4ZRK A;  5GMV A;  1EO6 A;  1EWY C;  4HDQ A;  4E71 A;  2LMC A;  1XT9 B;  1P7F A;  1ZW7 A;  3QQ8 B;  2PW9 A;  2FID A;  1WR1 A;  3I63 C;  3QJZ A;  3JSV B;  5FKA C;  3PRE A;  3R8B A;  3A1Q A;  3U7D A;  2JVC A;  3AEE B;  2LUE A;  4WUR A;  2N9K A;  3RT3 B;  2K3U A;  4GU2 A;  1RAX A;  1WM2 A;  4C00 A;  2BYF A;  2XBB C;  2D11 A;  4EZK A;  2LVP A;  2UWQ A;  2KX0 A;  3IT4 B;  2MJD A;  3VUY A;  2H88 B;  3AE8 B;  2MBO A;  2K25 A;  5AUI A;  3Q14 C;  1JRP A;  2DAF A;  5JHA A;  3IXS A;  4AQ7 A;  1QOB A;  2GMI C;  4OW0 A;  2HJ1 A;  1L2N A;  3L08 A;  2O6V B;  5EE1 A;  1WGG A;  4LNK A;  3BVG A;  3GZN B;  1LXD A;  4ZYN A;  4CHK A;  1QZE A;  1SB3 C;  3MP9 A;  2WDT B;  1T0R C;  4JIO U;  2KC1 A;  2I38 A;  1SJH D;  4L23 A;  1CK1 A;  2Z8L A;  3AE1 B;  3VRA B;  2MQJ A;  1EU3 A;  3ZIM A;  2KLG A;  3ZDM C;  1TKY A;  3B9J A;  3Q2A C;  3EA6 A;  3GZN I;  1A70 A;  2XEW A;  4US9 A;  4HDO A;  4X57 B;  3IAS 1;  2MHJ A;  3APC A;  3RMK C;  2WS3 B;  4LNN A;  3NY5 A;  2UU7 A;  5IN7 A;  5HKH A;  1L6U A;  2D3A A;  1PUT A;  2RDB C;  2JSV X;  3AM9 A;  1C1Y B;  4WJP A;  2K8B A;  2QEJ C;  4K3B A;  4WQO B;  2E3T A;  1IBX B;  5G2N A;  1KOT A;  3AH7 A;  1N60 A;  2IND C;  4NJ7 A;  2QIL A;  1WR6 E;  2L7R A;  4P7I A;  3W5U B;  2KOX A;  3GOE A;  3V6E B;  4IW0 A;  3NZ3 A;  3UIN B;  2OHF A;  4A90 A;  3H7S A;  1A5R A;  3LYY A;  1YN5 A;  4M0W B;  2LHD A;  1ESF A;  3MC8 A;  3RD2 A;  3W1S A;  4D2K A;  2N7D A;  1UBI A;  1F2R I;  2CU3 A;  4AS1 A;  4WWO A;  4CO7 A;  2BT6 A;  3L16 A;  3AEG B;  3UF8 A;  3N20 C;  1OEY A;  4LNF A;  4IC7 B;  1IGC A;  3FKY A;  2I2Y A;  4MSM B;  2KFJ A;  2NR2 A;  4OVV A;  4NQL B;  3HRD D;  2L3Z A;  4RM8 A;  1KH0 A;  3TJP A;  4KGR A;  1WZ3 A;  4DHZ B;  2DHZ A;  4BKS D;  4ZDV A;  1V81 A;  4ZOH C;  3RFZ B;  3AV8 A;  3M62 B;  2GB1 A;  1WSP A;  2MLB A;  4MM3 A;  1QOG A;  5BYQ A;  3B1L X;  1I4R A;  2L83 A;  3WAM A;  1MHH E;  1FMA D;  3AEF B;  2K8H A;  4DQO C;  1U4A A;  3DBL B;  4MSQ B;  3BZD B;  3Q3J A;  2JU6 X;  2IO2 B;  3MTN B;  3Q3N C;  1WJ4 A;  1B1Z A;  2KDE B;  2I1K A;  3RNC C;  4LNO A;  1J19 A;  4HK2 A;  1P98 A;  4MDK E;  2IO3 B;  5E6N A;  2VH2 A;  3C8Y A;  4P6V F;  3SU8 X;  1KM7 A;  2KDF B;  2H89 B;  1BT0 A;  3V05 A;  3ZTC A;  1AYF A;  4WIP A;  2V0G A;  4LJO B;  2NPT A;  1HZ5 A;  3BVM A;  5G5H A;  3SDL C;  3TUO A;  2WXL A;  4ICV A;  1FFV A;  4LNI A;  5FR3 A;  1QOA A;  2RR9 A;  5G5G A;  1TZO A;  3ML8 A;  3IAM 1;  4TQ1 A;  1VCB A;  1YJI A;  2LVO A;  1L6V A;  1N5W A;  3JW0 X;  1E7U A;  1DOI A;  2D3B A;  3PZ8 A;  2IGD A;  3BK1 A;  4EOY A;  1UBQ A;  1T0S C;  3J9C A;  1SE2 A;  3IHP C;  3L54 A;  1SE9 A;  1V1O A;  3LDZ E;  3AE3 B;  4YTN B;  4MT5 A;  4W9D A;  5I4D A;  1D5Z C;  1M4V A;  1F9J A;  2BPS A;  1L4Z B;  1N63 A;  2D3G A;  2BS2 B;  1EF5 A;  4BKT A;  1WIA A;  1KFY B;  1TKG A;  2K1F A;  3U7Z A;  1TY0 A;  4BFR A;  4NAW A;  5AZH A;  2WDR B;  2WXI A;  4XGA B;  3HHM A;  3PZD A;  3KWL A;  1C76 A;  1I4X A;  1R7S A;  1X1M A;  4GDL B;  4UDU C;  1TJE A;  1QF6 A;  4URK A;  1WM3 A;  3M95 A;  4C4V B;  2SEB D;  2W54 A;  4XDC A;  2CHZ A;  1J7A A;  2EKI A;  3R66 C;  2KMA A;  3U4E G;  1MG8 A;  3P4Q B;  3VVW B;  1WGY A;  2FIF A;  3B0A A;  1ZXI A;  2LZ6 A;  2WXK A;  4FHK A;  1E7V A;  3WAP A;  3E9S A;  1V2Y A;  4W9I A;  1WMH B;  2LGY A;  5G55 A;  3VFK A;  1SF0 A;  2LEK A;  3S2A A;  2AEH A;  3QHT A;  1KF6 B;  3NOB A;  4GOC A;  3NZS A;  1P0R A;  2LGD A;  4OVZ A;  1OEY J;  1SGH A;  3VH3 B;  2N9E B;  1P3Q U;  1PFD A;  4GB9 A;  4KGS A;  3DVN U;  4B9K A;  1E10 A;  3DOW A;  1YQ4 B;  1NEK B;  2LAS A;  2ZW0 A;  1BML C;  1SBB B;  3GB1 A;  3RN9 C;  2VH1 A;  5FK9 C;  1ZGU B;  2K6Q A;  4A8X C;  5D2M B;  1WX8 A;  3PS6 A;  2KLC A;  4HPP A;  2NTS A;  4I6L B;  1XCT L;  2ICI A;  1OTR B;  2PKO A;  1OFF A;  1V80 A;  3ZJU A;  2RMM A;  2OOB B;  3RZW C;  2MSE D;  2C5L C;  4GMV A;  2IZV B;  3D32 A;  1NBF C;  1Y8R C;  3AE6 B;  3C19 A;  1IBX A;  2WXG A;  2ZJD A;  3DQV A;  2V9H A;  4HJK A;  2WHI A;  4ZRP A;  2DEN B;  1XXG A;  2LGI A;  2RD0 A;  2ZPN A;  1BXT A;  3NUH B;  2DWQ A;  1PGX A;  1JWA D;  3R2I A;  1GTE A;  2MBB B;  4BVU C;  2N9P C;  4XE0 A;  4NZL B;  2QCZ A;  4W9E A;  2R2Q A;  4IWQ A;  4KKJ A;  1ACC A;  4KZ0 A;  4TSS A;  4XDD A;  4HJG E;  1YJJ A;  3ZRC A;  3VR8 B;  4MGY E;  3FC4 A;  3L17 A;  2WXM A;  3U2S C;  1JQ4 A;  3N1X C;  1I42 A;  3HM3 A;  3RI7 C;  2L0T A;  1VDV A;  2PVG C;  4HLE A;  2KD0 A;  4FJV B;  3ZJV A;  1E8X A;  5L83 A;  3RNG C;  2Z0D B;  2KWU B;  2G4D B;  3P63 A;  1YIW A;  2WXJ A;  1YN3 A;  2FCN A;  2MBE A;  1V5T A;  4BOZ B;  2JYT A;  2ZVO A;  1V86 A;  2WYQ A;  1NDD A;  3PT2 B;  2VRR B;  3RYT A;  3ENE A;  4AJY B;  1N62 A;  1TTN A;  2PTL A;  3N30 A;  1HA5 A;  1FIQ A;  4A6Q A;  2DNF A;  2HJ8 A;  4W9L A;  5LXI B;  3TEW A;  4RF1 A;  5KHO A;  3QAQ A;  2Y5C A;  1WF9 A;  2D07 B;  2LFI A;  3AE7 B;  1EM7 A;  4K7W A;  1YD8 U;  3NVZ A;  1E8Z A;  3RCZ A;  2JZP A;  1CZP A;  3IVF A;  3VAW A;  4PT5 A;  3DVG X;  1V8C A;  3VRB B;  3MJW A;  4W9H A;  3V6C B;  2KFK B;  4GXB A;  1UNS A;  2NS5 A;  2L32 A;  2N7E A;  4EEW A;  2K22 A;  3EC8 A;  5E6P A;  2W3R A;  4HCP B;  1WJ6 A;  3HVZ A;  3PVL A;  4A55 A;  2WGS A;  2GI9 A;  4C56 C;  2L05 A;  5E6O A;  4US8 A;  3QAR A;  2JWZ A;  4ZRJ A;  5JHB A;  1Y56 A;  3H8H A;  2WXO A;  4A9A A;  2WXF A;  4J6I A;  1EF1 A;  3H7P B;  2BVC A;  2Y5B B;  3RPF C;  1FEH A;  2IGG A;  4ZHP A;  2M8S A;  1WXA A;  1IUE A;  1FNU A;  3U30 A;  3VTV A;  4HKQ A;  3UQA A;  1WGK A;  5J17 A;  4YWG G;  4DHZ E;  5TSS A;  2M0A A;  2LD9 A;  2M4N A;  2AX5 A;  2C7N B;  2JX5 A;  2KDB A;  4HRO A;  5DPR A;  3EGR A;  4K81 A;  3CSF A;  4EE2 A;  3KYC D;  2A5U A;  2FCM A;  3CF4 A;  1CJE A;  4ANU A;  2FAZ A;  3ZDT A;  3DHG C;  4O1N A;  4P1C C; 
#chains in the Genus database with same CATH homology
 4XWT A;  3SR6 A;  2CJN A;  4M0W A;  1C9F A;  3LYY A;  3W9C B;  1YN5 A;  1H7X A;  3U52 E;  2K5P A;  2LHD A;  1I4H A;  1JCK B;  2MJ3 A;  4WQM A;  2BTE A;  2QIE B;  1ESF A;  2D5G A;  1C78 A;  5D3I B;  4YXD B;  1YN4 A;  2FBW B;  2G1E A;  3W1S A;  4D2K A;  3KWV A;  1L0X B;  2MEK A;  2DYO A;  1B9R A;  1F2R I;  3Q69 A;  2CU3 A;  4ARI A;  5C3J B;  1ROE A;  1SE3 A;  2M56 B;  4AS1 A;  1ET9 A;  3HUI A;  1XEE A;  2BT6 A;  2ONQ A;  1XF5 L;  3AEG B;  3I9V 1;  2CJO A;  4MAC A;  3MFG A;  1IGC A;  3AED B;  2M19 A;  1VZ7 A;  2I2Y A;  5HHD G;  2MH7 A;  3HRD D;  2W82 A;  1KH0 A;  4L1B A;  4KGR A;  3WCQ A;  2J42 A;  2IGH A;  2NMQ A;  3NVW A;  3V3X A;  1TY2 A;  1P7E A;  1E6E B;  2DLB A;  2J53 A;  4ZOH C;  3RFZ B;  4ZYS A;  3KQ4 A;  3AV8 A;  4O1N A;  2GB1 A;  2PLP A;  3SFD B;  4OZC A;  1WSP A;  1QOG A;  3VR9 B;  5BYQ A;  1L4D B;  2HDE A;  5BMG A;  4N59 A;  1I4R A;  2L83 A;  4RFB A;  1TKE A;  1MHH E;  1GTH A;  4NJC A;  1FMA D;  4YT0 B;  1WRI A;  5JXV A;  2ON8 A;  3AEF B;  1SE4 A;  4KGT A;  1VLB A;  4DQO C;  2YEP B;  3FAH A;  2R61 A;  2FE8 A;  5H92 C;  1FNV A;  3BZD B;  3KLS X;  2SAK A;  1QKZ A;  1I4P A;  2JU6 X;  3ZYY X;  4MH8 A;  1B1Z A;  2WXN A;  1TS2 A;  2IJ0 A;  1PGB A;  1HXY D;  1FXA A;  2KAC A;  1ET6 A;  1D6E C;  3Q8B A;  1PYW D;  3T3N A;  2DYM A;  3C8Y A;  3I57 A;  4P6V F;  4FXC A;  5BYS A;  1DOY A;  3Q8C A;  2H89 B;  2L1A A;  5EE3 A;  2WXP A;  1TS4 A;  3AN1 A;  4JPS A;  3V05 A;  1TS5 A;  3P1M A;  4YSX B;  2DBY A;  2WDV B;  2LUM A;  1AYF A;  4WIP A;  2V0G A;  2EEL A;  2JQR B;  1L0V B;  1XCQ L;  1WWT A;  1HQR D;  4WAF A;  1MI0 A;  1HZ5 A;  3HVD A;  2WDQ B;  3BVM A;  5G5H A;  4C7Z A;  1C79 A;  1SSN A;  3TUO A;  2FUG 1;  2WXL A;  1FFV A;  2RDH A;  4RNA A;  4DXG A;  5FR3 A;  1QOA A;  1N5X A;  5G5G A;  1YNT E;  1V97 A;  1TZO A;  2IPK D;  2QSD A;  3IAM 1;  4JE3 B;  4TQ1 A;  1YJI A;  1L6V A;  1KTK A;  1N5W A;  4REZ A;  2LHE A;  3NVV A;  1F2R C;  1DOI A;  3E56 A;  3PZ8 A;  4WWM A;  2IGD A;  3BK1 A;  2JWU A;  3ZQ4 A;  2PMV A;  1ZDX A;  2JXT A;  2K0P A;  1SE2 A;  1VR9 A;  3J9C A;  1QLB B;  1WYG A;  3NRZ A;  2INP E;  1KLG D;  1H7W A;  4JWS C;  1V1O A;  1NYR A;  2KN4 A;  4HKZ E;  3AE3 B;  4YTN B;  4HRS A;  4MT5 A;  4C80 A;  1C4A A;  5I4D A;  2AQ3 B;  2LJI A;  1D5Z C;  1M4V A;  2V3N A;  1C4C A;  2KDM A;  2IDY A;  1LO5 D;  4NAM A;  3AE9 B;  1L4Z B;  1C77 A;  1N63 A;  2QJL A;  3B2F A;  5LNK 1;  2L52 A;  2BS2 B;  3P42 A;  5T8I A;  1KFY B;  1TYG B;  3BK2 A;  4YTP B;  1TKG A;  3IT6 B;  3U7Z A;  4DXF A;  1TY0 A;  1J7C A;  3UI3 A;  1MHX A;  1TS3 A;  1L5P A;  3BII D;  3AEC B;  1SJE D;  2WDR B;  2WXI A;  4IKG A;  1JWB D;  1UWX A;  2KAJ A;  3N9Y C;  3TEY A;  3Q8A A;  1I4X A;  1C76 A;  1R7S A;  3KWL A;  3W5V B;  3AE2 B;  1KRH A;  4GDL B;  4HEA 1;  1T5X D;  1TJE A;  4UDU C;  2Y3A A;  2J4X A;  1QF6 A;  4TMA B;  2BB5 A;  5GXG B;  1VZ6 A;  1RWS A;  2SEB D;  1ENF A;  2VZK B;  2W54 A;  1YMH E;  4XDC A;  1J7A A;  1GAQ B;  1MVK A;  2EKI A;  4KKI A;  3TEX A;  3U4E G;  3P4Q B;  5HI1 A;  1ZDV A;  1NEN B;  1EU4 A;  1T6B X;  1V1P A;  3BYT B;  1D5M C;  1ZXI A;  4USA A;  1WXQ A;  5BMH A;  1V1P B;  1XLQ A;  4LK0 M;  1XLP A;  2WXK A;  1ZPS A;  1FNW A;  3EUB 2;  1RYJ A;  1OQR A;  3E9S A;  2BS4 B;  4RGN A;  1ZP0 B;  1FFU A;  1VRA B;  3B2G A;  1RFK A;  1SF0 A;  1HEZ E;  2ACZ B;  4TQ0 A;  2LEK A;  3SEB A;  4JWU C;  5EE0 A;  4YTM B;  1GB1 A;  1CQV A;  5MPO A;  1KF6 B;  3GP7 A;  2GRI A;  1AWD A;  1ZOY B;  1GPX A;  2XNA C;  1C4P A;  4ARC A;  1EWC A;  1I7H A;  4OZA A;  1F0Z A;  3ABV B;  1I4Q A;  4OVZ A;  2BBC A;  1E9M A;  1T3Q A;  1DOX A;  1JWU D;  1BUI C;  1D5X C;  3MHZ A;  5D3D A;  2V3P A;  1UWM A;  3URY A;  2INN E;  2JYE A;  4KX6 B;  1F77 A;  1PFD A;  4GLS C;  4KGS A;  4CQN A;  1E10 A;  4LTU A;  3AEA B;  1YQ4 B;  1NEK B;  3AEB B;  4GDK B;  2ZW0 A;  4N6E B;  4LLG M;  4RCO A;  1BML C;  1SBB B;  1K52 A;  3GB1 A;  4RGO S;  2W3S A;  5FK9 C;  1QQR A;  4A8X C;  4WH4 A;  2PVO D;  4RH6 A;  1N61 A;  4JX1 C;  3NVY A;  3TEZ A;  2V4I B;  2NTS A;  1XCT L;  1ZE3 D;  2ICI A;  2PKO A;  1UGJ A;  4H2A A;  3ZGZ A;  1OFF A;  1FXI A;  3ZJU A;  1SIJ A;  2WQY B;  2RMM A;  3T3O A;  3AB5 A;  3BWU D;  1RM6 C;  3Q8F A;  5HFY A;  4RF0 A;  1FO4 A;  2WXR A;  3AE6 B;  3PO0 A;  5HG2 A;  3ETR A;  5AUK A;  2YEP F;  1IBX A;  4IDI A;  3BYY B;  2WXG A;  2N0S B;  4YSY B;  2G9H D;  2QMT A;  2WXQ A;  3O13 A;  1XLO A;  3ZJT A;  4ZRP A;  1XXG A;  3AMZ A;  2LGI A;  1GB4 A;  1GOZ A;  2J52 A;  2KMM A;  1AN8 A;  4N58 A;  3LXF A;  5E6J A;  4B0M A;  3FIL B;  1BXT A;  2TSS A;  3NUH B;  3P4P B;  2DWQ A;  5BYR A;  1PGX A;  1JWA D;  3R2I A;  3L4P A;  1GTE A;  3MC0 B;  2Y5P A;  1NI3 A;  3GS2 A;  1JRO A;  1SXT A;  1JWS D;  3OWE B;  4XE0 A;  4NZL B;  4XDD A;  4KKJ A;  4TSS A;  1ACC A;  1SEB D;  4HJG E;  1YJJ A;  1L0Y B;  3P4S B;  4OHJ A;  1VZ8 A;  3FIL A;  3VR8 B;  1FCL A;  3TSS A;  1EWY C;  4MM3 B;  3FC4 A;  3P4R B;  2WXM A;  2LMC A;  1FRR A;  3U2S C;  1P7F A;  1JQ4 A;  1GT8 A;  2PW9 A;  1VDV A;  1JAL A;  2PVG C;  5H8Y E;  4ZHO A;  1K53 A;  3ZJV A;  1DGJ A;  5FKA C;  3R8B A;  3P63 A;  1KLU D;  2WXJ A;  1YN3 A;  1K51 A;  1PGA A;  1JML A;  1NVI D;  1VJK A;  1DYQ A;  3AEE B;  4WUR A;  2N9K A;  1E7P B;  3DWM A;  3CIR B;  3W2D A;  2JYT A;  2NTT A;  4B0E A;  4Q2J A;  2K3U A;  2X38 A;  5D7G A;  4R3D A;  2BB6 A;  3R2T A;  1JW9 D;  2KQ4 X;  1QT9 A;  4RGM A;  1NYQ A;  4OZB A;  1XO3 A;  1N62 A;  1IGD A;  2PTL A;  3IT4 B;  2MJD A;  1QOF A;  1UUP A;  1HA5 A;  2H88 B;  3AE8 B;  1FIQ A;  2KWD A;  5AUI A;  1JRP A;  1JWM D;  4A6Q A;  3TEW A;  4RF1 A;  2WP9 B;  1MPE A;  3IXS A;  4P16 A;  2Y5C A;  4AQ7 A;  1QOB A;  2W55 A;  1D4B A;  1YQ3 B;  4OW0 A;  2LFI A;  1AW7 A;  3AE7 B;  1EM7 A;  1FM0 D;  1Q10 A;  1E0Z A;  3NVZ A;  2N7J A;  5EE1 A;  2WU2 B;  2JZP A;  1CZP A;  1OQQ A;  5C2T B;  3BVG A;  4PT5 A;  3PZ7 A;  2Q5W D;  1V8C A;  2N9L A;  2RDG A;  2WNM A;  3VRB B;  3AE5 B;  2E6X A;  1UNS A;  2WU5 B;  2XN9 C;  4L2Y A;  3DWG C;  2HTM E;  2L32 A;  1SB3 C;  2B76 B;  3MP9 A;  2K22 A;  2ZW1 A;  4YSZ B;  1ZUD 2;  1XLN A;  2BS3 B;  2W3R A;  3HVZ A;  2I38 A;  1SJH D;  3Q8E A;  4L23 A;  1STE A;  1CK1 A;  2PIA A;  3VQI A;  2Z8L A;  3AE1 B;  3VRA B;  3MJ5 A;  4A55 A;  3AE4 B;  1EU3 A;  1FCC C;  1TKY A;  3B9J A;  2GI9 A;  3EA6 A;  4C56 C;  4US8 A;  4NAW B;  1HZ6 A;  3LB8 C;  1A70 A;  1Y56 A;  3H8H A;  2WXO A;  4A9A A;  2WXF A;  4US9 A;  3IAS 1;  1PDX A;  1I4G A;  4ZRQ A;  2WS3 B;  3RPF C;  1J7B A;  1FEH A;  1K50 A;  3NS1 A;  2IGG A;  3SFE B;  4ZHP A;  1L6U A;  1IUE A;  2AQ2 B;  1FNU A;  1PUT A;  5EE9 A;  4HKQ A;  2JSV X;  2OED A;  3CWI A;  3AM9 A;  4RGT A;  2MJE A;  1WGK A;  1QIL A;  4YWG G;  3BVZ A;  5TSS A;  2M0A A;  2QEJ C;  2AX5 A;  2JX5 A;  2E3T A;  2AQ1 B;  2VZK D;  1FD6 A;  1IBX B;  4HRO A;  4XWW A;  3EGR A;  2BW2 A;  4IOI E;  2BYT A;  5BMI A;  2K9X A;  4EE2 A;  3AH7 A;  1N60 A;  4J3O D;  2QIL A;  2RPV A;  2WXH A;  3CF4 A;  1CJE A;  2WLB A;  3W5U B;  1ZXH A;  4C7Y A;  1FRD A;  3NZ3 A;  2OHF A;  4ITK A;  4A90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...