3AE9C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae9C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae9C02
2WDVC 3AE1D 3VR9C 3P4QC 3VRBD 3AEBD 3P4SD 3AE8D 3CIRC 3ABVC 3AE4D 4YT0C 2WS3C 2WP9C 3SFEC 3S9OA 4YSYC 1OW6A 3AE3D 1KTMA 3AE7D 3AEED 4YTMC 1QLBC 3AE6D 4YSXC 4YTPC 3VRBC 1E7PC 1NEND 4KX6D 3AE8C 3P4RD 4YSZC 5C2TD 2G3AA 1ZP0D 2ACZD 2WU2D 3AEGD 3VR8D 2WQYD 2WU5C 1KF6C 1K04A 2BS3C 2H89D 2WDRD 2WDQD 3AE2D 3AECD 3VRAD 1ZOYD 2FBWD 4YTND 3AEAC 1L0VD 2H88C 3AE7C 1YQ4D 1KFYD 1OW7A 3P4PC 3AE1C 3P4RC 3VR9D 3AE9D 3P4QD 3AEBC 3P4SC 5C2TC 4YXDD 2B76D 3CIRD 3AEGC 3VR8C 5C3JD 3AE4C 1NEKD 3AE5D 1K05A 2WS3D 2WDRC 3VRAC 3AECC 1ZOYC 3SFED 2FBWC 4YTNC 3AE3C 4YSYD 3AEFD 1YQ4C 3AEEC 4YTMD 3AE6C 1YQ3D 4YSXD 4YTPD 3AE9C 3AEDD 1NENC 4KX6C 4YXDC 3SFDD 2WDVD 2B76C 4YSZD 1PV3A 1ZP0C 5C3JC 2ACZC 1OW8A 2WU2C 1NEKC 3AE5C 3ABVD 2WQYC 2WU5D 4YT0D 1KF6D 2H89C 3AE2C 2WDQC 2BS2C 2WP9D 3AEFC 1L0VC 3AEAD 2BS4C 2H88D 3B71A 1YQ3C 1KFYC 3AEDC 3P4PD 3SFDC
chains in the Genus database with same CATH superfamily
1RE3C 2XU6A 3BCCJ 1VF5D 3OA7A 3VRBD 3M9HA 2POHA 1T2KC 1KN7A 3SWYA 2WP9C 1SQXE 2A45H 1IZNB 1OVRA 2FYUD 1MKMA 4PV1D 1L4AA 1RF1C 1USEA 1QLBC 1NH4A 5C2TD 1FDOA 2B9BA 1PL5A 2D2CB 2H89D 1ZXGA 1X9VA 1NVOA 1PZQA 2YO2A 2ZVOB 1CSBA 5KLVK 3JSVC 4C7NB 4ZKUA 3M0AA 1EZVG 4WVZA 1NEKD 3V2RA 3VN0A 1T2KD 1NYHA 1SQXK 1ZOYC 3GLMA 3FX0A 3V2QA 1AV1A 5APQA 4PD4D 1KQFB 1AVYA 5C3JC 2IZ1A 3TNUA 3TNUB 4XA4A 1N73A 4GKGA 4I1LA 1K73Q 2BS4C 1NOHA 3H1LG 5M1BA 2WSSH 1JM0A 1ZR4A 4RO0A 1Q86Q 1JTHA 4BWNA 3H1LJ 2BASA 4ZKPA 2Y0EA 2K1AA 1FDMA 1SVFA 4H0LC 3IF4A 3F89A 1HUCA 1KYOI 1P84D 1H88A 1KTMA 1SFCB 4JBZA 3CL3D 5AVVB 1EDIA 2YKOA 2YXRB 2FKWB 4UB8E 4C7RA 2WSEH 2AXTE 1S4XA 1FBMA 2K9YA 4CPGA 4OH8B 3I55P 4NPFX 3AEAC 1YJNP 1SQPE 2IBZE 3GW6A 3I56P 1QEXA 2K9JA 4DHIB 3VR8C 4HH2A 4H13B 2R5BA 1QX8A 1RQVA 3AECC 2QRXA 1LTJB 3AEFD 3GHGC 1L0LD 4N6JA 3CC4P 5APUA 4D6TD 1Z56A 1IK7A 1SQQG 3A0HE 3L75D 3NFQA 1N7SB 2OYHC 2Z5HA 5GTIE 3L35A 3G4SP 1SQPK 3AEAD 2C0XA 2ZYGA 1FZBA 1LNQA 3BCCE 3VOPA 5AW8B 4WY4A 4WY4B 2J5UA 1NJIQ 1FZGA 1YIJP 4IL6E 2VRSA 4ZNCA 1NWQA 3S9OA 3OJAB 1MV8A 2BEZF 4PD4E 3AE7D 5APSA 4M3LA 5CJ4A 4YTPC 1FJKA 4LDTA 1ZR2A 2HPCA 2HPCB 4GODA 3V6IA 1FJPA 3CI9A 2MJZA 1YTZT 1RY3A 3EWKA 2M0BA 1HH0A 3C9IA 2JEEA 1W2BO 4OGQB 1ZN5A 2WMMA 5AVWB 2D2CC 1FZCB 3CCMP 1KQSO 3L74D 4IFDK 5KLIC 3H1JG 1G2CB 1KQGB 3HUSB 3CMEP 2WSFJ 2OARA 3H1KE 2YO3A 1AFOA 3M06A 1LWUA 4YTPD 4YXDC 4IFMA 2NPSD 3O6QA 1D7MA 2KSEA 2ACZC 2WPSA 4RJTA 3E7KA 4Y99B 1AA0A 1MZ9A 5K5GB 1M1JA 1DX7A 1U57A 1J2JB 1IK9A 1USDA 2D2CD 3USSA 3VR9C 1KV4A 2J58A 5APTA 2M5AA 1JO5A 1N7LA 3JCUE 1OVUA 3S1KA 3L36A 3L4FA 3KYQA 1T3JA 1KILB 2FFDB 2Q9IA 3L75E 4DDGA 2A06G 1M57D 1OXZA 4YSXC 2PFXA 2R3SA 1E79H 3PLNA 3P4RD 1BE3J 4U7JA 3CCEP 1SFCC 2ACZD 2N1TD 1KB9H 2BS3C 1NTKG 2ZXEB 1FOSE 2OYIB 4DCKA 4LGDE 1NTKJ 3P4PC 1EZVI 3AE1C 3VR9D 1A02J 2RMZA 3OW2O 1RF1A 2G8YA 2OYOA 3AE5D 1BCCJ 3VRAC 5H2FE 1EDJA 3IN6A 4B86A 4YTNC 2C0WA 2ZFCA 4U3FD 5BVZA 4H13C 2ZXXA 3C1LA 1HGVA 1NTZJ 2RH0A 4YSXD 3F5HA 2W27A 1R8EA 3CX5I 2XV5A 1LTJC 4ASWA 4EOTA 3D70A 5KLVD 1SFCD 2KP8A 1VQ7P 2WQYC 3TGUG 1NTMG 3BASA 4KT0J 1N7SC 1NTMJ 2IFNA 1SQXD 2K88A 3P4PD 3RL0B 3AE1D 1NU1G 3Q5RA 3CPWO 1YYCA 2GUVA 1N86A 3V2PA 1W5CE 1NU1J 4JYBA 1LTGC 4YXWH 1KYOD 2QSIA 2KNCB 2HODB 2GM4A 3O8ZA 3N4XA 3P7KA 1YITP 2BEQD 3AE8C 3KQGA 5C39A 5AW7B 3PHLA 2WQYD 1VQ6P 2WU5C 3L72E 2WDRD 2P7JA 1N7SD 1GZLA 2JO1A 1ZLLA 2R5DA 3Q5PA 1GTWA 3PP5A 2WT7B 1CW5A 2QG4A 2K37A 2CPBA 5DJUB 4H44D 4OGQC 4GT1A 5KAFH 1FZCC 3II6A 3V2NA 3D6YA 3CXHE 4NPDA 2Y9ZA 3A0BE 2NZ2A 1GL2D 1WMKA 4W80A 3HUSC 3CMAP 3AE9C 2KLVA 3FGAD 3WMM0 1EQ7A 3G9RA 2QJYB 1J1EB 1J1DB 3H1ID 1SQBJ 2WU5D 1L0NJ 2LR2A 3MP7B 1RE4A 1K9MQ 4HJGH 1BGYG 2KXPB 4Y99C 2WSEJ 2FYUG 1R5LA 1PGJA 5BU8B 2HYNA 1BGYJ 2Y0DA 3CCJP 3HD7B 1NO4A 1PP9D 5AW1B 1LTTC 2OYHA 4BRYA 2QJKB 1S3JA 2O1JA 1SQPD 1IC2A 3FXDA 1OZHA 1JY2P 3BVHA 2YKQA 1BE3E 2GUSA 1KILC 3VMXA 2FFDC 3AEGD 3U1CA 2QVAA 3G3ZA 1FZEA 2FBWD 1RF0A 1L4AB 3V4QA 3G71P 1W2EA 3CXHI 5CBNA 3W67A 1HTLC 2OYIC 1OVVA 2M3EA 5TISE 5CCHC 3CC7P 3HE4A 3HE4B 1KYOE 1JB0J 3L73E 3RK3B 1MFZA 1BCCE 4K3AA 3B8EB 2NPSA 2KK7A 5L8RJ 1YQ4C 4BXLA 3VMYA 3SWKA 1NTZE 2YNYA 4EDFA 1BDCA 4K35A 3SFDD 2ZVNB 3M0DC 1KILD 4WB4A 2OQQA 3BCCD 4DJGA 4NPEA 1XTGB 1S9KD 2WP9D 3V5BA 2W6AA 4YPCA 3Q3DA 1NTKK 3D6ZA 1YQ3C 1Q7YQ 2BCCE 2QIWA 3P4QC 2I1KA 4JQ0D 3P8MC 5CCHD 2YMYA 1T6AA 4YT0C 2H43A 2KIKA 3RL0C 1N73B 2CK3H 4AUWA 2N1TA 3HE5A 1FDIA 5AW6B 1NTZK 1JTHB 4I6LA 4I2LC 3H1IE 1HJBA 3KZIH 1YBKA 1PPJE 5E79E 4KJMA 1ZOYD 2AXTH 3NTNA 1NAFA 5AVRB 2YXQB 3MUDC 3BRVB 1CZQA 1EZVD 1VQ9P 1KZUB 3H1KD 1L0LG 1FOSF 2HLOA 1GDTA 3P4QD 2B87A 2B87B 4D6TG 2KS1A 5C3JD 5AW9B 1PP9E 2OTLP 3RL0D 4D6TJ 1LT9A 2A45I 1JUNA 2E75B 2E43A 3MD0A 4FJVA 3CX5D 1R5SA 1JMMA 1NHLA 1MUUA 1X22A 3L70G 2IDBA 3Q5SA 3VP9A 1PV3A 2K9JB 2I8DA 1M7LA 2QM8A 1YI2P 2WITA 1Y9BA 3H1LD 3L70J 1IO4A 1SQBE 4H0LD 1VQ8P 5KJ7A 2BS2C 3I5CA 1IFPA 5GTIH 1DEEG 1L0NE 1URQC 2QJYC 1J1EC 3VP8A 1SQVG 1X8YA 1H0TA 1MFTA 1H0TB 2JR8A 3H1HG 1SQVJ 2K3RA 1BGYE 2Q3EA 2H7HA 1LP1B 1LP1A 1SQQJ 1PGPA 3H1HJ 3M9BA 1S72P 1TFFA 2H8PD 1EDKA 3SFEC 3JC22 1QL2A 5CCGC 3G6EP 1ZV8A 2KI7B 1PFIA 1DH3A 2AEFA 3HD7C 1IFNA 3FXEA 3RK2B 4PD4H 1E7PC 1KILE 1KFNA 4YSZC 2C9LY 3IFMA 2JWAA 2WSCH 4KHXA 1S9KE 4Z1MH 3VR8D 1JOCA 1SQBK 3L74G 2OTKE 4ASVA 2AEMA 3ZDMA 5AVYB 3AECD 2WWWA 1L0NK 2JKVA 1URQD 1KORA 1JNMA 1EDLA 1XTCC 2B88A 1EC5A 3P4SC 1GL2A 3MTUE 2ZYAA 2FYNB 1L4AC 1OX3A 1IFJA 5EFWB 3SFED 1P84H 5CCGD 3CCVP 2P58A 2O01N 3B5NA 3CWBG 3RK3C 5AW3B 4C46A 3NXSA 1NENC 4KX6C 4JF7A 1EXIA 3CWBJ 4YSZD 5DJTB 1JCCA 3H1JJ 1L0VC 1EZVE 2IFMA 1JY2O 2E74B 3PJSK 1KFYC 1LWUB 4L73A 3AEDC 2KZIA 3P4SD 2LXBA 3T97A 3CIRC 3O6QB 5APWA 1LTIC 3WU2H 1FC2C 4MN4C 1M8OB 1VF5B 1H8AA 4OWFA 1BSHA 1M1JB 3CX5E 3FWLA 3L72D 3JCUH 4ZMDA 2Z5IA 3RBXA 1VQPP 1N73C 1NEND 4KX6D 4PV1B 3H1LE 3CCQP 2M5AB 1OFCX 5AVTB 1L0VD 1KFMA 4W7YA 3CXHD 1KFYD 1JY3N 2KB7P 1M90Q 3AEBC 4YXDD 3CIRD 5AVSB 1LT1A 2RN0A 1RE3A 3CCSP 1JY3P 1A02F 1GU5A 3AE3C 5KLVG 1GU4A 1LTAC 2PAJA 4XFJA 3CC2P 5AW2B 3RGUA 5KKZB 2E75C 1SQXG 2B76C 4EYYQ 1RF1B 2O3JA 1SQXJ 2IPPA 4Y28J 2WDQC 5CCHA 1P84I 1DD3A 3VYIA 2IZ0A 1S5LH 3AEBD 3GF7A 5APVA 2Y0CA 2QE7H 3KPEA 4LC1A 1SQQE 2V4HA 4LLHA 4N78E 1BE3D 5CHXA 3P32A 1FZAA 1OW6A 3AE3D 4UB6H 3L71G 2ZYDA 5CMZA 3TGUJ 1GMJA 5KAIH 1E5WA 2SPZA 1U7MA 1NKNA 3L71J 1OWAA 1NTKD 2W8ZA 1QVFO 3H25A 1YHQP 4GOFA 1QLED 1BSNA 3RK2C 2WDQD 3L73D 2O01H 3WUVA 2XNDH 3VRAD 4YTND 1VQOP 1T8ZA 1BCCD 4WY4C 1JMBA 5CJ0A 3HTKA 4H13D 1DD4A 4PJ0H 5B5EE 1SQVK 1NTZD 1GK4A 2XNXA 1SQQK 2Q6QA 2IX7C 4HKZH 1DEBA 3RK3E 2FYNC 2W90A 1X79B 3A0BH 1HJ0A 1NTMD 2WTYA 2FYZA 2BCCD 2IYPA 1HVVA 3HRNA 1FU1A 4I7ZB 1ZRTE 1KB9I 3RK2D 3H1JE 3KDPB 1ZMEC 3R4YA 4WY4D 5AW5B 3E1IA 1VQNP 3H32A 2WDVC 3CLQA 3AE8D 3ABVC 4AQRD 1SQPG 2E74C 2IBZG 1QVGO 1LWUC 5AVXB 1PPJD 1SQPJ 3TYYA 1LGHB 2WPQA 2E5TA 3QWOC 3VRBC 1YTZI 5KAFE 2KLUA 3GHGA 1K8AQ 2L91A 4OGQD 4GIFA 2FYUJ 1KF6C 4PV1C 2C9NY 2E76B 2H88C 2OYHB 3S4RA 4BRYB 1YJWP 3AE9D 5B66E 3RBZA 5C2TC 4EIJA 1Q82Q 2A06E 2O1KA 2Q5UA 1KYOH 1SQBD 3BCCG 3VMZA 1Y8AA 1L0ND 1NTKE 3CCLP 1L2PA 2YIUB 5GTHE 2WU2C 1NEKC 1UIIA 3SSUA 2E42A 5AVUB 1KF6D 1BGYD 3IR9A 2NPSB 5KKZC 2H88D 2PGDA 5APYA 2WSCJ 4IFFA 1RH5B 2KSJA 2V7QH 1JCDA 3N7NA 2I1JA 3EQ2A 1M1KQ 1VQMP 1FS0E 3A5TA 3CD6P 5KLIB 3TGUE 1NTME 2ZT9B 4JYCA 4C7NA 2HG5D 3L71E 2XZRA 1Q81Q 3PRJA 1JY3O 2WU2D 1T3UA 3H1KG 1GD2E 3PH0A 1K04A 1NU1E 2R32A 3LW5H 4TLFA 2MKVA 4RKUJ 3LIDA 1G1IA 3H1KJ 1WT6A 5E79H 3L37A 4XE5B 2N1TB 3HE5B 1YQ4D 4IL6X 2W6BA 1LTSC 1RQUA 3R2PA 3TDKA 3AE4C 1K05A 1FE6A 4UB8H 3K5BA 5AVZB 1NTMK 2HFED 2YMKA 1PGOA 1YQ3D 1IFMA 2QEXP 3GMAA 2ZAEB 2Y9YA 1ZP0C 3RL0g 1OIPA 2KS1B 1TU3F 1X0TA 1L0LJ 3L75G 1NU1K 1AJYA 4YT0D 1AQTA 1LT9B 3AEFC 3QH9A 3UIAA 2PP6A 1SFCA 2FXMA 5APXA 3L75J 1VQLP 5AW0B 2DW3A 2JDIH 3KZIE 4I7ZC 1QGKB 1S2EA 3E1RA 3A0HH 3AE4D 4L76A 2WPRA 1GW3A 1J1DC 4L74A 2RKLA 4N3YB 4DHJA 1RE4C 1ZP0D 1IJDB 3Q2YA 2YKPA 2FYUE 1LTJA 1GK6A 2KOGA 3VTPC 1H89A 4IL6H 3AE7C 3SWFA 2FXPA 3WUTA 2LXCB 1KMIZ 2KZJA 1N7SA 2E5YA 1VPCA 2E76C 1KQLA 2QJKC 3P8CD 5KTBA 1CI6B 1CI6A 2AEJA 3MHVA 4H44B 3L70D 3PTZA 3L74J 4IOIH 3AEEC 1KC8Q 1OMIA 3V4WA 3TK1A 1GL2B 2WVRA 1RF0C 1KB9D 2M3BA 2FYUK 1SQVD 2JJLA 3AE2C 1SQQD 4N78D 3H1HD 2YIUC 3B5NB 3HD7D 2IBZI 1GW4A 2NPSC 3L72G 1N8RQ 2O01J 3U1AA 2E76D 3NMDA 1S1CX 3FWNA 1IFIA 2B89A 3L72J 3LIEA 4W7ZA 2AXCA 2JP3A 2W6JH 3AEED 4YTMC 1FZCA 3M9QA 3W68A 3CX5H 4O9BA 3D71A 1ZW0A 3T97B 4AYCA 1S5LX 3EFGA 1G2CA 1SS1A 1P84E 2R44A 1L4AD 3MIWA 1G1JA 3HUSA 2ZT9C 4DOJA 3AE2D 4TT3H 2ITAA 3TF5A 3A2AA 1OW7A 3RK3D 2P2UA 5AVQB 3VONA 3P4RC 1QL1A 1NKZB 2N1TC 4DZOA 3H6PA 3CWBD 3ITKA 1Q90D 4DDIA 2QJPB 3VMAA 1HF9A 1ZRTD 4YTMD 2ZJSE 1VQ5P 3H1JD 1U7JA 3WU2E 3AEDD 4PD4I 1SP4A 4QMAA 1UIXA 2FXOA 4U3FG 3A7OA 3AE5C 2ZT9D 1L0LE 4HYTB 4U3FJ 5TJHA 4D6TE 4L75A 1KILA 2FFDA 1BE3G 5H2FH 5KLVJ 2PRRA 1LT9C 1VQ4P 4WBAA 3B4SA 4I6MC 3P8CE 3KXDA 2R3CA 3CCRP 2WS3C 2QM7A 3L70E 3M91A 2OYIA 1NAYA 4WWIA 2Q7CA 3L73G 2P1JA 1BCCG 5KJ7C 2Z4EA 1KB9E 3L73J 1SQVE 2Q1KA 4HB1A 1L0LK 1VDFA 3H1HE 2A06D 1NTZG 2N9YB 2HR3A 3M0DA 3EFFK 2A45G 1Y47A 1DIPA 1WRGA 3OAKA 2E75D 2B76D 5B5EH 4DHZA 2WS3D 2JWDA 2WDRC 4OVNF 3A3YB 2BCCG 2V7QJ 1HBWA 2L5GB 3CCUP 1S5LE 3L74E 2BCCJ 4DT0A 3AE6C 3HTKB 3IAOA 5KJ7D 4H44C 1OW8A 1RHZB 1Q2NA 4UB6E 3KHUA 5CBOA 2QA4P 5KAIE 2KNCA 2HODA 2OTJP 1GL2C 1LTBC 3H1IG 2UWJE 2WSFH 3CXHH 1PPJG 4H0LB 1HGZA 2OGUA 3TGUD 3H1IJ 3LW5J 1JEKA 5BU5A 3MZWB 3CWBE 3MUDA 3L71D 4A7PA 1PIXA 3B5NC 2WPVB 4EI2A 1VL2A 2LKMA 2P10A 4YSYC 1AQ5A 4PJ0E 1NU1D 3C8VA 2NRGA 2WT7A 3MGNA 3AE6D 1KD1Q 1PP9G 2P67A 2KUBA 3H32B 2WZ7A 2G3AA 1PP9J 2ZFYA 3BRTB 1N2DC 2FY8A 1VQKP 2M8RA 5AW4B 1SQBG 1VF5C 4JPZB 2GA1A 1SLQA 1URQB 1URQA 3GHGB 3GF3A 3U59A 1FZFA 1M56D 3AEGC 1YJ9P 1IFDA 3WUUA 1L0NG 1M1JC 5B66H 1BDDA 3B5ND 4R4MA 2XKMA 1HWTC 2FBWC 3Q1MA 2IYOA 4YSYD 1PGQA 2CPSA 1FAVA 4RESB 2W83C 2J59M 5CCGA 2WDVD 2QJPC 3TSIA 1EXJA 3ABVD 4R4LA 2Q3IA 1AVOA 3HD7A 1LJ2A 1JY2N 2N9BA 2E74D 2H89C 5TISH 5GTHH 4U3FE 2XDJA 4GOEA 3GG2A 3BATA 2KYVA 3B71A 1NGMB 4GDOA 2IBZD 5KLVE 3SFDC
chains in the Genus database with same CATH topology
2WDVC 3AE1D 2QIWA 3VR9C 1VF5D 3P4QC 3VRBD 3Q5RA 3AEBD 3P4SD 3GF7A 3LW5J 3AE8D 3CIRC 2O01J 3ABVC 2J5UA 2E76D 2E74C 3AE4D 1PIXA 1S1CX 4YT0C 2WS3C 4H0LC 2WPVB 2WP9C 1VF5B 1VL2A 2QSIA 3SFEC 2P10A 3S9OA 4YSYC 1OW6A 3AE3D 1KTMA 1MKMA 4PV1D 2JP3A 3C8VA 2BEZF 1GMJA 1FDIA 3AE7D 3AEED 4YTMC 2ZT9B 1QLBC 3AE6D 4YSXC 4YTPC 3VRBC 1E7PC 2BEQD 1NEND 1KILE 4KX6D 3AE8C 3D71A 3P4RD 4PV1B 4YSZC 4U7JA 2G3AA 5C2TD 3T97B 1ZP0D 1S5LX 1FDOA 3Q2YA 4OGQD 2ACZD 2WU2D 3AEGD 4Z1MH 3VR8D 1PL5A 3H25A 2ZT9C 2WQYD 2D2CB 2WU5C 1KF6C 1K04A 3EWKA 2BS3C 2H89D 2K9YA 2MKVA 2WDRD 2WDQD 3AE2D 4TT3H 1ZOYD 3AECD 3VRAD 4PV1C 4RKUJ 2FBWD 4YTND 3AEAC 1L0VD 1KORA 4OGQB 2E76B 2H88C 2JO1A 3AE7C 1YQ4D 3Q5PA 4IL6X 1DIPA 1KFYD 2D2CC 2FXPA 4H13D 1OW7A 3P4PC 3AE1C 1DD4A 3P4RC 3VR9D 1VF5C 3AE9D 1KMIZ 3P4QD 3AEBC 3P4SC 5C2TC 4YXDD 5KLIC 3GF3A 4H44D 2E75D 4OGQC 2E76C 2B76D 3AEGC 3CIRD 3VR8C 5C3JD 1JB0J 1RQUA 2G8YA 3AE4C 4H13B 1NEKD 1KQGB 2QJKC 3AE5D 1K05A 4R4MA 1NYHA 2WS3D 1RQVA 1Q90D 2WDRC 3AECC 3VRAC 1ZOYC 3IN6A 2WSFJ 3SFED 3D6YA 2FBWC 3GLMA 3Q1MA 4YTNC 3AE3C 4YSYD 4H44B 2E75B 2V7QJ 1HF9A 5L8RJ 3AEFD 3RK3E 2NZ2A 1WMKA 1YQ4C 2FYNC 2YMKA 3AEEC 4H13C 4YTMD 3AE6C 1IK7A 1YQ3D 1HJ0A 4XFJA 1KQFB 1OMIA 3AE9C 3FGAD 3AEDD 4YTPD 1R8EA 1NENC 3GMAA 4KX6C 4YXDC 3G9RA 3IAOA 2WDVD 3SFDD 2IDBA 2QJPC 4H44C 2E75C 1EXIA 3Q5SA 2B76C 4YSZD 1PV3A 1UIXA 1ZP0C 3O6QA 3D70A 5C3JC 3RL0g 2ACZC 4YSXD 1OW8A 1EXJA 1NEKC 3AE5C 2OQQA 4R4LA 2WU2C 3ABVD 1TU3F 1Y9BA 2WQYC 2E74D 2ZT9D 4I7ZB 2WU5D 1ZRTE 4Y28J 1AJYA 2H89C 1KF6D 4KT0J 4H0LD 4YT0D 3AE2C 2WDQC 2BS2C 2WP9D 3AEFC 5KKZC 1DD3A 1L0VC 2QJYC 3AEAD 2YIUC 2BS4C 1ZMEC 2H88D 3R4YA 3Q3DA 5M1BA 1U57A 3B71A 2E74B 3D6ZA 1YQ3C 1NGMB 1KFYC 4GDOA 2WSCJ 2D2CD 4H0LB 4I7ZC 3AEDC 3P4PD 2WSEJ 3SFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDV C;  3AE1 D;  3VR9 C;  3P4Q C;  3VRB D;  3AEB D;  3P4S D;  3AE8 D;  3CIR C;  3ABV C;  3AE4 D;  4YT0 C;  2WS3 C;  2WP9 C;  3SFE C;  3S9O A;  4YSY C;  1OW6 A;  3AE3 D;  1KTM A;  3AE7 D;  3AEE D;  4YTM C;  1QLB C;  3AE6 D;  4YSX C;  4YTP C;  3VRB C;  1E7P C;  1NEN D;  4KX6 D;  3AE8 C;  3P4R D;  4YSZ C;  5C2T D;  2G3A A;  1ZP0 D;  2ACZ D;  2WU2 D;  3AEG D;  3VR8 D;  2WQY D;  2WU5 C;  1KF6 C;  1K04 A;  2BS3 C;  2H89 D;  2WDR D;  2WDQ D;  3AE2 D;  3AEC D;  3VRA D;  1ZOY D;  2FBW D;  4YTN D;  3AEA C;  1L0V D;  2H88 C;  3AE7 C;  1YQ4 D;  1KFY D;  1OW7 A;  3P4P C;  3AE1 C;  3P4R C;  3VR9 D;  3AE9 D;  3P4Q D;  3AEB C;  3P4S C;  5C2T C;  4YXD D;  2B76 D;  3CIR D;  3AEG C;  3VR8 C;  5C3J D;  3AE4 C;  1NEK D;  3AE5 D;  1K05 A;  2WS3 D;  2WDR C;  3VRA C;  3AEC C;  1ZOY C;  3SFE D;  2FBW C;  4YTN C;  3AE3 C;  4YSY D;  3AEF D;  1YQ4 C;  3AEE C;  4YTM D;  3AE6 C;  1YQ3 D;  4YSX D;  4YTP D;  3AE9 C;  3AED D;  1NEN C;  4KX6 C;  4YXD C;  3SFD D;  2WDV D;  2B76 C;  4YSZ D;  1PV3 A;  1ZP0 C;  5C3J C;  2ACZ C;  1OW8 A;  2WU2 C;  1NEK C;  3AE5 C;  3ABV D;  2WQY C;  2WU5 D;  4YT0 D;  1KF6 D;  2H89 C;  3AE2 C;  2WDQ C;  2BS2 C;  2WP9 D;  3AEF C;  1L0V C;  3AEA D;  2BS4 C;  2H88 D;  3B71 A;  1YQ3 C;  1KFY C;  3AED C;  3P4P D;  3SFD C; 
#chains in the Genus database with same CATH topology
 1RE3 C;  2XU6 A;  3BCC J;  1VF5 D;  3OA7 A;  3VRB D;  3M9H A;  2POH A;  1T2K C;  1KN7 A;  3SWY A;  2WP9 C;  1SQX E;  2A45 H;  1IZN B;  1OVR A;  2FYU D;  1MKM A;  4PV1 D;  1L4A A;  1RF1 C;  1USE A;  1QLB C;  1NH4 A;  5C2T D;  1FDO A;  2B9B A;  1PL5 A;  2D2C B;  2H89 D;  1ZXG A;  1X9V A;  1NVO A;  1PZQ A;  2YO2 A;  2ZVO B;  1CSB A;  5KLV K;  3JSV C;  4C7N B;  4ZKU A;  3M0A A;  1EZV G;  4WVZ A;  1NEK D;  3V2R A;  3VN0 A;  1T2K D;  1NYH A;  1SQX K;  1ZOY C;  3GLM A;  3FX0 A;  3V2Q A;  1AV1 A;  5APQ A;  4PD4 D;  1KQF B;  1AVY A;  5C3J C;  2IZ1 A;  3TNU A;  3TNU B;  4XA4 A;  1N73 A;  4GKG A;  4I1L A;  1K73 Q;  2BS4 C;  1NOH A;  3H1L G;  5M1B A;  2WSS H;  1JM0 A;  1ZR4 A;  4RO0 A;  1Q86 Q;  1JTH A;  4BWN A;  3H1L J;  2BAS A;  4ZKP A;  2Y0E A;  2K1A A;  1FDM A;  1SVF A;  4H0L C;  3IF4 A;  3F89 A;  1HUC A;  1KYO I;  1P84 D;  1H88 A;  1KTM A;  1SFC B;  4JBZ A;  3CL3 D;  5AVV B;  1EDI A;  2YKO A;  2YXR B;  2FKW B;  4UB8 E;  4C7R A;  2WSE H;  2AXT E;  1S4X A;  1FBM A;  2K9Y A;  4CPG A;  4OH8 B;  3I55 P;  4NPF X;  3AEA C;  1YJN P;  1SQP E;  2IBZ E;  3GW6 A;  3I56 P;  1QEX A;  2K9J A;  4DHI B;  3VR8 C;  4HH2 A;  4H13 B;  2R5B A;  1QX8 A;  1RQV A;  3AEC C;  2QRX A;  1LTJ B;  3AEF D;  3GHG C;  1L0L D;  4N6J A;  3CC4 P;  5APU A;  4D6T D;  1Z56 A;  1IK7 A;  1SQQ G;  3A0H E;  3L75 D;  3NFQ A;  1N7S B;  2OYH C;  2Z5H A;  5GTI E;  3L35 A;  3G4S P;  1SQP K;  3AEA D;  2C0X A;  2ZYG A;  1FZB A;  1LNQ A;  3BCC E;  3VOP A;  5AW8 B;  4WY4 A;  4WY4 B;  2J5U A;  1NJI Q;  1FZG A;  1YIJ P;  4IL6 E;  2VRS A;  4ZNC A;  1NWQ A;  3S9O A;  3OJA B;  1MV8 A;  2BEZ F;  4PD4 E;  3AE7 D;  5APS A;  4M3L A;  5CJ4 A;  4YTP C;  1FJK A;  4LDT A;  1ZR2 A;  2HPC A;  2HPC B;  4GOD A;  3V6I A;  1FJP A;  3CI9 A;  2MJZ A;  1YTZ T;  1RY3 A;  3EWK A;  2M0B A;  1HH0 A;  3C9I A;  2JEE A;  1W2B O;  4OGQ B;  1ZN5 A;  2WMM A;  5AVW B;  2D2C C;  1FZC B;  3CCM P;  1KQS O;  3L74 D;  4IFD K;  5KLI C;  3H1J G;  1G2C B;  1KQG B;  3HUS B;  3CME P;  2WSF J;  2OAR A;  3H1K E;  2YO3 A;  1AFO A;  3M06 A;  1LWU A;  4YTP D;  4YXD C;  4IFM A;  2NPS D;  3O6Q A;  1D7M A;  2KSE A;  2ACZ C;  2WPS A;  4RJT A;  3E7K A;  4Y99 B;  1AA0 A;  1MZ9 A;  5K5G B;  1M1J A;  1DX7 A;  1U57 A;  1J2J B;  1IK9 A;  1USD A;  2D2C D;  3USS A;  3VR9 C;  1KV4 A;  2J58 A;  5APT A;  2M5A A;  1JO5 A;  1N7L A;  3JCU E;  1OVU A;  3S1K A;  3L36 A;  3L4F A;  3KYQ A;  1T3J A;  1KIL B;  2FFD B;  2Q9I A;  3L75 E;  4DDG A;  2A06 G;  1M57 D;  1OXZ A;  4YSX C;  2PFX A;  2R3S A;  1E79 H;  3PLN A;  3P4R D;  1BE3 J;  4U7J A;  3CCE P;  1SFC C;  2ACZ D;  2N1T D;  1KB9 H;  2BS3 C;  1NTK G;  2ZXE B;  1FOS E;  2OYI B;  4DCK A;  4LGD E;  1NTK J;  3P4P C;  1EZV I;  3AE1 C;  3VR9 D;  1A02 J;  2RMZ A;  3OW2 O;  1RF1 A;  2G8Y A;  2OYO A;  3AE5 D;  1BCC J;  3VRA C;  5H2F E;  1EDJ A;  3IN6 A;  4B86 A;  4YTN C;  2C0W A;  2ZFC A;  4U3F D;  5BVZ A;  4H13 C;  2ZXX A;  3C1L A;  1HGV A;  1NTZ J;  2RH0 A;  4YSX D;  3F5H A;  2W27 A;  1R8E A;  3CX5 I;  2XV5 A;  1LTJ C;  4ASW A;  4EOT A;  3D70 A;  5KLV D;  1SFC D;  2KP8 A;  1VQ7 P;  2WQY C;  3TGU G;  1NTM G;  3BAS A;  4KT0 J;  1N7S C;  1NTM J;  2IFN A;  1SQX D;  2K88 A;  3P4P D;  3RL0 B;  3AE1 D;  1NU1 G;  3Q5R A;  3CPW O;  1YYC A;  2GUV A;  1N86 A;  3V2P A;  1W5C E;  1NU1 J;  4JYB A;  1LTG C;  4YXW H;  1KYO D;  2QSI A;  2KNC B;  2HOD B;  2GM4 A;  3O8Z A;  3N4X A;  3P7K A;  1YIT P;  2BEQ D;  3AE8 C;  3KQG A;  5C39 A;  5AW7 B;  3PHL A;  2WQY D;  1VQ6 P;  2WU5 C;  3L72 E;  2WDR D;  2P7J A;  1N7S D;  1GZL A;  2JO1 A;  1ZLL A;  2R5D A;  3Q5P A;  1GTW A;  3PP5 A;  2WT7 B;  1CW5 A;  2QG4 A;  2K37 A;  2CPB A;  5DJU B;  4H44 D;  4OGQ C;  4GT1 A;  5KAF H;  1FZC C;  3II6 A;  3V2N A;  3D6Y A;  3CXH E;  4NPD A;  2Y9Z A;  3A0B E;  2NZ2 A;  1GL2 D;  1WMK A;  4W80 A;  3HUS C;  3CMA P;  3AE9 C;  2KLV A;  3FGA D;  3WMM 0;  1EQ7 A;  3G9R A;  2QJY B;  1J1E B;  1J1D B;  3H1I D;  1SQB J;  2WU5 D;  1L0N J;  2LR2 A;  3MP7 B;  1RE4 A;  1K9M Q;  4HJG H;  1BGY G;  2KXP B;  4Y99 C;  2WSE J;  2FYU G;  1R5L A;  1PGJ A;  5BU8 B;  2HYN A;  1BGY J;  2Y0D A;  3CCJ P;  3HD7 B;  1NO4 A;  1PP9 D;  5AW1 B;  1LTT C;  2OYH A;  4BRY A;  2QJK B;  1S3J A;  2O1J A;  1SQP D;  1IC2 A;  3FXD A;  1OZH A;  1JY2 P;  3BVH A;  2YKQ A;  1BE3 E;  2GUS A;  1KIL C;  3VMX A;  2FFD C;  3AEG D;  3U1C A;  2QVA A;  3G3Z A;  1FZE A;  2FBW D;  1RF0 A;  1L4A B;  3V4Q A;  3G71 P;  1W2E A;  3CXH I;  5CBN A;  3W67 A;  1HTL C;  2OYI C;  1OVV A;  2M3E A;  5TIS E;  5CCH C;  3CC7 P;  3HE4 A;  3HE4 B;  1KYO E;  1JB0 J;  3L73 E;  3RK3 B;  1MFZ A;  1BCC E;  4K3A A;  3B8E B;  2NPS A;  2KK7 A;  5L8R J;  1YQ4 C;  4BXL A;  3VMY A;  3SWK A;  1NTZ E;  2YNY A;  4EDF A;  1BDC A;  4K35 A;  3SFD D;  2ZVN B;  3M0D C;  1KIL D;  4WB4 A;  2OQQ A;  3BCC D;  4DJG A;  4NPE A;  1XTG B;  1S9K D;  2WP9 D;  3V5B A;  2W6A A;  4YPC A;  3Q3D A;  1NTK K;  3D6Z A;  1YQ3 C;  1Q7Y Q;  2BCC E;  2QIW A;  3P4Q C;  2I1K A;  4JQ0 D;  3P8M C;  5CCH D;  2YMY A;  1T6A A;  4YT0 C;  2H43 A;  2KIK A;  3RL0 C;  1N73 B;  2CK3 H;  4AUW A;  2N1T A;  3HE5 A;  1FDI A;  5AW6 B;  1NTZ K;  1JTH B;  4I6L A;  4I2L C;  3H1I E;  1HJB A;  3KZI H;  1YBK A;  1PPJ E;  5E79 E;  4KJM A;  1ZOY D;  2AXT H;  3NTN A;  1NAF A;  5AVR B;  2YXQ B;  3MUD C;  3BRV B;  1CZQ A;  1EZV D;  1VQ9 P;  1KZU B;  3H1K D;  1L0L G;  1FOS F;  2HLO A;  1GDT A;  3P4Q D;  2B87 A;  2B87 B;  4D6T G;  2KS1 A;  5C3J D;  5AW9 B;  1PP9 E;  2OTL P;  3RL0 D;  4D6T J;  1LT9 A;  2A45 I;  1JUN A;  2E75 B;  2E43 A;  3MD0 A;  4FJV A;  3CX5 D;  1R5S A;  1JMM A;  1NHL A;  1MUU A;  1X22 A;  3L70 G;  2IDB A;  3Q5S A;  3VP9 A;  1PV3 A;  2K9J B;  2I8D A;  1M7L A;  2QM8 A;  1YI2 P;  2WIT A;  1Y9B A;  3H1L D;  3L70 J;  1IO4 A;  1SQB E;  4H0L D;  1VQ8 P;  5KJ7 A;  2BS2 C;  3I5C A;  1IFP A;  5GTI H;  1DEE G;  1L0N E;  1URQ C;  2QJY C;  1J1E C;  3VP8 A;  1SQV G;  1X8Y A;  1H0T A;  1MFT A;  1H0T B;  2JR8 A;  3H1H G;  1SQV J;  2K3R A;  1BGY E;  2Q3E A;  2H7H A;  1LP1 B;  1LP1 A;  1SQQ J;  1PGP A;  3H1H J;  3M9B A;  1S72 P;  1TFF A;  2H8P D;  1EDK A;  3SFE C;  3JC2 2;  1QL2 A;  5CCG C;  3G6E P;  1ZV8 A;  2KI7 B;  1PFI A;  1DH3 A;  2AEF A;  3HD7 C;  1IFN A;  3FXE A;  3RK2 B;  4PD4 H;  1E7P C;  1KIL E;  1KFN A;  4YSZ C;  2C9L Y;  3IFM A;  2JWA A;  2WSC H;  4KHX A;  1S9K E;  4Z1M H;  3VR8 D;  1JOC A;  1SQB K;  3L74 G;  2OTK E;  4ASV A;  2AEM A;  3ZDM A;  5AVY B;  3AEC D;  2WWW A;  1L0N K;  2JKV A;  1URQ D;  1KOR A;  1JNM A;  1EDL A;  1XTC C;  2B88 A;  1EC5 A;  3P4S C;  1GL2 A;  3MTU E;  2ZYA A;  2FYN B;  1L4A C;  1OX3 A;  1IFJ A;  5EFW B;  3SFE D;  1P84 H;  5CCG D;  3CCV P;  2P58 A;  2O01 N;  3B5N A;  3CWB G;  3RK3 C;  5AW3 B;  4C46 A;  3NXS A;  1NEN C;  4KX6 C;  4JF7 A;  1EXI A;  3CWB J;  4YSZ D;  5DJT B;  1JCC A;  3H1J J;  1L0V C;  1EZV E;  2IFM A;  1JY2 O;  2E74 B;  3PJS K;  1KFY C;  1LWU B;  4L73 A;  3AED C;  2KZI A;  3P4S D;  2LXB A;  3T97 A;  3CIR C;  3O6Q B;  5APW A;  1LTI C;  3WU2 H;  1FC2 C;  4MN4 C;  1M8O B;  1VF5 B;  1H8A A;  4OWF A;  1BSH A;  1M1J B;  3CX5 E;  3FWL A;  3L72 D;  3JCU H;  4ZMD A;  2Z5I A;  3RBX A;  1VQP P;  1N73 C;  1NEN D;  4KX6 D;  4PV1 B;  3H1L E;  3CCQ P;  2M5A B;  1OFC X;  5AVT B;  1L0V D;  1KFM A;  4W7Y A;  3CXH D;  1KFY D;  1JY3 N;  2KB7 P;  1M90 Q;  3AEB C;  4YXD D;  3CIR D;  5AVS B;  1LT1 A;  2RN0 A;  1RE3 A;  3CCS P;  1JY3 P;  1A02 F;  1GU5 A;  3AE3 C;  5KLV G;  1GU4 A;  1LTA C;  2PAJ A;  4XFJ A;  3CC2 P;  5AW2 B;  3RGU A;  5KKZ B;  2E75 C;  1SQX G;  2B76 C;  4EYY Q;  1RF1 B;  2O3J A;  1SQX J;  2IPP A;  4Y28 J;  2WDQ C;  5CCH A;  1P84 I;  1DD3 A;  3VYI A;  2IZ0 A;  1S5L H;  3AEB D;  3GF7 A;  5APV A;  2Y0C A;  2QE7 H;  3KPE A;  4LC1 A;  1SQQ E;  2V4H A;  4LLH A;  4N78 E;  1BE3 D;  5CHX A;  3P32 A;  1FZA A;  1OW6 A;  3AE3 D;  4UB6 H;  3L71 G;  2ZYD A;  5CMZ A;  3TGU J;  1GMJ A;  5KAI H;  1E5W A;  2SPZ A;  1U7M A;  1NKN A;  3L71 J;  1OWA A;  1NTK D;  2W8Z A;  1QVF O;  3H25 A;  1YHQ P;  4GOF A;  1QLE D;  1BSN A;  3RK2 C;  2WDQ D;  3L73 D;  2O01 H;  3WUV A;  2XND H;  3VRA D;  4YTN D;  1VQO P;  1T8Z A;  1BCC D;  4WY4 C;  1JMB A;  5CJ0 A;  3HTK A;  4H13 D;  1DD4 A;  4PJ0 H;  5B5E E;  1SQV K;  1NTZ D;  1GK4 A;  2XNX A;  1SQQ K;  2Q6Q A;  2IX7 C;  4HKZ H;  1DEB A;  3RK3 E;  2FYN C;  2W90 A;  1X79 B;  3A0B H;  1HJ0 A;  1NTM D;  2WTY A;  2FYZ A;  2BCC D;  2IYP A;  1HVV A;  3HRN A;  1FU1 A;  4I7Z B;  1ZRT E;  1KB9 I;  3RK2 D;  3H1J E;  3KDP B;  1ZME C;  3R4Y A;  4WY4 D;  5AW5 B;  3E1I A;  1VQN P;  3H32 A;  2WDV C;  3CLQ A;  3AE8 D;  3ABV C;  4AQR D;  1SQP G;  2E74 C;  2IBZ G;  1QVG O;  1LWU C;  5AVX B;  1PPJ D;  1SQP J;  3TYY A;  1LGH B;  2WPQ A;  2E5T A;  3QWO C;  3VRB C;  1YTZ I;  5KAF E;  2KLU A;  3GHG A;  1K8A Q;  2L91 A;  4OGQ D;  4GIF A;  2FYU J;  1KF6 C;  4PV1 C;  2C9N Y;  2E76 B;  2H88 C;  2OYH B;  3S4R A;  4BRY B;  1YJW P;  3AE9 D;  5B66 E;  3RBZ A;  5C2T C;  4EIJ A;  1Q82 Q;  2A06 E;  2O1K A;  2Q5U A;  1KYO H;  1SQB D;  3BCC G;  3VMZ A;  1Y8A A;  1L0N D;  1NTK E;  3CCL P;  1L2P A;  2YIU B;  5GTH E;  2WU2 C;  1NEK C;  1UII A;  3SSU A;  2E42 A;  5AVU B;  1KF6 D;  1BGY D;  3IR9 A;  2NPS B;  5KKZ C;  2H88 D;  2PGD A;  5APY A;  2WSC J;  4IFF A;  1RH5 B;  2KSJ A;  2V7Q H;  1JCD A;  3N7N A;  2I1J A;  3EQ2 A;  1M1K Q;  1VQM P;  1FS0 E;  3A5T A;  3CD6 P;  5KLI B;  3TGU E;  1NTM E;  2ZT9 B;  4JYC A;  4C7N A;  2HG5 D;  3L71 E;  2XZR A;  1Q81 Q;  3PRJ A;  1JY3 O;  2WU2 D;  1T3U A;  3H1K G;  1GD2 E;  3PH0 A;  1K04 A;  1NU1 E;  2R32 A;  3LW5 H;  4TLF A;  2MKV A;  4RKU J;  3LID A;  1G1I A;  3H1K J;  1WT6 A;  5E79 H;  3L37 A;  4XE5 B;  2N1T B;  3HE5 B;  1YQ4 D;  4IL6 X;  2W6B A;  1LTS C;  1RQU A;  3R2P A;  3TDK A;  3AE4 C;  1K05 A;  1FE6 A;  4UB8 H;  3K5B A;  5AVZ B;  1NTM K;  2HFE D;  2YMK A;  1PGO A;  1YQ3 D;  1IFM A;  2QEX P;  3GMA A;  2ZAE B;  2Y9Y A;  1ZP0 C;  3RL0 g;  1OIP A;  2KS1 B;  1TU3 F;  1X0T A;  1L0L J;  3L75 G;  1NU1 K;  1AJY A;  4YT0 D;  1AQT A;  1LT9 B;  3AEF C;  3QH9 A;  3UIA A;  2PP6 A;  1SFC A;  2FXM A;  5APX A;  3L75 J;  1VQL P;  5AW0 B;  2DW3 A;  2JDI H;  3KZI E;  4I7Z C;  1QGK B;  1S2E A;  3E1R A;  3A0H H;  3AE4 D;  4L76 A;  2WPR A;  1GW3 A;  1J1D C;  4L74 A;  2RKL A;  4N3Y B;  4DHJ A;  1RE4 C;  1ZP0 D;  1IJD B;  3Q2Y A;  2YKP A;  2FYU E;  1LTJ A;  1GK6 A;  2KOG A;  3VTP C;  1H89 A;  4IL6 H;  3AE7 C;  3SWF A;  2FXP A;  3WUT A;  2LXC B;  1KMI Z;  2KZJ A;  1N7S A;  2E5Y A;  1VPC A;  2E76 C;  1KQL A;  2QJK C;  3P8C D;  5KTB A;  1CI6 B;  1CI6 A;  2AEJ A;  3MHV A;  4H44 B;  3L70 D;  3PTZ A;  3L74 J;  4IOI H;  3AEE C;  1KC8 Q;  1OMI A;  3V4W A;  3TK1 A;  1GL2 B;  2WVR A;  1RF0 C;  1KB9 D;  2M3B A;  2FYU K;  1SQV D;  2JJL A;  3AE2 C;  1SQQ D;  4N78 D;  3H1H D;  2YIU C;  3B5N B;  3HD7 D;  2IBZ I;  1GW4 A;  2NPS C;  3L72 G;  1N8R Q;  2O01 J;  3U1A A;  2E76 D;  3NMD A;  1S1C X;  3FWN A;  1IFI A;  2B89 A;  3L72 J;  3LIE A;  4W7Z A;  2AXC A;  2JP3 A;  2W6J H;  3AEE D;  4YTM C;  1FZC A;  3M9Q A;  3W68 A;  3CX5 H;  4O9B A;  3D71 A;  1ZW0 A;  3T97 B;  4AYC A;  1S5L X;  3EFG A;  1G2C A;  1SS1 A;  1P84 E;  2R44 A;  1L4A D;  3MIW A;  1G1J A;  3HUS A;  2ZT9 C;  4DOJ A;  3AE2 D;  4TT3 H;  2ITA A;  3TF5 A;  3A2A A;  1OW7 A;  3RK3 D;  2P2U A;  5AVQ B;  3VON A;  3P4R C;  1QL1 A;  1NKZ B;  2N1T C;  4DZO A;  3H6P A;  3CWB D;  3ITK A;  1Q90 D;  4DDI A;  2QJP B;  3VMA A;  1HF9 A;  1ZRT D;  4YTM D;  2ZJS E;  1VQ5 P;  3H1J D;  1U7J A;  3WU2 E;  3AED D;  4PD4 I;  1SP4 A;  4QMA A;  1UIX A;  2FXO A;  4U3F G;  3A7O A;  3AE5 C;  2ZT9 D;  1L0L E;  4HYT B;  4U3F J;  5TJH A;  4D6T E;  4L75 A;  1KIL A;  2FFD A;  1BE3 G;  5H2F H;  5KLV J;  2PRR A;  1LT9 C;  1VQ4 P;  4WBA A;  3B4S A;  4I6M C;  3P8C E;  3KXD A;  2R3C A;  3CCR P;  2WS3 C;  2QM7 A;  3L70 E;  3M91 A;  2OYI A;  1NAY A;  4WWI A;  2Q7C A;  3L73 G;  2P1J A;  1BCC G;  5KJ7 C;  2Z4E A;  1KB9 E;  3L73 J;  1SQV E;  2Q1K A;  4HB1 A;  1L0L K;  1VDF A;  3H1H E;  2A06 D;  1NTZ G;  2N9Y B;  2HR3 A;  3M0D A;  3EFF K;  2A45 G;  1Y47 A;  1DIP A;  1WRG A;  3OAK A;  2E75 D;  2B76 D;  5B5E H;  4DHZ A;  2WS3 D;  2JWD A;  2WDR C;  4OVN F;  3A3Y B;  2BCC G;  2V7Q J;  1HBW A;  2L5G B;  3CCU P;  1S5L E;  3L74 E;  2BCC J;  4DT0 A;  3AE6 C;  3HTK B;  3IAO A;  5KJ7 D;  4H44 C;  1OW8 A;  1RHZ B;  1Q2N A;  4UB6 E;  3KHU A;  5CBO A;  2QA4 P;  5KAI E;  2KNC A;  2HOD A;  2OTJ P;  1GL2 C;  1LTB C;  3H1I G;  2UWJ E;  2WSF H;  3CXH H;  1PPJ G;  4H0L B;  1HGZ A;  2OGU A;  3TGU D;  3H1I J;  3LW5 J;  1JEK A;  5BU5 A;  3MZW B;  3CWB E;  3MUD A;  3L71 D;  4A7P A;  1PIX A;  3B5N C;  2WPV B;  4EI2 A;  1VL2 A;  2LKM A;  2P10 A;  4YSY C;  1AQ5 A;  4PJ0 E;  1NU1 D;  3C8V A;  2NRG A;  2WT7 A;  3MGN A;  3AE6 D;  1KD1 Q;  1PP9 G;  2P67 A;  2KUB A;  3H32 B;  2WZ7 A;  2G3A A;  1PP9 J;  2ZFY A;  3BRT B;  1N2D C;  2FY8 A;  1VQK P;  2M8R A;  5AW4 B;  1SQB G;  1VF5 C;  4JPZ B;  2GA1 A;  1SLQ A;  1URQ B;  1URQ A;  3GHG B;  3GF3 A;  3U59 A;  1FZF A;  1M56 D;  3AEG C;  1YJ9 P;  1IFD A;  3WUU A;  1L0N G;  1M1J C;  5B66 H;  1BDD A;  3B5N D;  4R4M A;  2XKM A;  1HWT C;  2FBW C;  3Q1M A;  2IYO A;  4YSY D;  1PGQ A;  2CPS A;  1FAV A;  4RES B;  2W83 C;  2J59 M;  5CCG A;  2WDV D;  2QJP C;  3TSI A;  1EXJ A;  3ABV D;  4R4L A;  2Q3I A;  1AVO A;  3HD7 A;  1LJ2 A;  1JY2 N;  2N9B A;  2E74 D;  2H89 C;  5TIS H;  5GTH H;  4U3F E;  2XDJ A;  4GOE A;  3GG2 A;  3BAT A;  2KYV A;  3B71 A;  1NGM B;  4GDO A;  2IBZ D;  5KLV E;  3SFD C; 
#chains in the Genus database with same CATH homology
 2WDV C;  3AE1 D;  2QIW A;  3VR9 C;  1VF5 D;  3P4Q C;  3VRB D;  3Q5R A;  3AEB D;  3P4S D;  3GF7 A;  3LW5 J;  3AE8 D;  3CIR C;  2O01 J;  3ABV C;  2J5U A;  2E76 D;  2E74 C;  3AE4 D;  1PIX A;  1S1C X;  4YT0 C;  2WS3 C;  4H0L C;  2WPV B;  2WP9 C;  1VF5 B;  1VL2 A;  2QSI A;  3SFE C;  2P10 A;  3S9O A;  4YSY C;  1OW6 A;  3AE3 D;  1KTM A;  1MKM A;  4PV1 D;  2JP3 A;  3C8V A;  2BEZ F;  1GMJ A;  1FDI A;  3AE7 D;  3AEE D;  4YTM C;  2ZT9 B;  1QLB C;  3AE6 D;  4YSX C;  4YTP C;  3VRB C;  1E7P C;  2BEQ D;  1NEN D;  1KIL E;  4KX6 D;  3AE8 C;  3D71 A;  3P4R D;  4PV1 B;  4YSZ C;  4U7J A;  2G3A A;  5C2T D;  3T97 B;  1ZP0 D;  1S5L X;  1FDO A;  3Q2Y A;  4OGQ D;  2ACZ D;  2WU2 D;  3AEG D;  4Z1M H;  3VR8 D;  1PL5 A;  3H25 A;  2ZT9 C;  2WQY D;  2D2C B;  2WU5 C;  1KF6 C;  1K04 A;  3EWK A;  2BS3 C;  2H89 D;  2K9Y A;  2MKV A;  2WDR D;  2WDQ D;  3AE2 D;  4TT3 H;  1ZOY D;  3AEC D;  3VRA D;  4PV1 C;  4RKU J;  2FBW D;  4YTN D;  3AEA C;  1L0V D;  1KOR A;  4OGQ B;  2E76 B;  2H88 C;  2JO1 A;  3AE7 C;  1YQ4 D;  3Q5P A;  4IL6 X;  1DIP A;  1KFY D;  2D2C C;  2FXP A;  4H13 D;  1OW7 A;  3P4P C;  3AE1 C;  1DD4 A;  3P4R C;  3VR9 D;  1VF5 C;  3AE9 D;  1KMI Z;  3P4Q D;  3AEB C;  3P4S C;  5C2T C;  4YXD D;  5KLI C;  3GF3 A;  4H44 D;  2E75 D;  4OGQ C;  2E76 C;  2B76 D;  3AEG C;  3CIR D;  3VR8 C;  5C3J D;  1JB0 J;  1RQU A;  2G8Y A;  3AE4 C;  4H13 B;  1NEK D;  1KQG B;  2QJK C;  3AE5 D;  1K05 A;  4R4M A;  1NYH A;  2WS3 D;  1RQV A;  1Q90 D;  2WDR C;  3AEC C;  3VRA C;  1ZOY C;  3IN6 A;  2WSF J;  3SFE D;  3D6Y A;  2FBW C;  3GLM A;  3Q1M A;  4YTN C;  3AE3 C;  4YSY D;  4H44 B;  2E75 B;  2V7Q J;  1HF9 A;  5L8R J;  3AEF D;  3RK3 E;  2NZ2 A;  1WMK A;  1YQ4 C;  2FYN C;  2YMK A;  3AEE C;  4H13 C;  4YTM D;  3AE6 C;  1IK7 A;  1YQ3 D;  1HJ0 A;  4XFJ A;  1KQF B;  1OMI A;  3AE9 C;  3FGA D;  3AED D;  4YTP D;  1R8E A;  1NEN C;  3GMA A;  4KX6 C;  4YXD C;  3G9R A;  3IAO A;  2WDV D;  3SFD D;  2IDB A;  2QJP C;  4H44 C;  2E75 C;  1EXI A;  3Q5S A;  2B76 C;  4YSZ D;  1PV3 A;  1UIX A;  1ZP0 C;  3O6Q A;  3D70 A;  5C3J C;  3RL0 g;  2ACZ C;  4YSX D;  1OW8 A;  1EXJ A;  1NEK C;  3AE5 C;  2OQQ A;  4R4L A;  2WU2 C;  3ABV D;  1TU3 F;  1Y9B A;  2WQY C;  2E74 D;  2ZT9 D;  4I7Z B;  2WU5 D;  1ZRT E;  4Y28 J;  1AJY A;  2H89 C;  1KF6 D;  4KT0 J;  4H0L D;  4YT0 D;  3AE2 C;  2WDQ C;  2BS2 C;  2WP9 D;  3AEF C;  5KKZ C;  1DD3 A;  1L0V C;  2QJY C;  3AEA D;  2YIU C;  2BS4 C;  1ZME C;  2H88 D;  3R4Y A;  3Q3D A;  5M1B A;  1U57 A;  3B71 A;  2E74 B;  3D6Z A;  1YQ3 C;  1NGM B;  1KFY C;  4GDO A;  2WSC J;  2D2C D;  4H0L B;  4I7Z C;  3AED C;  3P4P D;  2WSE J;  3SFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...