3AE9C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae9C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae9C02
3AEAC 1L0VC 3AE3D 3AE9D 3AEBD 2WQYC 3SFEC 3AE5C 1YQ4D 2B76D 3AE4D 2WDQD 3AEBC 3AEGC 4YTND 1L0VD 4YTMD 4KX6C 4YSZC 5C3JD 3VRAC 3VR9D 1NEND 3P4PD 2WP9C 3P4SD 3AE6D 3P4PC 3AECC 5C3JC 1OW7A 1KFYC 5C2TD 2WU2C 1K05A 3SFDC 3CIRC 3AEDD 2H89C 2WDQC 2B76C 3ABVC 1KF6C 1ZOYD 3AE1C 3VRBC 2BS2C 1NEKD 4YSYD 5C2TC 3AEAD 3SFDD 3AE9C 1K04A 2WU5D 2WU2D 2ACZD 2WS3D 2BS4C 3AECD 3AE6C 2WDVC 3AE2D 3B71A 3P4RC 1OW6A 4YXDC 3P4QD 1YQ3C 2H88C 3AE8D 2WDVD 2ACZC 1NENC 1E7PC 3VR9C 4YTNC 3AEGD 3VRBD 4YTPC 1ZOYC 1KF6D 3AE4C 4YSXD 3ABVD 3AE1D 4YTPD 1YQ4C 2H89D 4YSXC 2FBWC 1KTMA 4YT0C 3AE7C 3AEEC 1YQ3D 2H88D 1ZP0D 3P4RD 3P4SC 3AE8C 3AE2C 4YXDD 2WS3C 1QLBC 4KX6D 3VRAD 4YTMC 4YSZD 2WDRD 1NEKC 3AE7D 4YT0D 4YSYC 2FBWD 2WQYD 3SFED 3S9OA 3AE5D 3CIRD 3AEDC 1OW8A 3AE3C 2WDRC 3AEFD 1KFYD 2G3AA 3VR8D 2BS3C 3P4QC 2WP9D 1PV3A 3AEED 3VR8C 3AEFC 1ZP0C 2WU5C
chains in the Genus database with same CATH superfamily
2E76C 3PRJA 1X9VA 3SFEC 3Q5PA 3CXHD 2BEZF 1XTCC 2E74D 2N1TD 4M3LA 5CCHA 3UIAA 5AW1B 2E76B 3H1JD 3H1JE 2QM8A 1IZNB 4IL6E 1EDIA 2IFMA 3TGUE 3TF5A 1NTZE 1ZOYD 4QMAA 4W7YA 1S1CX 1VL2A 3FXDA 1NTZG 3LIEA 3PTZA 1M1KQ 3K5BA 3CX5H 2LXBA 1E7PC 4C7NA 2R3SA 1W2EA 3WUTA 2ZVNB 2WPSA 1BCCJ 4YTPD 3VTPC 4PJ0H 3ZDMA 3VMZA 2W27A 5H2FE 3B5ND 3RK3E 3AEEC 2XDJA 1YQ3D 3H1JJ 3U1CA 3A0BH 4GOFA 5AVWB 1SQVG 2KB7P 2WWWA 4PV1D 1Q86Q 3G3ZA 2B87B 3GMAA 2WQYD 2XV5A 1LT1A 2E75C 1URQB 2WMMA 3HD7B 1L0NG 2W6BA 3FXEA 1Y47A 4Z1MH 1PL5A 3GF3A 4WY4A 5APQA 1QVFO 3A7OA 2RH0A 1FJPA 2J5UA 1KILC 1LTJA 3H32B 3B8EB 1VQPP 5EFWB 3FWNA 3L72J 1X0TA 4KX6C 4C46A 1VF5C 2QJYB 1JTHA 5C3JC 1JM0A 5DJTB 5APSA 3P8CE 3R2PA 2OYHA 3R4YA 3TYYA 1CI6B 1NH4A 1NGMB 2Q3IA 3AE9C 1SVFA 3KZIE 3M0DA 1YQ3C 3L37A 3RK3B 1NWQA 3RBZA 2QSIA 4FJVA 1EC5A 4YTPC 1VQLP 3L71G 2FYUK 3TDKA 3CCLP 1SFCA 3KPEA 3L71J 5CBOA 2KSJA 1KYOI 1N7SB 3KDPB 2Z5HA 3F89A 3D6YA 3AE7D 2IBZE 1MFZA 3OAKA 3H1KD 3CWBJ 5AW8B 2RMZA 1M57D 4H13B 2ZAEB 1FDMA 1FE6A 2JJLA 4B86A 2JDIH 4LDTA 5KLIC 1AVYA 2M0BA 1JY2N 1L2PA 4XE5B 3VR8C 4I7ZC 3AEAC 2P10A 2SPZA 2IX7C 2FKWB 3CXHI 5E79E 1OZHA 1N86A 1SQBG 3L74J 4N78E 3F5HA 3WU2E 4OGQB 1GL2A 5KKZC 1EZVE 3W67A 3VP9A 1NU1J 1OX3A 1RHZB 4A7PA 3P7KA 1K05A 2QJKC 5B5EE 3VN0A 5CJ0A 2E5TA 4DHJA 2JO1A 1AJYA 1LTSC 3L73J 3EWKA 2A06D 4DDGA 5KLVG 2OYIB 1GL2B 2H43A 1IFPA 1EDKA 3M9QA 2KZIA 3U1AA 1FZEA 3CXHE 3H1KJ 1HWTC 3H1HG 2V7QJ 4IOIH 2LR2A 1QVGO 3Q5RA 5CCHD 2ZYDA 5AVTB 2FFDA 1OVVA 1ZLLA 2IZ1A 4C7RA 1URQD 1HJ0A 3OW2O 1JMBA 3VRAD 1BE3E 3H1LJ 1T2KD 3GLMA 1RF1C 3T97A 3CPWO 3H1HD 1YHQP 1RQUA 4JYCA 3CXHH 5BU5A 1NO4A 1G1IA 1GZLA 3AEED 2ZFYA 1M8OB 2AXTE 1KD1Q 3A2AA 5DJUB 3WMM0 4U3FE 3E1IA 3NXSA 2P1JA 5GTIH 2M8RA 1SQPE 3TK1A 1SQVJ 2OYHC 2QG4A 2KI7B 2A45G 2Z5IA 4GT1A 2FXOA 1KN7A 1Z56A 5KLVK 1M1JC 2WSCH 2WSFH 1K04A 3H25A 2M3BA 3TNUA 2PP6A 2GUSA 3H1HE 3AE8D 3RL0g 2ZXEB 3BVHA 3T97B 2E5YA 1YQ4C 3L72G 1LWUB 2FBWC 4L74A 5AVYB 1KFNA 2E76D 1YTZT 1SQBK 2H88D 1TU3F 2K9JB 1QGKB 2WS3C 1IFDA 1QLBC 2ZYGA 2L91A 2IZ0A 2K1AA 1S5LE 1L4AD 1KYOD 2QJPB 4ZKUA 1GL2C 2IYOA 3TGUD 1KQLA 3G71P 2HR3A 3QH9A 2FFDB 3V2PA 2BS3C 1S5LX 2WP9D 3AEFC 1P84H 2J58A 1KC8Q 1JMMA 1L0NE 1FS0E 1SQQG 3HUSB 1NTKK 2FYUE 4W7ZA 2M3EA 1MKMA 3RK3D 1OFCX 2W6AA 1WMKA 4H44D 4OGQC 2K9JA 1NEND 1QL1A 2P2UA 3TGUG 2E75B 3HUSC 2WT7B 3I5CA 1G1JA 1NYHA 2O3JA 1L0LK 4N78D 1YJNP 3SFDC 1IK9A 3M9BA 2QM7A 3HTKB 1VQKP 1N7SD 2J59M 2FFDC 3EFFK 5APYA 1L0NJ 3CX5I 3MIWA 3P4QD 3U59A 3FGAD 3H1KG 2AEMA 5KLVE 4IFFA 1ZXGA 3D70A 3NFQA 1ZRTE 2I8DA 5APXA 3CC2P 1SQXE 5KAIH 2OYIC 2W83C 1GTWA 3D71A 3NMDA 3L70D 3IR9A 1SFCB 3PLNA 3VMXA 1FU1A 1N2DC 5TISH 3E7KA 4LC1A 1KFMA 3B5NB 5CCGC 1P84I 2N9BA 1SQQD 3CWBG 2WSCJ 2WSFJ 3OJAB 5AW3B 1PPJE 5AW4B 1TFFA 3I55P 3CX5E 3PJSK 2YXRB 1L0VC 1LT9C 2OYHB 2O1KA 4R4MA 4NPEA 2Z4EA 2A06G 3M91A 1OWAA 2D2CD 5AW9B 4MN4C 2R44A 2AXCA 3VMAA 1OMIA 1N8RQ 2NPSA 1KILE 2R32A 5KAFE 3AE6D 3GF7A 1ZR2A 3D6ZA 2NZ2A 1DH3A 2KUBA 4Y99B 2H89C 1NTMK 1DD3A 2XKMA 2NPSC 3CCQP 2W8ZA 5C2TC 2HLOA 3BCCE 2CPSA 1LP1B 1T8ZA 4OVNF 3HD7D 3CI9A 1JOCA 5AVZB 4C7NB 3AE4C 3L75E 1HTLC 1FAVA 2H89D 4YSXC 3L74E 1BE3G 1KYOH 4IFMA 1ZP0D 5AVQB 3EFGA 1FDIA 1L0LE 2KXPB 1BDDA 3TSIA 1BGYD 1VQNP 3O8ZA 2RN0A 1QL2A 4HYTB 1ZRTD 3AEDC 4R4LA 2BEQD 1AVOA 4PD4H 3P4QC 1SQQJ 4GIFA 2E43A 1J2JB 2XNXA 1NTZJ 2K9YA 5CCGA 2WU5C 1YBKA 1KORA 2YKPA 3V4WA 1M90Q 1KQGB 5AW0B 1A02J 5AVVB 2POHA 2BCCJ 1BGYG 2FYUJ 3KYQA 1NTKJ 1SQBE 3VRAC 1YIJP 1MFTA 1XTGB 3H6PA 1H89A 3ITKA 1J1EC 2E42A 4WB4A 3AECC 1AQ5A 3S4RA 2HPCA 3L74D 1JY3P 4I7ZB 1RF0C 3LIDA 3RBXA 4GOEA 5KTBA 1ZW0A 1NEKD 1CSBA 2YKQA 2WU5D 2WU2D 2ZT9B 1KB9H 3A0BE 1JCCA 4IL6H 3AE2D 1AQTA 2R5BA 3MZWB 4KJMA 3L74G 3CWBD 4GDOA 2HPCB 1KYOE 1M1JA 1L4AC 4OWFA 3TGUJ 1PGOA 1KB9D 1PP9G 3L71D 2M5AB 1G2CA 1JTHB 3EQ2A 1ZR4A 5GTHE 4H44B 1NKZB 5KJ7A 3N7NA 2FYUD 2Q1KA 2FBWD 3S9OA 2O01H 1VQ5P 1LTAC 2B89A 3AEFD 1NU1K 4H0LC 3VR8D 5KAIE 1NTZD 1EDJA 4I2LC 3GG2A 1M7LA 1K73Q 2YIUC 3H1HJ 4BRYB 1GL2D 2OQQA 1SQXK 3AEBC 4I1LA 1HGVA 1HF9A 4HJGH 4IFDK 1GU4A 3G4SP 1VQ8P 3NTNA 1BGYJ 1U7MA 2KOGA 2L5GB 4ZMDA 2N1TA 4U3FD 1E79H 1KB9E 2KIKA 1S5LH 2Q6QA 4YSYD 2WPQA 1N73B 3P4RC 5M1BA 5CMZA 3L72E 4WY4B 1RF1A 2C9LY 3VR9C 1PIXA 1VQ4P 1NAFA 4PD4I 3H1ID 4BRYA 3AEGD 1NTMD 2PRRA 3BASA 1URQA 1JB0J 3L70J 3A3YB 2NPSB 4O9BA 1EXJA 1LTIC 2D2CB 3KXDA 1LT9A 1VQ6P 1FBMA 5CCHC 4D6TE 1Q90D 2CPBA 4DOJA 4DT0A 2ITAA 1ZMEC 5GTHH 1YI2P 3BATA 3JCUH 1NTMJ 3N4XA 1L0ND 4D6TG 1J1DC 1CZQA 2G3AA 4LGDE 2KP8A 1RF0A 2YIUB 4ASWA 1UIXA 2JR8A 1S2EA 4PD4D 2I1JA 2E75D 1SFCD 1NTKG 1T2KC 1GMJA 1K8AQ 2JKVA 4YPCA 4EYYQ 1DEEG 3IAOA 4OGQD 1G2CB 3B5NC 3WU2H 1EQ7A 1A02F 1ZV8A 1FDOA 3CIRC 1LTGC 1NTKD 2BS2C 3JC22 2BCCD 3S1KA 2GA1A 1JEKA 1FZCB 3B4SA 3B71A 4YXDC 2LKMA 3MGNA 4YTNC 2HG5D 4DHZA 3Q1MA 3H1KE 1KTMA 2FYZA 2K37A 4N3YB 3RK2B 1BCCG 3AE7C 2Y9ZA 3H1LD 3CCUP 2Q5UA 1EZVD 2XNDH 2YMYA 2WDRD 3SWYA 1LJ2A 2B88A 5H2FH 2KLUA 1L0LG 3Q3DA 2IBZG 2WDRC 2MKVA 1SS1A 1L0LJ 1LTBC 1NOHA 4UB6E 4UB8H 4ZNCA 3AE9D 3HUSA 3BRVB 2W90A 3QWOC 2YO3A 3KHUA 2IBZD 4PD4E 1AFOA 4YTND 1SQQE 3V2NA 1LGHB 2XZRA 3W68A 4AYCA 1NU1D 1BGYE 1KFYC 3V6IA 1AV1A 3BCCG 5TJHA 3CC4P 4DCKA 3AE1C 1FZFA 2R3CA 1IFMA 1GDTA 2V4HA 3O6QA 3WUVA 1NU1E 1Q82Q 2WDVC 2AXTH 2V7QH 1YJ9P 4JBZA 4HH2A 1BSNA 5KLVD 4Y28J 5APWA 3B5NA 1SQPJ 1S72P 1LNQA 3MHVA 3VYIA 3A5TA 2KNCA 4PV1C 3H1IE 4EI2A 2P67A 1NVOA 4KX6D 4Y99C 3VONA 3H1IG 1PZQA 1SQVD 3PH0A 4L73A 1T3JA 1IFIA 3II6A 3CD6P 1KILD 1CI6A 3Q5SA 1IFNA 3CCMP 2JP3A 3CIRD 5AW7B 1SQVK 1IO4A 2OYOA 1KFYD 1HGZA 2O1JA 4I6MC 1BSHA 1R5LA 2FYNB 3CCRP 4U3FG 1T3UA 1LT9B 3CCSP 1AA0A 1J1EB 2WQYC 3HRNA 2O01J 1SQPG 3BCCD 3AEGC 2C0WA 3CC7P 3VR9D 3FWLA 1NTZK 1FZBA 3JSVC 2E74C 1RF1B 3GW6A 1BCCD 1LTJC 2ZT9D 1VPCA 2FXPA 1OVRA 2Y9YA 2ZVOB 1JUNA 3AEAD 3L73G 1HJBA 3RGUA 2QJPC 3L71E 1BCCE 2AEJA 1ZOYC 1PPJD 3HTKA 2HFED 2RKLA 4WVZA 1FJKA 1Y8AA 3P4RD 4YXDD 1W2BO 2DW3A 1RQVA 1P84D 2OYIA 3V5BA 2YKOA 2YNYA 1LTJB 3H32A 2N9YB 4TLFA 1BDCA 2E74B 3SFED 1PGPA 1PPJG 1LWUA 5B66H 5L8RJ 3M0AA 3HE4A 4DJGA 1M1JB 1OXZA 3G6EP 1EDLA 2LXCB 3RL0C 3USSA 1PFIA 1DD4A 1PV3A 2ZFCA 4KT0J 3KZIH 2IYPA 2Q7CA 1KZUB 1P84E 2OGUA 1NTME 1X22A 3MUDA 5C39A 1MV8A 1DIPA 2GUVA 2OTJP 4YSZC 3SWKA 5C3JD 3M06A 1QEXA 1VF5D 3L72D 3V2RA 2PGDA 4GODA 3E1RA 1OW7A 1VQ9P 3RK2D 2WU2C 3M0DC 2BASA 1W5CE 1K9MQ 1KMIZ 1YJWP 2KZJA 4RESB 5KAFH 4L76A 4PV1B 2ACZD 3KQGA 4JPZB 2AEFA 2YMKA 1YTZI 4L75A 2XU6A 1KQFB 2CK3H 1VQMP 3FX0A 1HUCA 1SFCC 1JY2P 2OARA 1GW3A 3C8VA 3AE2C 1R8EA 2C0XA 1Q81Q 4UB8E 1NEKC 3L35A 3C9IA 4YSYC 3M9HA 3P8MC 4K3AA 2QEXP 3AE5D 3AE3C 1N73A 2H8PD 2FY8A 1ZP0C 2QJKB 3AEBD 2N1TB 2WDQD 3HE4B 4WY4D 3RL0B 4AUWA 1FZCA 1OIPA 4YTMD 3HD7C 2WITA 1KQSO 2N1TC 1D7MA 4H0LD 2P7JA 1KILA 2VRSA 2HODB 3L73E 1JY3O 4ZKPA 1SQPD 3ABVC 1U57A 5KLIB 1S9KE 1KF6C 2KSEA 2QIWA 3CMEP 3MUDC 1IC2A 2BS4C 2B9BA 3L75G 3HE5B 4JQ0D 1H0TA 3P32A 5CBNA 3C1LA 1YITP 1PP9E 1HVVA 4YT0C 2IBZI 1NHLA 3O6QB 4NPDA 1LWUC 2JWDA 1QLED 3P4SC 5GTIE 1FOSE 1RH5B 2ZYAA 1BE3D 2Q3EA 3CL3D 4TT3H 2G8YA 1IFJA 1FOSF 1GW4A 5CJ4A 2WZ7A 1Q7YQ 1USDA 3A0HH 2ZXXA 2NRGA 5AVUB 1L0LD 2WVRA 2KLVA 3VOPA 2ZJSE 1H88A 3OA7A 4XFJA 5KJ7C 4N6JA 2PFXA 1EZVI 2BCCG 3SWFA 2QJYC 1RY3A 1VF5B 3AE5C 4U3FJ 2FYNC 3L70G 1BE3J 3L73D 4DZOA 3H1LE 1L0VD 2A06E 4XA4A 1IK7A 1Q2NA 1KILB 3P4PC 3H1LG 1N7SA 4IL6X 3IF4A 1FZGA 2FXMA 1EZVG 1WRGA 3AEDD 1NU1G 1N7SC 3SSUA 1QX8A 2KYVA 3VRBC 4RJTA 1L4AA 3SFDD 1JCDA 4LLHA 4WWIA 3AECD 3CCVP 4D6TJ 2KS1A 1OW6A 4HKZH 5AW5B 1NENC 2JEEA 1CW5A 4PJ0E 2HODA 3RK3C 5BVZA 3VRBD 3JCUE 4YSXD 1KB9I 1H8AA 4DHIB 2C9NY 1GD2E 1S3JA 1SP4A 1RE3A 1U7JA 1SLQA 3CX5D 1SQXG 2Y0CA 3BRTB 1L0NK 5AVRB 1IJDB 2WPVB 4YSZD 1RE4C 1PGJA 2NPSD 5B5EH 2WTYA 3IFMA 1FZCC 3LW5J 5TISE 1OW8A 2OTKE 3VMYA 1GU5A 5KJ7D 2WSSH 1LP1A 3VP8A 3MP7B 1SQBD 1NTMG 3L70E 4H13D 3RL0D 1WT6A 1USEA 3MD0A 4RO0A 1VQ7P 1SQXD 1S9KD 2B76D 1YQ4D 3AE4D 1SQPK 4EDFA 4KHXA 4DDIA 4YXWH 2Q9IA 1OVUA 4H0LB 1KV4A 5KKZB 3PHLA 3H1JG 2QVAA 2WP9C 4I6LA 3P4SD 3BCCJ 5AVSB 5C2TD 1SQXJ 1NJIQ 2O01N 1PP9D 2WDQC 2B76C 4U7JA 1HH0A 3CCEP 2K88A 1Y9BA 2A45H 2KK7A 3L75J 3HD7A 5B66E 4JF7A 2KS1B 1X79B 4H13C 4HB1A 1X8YA 2WS3D 3AE6C 1L4AB 1MUUA 2H88C 4K35A 3GHGC 5E79H 4W80A 1HBWA 3GHGB 1PGQA 5AVXB 5APUA 1KF6D 2D2CC 3L75D 3ABVD 5APTA 3V4QA 5APVA 2QE7H 2ZT9C 2IPPA 4BXLA 1PP9J 1S4XA 3PP5A 4EIJA 1JY3N 4AQRD 1YYCA 2IFNA 1LTTC 4YTMC 2W6JH 4WY4C 4OH8B 1H0TB 2UWJE 1N73C 5CCGD 5KLVJ 2KNCB 2JWAA 2H7HA 2BCCE 5K5GB 3TNUB 2GM4A 5CHXA 1NTKE 1SQBJ 3HE5A 3AE3D 2YO2A 3L4FA 1MZ9A 1GK6A 2WPRA 4JYBA 1JO5A 2HYNA 1VDFA 1J1DB 2WT7A 3L36A 1E5WA 3P4PD 2WSEH 3A0HE 1ZN5A 2FYUG 2I1KA 1DX7A 1SQQK 3H1IJ 2B87A 1JNMA 5BU8B 3LW5H 4BWNA 1URQC 2P58A 2OTLP 3CLQA 3MTUE 4ASVA 3I56P 2WDVD 2ACZC 4H44C 1UIIA 4D6TD 4CPGA 1RE3C 1NKNA 3WUUA 2K3RA 1EXIA 1FC2C 1RE4A 3AE1D 2PAJA 1FZAA 1NAYA 1DEBA 4WBAA 3RK2C 1SQVE 3G9RA 2IDBA 3AE8C 2WSEJ 1M56D 2YXQB 5AW2B 2QRXA 3CMAP 1VQOP 3CCJP 4GKGA 4EOTA 1GK4A 2R5DA 4YT0D 3CWBE 3V2QA 3GHGA 4RKUJ 1N7LA 1JY2O 5AW6B 2QA4P 3P8CD 3IN6A 2MJZA 4NPFX 1R5SA 2Y0EA 4UB6H 1T6AA 2A45I 2Y0DA 2M5AA 3Q2YA
chains in the Genus database with same CATH topology
4KT0J 3AEAC 1L0VC 2P10A 3AE3D 3AE9D 2E76C 1UIXA 4R4MA 2YIUC 1KORA 2QJYC 3AEBD 1VF5B 2J5UA 1KQGB 2E75D 2WQYC 3SFEC 3AE5C 1YQ4D 2D2CD 2B76D 3AE4D 2FYNC 2OQQA 2O01J 3Q5PA 2WDQD 4OGQB 1GMJA 3AEBC 4H0LB 1MKMA 3AEGC 1DIPA 2BEZF 1HF9A 4YTND 5KKZC 1L0VD 1OMIA 4YTMD 4KX6C 2WU5C 4YSZC 1WMKA 4H44D 4OGQC 5C3JD 3VR9D 3VRAC 1NEND 2E74D 1VF5D 1KILE 3P4PD 1IK7A 2WP9C 2E75B 3P4SD 3AE6D 3GF7A 1VF5C 3P4PC 3AECC 3IAOA 4OGQD 1NYHA 5C3JC 2E74C 1OW7A 4H0LD 4IL6X 1KFYC 3D6ZA 2E76B 5C2TD 2WU2C 2NZ2A 1K05A 3SFDC 2QJKC 3CIRC 1FDOA 4I7ZB 1KMIZ 3AEDD 2H89C 2ZT9D 2JO1A 1AJYA 2WDQC 2B76C 3ABVC 1U57A 4U7JA 1KF6C 3R4YA 1ZOYD 3EWKA 1Y9BA 2FXPA 3AE1C 3VRBC 2BS2C 1DD3A 1NEKD 1NGMB 4YSYD 2QIWA 5C2TC 1S1CX 1VL2A 3AEAD 3SFDD 3AE9C 1K04A 3O6QA 4H13C 4PV1B 2WU5D 2ACZD 3H25A 2WU2D 2WS3D 2BS4C 2ZT9B 3AECD 2YMKA 3GF3A 3AE6C 2QJPC 2WDVC 3AE2D 3B71A 1KQFB 1OW6A 5M1BA 4YXDC 3P4RC 3P4QD 1YQ3C 2H88C 3AE8D 2WDVD 2ACZC 3FGAD 4H44C 3VR8C 3RL0g 1NENC 1E7PC 3VR9C 1PIXA 4Y28J 4YTNC 3D70A 2QSIA 3AEGD 3VRBD 1ZRTE 1ZOYC 4GDOA 4YTPC 3T97B 2D2CC 3AE4C 1EXIA 1KF6D 3ABVD 3AE1D 4YSXD 4YTPD 1YQ4C 2V7QJ 3Q1MA 2H89D 4YSXC 2FBWC 2ZT9C 3Q5RA 1KTMA 4YT0C 2E76D 1JB0J 4PV1C 3AE7C 3G9RA 3RK3E 3AEEC 3D71A 1TU3F 1YQ3D 2H88D 1ZP0D 3P4RD 3P4SC 2IDBA 3AE8C 2WSEJ 3AE2C 3C8VA 1EXJA 2D2CB 4YXDD 1RQVA 2WS3C 1FDIA 1HJ0A 1R8EA 1QLBC 4KX6D 3VRAD 4YTMC 2WPVB 4YSZD 3D6YA 2WDRD 1NEKC 3AE7D 4YT0D 4PV1D 4YSYC 3GLMA 2G8YA 4H44B 4TT3H 4RKUJ 2E74B 3GMAA 2FBWD 1Q90D 2WQYD 3SFED 3S9OA 3Q5SA 3AE5D 2E75C 3LW5J 5L8RJ 1RQUA 4H13B 1ZMEC 2JP3A 3CIRD 3IN6A 3AEDC 1OW8A 3Q3DA 3AE3C 4R4LA 2BEQD 2WSCJ 2WSFJ 2WDRC 2MKVA 3AEFD 1KFYD 4H0LC 4Z1MH 2G3AA 3VR8D 5KLIC 2BS3C 3Q2YA 3P4QC 1S5LX 2WP9D 1DD4A 1PV3A 1PL5A 2K9YA 4XFJA 3AEFC 3AEED 1ZP0C 4I7ZC 4H13D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA C;  1L0V C;  3AE3 D;  3AE9 D;  3AEB D;  2WQY C;  3SFE C;  3AE5 C;  1YQ4 D;  2B76 D;  3AE4 D;  2WDQ D;  3AEB C;  3AEG C;  4YTN D;  1L0V D;  4YTM D;  4KX6 C;  4YSZ C;  5C3J D;  3VRA C;  3VR9 D;  1NEN D;  3P4P D;  2WP9 C;  3P4S D;  3AE6 D;  3P4P C;  3AEC C;  5C3J C;  1OW7 A;  1KFY C;  5C2T D;  2WU2 C;  1K05 A;  3SFD C;  3CIR C;  3AED D;  2H89 C;  2WDQ C;  2B76 C;  3ABV C;  1KF6 C;  1ZOY D;  3AE1 C;  3VRB C;  2BS2 C;  1NEK D;  4YSY D;  5C2T C;  3AEA D;  3SFD D;  3AE9 C;  1K04 A;  2WU5 D;  2WU2 D;  2ACZ D;  2WS3 D;  2BS4 C;  3AEC D;  3AE6 C;  2WDV C;  3AE2 D;  3B71 A;  3P4R C;  1OW6 A;  4YXD C;  3P4Q D;  1YQ3 C;  2H88 C;  3AE8 D;  2WDV D;  2ACZ C;  1NEN C;  1E7P C;  3VR9 C;  4YTN C;  3AEG D;  3VRB D;  4YTP C;  1ZOY C;  1KF6 D;  3AE4 C;  4YSX D;  3ABV D;  3AE1 D;  4YTP D;  1YQ4 C;  2H89 D;  4YSX C;  2FBW C;  1KTM A;  4YT0 C;  3AE7 C;  3AEE C;  1YQ3 D;  2H88 D;  1ZP0 D;  3P4R D;  3P4S C;  3AE8 C;  3AE2 C;  4YXD D;  2WS3 C;  1QLB C;  4KX6 D;  3VRA D;  4YTM C;  4YSZ D;  2WDR D;  1NEK C;  3AE7 D;  4YT0 D;  4YSY C;  2FBW D;  2WQY D;  3SFE D;  3S9O A;  3AE5 D;  3CIR D;  3AED C;  1OW8 A;  3AE3 C;  2WDR C;  3AEF D;  1KFY D;  2G3A A;  3VR8 D;  2BS3 C;  3P4Q C;  2WP9 D;  1PV3 A;  3AEE D;  3VR8 C;  3AEF C;  1ZP0 C;  2WU5 C; 
#chains in the Genus database with same CATH topology
 2E76 C;  3PRJ A;  1X9V A;  3SFE C;  3Q5P A;  3CXH D;  2BEZ F;  1XTC C;  2E74 D;  2N1T D;  4M3L A;  5CCH A;  3UIA A;  5AW1 B;  2E76 B;  3H1J D;  3H1J E;  2QM8 A;  1IZN B;  4IL6 E;  1EDI A;  2IFM A;  3TGU E;  3TF5 A;  1NTZ E;  1ZOY D;  4QMA A;  4W7Y A;  1S1C X;  1VL2 A;  3FXD A;  1NTZ G;  3LIE A;  3PTZ A;  1M1K Q;  3K5B A;  3CX5 H;  2LXB A;  1E7P C;  4C7N A;  2R3S A;  1W2E A;  3WUT A;  2ZVN B;  2WPS A;  1BCC J;  4YTP D;  3VTP C;  4PJ0 H;  3ZDM A;  3VMZ A;  2W27 A;  5H2F E;  3B5N D;  3RK3 E;  3AEE C;  2XDJ A;  1YQ3 D;  3H1J J;  3U1C A;  3A0B H;  4GOF A;  5AVW B;  1SQV G;  2KB7 P;  2WWW A;  4PV1 D;  1Q86 Q;  3G3Z A;  2B87 B;  3GMA A;  2WQY D;  2XV5 A;  1LT1 A;  2E75 C;  1URQ B;  2WMM A;  3HD7 B;  1L0N G;  2W6B A;  3FXE A;  1Y47 A;  4Z1M H;  1PL5 A;  3GF3 A;  4WY4 A;  5APQ A;  1QVF O;  3A7O A;  2RH0 A;  1FJP A;  2J5U A;  1KIL C;  1LTJ A;  3H32 B;  3B8E B;  1VQP P;  5EFW B;  3FWN A;  3L72 J;  1X0T A;  4KX6 C;  4C46 A;  1VF5 C;  2QJY B;  1JTH A;  5C3J C;  1JM0 A;  5DJT B;  5APS A;  3P8C E;  3R2P A;  2OYH A;  3R4Y A;  3TYY A;  1CI6 B;  1NH4 A;  1NGM B;  2Q3I A;  3AE9 C;  1SVF A;  3KZI E;  3M0D A;  1YQ3 C;  3L37 A;  3RK3 B;  1NWQ A;  3RBZ A;  2QSI A;  4FJV A;  1EC5 A;  4YTP C;  1VQL P;  3L71 G;  2FYU K;  3TDK A;  3CCL P;  1SFC A;  3KPE A;  3L71 J;  5CBO A;  2KSJ A;  1KYO I;  1N7S B;  3KDP B;  2Z5H A;  3F89 A;  3D6Y A;  3AE7 D;  2IBZ E;  1MFZ A;  3OAK A;  3H1K D;  3CWB J;  5AW8 B;  2RMZ A;  1M57 D;  4H13 B;  2ZAE B;  1FDM A;  1FE6 A;  2JJL A;  4B86 A;  2JDI H;  4LDT A;  5KLI C;  1AVY A;  2M0B A;  1JY2 N;  1L2P A;  4XE5 B;  3VR8 C;  4I7Z C;  3AEA C;  2P10 A;  2SPZ A;  2IX7 C;  2FKW B;  3CXH I;  5E79 E;  1OZH A;  1N86 A;  1SQB G;  3L74 J;  4N78 E;  3F5H A;  3WU2 E;  4OGQ B;  1GL2 A;  5KKZ C;  1EZV E;  3W67 A;  3VP9 A;  1NU1 J;  1OX3 A;  1RHZ B;  4A7P A;  3P7K A;  1K05 A;  2QJK C;  5B5E E;  3VN0 A;  5CJ0 A;  2E5T A;  4DHJ A;  2JO1 A;  1AJY A;  1LTS C;  3L73 J;  3EWK A;  2A06 D;  4DDG A;  5KLV G;  2OYI B;  1GL2 B;  2H43 A;  1IFP A;  1EDK A;  3M9Q A;  2KZI A;  3U1A A;  1FZE A;  3CXH E;  3H1K J;  1HWT C;  3H1H G;  2V7Q J;  4IOI H;  2LR2 A;  1QVG O;  3Q5R A;  5CCH D;  2ZYD A;  5AVT B;  2FFD A;  1OVV A;  1ZLL A;  2IZ1 A;  4C7R A;  1URQ D;  1HJ0 A;  3OW2 O;  1JMB A;  3VRA D;  1BE3 E;  3H1L J;  1T2K D;  3GLM A;  1RF1 C;  3T97 A;  3CPW O;  3H1H D;  1YHQ P;  1RQU A;  4JYC A;  3CXH H;  5BU5 A;  1NO4 A;  1G1I A;  1GZL A;  3AEE D;  2ZFY A;  1M8O B;  2AXT E;  1KD1 Q;  3A2A A;  5DJU B;  3WMM 0;  4U3F E;  3E1I A;  3NXS A;  2P1J A;  5GTI H;  2M8R A;  1SQP E;  3TK1 A;  1SQV J;  2OYH C;  2QG4 A;  2KI7 B;  2A45 G;  2Z5I A;  4GT1 A;  2FXO A;  1KN7 A;  1Z56 A;  5KLV K;  1M1J C;  2WSC H;  2WSF H;  1K04 A;  3H25 A;  2M3B A;  3TNU A;  2PP6 A;  2GUS A;  3H1H E;  3AE8 D;  3RL0 g;  2ZXE B;  3BVH A;  3T97 B;  2E5Y A;  1YQ4 C;  3L72 G;  1LWU B;  2FBW C;  4L74 A;  5AVY B;  1KFN A;  2E76 D;  1YTZ T;  1SQB K;  2H88 D;  1TU3 F;  2K9J B;  1QGK B;  2WS3 C;  1IFD A;  1QLB C;  2ZYG A;  2L91 A;  2IZ0 A;  2K1A A;  1S5L E;  1L4A D;  1KYO D;  2QJP B;  4ZKU A;  1GL2 C;  2IYO A;  3TGU D;  1KQL A;  3G71 P;  2HR3 A;  3QH9 A;  2FFD B;  3V2P A;  2BS3 C;  1S5L X;  2WP9 D;  3AEF C;  1P84 H;  2J58 A;  1KC8 Q;  1JMM A;  1L0N E;  1FS0 E;  1SQQ G;  3HUS B;  1NTK K;  2FYU E;  4W7Z A;  2M3E A;  1MKM A;  3RK3 D;  1OFC X;  2W6A A;  1WMK A;  4H44 D;  4OGQ C;  2K9J A;  1NEN D;  1QL1 A;  2P2U A;  3TGU G;  2E75 B;  3HUS C;  2WT7 B;  3I5C A;  1G1J A;  1NYH A;  2O3J A;  1L0L K;  4N78 D;  1YJN P;  3SFD C;  1IK9 A;  3M9B A;  2QM7 A;  3HTK B;  1VQK P;  1N7S D;  2J59 M;  2FFD C;  3EFF K;  5APY A;  1L0N J;  3CX5 I;  3MIW A;  3P4Q D;  3U59 A;  3FGA D;  3H1K G;  2AEM A;  5KLV E;  4IFF A;  1ZXG A;  3D70 A;  3NFQ A;  1ZRT E;  2I8D A;  5APX A;  3CC2 P;  1SQX E;  5KAI H;  2OYI C;  2W83 C;  1GTW A;  3D71 A;  3NMD A;  3L70 D;  3IR9 A;  1SFC B;  3PLN A;  3VMX A;  1FU1 A;  1N2D C;  5TIS H;  3E7K A;  4LC1 A;  1KFM A;  3B5N B;  5CCG C;  1P84 I;  2N9B A;  1SQQ D;  3CWB G;  2WSC J;  2WSF J;  3OJA B;  5AW3 B;  1PPJ E;  5AW4 B;  1TFF A;  3I55 P;  3CX5 E;  3PJS K;  2YXR B;  1L0V C;  1LT9 C;  2OYH B;  2O1K A;  4R4M A;  4NPE A;  2Z4E A;  2A06 G;  3M91 A;  1OWA A;  2D2C D;  5AW9 B;  4MN4 C;  2R44 A;  2AXC A;  3VMA A;  1OMI A;  1N8R Q;  2NPS A;  1KIL E;  2R32 A;  5KAF E;  3AE6 D;  3GF7 A;  1ZR2 A;  3D6Z A;  2NZ2 A;  1DH3 A;  2KUB A;  4Y99 B;  2H89 C;  1NTM K;  1DD3 A;  2XKM A;  2NPS C;  3CCQ P;  2W8Z A;  5C2T C;  2HLO A;  3BCC E;  2CPS A;  1LP1 B;  1T8Z A;  4OVN F;  3HD7 D;  3CI9 A;  1JOC A;  5AVZ B;  4C7N B;  3AE4 C;  3L75 E;  1HTL C;  1FAV A;  2H89 D;  4YSX C;  3L74 E;  1BE3 G;  1KYO H;  4IFM A;  1ZP0 D;  5AVQ B;  3EFG A;  1FDI A;  1L0L E;  2KXP B;  1BDD A;  3TSI A;  1BGY D;  1VQN P;  3O8Z A;  2RN0 A;  1QL2 A;  4HYT B;  1ZRT D;  3AED C;  4R4L A;  2BEQ D;  1AVO A;  4PD4 H;  3P4Q C;  1SQQ J;  4GIF A;  2E43 A;  1J2J B;  2XNX A;  1NTZ J;  2K9Y A;  5CCG A;  2WU5 C;  1YBK A;  1KOR A;  2YKP A;  3V4W A;  1M90 Q;  1KQG B;  5AW0 B;  1A02 J;  5AVV B;  2POH A;  2BCC J;  1BGY G;  2FYU J;  3KYQ A;  1NTK J;  1SQB E;  3VRA C;  1YIJ P;  1MFT A;  1XTG B;  3H6P A;  1H89 A;  3ITK A;  1J1E C;  2E42 A;  4WB4 A;  3AEC C;  1AQ5 A;  3S4R A;  2HPC A;  3L74 D;  1JY3 P;  4I7Z B;  1RF0 C;  3LID A;  3RBX A;  4GOE A;  5KTB A;  1ZW0 A;  1NEK D;  1CSB A;  2YKQ A;  2WU5 D;  2WU2 D;  2ZT9 B;  1KB9 H;  3A0B E;  1JCC A;  4IL6 H;  3AE2 D;  1AQT A;  2R5B A;  3MZW B;  4KJM A;  3L74 G;  3CWB D;  4GDO A;  2HPC B;  1KYO E;  1M1J A;  1L4A C;  4OWF A;  3TGU J;  1PGO A;  1KB9 D;  1PP9 G;  3L71 D;  2M5A B;  1G2C A;  1JTH B;  3EQ2 A;  1ZR4 A;  5GTH E;  4H44 B;  1NKZ B;  5KJ7 A;  3N7N A;  2FYU D;  2Q1K A;  2FBW D;  3S9O A;  2O01 H;  1VQ5 P;  1LTA C;  2B89 A;  3AEF D;  1NU1 K;  4H0L C;  3VR8 D;  5KAI E;  1NTZ D;  1EDJ A;  4I2L C;  3GG2 A;  1M7L A;  1K73 Q;  2YIU C;  3H1H J;  4BRY B;  1GL2 D;  2OQQ A;  1SQX K;  3AEB C;  4I1L A;  1HGV A;  1HF9 A;  4HJG H;  4IFD K;  1GU4 A;  3G4S P;  1VQ8 P;  3NTN A;  1BGY J;  1U7M A;  2KOG A;  2L5G B;  4ZMD A;  2N1T A;  4U3F D;  1E79 H;  1KB9 E;  2KIK A;  1S5L H;  2Q6Q A;  4YSY D;  2WPQ A;  1N73 B;  3P4R C;  5M1B A;  5CMZ A;  3L72 E;  4WY4 B;  1RF1 A;  2C9L Y;  3VR9 C;  1PIX A;  1VQ4 P;  1NAF A;  4PD4 I;  3H1I D;  4BRY A;  3AEG D;  1NTM D;  2PRR A;  3BAS A;  1URQ A;  1JB0 J;  3L70 J;  3A3Y B;  2NPS B;  4O9B A;  1EXJ A;  1LTI C;  2D2C B;  3KXD A;  1LT9 A;  1VQ6 P;  1FBM A;  5CCH C;  4D6T E;  1Q90 D;  2CPB A;  4DOJ A;  4DT0 A;  2ITA A;  1ZME C;  5GTH H;  1YI2 P;  3BAT A;  3JCU H;  1NTM J;  3N4X A;  1L0N D;  4D6T G;  1J1D C;  1CZQ A;  2G3A A;  4LGD E;  2KP8 A;  1RF0 A;  2YIU B;  4ASW A;  1UIX A;  2JR8 A;  1S2E A;  4PD4 D;  2I1J A;  2E75 D;  1SFC D;  1NTK G;  1T2K C;  1GMJ A;  1K8A Q;  2JKV A;  4YPC A;  4EYY Q;  1DEE G;  3IAO A;  4OGQ D;  1G2C B;  3B5N C;  3WU2 H;  1EQ7 A;  1A02 F;  1ZV8 A;  1FDO A;  3CIR C;  1LTG C;  1NTK D;  2BS2 C;  3JC2 2;  2BCC D;  3S1K A;  2GA1 A;  1JEK A;  1FZC B;  3B4S A;  3B71 A;  4YXD C;  2LKM A;  3MGN A;  4YTN C;  2HG5 D;  4DHZ A;  3Q1M A;  3H1K E;  1KTM A;  2FYZ A;  2K37 A;  4N3Y B;  3RK2 B;  1BCC G;  3AE7 C;  2Y9Z A;  3H1L D;  3CCU P;  2Q5U A;  1EZV D;  2XND H;  2YMY A;  2WDR D;  3SWY A;  1LJ2 A;  2B88 A;  5H2F H;  2KLU A;  1L0L G;  3Q3D A;  2IBZ G;  2WDR C;  2MKV A;  1SS1 A;  1L0L J;  1LTB C;  1NOH A;  4UB6 E;  4UB8 H;  4ZNC A;  3AE9 D;  3HUS A;  3BRV B;  2W90 A;  3QWO C;  2YO3 A;  3KHU A;  2IBZ D;  4PD4 E;  1AFO A;  4YTN D;  1SQQ E;  3V2N A;  1LGH B;  2XZR A;  3W68 A;  4AYC A;  1NU1 D;  1BGY E;  1KFY C;  3V6I A;  1AV1 A;  3BCC G;  5TJH A;  3CC4 P;  4DCK A;  3AE1 C;  1FZF A;  2R3C A;  1IFM A;  1GDT A;  2V4H A;  3O6Q A;  3WUV A;  1NU1 E;  1Q82 Q;  2WDV C;  2AXT H;  2V7Q H;  1YJ9 P;  4JBZ A;  4HH2 A;  1BSN A;  5KLV D;  4Y28 J;  5APW A;  3B5N A;  1SQP J;  1S72 P;  1LNQ A;  3MHV A;  3VYI A;  3A5T A;  2KNC A;  4PV1 C;  3H1I E;  4EI2 A;  2P67 A;  1NVO A;  4KX6 D;  4Y99 C;  3VON A;  3H1I G;  1PZQ A;  1SQV D;  3PH0 A;  4L73 A;  1T3J A;  1IFI A;  3II6 A;  3CD6 P;  1KIL D;  1CI6 A;  3Q5S A;  1IFN A;  3CCM P;  2JP3 A;  3CIR D;  5AW7 B;  1SQV K;  1IO4 A;  2OYO A;  1KFY D;  1HGZ A;  2O1J A;  4I6M C;  1BSH A;  1R5L A;  2FYN B;  3CCR P;  4U3F G;  1T3U A;  1LT9 B;  3CCS P;  1AA0 A;  1J1E B;  2WQY C;  3HRN A;  2O01 J;  1SQP G;  3BCC D;  3AEG C;  2C0W A;  3CC7 P;  3VR9 D;  3FWL A;  1NTZ K;  1FZB A;  3JSV C;  2E74 C;  1RF1 B;  3GW6 A;  1BCC D;  1LTJ C;  2ZT9 D;  1VPC A;  2FXP A;  1OVR A;  2Y9Y A;  2ZVO B;  1JUN A;  3AEA D;  3L73 G;  1HJB A;  3RGU A;  2QJP C;  3L71 E;  1BCC E;  2AEJ A;  1ZOY C;  1PPJ D;  3HTK A;  2HFE D;  2RKL A;  4WVZ A;  1FJK A;  1Y8A A;  3P4R D;  4YXD D;  1W2B O;  2DW3 A;  1RQV A;  1P84 D;  2OYI A;  3V5B A;  2YKO A;  2YNY A;  1LTJ B;  3H32 A;  2N9Y B;  4TLF A;  1BDC A;  2E74 B;  3SFE D;  1PGP A;  1PPJ G;  1LWU A;  5B66 H;  5L8R J;  3M0A A;  3HE4 A;  4DJG A;  1M1J B;  1OXZ A;  3G6E P;  1EDL A;  2LXC B;  3RL0 C;  3USS A;  1PFI A;  1DD4 A;  1PV3 A;  2ZFC A;  4KT0 J;  3KZI H;  2IYP A;  2Q7C A;  1KZU B;  1P84 E;  2OGU A;  1NTM E;  1X22 A;  3MUD A;  5C39 A;  1MV8 A;  1DIP A;  2GUV A;  2OTJ P;  4YSZ C;  3SWK A;  5C3J D;  3M06 A;  1QEX A;  1VF5 D;  3L72 D;  3V2R A;  2PGD A;  4GOD A;  3E1R A;  1OW7 A;  1VQ9 P;  3RK2 D;  2WU2 C;  3M0D C;  2BAS A;  1W5C E;  1K9M Q;  1KMI Z;  1YJW P;  2KZJ A;  4RES B;  5KAF H;  4L76 A;  4PV1 B;  2ACZ D;  3KQG A;  4JPZ B;  2AEF A;  2YMK A;  1YTZ I;  4L75 A;  2XU6 A;  1KQF B;  2CK3 H;  1VQM P;  3FX0 A;  1HUC A;  1SFC C;  1JY2 P;  2OAR A;  1GW3 A;  3C8V A;  3AE2 C;  1R8E A;  2C0X A;  1Q81 Q;  4UB8 E;  1NEK C;  3L35 A;  3C9I A;  4YSY C;  3M9H A;  3P8M C;  4K3A A;  2QEX P;  3AE5 D;  3AE3 C;  1N73 A;  2H8P D;  2FY8 A;  1ZP0 C;  2QJK B;  3AEB D;  2N1T B;  2WDQ D;  3HE4 B;  4WY4 D;  3RL0 B;  4AUW A;  1FZC A;  1OIP A;  4YTM D;  3HD7 C;  2WIT A;  1KQS O;  2N1T C;  1D7M A;  4H0L D;  2P7J A;  1KIL A;  2VRS A;  2HOD B;  3L73 E;  1JY3 O;  4ZKP A;  1SQP D;  3ABV C;  1U57 A;  5KLI B;  1S9K E;  1KF6 C;  2KSE A;  2QIW A;  3CME P;  3MUD C;  1IC2 A;  2BS4 C;  2B9B A;  3L75 G;  3HE5 B;  4JQ0 D;  1H0T A;  3P32 A;  5CBN A;  3C1L A;  1YIT P;  1PP9 E;  1HVV A;  4YT0 C;  2IBZ I;  1NHL A;  3O6Q B;  4NPD A;  1LWU C;  2JWD A;  1QLE D;  3P4S C;  5GTI E;  1FOS E;  1RH5 B;  2ZYA A;  1BE3 D;  2Q3E A;  3CL3 D;  4TT3 H;  2G8Y A;  1IFJ A;  1FOS F;  1GW4 A;  5CJ4 A;  2WZ7 A;  1Q7Y Q;  1USD A;  3A0H H;  2ZXX A;  2NRG A;  5AVU B;  1L0L D;  2WVR A;  2KLV A;  3VOP A;  2ZJS E;  1H88 A;  3OA7 A;  4XFJ A;  5KJ7 C;  4N6J A;  2PFX A;  1EZV I;  2BCC G;  3SWF A;  2QJY C;  1RY3 A;  1VF5 B;  3AE5 C;  4U3F J;  2FYN C;  3L70 G;  1BE3 J;  3L73 D;  4DZO A;  3H1L E;  1L0V D;  2A06 E;  4XA4 A;  1IK7 A;  1Q2N A;  1KIL B;  3P4P C;  3H1L G;  1N7S A;  4IL6 X;  3IF4 A;  1FZG A;  2FXM A;  1EZV G;  1WRG A;  3AED D;  1NU1 G;  1N7S C;  3SSU A;  1QX8 A;  2KYV A;  3VRB C;  4RJT A;  1L4A A;  3SFD D;  1JCD A;  4LLH A;  4WWI A;  3AEC D;  3CCV P;  4D6T J;  2KS1 A;  1OW6 A;  4HKZ H;  5AW5 B;  1NEN C;  2JEE A;  1CW5 A;  4PJ0 E;  2HOD A;  3RK3 C;  5BVZ A;  3VRB D;  3JCU E;  4YSX D;  1KB9 I;  1H8A A;  4DHI B;  2C9N Y;  1GD2 E;  1S3J A;  1SP4 A;  1RE3 A;  1U7J A;  1SLQ A;  3CX5 D;  1SQX G;  2Y0C A;  3BRT B;  1L0N K;  5AVR B;  1IJD B;  2WPV B;  4YSZ D;  1RE4 C;  1PGJ A;  2NPS D;  5B5E H;  2WTY A;  3IFM A;  1FZC C;  3LW5 J;  5TIS E;  1OW8 A;  2OTK E;  3VMY A;  1GU5 A;  5KJ7 D;  2WSS H;  1LP1 A;  3VP8 A;  3MP7 B;  1SQB D;  1NTM G;  3L70 E;  4H13 D;  3RL0 D;  1WT6 A;  1USE A;  3MD0 A;  4RO0 A;  1VQ7 P;  1SQX D;  1S9K D;  2B76 D;  1YQ4 D;  3AE4 D;  1SQP K;  4EDF A;  4KHX A;  4DDI A;  4YXW H;  2Q9I A;  1OVU A;  4H0L B;  1KV4 A;  5KKZ B;  3PHL A;  3H1J G;  2QVA A;  2WP9 C;  4I6L A;  3P4S D;  3BCC J;  5AVS B;  5C2T D;  1SQX J;  1NJI Q;  2O01 N;  1PP9 D;  2WDQ C;  2B76 C;  4U7J A;  1HH0 A;  3CCE P;  2K88 A;  1Y9B A;  2A45 H;  2KK7 A;  3L75 J;  3HD7 A;  5B66 E;  4JF7 A;  2KS1 B;  1X79 B;  4H13 C;  4HB1 A;  1X8Y A;  2WS3 D;  3AE6 C;  1L4A B;  1MUU A;  2H88 C;  4K35 A;  3GHG C;  5E79 H;  4W80 A;  1HBW A;  3GHG B;  1PGQ A;  5AVX B;  5APU A;  1KF6 D;  2D2C C;  3L75 D;  3ABV D;  5APT A;  3V4Q A;  5APV A;  2QE7 H;  2ZT9 C;  2IPP A;  4BXL A;  1PP9 J;  1S4X A;  3PP5 A;  4EIJ A;  1JY3 N;  4AQR D;  1YYC A;  2IFN A;  1LTT C;  4YTM C;  2W6J H;  4WY4 C;  4OH8 B;  1H0T B;  2UWJ E;  1N73 C;  5CCG D;  5KLV J;  2KNC B;  2JWA A;  2H7H A;  2BCC E;  5K5G B;  3TNU B;  2GM4 A;  5CHX A;  1NTK E;  1SQB J;  3HE5 A;  3AE3 D;  2YO2 A;  3L4F A;  1MZ9 A;  1GK6 A;  2WPR A;  4JYB A;  1JO5 A;  2HYN A;  1VDF A;  1J1D B;  2WT7 A;  3L36 A;  1E5W A;  3P4P D;  2WSE H;  3A0H E;  1ZN5 A;  2FYU G;  2I1K A;  1DX7 A;  1SQQ K;  3H1I J;  2B87 A;  1JNM A;  5BU8 B;  3LW5 H;  4BWN A;  1URQ C;  2P58 A;  2OTL P;  3CLQ A;  3MTU E;  4ASV A;  3I56 P;  2WDV D;  2ACZ C;  4H44 C;  1UII A;  4D6T D;  4CPG A;  1RE3 C;  1NKN A;  3WUU A;  2K3R A;  1EXI A;  1FC2 C;  1RE4 A;  3AE1 D;  2PAJ A;  1FZA A;  1NAY A;  1DEB A;  4WBA A;  3RK2 C;  1SQV E;  3G9R A;  2IDB A;  3AE8 C;  2WSE J;  1M56 D;  2YXQ B;  5AW2 B;  2QRX A;  3CMA P;  1VQO P;  3CCJ P;  4GKG A;  4EOT A;  1GK4 A;  2R5D A;  4YT0 D;  3CWB E;  3V2Q A;  3GHG A;  4RKU J;  1N7L A;  1JY2 O;  5AW6 B;  2QA4 P;  3P8C D;  3IN6 A;  2MJZ A;  4NPF X;  1R5S A;  2Y0E A;  4UB6 H;  1T6A A;  2A45 I;  2Y0D A;  2M5A A;  3Q2Y A; 
#chains in the Genus database with same CATH homology
 4KT0 J;  3AEA C;  1L0V C;  2P10 A;  3AE3 D;  3AE9 D;  2E76 C;  1UIX A;  4R4M A;  2YIU C;  1KOR A;  2QJY C;  3AEB D;  1VF5 B;  2J5U A;  1KQG B;  2E75 D;  2WQY C;  3SFE C;  3AE5 C;  1YQ4 D;  2D2C D;  2B76 D;  3AE4 D;  2FYN C;  2OQQ A;  2O01 J;  3Q5P A;  2WDQ D;  4OGQ B;  1GMJ A;  3AEB C;  4H0L B;  1MKM A;  3AEG C;  1DIP A;  2BEZ F;  1HF9 A;  4YTN D;  5KKZ C;  1L0V D;  1OMI A;  4YTM D;  4KX6 C;  2WU5 C;  4YSZ C;  1WMK A;  4H44 D;  4OGQ C;  5C3J D;  3VR9 D;  3VRA C;  1NEN D;  2E74 D;  1VF5 D;  1KIL E;  3P4P D;  1IK7 A;  2WP9 C;  2E75 B;  3P4S D;  3AE6 D;  3GF7 A;  1VF5 C;  3P4P C;  3AEC C;  3IAO A;  4OGQ D;  1NYH A;  5C3J C;  2E74 C;  1OW7 A;  4H0L D;  4IL6 X;  1KFY C;  3D6Z A;  2E76 B;  5C2T D;  2WU2 C;  2NZ2 A;  1K05 A;  3SFD C;  2QJK C;  3CIR C;  1FDO A;  4I7Z B;  1KMI Z;  3AED D;  2H89 C;  2ZT9 D;  2JO1 A;  1AJY A;  2WDQ C;  2B76 C;  3ABV C;  1U57 A;  4U7J A;  1KF6 C;  3R4Y A;  1ZOY D;  3EWK A;  1Y9B A;  2FXP A;  3AE1 C;  3VRB C;  2BS2 C;  1DD3 A;  1NEK D;  1NGM B;  4YSY D;  2QIW A;  5C2T C;  1S1C X;  1VL2 A;  3AEA D;  3SFD D;  3AE9 C;  1K04 A;  3O6Q A;  4H13 C;  4PV1 B;  2WU5 D;  2ACZ D;  3H25 A;  2WU2 D;  2WS3 D;  2BS4 C;  2ZT9 B;  3AEC D;  2YMK A;  3GF3 A;  3AE6 C;  2QJP C;  2WDV C;  3AE2 D;  3B71 A;  1KQF B;  1OW6 A;  5M1B A;  4YXD C;  3P4R C;  3P4Q D;  1YQ3 C;  2H88 C;  3AE8 D;  2WDV D;  2ACZ C;  3FGA D;  4H44 C;  3VR8 C;  3RL0 g;  1NEN C;  1E7P C;  3VR9 C;  1PIX A;  4Y28 J;  4YTN C;  3D70 A;  2QSI A;  3AEG D;  3VRB D;  1ZRT E;  1ZOY C;  4GDO A;  4YTP C;  3T97 B;  2D2C C;  3AE4 C;  1EXI A;  1KF6 D;  3ABV D;  3AE1 D;  4YSX D;  4YTP D;  1YQ4 C;  2V7Q J;  3Q1M A;  2H89 D;  4YSX C;  2FBW C;  2ZT9 C;  3Q5R A;  1KTM A;  4YT0 C;  2E76 D;  1JB0 J;  4PV1 C;  3AE7 C;  3G9R A;  3RK3 E;  3AEE C;  3D71 A;  1TU3 F;  1YQ3 D;  2H88 D;  1ZP0 D;  3P4R D;  3P4S C;  2IDB A;  3AE8 C;  2WSE J;  3AE2 C;  3C8V A;  1EXJ A;  2D2C B;  4YXD D;  1RQV A;  2WS3 C;  1FDI A;  1HJ0 A;  1R8E A;  1QLB C;  4KX6 D;  3VRA D;  4YTM C;  2WPV B;  4YSZ D;  3D6Y A;  2WDR D;  1NEK C;  3AE7 D;  4YT0 D;  4PV1 D;  4YSY C;  3GLM A;  2G8Y A;  4H44 B;  4TT3 H;  4RKU J;  2E74 B;  3GMA A;  2FBW D;  1Q90 D;  2WQY D;  3SFE D;  3S9O A;  3Q5S A;  3AE5 D;  2E75 C;  3LW5 J;  5L8R J;  1RQU A;  4H13 B;  1ZME C;  2JP3 A;  3CIR D;  3IN6 A;  3AED C;  1OW8 A;  3Q3D A;  3AE3 C;  4R4L A;  2BEQ D;  2WSC J;  2WSF J;  2WDR C;  2MKV A;  3AEF D;  1KFY D;  4H0L C;  4Z1M H;  2G3A A;  3VR8 D;  5KLI C;  2BS3 C;  3Q2Y A;  3P4Q C;  1S5L X;  2WP9 D;  1DD4 A;  1PV3 A;  1PL5 A;  2K9Y A;  4XFJ A;  3AEF C;  3AEE D;  1ZP0 C;  4I7Z C;  4H13 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...