3AEAD

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
102
structure length
102
Chain Sequence
b'SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKAAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 38
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeaD00
3AEDC 5C3JD 4YSZC 3P4QD 3VR8D 2WQYC 4YTND 2WDRD 2H89D 3AE6D 1E7PC 4YXDD 2BS2C 5C3JC 2ACZD 3AEBC 3AE7D 3AE5D 3AE9D 3CIRD 3VR8C 3AECC 4YTNC 3P4RC 2H89C 4KX6C 1NENC 3AEEC 1ZOYD 2WDQD 2BS3C 3P4SD 3AE7C 3VR9D 3AE9C 3AE4C 3AE1C 3AE8C 4YT0C 2H88C 4YTMD 1YQ3C 3P4SC 2BS4C 1YQ4D 2WP9D 1QLBC 2WU2D 1NEKD 3P4QC 3SFDD 3AEGD 3AEAD 4YTMC 2WDRC 4YSXD 1YQ4C 3AE6C 1ZP0D 3VRAD 4YSYD 4YXDC 3AE3D 2ACZC 2FBWD 2WU2C 2B76D 1L0VD 3AE5C 3AEAC 2WDVD 3CIRC 2WU5D 4YTPD 3AE2D 3AE3C 1ZOYC 3AEFD 2WDQC 2FBWC 3SFED 1KF6D 3VR9C 1L0VC 3P4PD 2WDVC 1KFYD 4YSZD 2WU5C 3ABVD 2WQYD 4YTPC 3SFEC 1KF6C 2WP9C 3P4PC 1KFYC 1NEKC 3AEBD 3SFDC 3ABVC 2WS3D 3AECD 3AEGC 3P4RD 5C2TD 4YSXC 4KX6D 1NEND 3AEED 1ZP0C 3VRAC 4YSYC 3VRBD 3AEDD 2B76C 3AE4D 2WS3C 3AE1D 5C2TC 3AE8D 4YT0D 2H88D 1YQ3D 3AE2C 3AEFC 3VRBC
chains in the Genus database with same CATH superfamily
4FJVA 3AEDC 5C3JD 4YSZC 3P4QD 4DDGA 3VR8D 2WQYC 4YTND 2WDRD 2H89D 4DDIA 3AE6D 3VONA 1E7PC 4YXDD 2BS2C 5C3JC 2ACZD 3AEBC 3AE7D 3AE5D 3AE9D 3CIRD 3VR8C 3AECC 4YTNC 3P4RC 2H89C 4KX6C 1NENC 3AEEC 1ZOYD 2WDQD 2BS3C 3P4SD 3AE7C 3VR9D 3AE9C 3AE4C 3AE1C 3AE8C 4LDTA 4YT0C 2H88C 4YTMD 1YQ3C 3P4SC 4DHIB 2BS4C 1YQ4D 2WP9D 1QLBC 2WU2D 1NEKD 3P4QC 3SFDD 3AEGD 3AEAD 4YTMC 2WDRC 4YSXD 1YQ4C 3AE6C 1ZP0D 3VRAD 4YSYD 4YXDC 3AE3D 2ACZC 2FBWD 2WU2C 2B76D 1L0VD 3AE5C 3AEAC 2WDVD 3CIRC 2WU5D 4I6LA 4YTPD 4DHJA 3AE2D 3AE3C 1ZOYC 3AEFD 2WDQC 2FBWC 3SFED 1KF6D 3VR9C 1L0VC 3P4PD 2WDVC 1KFYD 4YSZD 2WU5C 3ABVD 2WQYD 4YTPC 3SFEC 1KF6C 2WP9C 2ZFYA 3P4PC 1KFYC 1NEKC 3AEBD 3SFDC 3ABVC 2WS3D 3AECD 3AEGC 3P4RD 5C2TD 4YSXC 4KX6D 1NEND 3AEED 1ZP0C 3VRAC 4YSYC 1TFFA 3VRBD 3AEDD 2B76C 3AE4D 2WS3C 3AE1D 5C2TC 3AE8D 4YT0D 2H88D 4DHZA 1YQ3D 3AE2C 3AEFC 3VRBC
chains in the Genus database with same CATH topology
3AEDC 5C3JD 4YSZC 3P4QD 3VR8D 2WQYC 4YTND 2WDRD 2H89D 3AE6D 1E7PC 4YXDD 2BS2C 5C3JC 2ACZD 3AEBC 3AE7D 3AE5D 3AE9D 3CIRD 3VR8C 3AECC 4YTNC 3P4RC 2H89C 4KX6C 1NENC 3AEEC 1ZOYD 2WDQD 2BS3C 3P4SD 3AE7C 3VR9D 3AE9C 3AE4C 3AE1C 3AE8C 4YT0C 2H88C 4YTMD 1YQ3C 3P4SC 2BS4C 1YQ4D 2WP9D 1QLBC 2WU2D 1NEKD 3P4QC 3SFDD 3AEGD 3AEAD 4YTMC 2WDRC 4YSXD 1YQ4C 3AE6C 1ZP0D 3VRAD 4YSYD 4YXDC 3AE3D 2ACZC 2FBWD 2WU2C 2B76D 1L0VD 3AE5C 3AEAC 2WDVD 3CIRC 2WU5D 4YTPD 3AE2D 3AE3C 1ZOYC 3AEFD 2WDQC 2FBWC 3SFED 1KF6D 3VR9C 1L0VC 3P4PD 2WDVC 1KFYD 4YSZD 2WU5C 3ABVD 2WQYD 4YTPC 3SFEC 1KF6C 2WP9C 3P4PC 1KFYC 1NEKC 3AEBD 3SFDC 3ABVC 2WS3D 3AECD 3AEGC 3P4RD 5C2TD 4YSXC 4KX6D 1NEND 3AEED 1ZP0C 3VRAC 4YSYC 3VRBD 3AEDD 2B76C 3AE4D 2WS3C 3AE1D 5C2TC 3AE8D 4YT0D 2H88D 1YQ3D 3AE2C 3AEFC 3VRBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED C;  5C3J D;  4YSZ C;  3P4Q D;  3VR8 D;  2WQY C;  4YTN D;  2WDR D;  2H89 D;  3AE6 D;  1E7P C;  4YXD D;  2BS2 C;  5C3J C;  2ACZ D;  3AEB C;  3AE7 D;  3AE5 D;  3AE9 D;  3CIR D;  3VR8 C;  3AEC C;  4YTN C;  3P4R C;  2H89 C;  4KX6 C;  1NEN C;  3AEE C;  1ZOY D;  2WDQ D;  2BS3 C;  3P4S D;  3AE7 C;  3VR9 D;  3AE9 C;  3AE4 C;  3AE1 C;  3AE8 C;  4YT0 C;  2H88 C;  4YTM D;  1YQ3 C;  3P4S C;  2BS4 C;  1YQ4 D;  2WP9 D;  1QLB C;  2WU2 D;  1NEK D;  3P4Q C;  3SFD D;  3AEG D;  3AEA D;  4YTM C;  2WDR C;  4YSX D;  1YQ4 C;  3AE6 C;  1ZP0 D;  3VRA D;  4YSY D;  4YXD C;  3AE3 D;  2ACZ C;  2FBW D;  2WU2 C;  2B76 D;  1L0V D;  3AE5 C;  3AEA C;  2WDV D;  3CIR C;  2WU5 D;  4YTP D;  3AE2 D;  3AE3 C;  1ZOY C;  3AEF D;  2WDQ C;  2FBW C;  3SFE D;  1KF6 D;  3VR9 C;  1L0V C;  3P4P D;  2WDV C;  1KFY D;  4YSZ D;  2WU5 C;  3ABV D;  2WQY D;  4YTP C;  3SFE C;  1KF6 C;  2WP9 C;  3P4P C;  1KFY C;  1NEK C;  3AEB D;  3SFD C;  3ABV C;  2WS3 D;  3AEC D;  3AEG C;  3P4R D;  5C2T D;  4YSX C;  4KX6 D;  1NEN D;  3AEE D;  1ZP0 C;  3VRA C;  4YSY C;  3VRB D;  3AED D;  2B76 C;  3AE4 D;  2WS3 C;  3AE1 D;  5C2T C;  3AE8 D;  4YT0 D;  2H88 D;  1YQ3 D;  3AE2 C;  3AEF C;  3VRB C; 
#chains in the Genus database with same CATH topology
 4FJV A;  3AED C;  5C3J D;  4YSZ C;  3P4Q D;  4DDG A;  3VR8 D;  2WQY C;  4YTN D;  2WDR D;  2H89 D;  4DDI A;  3AE6 D;  3VON A;  1E7P C;  4YXD D;  2BS2 C;  5C3J C;  2ACZ D;  3AEB C;  3AE7 D;  3AE5 D;  3AE9 D;  3CIR D;  3VR8 C;  3AEC C;  4YTN C;  3P4R C;  2H89 C;  4KX6 C;  1NEN C;  3AEE C;  1ZOY D;  2WDQ D;  2BS3 C;  3P4S D;  3AE7 C;  3VR9 D;  3AE9 C;  3AE4 C;  3AE1 C;  3AE8 C;  4LDT A;  4YT0 C;  2H88 C;  4YTM D;  1YQ3 C;  3P4S C;  4DHI B;  2BS4 C;  1YQ4 D;  2WP9 D;  1QLB C;  2WU2 D;  1NEK D;  3P4Q C;  3SFD D;  3AEG D;  3AEA D;  4YTM C;  2WDR C;  4YSX D;  1YQ4 C;  3AE6 C;  1ZP0 D;  3VRA D;  4YSY D;  4YXD C;  3AE3 D;  2ACZ C;  2FBW D;  2WU2 C;  2B76 D;  1L0V D;  3AE5 C;  3AEA C;  2WDV D;  3CIR C;  2WU5 D;  4I6L A;  4YTP D;  4DHJ A;  3AE2 D;  3AE3 C;  1ZOY C;  3AEF D;  2WDQ C;  2FBW C;  3SFE D;  1KF6 D;  3VR9 C;  1L0V C;  3P4P D;  2WDV C;  1KFY D;  4YSZ D;  2WU5 C;  3ABV D;  2WQY D;  4YTP C;  3SFE C;  1KF6 C;  2WP9 C;  2ZFY A;  3P4P C;  1KFY C;  1NEK C;  3AEB D;  3SFD C;  3ABV C;  2WS3 D;  3AEC D;  3AEG C;  3P4R D;  5C2T D;  4YSX C;  4KX6 D;  1NEN D;  3AEE D;  1ZP0 C;  3VRA C;  4YSY C;  1TFF A;  3VRB D;  3AED D;  2B76 C;  3AE4 D;  2WS3 C;  3AE1 D;  5C2T C;  3AE8 D;  4YT0 D;  2H88 D;  4DHZ A;  1YQ3 D;  3AE2 C;  3AEF C;  3VRB C; 
#chains in the Genus database with same CATH homology
 3AED C;  5C3J D;  4YSZ C;  3P4Q D;  3VR8 D;  2WQY C;  4YTN D;  2WDR D;  2H89 D;  3AE6 D;  1E7P C;  4YXD D;  2BS2 C;  5C3J C;  2ACZ D;  3AEB C;  3AE7 D;  3AE5 D;  3AE9 D;  3CIR D;  3VR8 C;  3AEC C;  4YTN C;  3P4R C;  2H89 C;  4KX6 C;  1NEN C;  3AEE C;  1ZOY D;  2WDQ D;  2BS3 C;  3P4S D;  3AE7 C;  3VR9 D;  3AE9 C;  3AE4 C;  3AE1 C;  3AE8 C;  4YT0 C;  2H88 C;  4YTM D;  1YQ3 C;  3P4S C;  2BS4 C;  1YQ4 D;  2WP9 D;  1QLB C;  2WU2 D;  1NEK D;  3P4Q C;  3SFD D;  3AEG D;  3AEA D;  4YTM C;  2WDR C;  4YSX D;  1YQ4 C;  3AE6 C;  1ZP0 D;  3VRA D;  4YSY D;  4YXD C;  3AE3 D;  2ACZ C;  2FBW D;  2WU2 C;  2B76 D;  1L0V D;  3AE5 C;  3AEA C;  2WDV D;  3CIR C;  2WU5 D;  4YTP D;  3AE2 D;  3AE3 C;  1ZOY C;  3AEF D;  2WDQ C;  2FBW C;  3SFE D;  1KF6 D;  3VR9 C;  1L0V C;  3P4P D;  2WDV C;  1KFY D;  4YSZ D;  2WU5 C;  3ABV D;  2WQY D;  4YTP C;  3SFE C;  1KF6 C;  2WP9 C;  3P4P C;  1KFY C;  1NEK C;  3AEB D;  3SFD C;  3ABV C;  2WS3 D;  3AEC D;  3AEG C;  3P4R D;  5C2T D;  4YSX C;  4KX6 D;  1NEN D;  3AEE D;  1ZP0 C;  3VRA C;  4YSY C;  3VRB D;  3AED D;  2B76 C;  3AE4 D;  2WS3 C;  3AE1 D;  5C2T C;  3AE8 D;  4YT0 D;  2H88 D;  1YQ3 D;  3AE2 C;  3AEF C;  3VRB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...