3AECC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aecC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aecC02
2WDVD 1YQ4C 3AEAD 3AE8D 3P4RD 4KX6D 4YSXD 2ACZD 3AE2D 3AECD 3AEED 2BS3C 4YTNC 3SFDC 2WQYD 3P4QC 3AE8C 1K05A 4YT0D 3SFEC 5C2TD 3AEGC 2H88C 1KF6C 2WDRC 1OW8A 2WQYC 4YSZD 3AEAC 1YQ4D 3ABVD 1KFYD 1NEKC 3VR8C 2H88D 1KF6D 1ZOYD 3VRBD 2WP9D 1L0VD 1L0VC 2BS4C 3VRBC 1ZP0C 5C3JC 4YTMC 3ABVC 1QLBC 3AEEC 1PV3A 4YTPD 4YT0C 3AE1D 3AE6D 3AEBC 3SFED 4YSYD 3VRAD 1K04A 3SFDD 4YTND 3P4PD 2WDVC 1YQ3D 2WP9C 2WS3D 3AE2C 2ACZC 3S9OA 2WU5C 3P4SC 3P4RC 1E7PC 2FBWD 2FBWC 2WDQD 4YTPC 3AEDC 1NEND 3AE5D 3VR8D 3VR9C 1YQ3C 1KFYC 3AEDD 3AE7D 3AE4D 3AEFD 3AE9C 4YTMD 3VRAC 4YSYC 1ZP0D 2WU2D 2WU2C 2H89D 2B76C 3AE6C 3AECC 1ZOYC 3AE4C 2BS2C 3P4PC 4YXDC 3AE5C 1NENC 4YSZC 3B71A 2B76D 3AE1C 4YXDD 2H89C 1OW6A 2WDRD 3AEGD 5C3JD 5C2TC 1KTMA 1OW7A 2WS3C 3AE9D 3AEFC 3CIRC 3P4QD 3AE3D 3VR9D 3AE3C 4YSXC 4KX6C 3AEBD 2WDQC 3AE7C 2G3AA 3CIRD 2WU5D 3P4SD 1NEKD
chains in the Genus database with same CATH superfamily
2Q5UA 3JSVC 3FWNA 1JMBA 3OA7A 3P8CD 2C9LY 1LJ2A 5E79H 3CX5I 1VQKP 2H88C 1PGPA 2ZYAA 1KN7A 1BSNA 2YKQA 3VR8C 5L8RJ 1VQOP 1JM0A 3H1LD 1IFPA 2NRGA 1GK6A 2PP6A 1L0LK 1SQVJ 2XV5A 1NKZB 3RK3D 5BU5A 3CD6P 2KLUA 3V6IA 1J2JB 3V2PA 3AE6D 1QL1A 1JMMA 1H88A 1P84I 3RL0C 4U3FJ 2KOGA 2WP9C 3RK2B 3HE5A 2O01J 2RH0A 4IL6H 1YQ3C 2P67A 4OGQB 1KILA 1A02J 1OFCX 1L4AA 1KZUB 1FDOA 1KB9E 3HD7C 3IR9A 3L73J 2ZXXA 5C2TC 1LP1A 5CCGC 1BE3J 1KYOH 4GT1A 4KT0J 3AE7C 3Q5RA 1A02F 4WVZA 1SQBJ 4PV1D 1CZQA 1LTAC 2R44A 1NTKE 3CCSP 3AECD 4YPCA 2AEMA 3CWBJ 1U7JA 1SQBG 1R5LA 3RGUA 1NU1J 1IJDB 2WPVB 1BGYG 3D6ZA 1KF6D 1NTMJ 1PP9D 2AEJA 2K37A 5KLIB 2L5GB 1EDJA 2IBZG 3L4FA 1QX8A 3ABVC 3II6A 1QLBC 2IX7C 2QM8A 2IBZD 3HUSA 1SQPD 3H1LE 1JY2O 4IFDK 3H1JJ 3AEBC 2FYUJ 1BDDA 2Q1KA 2WPSA 3CCJP 1VQ7P 1UIXA 3RK2D 3A0HH 2QJKB 3PTZA 1NEND 3EWKA 5H2FH 1QL2A 1GL2D 3AEFD 1Q7YQ 1FS0E 4H13D 2HR3A 1Q81Q 2HG5D 3RK3B 3BATA 3AE4C 1KQFB 1SQQK 3HE5B 1NENC 4WY4A 1LT1A 4O9BA 1KYOI 4Y28J 1L0LE 2IZ0A 1BGYJ 4XFJA 4DZOA 5KKZB 1W2BO 1SS1A 2JWDA 2WSEJ 3AE3D 3H1HG 3AEBD 1YJ9P 3KPEA 2WDQC 1LNQA 1YITP 2WU5D 3CX5E 4M3LA 5KLVG 1IZNB 2XKMA 1EZVG 1JY3N 1RHZB 2JDIH 1ZV8A 2KXPB 4KJMA 1NTME 4WY4D 3L73G 2WITA 1NTMK 1GDTA 1KF6C 3MUDC 2VRSA 1AA0A 2E5YA 2OTJP 3CXHI 1QLED 5APYA 2WZ7A 2R32A 5KLVJ 2KSEA 4U3FD 3VOPA 1BCCG 1SQXJ 2WSFH 4Y99B 1YJWP 3BCCJ 4AQRD 1RF1A 2MJZA 5TJHA 4CPGA 1SQBE 2AXTH 2LR2A 4TLFA 3CI9A 3B5NA 5AW4B 3P4PD 2IFMA 1VF5D 5CCHC 3HTKB 3TNUB 3H1HE 1DEEG 3H32B 1JO5A 1OX3A 1LWUB 2FYNB 3L71J 1NTKG 1DD3A 1LWUC 2LKMA 2O01H 4EYYQ 3H1ID 3VRAC 2ZFCA 5GTHH 3GMAA 2GM4A 1LT9B 1RE4C 3U1CA 1H0TA 4RKUJ 1RF1C 2PGDA 2Z5HA 3NTNA 3LIEA 5CJ4A 2V7QH 3B4SA 4YXWH 2RKLA 2W8ZA 3KQGA 1JCDA 3D70A 3FXEA 1T3JA 1YQ4C 2QA4P 4KX6D 2QVAA 3N7NA 1SQVE 1PGOA 3R4YA 1NTZE 2FYNC 1VDFA 3HD7A 1S5LE 3E1IA 1VF5B 3Q3DA 1Y47A 2N1TA 3MD0A 5KJ7A 1IFDA 4YTMC 4DT0A 2HPCA 4RO0A 1L0NJ 4I2LC 5KAIE 4ZMDA 2P2UA 1EDKA 2O01N 4YT0C 1NU1G 1U7MA 4EOTA 2OGUA 1NJIQ 1LTIC 1FZFA 1DD4A 2YO2A 2M3BA 4GODA 1J1DB 1T2KC 3M9QA 1HH0A 1VQ4P 1SQQD 1GU4A 3E1RA 3RL0D 5GTIE 2FFDA 3UIAA 3GLMA 1G1JA 3MIWA 3PLNA 2FYUG 5AVXB 1KB9H 4YXDC 4LLHA 1FBMA 1N73C 4AYCA 3TGUJ 1KTMA 1J1EC 1JY3P 1LTBC 2Y9ZA 2FYUK 1GK4A 5KLIC 2HODA 5KAIH 1T2KD 4BRYA 1TU3F 3B5NC 1ZRTE 4YSXD 1N7SD 2N9BA 1JUNA 3F5HA 5KAFE 1IFNA 1P84H 1DH3A 4ZKPA 1G2CB 3MZWB 5DJTB 2ZJSE 3GHGB 4IL6E 3FWLA 3N4XA 2K3RA 2J59M 3O8ZA 2ZVNB 4H13B 1KD1Q 3L71G 1VQ6P 1PZQA 3CCUP 1Q2NA 3H1IJ 1SQXG 1RE3A 2L91A 1G2CA 2JKVA 1SQPG 3VYIA 1SQXD 1FDIA 1CI6A 2W6AA 4D6TJ 1N86A 3SFDD 2Y0DA 4YTND 2H43A 1ZR4A 2QG4A 1USEA 4N3YB 3AE2C 2ACZC 3O6QA 3P4SC 4JPZB 2R3SA 3L70J 2LXBA 5KLVK 1EXIA 2YIUB 2XZRA 3ITKA 2PRRA 3SWFA 3EFFK 1NTZD 1LWUA 2QJPB 1NTZG 4DJGA 1MV8A 2IBZI 1SQVD 3G71P 3AE5C 1JEKA 3HTKA 3QH9A 2QJPC 1IO4A 1NU1D 1IC2A 3JCUH 5AVSB 2KB7P 1YYCA 3LW5J 1FZAA 2E74C 1KB9I 2E75C 2BCCE 2M3EA 3H1JG 3CWBG 1MFZA 1JOCA 2WDVD 1JNMA 2WT7A 3VMXA 1LGHB 2HYNA 2M8RA 3S1KA 1AQ5A 2C0WA 5APSA 2E42A 1Y9BA 1PP9G 3USSA 1NEKC 2M0BA 1ZR2A 2OTLP 3AEEC 5B66E 5KJ7C 2E5TA 3P32A 4JQ0D 1M1JB 4K35A 4BWNA 3L70E 1SP4A 1EXJA 1IFIA 1EZVE 1IK7A 1K04A 3L37A 3H1KD 2D2CB 3CMAP 1PGQA 5GTIH 1ZW0A 2WS3D 1U57A 2WU5C 2K88A 4IFFA 3TGUG 3VN0A 4LGDE 2WDQD 3EFGA 3L73E 3VR9C 4BXLA 1VQ9P 3AE7D 2I8DA 3H25A 2MKVA 4ASVA 2QE7H 3M9BA 1URQB 2B76C 3VMYA 3AECC 1AV1A 1NU1K 1OMIA 4C7RA 5CJ0A 1JY2P 1H8AA 2ZVOB 3P8MC 5KAFH 4YSXC 1QVGO 3SWKA 3GG2A 4JBZA 3RK2C 1YI2P 4DDGA 3A5TA 3AEAD 3AE8D 3P4RD 1EDIA 1HGZA 5KJ7D 2HLOA 1Q82Q 1USDA 3I55P 1GU5A 5AW8B 3M91A 3TGUE 1HUCA 2YKPA 1LTGC 1PL5A 2DW3A 1RF1B 2WSCH 1YQ4D 3ABVD 3HUSB 3IN6A 1FZCB 4EDFA 3D71A 2E75B 3VRBC 2FXMA 5C3JC 2BASA 4U7JA 2FY8A 2Y0CA 1N73B 3H1HD 2PFXA 5B5EH 3AE1D 1K73Q 5CMZA 2B89A 4Y99C 4H44B 2C9NY 1AJYA 2JO1A 2JWAA 2OYHA 4PV1C 4KHXA 1CSBA 4C7NA 1SQBD 1NTZK 4D6TG 3G4SP 2WT7B 2OYHC 1E7PC 2OTKE 4W7ZA 4D6TD 3TF5A 1MZ9A 1YHQP 1BE3D 1VQLP 4H44D 4YTMD 2NPSB 1HVVA 2KP8A 3A0BH 3F89A 3P4PC 4UB8E 3KXDA 1GW4A 1N7SA 3A3YB 2E76C 2N1TB 5AW6B 1HJ0A 2YXQB 4L76A 1BSHA 3L72E 1XTGB 4D6TE 1GD2E 3HUSC 2A06G 4KX6C 2HFED 3CIRD 3FXDA 2JP3A 3G6EP 1FOSF 1QEXA 5AVTB 3BCCD 1KB9D 1NVOA 1FE6A 5AW7B 2E43A 1AVOA 1IFMA 1JCCA 2YIUC 4JF7A 3QWOC 3L70G 3L75E 4GOEA 1ZMEC 2BS4C 4W80A 3V5BA 3VTPC 1YTZT 3H1LG 3TK1A 2FFDB 3Q5SA 3L71E 1BDCA 3H1HJ 3L72J 1FZEA 1KV4A 2KS1B 4H13C 4OGQD 3CCRP 1YIJP 3RL0g 2H7HA 3WUUA 3CLQA 1KFYC 2Q3IA 2A45I 2AEFA 4L74A 2XU6A 2WU2C 3D6YA 3VMZA 3L75J 2BS2C 2KS1A 2FXOA 4I7ZB 3HRNA 2QJYC 2YKOA 3PRJA 5H2FE 1Y8AA 2Q6QA 2H89C 2N1TD 1OW7A 3CXHE 3GF7A 1OVUA 1MFTA 2N9YB 3PHLA 1PPJE 4I7ZC 1J1EB 4NPEA 3L74D 2Y0EA 2W6JH 1S3JA 5KLVD 1L0NK 3CCLP 1EZVD 3HD7B 4I1LA 4QMAA 2H8PD 2IZ1A 1XTCC 1S5LH 1HTLC 1QVFO 1BGYD 1M7LA 4NPFX 2WQYC 2V4HA 1L0LJ 1SQVK 3VP8A 1NWQA 3BVHA 5AW2B 1L0VC 1FU1A 1R8EA 1NTMD 2WSCJ 2YO3A 1YTZI 4HJGH 1CI6B 2ZAEB 1KILD 2UWJE 3FGAD 2QIWA 3M06A 2W6BA 3WMM0 1ZRTD 5APTA 3WU2H 3HD7D 2K9JB 3B8EB 1X0TA 2KZIA 1LTTC 2JR8A 1VPCA 1KQGB 5M1BA 2GUVA 2R5BA 3P4RC 3CL3D 2C0XA 4YTPC 3B5NB 3T97A 1FZCC 3NXSA 2WMMA 1R5SA 1DX7A 1L0LG 4IL6X 1SFCD 2KUBA 2E76D 3FX0A 3KDPB 3L35A 4GDOA 2KLVA 3L71D 3JC22 2W27A 1S72P 3CWBE 3GHGC 1L4AD 1RF0C 5AVUB 3CX5D 2K9YA 5C39A 2G8YA 1FZGA 1FZCA 4DCKA 4TT3H 1FAVA 2BS3C 1RQUA 2WQYD 1SQXE 1AQTA 4PJ0H 2P58A 1PGJA 1EQ7A 3SFEC 1ZXGA 3OJAB 5C2TD 4DOJA 2B88A 1FZBA 3V4WA 4R4MA 1OXZA 3S4RA 3VRBD 3V2QA 1SFCC 4W7YA 1WMKA 1LTJB 3KZIE 5AVVB 1T3UA 1X22A 4YTPD 1P84D 3VRAD 3NMDA 1BGYE 2YMKA 3W67A 1HF9A 1SQQG 1IFJA 2IBZE 1URQA 3HE4B 1J1DC 3BASA 3MTUE 1OVRA 4PV1B 3AE4D 2E74D 5KTBA 3HE4A 3L70D 3TYYA 2WTYA 1N8RQ 3C8VA 4PD4D 3H1IG 3TNUA 1KORA 4UB8H 2AXTE 3CXHD 2B76D 4XA4A 2ZT9B 3A7OA 1URQD 4H0LD 3AE9D 1OWAA 2KNCA 1M8OB 1SQQE 4OWFA 5APUA 2FYUE 2W83C 1GW3A 3VR9D 1M90Q 3H1JE 5AW1B 3MHVA 3H32A 5AVWB 3TGUD 2KI7B 3AE2D 2BCCJ 2ACZD 2D2CC 2R5DA 2Q7CA 2D2CD 2YNYA 4BRYB 1HWTC 1K05A 3A0BE 1QGKB 2WDRC 1RY3A 1L0ND 2Z5IA 2O1JA 1Q86Q 3CCVP 1ZOYD 1NGMB 1NU1E 1S1CX 1N73A 4N6JA 3H6PA 3Q5PA 2QRXA 3RBXA 2Q9IA 1HGVA 1NAYA 1M1JC 4A7PA 1KYOE 2ZXEB 2OYIC 2POHA 1N2DC 5DJUB 2IPPA 2WDVC 4N78D 4OVNF 2KIKA 4JYBA 3IAOA 5CCHA 2RN0A 1SQXK 2M5AB 1L4AB 3AEDC 1KQLA 1Q90D 1OVVA 3G3ZA 1KFNA 3A2AA 2BEQD 2XNXA 4GKGA 3GW6A 3PH0A 1PP9J 1N7SC 3LW5H 3C9IA 2HPCB 5AVYB 4YXDD 3AE1C 1L2PA 3Q1MA 1BCCD 2R3CA 1FDMA 2LXCB 4L75A 1ZLLA 1JY2N 1S9KD 1NH4A 2A06E 3I56P 3P4SD 3NFQA 3VMAA 1UIIA 4IFMA 1L0NE 3P7KA 1RF0A 1IK9A 2QJKC 1KFMA 4YTNC 3SFDC 1S2EA 3P4QC 1NAFA 2K9JA 2O1KA 1WT6A 1L4AC 4YSZD 3L36A 5B66H 3AEAC 4HYTB 5APQA 2KZJA 2H88D 2FFDC 1X8YA 2FYUD 5CCGD 1VQ8P 3U59A 2Q3EA 1S9KE 1JTHA 2IYOA 1RQVA 3JCUE 1KILE 3H1KG 1BCCE 2V7QJ 4HH2A 3KZIH 2JEEA 1YQ3D 2CPBA 1LTSC 1NHLA 1EDLA 3ZDMA 1L0NG 2NPSA 3EQ2A 4WWIA 1ZP0D 2WU2D 1PPJG 4FJVA 1N7LA 1M1KQ 3AE6C 4GIFA 1KMIZ 2ZT9C 2ZYDA 1P84E 1S4XA 5E79E 3TSIA 5EFWB 1HBWA 3RL0B 1MUUA 3AE3C 4EI2A 2QSIA 4HKZH 1KYOD 1ZN5A 2I1JA 2KSJA 2G3AA 1YBKA 1LP1B 4H0LC 2CPSA 2OYIA 1NEKD 1S5LX 2IYPA 3CPWO 4HB1A 4PJ0E 3CX5H 1OIPA 1SLQA 4I6MC 5CCHD 3CCEP 2WWWA 5AW0B 4YT0D 4JYCA 3AEGC 1SQPJ 2KNCB 3KYQA 1FJKA 1E5WA 1AFOA 2XDJA 3O6QB 5AW9B 1PP9E 3M0AA 2GA1A 1VF5C 2YXRB 3M0DC 1X9VA 1FOSE 5APWA 3M0DA 2XNDH 3V4QA 3WU2E 1PV3A 3H1JD 4GOFA 3L74G 3KHUA 2WVRA 1NYHA 2YMYA 4PD4I 3A0HE 1K8AQ 3OW2O 2FBWC 4DDIA 1BE3G 2OYOA 5CHXA 1AVYA 2WPRA 3BCCE 3CXHH 4YSYC 2BCCD 3MGNA 5KLVE 1LTJA 2WSEH 1X79B 3CC7P 5CCGA 3L72D 4DHJA 3VONA 4H0LB 1OZHA 2A06D 2PAJA 3CCMP 2WSSH 2AXCA 4RESB 3BCCG 1VQ5P 1GL2B 1Z56A 2E75D 2E74B 3R2PA 1GL2A 3L74J 2IFNA 1SQQJ 2KYVA 5APXA 1GL2C 3H1KJ 4K3AA 1DIPA 2K1AA 5TISE 1LTJC 5BU8B 4LDTA 4UB6E 1L0LD 3B5ND 2ITAA 2JJLA 2J5UA 5GTHE 1SFCA 1PPJD 1EZVI 3BRVB 1VQNP 1CW5A 3SWYA 3WUTA 4NPDA 2QJYB 1NTKK 1HJBA 1FC2C 1JTHB 3T97B 2FXPA 3SFED 3L75G 1K9MQ 2ZT9D 1PFIA 5AW5B 2O3JA 2FYZA 4C46A 2WPQA 2B87B 1E79H 1WRGA 3S9OA 1LT9A 3H1LJ 2ZFYA 3VR8D 2QM7A 1T8ZA 1FJPA 1JB0J 1URQC 3AE9C 1M57D 1EC5A 4XE5B 2OQQA 3CCQP 5KKZC 4DHIB 2HODB 5CBOA 4U3FG 1SQVG 3AEGD 5C3JD 2WS3C 3AEFC 4U3FE 1SQBK 3V2NA 1M1JA 1NTKJ 3Q2YA 3V2RA 5AVRB 4C7NB 1N7SB 3CC2P 3CMEP 2A45H 3AEED 2KK7A 3MUDA 2W90A 4PD4H 4PD4E 3AE8C 1BE3E 3WUVA 5AW3B 3IF4A 4ZNCA 3IFMA 4ZKUA 1MKMA 1KFYD 3H1KE 1T6AA 1KILC 2WP9D 3E7KA 5BVZA 3L74E 1ZP0C 4OH8B 1KC8Q 4OGQC 2OYIB 1DEBA 4L73A 1KILB 2IDBA 2RMZA 2CK3H 3M9HA 2A45G 5B5EE 3RK3C 4DHZA 3VP9A 5AVQB 2FKWB 4WBAA 1KQSO 1BCCJ 3G9RA 4MN4C 1D7MA 3LIDA 3AE5D 2WSFJ 3AEDD 2ZYGA 4RJTA 1VL2A 3CC4P 3I5CA 1PIXA 1W5CE 1GMJA 3RBZA 5TISH 3BRTB 4YSZC 1NTZJ 3C1LA 3CIRC 3SSUA 1NKNA 3P4QD 3CWBD 3GF3A 3PP5A 3P8CE 3H1IE 4WY4B 2I1KA 1VQPP 3L75D 4UB6H 1H0TB 2B87A 2NPSD 2J58A 3K5BA 4I6LA 4EIJA 1TFFA 1RE4A 1OW8A 4H44C 3L73D 1SQPE 1SQPK 1L0VD 2SPZA 2OYHB 1NTMG 2Y9YA 3GHGA 5APVA 2OARA 2QEXP 2NZ2A 3W68A 4Z1MH 4AUWA 1M56D 2BEZF 4YSYD 1GZLA 1RH5B 5CBNA 1LT9C 3PJSK 4IOIH 1SFCB 2P10A 2E76B 1NTKD 2FBWD 2GUSA 1G1IA 4LC1A 3MP7B 1VQMP 1YJNP 4WB4A 1W2EA 2N1TC 3U1AA 2NPSC 2H89D 1NO4A 4B86A 2M5AA 1ZOYC 2P1JA 3L72G 2BCCG 1SVFA 3B71A 3RK3E 3TDKA 3OAKA 1OW6A 2WDRD 1JY3O 4WY4C 1GTWA 2B9BA 2Z4EA 4R4LA 4N78E 2P7JA 4ASWA 5AVZB 1H89A 1NOHA 1RE3C 5K5GB
chains in the Genus database with same CATH topology
1TU3F 4PV1D 1YQ4C 2WDVD 3AEAD 3AE8D 1S5LX 3P4RD 1ZRTE 2E75D 4KX6D 2G8YA 4YSXD 2QJKC 2ACZD 3AE2D 2E74B 2D2CC 3AECD 4TT3H 2BS3C 3AEED 1RQUA 3SFDC 4YTNC 3VRAD 2WQYD 3P4QC 2D2CD 3R4YA 3AE8C 1K05A 4YT0D 3SFEC 1DIPA 5C2TD 3AEGC 2H88C 1KF6C 2WDRC 2WPVB 1OW8A 2WQYC 2FYNC 4H44C 4YSZD 1Y9BA 2YIUC 1PL5A 3AEAC 1MKMA 1YQ4D 3ABVD 4R4MA 1KFYD 2J5UA 3IN6A 3D6ZA 1NEKC 3VR8C 5L8RJ 1NGMB 3D71A 1KF6D 1S1CX 1ZOYD 2H88D 2WP9D 3VRBD 1VF5B 3Q3DA 1L0VD 1ZMEC 1L0VC 2E75B 2BS4C 1VF5C 1R8EA 2WSCJ 3VRBC 1ZP0C 3Q5PA 5C3JC 4YTMC 4OGQC 3ABVC 4H13B 1QLBC 1WMKA 3AEEC 4U7JA 1RQVA 3FGAD 1KILE 2IDBA 2QIWA 3Q5SA 1PV3A 4YTPD 2NZ2A 4YT0C 4Z1MH 3P4SC 3AE1D 3AE6D 1EXJA 4H44B 3AEBC 1AJYA 3T97B 1FDIA 2FXPA 3SFED 2BEZF 1IK7A 2JO1A 1K04A 2V7QJ 2ZT9D 4YSYD 3SFDD 1NYHA 3P4PD 4YTND 2D2CB 1VF5D 4PV1C 2WDVC 1YQ3D 4H13C 1DD4A 1KQGB 1UIXA 5M1BA 4OGQD 2WP9C 2WS3D 2YMKA 3AE2C 1U57A 2O01J 2P10A 2E76B 3G9RA 3IAOA 3O6QA 3S9OA 3RL0g 1E7PC 2FBWD 2FBWC 2WU5C 1HF9A 2WDQD 3P4RC 4YTPC 3AEDC 1NEND 3AE5D 1Q90D 3VR8D 3VR9C 3EWKA 1YQ3C 1KFYC 1DD3A 2WSFJ 3AEDD 3AE7D 4PV1B 1EXIA 3AE4D 3AEFD 3H25A 2E74D 1JB0J 2BEQD 4IL6X 3AE9C 4H44D 4OGQB 4YTMD 2MKVA 3VRAC 4YSYC 1VL2A 3GMAA 1ZP0D 2WU2C 2E76D 2H89D 2WU2D 4H13D 3D6YA 2B76C 1PIXA 2OQQA 3AE6C 3GLMA 3AECC 1KMIZ 3C8VA 1ZOYC 3AE4C 5KKZC 2BS2C 4GDOA 1GMJA 3P4PC 1FDOA 1KORA 2ZT9C 4RKUJ 1KQFB 4YXDC 3AE5C 1NENC 4I7ZB 2QJYC 4YSZC 4Y28J 3B71A 2B76D 3AE1C 3RK3E 3Q1MA 4YXDD 2QJPC 1OMIA 2E76C 2H89C 1OW6A 2WDRD 3AEGD 5C3JD 1HJ0A 2ZT9B 1KTMA 5C2TC 1OW7A 4H0LB 2WS3C 4XFJA 4H0LD 3AE9D 2ACZC 3GF7A 3AEFC 3CIRC 4R4LA 3LW5J 3P4QD 3AE3D 2WSEJ 3AE3C 3VR9D 2QSIA 2E74C 4KT0J 4YSXC 2E75C 5KLIC 3GF3A 2WDQC 3AEBD 3AE7C 3Q5RA 2G3AA 4KX6C 3CIRD 4I7ZC 3Q2YA 2WU5D 3P4SD 2JP3A 4H0LC 3D70A 2K9YA 1NEKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDV D;  1YQ4 C;  3AEA D;  3AE8 D;  3P4R D;  4KX6 D;  4YSX D;  2ACZ D;  3AE2 D;  3AEC D;  3AEE D;  2BS3 C;  4YTN C;  3SFD C;  2WQY D;  3P4Q C;  3AE8 C;  1K05 A;  4YT0 D;  3SFE C;  5C2T D;  3AEG C;  2H88 C;  1KF6 C;  2WDR C;  1OW8 A;  2WQY C;  4YSZ D;  3AEA C;  1YQ4 D;  3ABV D;  1KFY D;  1NEK C;  3VR8 C;  2H88 D;  1KF6 D;  1ZOY D;  3VRB D;  2WP9 D;  1L0V D;  1L0V C;  2BS4 C;  3VRB C;  1ZP0 C;  5C3J C;  4YTM C;  3ABV C;  1QLB C;  3AEE C;  1PV3 A;  4YTP D;  4YT0 C;  3AE1 D;  3AE6 D;  3AEB C;  3SFE D;  4YSY D;  3VRA D;  1K04 A;  3SFD D;  4YTN D;  3P4P D;  2WDV C;  1YQ3 D;  2WP9 C;  2WS3 D;  3AE2 C;  2ACZ C;  3S9O A;  2WU5 C;  3P4S C;  3P4R C;  1E7P C;  2FBW D;  2FBW C;  2WDQ D;  4YTP C;  3AED C;  1NEN D;  3AE5 D;  3VR8 D;  3VR9 C;  1YQ3 C;  1KFY C;  3AED D;  3AE7 D;  3AE4 D;  3AEF D;  3AE9 C;  4YTM D;  3VRA C;  4YSY C;  1ZP0 D;  2WU2 D;  2WU2 C;  2H89 D;  2B76 C;  3AE6 C;  3AEC C;  1ZOY C;  3AE4 C;  2BS2 C;  3P4P C;  4YXD C;  3AE5 C;  1NEN C;  4YSZ C;  3B71 A;  2B76 D;  3AE1 C;  4YXD D;  2H89 C;  1OW6 A;  2WDR D;  3AEG D;  5C3J D;  5C2T C;  1KTM A;  1OW7 A;  2WS3 C;  3AE9 D;  3AEF C;  3CIR C;  3P4Q D;  3AE3 D;  3VR9 D;  3AE3 C;  4YSX C;  4KX6 C;  3AEB D;  2WDQ C;  3AE7 C;  2G3A A;  3CIR D;  2WU5 D;  3P4S D;  1NEK D; 
#chains in the Genus database with same CATH topology
 2Q5U A;  3JSV C;  3FWN A;  1JMB A;  3OA7 A;  3P8C D;  2C9L Y;  1LJ2 A;  5E79 H;  3CX5 I;  1VQK P;  2H88 C;  1PGP A;  2ZYA A;  1KN7 A;  1BSN A;  2YKQ A;  3VR8 C;  5L8R J;  1VQO P;  1JM0 A;  3H1L D;  1IFP A;  2NRG A;  1GK6 A;  2PP6 A;  1L0L K;  1SQV J;  2XV5 A;  1NKZ B;  3RK3 D;  5BU5 A;  3CD6 P;  2KLU A;  3V6I A;  1J2J B;  3V2P A;  3AE6 D;  1QL1 A;  1JMM A;  1H88 A;  1P84 I;  3RL0 C;  4U3F J;  2KOG A;  2WP9 C;  3RK2 B;  3HE5 A;  2O01 J;  2RH0 A;  4IL6 H;  1YQ3 C;  2P67 A;  4OGQ B;  1KIL A;  1A02 J;  1OFC X;  1L4A A;  1KZU B;  1FDO A;  1KB9 E;  3HD7 C;  3IR9 A;  3L73 J;  2ZXX A;  5C2T C;  1LP1 A;  5CCG C;  1BE3 J;  1KYO H;  4GT1 A;  4KT0 J;  3AE7 C;  3Q5R A;  1A02 F;  4WVZ A;  1SQB J;  4PV1 D;  1CZQ A;  1LTA C;  2R44 A;  1NTK E;  3CCS P;  3AEC D;  4YPC A;  2AEM A;  3CWB J;  1U7J A;  1SQB G;  1R5L A;  3RGU A;  1NU1 J;  1IJD B;  2WPV B;  1BGY G;  3D6Z A;  1KF6 D;  1NTM J;  1PP9 D;  2AEJ A;  2K37 A;  5KLI B;  2L5G B;  1EDJ A;  2IBZ G;  3L4F A;  1QX8 A;  3ABV C;  3II6 A;  1QLB C;  2IX7 C;  2QM8 A;  2IBZ D;  3HUS A;  1SQP D;  3H1L E;  1JY2 O;  4IFD K;  3H1J J;  3AEB C;  2FYU J;  1BDD A;  2Q1K A;  2WPS A;  3CCJ P;  1VQ7 P;  1UIX A;  3RK2 D;  3A0H H;  2QJK B;  3PTZ A;  1NEN D;  3EWK A;  5H2F H;  1QL2 A;  1GL2 D;  3AEF D;  1Q7Y Q;  1FS0 E;  4H13 D;  2HR3 A;  1Q81 Q;  2HG5 D;  3RK3 B;  3BAT A;  3AE4 C;  1KQF B;  1SQQ K;  3HE5 B;  1NEN C;  4WY4 A;  1LT1 A;  4O9B A;  1KYO I;  4Y28 J;  1L0L E;  2IZ0 A;  1BGY J;  4XFJ A;  4DZO A;  5KKZ B;  1W2B O;  1SS1 A;  2JWD A;  2WSE J;  3AE3 D;  3H1H G;  3AEB D;  1YJ9 P;  3KPE A;  2WDQ C;  1LNQ A;  1YIT P;  2WU5 D;  3CX5 E;  4M3L A;  5KLV G;  1IZN B;  2XKM A;  1EZV G;  1JY3 N;  1RHZ B;  2JDI H;  1ZV8 A;  2KXP B;  4KJM A;  1NTM E;  4WY4 D;  3L73 G;  2WIT A;  1NTM K;  1GDT A;  1KF6 C;  3MUD C;  2VRS A;  1AA0 A;  2E5Y A;  2OTJ P;  3CXH I;  1QLE D;  5APY A;  2WZ7 A;  2R32 A;  5KLV J;  2KSE A;  4U3F D;  3VOP A;  1BCC G;  1SQX J;  2WSF H;  4Y99 B;  1YJW P;  3BCC J;  4AQR D;  1RF1 A;  2MJZ A;  5TJH A;  4CPG A;  1SQB E;  2AXT H;  2LR2 A;  4TLF A;  3CI9 A;  3B5N A;  5AW4 B;  3P4P D;  2IFM A;  1VF5 D;  5CCH C;  3HTK B;  3TNU B;  3H1H E;  1DEE G;  3H32 B;  1JO5 A;  1OX3 A;  1LWU B;  2FYN B;  3L71 J;  1NTK G;  1DD3 A;  1LWU C;  2LKM A;  2O01 H;  4EYY Q;  3H1I D;  3VRA C;  2ZFC A;  5GTH H;  3GMA A;  2GM4 A;  1LT9 B;  1RE4 C;  3U1C A;  1H0T A;  4RKU J;  1RF1 C;  2PGD A;  2Z5H A;  3NTN A;  3LIE A;  5CJ4 A;  2V7Q H;  3B4S A;  4YXW H;  2RKL A;  2W8Z A;  3KQG A;  1JCD A;  3D70 A;  3FXE A;  1T3J A;  1YQ4 C;  2QA4 P;  4KX6 D;  2QVA A;  3N7N A;  1SQV E;  1PGO A;  3R4Y A;  1NTZ E;  2FYN C;  1VDF A;  3HD7 A;  1S5L E;  3E1I A;  1VF5 B;  3Q3D A;  1Y47 A;  2N1T A;  3MD0 A;  5KJ7 A;  1IFD A;  4YTM C;  4DT0 A;  2HPC A;  4RO0 A;  1L0N J;  4I2L C;  5KAI E;  4ZMD A;  2P2U A;  1EDK A;  2O01 N;  4YT0 C;  1NU1 G;  1U7M A;  4EOT A;  2OGU A;  1NJI Q;  1LTI C;  1FZF A;  1DD4 A;  2YO2 A;  2M3B A;  4GOD A;  1J1D B;  1T2K C;  3M9Q A;  1HH0 A;  1VQ4 P;  1SQQ D;  1GU4 A;  3E1R A;  3RL0 D;  5GTI E;  2FFD A;  3UIA A;  3GLM A;  1G1J A;  3MIW A;  3PLN A;  2FYU G;  5AVX B;  1KB9 H;  4YXD C;  4LLH A;  1FBM A;  1N73 C;  4AYC A;  3TGU J;  1KTM A;  1J1E C;  1JY3 P;  1LTB C;  2Y9Z A;  2FYU K;  1GK4 A;  5KLI C;  2HOD A;  5KAI H;  1T2K D;  4BRY A;  1TU3 F;  3B5N C;  1ZRT E;  4YSX D;  1N7S D;  2N9B A;  1JUN A;  3F5H A;  5KAF E;  1IFN A;  1P84 H;  1DH3 A;  4ZKP A;  1G2C B;  3MZW B;  5DJT B;  2ZJS E;  3GHG B;  4IL6 E;  3FWL A;  3N4X A;  2K3R A;  2J59 M;  3O8Z A;  2ZVN B;  4H13 B;  1KD1 Q;  3L71 G;  1VQ6 P;  1PZQ A;  3CCU P;  1Q2N A;  3H1I J;  1SQX G;  1RE3 A;  2L91 A;  1G2C A;  2JKV A;  1SQP G;  3VYI A;  1SQX D;  1FDI A;  1CI6 A;  2W6A A;  4D6T J;  1N86 A;  3SFD D;  2Y0D A;  4YTN D;  2H43 A;  1ZR4 A;  2QG4 A;  1USE A;  4N3Y B;  3AE2 C;  2ACZ C;  3O6Q A;  3P4S C;  4JPZ B;  2R3S A;  3L70 J;  2LXB A;  5KLV K;  1EXI A;  2YIU B;  2XZR A;  3ITK A;  2PRR A;  3SWF A;  3EFF K;  1NTZ D;  1LWU A;  2QJP B;  1NTZ G;  4DJG A;  1MV8 A;  2IBZ I;  1SQV D;  3G71 P;  3AE5 C;  1JEK A;  3HTK A;  3QH9 A;  2QJP C;  1IO4 A;  1NU1 D;  1IC2 A;  3JCU H;  5AVS B;  2KB7 P;  1YYC A;  3LW5 J;  1FZA A;  2E74 C;  1KB9 I;  2E75 C;  2BCC E;  2M3E A;  3H1J G;  3CWB G;  1MFZ A;  1JOC A;  2WDV D;  1JNM A;  2WT7 A;  3VMX A;  1LGH B;  2HYN A;  2M8R A;  3S1K A;  1AQ5 A;  2C0W A;  5APS A;  2E42 A;  1Y9B A;  1PP9 G;  3USS A;  1NEK C;  2M0B A;  1ZR2 A;  2OTL P;  3AEE C;  5B66 E;  5KJ7 C;  2E5T A;  3P32 A;  4JQ0 D;  1M1J B;  4K35 A;  4BWN A;  3L70 E;  1SP4 A;  1EXJ A;  1IFI A;  1EZV E;  1IK7 A;  1K04 A;  3L37 A;  3H1K D;  2D2C B;  3CMA P;  1PGQ A;  5GTI H;  1ZW0 A;  2WS3 D;  1U57 A;  2WU5 C;  2K88 A;  4IFF A;  3TGU G;  3VN0 A;  4LGD E;  2WDQ D;  3EFG A;  3L73 E;  3VR9 C;  4BXL A;  1VQ9 P;  3AE7 D;  2I8D A;  3H25 A;  2MKV A;  4ASV A;  2QE7 H;  3M9B A;  1URQ B;  2B76 C;  3VMY A;  3AEC C;  1AV1 A;  1NU1 K;  1OMI A;  4C7R A;  5CJ0 A;  1JY2 P;  1H8A A;  2ZVO B;  3P8M C;  5KAF H;  4YSX C;  1QVG O;  3SWK A;  3GG2 A;  4JBZ A;  3RK2 C;  1YI2 P;  4DDG A;  3A5T A;  3AEA D;  3AE8 D;  3P4R D;  1EDI A;  1HGZ A;  5KJ7 D;  2HLO A;  1Q82 Q;  1USD A;  3I55 P;  1GU5 A;  5AW8 B;  3M91 A;  3TGU E;  1HUC A;  2YKP A;  1LTG C;  1PL5 A;  2DW3 A;  1RF1 B;  2WSC H;  1YQ4 D;  3ABV D;  3HUS B;  3IN6 A;  1FZC B;  4EDF A;  3D71 A;  2E75 B;  3VRB C;  2FXM A;  5C3J C;  2BAS A;  4U7J A;  2FY8 A;  2Y0C A;  1N73 B;  3H1H D;  2PFX A;  5B5E H;  3AE1 D;  1K73 Q;  5CMZ A;  2B89 A;  4Y99 C;  4H44 B;  2C9N Y;  1AJY A;  2JO1 A;  2JWA A;  2OYH A;  4PV1 C;  4KHX A;  1CSB A;  4C7N A;  1SQB D;  1NTZ K;  4D6T G;  3G4S P;  2WT7 B;  2OYH C;  1E7P C;  2OTK E;  4W7Z A;  4D6T D;  3TF5 A;  1MZ9 A;  1YHQ P;  1BE3 D;  1VQL P;  4H44 D;  4YTM D;  2NPS B;  1HVV A;  2KP8 A;  3A0B H;  3F89 A;  3P4P C;  4UB8 E;  3KXD A;  1GW4 A;  1N7S A;  3A3Y B;  2E76 C;  2N1T B;  5AW6 B;  1HJ0 A;  2YXQ B;  4L76 A;  1BSH A;  3L72 E;  1XTG B;  4D6T E;  1GD2 E;  3HUS C;  2A06 G;  4KX6 C;  2HFE D;  3CIR D;  3FXD A;  2JP3 A;  3G6E P;  1FOS F;  1QEX A;  5AVT B;  3BCC D;  1KB9 D;  1NVO A;  1FE6 A;  5AW7 B;  2E43 A;  1AVO A;  1IFM A;  1JCC A;  2YIU C;  4JF7 A;  3QWO C;  3L70 G;  3L75 E;  4GOE A;  1ZME C;  2BS4 C;  4W80 A;  3V5B A;  3VTP C;  1YTZ T;  3H1L G;  3TK1 A;  2FFD B;  3Q5S A;  3L71 E;  1BDC A;  3H1H J;  3L72 J;  1FZE A;  1KV4 A;  2KS1 B;  4H13 C;  4OGQ D;  3CCR P;  1YIJ P;  3RL0 g;  2H7H A;  3WUU A;  3CLQ A;  1KFY C;  2Q3I A;  2A45 I;  2AEF A;  4L74 A;  2XU6 A;  2WU2 C;  3D6Y A;  3VMZ A;  3L75 J;  2BS2 C;  2KS1 A;  2FXO A;  4I7Z B;  3HRN A;  2QJY C;  2YKO A;  3PRJ A;  5H2F E;  1Y8A A;  2Q6Q A;  2H89 C;  2N1T D;  1OW7 A;  3CXH E;  3GF7 A;  1OVU A;  1MFT A;  2N9Y B;  3PHL A;  1PPJ E;  4I7Z C;  1J1E B;  4NPE A;  3L74 D;  2Y0E A;  2W6J H;  1S3J A;  5KLV D;  1L0N K;  3CCL P;  1EZV D;  3HD7 B;  4I1L A;  4QMA A;  2H8P D;  2IZ1 A;  1XTC C;  1S5L H;  1HTL C;  1QVF O;  1BGY D;  1M7L A;  4NPF X;  2WQY C;  2V4H A;  1L0L J;  1SQV K;  3VP8 A;  1NWQ A;  3BVH A;  5AW2 B;  1L0V C;  1FU1 A;  1R8E A;  1NTM D;  2WSC J;  2YO3 A;  1YTZ I;  4HJG H;  1CI6 B;  2ZAE B;  1KIL D;  2UWJ E;  3FGA D;  2QIW A;  3M06 A;  2W6B A;  3WMM 0;  1ZRT D;  5APT A;  3WU2 H;  3HD7 D;  2K9J B;  3B8E B;  1X0T A;  2KZI A;  1LTT C;  2JR8 A;  1VPC A;  1KQG B;  5M1B A;  2GUV A;  2R5B A;  3P4R C;  3CL3 D;  2C0X A;  4YTP C;  3B5N B;  3T97 A;  1FZC C;  3NXS A;  2WMM A;  1R5S A;  1DX7 A;  1L0L G;  4IL6 X;  1SFC D;  2KUB A;  2E76 D;  3FX0 A;  3KDP B;  3L35 A;  4GDO A;  2KLV A;  3L71 D;  3JC2 2;  2W27 A;  1S72 P;  3CWB E;  3GHG C;  1L4A D;  1RF0 C;  5AVU B;  3CX5 D;  2K9Y A;  5C39 A;  2G8Y A;  1FZG A;  1FZC A;  4DCK A;  4TT3 H;  1FAV A;  2BS3 C;  1RQU A;  2WQY D;  1SQX E;  1AQT A;  4PJ0 H;  2P58 A;  1PGJ A;  1EQ7 A;  3SFE C;  1ZXG A;  3OJA B;  5C2T D;  4DOJ A;  2B88 A;  1FZB A;  3V4W A;  4R4M A;  1OXZ A;  3S4R A;  3VRB D;  3V2Q A;  1SFC C;  4W7Y A;  1WMK A;  1LTJ B;  3KZI E;  5AVV B;  1T3U A;  1X22 A;  4YTP D;  1P84 D;  3VRA D;  3NMD A;  1BGY E;  2YMK A;  3W67 A;  1HF9 A;  1SQQ G;  1IFJ A;  2IBZ E;  1URQ A;  3HE4 B;  1J1D C;  3BAS A;  3MTU E;  1OVR A;  4PV1 B;  3AE4 D;  2E74 D;  5KTB A;  3HE4 A;  3L70 D;  3TYY A;  2WTY A;  1N8R Q;  3C8V A;  4PD4 D;  3H1I G;  3TNU A;  1KOR A;  4UB8 H;  2AXT E;  3CXH D;  2B76 D;  4XA4 A;  2ZT9 B;  3A7O A;  1URQ D;  4H0L D;  3AE9 D;  1OWA A;  2KNC A;  1M8O B;  1SQQ E;  4OWF A;  5APU A;  2FYU E;  2W83 C;  1GW3 A;  3VR9 D;  1M90 Q;  3H1J E;  5AW1 B;  3MHV A;  3H32 A;  5AVW B;  3TGU D;  2KI7 B;  3AE2 D;  2BCC J;  2ACZ D;  2D2C C;  2R5D A;  2Q7C A;  2D2C D;  2YNY A;  4BRY B;  1HWT C;  1K05 A;  3A0B E;  1QGK B;  2WDR C;  1RY3 A;  1L0N D;  2Z5I A;  2O1J A;  1Q86 Q;  3CCV P;  1ZOY D;  1NGM B;  1NU1 E;  1S1C X;  1N73 A;  4N6J A;  3H6P A;  3Q5P A;  2QRX A;  3RBX A;  2Q9I A;  1HGV A;  1NAY A;  1M1J C;  4A7P A;  1KYO E;  2ZXE B;  2OYI C;  2POH A;  1N2D C;  5DJU B;  2IPP A;  2WDV C;  4N78 D;  4OVN F;  2KIK A;  4JYB A;  3IAO A;  5CCH A;  2RN0 A;  1SQX K;  2M5A B;  1L4A B;  3AED C;  1KQL A;  1Q90 D;  1OVV A;  3G3Z A;  1KFN A;  3A2A A;  2BEQ D;  2XNX A;  4GKG A;  3GW6 A;  3PH0 A;  1PP9 J;  1N7S C;  3LW5 H;  3C9I A;  2HPC B;  5AVY B;  4YXD D;  3AE1 C;  1L2P A;  3Q1M A;  1BCC D;  2R3C A;  1FDM A;  2LXC B;  4L75 A;  1ZLL A;  1JY2 N;  1S9K D;  1NH4 A;  2A06 E;  3I56 P;  3P4S D;  3NFQ A;  3VMA A;  1UII A;  4IFM A;  1L0N E;  3P7K A;  1RF0 A;  1IK9 A;  2QJK C;  1KFM A;  4YTN C;  3SFD C;  1S2E A;  3P4Q C;  1NAF A;  2K9J A;  2O1K A;  1WT6 A;  1L4A C;  4YSZ D;  3L36 A;  5B66 H;  3AEA C;  4HYT B;  5APQ A;  2KZJ A;  2H88 D;  2FFD C;  1X8Y A;  2FYU D;  5CCG D;  1VQ8 P;  3U59 A;  2Q3E A;  1S9K E;  1JTH A;  2IYO A;  1RQV A;  3JCU E;  1KIL E;  3H1K G;  1BCC E;  2V7Q J;  4HH2 A;  3KZI H;  2JEE A;  1YQ3 D;  2CPB A;  1LTS C;  1NHL A;  1EDL A;  3ZDM A;  1L0N G;  2NPS A;  3EQ2 A;  4WWI A;  1ZP0 D;  2WU2 D;  1PPJ G;  4FJV A;  1N7L A;  1M1K Q;  3AE6 C;  4GIF A;  1KMI Z;  2ZT9 C;  2ZYD A;  1P84 E;  1S4X A;  5E79 E;  3TSI A;  5EFW B;  1HBW A;  3RL0 B;  1MUU A;  3AE3 C;  4EI2 A;  2QSI A;  4HKZ H;  1KYO D;  1ZN5 A;  2I1J A;  2KSJ A;  2G3A A;  1YBK A;  1LP1 B;  4H0L C;  2CPS A;  2OYI A;  1NEK D;  1S5L X;  2IYP A;  3CPW O;  4HB1 A;  4PJ0 E;  3CX5 H;  1OIP A;  1SLQ A;  4I6M C;  5CCH D;  3CCE P;  2WWW A;  5AW0 B;  4YT0 D;  4JYC A;  3AEG C;  1SQP J;  2KNC B;  3KYQ A;  1FJK A;  1E5W A;  1AFO A;  2XDJ A;  3O6Q B;  5AW9 B;  1PP9 E;  3M0A A;  2GA1 A;  1VF5 C;  2YXR B;  3M0D C;  1X9V A;  1FOS E;  5APW A;  3M0D A;  2XND H;  3V4Q A;  3WU2 E;  1PV3 A;  3H1J D;  4GOF A;  3L74 G;  3KHU A;  2WVR A;  1NYH A;  2YMY A;  4PD4 I;  3A0H E;  1K8A Q;  3OW2 O;  2FBW C;  4DDI A;  1BE3 G;  2OYO A;  5CHX A;  1AVY A;  2WPR A;  3BCC E;  3CXH H;  4YSY C;  2BCC D;  3MGN A;  5KLV E;  1LTJ A;  2WSE H;  1X79 B;  3CC7 P;  5CCG A;  3L72 D;  4DHJ A;  3VON A;  4H0L B;  1OZH A;  2A06 D;  2PAJ A;  3CCM P;  2WSS H;  2AXC A;  4RES B;  3BCC G;  1VQ5 P;  1GL2 B;  1Z56 A;  2E75 D;  2E74 B;  3R2P A;  1GL2 A;  3L74 J;  2IFN A;  1SQQ J;  2KYV A;  5APX A;  1GL2 C;  3H1K J;  4K3A A;  1DIP A;  2K1A A;  5TIS E;  1LTJ C;  5BU8 B;  4LDT A;  4UB6 E;  1L0L D;  3B5N D;  2ITA A;  2JJL A;  2J5U A;  5GTH E;  1SFC A;  1PPJ D;  1EZV I;  3BRV B;  1VQN P;  1CW5 A;  3SWY A;  3WUT A;  4NPD A;  2QJY B;  1NTK K;  1HJB A;  1FC2 C;  1JTH B;  3T97 B;  2FXP A;  3SFE D;  3L75 G;  1K9M Q;  2ZT9 D;  1PFI A;  5AW5 B;  2O3J A;  2FYZ A;  4C46 A;  2WPQ A;  2B87 B;  1E79 H;  1WRG A;  3S9O A;  1LT9 A;  3H1L J;  2ZFY A;  3VR8 D;  2QM7 A;  1T8Z A;  1FJP A;  1JB0 J;  1URQ C;  3AE9 C;  1M57 D;  1EC5 A;  4XE5 B;  2OQQ A;  3CCQ P;  5KKZ C;  4DHI B;  2HOD B;  5CBO A;  4U3F G;  1SQV G;  3AEG D;  5C3J D;  2WS3 C;  3AEF C;  4U3F E;  1SQB K;  3V2N A;  1M1J A;  1NTK J;  3Q2Y A;  3V2R A;  5AVR B;  4C7N B;  1N7S B;  3CC2 P;  3CME P;  2A45 H;  3AEE D;  2KK7 A;  3MUD A;  2W90 A;  4PD4 H;  4PD4 E;  3AE8 C;  1BE3 E;  3WUV A;  5AW3 B;  3IF4 A;  4ZNC A;  3IFM A;  4ZKU A;  1MKM A;  1KFY D;  3H1K E;  1T6A A;  1KIL C;  2WP9 D;  3E7K A;  5BVZ A;  3L74 E;  1ZP0 C;  4OH8 B;  1KC8 Q;  4OGQ C;  2OYI B;  1DEB A;  4L73 A;  1KIL B;  2IDB A;  2RMZ A;  2CK3 H;  3M9H A;  2A45 G;  5B5E E;  3RK3 C;  4DHZ A;  3VP9 A;  5AVQ B;  2FKW B;  4WBA A;  1KQS O;  1BCC J;  3G9R A;  4MN4 C;  1D7M A;  3LID A;  3AE5 D;  2WSF J;  3AED D;  2ZYG A;  4RJT A;  1VL2 A;  3CC4 P;  3I5C A;  1PIX A;  1W5C E;  1GMJ A;  3RBZ A;  5TIS H;  3BRT B;  4YSZ C;  1NTZ J;  3C1L A;  3CIR C;  3SSU A;  1NKN A;  3P4Q D;  3CWB D;  3GF3 A;  3PP5 A;  3P8C E;  3H1I E;  4WY4 B;  2I1K A;  1VQP P;  3L75 D;  4UB6 H;  1H0T B;  2B87 A;  2NPS D;  2J58 A;  3K5B A;  4I6L A;  4EIJ A;  1TFF A;  1RE4 A;  1OW8 A;  4H44 C;  3L73 D;  1SQP E;  1SQP K;  1L0V D;  2SPZ A;  2OYH B;  1NTM G;  2Y9Y A;  3GHG A;  5APV A;  2OAR A;  2QEX P;  2NZ2 A;  3W68 A;  4Z1M H;  4AUW A;  1M56 D;  2BEZ F;  4YSY D;  1GZL A;  1RH5 B;  5CBN A;  1LT9 C;  3PJS K;  4IOI H;  1SFC B;  2P10 A;  2E76 B;  1NTK D;  2FBW D;  2GUS A;  1G1I A;  4LC1 A;  3MP7 B;  1VQM P;  1YJN P;  4WB4 A;  1W2E A;  2N1T C;  3U1A A;  2NPS C;  2H89 D;  1NO4 A;  4B86 A;  2M5A A;  1ZOY C;  2P1J A;  3L72 G;  2BCC G;  1SVF A;  3B71 A;  3RK3 E;  3TDK A;  3OAK A;  1OW6 A;  2WDR D;  1JY3 O;  4WY4 C;  1GTW A;  2B9B A;  2Z4E A;  4R4L A;  4N78 E;  2P7J A;  4ASW A;  5AVZ B;  1H89 A;  1NOH A;  1RE3 C;  5K5G B; 
#chains in the Genus database with same CATH homology
 1TU3 F;  4PV1 D;  1YQ4 C;  2WDV D;  3AEA D;  3AE8 D;  1S5L X;  3P4R D;  1ZRT E;  2E75 D;  4KX6 D;  2G8Y A;  4YSX D;  2QJK C;  2ACZ D;  3AE2 D;  2E74 B;  2D2C C;  3AEC D;  4TT3 H;  2BS3 C;  3AEE D;  1RQU A;  3SFD C;  4YTN C;  3VRA D;  2WQY D;  3P4Q C;  2D2C D;  3R4Y A;  3AE8 C;  1K05 A;  4YT0 D;  3SFE C;  1DIP A;  5C2T D;  3AEG C;  2H88 C;  1KF6 C;  2WDR C;  2WPV B;  1OW8 A;  2WQY C;  2FYN C;  4H44 C;  4YSZ D;  1Y9B A;  2YIU C;  1PL5 A;  3AEA C;  1MKM A;  1YQ4 D;  3ABV D;  4R4M A;  1KFY D;  2J5U A;  3IN6 A;  3D6Z A;  1NEK C;  3VR8 C;  5L8R J;  1NGM B;  3D71 A;  1KF6 D;  1S1C X;  1ZOY D;  2H88 D;  2WP9 D;  3VRB D;  1VF5 B;  3Q3D A;  1L0V D;  1ZME C;  1L0V C;  2E75 B;  2BS4 C;  1VF5 C;  1R8E A;  2WSC J;  3VRB C;  1ZP0 C;  3Q5P A;  5C3J C;  4YTM C;  4OGQ C;  3ABV C;  4H13 B;  1QLB C;  1WMK A;  3AEE C;  4U7J A;  1RQV A;  3FGA D;  1KIL E;  2IDB A;  2QIW A;  3Q5S A;  1PV3 A;  4YTP D;  2NZ2 A;  4YT0 C;  4Z1M H;  3P4S C;  3AE1 D;  3AE6 D;  1EXJ A;  4H44 B;  3AEB C;  1AJY A;  3T97 B;  1FDI A;  2FXP A;  3SFE D;  2BEZ F;  1IK7 A;  2JO1 A;  1K04 A;  2V7Q J;  2ZT9 D;  4YSY D;  3SFD D;  1NYH A;  3P4P D;  4YTN D;  2D2C B;  1VF5 D;  4PV1 C;  2WDV C;  1YQ3 D;  4H13 C;  1DD4 A;  1KQG B;  1UIX A;  5M1B A;  4OGQ D;  2WP9 C;  2WS3 D;  2YMK A;  3AE2 C;  1U57 A;  2O01 J;  2P10 A;  2E76 B;  3G9R A;  3IAO A;  3O6Q A;  3S9O A;  3RL0 g;  1E7P C;  2FBW D;  2FBW C;  2WU5 C;  1HF9 A;  2WDQ D;  3P4R C;  4YTP C;  3AED C;  1NEN D;  3AE5 D;  1Q90 D;  3VR8 D;  3VR9 C;  3EWK A;  1YQ3 C;  1KFY C;  1DD3 A;  2WSF J;  3AED D;  3AE7 D;  4PV1 B;  1EXI A;  3AE4 D;  3AEF D;  3H25 A;  2E74 D;  1JB0 J;  2BEQ D;  4IL6 X;  3AE9 C;  4H44 D;  4OGQ B;  4YTM D;  2MKV A;  3VRA C;  4YSY C;  1VL2 A;  3GMA A;  1ZP0 D;  2WU2 C;  2E76 D;  2H89 D;  2WU2 D;  4H13 D;  3D6Y A;  2B76 C;  1PIX A;  2OQQ A;  3AE6 C;  3GLM A;  3AEC C;  1KMI Z;  3C8V A;  1ZOY C;  3AE4 C;  5KKZ C;  2BS2 C;  4GDO A;  1GMJ A;  3P4P C;  1FDO A;  1KOR A;  2ZT9 C;  4RKU J;  1KQF B;  4YXD C;  3AE5 C;  1NEN C;  4I7Z B;  2QJY C;  4YSZ C;  4Y28 J;  3B71 A;  2B76 D;  3AE1 C;  3RK3 E;  3Q1M A;  4YXD D;  2QJP C;  1OMI A;  2E76 C;  2H89 C;  1OW6 A;  2WDR D;  3AEG D;  5C3J D;  1HJ0 A;  2ZT9 B;  1KTM A;  5C2T C;  1OW7 A;  4H0L B;  2WS3 C;  4XFJ A;  4H0L D;  3AE9 D;  2ACZ C;  3GF7 A;  3AEF C;  3CIR C;  4R4L A;  3LW5 J;  3P4Q D;  3AE3 D;  2WSE J;  3AE3 C;  3VR9 D;  2QSI A;  2E74 C;  4KT0 J;  4YSX C;  2E75 C;  5KLI C;  3GF3 A;  2WDQ C;  3AEB D;  3AE7 C;  3Q5R A;  2G3A A;  4KX6 C;  3CIR D;  4I7Z C;  3Q2Y A;  2WU5 D;  3P4S D;  2JP3 A;  4H0L C;  3D70 A;  2K9Y A;  1NEK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...