3AECC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aecC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aecC02
3AEBD 3AE6D 2WU2D 3AE3C 3B71A 2ACZD 3AEEC 2BS2C 3AE4D 5C3JC 2WU5C 2WS3C 5C2TD 3VR8D 1ZOYC 1NENC 4YSYD 2G3AA 4YXDC 3AE3D 1OW7A 2H88C 3AEED 4YSZC 1QLBC 3VRBC 5C3JD 2WU5D 1ZP0C 2WS3D 1ZOYD 1NEND 2FBWC 4YXDD 1L0VC 1KF6C 2H88D 1NEKC 4YSZD 3VRBD 4KX6C 1OW6A 1ZP0D 2BS4C 1K05A 3CIRC 2FBWD 3SFDC 1L0VD 3AE9C 1KF6D 1NEKD 3AEDC 1OW8A 1YQ4C 3AEGC 3AE5C 3P4SC 3AE8C 3P4QC 4KX6D 3SFEC 2WQYC 3AEAC 2H89C 4YTPC 4YTNC 3CIRD 3VR9C 3AE1C 3VRAC 3AE2C 3SFDD 1KTMA 3AE9D 3AEDD 1YQ4D 3AEGD 3AE5D 3P4SD 3AE8D 3P4QD 2B76C 3SFED 2WQYD 3AEAD 1KFYC 2WDRC 2H89D 4YTPD 1YQ3C 3S9OA 4YTND 3VR9D 3AE1D 3VRAD 3AE2D 3AEFC 2WDVC 2BS3C 2WP9C 3ABVC 2B76D 1KFYD 2WDRD 1YQ3D 3AE6C 4YTMC 1E7PC 3AEFD 2WDVD 1PV3A 2WP9D 3ABVD 4YSXC 4YTMD 3P4RC 4YT0C 4YSXD 3AE7C 2WDQC 3AECC 3P4PC 1K04A 3AEBC 3P4RD 4YT0D 2WU2C 3AE7D 2ACZC 2WDQD 3AECD 3P4PD 3AE4C 5C2TC 3VR8C 4YSYC
chains in the Genus database with same CATH superfamily
4EYYQ 2KNCB 2OTJP 2ACZD 2B87B 3HD7B 2KOGA 1EQ7A 3M0DC 2WU5C 1J1EC 4GDOA 1OX3A 2B89A 2IYPA 1SQQD 2H8PD 2WTYA 1OVRA 3NFQA 2WS3D 3I56P 2H43A 1KYOE 3CX5H 2BCCG 2E76C 1HGVA 2W83C 3IR9A 1BCCJ 4W7YA 2ZFCA 1SQQE 3AE5C 3K5BA 1ZR2A 2QJPC 1FS0E 1G1JA 1LJ2A 3KZIE 1KORA 5E79H 1JY2O 1VF5B 2DW3A 2JEEA 1BSHA 1KFNA 3A0BE 2JKVA 3GHGB 2IPPA 1MV8A 2IX7C 2KB7P 4D6TG 4MN4C 3GG2A 1X79B 1HVVA 5APTA 4R4LA 3B5ND 3LIEA 2E5YA 1LTTC 4EOTA 2OYOA 1SQQJ 4I7ZB 2WZ7A 1JUNA 4OGQD 1PGPA 5AVXB 3P4RC 4YSXD 3WU2H 1J2JB 4PD4D 3GF3A 2R5BA 1FZCC 2N1TC 4PV1C 2FYUK 1FZAA 2WT7A 1LWUB 2GM4A 3TNUB 1SFCD 3WUTA 4H44B 1NYHA 4QMAA 2Q9IA 3GMAA 3ITKA 3VYIA 3L36A 1R5LA 2YMKA 3PLNA 1PZQA 3HUSC 1SQXE 3G9RA 4YSZC 1QLBC 1RE4A 1S5LX 2AXTE 1TU3F 1KF6C 3U1AA 4KX6C 1ZP0D 3BCCD 3CCSP 4HJGH 1GZLA 3TF5A 3OW2O 2WPQA 2Y9ZA 3L73G 4Y99B 2VRSA 3SFDD 1DIPA 3RL0g 3Q1MA 1RE3A 2YO3A 4W80A 5KAFE 3H1HE 1SQXJ 5H2FH 1IO4A 2RN0A 1DD4A 2O01H 1DEBA 5GTHH 3L4FA 5APXA 1LT9C 1NKNA 1SQVD 4DHZA 2XNDH 1VQOP 2FFDB 1PFIA 5KKZC 2W27A 4JQ0D 3RK2D 1LGHB 4KHXA 2WSFH 3W68A 2E74B 3H1HJ 2P1JA 1XTGB 1VQ9P 2YNYA 1SQVE 2SPZA 4WY4C 4YT0D 2Q6QA 3H1ID 1SQPK 4UB8E 1ZN5A 3V2PA 5AVWB 3FX0A 1IFDA 3B71A 3NMDA 4ASVA 3SWFA 5KLVG 1VL2A 3AE3D 2KZIA 2YKQA 3MD0A 2IFMA 5CCGC 3V4QA 2LR2A 3H1IE 4ZKPA 1NU1D 3TGUE 5KJ7C 2M5AA 1SS1A 4FJVA 3B5NA 1JY3P 5AVYB 3Q5SA 1EZVG 1EXIA 1SQVJ 3RL0D 2FYUG 2HODB 2Y0CA 4H0LD 1Q86Q 5CHXA 1NEKD 3CCLP 1ZW0A 4OH8B 1BGYG 2BEQD 3P4QC 1AVYA 1MFTA 3UIAA 2H89C 1M8OB 1PL5A 1NU1E 1YJWP 1BE3G 5B5EE 4IFFA 1GTWA 2E75D 3AE1D 2P67A 4JF7A 5TISE 2WDVC 2BS3C 1SFCA 3FGAD 3TGUJ 1M56D 5AW6B 3F89A 2QJYB 2ZT9C 1PV3A 1KILD 1RQUA 1PIXA 2A45G 1PGJA 3V2RA 2K88A 1NU1J 4PJ0H 2OGUA 1FZFA 1SQBD 3A2AA 3M9QA 1KILE 3HD7D 1NWQA 2OYHB 2FXOA 5AVQB 3PJSK 1QLED 3HE4A 3H1JG 1SQQK 1SQBE 3OA7A 1ZOYC 1OWAA 1GK4A 3N4XA 5C3JD 1QL2A 1N7SD 3LW5H 1FZBA 1RF0A 2M3EA 1VDFA 3L74D 1LP1A 1IC2A 1D7MA 3WUVA 4DHIB 1EC5A 1L0LD 3AEGC 3SWYA 3P4SC 5KLIC 1E79H 1N86A 1VF5D 3B4SA 1SQBJ 3AEDD 3L71D 2XDJA 4TLFA 4YTPD 1RE4C 5GTIE 2KYVA 3AEFC 3ABVC 2B76D 1L0LE 2M8RA 1PP9D 3VMXA 1EDLA 1Q90D 4YTMC 2PRRA 2WP9D 1G1IA 1YI2P 1LTJB 1KN7A 3L71E 2K3RA 1XTCC 3CWBD 4OVNF 1HBWA 3KXDA 2NPSC 3VONA 1RE3C 1SQXK 3AE7C 2HFED 1PP9E 3RK3B 1X22A 2HR3A 3E7KA 1T2KD 2BEZF 2QEXP 3QWOC 2O1JA 1KQLA 2ACZC 4O9BA 1KB9I 3JSVC 1L0LJ 3CWBE 3BASA 2BS2C 3AE4D 2WS3C 2CPSA 2V4HA 3U59A 2OYIA 2I1JA 1M1JB 2CK3H 2OARA 2E76B 1HWTC 1KILA 1Q7YQ 1GU4A 1SQPD 1GK6A 2O01N 3L35A 2QJPB 1SQQG 5CCHD 4N78D 3CXHH 3GLMA 1OMIA 4H13D 1BDCA 1NKZB 3HD7A 4K35A 1YIJP 4YTND 4GKGA 3VR9D 3HTKA 1SQVK 1K8AQ 1M7LA 4ZMDA 3B5NC 4N78E 1U57A 2OTLP 3H1KE 4OGQC 1N2DC 4YSXC 3SWKA 1N7SA 1DX7A 2KP8A 5L8RJ 1OVUA 4WVZA 3IFMA 1K04A 3CCUP 2N1TB 1JNMA 2PAJA 1SFCC 2YIUB 1L0NE 2A45H 3P4PD 5DJUB 1BCCD 5KAIH 3H1KJ 3H25A 3CPWO 3FWNA 1L4AB 1NU1K 2K9JB 3IF4A 2NPSD 5AW0B 3V2NA 4Z1MH 1AV1A 1ZP0C 3P32A 3TYYA 1ZRTE 1FDIA 2PP6A 4C7RA 1HJBA 4DDIA 2AXCA 1L0NJ 2KIKA 3VOPA 2WSCJ 3SFDC 3USSA 3WU2E 4TT3H 4I2LC 1KTMA 3AE9D 1H0TB 2MJZA 3L75E 1S3JA 3IAOA 3NXSA 3BCCG 1LT9B 2KLUA 1JOCA 1RF0C 1CI6B 2XNXA 2UWJE 2WDRD 2OTKE 5CMZA 3RK2C 5KKZB 1SQBK 2WPRA 4EIJA 4YT0C 1P84I 3MTUE 4WBAA 4WY4B 3L75J 1SQVG 3H1LD 2GUSA 2O3JA 5CCHA 2KS1B 1JB0J 1BDDA 3A0HH 1VQPP 1UIIA 2P10A 1S1CX 2QE7H 3AEBD 1YHQP 3AE3C 1KB9D 3HRNA 2C0WA 4XFJA 2QJKC 3O8ZA 4KT0J 5B66H 3H1LE 1T8ZA 1USEA 5GTHE 4LLHA 3RL0C 2J5UA 3P7KA 3H1IG 2ITAA 1SQXD 2Y0EA 4H0LC 4BRYB 2ZYGA 4CPGA 1NGMB 1NEKC 3KHUA 1N73B 2RMZA 1KB9E 1L0LK 3VRBD 3A5TA 2BS4C 2RH0A 2NRGA 5CBNA 1T6AA 1JY2N 1JY2P 1OW8A 1KYOH 3RBZA 3KPEA 2E75C 1NU1G 5CJ0A 3PP5A 3AE1C 3B8EB 4L74A 3T97A 5AW3B 5AW4B 1YQ4D 3MIWA 3H1LJ 3SFED 2O01J 3H1HD 1PPJD 2OYIC 3VRAD 4HYTB 3KQGA 2KSJA 2YXQB 1KILC 2D2CB 2FXMA 1FOSF 2CPBA 3CXHI 1YQ3D 2JDIH 1VQ5P 1KMIZ 3CC4P 2N9BA 1QGKB 3KZIH 1RQVA 3V5BA 2NPSA 4ZKUA 1GL2D 2POHA 2HODA 2WSFJ 2XKMA 3A0BH 3RK3D 2H7HA 1PPJE 5TJHA 4DOJA 1HF9A 3A7OA 3R2PA 4AYCA 2QG4A 3HD7C 1VQ7P 2YXRB 1MUUA 4RO0A 4LGDE 2K9YA 4GODA 3RK3E 1OVVA 1SQBG 5C3JC 1FZGA 3D6ZA 1N7SC 4YSYD 1NTMD 1OW7A 2AEFA 4M3LA 1VPCA 1NEND 5EFWB 5BU5A 3PTZA 4YXDD 1U7JA 3TGUD 5M1BA 4PD4H 1IFIA 1VF5C 1GU5A 1JEKA 2FBWD 1NTME 3AEDC 2BCCJ 4PJ0E 2OYHA 4D6TE 4YTPC 4R4MA 1A02F 3L74G 2B76C 2L91A 2WP9C 1L0LG 3OJAB 3O6QB 1L0NK 3AE6C 5KAFH 3VMYA 2MKVA 3L71G 3CX5I 1NTMJ 1NHLA 3JC22 1W5CE 4D6TJ 1T2KC 1LWUC 3PH0A 1PP9G 1YTZT 4RESB 3CC2P 2ZFYA 3BATA 4UB6E 1QVFO 5APYA 3MP7B 1P84D 3ZDMA 2WDQD 1S4XA 3BRVB 1E5WA 1CZQA 2KXPB 2Q1KA 3AE4C 1L4AD 3CWBG 2WVRA 1RF1B 1FBMA 5APSA 1FJPA 3RGUA 3CCEP 3LW5J 3CMAP 1S5LH 1LTIC 3F5HA 4RJTA 1P84E 2IBZG 2JR8A 4JYCA 1DEEG 3CCRP 3VTPC 1GL2A 1YBKA 4GOFA 5CCHC 1K9MQ 3GW6A 4U3FD 3W67A 3Q5PA 4H13C 3SSUA 4C46A 2IDBA 4YTNC 3CIRD 3VR9C 1IZNB 2ZJSE 4YPCA 3H6PA 3JCUH 2WQYD 3AEAD 1JM0A 1SQPG 3B5NB 3L73J 1M90Q 4U3FE 2ZVOB 1JMBA 3MHVA 2WPVB 4IL6X 3BVHA 1KFYD 4OGQB 2FYNB 1M1JA 4C7NA 3HE5B 1K73Q 1KZUB 3CXHD 1JCCA 4IFDK 2JP3A 5KLVE 1S2EA 4W7ZA 1G2CA 3E1IA 3P4PC 1SFCB 5APVA 1UIXA 5AVZB 4U3FJ 1MKMA 3CXHE 1GMJA 1AQ5A 1EZVE 2QSIA 3AE6D 3OAKA 2WU2D 3C9IA 4DCKA 2JO1A 2KI7B 3M9BA 4L73A 1NAFA 1ZMEC 5KLVJ 1URQB 1BCCG 4H44D 2K1AA 4I1LA 2J59M 3A3YB 3P8MC 2V7QH 1J1EB 1KC8Q 1SP4A 1KD1Q 1L0VD 4IL6E 1BSNA 3AE9C 4A7PA 2WSEH 1SLQA 1M57D 4IFMA 2ZYAA 2D2CD 2WDRC 4YXWH 1L4AA 3N7NA 3BRTB 2XV5A 1AA0A 2YKOA 4IOIH 3H32B 5AW9B 3H1KD 2Z4EA 1IFNA 2KNCA 2B87A 2OYHC 3CX5D 2W6JH 3GF7A 1H8AA 1T3JA 4I6MC 3CC7P 3AEBC 4HH2A 1H0TA 1L0ND 3VMZA 2E74D 2PFXA 1U7MA 3WUUA 1NTMK 1CI6A 2IYOA 2Q3EA 3CX5E 2QJKB 4KJMA 5AVSB 1GW4A 3H1LG 2G3AA 4EI2A 2WPSA 1FZCB 2RKLA 4H0LB 4PV1B 1J1DC 5AVRB 3H1JJ 3VRBC 2XZRA 3Q5RA 5C39A 1PGOA 1H89A 4GOEA 3S1KA 2YMYA 1ZRTD 1VQ8P 2R5DA 1IJDB 3M06A 3FXEA 4L76A 3GHGA 5E79E 3HUSB 1ZXGA 2E75B 1YQ4C 2M3BA 1SQXG 2AEJA 3SFEC 4HKZH 2HPCB 3CLQA 3VRAC 3L70D 1LTGC 3A0HE 3L75D 1YQ3C 3AE2D 1EDKA 2ZYDA 3WMM0 1GL2C 2Y0DA 3RK3C 2R44A 4BRYA 2P7JA 5B66E 4U7JA 3VP9A 1LWUA 1VQMP 1N73A 3TNUA 5DJTB 3L70E 3H1HG 2I1KA 1JTHB 1PPJG 1HTLC 2KLVA 1X9VA 4NPDA 2FY8A 1USDA 3E1RA 2ZXXA 2KUBA 3HTKB 1FU1A 4DDGA 2E42A 2Q7CA 4DHJA 2IZ0A 2JWDA 2E5TA 2HYNA 1QEXA 3G3ZA 3Q3DA 3AECD 1NTKD 2QIWA 3IN6A 1M1JC 2A06D 4K3AA 2C9LY 4YSYC 1GW3A 1N7SB 3L72D 3MUDA 3L70J 3VR8D 1NENC 4YXDC 2WSCH 3AEED 2O1KA 4XA4A 3D71A 1M1KQ 1OIPA 3EFGA 1N8RQ 2PGDA 1NTKE 3PHLA 2A06E 2IZ1A 2FBWC 2H88D 3L72E 4NPFX 1NTMG 5H2FE 1FE6A 3PRJA 3U1CA 2FFDA 4I6LA 4JYBA 3TGUG 3CCMP 4GT1A 5KLVK 3AE8D 2B9BA 3TDKA 1NTZD 1KV4A 4XE5B 1NTKJ 1HGZA 1OXZA 2ZAEB 2BASA 1KQFB 1FAVA 2OQQA 3L72J 5AW1B 3VN0A 2LKMA 1RY3A 1EXJA 2QM8A 2YIUC 2HG5D 4NPEA 1Y9BA 3KDPB 4DJGA 1NTZE 3M0AA 4PD4E 2WDQC 2ZT9B 3G6EP 1L4AC 1H88A 3MZWB 2KK7A 1EZVI 4WB4A 1YTZI 1NOHA 2W6AA 2FXPA 3O6QA 2BCCD 1GD2E 1IK9A 5C2TD 1DD3A 1URQD 2FKWB 1CSBA 1W2BO 1NTZJ 1T3UA 2AEMA 1L2PA 1NJIQ 3CD6P 2WU5D 1RH5B 1Y8AA 2KZJA 1R5SA 1WT6A 1KFMA 2BCCE 3BCCE 4H13B 3L37A 1NH4A 4L75A 3CIRC 3CI9A 2E76D 1FDOA 3P8CD 1ZR4A 2WQYC 3AEAC 1GDTA 1JY3O 3CCVP 4D6TD 2A45I 1KB9H 4AUWA 1RF1A 3AE5D 1KFYC 1WMKA 1QVGO 1FDMA 2WT7B 4U3FG 1KQGB 1CW5A 5KLIB 1WRGA 3P8CE 2IBZI 3BCCJ 2AXTH 2HLOA 1QX8A 3GHGC 4Y28J 1S5LE 1DH3A 1TFFA 4DZOA 3T97B 2J58A 5KTBA 2L5GB 2IFNA 4I7ZC 2Q3IA 1YITP 1X0TA 1MZ9A 3P4RD 2WU2C 1JY3N 5APUA 2NPSB 1KQSO 4OWFA 1N73C 3JCUE 2N1TD 4PV1D 2QM7A 3VP8A 3HE5A 4H44C 1EDJA 4BXLA 2FYZA 1OZHA 1VQKP 2R3SA 3L73D 3QH9A 3EFFK 1L0VC 4YSZD 4JPZB 3H1IJ 3TSIA 5BVZA 1K05A 1AVOA 1KF6D 3CL3D 2P2UA 1LNQA 3LIDA 1ZV8A 1X8YA 4KX6D 1LT1A 1IFJA 2D2CC 3C1LA 1LTJA 4UB8H 4GIFA 3L73E 3MUDC 1IFPA 2QA4P 1R8EA 4Y99C 1W2EA 1LTSC 4ZNCA 3EWKA 3V6IA 1URQA 3RBXA 3G4SP 1Y47A 2W8ZA 1LTBC 3M0DA 5AVUB 2Y9YA 2R32A 2FFDC 2M5AB 2ZXEB 5KLVD 1VQ6P 1JMMA 4BWNA 2WITA 4WWIA 2WSSH 1NTKK 1EDIA 1KYOI 1NVOA 2E74C 3H1KG 5B5EH 5CJ4A 3CCJP 1HJ0A 1N7LA 5TISH 4WY4D 3V2QA 1EZVD 4LC1A 4UB6H 2FYUD 1FC2C 3H32A 1AJYA 1PGQA 3KYQA 3VMAA 2Z5HA 1J1DB 3M91A 2R3CA 1QL1A 1BGYD 1L0NG 2V7QJ 5AW8B 1HUCA 1YYCA 3L74E 1S72P 3C8VA 3NTNA 1SVFA 5CCGD 1BE3D 5CBOA 3EQ2A 2FYUE 5KJ7D 1VQNP 2WSEJ 1P84H 3FXDA 3FWLA 1LTAC 5AVVB 2GUVA 2C9NY 2YO2A 1BGYE 1NO4A 3CCQP 3AE2C 5APQA 2JWAA 1NTZK 4HB1A 3R4YA 2M0BA 1AQTA 2Z5IA 1JCDA 3P4QD 1BE3E 1Q81Q 2QVAA 2ZVNB 3II6A 2JJLA 2H89D 1HH0A 1FOSE 1GL2B 1FZCA 3G71P 1IK7A 4JBZA 3HE4B 3L74J 2N1TA 2YKPA 1MFZA 1E7PC 2FYUJ 1FJKA 1YJ9P 2WDVD 1ZLLA 2QJYC 3L70G 2G8YA 2IBZD 2LXCB 3L75G 2B88A 2ZT9D 5AW7B 4PD4I 1BGYJ 3HUSA 2XU6A 1RF1C 5K5GB 2K9JA 3H1JD 4RKUJ 3AECC 1LP1B 3L71J 2HPCA 5KAIE 5AW5B 1BE3J 3RK2B 2LXBA 2E43A 2N9YB 2IBZE 4N3YB 1PP9J 4C7NB 1VQLP 3I55P 5GTIH 3VR8C 3TK1A 3CMEP 3Q2YA 2WWWA 3AEEC 3H1JE 3CWBJ 1YJNP 1G2CB 3S4RA 2H88C 1JTHA 1Z56A 4LDTA 5AW2B 1NTKG 2A06G 2QRXA 1RHZB 1ZOYD 3D70A 1AFOA 1LT9A 1NAYA 3L72G 2NZ2A 1OW6A 1SQPE 2W90A 4B86A 1VQ4P 3RL0B 4AQRD 3AE8C 2FYNC 3AEGD 4EDFA 3P4SD 2GA1A 4IL6H 1Q82Q 3S9OA 4WY4A 2P58A 4N6JA 1S9KD 2WMMA 3D6YA 5BU8B 2KS1A 1SQPJ 2K37A 3AEFD 5APWA 3ABVD 4DT0A 2KSEA 1IFMA 2OYIB 1JO5A 1Q2NA 1A02J 2W6BA 4YTMD 1NTZG 1LTJC 5AVTB 5CCGA 1KILB 2Q5UA 1S9KE 4ASWA 5KJ7A 3V4WA 2C0XA 3M9HA 3AE7D 3I5CA 1BCCE 2I8DA 5C2TC 1KYOD 1OFCX 1URQC 3MGNA 1FZEA
chains in the Genus database with same CATH topology
2QSIA 3AEBD 3AE6D 2WU2D 3AE3C 2FXPA 3Q2YA 3B71A 3O6QA 2ACZD 3H25A 3AEEC 4H44B 1NYHA 4PV1D 2BS2C 1AJYA 3AE4D 5C3JC 2JO1A 3GMAA 2WS3C 1DD3A 2WU5C 3D6ZA 3VR8D 5C2TD 4GDOA 1ZOYC 4XFJA 4H44C 2QJKC 4KT0J 1NENC 4YSYD 2G3AA 4YXDC 3LW5J 1VL2A 3AE3D 2YMKA 1OW7A 1ZMEC 4H0LB 2H88C 3G9RA 3AEED 4YSZC 2J5UA 4PV1B 1QLBC 4Z1MH 3D71A 3VRBC 5C3JD 3Q5RA 1ZP0C 2WS3D 2WU5D 1ZRTE 1S5LX 4H0LC 2E76B 1ZOYD 2V7QJ 4H44D 1NEND 1FDIA 3D70A 2FBWC 4YXDD 1TU3F 1NGMB 3Q5SA 1L0VC 1EXIA 1KF6C 1NEKC 2H88D 3C8VA 2E76C 4YSZD 5M1BA 2NZ2A 3VRBD 4KX6C 1OW6A 4H13B 1ZP0D 2BS4C 4H0LD 1K05A 1VF5C 2WSEJ 2WSCJ 3CIRC 3Q5PA 2FBWD 3SFDC 1L0VD 4H13C 3AE9C 1KF6D 1NEKD 2E75B 2E76D 3AEDC 1OW8A 1YQ4C 1FDOA 3AEGC 2BEQD 3AE5C 5KLIC 3AE8C 4TT3H 3P4SC 3SFEC 2D2CC 3P4QC 2WQYC 2QJPC 3AEAC 1VF5D 2FYNC 2E75C 2H89C 2IDBA 3GLMA 4YTPC 3CIRD 4YTNC 1OMIA 1PL5A 3AE1C 3VR9C 3AE2C 3SFDD 3VRAC 4H13D 1DIPA 4R4MA 1KTMA 3AE9D 3RL0g 3R4YA 3Q1MA 1R8EA 3AEDD 1YQ4D 3AEGD 3AE5D 3P4SD 3AE8D 3P4QD 2B76C 3SFED 2D2CD 1KORA 2WQYD 2O01J 3AEAD 1KFYC 3IAOA 1WMKA 1VF5B 2WDRC 2E75D 2H89D 1YQ3C 4YTPD 3S9OA 4YTND 3VR9D 3AE1D 3VRAD 1KQGB 3EWKA 3AE2D 3AEFC 2WPVB 2WDVC 2BS3C 3FGAD 1DD4A 1IK7A 4IL6X 2WP9C 3ABVC 2B76D 1KQFB 2D2CB 3D6YA 1KFYD 2WDRD 4OGQB 1YQ3D 1U57A 2OQQA 1KMIZ 3AE6C 2ZT9C 1Q90D 4YTMC 1E7PC 3AEFD 4U7JA 2WDVD 1PV3A 1RQVA 4OGQC 4Y28J 2WP9D 2QJYC 3ABVD 4R4LA 2MKVA 2G8YA 4YSXC 1EXJA 1RQUA 2YIUC 2WSFJ 3T97B 1PIXA 2ZT9D 4I7ZB 4YTMD 5KKZC 1Y9BA 2JP3A 4OGQD 5L8RJ 1HF9A 4KX6D 4I7ZC 3P4RC 4YT0C 4YSXD 3AE7C 3GF7A 4RKUJ 2WDQC 3AECC 2E74B 2ZT9B 3P4PC 1K04A 1UIXA 2BEZF 2E74C 3AEBC 3P4RD 4YT0D 2WU2C 3GF3A 3AE7D 2ACZC 1KILE 1MKMA 3Q3DA 2WDQD 3AECD 1JB0J 4PV1C 2K9YA 3P4PD 1HJ0A 1GMJA 3AE4C 2QIWA 3IN6A 2P10A 1S1CX 3RK3E 5C2TC 3VR8C 4YSYC 2E74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEB D;  3AE6 D;  2WU2 D;  3AE3 C;  3B71 A;  2ACZ D;  3AEE C;  2BS2 C;  3AE4 D;  5C3J C;  2WU5 C;  2WS3 C;  5C2T D;  3VR8 D;  1ZOY C;  1NEN C;  4YSY D;  2G3A A;  4YXD C;  3AE3 D;  1OW7 A;  2H88 C;  3AEE D;  4YSZ C;  1QLB C;  3VRB C;  5C3J D;  2WU5 D;  1ZP0 C;  2WS3 D;  1ZOY D;  1NEN D;  2FBW C;  4YXD D;  1L0V C;  1KF6 C;  2H88 D;  1NEK C;  4YSZ D;  3VRB D;  4KX6 C;  1OW6 A;  1ZP0 D;  2BS4 C;  1K05 A;  3CIR C;  2FBW D;  3SFD C;  1L0V D;  3AE9 C;  1KF6 D;  1NEK D;  3AED C;  1OW8 A;  1YQ4 C;  3AEG C;  3AE5 C;  3P4S C;  3AE8 C;  3P4Q C;  4KX6 D;  3SFE C;  2WQY C;  3AEA C;  2H89 C;  4YTP C;  4YTN C;  3CIR D;  3VR9 C;  3AE1 C;  3VRA C;  3AE2 C;  3SFD D;  1KTM A;  3AE9 D;  3AED D;  1YQ4 D;  3AEG D;  3AE5 D;  3P4S D;  3AE8 D;  3P4Q D;  2B76 C;  3SFE D;  2WQY D;  3AEA D;  1KFY C;  2WDR C;  2H89 D;  4YTP D;  1YQ3 C;  3S9O A;  4YTN D;  3VR9 D;  3AE1 D;  3VRA D;  3AE2 D;  3AEF C;  2WDV C;  2BS3 C;  2WP9 C;  3ABV C;  2B76 D;  1KFY D;  2WDR D;  1YQ3 D;  3AE6 C;  4YTM C;  1E7P C;  3AEF D;  2WDV D;  1PV3 A;  2WP9 D;  3ABV D;  4YSX C;  4YTM D;  3P4R C;  4YT0 C;  4YSX D;  3AE7 C;  2WDQ C;  3AEC C;  3P4P C;  1K04 A;  3AEB C;  3P4R D;  4YT0 D;  2WU2 C;  3AE7 D;  2ACZ C;  2WDQ D;  3AEC D;  3P4P D;  3AE4 C;  5C2T C;  3VR8 C;  4YSY C; 
#chains in the Genus database with same CATH topology
 4EYY Q;  2KNC B;  2OTJ P;  2ACZ D;  2B87 B;  3HD7 B;  2KOG A;  1EQ7 A;  3M0D C;  2WU5 C;  1J1E C;  4GDO A;  1OX3 A;  2B89 A;  2IYP A;  1SQQ D;  2H8P D;  2WTY A;  1OVR A;  3NFQ A;  2WS3 D;  3I56 P;  2H43 A;  1KYO E;  3CX5 H;  2BCC G;  2E76 C;  1HGV A;  2W83 C;  3IR9 A;  1BCC J;  4W7Y A;  2ZFC A;  1SQQ E;  3AE5 C;  3K5B A;  1ZR2 A;  2QJP C;  1FS0 E;  1G1J A;  1LJ2 A;  3KZI E;  1KOR A;  5E79 H;  1JY2 O;  1VF5 B;  2DW3 A;  2JEE A;  1BSH A;  1KFN A;  3A0B E;  2JKV A;  3GHG B;  2IPP A;  1MV8 A;  2IX7 C;  2KB7 P;  4D6T G;  4MN4 C;  3GG2 A;  1X79 B;  1HVV A;  5APT A;  4R4L A;  3B5N D;  3LIE A;  2E5Y A;  1LTT C;  4EOT A;  2OYO A;  1SQQ J;  4I7Z B;  2WZ7 A;  1JUN A;  4OGQ D;  1PGP A;  5AVX B;  3P4R C;  4YSX D;  3WU2 H;  1J2J B;  4PD4 D;  3GF3 A;  2R5B A;  1FZC C;  2N1T C;  4PV1 C;  2FYU K;  1FZA A;  2WT7 A;  1LWU B;  2GM4 A;  3TNU B;  1SFC D;  3WUT A;  4H44 B;  1NYH A;  4QMA A;  2Q9I A;  3GMA A;  3ITK A;  3VYI A;  3L36 A;  1R5L A;  2YMK A;  3PLN A;  1PZQ A;  3HUS C;  1SQX E;  3G9R A;  4YSZ C;  1QLB C;  1RE4 A;  1S5L X;  2AXT E;  1TU3 F;  1KF6 C;  3U1A A;  4KX6 C;  1ZP0 D;  3BCC D;  3CCS P;  4HJG H;  1GZL A;  3TF5 A;  3OW2 O;  2WPQ A;  2Y9Z A;  3L73 G;  4Y99 B;  2VRS A;  3SFD D;  1DIP A;  3RL0 g;  3Q1M A;  1RE3 A;  2YO3 A;  4W80 A;  5KAF E;  3H1H E;  1SQX J;  5H2F H;  1IO4 A;  2RN0 A;  1DD4 A;  2O01 H;  1DEB A;  5GTH H;  3L4F A;  5APX A;  1LT9 C;  1NKN A;  1SQV D;  4DHZ A;  2XND H;  1VQO P;  2FFD B;  1PFI A;  5KKZ C;  2W27 A;  4JQ0 D;  3RK2 D;  1LGH B;  4KHX A;  2WSF H;  3W68 A;  2E74 B;  3H1H J;  2P1J A;  1XTG B;  1VQ9 P;  2YNY A;  1SQV E;  2SPZ A;  4WY4 C;  4YT0 D;  2Q6Q A;  3H1I D;  1SQP K;  4UB8 E;  1ZN5 A;  3V2P A;  5AVW B;  3FX0 A;  1IFD A;  3B71 A;  3NMD A;  4ASV A;  3SWF A;  5KLV G;  1VL2 A;  3AE3 D;  2KZI A;  2YKQ A;  3MD0 A;  2IFM A;  5CCG C;  3V4Q A;  2LR2 A;  3H1I E;  4ZKP A;  1NU1 D;  3TGU E;  5KJ7 C;  2M5A A;  1SS1 A;  4FJV A;  3B5N A;  1JY3 P;  5AVY B;  3Q5S A;  1EZV G;  1EXI A;  1SQV J;  3RL0 D;  2FYU G;  2HOD B;  2Y0C A;  4H0L D;  1Q86 Q;  5CHX A;  1NEK D;  3CCL P;  1ZW0 A;  4OH8 B;  1BGY G;  2BEQ D;  3P4Q C;  1AVY A;  1MFT A;  3UIA A;  2H89 C;  1M8O B;  1PL5 A;  1NU1 E;  1YJW P;  1BE3 G;  5B5E E;  4IFF A;  1GTW A;  2E75 D;  3AE1 D;  2P67 A;  4JF7 A;  5TIS E;  2WDV C;  2BS3 C;  1SFC A;  3FGA D;  3TGU J;  1M56 D;  5AW6 B;  3F89 A;  2QJY B;  2ZT9 C;  1PV3 A;  1KIL D;  1RQU A;  1PIX A;  2A45 G;  1PGJ A;  3V2R A;  2K88 A;  1NU1 J;  4PJ0 H;  2OGU A;  1FZF A;  1SQB D;  3A2A A;  3M9Q A;  1KIL E;  3HD7 D;  1NWQ A;  2OYH B;  2FXO A;  5AVQ B;  3PJS K;  1QLE D;  3HE4 A;  3H1J G;  1SQQ K;  1SQB E;  3OA7 A;  1ZOY C;  1OWA A;  1GK4 A;  3N4X A;  5C3J D;  1QL2 A;  1N7S D;  3LW5 H;  1FZB A;  1RF0 A;  2M3E A;  1VDF A;  3L74 D;  1LP1 A;  1IC2 A;  1D7M A;  3WUV A;  4DHI B;  1EC5 A;  1L0L D;  3AEG C;  3SWY A;  3P4S C;  5KLI C;  1E79 H;  1N86 A;  1VF5 D;  3B4S A;  1SQB J;  3AED D;  3L71 D;  2XDJ A;  4TLF A;  4YTP D;  1RE4 C;  5GTI E;  2KYV A;  3AEF C;  3ABV C;  2B76 D;  1L0L E;  2M8R A;  1PP9 D;  3VMX A;  1EDL A;  1Q90 D;  4YTM C;  2PRR A;  2WP9 D;  1G1I A;  1YI2 P;  1LTJ B;  1KN7 A;  3L71 E;  2K3R A;  1XTC C;  3CWB D;  4OVN F;  1HBW A;  3KXD A;  2NPS C;  3VON A;  1RE3 C;  1SQX K;  3AE7 C;  2HFE D;  1PP9 E;  3RK3 B;  1X22 A;  2HR3 A;  3E7K A;  1T2K D;  2BEZ F;  2QEX P;  3QWO C;  2O1J A;  1KQL A;  2ACZ C;  4O9B A;  1KB9 I;  3JSV C;  1L0L J;  3CWB E;  3BAS A;  2BS2 C;  3AE4 D;  2WS3 C;  2CPS A;  2V4H A;  3U59 A;  2OYI A;  2I1J A;  1M1J B;  2CK3 H;  2OAR A;  2E76 B;  1HWT C;  1KIL A;  1Q7Y Q;  1GU4 A;  1SQP D;  1GK6 A;  2O01 N;  3L35 A;  2QJP B;  1SQQ G;  5CCH D;  4N78 D;  3CXH H;  3GLM A;  1OMI A;  4H13 D;  1BDC A;  1NKZ B;  3HD7 A;  4K35 A;  1YIJ P;  4YTN D;  4GKG A;  3VR9 D;  3HTK A;  1SQV K;  1K8A Q;  1M7L A;  4ZMD A;  3B5N C;  4N78 E;  1U57 A;  2OTL P;  3H1K E;  4OGQ C;  1N2D C;  4YSX C;  3SWK A;  1N7S A;  1DX7 A;  2KP8 A;  5L8R J;  1OVU A;  4WVZ A;  3IFM A;  1K04 A;  3CCU P;  2N1T B;  1JNM A;  2PAJ A;  1SFC C;  2YIU B;  1L0N E;  2A45 H;  3P4P D;  5DJU B;  1BCC D;  5KAI H;  3H1K J;  3H25 A;  3CPW O;  3FWN A;  1L4A B;  1NU1 K;  2K9J B;  3IF4 A;  2NPS D;  5AW0 B;  3V2N A;  4Z1M H;  1AV1 A;  1ZP0 C;  3P32 A;  3TYY A;  1ZRT E;  1FDI A;  2PP6 A;  4C7R A;  1HJB A;  4DDI A;  2AXC A;  1L0N J;  2KIK A;  3VOP A;  2WSC J;  3SFD C;  3USS A;  3WU2 E;  4TT3 H;  4I2L C;  1KTM A;  3AE9 D;  1H0T B;  2MJZ A;  3L75 E;  1S3J A;  3IAO A;  3NXS A;  3BCC G;  1LT9 B;  2KLU A;  1JOC A;  1RF0 C;  1CI6 B;  2XNX A;  2UWJ E;  2WDR D;  2OTK E;  5CMZ A;  3RK2 C;  5KKZ B;  1SQB K;  2WPR A;  4EIJ A;  4YT0 C;  1P84 I;  3MTU E;  4WBA A;  4WY4 B;  3L75 J;  1SQV G;  3H1L D;  2GUS A;  2O3J A;  5CCH A;  2KS1 B;  1JB0 J;  1BDD A;  3A0H H;  1VQP P;  1UII A;  2P10 A;  1S1C X;  2QE7 H;  3AEB D;  1YHQ P;  3AE3 C;  1KB9 D;  3HRN A;  2C0W A;  4XFJ A;  2QJK C;  3O8Z A;  4KT0 J;  5B66 H;  3H1L E;  1T8Z A;  1USE A;  5GTH E;  4LLH A;  3RL0 C;  2J5U A;  3P7K A;  3H1I G;  2ITA A;  1SQX D;  2Y0E A;  4H0L C;  4BRY B;  2ZYG A;  4CPG A;  1NGM B;  1NEK C;  3KHU A;  1N73 B;  2RMZ A;  1KB9 E;  1L0L K;  3VRB D;  3A5T A;  2BS4 C;  2RH0 A;  2NRG A;  5CBN A;  1T6A A;  1JY2 N;  1JY2 P;  1OW8 A;  1KYO H;  3RBZ A;  3KPE A;  2E75 C;  1NU1 G;  5CJ0 A;  3PP5 A;  3AE1 C;  3B8E B;  4L74 A;  3T97 A;  5AW3 B;  5AW4 B;  1YQ4 D;  3MIW A;  3H1L J;  3SFE D;  2O01 J;  3H1H D;  1PPJ D;  2OYI C;  3VRA D;  4HYT B;  3KQG A;  2KSJ A;  2YXQ B;  1KIL C;  2D2C B;  2FXM A;  1FOS F;  2CPB A;  3CXH I;  1YQ3 D;  2JDI H;  1VQ5 P;  1KMI Z;  3CC4 P;  2N9B A;  1QGK B;  3KZI H;  1RQV A;  3V5B A;  2NPS A;  4ZKU A;  1GL2 D;  2POH A;  2HOD A;  2WSF J;  2XKM A;  3A0B H;  3RK3 D;  2H7H A;  1PPJ E;  5TJH A;  4DOJ A;  1HF9 A;  3A7O A;  3R2P A;  4AYC A;  2QG4 A;  3HD7 C;  1VQ7 P;  2YXR B;  1MUU A;  4RO0 A;  4LGD E;  2K9Y A;  4GOD A;  3RK3 E;  1OVV A;  1SQB G;  5C3J C;  1FZG A;  3D6Z A;  1N7S C;  4YSY D;  1NTM D;  1OW7 A;  2AEF A;  4M3L A;  1VPC A;  1NEN D;  5EFW B;  5BU5 A;  3PTZ A;  4YXD D;  1U7J A;  3TGU D;  5M1B A;  4PD4 H;  1IFI A;  1VF5 C;  1GU5 A;  1JEK A;  2FBW D;  1NTM E;  3AED C;  2BCC J;  4PJ0 E;  2OYH A;  4D6T E;  4YTP C;  4R4M A;  1A02 F;  3L74 G;  2B76 C;  2L91 A;  2WP9 C;  1L0L G;  3OJA B;  3O6Q B;  1L0N K;  3AE6 C;  5KAF H;  3VMY A;  2MKV A;  3L71 G;  3CX5 I;  1NTM J;  1NHL A;  3JC2 2;  1W5C E;  4D6T J;  1T2K C;  1LWU C;  3PH0 A;  1PP9 G;  1YTZ T;  4RES B;  3CC2 P;  2ZFY A;  3BAT A;  4UB6 E;  1QVF O;  5APY A;  3MP7 B;  1P84 D;  3ZDM A;  2WDQ D;  1S4X A;  3BRV B;  1E5W A;  1CZQ A;  2KXP B;  2Q1K A;  3AE4 C;  1L4A D;  3CWB G;  2WVR A;  1RF1 B;  1FBM A;  5APS A;  1FJP A;  3RGU A;  3CCE P;  3LW5 J;  3CMA P;  1S5L H;  1LTI C;  3F5H A;  4RJT A;  1P84 E;  2IBZ G;  2JR8 A;  4JYC A;  1DEE G;  3CCR P;  3VTP C;  1GL2 A;  1YBK A;  4GOF A;  5CCH C;  1K9M Q;  3GW6 A;  4U3F D;  3W67 A;  3Q5P A;  4H13 C;  3SSU A;  4C46 A;  2IDB A;  4YTN C;  3CIR D;  3VR9 C;  1IZN B;  2ZJS E;  4YPC A;  3H6P A;  3JCU H;  2WQY D;  3AEA D;  1JM0 A;  1SQP G;  3B5N B;  3L73 J;  1M90 Q;  4U3F E;  2ZVO B;  1JMB A;  3MHV A;  2WPV B;  4IL6 X;  3BVH A;  1KFY D;  4OGQ B;  2FYN B;  1M1J A;  4C7N A;  3HE5 B;  1K73 Q;  1KZU B;  3CXH D;  1JCC A;  4IFD K;  2JP3 A;  5KLV E;  1S2E A;  4W7Z A;  1G2C A;  3E1I A;  3P4P C;  1SFC B;  5APV A;  1UIX A;  5AVZ B;  4U3F J;  1MKM A;  3CXH E;  1GMJ A;  1AQ5 A;  1EZV E;  2QSI A;  3AE6 D;  3OAK A;  2WU2 D;  3C9I A;  4DCK A;  2JO1 A;  2KI7 B;  3M9B A;  4L73 A;  1NAF A;  1ZME C;  5KLV J;  1URQ B;  1BCC G;  4H44 D;  2K1A A;  4I1L A;  2J59 M;  3A3Y B;  3P8M C;  2V7Q H;  1J1E B;  1KC8 Q;  1SP4 A;  1KD1 Q;  1L0V D;  4IL6 E;  1BSN A;  3AE9 C;  4A7P A;  2WSE H;  1SLQ A;  1M57 D;  4IFM A;  2ZYA A;  2D2C D;  2WDR C;  4YXW H;  1L4A A;  3N7N A;  3BRT B;  2XV5 A;  1AA0 A;  2YKO A;  4IOI H;  3H32 B;  5AW9 B;  3H1K D;  2Z4E A;  1IFN A;  2KNC A;  2B87 A;  2OYH C;  3CX5 D;  2W6J H;  3GF7 A;  1H8A A;  1T3J A;  4I6M C;  3CC7 P;  3AEB C;  4HH2 A;  1H0T A;  1L0N D;  3VMZ A;  2E74 D;  2PFX A;  1U7M A;  3WUU A;  1NTM K;  1CI6 A;  2IYO A;  2Q3E A;  3CX5 E;  2QJK B;  4KJM A;  5AVS B;  1GW4 A;  3H1L G;  2G3A A;  4EI2 A;  2WPS A;  1FZC B;  2RKL A;  4H0L B;  4PV1 B;  1J1D C;  5AVR B;  3H1J J;  3VRB C;  2XZR A;  3Q5R A;  5C39 A;  1PGO A;  1H89 A;  4GOE A;  3S1K A;  2YMY A;  1ZRT D;  1VQ8 P;  2R5D A;  1IJD B;  3M06 A;  3FXE A;  4L76 A;  3GHG A;  5E79 E;  3HUS B;  1ZXG A;  2E75 B;  1YQ4 C;  2M3B A;  1SQX G;  2AEJ A;  3SFE C;  4HKZ H;  2HPC B;  3CLQ A;  3VRA C;  3L70 D;  1LTG C;  3A0H E;  3L75 D;  1YQ3 C;  3AE2 D;  1EDK A;  2ZYD A;  3WMM 0;  1GL2 C;  2Y0D A;  3RK3 C;  2R44 A;  4BRY A;  2P7J A;  5B66 E;  4U7J A;  3VP9 A;  1LWU A;  1VQM P;  1N73 A;  3TNU A;  5DJT B;  3L70 E;  3H1H G;  2I1K A;  1JTH B;  1PPJ G;  1HTL C;  2KLV A;  1X9V A;  4NPD A;  2FY8 A;  1USD A;  3E1R A;  2ZXX A;  2KUB A;  3HTK B;  1FU1 A;  4DDG A;  2E42 A;  2Q7C A;  4DHJ A;  2IZ0 A;  2JWD A;  2E5T A;  2HYN A;  1QEX A;  3G3Z A;  3Q3D A;  3AEC D;  1NTK D;  2QIW A;  3IN6 A;  1M1J C;  2A06 D;  4K3A A;  2C9L Y;  4YSY C;  1GW3 A;  1N7S B;  3L72 D;  3MUD A;  3L70 J;  3VR8 D;  1NEN C;  4YXD C;  2WSC H;  3AEE D;  2O1K A;  4XA4 A;  3D71 A;  1M1K Q;  1OIP A;  3EFG A;  1N8R Q;  2PGD A;  1NTK E;  3PHL A;  2A06 E;  2IZ1 A;  2FBW C;  2H88 D;  3L72 E;  4NPF X;  1NTM G;  5H2F E;  1FE6 A;  3PRJ A;  3U1C A;  2FFD A;  4I6L A;  4JYB A;  3TGU G;  3CCM P;  4GT1 A;  5KLV K;  3AE8 D;  2B9B A;  3TDK A;  1NTZ D;  1KV4 A;  4XE5 B;  1NTK J;  1HGZ A;  1OXZ A;  2ZAE B;  2BAS A;  1KQF B;  1FAV A;  2OQQ A;  3L72 J;  5AW1 B;  3VN0 A;  2LKM A;  1RY3 A;  1EXJ A;  2QM8 A;  2YIU C;  2HG5 D;  4NPE A;  1Y9B A;  3KDP B;  4DJG A;  1NTZ E;  3M0A A;  4PD4 E;  2WDQ C;  2ZT9 B;  3G6E P;  1L4A C;  1H88 A;  3MZW B;  2KK7 A;  1EZV I;  4WB4 A;  1YTZ I;  1NOH A;  2W6A A;  2FXP A;  3O6Q A;  2BCC D;  1GD2 E;  1IK9 A;  5C2T D;  1DD3 A;  1URQ D;  2FKW B;  1CSB A;  1W2B O;  1NTZ J;  1T3U A;  2AEM A;  1L2P A;  1NJI Q;  3CD6 P;  2WU5 D;  1RH5 B;  1Y8A A;  2KZJ A;  1R5S A;  1WT6 A;  1KFM A;  2BCC E;  3BCC E;  4H13 B;  3L37 A;  1NH4 A;  4L75 A;  3CIR C;  3CI9 A;  2E76 D;  1FDO A;  3P8C D;  1ZR4 A;  2WQY C;  3AEA C;  1GDT A;  1JY3 O;  3CCV P;  4D6T D;  2A45 I;  1KB9 H;  4AUW A;  1RF1 A;  3AE5 D;  1KFY C;  1WMK A;  1QVG O;  1FDM A;  2WT7 B;  4U3F G;  1KQG B;  1CW5 A;  5KLI B;  1WRG A;  3P8C E;  2IBZ I;  3BCC J;  2AXT H;  2HLO A;  1QX8 A;  3GHG C;  4Y28 J;  1S5L E;  1DH3 A;  1TFF A;  4DZO A;  3T97 B;  2J58 A;  5KTB A;  2L5G B;  2IFN A;  4I7Z C;  2Q3I A;  1YIT P;  1X0T A;  1MZ9 A;  3P4R D;  2WU2 C;  1JY3 N;  5APU A;  2NPS B;  1KQS O;  4OWF A;  1N73 C;  3JCU E;  2N1T D;  4PV1 D;  2QM7 A;  3VP8 A;  3HE5 A;  4H44 C;  1EDJ A;  4BXL A;  2FYZ A;  1OZH A;  1VQK P;  2R3S A;  3L73 D;  3QH9 A;  3EFF K;  1L0V C;  4YSZ D;  4JPZ B;  3H1I J;  3TSI A;  5BVZ A;  1K05 A;  1AVO A;  1KF6 D;  3CL3 D;  2P2U A;  1LNQ A;  3LID A;  1ZV8 A;  1X8Y A;  4KX6 D;  1LT1 A;  1IFJ A;  2D2C C;  3C1L A;  1LTJ A;  4UB8 H;  4GIF A;  3L73 E;  3MUD C;  1IFP A;  2QA4 P;  1R8E A;  4Y99 C;  1W2E A;  1LTS C;  4ZNC A;  3EWK A;  3V6I A;  1URQ A;  3RBX A;  3G4S P;  1Y47 A;  2W8Z A;  1LTB C;  3M0D A;  5AVU B;  2Y9Y A;  2R32 A;  2FFD C;  2M5A B;  2ZXE B;  5KLV D;  1VQ6 P;  1JMM A;  4BWN A;  2WIT A;  4WWI A;  2WSS H;  1NTK K;  1EDI A;  1KYO I;  1NVO A;  2E74 C;  3H1K G;  5B5E H;  5CJ4 A;  3CCJ P;  1HJ0 A;  1N7L A;  5TIS H;  4WY4 D;  3V2Q A;  1EZV D;  4LC1 A;  4UB6 H;  2FYU D;  1FC2 C;  3H32 A;  1AJY A;  1PGQ A;  3KYQ A;  3VMA A;  2Z5H A;  1J1D B;  3M91 A;  2R3C A;  1QL1 A;  1BGY D;  1L0N G;  2V7Q J;  5AW8 B;  1HUC A;  1YYC A;  3L74 E;  1S72 P;  3C8V A;  3NTN A;  1SVF A;  5CCG D;  1BE3 D;  5CBO A;  3EQ2 A;  2FYU E;  5KJ7 D;  1VQN P;  2WSE J;  1P84 H;  3FXD A;  3FWL A;  1LTA C;  5AVV B;  2GUV A;  2C9N Y;  2YO2 A;  1BGY E;  1NO4 A;  3CCQ P;  3AE2 C;  5APQ A;  2JWA A;  1NTZ K;  4HB1 A;  3R4Y A;  2M0B A;  1AQT A;  2Z5I A;  1JCD A;  3P4Q D;  1BE3 E;  1Q81 Q;  2QVA A;  2ZVN B;  3II6 A;  2JJL A;  2H89 D;  1HH0 A;  1FOS E;  1GL2 B;  1FZC A;  3G71 P;  1IK7 A;  4JBZ A;  3HE4 B;  3L74 J;  2N1T A;  2YKP A;  1MFZ A;  1E7P C;  2FYU J;  1FJK A;  1YJ9 P;  2WDV D;  1ZLL A;  2QJY C;  3L70 G;  2G8Y A;  2IBZ D;  2LXC B;  3L75 G;  2B88 A;  2ZT9 D;  5AW7 B;  4PD4 I;  1BGY J;  3HUS A;  2XU6 A;  1RF1 C;  5K5G B;  2K9J A;  3H1J D;  4RKU J;  3AEC C;  1LP1 B;  3L71 J;  2HPC A;  5KAI E;  5AW5 B;  1BE3 J;  3RK2 B;  2LXB A;  2E43 A;  2N9Y B;  2IBZ E;  4N3Y B;  1PP9 J;  4C7N B;  1VQL P;  3I55 P;  5GTI H;  3VR8 C;  3TK1 A;  3CME P;  3Q2Y A;  2WWW A;  3AEE C;  3H1J E;  3CWB J;  1YJN P;  1G2C B;  3S4R A;  2H88 C;  1JTH A;  1Z56 A;  4LDT A;  5AW2 B;  1NTK G;  2A06 G;  2QRX A;  1RHZ B;  1ZOY D;  3D70 A;  1AFO A;  1LT9 A;  1NAY A;  3L72 G;  2NZ2 A;  1OW6 A;  1SQP E;  2W90 A;  4B86 A;  1VQ4 P;  3RL0 B;  4AQR D;  3AE8 C;  2FYN C;  3AEG D;  4EDF A;  3P4S D;  2GA1 A;  4IL6 H;  1Q82 Q;  3S9O A;  4WY4 A;  2P58 A;  4N6J A;  1S9K D;  2WMM A;  3D6Y A;  5BU8 B;  2KS1 A;  1SQP J;  2K37 A;  3AEF D;  5APW A;  3ABV D;  4DT0 A;  2KSE A;  1IFM A;  2OYI B;  1JO5 A;  1Q2N A;  1A02 J;  2W6B A;  4YTM D;  1NTZ G;  1LTJ C;  5AVT B;  5CCG A;  1KIL B;  2Q5U A;  1S9K E;  4ASW A;  5KJ7 A;  3V4W A;  2C0X A;  3M9H A;  3AE7 D;  3I5C A;  1BCC E;  2I8D A;  5C2T C;  1KYO D;  1OFC X;  1URQ C;  3MGN A;  1FZE A; 
#chains in the Genus database with same CATH homology
 2QSI A;  3AEB D;  3AE6 D;  2WU2 D;  3AE3 C;  2FXP A;  3Q2Y A;  3B71 A;  3O6Q A;  2ACZ D;  3H25 A;  3AEE C;  4H44 B;  1NYH A;  4PV1 D;  2BS2 C;  1AJY A;  3AE4 D;  5C3J C;  2JO1 A;  3GMA A;  2WS3 C;  1DD3 A;  2WU5 C;  3D6Z A;  3VR8 D;  5C2T D;  4GDO A;  1ZOY C;  4XFJ A;  4H44 C;  2QJK C;  4KT0 J;  1NEN C;  4YSY D;  2G3A A;  4YXD C;  3LW5 J;  1VL2 A;  3AE3 D;  2YMK A;  1OW7 A;  1ZME C;  4H0L B;  2H88 C;  3G9R A;  3AEE D;  4YSZ C;  2J5U A;  4PV1 B;  1QLB C;  4Z1M H;  3D71 A;  3VRB C;  5C3J D;  3Q5R A;  1ZP0 C;  2WS3 D;  2WU5 D;  1ZRT E;  1S5L X;  4H0L C;  2E76 B;  1ZOY D;  2V7Q J;  4H44 D;  1NEN D;  1FDI A;  3D70 A;  2FBW C;  4YXD D;  1TU3 F;  1NGM B;  3Q5S A;  1L0V C;  1EXI A;  1KF6 C;  1NEK C;  2H88 D;  3C8V A;  2E76 C;  4YSZ D;  5M1B A;  2NZ2 A;  3VRB D;  4KX6 C;  1OW6 A;  4H13 B;  1ZP0 D;  2BS4 C;  4H0L D;  1K05 A;  1VF5 C;  2WSE J;  2WSC J;  3CIR C;  3Q5P A;  2FBW D;  3SFD C;  1L0V D;  4H13 C;  3AE9 C;  1KF6 D;  1NEK D;  2E75 B;  2E76 D;  3AED C;  1OW8 A;  1YQ4 C;  1FDO A;  3AEG C;  2BEQ D;  3AE5 C;  5KLI C;  3AE8 C;  4TT3 H;  3P4S C;  3SFE C;  2D2C C;  3P4Q C;  2WQY C;  2QJP C;  3AEA C;  1VF5 D;  2FYN C;  2E75 C;  2H89 C;  2IDB A;  3GLM A;  4YTP C;  3CIR D;  4YTN C;  1OMI A;  1PL5 A;  3AE1 C;  3VR9 C;  3AE2 C;  3SFD D;  3VRA C;  4H13 D;  1DIP A;  4R4M A;  1KTM A;  3AE9 D;  3RL0 g;  3R4Y A;  3Q1M A;  1R8E A;  3AED D;  1YQ4 D;  3AEG D;  3AE5 D;  3P4S D;  3AE8 D;  3P4Q D;  2B76 C;  3SFE D;  2D2C D;  1KOR A;  2WQY D;  2O01 J;  3AEA D;  1KFY C;  3IAO A;  1WMK A;  1VF5 B;  2WDR C;  2E75 D;  2H89 D;  1YQ3 C;  4YTP D;  3S9O A;  4YTN D;  3VR9 D;  3AE1 D;  3VRA D;  1KQG B;  3EWK A;  3AE2 D;  3AEF C;  2WPV B;  2WDV C;  2BS3 C;  3FGA D;  1DD4 A;  1IK7 A;  4IL6 X;  2WP9 C;  3ABV C;  2B76 D;  1KQF B;  2D2C B;  3D6Y A;  1KFY D;  2WDR D;  4OGQ B;  1YQ3 D;  1U57 A;  2OQQ A;  1KMI Z;  3AE6 C;  2ZT9 C;  1Q90 D;  4YTM C;  1E7P C;  3AEF D;  4U7J A;  2WDV D;  1PV3 A;  1RQV A;  4OGQ C;  4Y28 J;  2WP9 D;  2QJY C;  3ABV D;  4R4L A;  2MKV A;  2G8Y A;  4YSX C;  1EXJ A;  1RQU A;  2YIU C;  2WSF J;  3T97 B;  1PIX A;  2ZT9 D;  4I7Z B;  4YTM D;  5KKZ C;  1Y9B A;  2JP3 A;  4OGQ D;  5L8R J;  1HF9 A;  4KX6 D;  4I7Z C;  3P4R C;  4YT0 C;  4YSX D;  3AE7 C;  3GF7 A;  4RKU J;  2WDQ C;  3AEC C;  2E74 B;  2ZT9 B;  3P4P C;  1K04 A;  1UIX A;  2BEZ F;  2E74 C;  3AEB C;  3P4R D;  4YT0 D;  2WU2 C;  3GF3 A;  3AE7 D;  2ACZ C;  1KIL E;  1MKM A;  3Q3D A;  2WDQ D;  3AEC D;  1JB0 J;  4PV1 C;  2K9Y A;  3P4P D;  1HJ0 A;  1GMJ A;  3AE4 C;  2QIW A;  3IN6 A;  2P10 A;  1S1C X;  3RK3 E;  5C2T C;  3VR8 C;  4YSY C;  2E74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...