3AECC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aecC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aecC02
4YSYC 4YTPC 2WDQD 3SFEC 2WP9C 1YQ4C 2ACZC 4KX6C 3VR8D 3AE6C 2WQYC 4YTND 3AE3C 3AEGC 1YQ3D 5C2TC 4YSZD 3AEFD 3P4RD 2WS3C 1KFYD 2WDVD 3VR9C 2H88C 3ABVC 3AEEC 2FBWD 2WDRC 3AE5D 3SFDC 3VRBD 3AE2C 1ZP0C 3AEBD 3AEAC 3P4QD 1KF6D 1OW6A 2B76D 3AECD 3B71A 3AE1C 2WU5D 3AEDD 4YXDD 3P4SC 4YT0D 3AE7C 1NENC 3AE8D 4YTMC 3CIRC 2WDQC 3AE9D 3VR8C 1L0VD 2BS4C 5C3JD 3VRAD 3P4PD 4YTNC 1OW8A 1YQ3C 2G3AA 4YSZC 1NEKD 4YSXD 3AEFC 3P4RC 1K04A 1KFYC 1ZOYD 2WDVC 3AE4D 2H89D 3AEED 1K05A 2FBWC 2WU2D 4YSYD 4YTPD 3SFED 3S9OA 2WP9D 1YQ4D 3AE5C 2ACZD 3VRBC 4KX6D 3AEBC 3AE6D 2WQYD 3P4QC 1KF6C 2B76C 3AECC 2WU5C 3AEDC 1OW7A 4YXDC 4YT0C 3AE3D 1E7PC 3AEGD 5C2TD 3AE8C 2BS3C 3AE9C 1QLBC 2WS3D 1L0VC 3VR9D 5C3JC 2H88D 3VRAC 3ABVD 3P4PC 2WDRD 1NEKC 3SFDD 3AE2D 4YSXC 1ZP0D 4YTMD 3AEAD 2BS2C 1PV3A 1ZOYC 3AE1D 3AE4C 3P4SD 2H89C 3AE7D 1NEND 1KTMA 3CIRD 2WU2C
chains in the Genus database with same CATH superfamily
4D6TJ 1MZ9A 2KP8A 1EDIA 1LP1A 1HJBA 1NKNA 3LIDA 3G71P 4OVNF 3KZIE 4YPCA 1KYOE 2RH0A 2K37A 4YSZD 1ZV8A 1LP1B 1BGYG 3RBXA 5AW6B 1DIPA 1N8RQ 3H1KD 3V5BA 2ZAEB 2Q1KA 1DEEG 1CSBA 3PTZA 1YJWP 3SFDC 2LR2A 1CZQA 3VMYA 3P4QD 1K8AQ 5KLIC 3AECD 1T2KD 3P4SC 5CBNA 3CMAP 2BCCG 4LC1A 5AW9B 2R5BA 1QEXA 1GD2E 1VQ7P 5GTHE 2P58A 3AEFC 1X9VA 5K5GB 1OVUA 4GDOA 4D6TD 4LGDE 3P32A 2K3RA 2JR8A 1ZR4A 1IFNA 4OGQD 3L75D 4TT3H 1AVOA 2C0WA 1KILC 5B5EH 2QE7H 1AV1A 3D70A 2FXOA 1SQQK 2RN0A 1QVGO 3PP5A 3V2PA 4H44B 1HUCA 2N1TD 3JCUE 1EZVD 5EFWB 2N9YB 5KAFH 2OQQA 1YHQP 3SWFA 5KKZC 5AVUB 4YSYC 2WP9C 2FYUK 5KJ7A 1HGVA 2WTYA 1KILE 1P84I 2ZYAA 1QL1A 5BU5A 3TGUE 3MGNA 2L91A 3HE5A 1D7MA 2E74B 1N7SD 5KLVG 1BE3J 3BCCJ 3AE2C 1WMKA 3HE5B 2M3EA 1SP4A 3M91A 3ZDMA 3AEDD 4DOJA 2QVAA 2WSEH 1URQA 3AE8D 3C1LA 1OZHA 2IFMA 2IZ1A 2Y0CA 4Z1MH 1RE4C 2M3BA 4IL6H 5AW3B 2ZFCA 1URQB 1BGYD 1OW8A 2E76C 1NEKD 5AW4B 3PHLA 1IK7A 1QGKB 1KB9D 2YKOA 4H0LB 5CCGD 1NU1E 2QJPC 4BRYA 2POHA 2QM7A 2O01N 3VOPA 3RL0D 1YIJP 1OFCX 3F89A 1PGOA 3G9RA 1S5LX 4N6JA 4BRYB 2BCCD 1OVRA 2JWDA 3NFQA 1KN7A 5TISH 3TYYA 3S4RA 1JMMA 3GF3A 5AVZB 5DJUB 1SQXG 3L70G 3A0BH 3V2RA 4YSXC 3H1JG 3W68A 5KLVJ 3JSVC 1KTMA 1M1JA 3WUVA 3Q2YA 2WPSA 3VR8D 2JEEA 1L0NE 3BASA 3IN6A 3O6QA 1M1JB 4ASVA 2OTJP 2V7QH 4WWIA 1QL2A 1ZN5A 3O6QB 1LWUA 3HD7D 1GW4A 2FYNC 1LTIC 3AEAC 2IZ0A 5APVA 1LWUB 1FDOA 1CW5A 2YO3A 3VMXA 5CHXA 2R3SA 3L37A 1VQ5P 1AVYA 3WMM0 3G4SP 1FZFA 3II6A 4PJ0H 1M1KQ 5KLVD 1H89A 1JUNA 2IBZI 3HRNA 1Z56A 1KFYC 1ZOYD 2D2CB 3TGUJ 2H89D 1RY3A 4WBAA 4C46A 1K05A 2E42A 2FFDC 2FXMA 1JY2P 3KDPB 3H1IG 2JP3A 3H1JJ 3V6IA 1VF5C 1KF6C 3U59A 5KAIE 2WU5C 1NVOA 1E7PC 1DH3A 1L4AD 1S72P 2R3CA 1YJ9P 2I8DA 2AEJA 3D6YA 4PV1C 3AE4C 5E79E 1IC2A 4PD4H 1NU1J 1LTBC 4ASWA 2ITAA 1AJYA 3I55P 5AVVB 1SQQG 1GW3A 2QEXP 1TU3F 3GHGA 2WDVD 1SQXD 3L70D 2KSEA 3H1JD 4WB4A 3GHGB 3H1HE 1ZP0C 1Y47A 2FYUG 2B76D 2HR3A 1SFCC 1R8EA 5AVRB 4K35A 2LXBA 4GIFA 2G8YA 3OJAB 3KXDA 1ZXGA 3H1LG 4UB6E 1PIXA 1K73Q 1L0NJ 4O9BA 4IFMA 1M57D 2M0BA 1XTCC 2WSFJ 2JO1A 2WT7A 2OYHC 2GUVA 2WU2D 3Q5PA 1P84D 3AE5C 4U3FE 2WT7B 3MUDC 3P7KA 2A45I 1KQGB 1S9KE 3L74G 2IBZG 1QLBC 1H8AA 5GTIH 2E5YA 4I1LA 3VRAC 2WDRD 1G1JA 1GL2C 3RGUA 3N4XA 1Q90D 2NPSC 3CMEP 1GL2A 1NO4A 2YKPA 3GF7A 3H1ID 2Q6QA 4OGQB 5DJTB 4L76A 3RK2D 4IFFA 3CD6P 4KX6C 1JY3P 1L0ND 2N1TA 1RE3C 3FX0A 4DHIB 1BSNA 1M7LA 1N86A 1NHLA 2N1TB 5KLVK 1OMIA 4GOEA 4U7JA 2W6AA 3IFMA 1KB9I 1DX7A 5AW0B 2M8RA 3CXHE 4UB8H 3RL0g 4I2LC 2Z5HA 5B66H 4CPGA 1N7SA 2HODA 2FYZA 1SQQD 1VQ9P 2YMKA 1N73C 2IYOA 2C9NY 4W7YA 1LGHB 1N7SB 2HODB 2LXCB 4L75A 4D6TG 1DD3A 1VQPP 3B5NC 2WWWA 1NH4A 2FBWC 2FYUD 1HVVA 2KOGA 1VQOP 3F5HA 1S1CX 4KHXA 2Z4EA 3H1HJ 1OW7A 5AW7B 2Z5IA 1KYOI 5C3JC 5TJHA 4I7ZB 3TDKA 2ZT9C 1VQLP 1ZW0A 4R4LA 1MFTA 3QH9A 2A45G 3RL0B 3BVHA 3CX5E 3PJSK 2WDQD 3AE6C 1SQBE 3L74D 2IBZD 5C2TC 4U3FJ 1YYCA 2RMZA 3OA7A 1OVVA 3A0HE 2W6JH 1H88A 1EXJA 1NU1K 5AW5B 2ZXXA 1AQ5A 4BXLA 1JB0J 2ZXEB 4WY4D 3EFFK 4MN4C 3FWNA 1Y8AA 4JYCA 2R44A 3AE7C 1NENC 4OH8B 2K88A 1RF1A 3CIRC 2BEZF 1LT9A 3LIEA 3I5CA 2AXTE 3HD7A 1L0VD 1S5LH 1RF1B 5AVSB 4HH2A 1NTME 1LT9B 3HD7B 2I1JA 2WSSH 3P4RC 2A06E 1QLED 2O01J 1EDJA 1QX8A 4ZKUA 3SFED 3RBZA 3AEBC 1JEKA 5APXA 1VQNP 4U3FD 1KORA 3R4YA 4YXDC 4YT0C 4DJGA 1L0NK 1BE3G 1LTJA 3BCCG 2JKVA 1P84H 3A2AA 3PRJA 1FZEA 1T3UA 3ABVD 1FZCA 3P4PC 1RH5B 1LTJB 3BRVB 2B87A 1FZCB 4H44C 1L4AA 2P10A 3CCLP 1U7JA 1YQ4C 2ACZC 2B87B 5BU8B 5CJ0A 3NTNA 1L4AB 2IYPA 5CCHD 3AE3C 2YIUB 1EXIA 4GOFA 2IX7C 4N78D 2WPVB 5KJ7C 3L4FA 1LTAC 3TNUA 2QSIA 2E74C 2K1AA 1NTKE 1K9MQ 4H13D 3L71E 2WSCJ 3VMZA 1XTGB 3TNUB 4YTMC 2XU6A 1RF0A 2CK3H 2KLUA 3HUSA 2KB7P 2XV5A 4GT1A 2QRXA 3P8CE 1SQBJ 2WITA 1E79H 1HH0A 1SQPE 1URQC 3HUSB 2YO2A 2XNXA 3E7KA 3PH0A 2FXPA 1JO5A 4H0LC 1WRGA 1PGPA 2WPRA 2E75D 5CJ4A 1DEBA 4IOIH 3AE9C 2KZIA 4AYCA 1GK6A 2OARA 2QJYB 2H88D 2AXCA 1UIIA 1NTMJ 1LJ2A 3AE1D 1KQLA 1T8ZA 4Y99B 2YXRB 4HJGH 4YTPC 3VMAA 3H32A 1ZLLA 2YNYA 2QJKB 3RK3D 2KUBA 1NYHA 1BE3D 4W80A 1E5WA 3BCCD 4YTND 3TGUG 3AEGC 3H32B 3LW5J 2K9JA 3UIAA 1SQVE 1M1JC 3Q1MA 1SVFA 5BVZA 1BDCA 2K9JB 1W2BO 3VRBD 5H2FH 1FZGA 3CWBE 3KQGA 3RK2B 4AQRD 3B4SA 5B5EE 2ZYDA 2YKQA 1KYOD 4AUWA 4DHZA 1LWUC 1VQ4P 1YJNP 1Q82Q 1YQ3C 5KAFE 2B9BA 1NU1G 2XZRA 4DDGA 1WT6A 4EYYQ 2WPQA 2D2CC 1EC5A 1NTKJ 1CI6A 2JWAA 1RQUA 3L71J 2KZJA 1HWTC 3D6ZA 1IO4A 1IFMA 1CI6B 2XNDH 2P1JA 3VYIA 1LT1A 3N7NA 1SQVG 3MTUE 3MIWA 3M0DA 2WMMA 3SFDD 1JM0A 1BDDA 4JQ0D 4ZKPA 3P4SD 2BASA 1LTTC 1SQPJ 3T97A 3BATA 4IL6E 2QA4P 1L0NG 2WQYC 3T97B 1Q86Q 3VN0A 2FY8A 3C8VA 1LTSC 3AEFD 2WS3C 1PFIA 3IR9A 4NPEA 3VR9C 2FKWB 2YMYA 1KZUB 3I56P 4DHJA 3CCRP 1NTKD 1HTLC 1IFPA 2B88A 3CLQA 4OWFA 5TISE 3GHGC 1KILD 3VP8A 1VDFA 3TGUD 4IL6X 2A45H 1SS1A 3A0BE 2KSJA 2OYIA 1T3JA 4WY4A 4YSZC 3WU2H 1YBKA 1KMIZ 1QVFO 2PAJA 1NAYA 4PV1B 2OYIB 2O3JA 1SQVJ 4RO0A 4WY4B 3CCMP 1S3JA 4YSYD 2WP9D 3P4QC 2LKMA 3IF4A 3JC22 4RJTA 1YI2P 3AECC 1M8OB 3CWBJ 1T2KC 1SQBK 1FJKA 1G1IA 2ZYGA 3CCEP 1NU1D 4GODA 2IDBA 4NPDA 1IFJA 3AE2D 2IFNA 5APQA 4N3YB 1NWQA 2KNCA 1BCCE 3H1KE 1FJPA 1KB9H 3CCJP 3CXHI 1FZAA 3GG2A 1YTZT 3P8MC 2KNCB 1H0TA 3K5BA 4OGQC 2WVRA 2SPZA 4PJ0E 2HYNA 1W5CE 1L2PA 3A5TA 2E76D 3L35A 1NTMK 2W83C 3TSIA 1H0TB 1TFFA 1SQVD 2CPSA 1Q7YQ 1OIPA 3H1HG 4HKZH 2N1TC 2YXQB 3M9QA 1JOCA 2WSEJ 3Q5SA 2JDIH 4L73A 3TF5A 4QMAA 3L75E 3KHUA 1J1EC 2HG5D 2J59M 3VONA 5AVWB 4YSXD 1N7LA 3KZIH 1KYOH 4PD4E 1YTZI 1N7SC 1ZMEC 2NPSB 1NJIQ 4H13B 4XE5B 2PFXA 3M0AA 1EZVE 2O1KA 1BCCG 4U3FG 1KV4A 1ZRTE 3AEDC 1KQSO 3CX5I 3OAKA 1JCCA 3AE8C 2K9YA 5CBOA 1U57A 1PGQA 2KIKA 3QWOC 5AVTB 1FC2C 4A7PA 1NOHA 3TK1A 3KPEA 1NEKC 1JCDA 1G2CB 1PPJE 4C7NA 3AEAD 4I7ZC 3L72E 1NTKK 5CCGC 5GTHH 3FXDA 3MHVA 4C7NB 3PLNA 5CCGA 2E75B 3RL0C 4WVZA 1R5SA 1OX3A 2V7QJ 2ZFYA 4FJVA 1KFYD 1YITP 1BGYE 1SQPK 1IFIA 2HLOA 1J1DB 2AEFA 1VF5D 1GZLA 1KF6D 3SWKA 1KFNA 2WU5D 3JCUH 2PGDA 3RK3B 4DZOA 1BCCJ 5GTIE 2PRRA 4B86A 3VR8C 2J5UA 5AW8B 1J2JB 1FE6A 2BCCE 1MUUA 5AVQB 2G3AA 4PV1D 1RF1C 4RESB 2PP6A 3H1HD 1LT9C 3AE4D 1Y9BA 1PPJG 1AFOA 3EFGA 3G6EP 1U7MA 3HD7C 3CC4P 2DW3A 2KS1A 1EDLA 3CCUP 4W7ZA 2MJZA 3CC2P 4HB1A 2J58A 2KS1B 5APWA 1GU5A 2Q3EA 3VP9A 1NTZE 4K3AA 1L0LE 5AW1B 1SQVK 3L75J 2QIWA 3A7OA 1MKMA 4GKGA 4UB8E 3MZWB 1NAFA 3FXEA 1ZP0D 5B66E 3USSA 1ZOYC 1LTJC 1SFCD 1BCCD 2H89C 4TLFA 4KJMA 1T6AA 3G3ZA 1S9KD 1FZCC 2V4HA 1SQBG 2VRSA 5APSA 2E43A 1EQ7A 3EWKA 5KTBA 4XA4A 1L4AC 2KXPB 2OTLP 1X22A 5KLIB 2YIUC 1Q2NA 4DT0A 5KLVE 3AE5D 2W90A 1GTWA 3L72J 2KYVA 3Q3DA 1NGMB 2KLVA 1NTMG 3VRAD 4LDTA 1M90Q 2GA1A 1NTZG 1GL2D 2NRGA 2A06G 1L0LG 1X0TA 2Y9ZA 1KILA 2NPSD 2WSFH 2WZ7A 3CXHD 4PD4D 3HTKA 2WDVC 3GW6A 3D71A 5AVYB 2GM4A 1RF0C 4I6LA 2O1JA 1BGYJ 3HUSC 2QM8A 4KX6D 3WUTA 1KILB 1LTGC 3HTKB 2W8ZA 2B76C 1ZRTD 3L36A 2Y0EA 1VPCA 1RQVA 1VQ6P 3V4QA 2HPCA 2BCCJ 2HPCB 5KKZB 1PPJD 2Q3IA 2QJYC 3CC7P 1SQXE 1FZBA 3L70E 3L72D 1VL2A 3H1JE 3CI9A 2WU2C 2JJLA 1S5LE 4Y99C 2W27A 3BRTB 1FBMA 1GK4A 3FGAD 2QJKC 3SWYA 4JYBA 5KAIH 4C7RA 4LLHA 1JY2O 2L5GB 3B5ND 3VTPC 1NTZJ 3AEEC 2FBWD 2WDRC 1NTKG 3S1KA 1L0LJ 1RE4A 2ZJSE 4JF7A 3L71G 3CX5D 2GUSA 4BWNA 1HJ0A 1JY2N 1SQBD 1HBWA 1P84E 1GDTA 3RK2C 5E79H 3CPWO 2E76B 5C3JD 1SQPG 2ZT9D 2QJPB 3Q5RA 1HGZA 4R4MA 5AW2B 2AEMA 1UIXA 1JMBA 1K04A 5APTA 4IFDK 3C9IA 1FDMA 3S9OA 1M56D 1Q81Q 1BSHA 3AE6D 2IPPA 1A02F 3H1IE 1KD1Q 1IK9A 5C2TD 1NTMD 1NTZD 2A06D 1L0LD 2KK7A 3M9BA 3HE4A 1KC8Q 4UB6H 4XFJA 3MD0A 3AE7D 1NEND 3U1CA 1MV8A 3HE4B 3ITKA 1PZQA 3CIRD 3V2NA 2OYOA 2I1KA 2P2UA 3V4WA 3CCSP 3M0DC 5AVXB 4YXWH 3A3YB 2Q9IA 1SQQE 3P4RD 1HF9A 2FYNB 4L74A 1PGJA 2H8PD 4EOTA 3CWBG 2W6BA 3AEBD 1PP9E 4YXDD 2XDJA 4YT0D 2FYUE 1SQXJ 3MP7B 3L70J 1MFZA 2WDQC 2C9LY 1ZR2A 2FFDA 4ZNCA 3P4PD 3H1LE 1USEA 1JTHA 2FFDB 2O01H 4H44D 2E5TA 3L71D 4RKUJ 2M5AA 1VF5B 1JY3O 2Q5UA 1JTHB 1YQ4D 2H43A 5C39A 2ACZD 3W67A 2OYIC 4Y28J 4WY4C 3O8ZA 1SLQA 2M5AB 3CXHH 3AE3D 3L73E 1OXZA 3P8CD 2Y9YA 1JY3N 3GMAA 3KYQA 3L74E 2R32A 5KJ7D 1SQPD 4I6MC 1L0VC 2IBZE 5H2FE 2E74D 2P7JA 1AQTA 3CCQP 2BS2C 1PV3A 4KT0J 1IZNB 4YTMD 3SFEC 1PP9G 3U1AA 1KQFB 1W2EA 4JPZB 1S2EA 3H6PA 3H1IJ 1N2DC 1GMJA 1SFCA 1URQD 3M9HA 2N9BA 3ABVC 1FDIA 1FAVA 1SFCB 4H0LD 3H25A 4PD4I 4HYTB 1OW6A 1KFMA 3WUUA 4DCKA 4EDFA 2WSCH 1EZVI 4M3LA 2R5DA 1GU4A 5M1BA 2B89A 3AE9D 1USDA 3E1IA 2OYHA 3CX5H 3L73G 2UWJE 3V2QA 4EI2A 4EIJA 2BEQD 1NTZK 4ZMDA 5CCHC 2OTKE 1L0LK 1S4XA 3MUDA 2OYHB 5CCHA 3CWBD 1FOSF 1X8YA 4D6TE 3AEED 1SQQJ 1FU1A 3A0HH 2H7HA 4YTPD 3R2PA 3SSUA 2OGUA 3B8EB 4NPFX 4H13C 1FS0E 1LNQA 3AEGD 1PP9J 2NPSA 3CL3D 2FYUJ 1PL5A 1GL2B 1IJDB 2AXTH 1OWAA 1A02J 2CPBA 4N78E 1RE3A 3H1LJ 3H1KG 4DDIA 5APUA 1RHZB 5CMZA 2P67A 1AA0A 2KI7B 1EDKA 3NXSA 1G2CA 3WU2E 1DD4A 2C0XA 2E75C 1YQ3D 1J1EB 3LW5H 2XKMA 2Q7CA 3CCVP 3L73J 1NKZB 2QG4A 1VQKP 2H88C 3L74J 1N73A 2D2CD 1VQ8P 1J1DC 3B71A 1PP9D 2ZVNB 3AE1C 3M06A 1FOSE 1N73B 3L75G 3OW2O 3B5NA 3RK3C 2BS4C 2HFED 2RKLA 4YTNC 3H1LD 3NMDA 2MKVA 3B5NB 2Y0DA 1X79B 1KB9E 1SQXK 1EZVG 1R5LA 3IAOA 1VQMP 3H1KJ 3VRBC 2WQYD 5APYA 3FWLA 3GLMA 3L73D 3E1RA 2BS3C 1IFDA 4JBZA 3RK3E 2WS3D 1BE3E 2ZVOB 2ZT9B 3BCCE 3VR9D 1JNMA 2NZ2A 5L8RJ 3L72G 3EQ2A
chains in the Genus database with same CATH topology
4YSYC 4YTPC 2WDQD 3SFEC 2WP9C 3Q2YA 1YQ4C 2E75B 1KQFB 2ACZC 4KX6C 3VR8D 3AE6C 2WQYC 1AJYA 4OGQC 1NYHA 3EWKA 3IN6A 3T97B 4YXDD 3O6QA 1KILE 4YTND 1DD4A 2E75C 3AE3C 3AEGC 1YQ3D 2E76D 5C2TC 3LW5J 3FGAD 2QJKC 4YSZD 2V7QJ 3C8VA 1GMJA 1TU3F 3AEFD 3P4RD 1EXIA 2WS3C 1HF9A 1KFYD 2WDVD 2WPVB 3Q1MA 2E74B 1OMIA 3VR9C 1DIPA 2H88C 3ABVC 1EXJA 1FDIA 3AEEC 4U7JA 2FBWD 2WDRC 2YIUC 4H0LD 3H25A 2D2CD 3AE5D 2QSIA 2E74C 2FYNC 3SFDC 3VRBD 3AE2C 1WMKA 1ZP0C 1JB0J 3AEBD 3AEAC 3P4QD 1VF5D 5KLIC 4H13D 1OW6A 3RL0g 1KF6D 1HJ0A 2B76D 3AECD 3B71A 3AE1C 2WU5D 1FDOA 2WSCJ 3AEDD 3P4SC 4YT0D 2WSEJ 1R8EA 3Q5SA 3AE7C 1NENC 3AE8D 5M1BA 4YTMC 3CIRC 2BEZF 2WDQC 3Q3DA 1NGMB 2G8YA 3AE9D 2E76B 3VR8C 2J5UA 4Z1MH 4IL6X 1L0VD 2YMKA 2BS4C 5C3JD 1PIXA 2BEQD 3VRAD 3P4PD 4YTNC 1OW8A 1YQ3C 2E76C 2G3AA 2MKVA 2ZT9D 1NEKD 4YSZC 4YSXD 3Q5RA 4R4MA 1IK7A 4PV1D 3AEFC 1UIXA 3P4RC 2WSFJ 1K04A 2O01J 4H0LB 1KFYC 1ZOYD 2D2CB 4H44D 2WDVC 3AE4D 1KMIZ 3D71A 4PV1B 1Y9BA 1DD3A 4GDOA 2JO1A 4RKUJ 1ZMEC 2QJPC 2H89D 3AEED 1VF5B 3IAOA 2FXPA 1K05A 4H13B 2FBWC 2WU2D 4YSYD 4YTPD 3SFED 3S9OA 2WP9D 4H0LC 1YQ4D 3Q5PA 2D2CC 3AE5C 2ACZD 3VRBC 2JP3A 4KX6D 3AEBC 3AE6D 2WQYD 3P4QC 1VF5C 4Y28J 4OGQD 4H13C 1S1CX 3G9RA 1S5LX 3AECC 4TT3H 1KF6C 1ZRTE 2B76C 1KORA 3R4YA 2WU5C 3AEDC 1OW7A 4YXDC 3GLMA 4YT0C 2E75D 1KQGB 1E7PC 3AE3D 3AEGD 1RQUA 5C2TD 3AE8C 2K9YA 3D6ZA 2BS3C 1RQVA 1U57A 3AE9C 3RK3E 1QLBC 3GMAA 2WS3D 1PL5A 2ZT9B 3GF3A 3D70A 1L0VC 3VR9D 5C3JC 2H88D 3VRAC 3ABVD 4I7ZB 3P4PC 2QIWA 2WDRD 1MKMA 2IDBA 4H44B 2NZ2A 2ZT9C 5L8RJ 2E74D 1NEKC 3SFDD 3AE2D 4XFJA 1ZP0D 4YSXC 4YTMD 2QJYC 4R4LA 3AEAD 3D6YA 4I7ZC 4PV1C 1Q90D 1PV3A 2BS2C 1ZOYC 3AE1D 4H44C 3AE4C 4KT0J 1VL2A 2H89C 2OQQA 3P4SD 3AE7D 2P10A 1NEND 3GF7A 4OGQB 5KKZC 1KTMA 3CIRD 2WU2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSY C;  4YTP C;  2WDQ D;  3SFE C;  2WP9 C;  1YQ4 C;  2ACZ C;  4KX6 C;  3VR8 D;  3AE6 C;  2WQY C;  4YTN D;  3AE3 C;  3AEG C;  1YQ3 D;  5C2T C;  4YSZ D;  3AEF D;  3P4R D;  2WS3 C;  1KFY D;  2WDV D;  3VR9 C;  2H88 C;  3ABV C;  3AEE C;  2FBW D;  2WDR C;  3AE5 D;  3SFD C;  3VRB D;  3AE2 C;  1ZP0 C;  3AEB D;  3AEA C;  3P4Q D;  1KF6 D;  1OW6 A;  2B76 D;  3AEC D;  3B71 A;  3AE1 C;  2WU5 D;  3AED D;  4YXD D;  3P4S C;  4YT0 D;  3AE7 C;  1NEN C;  3AE8 D;  4YTM C;  3CIR C;  2WDQ C;  3AE9 D;  3VR8 C;  1L0V D;  2BS4 C;  5C3J D;  3VRA D;  3P4P D;  4YTN C;  1OW8 A;  1YQ3 C;  2G3A A;  4YSZ C;  1NEK D;  4YSX D;  3AEF C;  3P4R C;  1K04 A;  1KFY C;  1ZOY D;  2WDV C;  3AE4 D;  2H89 D;  3AEE D;  1K05 A;  2FBW C;  2WU2 D;  4YSY D;  4YTP D;  3SFE D;  3S9O A;  2WP9 D;  1YQ4 D;  3AE5 C;  2ACZ D;  3VRB C;  4KX6 D;  3AEB C;  3AE6 D;  2WQY D;  3P4Q C;  1KF6 C;  2B76 C;  3AEC C;  2WU5 C;  3AED C;  1OW7 A;  4YXD C;  4YT0 C;  3AE3 D;  1E7P C;  3AEG D;  5C2T D;  3AE8 C;  2BS3 C;  3AE9 C;  1QLB C;  2WS3 D;  1L0V C;  3VR9 D;  5C3J C;  2H88 D;  3VRA C;  3ABV D;  3P4P C;  2WDR D;  1NEK C;  3SFD D;  3AE2 D;  4YSX C;  1ZP0 D;  4YTM D;  3AEA D;  2BS2 C;  1PV3 A;  1ZOY C;  3AE1 D;  3AE4 C;  3P4S D;  2H89 C;  3AE7 D;  1NEN D;  1KTM A;  3CIR D;  2WU2 C; 
#chains in the Genus database with same CATH topology
 4D6T J;  1MZ9 A;  2KP8 A;  1EDI A;  1LP1 A;  1HJB A;  1NKN A;  3LID A;  3G71 P;  4OVN F;  3KZI E;  4YPC A;  1KYO E;  2RH0 A;  2K37 A;  4YSZ D;  1ZV8 A;  1LP1 B;  1BGY G;  3RBX A;  5AW6 B;  1DIP A;  1N8R Q;  3H1K D;  3V5B A;  2ZAE B;  2Q1K A;  1DEE G;  1CSB A;  3PTZ A;  1YJW P;  3SFD C;  2LR2 A;  1CZQ A;  3VMY A;  3P4Q D;  1K8A Q;  5KLI C;  3AEC D;  1T2K D;  3P4S C;  5CBN A;  3CMA P;  2BCC G;  4LC1 A;  5AW9 B;  2R5B A;  1QEX A;  1GD2 E;  1VQ7 P;  5GTH E;  2P58 A;  3AEF C;  1X9V A;  5K5G B;  1OVU A;  4GDO A;  4D6T D;  4LGD E;  3P32 A;  2K3R A;  2JR8 A;  1ZR4 A;  1IFN A;  4OGQ D;  3L75 D;  4TT3 H;  1AVO A;  2C0W A;  1KIL C;  5B5E H;  2QE7 H;  1AV1 A;  3D70 A;  2FXO A;  1SQQ K;  2RN0 A;  1QVG O;  3PP5 A;  3V2P A;  4H44 B;  1HUC A;  2N1T D;  3JCU E;  1EZV D;  5EFW B;  2N9Y B;  5KAF H;  2OQQ A;  1YHQ P;  3SWF A;  5KKZ C;  5AVU B;  4YSY C;  2WP9 C;  2FYU K;  5KJ7 A;  1HGV A;  2WTY A;  1KIL E;  1P84 I;  2ZYA A;  1QL1 A;  5BU5 A;  3TGU E;  3MGN A;  2L91 A;  3HE5 A;  1D7M A;  2E74 B;  1N7S D;  5KLV G;  1BE3 J;  3BCC J;  3AE2 C;  1WMK A;  3HE5 B;  2M3E A;  1SP4 A;  3M91 A;  3ZDM A;  3AED D;  4DOJ A;  2QVA A;  2WSE H;  1URQ A;  3AE8 D;  3C1L A;  1OZH A;  2IFM A;  2IZ1 A;  2Y0C A;  4Z1M H;  1RE4 C;  2M3B A;  4IL6 H;  5AW3 B;  2ZFC A;  1URQ B;  1BGY D;  1OW8 A;  2E76 C;  1NEK D;  5AW4 B;  3PHL A;  1IK7 A;  1QGK B;  1KB9 D;  2YKO A;  4H0L B;  5CCG D;  1NU1 E;  2QJP C;  4BRY A;  2POH A;  2QM7 A;  2O01 N;  3VOP A;  3RL0 D;  1YIJ P;  1OFC X;  3F89 A;  1PGO A;  3G9R A;  1S5L X;  4N6J A;  4BRY B;  2BCC D;  1OVR A;  2JWD A;  3NFQ A;  1KN7 A;  5TIS H;  3TYY A;  3S4R A;  1JMM A;  3GF3 A;  5AVZ B;  5DJU B;  1SQX G;  3L70 G;  3A0B H;  3V2R A;  4YSX C;  3H1J G;  3W68 A;  5KLV J;  3JSV C;  1KTM A;  1M1J A;  3WUV A;  3Q2Y A;  2WPS A;  3VR8 D;  2JEE A;  1L0N E;  3BAS A;  3IN6 A;  3O6Q A;  1M1J B;  4ASV A;  2OTJ P;  2V7Q H;  4WWI A;  1QL2 A;  1ZN5 A;  3O6Q B;  1LWU A;  3HD7 D;  1GW4 A;  2FYN C;  1LTI C;  3AEA C;  2IZ0 A;  5APV A;  1LWU B;  1FDO A;  1CW5 A;  2YO3 A;  3VMX A;  5CHX A;  2R3S A;  3L37 A;  1VQ5 P;  1AVY A;  3WMM 0;  3G4S P;  1FZF A;  3II6 A;  4PJ0 H;  1M1K Q;  5KLV D;  1H89 A;  1JUN A;  2IBZ I;  3HRN A;  1Z56 A;  1KFY C;  1ZOY D;  2D2C B;  3TGU J;  2H89 D;  1RY3 A;  4WBA A;  4C46 A;  1K05 A;  2E42 A;  2FFD C;  2FXM A;  1JY2 P;  3KDP B;  3H1I G;  2JP3 A;  3H1J J;  3V6I A;  1VF5 C;  1KF6 C;  3U59 A;  5KAI E;  2WU5 C;  1NVO A;  1E7P C;  1DH3 A;  1L4A D;  1S72 P;  2R3C A;  1YJ9 P;  2I8D A;  2AEJ A;  3D6Y A;  4PV1 C;  3AE4 C;  5E79 E;  1IC2 A;  4PD4 H;  1NU1 J;  1LTB C;  4ASW A;  2ITA A;  1AJY A;  3I55 P;  5AVV B;  1SQQ G;  1GW3 A;  2QEX P;  1TU3 F;  3GHG A;  2WDV D;  1SQX D;  3L70 D;  2KSE A;  3H1J D;  4WB4 A;  3GHG B;  3H1H E;  1ZP0 C;  1Y47 A;  2FYU G;  2B76 D;  2HR3 A;  1SFC C;  1R8E A;  5AVR B;  4K35 A;  2LXB A;  4GIF A;  2G8Y A;  3OJA B;  3KXD A;  1ZXG A;  3H1L G;  4UB6 E;  1PIX A;  1K73 Q;  1L0N J;  4O9B A;  4IFM A;  1M57 D;  2M0B A;  1XTC C;  2WSF J;  2JO1 A;  2WT7 A;  2OYH C;  2GUV A;  2WU2 D;  3Q5P A;  1P84 D;  3AE5 C;  4U3F E;  2WT7 B;  3MUD C;  3P7K A;  2A45 I;  1KQG B;  1S9K E;  3L74 G;  2IBZ G;  1QLB C;  1H8A A;  5GTI H;  2E5Y A;  4I1L A;  3VRA C;  2WDR D;  1G1J A;  1GL2 C;  3RGU A;  3N4X A;  1Q90 D;  2NPS C;  3CME P;  1GL2 A;  1NO4 A;  2YKP A;  3GF7 A;  3H1I D;  2Q6Q A;  4OGQ B;  5DJT B;  4L76 A;  3RK2 D;  4IFF A;  3CD6 P;  4KX6 C;  1JY3 P;  1L0N D;  2N1T A;  1RE3 C;  3FX0 A;  4DHI B;  1BSN A;  1M7L A;  1N86 A;  1NHL A;  2N1T B;  5KLV K;  1OMI A;  4GOE A;  4U7J A;  2W6A A;  3IFM A;  1KB9 I;  1DX7 A;  5AW0 B;  2M8R A;  3CXH E;  4UB8 H;  3RL0 g;  4I2L C;  2Z5H A;  5B66 H;  4CPG A;  1N7S A;  2HOD A;  2FYZ A;  1SQQ D;  1VQ9 P;  2YMK A;  1N73 C;  2IYO A;  2C9N Y;  4W7Y A;  1LGH B;  1N7S B;  2HOD B;  2LXC B;  4L75 A;  4D6T G;  1DD3 A;  1VQP P;  3B5N C;  2WWW A;  1NH4 A;  2FBW C;  2FYU D;  1HVV A;  2KOG A;  1VQO P;  3F5H A;  1S1C X;  4KHX A;  2Z4E A;  3H1H J;  1OW7 A;  5AW7 B;  2Z5I A;  1KYO I;  5C3J C;  5TJH A;  4I7Z B;  3TDK A;  2ZT9 C;  1VQL P;  1ZW0 A;  4R4L A;  1MFT A;  3QH9 A;  2A45 G;  3RL0 B;  3BVH A;  3CX5 E;  3PJS K;  2WDQ D;  3AE6 C;  1SQB E;  3L74 D;  2IBZ D;  5C2T C;  4U3F J;  1YYC A;  2RMZ A;  3OA7 A;  1OVV A;  3A0H E;  2W6J H;  1H88 A;  1EXJ A;  1NU1 K;  5AW5 B;  2ZXX A;  1AQ5 A;  4BXL A;  1JB0 J;  2ZXE B;  4WY4 D;  3EFF K;  4MN4 C;  3FWN A;  1Y8A A;  4JYC A;  2R44 A;  3AE7 C;  1NEN C;  4OH8 B;  2K88 A;  1RF1 A;  3CIR C;  2BEZ F;  1LT9 A;  3LIE A;  3I5C A;  2AXT E;  3HD7 A;  1L0V D;  1S5L H;  1RF1 B;  5AVS B;  4HH2 A;  1NTM E;  1LT9 B;  3HD7 B;  2I1J A;  2WSS H;  3P4R C;  2A06 E;  1QLE D;  2O01 J;  1EDJ A;  1QX8 A;  4ZKU A;  3SFE D;  3RBZ A;  3AEB C;  1JEK A;  5APX A;  1VQN P;  4U3F D;  1KOR A;  3R4Y A;  4YXD C;  4YT0 C;  4DJG A;  1L0N K;  1BE3 G;  1LTJ A;  3BCC G;  2JKV A;  1P84 H;  3A2A A;  3PRJ A;  1FZE A;  1T3U A;  3ABV D;  1FZC A;  3P4P C;  1RH5 B;  1LTJ B;  3BRV B;  2B87 A;  1FZC B;  4H44 C;  1L4A A;  2P10 A;  3CCL P;  1U7J A;  1YQ4 C;  2ACZ C;  2B87 B;  5BU8 B;  5CJ0 A;  3NTN A;  1L4A B;  2IYP A;  5CCH D;  3AE3 C;  2YIU B;  1EXI A;  4GOF A;  2IX7 C;  4N78 D;  2WPV B;  5KJ7 C;  3L4F A;  1LTA C;  3TNU A;  2QSI A;  2E74 C;  2K1A A;  1NTK E;  1K9M Q;  4H13 D;  3L71 E;  2WSC J;  3VMZ A;  1XTG B;  3TNU B;  4YTM C;  2XU6 A;  1RF0 A;  2CK3 H;  2KLU A;  3HUS A;  2KB7 P;  2XV5 A;  4GT1 A;  2QRX A;  3P8C E;  1SQB J;  2WIT A;  1E79 H;  1HH0 A;  1SQP E;  1URQ C;  3HUS B;  2YO2 A;  2XNX A;  3E7K A;  3PH0 A;  2FXP A;  1JO5 A;  4H0L C;  1WRG A;  1PGP A;  2WPR A;  2E75 D;  5CJ4 A;  1DEB A;  4IOI H;  3AE9 C;  2KZI A;  4AYC A;  1GK6 A;  2OAR A;  2QJY B;  2H88 D;  2AXC A;  1UII A;  1NTM J;  1LJ2 A;  3AE1 D;  1KQL A;  1T8Z A;  4Y99 B;  2YXR B;  4HJG H;  4YTP C;  3VMA A;  3H32 A;  1ZLL A;  2YNY A;  2QJK B;  3RK3 D;  2KUB A;  1NYH A;  1BE3 D;  4W80 A;  1E5W A;  3BCC D;  4YTN D;  3TGU G;  3AEG C;  3H32 B;  3LW5 J;  2K9J A;  3UIA A;  1SQV E;  1M1J C;  3Q1M A;  1SVF A;  5BVZ A;  1BDC A;  2K9J B;  1W2B O;  3VRB D;  5H2F H;  1FZG A;  3CWB E;  3KQG A;  3RK2 B;  4AQR D;  3B4S A;  5B5E E;  2ZYD A;  2YKQ A;  1KYO D;  4AUW A;  4DHZ A;  1LWU C;  1VQ4 P;  1YJN P;  1Q82 Q;  1YQ3 C;  5KAF E;  2B9B A;  1NU1 G;  2XZR A;  4DDG A;  1WT6 A;  4EYY Q;  2WPQ A;  2D2C C;  1EC5 A;  1NTK J;  1CI6 A;  2JWA A;  1RQU A;  3L71 J;  2KZJ A;  1HWT C;  3D6Z A;  1IO4 A;  1IFM A;  1CI6 B;  2XND H;  2P1J A;  3VYI A;  1LT1 A;  3N7N A;  1SQV G;  3MTU E;  3MIW A;  3M0D A;  2WMM A;  3SFD D;  1JM0 A;  1BDD A;  4JQ0 D;  4ZKP A;  3P4S D;  2BAS A;  1LTT C;  1SQP J;  3T97 A;  3BAT A;  4IL6 E;  2QA4 P;  1L0N G;  2WQY C;  3T97 B;  1Q86 Q;  3VN0 A;  2FY8 A;  3C8V A;  1LTS C;  3AEF D;  2WS3 C;  1PFI A;  3IR9 A;  4NPE A;  3VR9 C;  2FKW B;  2YMY A;  1KZU B;  3I56 P;  4DHJ A;  3CCR P;  1NTK D;  1HTL C;  1IFP A;  2B88 A;  3CLQ A;  4OWF A;  5TIS E;  3GHG C;  1KIL D;  3VP8 A;  1VDF A;  3TGU D;  4IL6 X;  2A45 H;  1SS1 A;  3A0B E;  2KSJ A;  2OYI A;  1T3J A;  4WY4 A;  4YSZ C;  3WU2 H;  1YBK A;  1KMI Z;  1QVF O;  2PAJ A;  1NAY A;  4PV1 B;  2OYI B;  2O3J A;  1SQV J;  4RO0 A;  4WY4 B;  3CCM P;  1S3J A;  4YSY D;  2WP9 D;  3P4Q C;  2LKM A;  3IF4 A;  3JC2 2;  4RJT A;  1YI2 P;  3AEC C;  1M8O B;  3CWB J;  1T2K C;  1SQB K;  1FJK A;  1G1I A;  2ZYG A;  3CCE P;  1NU1 D;  4GOD A;  2IDB A;  4NPD A;  1IFJ A;  3AE2 D;  2IFN A;  5APQ A;  4N3Y B;  1NWQ A;  2KNC A;  1BCC E;  3H1K E;  1FJP A;  1KB9 H;  3CCJ P;  3CXH I;  1FZA A;  3GG2 A;  1YTZ T;  3P8M C;  2KNC B;  1H0T A;  3K5B A;  4OGQ C;  2WVR A;  2SPZ A;  4PJ0 E;  2HYN A;  1W5C E;  1L2P A;  3A5T A;  2E76 D;  3L35 A;  1NTM K;  2W83 C;  3TSI A;  1H0T B;  1TFF A;  1SQV D;  2CPS A;  1Q7Y Q;  1OIP A;  3H1H G;  4HKZ H;  2N1T C;  2YXQ B;  3M9Q A;  1JOC A;  2WSE J;  3Q5S A;  2JDI H;  4L73 A;  3TF5 A;  4QMA A;  3L75 E;  3KHU A;  1J1E C;  2HG5 D;  2J59 M;  3VON A;  5AVW B;  4YSX D;  1N7L A;  3KZI H;  1KYO H;  4PD4 E;  1YTZ I;  1N7S C;  1ZME C;  2NPS B;  1NJI Q;  4H13 B;  4XE5 B;  2PFX A;  3M0A A;  1EZV E;  2O1K A;  1BCC G;  4U3F G;  1KV4 A;  1ZRT E;  3AED C;  1KQS O;  3CX5 I;  3OAK A;  1JCC A;  3AE8 C;  2K9Y A;  5CBO A;  1U57 A;  1PGQ A;  2KIK A;  3QWO C;  5AVT B;  1FC2 C;  4A7P A;  1NOH A;  3TK1 A;  3KPE A;  1NEK C;  1JCD A;  1G2C B;  1PPJ E;  4C7N A;  3AEA D;  4I7Z C;  3L72 E;  1NTK K;  5CCG C;  5GTH H;  3FXD A;  3MHV A;  4C7N B;  3PLN A;  5CCG A;  2E75 B;  3RL0 C;  4WVZ A;  1R5S A;  1OX3 A;  2V7Q J;  2ZFY A;  4FJV A;  1KFY D;  1YIT P;  1BGY E;  1SQP K;  1IFI A;  2HLO A;  1J1D B;  2AEF A;  1VF5 D;  1GZL A;  1KF6 D;  3SWK A;  1KFN A;  2WU5 D;  3JCU H;  2PGD A;  3RK3 B;  4DZO A;  1BCC J;  5GTI E;  2PRR A;  4B86 A;  3VR8 C;  2J5U A;  5AW8 B;  1J2J B;  1FE6 A;  2BCC E;  1MUU A;  5AVQ B;  2G3A A;  4PV1 D;  1RF1 C;  4RES B;  2PP6 A;  3H1H D;  1LT9 C;  3AE4 D;  1Y9B A;  1PPJ G;  1AFO A;  3EFG A;  3G6E P;  1U7M A;  3HD7 C;  3CC4 P;  2DW3 A;  2KS1 A;  1EDL A;  3CCU P;  4W7Z A;  2MJZ A;  3CC2 P;  4HB1 A;  2J58 A;  2KS1 B;  5APW A;  1GU5 A;  2Q3E A;  3VP9 A;  1NTZ E;  4K3A A;  1L0L E;  5AW1 B;  1SQV K;  3L75 J;  2QIW A;  3A7O A;  1MKM A;  4GKG A;  4UB8 E;  3MZW B;  1NAF A;  3FXE A;  1ZP0 D;  5B66 E;  3USS A;  1ZOY C;  1LTJ C;  1SFC D;  1BCC D;  2H89 C;  4TLF A;  4KJM A;  1T6A A;  3G3Z A;  1S9K D;  1FZC C;  2V4H A;  1SQB G;  2VRS A;  5APS A;  2E43 A;  1EQ7 A;  3EWK A;  5KTB A;  4XA4 A;  1L4A C;  2KXP B;  2OTL P;  1X22 A;  5KLI B;  2YIU C;  1Q2N A;  4DT0 A;  5KLV E;  3AE5 D;  2W90 A;  1GTW A;  3L72 J;  2KYV A;  3Q3D A;  1NGM B;  2KLV A;  1NTM G;  3VRA D;  4LDT A;  1M90 Q;  2GA1 A;  1NTZ G;  1GL2 D;  2NRG A;  2A06 G;  1L0L G;  1X0T A;  2Y9Z A;  1KIL A;  2NPS D;  2WSF H;  2WZ7 A;  3CXH D;  4PD4 D;  3HTK A;  2WDV C;  3GW6 A;  3D71 A;  5AVY B;  2GM4 A;  1RF0 C;  4I6L A;  2O1J A;  1BGY J;  3HUS C;  2QM8 A;  4KX6 D;  3WUT A;  1KIL B;  1LTG C;  3HTK B;  2W8Z A;  2B76 C;  1ZRT D;  3L36 A;  2Y0E A;  1VPC A;  1RQV A;  1VQ6 P;  3V4Q A;  2HPC A;  2BCC J;  2HPC B;  5KKZ B;  1PPJ D;  2Q3I A;  2QJY C;  3CC7 P;  1SQX E;  1FZB A;  3L70 E;  3L72 D;  1VL2 A;  3H1J E;  3CI9 A;  2WU2 C;  2JJL A;  1S5L E;  4Y99 C;  2W27 A;  3BRT B;  1FBM A;  1GK4 A;  3FGA D;  2QJK C;  3SWY A;  4JYB A;  5KAI H;  4C7R A;  4LLH A;  1JY2 O;  2L5G B;  3B5N D;  3VTP C;  1NTZ J;  3AEE C;  2FBW D;  2WDR C;  1NTK G;  3S1K A;  1L0L J;  1RE4 A;  2ZJS E;  4JF7 A;  3L71 G;  3CX5 D;  2GUS A;  4BWN A;  1HJ0 A;  1JY2 N;  1SQB D;  1HBW A;  1P84 E;  1GDT A;  3RK2 C;  5E79 H;  3CPW O;  2E76 B;  5C3J D;  1SQP G;  2ZT9 D;  2QJP B;  3Q5R A;  1HGZ A;  4R4M A;  5AW2 B;  2AEM A;  1UIX A;  1JMB A;  1K04 A;  5APT A;  4IFD K;  3C9I A;  1FDM A;  3S9O A;  1M56 D;  1Q81 Q;  1BSH A;  3AE6 D;  2IPP A;  1A02 F;  3H1I E;  1KD1 Q;  1IK9 A;  5C2T D;  1NTM D;  1NTZ D;  2A06 D;  1L0L D;  2KK7 A;  3M9B A;  3HE4 A;  1KC8 Q;  4UB6 H;  4XFJ A;  3MD0 A;  3AE7 D;  1NEN D;  3U1C A;  1MV8 A;  3HE4 B;  3ITK A;  1PZQ A;  3CIR D;  3V2N A;  2OYO A;  2I1K A;  2P2U A;  3V4W A;  3CCS P;  3M0D C;  5AVX B;  4YXW H;  3A3Y B;  2Q9I A;  1SQQ E;  3P4R D;  1HF9 A;  2FYN B;  4L74 A;  1PGJ A;  2H8P D;  4EOT A;  3CWB G;  2W6B A;  3AEB D;  1PP9 E;  4YXD D;  2XDJ A;  4YT0 D;  2FYU E;  1SQX J;  3MP7 B;  3L70 J;  1MFZ A;  2WDQ C;  2C9L Y;  1ZR2 A;  2FFD A;  4ZNC A;  3P4P D;  3H1L E;  1USE A;  1JTH A;  2FFD B;  2O01 H;  4H44 D;  2E5T A;  3L71 D;  4RKU J;  2M5A A;  1VF5 B;  1JY3 O;  2Q5U A;  1JTH B;  1YQ4 D;  2H43 A;  5C39 A;  2ACZ D;  3W67 A;  2OYI C;  4Y28 J;  4WY4 C;  3O8Z A;  1SLQ A;  2M5A B;  3CXH H;  3AE3 D;  3L73 E;  1OXZ A;  3P8C D;  2Y9Y A;  1JY3 N;  3GMA A;  3KYQ A;  3L74 E;  2R32 A;  5KJ7 D;  1SQP D;  4I6M C;  1L0V C;  2IBZ E;  5H2F E;  2E74 D;  2P7J A;  1AQT A;  3CCQ P;  2BS2 C;  1PV3 A;  4KT0 J;  1IZN B;  4YTM D;  3SFE C;  1PP9 G;  3U1A A;  1KQF B;  1W2E A;  4JPZ B;  1S2E A;  3H6P A;  3H1I J;  1N2D C;  1GMJ A;  1SFC A;  1URQ D;  3M9H A;  2N9B A;  3ABV C;  1FDI A;  1FAV A;  1SFC B;  4H0L D;  3H25 A;  4PD4 I;  4HYT B;  1OW6 A;  1KFM A;  3WUU A;  4DCK A;  4EDF A;  2WSC H;  1EZV I;  4M3L A;  2R5D A;  1GU4 A;  5M1B A;  2B89 A;  3AE9 D;  1USD A;  3E1I A;  2OYH A;  3CX5 H;  3L73 G;  2UWJ E;  3V2Q A;  4EI2 A;  4EIJ A;  2BEQ D;  1NTZ K;  4ZMD A;  5CCH C;  2OTK E;  1L0L K;  1S4X A;  3MUD A;  2OYH B;  5CCH A;  3CWB D;  1FOS F;  1X8Y A;  4D6T E;  3AEE D;  1SQQ J;  1FU1 A;  3A0H H;  2H7H A;  4YTP D;  3R2P A;  3SSU A;  2OGU A;  3B8E B;  4NPF X;  4H13 C;  1FS0 E;  1LNQ A;  3AEG D;  1PP9 J;  2NPS A;  3CL3 D;  2FYU J;  1PL5 A;  1GL2 B;  1IJD B;  2AXT H;  1OWA A;  1A02 J;  2CPB A;  4N78 E;  1RE3 A;  3H1L J;  3H1K G;  4DDI A;  5APU A;  1RHZ B;  5CMZ A;  2P67 A;  1AA0 A;  2KI7 B;  1EDK A;  3NXS A;  1G2C A;  3WU2 E;  1DD4 A;  2C0X A;  2E75 C;  1YQ3 D;  1J1E B;  3LW5 H;  2XKM A;  2Q7C A;  3CCV P;  3L73 J;  1NKZ B;  2QG4 A;  1VQK P;  2H88 C;  3L74 J;  1N73 A;  2D2C D;  1VQ8 P;  1J1D C;  3B71 A;  1PP9 D;  2ZVN B;  3AE1 C;  3M06 A;  1FOS E;  1N73 B;  3L75 G;  3OW2 O;  3B5N A;  3RK3 C;  2BS4 C;  2HFE D;  2RKL A;  4YTN C;  3H1L D;  3NMD A;  2MKV A;  3B5N B;  2Y0D A;  1X79 B;  1KB9 E;  1SQX K;  1EZV G;  1R5L A;  3IAO A;  1VQM P;  3H1K J;  3VRB C;  2WQY D;  5APY A;  3FWL A;  3GLM A;  3L73 D;  3E1R A;  2BS3 C;  1IFD A;  4JBZ A;  3RK3 E;  2WS3 D;  1BE3 E;  2ZVO B;  2ZT9 B;  3BCC E;  3VR9 D;  1JNM A;  2NZ2 A;  5L8R J;  3L72 G;  3EQ2 A; 
#chains in the Genus database with same CATH homology
 4YSY C;  4YTP C;  2WDQ D;  3SFE C;  2WP9 C;  3Q2Y A;  1YQ4 C;  2E75 B;  1KQF B;  2ACZ C;  4KX6 C;  3VR8 D;  3AE6 C;  2WQY C;  1AJY A;  4OGQ C;  1NYH A;  3EWK A;  3IN6 A;  3T97 B;  4YXD D;  3O6Q A;  1KIL E;  4YTN D;  1DD4 A;  2E75 C;  3AE3 C;  3AEG C;  1YQ3 D;  2E76 D;  5C2T C;  3LW5 J;  3FGA D;  2QJK C;  4YSZ D;  2V7Q J;  3C8V A;  1GMJ A;  1TU3 F;  3AEF D;  3P4R D;  1EXI A;  2WS3 C;  1HF9 A;  1KFY D;  2WDV D;  2WPV B;  3Q1M A;  2E74 B;  1OMI A;  3VR9 C;  1DIP A;  2H88 C;  3ABV C;  1EXJ A;  1FDI A;  3AEE C;  4U7J A;  2FBW D;  2WDR C;  2YIU C;  4H0L D;  3H25 A;  2D2C D;  3AE5 D;  2QSI A;  2E74 C;  2FYN C;  3SFD C;  3VRB D;  3AE2 C;  1WMK A;  1ZP0 C;  1JB0 J;  3AEB D;  3AEA C;  3P4Q D;  1VF5 D;  5KLI C;  4H13 D;  1OW6 A;  3RL0 g;  1KF6 D;  1HJ0 A;  2B76 D;  3AEC D;  3B71 A;  3AE1 C;  2WU5 D;  1FDO A;  2WSC J;  3AED D;  3P4S C;  4YT0 D;  2WSE J;  1R8E A;  3Q5S A;  3AE7 C;  1NEN C;  3AE8 D;  5M1B A;  4YTM C;  3CIR C;  2BEZ F;  2WDQ C;  3Q3D A;  1NGM B;  2G8Y A;  3AE9 D;  2E76 B;  3VR8 C;  2J5U A;  4Z1M H;  4IL6 X;  1L0V D;  2YMK A;  2BS4 C;  5C3J D;  1PIX A;  2BEQ D;  3VRA D;  3P4P D;  4YTN C;  1OW8 A;  1YQ3 C;  2E76 C;  2G3A A;  2MKV A;  2ZT9 D;  1NEK D;  4YSZ C;  4YSX D;  3Q5R A;  4R4M A;  1IK7 A;  4PV1 D;  3AEF C;  1UIX A;  3P4R C;  2WSF J;  1K04 A;  2O01 J;  4H0L B;  1KFY C;  1ZOY D;  2D2C B;  4H44 D;  2WDV C;  3AE4 D;  1KMI Z;  3D71 A;  4PV1 B;  1Y9B A;  1DD3 A;  4GDO A;  2JO1 A;  4RKU J;  1ZME C;  2QJP C;  2H89 D;  3AEE D;  1VF5 B;  3IAO A;  2FXP A;  1K05 A;  4H13 B;  2FBW C;  2WU2 D;  4YSY D;  4YTP D;  3SFE D;  3S9O A;  2WP9 D;  4H0L C;  1YQ4 D;  3Q5P A;  2D2C C;  3AE5 C;  2ACZ D;  3VRB C;  2JP3 A;  4KX6 D;  3AEB C;  3AE6 D;  2WQY D;  3P4Q C;  1VF5 C;  4Y28 J;  4OGQ D;  4H13 C;  1S1C X;  3G9R A;  1S5L X;  3AEC C;  4TT3 H;  1KF6 C;  1ZRT E;  2B76 C;  1KOR A;  3R4Y A;  2WU5 C;  3AED C;  1OW7 A;  4YXD C;  3GLM A;  4YT0 C;  2E75 D;  1KQG B;  1E7P C;  3AE3 D;  3AEG D;  1RQU A;  5C2T D;  3AE8 C;  2K9Y A;  3D6Z A;  2BS3 C;  1RQV A;  1U57 A;  3AE9 C;  3RK3 E;  1QLB C;  3GMA A;  2WS3 D;  1PL5 A;  2ZT9 B;  3GF3 A;  3D70 A;  1L0V C;  3VR9 D;  5C3J C;  2H88 D;  3VRA C;  3ABV D;  4I7Z B;  3P4P C;  2QIW A;  2WDR D;  1MKM A;  2IDB A;  4H44 B;  2NZ2 A;  2ZT9 C;  5L8R J;  2E74 D;  1NEK C;  3SFD D;  3AE2 D;  4XFJ A;  1ZP0 D;  4YSX C;  4YTM D;  2QJY C;  4R4L A;  3AEA D;  3D6Y A;  4I7Z C;  4PV1 C;  1Q90 D;  1PV3 A;  2BS2 C;  1ZOY C;  3AE1 D;  4H44 C;  3AE4 C;  4KT0 J;  1VL2 A;  2H89 C;  2OQQ A;  3P4S D;  3AE7 D;  2P10 A;  1NEN D;  3GF7 A;  4OGQ B;  5KKZ C;  1KTM A;  3CIR D;  2WU2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...