3AECC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aecC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aecC02
4YTMC 3ABVC 3AE9D 3AECC 4YSZD 2ACZD 3AE6C 3P4RC 1OW8A 3AEAC 2WP9D 3AE9C 3VRBD 4YSZC 2BS3C 1K04A 2ACZC 2FBWD 4YSXC 2WP9C 3P4QD 2B76D 3VRBC 4YT0D 3AE2D 1PV3A 3SFEC 3P4QC 2B76C 2H88D 3AE8D 4YT0C 3AE2C 2BS2C 3AEFD 2H88C 3AE8C 3P4PD 3AEED 3AEFC 2WDQD 3VRAD 1NEND 3P4PC 3AE4D 3AEEC 2WDQC 3VR9D 3VRAC 3VR8D 3AEDD 5C3JD 1QLBC 2FBWC 1NENC 2WDRD 3AE4C 3CIRD 3AE1D 2WDVD 2WQYD 1OW6A 3VR9C 3S9OA 4YSYD 4KX6D 3VR8C 3AEDC 5C3JC 2WDRC 5C2TD 1YQ4D 3AE5D 3CIRC 2WS3D 3AE1C 1ZOYD 2WDVC 2WQYC 2WU2D 4YSYC 5C2TC 3AE7D 2WS3C 2BS4C 1ZOYC 2WU2C 1ZP0D 1K05A 1L0VD 3AE7C 3AEAD 4YXDD 4YTND 3B71A 1ZP0C 1L0VC 3AEGD 1NEKD 2H89D 4YTPD 1YQ3D 4YSXD 4YXDC 4YTNC 2G3AA 3AEGC 2WU5D 3AEBD 1NEKC 2H89C 3AE3D 4YTPC 1KF6D 3P4SD 4KX6C 1YQ3C 3SFED 1KTMA 1KFYD 1YQ4C 3AE5C 1OW7A 3SFDD 2WU5C 3AEBC 3AE3C 4YTMD 1KF6C 3ABVD 3P4SC 3AECD 1E7PC 1KFYC 3SFDC 3AE6D 3P4RD
chains in the Genus database with same CATH superfamily
1M8OB 3P4RC 2C0WA 1KQFB 3AE9C 3L36A 2AXCA 3B5NA 2BS3C 2YO3A 4ASWA 1BSNA 3E1RA 2N1TA 2HYNA 1JMMA 3FXEA 2A45H 3U1CA 2O1JA 5AVRB 1DH3A 1X79B 3L71E 3GHGA 2NPSA 2BCCG 3KDPB 1IJDB 1S5LX 1S72P 2IBZI 2YMKA 3O8ZA 2YIUC 2HFED 2QJYB 3AEDD 2FYUE 3H1JD 3KHUA 3L70D 4KX6D 3H1KD 5CCGC 4XFJA 2LXCB 1ZRTD 5GTHE 2I8DA 1QX8A 5TJHA 2AXTH 4JYCA 1PZQA 2ITAA 3D6ZA 3VOPA 1KYOH 1LT1A 2KS1A 3FGAD 1FOSE 1KQGB 2YO2A 1NEKC 4PV1C 1A02F 3M0AA 5BU8B 2A45G 1Q90D 3IF4A 3ABVD 1S1CX 3T97B 5APSA 1J2JB 5KJ7D 3L73J 1CI6A 3CWBD 3AECC 1NU1D 4C7NB 1K8AQ 3MP7B 1OFCX 4D6TD 4EI2A 4OGQD 1IK7A 1SQBE 2POHA 1JEKA 1HBWA 5KLVE 3VRBC 3GLMA 3P8MC 1BSHA 1NKNA 4EDFA 3KZIE 1L0NG 1G2CB 2J5UA 1N7SA 5CCHD 3N7NA 3P8CD 2M0BA 3PRJA 4H44D 4LDTA 2Y0EA 1L4AD 4OWFA 1DX7A 5KAIE 2Q5UA 1NEND 1SQXE 1N7LA 2E76C 4O9BA 1M1JC 3R4YA 1SQPG 2L5GB 3VR9C 4DT0A 3H1ID 2K9JA 1Y47A 4KHXA 4L75A 1W2BO 3H1HJ 1LTGC 3HE4B 1KILD 3L37A 4U3FJ 1W5CE 2QIWA 1PGOA 1YQ3D 3L74G 1RE4A 2GA1A 2LKMA 4DDIA 2Q3IA 4LGDE 1GK6A 1PP9J 3EWKA 1SQBK 1NTKJ 3AE5C 1BE3G 1VQ8P 5KLVK 2ZXXA 1EZVI 1KFYC 2W27A 2JJLA 4DHZA 3TK1A 3B5NC 2WSCJ 3CCMP 2P58A 1JCDA 2N1TC 2Y9ZA 2WP9C 2E75B 5AVQB 3RBXA 3VTPC 1NHLA 1LTJB 3IN6A 1ZMEC 1RF0A 1SQXK 4TLFA 3S4RA 3L35A 1KB9I 2H8PD 2E74C 3AE8D 1SFCB 1GU5A 2HODA 3B8EB 3V4QA 3BCCJ 1S9KD 4YXWH 5KAFE 5AW8B 3AE4D 2AEMA 5AVWB 1KQLA 1SS1A 3HUSA 2PFXA 3L75J 5E79E 1BGYJ 4OVNF 4W80A 1JUNA 1EZVE 3H1LG 1YQ4D 2WS3D 1R5SA 2IZ0A 3L71G 2YKPA 4GIFA 5AVYB 1ZOYC 2KIKA 2WU2C 2AEJA 3VMZA 5GTIE 3G6EP 3H1IE 1YITP 1T2KD 4GOFA 1Q86Q 3WUUA 1ZV8A 1KB9E 4YSXD 4YTNC 1S5LE 2OYIB 5AW0B 4YTPC 5B5EE 3V6IA 5CBNA 5AW3B 2WPVB 5KKZB 1FAVA 3L73E 3SFDC 1XTCC 3P32A 1WRGA 3A2AA 2IDBA 1YJNP 2FYNB 1BCCE 3E7KA 1YJWP 2K1AA 5KJ7A 3IR9A 2FBWD 4NPDA 2Y0DA 3A0HH 1PV3A 4IFFA 1N7SC 1HF9A 3AE2C 3D71A 1EDLA 2ZXEB 2IBZG 2ZT9B 2W6BA 3AEED 4RESB 1KC8Q 2RKLA 1KYOD 1AJYA 3CX5I 3A0BH 5CCHA 1KZUB 5EFWB 1WMKA 1P84H 2H7HA 1SQBG 1RE3C 3CIRD 4C7RA 2W83C 5KLIB 5KLVG 3S9OA 3RK3B 1LJ2A 2P67A 2XDJA 5B66H 4K35A 1NH4A 1RQVA 4WBAA 5CMZA 3MUDC 3AEAD 1ZP0C 4U3FE 2FYUJ 3IFMA 2HR3A 1M90Q 1SQXG 1USEA 2O01H 1NTKE 3BASA 3TGUJ 4KT0J 3RL0C 2E75D 3TDKA 1JTHB 1PFIA 2E5YA 2OQQA 3G4SP 4BWNA 4UB8E 1DIPA 2IFNA 4GDOA 1G1JA 1RF0C 1PPJG 1FDMA 2C0XA 5KTBA 1G1IA 1JY2N 2I1JA 1TFFA 1FOSF 3AEFD 4MN4C 2GM4A 1U7MA 3P4PD 4EOTA 1Y9BA 2ZYDA 2B87A 3VRAD 1SLQA 1NTZD 2CK3H 3LW5H 1GDTA 3L75E 5C3JD 1BGYE 3H1LD 3KXDA 4YSYD 3AEDC 2QJPC 3I56P 4PJ0E 3Q1MA 3CXHI 1AQTA 1LT9B 2M3BA 2O1KA 2BS4C 1NTKK 2V4HA 3MTUE 2R3CA 1LP1B 1JCCA 1AQ5A 2H89D 1MUUA 1M1JA 1VF5D 2KUBA 3HE5B 3L4FA 2HPCB 5AW4B 1Y8AA 4UB6E 1KTMA 1EZVG 1YTZI 4IOIH 2GUVA 2A06E 4JF7A 2V7QH 3L70J 3H1KJ 2FXOA 3ABVC 1KORA 3BRVB 1FZBA 4KJMA 4R4LA 2OGUA 3CCSP 3M9BA 5TISH 3JCUE 3CCRP 1SQQE 5KJ7C 3KPEA 3BATA 3CXHE 2ZT9D 2DW3A 4OGQC 3VONA 3E1IA 2IBZD 4K3AA 2FY8A 3L73G 5CCHC 1YIJP 1FZCC 3RK3D 3V4WA 2W6AA 1WT6A 4H44C 3NTNA 2FKWB 1NENC 1NTMD 3M0DC 3PJSK 4NPFX 5AW2B 3OJAB 1RF1B 3W67A 1S4XA 3P7KA 3M06A 1USDA 2PAJA 1EXIA 2D2CB 2JWDA 3VYIA 4PV1B 1DD4A 1NGMB 1LTAC 1E5WA 3VN0A 3WMM0 4PD4H 2WSFJ 1SQQK 3BVHA 1KILC 1YQ3C 3SFED 1URQD 5C39A 3CCUP 4TT3H 3TGUE 3U59A 1QL2A 4YTMD 3LIEA 2PGDA 1MFTA 1BDCA 3CD6P 3N4XA 2LR2A 3H1IJ 3H1HG 4WWIA 2ACZD 2XKMA 3LIDA 1P84D 4U3FG 3BRTB 1ZN5A 1SVFA 1PPJD 4BXLA 1PP9G 2MJZA 3HD7D 1NTKG 2OYHA 2K3RA 4ZKPA 1KFMA 3AE8C 5APQA 3TNUB 2QJYC 1BCCJ 1L0LD 2ZYAA 1CZQA 2WTYA 4WY4D 2Q1KA 3AE4C 2FFDB 2I1KA 1T3UA 3F89A 1OW6A 2FYUK 2WQYD 2B88A 4U7JA 3CI9A 4ZNCA 2NZ2A 2WS3C 2XNXA 1GW4A 3BCCG 1SQVD 3V2NA 4DOJA 2QRXA 5AW9B 1T2KC 3CMAP 2OYIA 2GUSA 1RE3A 3L75G 3AEBD 4IFDK 3H1JE 3L70E 2QM8A 3GMAA 2N1TB 3H1KE 2YMYA 3H25A 1JNMA 2JR8A 2KLUA 1ZRTE 3L72D 1KN7A 1EDKA 2XV5A 3NMDA 2Y0CA 1BDDA 3MUDA 2O01N 3GHGB 2NPSB 2E43A 2P7JA 1JO5A 1LTTC 3GW6A 3CL3D 4L76A 3P4QD 2B76D 3A7OA 1IFJA 3CCVP 1S3JA 3WU2H 5CCGD 1AV1A 1P84E 1N73A 2L91A 2A06G 3RGUA 4EYYQ 1OWAA 1PIXA 2YKQA 2RMZA 1YTZT 2M5AB 1J1DB 3CWBE 1IFPA 3AEEC 3CC2P 1RH5B 1NU1E 1W2EA 4I2LC 2D2CD 3VR8D 3O6QA 1QLBC 2J59M 4D6TE 4HH2A 3SWKA 5AVTB 5GTHH 2BCCD 5APTA 4PV1D 2KS1B 3CIRC 3HTKA 1YHQP 1L2PA 1NKZB 1CW5A 2OTKE 4I1LA 1KFNA 1LWUA 1QVFO 1K05A 4H0LB 3Q5SA 2W6JH 5BU5A 4WVZA 3P8CE 3JC22 3Q5RA 2WPQA 1PL5A 3AEGD 2ZJSE 1U57A 1YYCA 1CI6B 2IYOA 1ZR4A 5H2FE 2OYOA 1J1EC 4AQRD 3RK2B 3CCJP 4QMAA 1FJKA 1OVUA 3H1HD 2KXPB 1NWQA 1GTWA 3AE6D 3ZDMA 1URQA 4H13B 2E75C 3H32A 2K37A 3RL0g 1N7SB 5DJUB 5APYA 2JKVA 2FYUG 1LTIC 2WSEH 3KZIH 4RJTA 2BEZF 2QVAA 1KV4A 1KILE 1PP9D 2OYHC 1HVVA 1Q2NA 2H88D 3TGUG 2BS2C 3MD0A 1IFNA 5KAIH 1H0TA 1SQQJ 5AW5B 2QSIA 2WT7B 2K9JB 3AEFC 3HD7A 2JDIH 4N6JA 5AW7B 3P4PC 2KNCA 3OAKA 1L0ND 1QEXA 3VRAC 1LTBC 4PD4D 2WPSA 1GU4A 1VQKP 5C3JC 4LLHA 1LT9A 2KSEA 3AE5D 4WY4A 4YSYC 4N78D 3IAOA 3FXDA 1T6AA 4Y99C 1FU1A 1LTSC 1FZCA 1GL2B 2A45I 2B9BA 1IK9A 1SQPD 4YXDD 2OYIC 3V2RA 3HE5A 1S9KE 1L4AA 2ZVOB 3M0DA 4I7ZB 1NTZJ 1NJIQ 2WU5D 2H89C 5TISE 1R8EA 1VF5C 2Q3EA 1FJPA 1M57D 2NPSD 3H6PA 4IFMA 2FYNC 2JEEA 2YXRB 2QG4A 3L74D 4YSZD 2HODB 3MZWB 1VPCA 2R44A 1VQPP 1BE3D 1LNQA 1KILA 4BRYB 4RO0A 4HJGH 1M7LA 1RQUA 1N73C 2ZT9C 5AW1B 3I5CA 3JSVC 1KYOI 3TF5A 3HUSB 1JY3O 5KAFH 3L70G 2WITA 3H1KG 1DEEG 1SFCD 1YI2P 2Z5IA 2QJKB 2N9BA 5L8RJ 5KLIC 2HG5D 5AVZB 1KQSO 2WDRD 2JP3A 1RF1A 3B4SA 1MFZA 3AE1D 1YJ9P 4H0LD 1GMJA 1HGZA 1FS0E 1GZLA 1OXZA 2JO1A 3SWYA 1LWUC 2Z4EA 5GTIH 3AE7D 2NRGA 1X0TA 1QGKB 3CPWO 2E5TA 2AXTE 4A7PA 4DCKA 5DJTB 1KB9H 1VQMP 3RK2D 3CLQA 4I6MC 1DEBA 5B5EH 1KYOE 2CPBA 2KZIA 3U1AA 5AVSB 4YPCA 4H13D 3L71D 3AE3D 3P4SD 4KX6C 1SQPE 4EIJA 1NTMJ 3G9RA 1FZGA 1URQC 1PGQA 4YTMC 2OTLP 1HUCA 4DHJA 1NAFA 2KSJA 2KYVA 1NO4A 2KZJA 2C9LY 2ACZC 1T8ZA 2C9NY 4W7YA 3FX0A 2QEXP 3T97A 5CHXA 1IC2A 2R5BA 3L74E 3H1JJ 4C7NA 4XE5B 5AVUB 1NAYA 3FWLA 3HD7C 3H1IG 1M1KQ 2R5DA 2WDQD 3PTZA 2YXQB 4M3LA 1Q82Q 1G2CA 1JY3P 3KYQA 1LT9C 4JPZB 2WDVD 1GL2D 4WY4C 2YIUB 4DHIB 1QL1A 2KP8A 2WQYC 5APVA 1VQ5P 2KK7A 3RBZA 3GG2A 1E79H 3CWBJ 3SWFA 1BCCG 1SQBD 1L4AC 1NU1J 5KLVD 2SPZA 2P2UA 4D6TJ 1L0LJ 1NTZE 3II6A 1ZR2A 1KF6D 1NOHA 3CX5H 1OW7A 3H1LE 2O01J 3AEBC 1GD2E 2YKOA 1QLED 1XTGB 3MGNA 1X8YA 3HE4A 2J58A 3EQ2A 2WSCH 4UB8H 3W68A 1QVGO 2FXMA 2Y9YA 1SQXD 1HJ0A 3WU2E 3CC7P 1SQVJ 1IFDA 2N9YB 2B87B 5APWA 4YT0D 1R5LA 3P4QC 4B86A 2B76C 4IL6H 1FZFA 3A5TA 2IFMA 2M5AA 1ZLLA 2MKVA 2O3JA 1OIPA 1MZ9A 3M9QA 5CJ4A 5BVZA 1LTJA 4JBZA 1A02J 1RF1C 3L72J 3OW2O 1SFCA 4PJ0H 1JOCA 2R3SA 3LW5J 2D2CC 3VR8C 5C2TD 3EFGA 2E76B 1NTZK 1M1JB 1JM0A 1OVRA 3I55P 2QA4P 2IBZE 1L0VD 4CPGA 3TYYA 2WZ7A 4UB6H 3RK3E 3AEGC 1JMBA 4ZMDA 3FWNA 1YQ4C 1NTME 1P84I 2BCCJ 3VMAA 4JQ0D 3JCUH 3P4RD 4AUWA 3AE9D 2ZYGA 1TU3F 2V7QJ 3C9IA 3CCLP 2M8RA 3AE6C 3CXHH 3V2PA 1EZVD 1BGYG 3MIWA 4YSXC 1FZAA 2WMMA 3PHLA 3B5NB 2JWAA 1YBKA 1KD1Q 3A0HE 1IZNB 1VQ6P 2M3EA 2WT7A 2H88C 1AVYA 2E74B 3GF3A 2BEQD 2FFDC 1KB9D 1Q7YQ 2FBWC 3A3YB 3A0BE 3CCQP 1VQ7P 2XZRA 3CMEP 2HLOA 2K9YA 2CPSA 3L73D 4IL6X 4RKUJ 2BASA 1EXJA 1HH0A 1N86A 1PPJE 1ZW0A 4GODA 1FC2C 1RHZB 1X22A 1GL2A 1FE6A 1BCCD 5B66E 4WB4A 1NTMK 3QWOC 1SQQG 4LC1A 1J1EB 4OH8B 1IFIA 2VRSA 1NEKD 1K73Q 1UIXA 1L0LE 3K5BA 4YXDC 2Q7CA 2G3AA 2K88A 3NXSA 3VMYA 1N2DC 1L0NJ 3ITKA 1OVVA 2WU5C 1HWTC 3AECD 5AVVB 5M1BA 3GHGC 2NPSC 3KQGA 2IPPA 2XNDH 2LXBA 1EC5A 1OMIA 2OYHB 3R2PA 1VDFA 1OW8A 2OTJP 3AEAC 4GKGA 4XA4A 1ZXGA 4NPEA 3VRBD 4YSZC 1K04A 4BRYA 2RN0A 1SQVE 1HTLC 1SQPJ 2Q9IA 1NTZG 1JTHA 3HRNA 2IYPA 2E42A 1EQ7A 3F5HA 1J1DC 1AA0A 3C1LA 5AW6B 4U3FD 1LTJC 3Q2YA 1S2EA 2E76D 1NVOA 1GW3A 1SFCC 1PGJA 1CSBA 3L72E 3VR9D 3L74J 1NTKD 2ZAEB 1NU1K 1Z56A 4Y99B 1VQ9P 2ZFCA 3M9HA 2Q6QA 4HKZH 2WDRC 1Q81Q 3CX5D 1VQNP 1BE3J 1L0LK 3AE1C 5CBOA 4H0LC 1GK4A 1IO4A 1OX3A 4R4MA 2PRRA 3AE7C 4W7ZA 3VMXA 2KI7B 1VF5B 3SSUA 3USSA 2R32A 2UWJE 3RK2C 2QE7H 3TSIA 3M91A 1KFYD 3CCEP 1LP1A 3OA7A 1SQVK 3BCCD 2ZFYA 4H13C 3AE3C 1H8AA 1K9MQ 4HYTB 2BCCE 4JYBA 3P4SC 3V5BA 3G3ZA 3B5ND 4ZKUA 1AVOA 2FXPA 1MKMA 5APUA 2N1TD 3L75D 1N73B 2HPCA 3RL0B 1BGYD 2WP9D 5KKZC 1FDOA 3PH0A 1OZHA 2E74D 2IZ1A 3H1LJ 1T3JA 1HJBA 1EDJA 1RY3A 2QM7A 3O6QB 1NTMG 1PGPA 2B89A 3L71J 4PD4I 3QH9A 4GT1A 4AYCA 3HTKB 2KLVA 3H1HE 2KOGA 3MHVA 2P1JA 1LWUB 2WDQC 3V2QA 2KB7P 5APXA 3NFQA 4DJGA 1H89A 1RE4C 2A06D 3H1JG 3Q5PA 1N8RQ 1JY2O 2Z5HA 1ZOYD 2WDVC 1GL2C 2WVRA 1PP9E 3CC4P 2WU2D 2WSSH 1UIIA 5CCGA 1SQQD 5K5GB 3D6YA 1AFOA 2QJPB 5E79H 3CX5E 4I7ZC 3RK3C 3CXHD 2WSFH 4YTND 3B71A 5H2FH 1FZEA 2OARA 2W90A 4YTPD 1URQB 5CJ0A 3H32B 1L0NE 1X9VA 4PD4E 4C46A 2PP6A 3SFDD 3GF7A 1VL2A 1KF6C 1FBMA 1E7PC 1JY3N 4Y28J 1VQOP 1S5LH 4N78E 2W8ZA 3CWBG 4IL6E 1M56D 1H88A 3BCCE 1NU1G 1JB0J 4FJVA 1H0TB 4D6TG 3EFFK 5AVXB 1SQBJ 3HUSC 3HD7B 1L0LG 1N7SD 5KLVJ 2IX7C 3AE2D 1FDIA 2KNCB 3SFEC 4I6LA 2WSEJ 2FYZA 1D7MA 4YT0C 3S1KA 2QJKC 1U7JA 4OGQB 3D70A 1VQ4P 2FYUD 1LGHB 4WY4B 2AEFA 4DDGA 3PLNA 1NYHA 4Z1MH 1SQXJ 1KMIZ 3WUTA 1FZCB 3TGUD 1SQVG 1IFMA 4H44B 3TNUA 2RH0A 1BE3E 1L4AB 1SP4A 3PP5A 3VP8A 2P10A 4L73A 3G71P 5C2TC 1EDIA 1L0NK 3WUVA 2WPRA 2G8YA 1ZP0D 3Q3DA 4DZOA 2FFDA 1HGVA 2H43A 4N3YB 1JY2P 1L0VC 2YNYA 3L72G 3C8VA 2XU6A 2WWWA 4GOEA 3RL0D 3UIAA 1VQLP 1DD3A 1SQPK 1KILB 4L74A 1MV8A 3VP9A 2ZVNB 4ASVA 4HB1A
chains in the Genus database with same CATH topology
1ZRTE 4YTMC 3ABVC 1KORA 4R4LA 3AE9D 3AECC 2FXPA 1MKMA 1TU3F 4H13B 4YSZD 1OMIA 2V7QJ 2ACZD 1HJ0A 2E75C 2IDBA 2OQQA 3AE6C 3RL0g 3P4RC 1OW8A 1DIPA 2WSCJ 3AEAC 1KQFB 1JB0J 5KKZC 3AE9C 2WP9D 4GDOA 3VRBD 4OGQD 4YSZC 2BS3C 1K04A 2ACZC 1IK7A 1FDOA 2FBWD 4YSXC 2ZT9D 2BEZF 2WP9C 2E75B 3P4QD 2B76D 3VRBC 4OGQC 2E74D 3GLMA 1KILE 4YT0D 3IN6A 1ZMEC 3AE2D 1FDIA 1RQUA 1PV3A 3SFEC 2ZT9C 2WSEJ 2B76C 3P4QC 2J5UA 2E74C 2H88D 1HF9A 3AE8D 4YT0C 3AE2C 2QJKC 2BS2C 3D71A 4OGQB 3D70A 3AEFD 2H88C 3AE8C 2ZT9B 3P4PD 1S5LX 3Q2YA 2MKVA 3AEED 1PIXA 2E74B 2QJYC 2QSIA 4H44D 3AEFC 2WDQD 1Y9BA 3GF3A 5L8RJ 2BEQD 3VRAD 1AJYA 2YMKA 2E76D 1NEND 5KLIC 3P4PC 1NYHA 3AE4D 3AEEC 4H44C 1WMKA 2YIUC 4Z1MH 2WDQC 3VR9D 2D2CD 1KMIZ 3VRAC 3VR8D 3O6QA 3AEDD 5C3JD 1QLBC 2E76C 2FBWC 2JP3A 1NENC 2WDRD 3AE4C 3R4YA 3CIRD 3AE1D 3LW5J 4H0LD 1GMJA 2WDVD 2WQYD 1OW6A 2D2CC 3VR9C 3S9OA 4YSYD 2K9YA 4PV1D 4H44B 3AEDC 4KX6D 3Q5PA 2WDRC 3VR8C 5C2TD 5C3JC 2QJPC 1YQ4D 4U7JA 3AE5D 3CIRC 4IL6X 3Q1MA 3AE1C 2WS3D 4RKUJ 4XFJA 2E76B 4H0LC 1EXJA 2JO1A 1ZOYD 2WQYC 2WDVC 2P10A 2WU2D 4YSYC 3IAOA 5C2TC 3AE7D 1EXIA 2D2CB 2NZ2A 2WS3C 3D6YA 2BS4C 1ZOYC 1RQVA 2WU2C 2G8YA 4R4MA 3D6ZA 1K05A 1ZP0D 3Q3DA 1L0VD 4H0LB 3AE7C 3Q5SA 4I7ZC 4PV1B 1DD4A 1VF5B 1NGMB 3AEAD 4YXDD 4YTND 3B71A 1ZP0C 3Q5RA 1L0VC 1PL5A 3AEGD 1U57A 1NEKD 3FGAD 2H89D 1UIXA 2QIWA 3RK3E 4YTPD 1YQ3D 4YSXD 1VF5D 4YXDC 4YTNC 4I7ZB 1KQGB 2WSFJ 3C8VA 2G3AA 3AEGC 2WU5D 4H13D 3AEBD 1NEKC 2H89C 3AE3D 4YTPC 1KF6D 1R8EA 4PV1C 3P4SD 1YQ3C 4KX6C 3SFED 1KTMA 1VF5C 3EWKA 2WPVB 1KFYD 1YQ4C 3AE5C 1DD3A 1Q90D 1OW7A 4TT3H 3SFDD 2WU5C 3GF7A 3G9RA 2O01J 3AE3C 1VL2A 3AEBC 4H13C 4YTMD 1KF6C 3ABVD 1S1CX 3GMAA 3AECD 3P4SC 4KT0J 1E7PC 1KFYC 5M1BA 3T97B 2FYNC 3H25A 2E75D 3SFDC 3AE6D 3P4RD 4Y28J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTM C;  3ABV C;  3AE9 D;  3AEC C;  4YSZ D;  2ACZ D;  3AE6 C;  3P4R C;  1OW8 A;  3AEA C;  2WP9 D;  3AE9 C;  3VRB D;  4YSZ C;  2BS3 C;  1K04 A;  2ACZ C;  2FBW D;  4YSX C;  2WP9 C;  3P4Q D;  2B76 D;  3VRB C;  4YT0 D;  3AE2 D;  1PV3 A;  3SFE C;  3P4Q C;  2B76 C;  2H88 D;  3AE8 D;  4YT0 C;  3AE2 C;  2BS2 C;  3AEF D;  2H88 C;  3AE8 C;  3P4P D;  3AEE D;  3AEF C;  2WDQ D;  3VRA D;  1NEN D;  3P4P C;  3AE4 D;  3AEE C;  2WDQ C;  3VR9 D;  3VRA C;  3VR8 D;  3AED D;  5C3J D;  1QLB C;  2FBW C;  1NEN C;  2WDR D;  3AE4 C;  3CIR D;  3AE1 D;  2WDV D;  2WQY D;  1OW6 A;  3VR9 C;  3S9O A;  4YSY D;  4KX6 D;  3VR8 C;  3AED C;  5C3J C;  2WDR C;  5C2T D;  1YQ4 D;  3AE5 D;  3CIR C;  2WS3 D;  3AE1 C;  1ZOY D;  2WDV C;  2WQY C;  2WU2 D;  4YSY C;  5C2T C;  3AE7 D;  2WS3 C;  2BS4 C;  1ZOY C;  2WU2 C;  1ZP0 D;  1K05 A;  1L0V D;  3AE7 C;  3AEA D;  4YXD D;  4YTN D;  3B71 A;  1ZP0 C;  1L0V C;  3AEG D;  1NEK D;  2H89 D;  4YTP D;  1YQ3 D;  4YSX D;  4YXD C;  4YTN C;  2G3A A;  3AEG C;  2WU5 D;  3AEB D;  1NEK C;  2H89 C;  3AE3 D;  4YTP C;  1KF6 D;  3P4S D;  4KX6 C;  1YQ3 C;  3SFE D;  1KTM A;  1KFY D;  1YQ4 C;  3AE5 C;  1OW7 A;  3SFD D;  2WU5 C;  3AEB C;  3AE3 C;  4YTM D;  1KF6 C;  3ABV D;  3P4S C;  3AEC D;  1E7P C;  1KFY C;  3SFD C;  3AE6 D;  3P4R D; 
#chains in the Genus database with same CATH topology
 1M8O B;  3P4R C;  2C0W A;  1KQF B;  3AE9 C;  3L36 A;  2AXC A;  3B5N A;  2BS3 C;  2YO3 A;  4ASW A;  1BSN A;  3E1R A;  2N1T A;  2HYN A;  1JMM A;  3FXE A;  2A45 H;  3U1C A;  2O1J A;  5AVR B;  1DH3 A;  1X79 B;  3L71 E;  3GHG A;  2NPS A;  2BCC G;  3KDP B;  1IJD B;  1S5L X;  1S72 P;  2IBZ I;  2YMK A;  3O8Z A;  2YIU C;  2HFE D;  2QJY B;  3AED D;  2FYU E;  3H1J D;  3KHU A;  3L70 D;  4KX6 D;  3H1K D;  5CCG C;  4XFJ A;  2LXC B;  1ZRT D;  5GTH E;  2I8D A;  1QX8 A;  5TJH A;  2AXT H;  4JYC A;  1PZQ A;  2ITA A;  3D6Z A;  3VOP A;  1KYO H;  1LT1 A;  2KS1 A;  3FGA D;  1FOS E;  1KQG B;  2YO2 A;  1NEK C;  4PV1 C;  1A02 F;  3M0A A;  5BU8 B;  2A45 G;  1Q90 D;  3IF4 A;  3ABV D;  1S1C X;  3T97 B;  5APS A;  1J2J B;  5KJ7 D;  3L73 J;  1CI6 A;  3CWB D;  3AEC C;  1NU1 D;  4C7N B;  1K8A Q;  3MP7 B;  1OFC X;  4D6T D;  4EI2 A;  4OGQ D;  1IK7 A;  1SQB E;  2POH A;  1JEK A;  1HBW A;  5KLV E;  3VRB C;  3GLM A;  3P8M C;  1BSH A;  1NKN A;  4EDF A;  3KZI E;  1L0N G;  1G2C B;  2J5U A;  1N7S A;  5CCH D;  3N7N A;  3P8C D;  2M0B A;  3PRJ A;  4H44 D;  4LDT A;  2Y0E A;  1L4A D;  4OWF A;  1DX7 A;  5KAI E;  2Q5U A;  1NEN D;  1SQX E;  1N7L A;  2E76 C;  4O9B A;  1M1J C;  3R4Y A;  1SQP G;  2L5G B;  3VR9 C;  4DT0 A;  3H1I D;  2K9J A;  1Y47 A;  4KHX A;  4L75 A;  1W2B O;  3H1H J;  1LTG C;  3HE4 B;  1KIL D;  3L37 A;  4U3F J;  1W5C E;  2QIW A;  1PGO A;  1YQ3 D;  3L74 G;  1RE4 A;  2GA1 A;  2LKM A;  4DDI A;  2Q3I A;  4LGD E;  1GK6 A;  1PP9 J;  3EWK A;  1SQB K;  1NTK J;  3AE5 C;  1BE3 G;  1VQ8 P;  5KLV K;  2ZXX A;  1EZV I;  1KFY C;  2W27 A;  2JJL A;  4DHZ A;  3TK1 A;  3B5N C;  2WSC J;  3CCM P;  2P58 A;  1JCD A;  2N1T C;  2Y9Z A;  2WP9 C;  2E75 B;  5AVQ B;  3RBX A;  3VTP C;  1NHL A;  1LTJ B;  3IN6 A;  1ZME C;  1RF0 A;  1SQX K;  4TLF A;  3S4R A;  3L35 A;  1KB9 I;  2H8P D;  2E74 C;  3AE8 D;  1SFC B;  1GU5 A;  2HOD A;  3B8E B;  3V4Q A;  3BCC J;  1S9K D;  4YXW H;  5KAF E;  5AW8 B;  3AE4 D;  2AEM A;  5AVW B;  1KQL A;  1SS1 A;  3HUS A;  2PFX A;  3L75 J;  5E79 E;  1BGY J;  4OVN F;  4W80 A;  1JUN A;  1EZV E;  3H1L G;  1YQ4 D;  2WS3 D;  1R5S A;  2IZ0 A;  3L71 G;  2YKP A;  4GIF A;  5AVY B;  1ZOY C;  2KIK A;  2WU2 C;  2AEJ A;  3VMZ A;  5GTI E;  3G6E P;  3H1I E;  1YIT P;  1T2K D;  4GOF A;  1Q86 Q;  3WUU A;  1ZV8 A;  1KB9 E;  4YSX D;  4YTN C;  1S5L E;  2OYI B;  5AW0 B;  4YTP C;  5B5E E;  3V6I A;  5CBN A;  5AW3 B;  2WPV B;  5KKZ B;  1FAV A;  3L73 E;  3SFD C;  1XTC C;  3P32 A;  1WRG A;  3A2A A;  2IDB A;  1YJN P;  2FYN B;  1BCC E;  3E7K A;  1YJW P;  2K1A A;  5KJ7 A;  3IR9 A;  2FBW D;  4NPD A;  2Y0D A;  3A0H H;  1PV3 A;  4IFF A;  1N7S C;  1HF9 A;  3AE2 C;  3D71 A;  1EDL A;  2ZXE B;  2IBZ G;  2ZT9 B;  2W6B A;  3AEE D;  4RES B;  1KC8 Q;  2RKL A;  1KYO D;  1AJY A;  3CX5 I;  3A0B H;  5CCH A;  1KZU B;  5EFW B;  1WMK A;  1P84 H;  2H7H A;  1SQB G;  1RE3 C;  3CIR D;  4C7R A;  2W83 C;  5KLI B;  5KLV G;  3S9O A;  3RK3 B;  1LJ2 A;  2P67 A;  2XDJ A;  5B66 H;  4K35 A;  1NH4 A;  1RQV A;  4WBA A;  5CMZ A;  3MUD C;  3AEA D;  1ZP0 C;  4U3F E;  2FYU J;  3IFM A;  2HR3 A;  1M90 Q;  1SQX G;  1USE A;  2O01 H;  1NTK E;  3BAS A;  3TGU J;  4KT0 J;  3RL0 C;  2E75 D;  3TDK A;  1JTH B;  1PFI A;  2E5Y A;  2OQQ A;  3G4S P;  4BWN A;  4UB8 E;  1DIP A;  2IFN A;  4GDO A;  1G1J A;  1RF0 C;  1PPJ G;  1FDM A;  2C0X A;  5KTB A;  1G1I A;  1JY2 N;  2I1J A;  1TFF A;  1FOS F;  3AEF D;  4MN4 C;  2GM4 A;  1U7M A;  3P4P D;  4EOT A;  1Y9B A;  2ZYD A;  2B87 A;  3VRA D;  1SLQ A;  1NTZ D;  2CK3 H;  3LW5 H;  1GDT A;  3L75 E;  5C3J D;  1BGY E;  3H1L D;  3KXD A;  4YSY D;  3AED C;  2QJP C;  3I56 P;  4PJ0 E;  3Q1M A;  3CXH I;  1AQT A;  1LT9 B;  2M3B A;  2O1K A;  2BS4 C;  1NTK K;  2V4H A;  3MTU E;  2R3C A;  1LP1 B;  1JCC A;  1AQ5 A;  2H89 D;  1MUU A;  1M1J A;  1VF5 D;  2KUB A;  3HE5 B;  3L4F A;  2HPC B;  5AW4 B;  1Y8A A;  4UB6 E;  1KTM A;  1EZV G;  1YTZ I;  4IOI H;  2GUV A;  2A06 E;  4JF7 A;  2V7Q H;  3L70 J;  3H1K J;  2FXO A;  3ABV C;  1KOR A;  3BRV B;  1FZB A;  4KJM A;  4R4L A;  2OGU A;  3CCS P;  3M9B A;  5TIS H;  3JCU E;  3CCR P;  1SQQ E;  5KJ7 C;  3KPE A;  3BAT A;  3CXH E;  2ZT9 D;  2DW3 A;  4OGQ C;  3VON A;  3E1I A;  2IBZ D;  4K3A A;  2FY8 A;  3L73 G;  5CCH C;  1YIJ P;  1FZC C;  3RK3 D;  3V4W A;  2W6A A;  1WT6 A;  4H44 C;  3NTN A;  2FKW B;  1NEN C;  1NTM D;  3M0D C;  3PJS K;  4NPF X;  5AW2 B;  3OJA B;  1RF1 B;  3W67 A;  1S4X A;  3P7K A;  3M06 A;  1USD A;  2PAJ A;  1EXI A;  2D2C B;  2JWD A;  3VYI A;  4PV1 B;  1DD4 A;  1NGM B;  1LTA C;  1E5W A;  3VN0 A;  3WMM 0;  4PD4 H;  2WSF J;  1SQQ K;  3BVH A;  1KIL C;  1YQ3 C;  3SFE D;  1URQ D;  5C39 A;  3CCU P;  4TT3 H;  3TGU E;  3U59 A;  1QL2 A;  4YTM D;  3LIE A;  2PGD A;  1MFT A;  1BDC A;  3CD6 P;  3N4X A;  2LR2 A;  3H1I J;  3H1H G;  4WWI A;  2ACZ D;  2XKM A;  3LID A;  1P84 D;  4U3F G;  3BRT B;  1ZN5 A;  1SVF A;  1PPJ D;  4BXL A;  1PP9 G;  2MJZ A;  3HD7 D;  1NTK G;  2OYH A;  2K3R A;  4ZKP A;  1KFM A;  3AE8 C;  5APQ A;  3TNU B;  2QJY C;  1BCC J;  1L0L D;  2ZYA A;  1CZQ A;  2WTY A;  4WY4 D;  2Q1K A;  3AE4 C;  2FFD B;  2I1K A;  1T3U A;  3F89 A;  1OW6 A;  2FYU K;  2WQY D;  2B88 A;  4U7J A;  3CI9 A;  4ZNC A;  2NZ2 A;  2WS3 C;  2XNX A;  1GW4 A;  3BCC G;  1SQV D;  3V2N A;  4DOJ A;  2QRX A;  5AW9 B;  1T2K C;  3CMA P;  2OYI A;  2GUS A;  1RE3 A;  3L75 G;  3AEB D;  4IFD K;  3H1J E;  3L70 E;  2QM8 A;  3GMA A;  2N1T B;  3H1K E;  2YMY A;  3H25 A;  1JNM A;  2JR8 A;  2KLU A;  1ZRT E;  3L72 D;  1KN7 A;  1EDK A;  2XV5 A;  3NMD A;  2Y0C A;  1BDD A;  3MUD A;  2O01 N;  3GHG B;  2NPS B;  2E43 A;  2P7J A;  1JO5 A;  1LTT C;  3GW6 A;  3CL3 D;  4L76 A;  3P4Q D;  2B76 D;  3A7O A;  1IFJ A;  3CCV P;  1S3J A;  3WU2 H;  5CCG D;  1AV1 A;  1P84 E;  1N73 A;  2L91 A;  2A06 G;  3RGU A;  4EYY Q;  1OWA A;  1PIX A;  2YKQ A;  2RMZ A;  1YTZ T;  2M5A B;  1J1D B;  3CWB E;  1IFP A;  3AEE C;  3CC2 P;  1RH5 B;  1NU1 E;  1W2E A;  4I2L C;  2D2C D;  3VR8 D;  3O6Q A;  1QLB C;  2J59 M;  4D6T E;  4HH2 A;  3SWK A;  5AVT B;  5GTH H;  2BCC D;  5APT A;  4PV1 D;  2KS1 B;  3CIR C;  3HTK A;  1YHQ P;  1L2P A;  1NKZ B;  1CW5 A;  2OTK E;  4I1L A;  1KFN A;  1LWU A;  1QVF O;  1K05 A;  4H0L B;  3Q5S A;  2W6J H;  5BU5 A;  4WVZ A;  3P8C E;  3JC2 2;  3Q5R A;  2WPQ A;  1PL5 A;  3AEG D;  2ZJS E;  1U57 A;  1YYC A;  1CI6 B;  2IYO A;  1ZR4 A;  5H2F E;  2OYO A;  1J1E C;  4AQR D;  3RK2 B;  3CCJ P;  4QMA A;  1FJK A;  1OVU A;  3H1H D;  2KXP B;  1NWQ A;  1GTW A;  3AE6 D;  3ZDM A;  1URQ A;  4H13 B;  2E75 C;  3H32 A;  2K37 A;  3RL0 g;  1N7S B;  5DJU B;  5APY A;  2JKV A;  2FYU G;  1LTI C;  2WSE H;  3KZI H;  4RJT A;  2BEZ F;  2QVA A;  1KV4 A;  1KIL E;  1PP9 D;  2OYH C;  1HVV A;  1Q2N A;  2H88 D;  3TGU G;  2BS2 C;  3MD0 A;  1IFN A;  5KAI H;  1H0T A;  1SQQ J;  5AW5 B;  2QSI A;  2WT7 B;  2K9J B;  3AEF C;  3HD7 A;  2JDI H;  4N6J A;  5AW7 B;  3P4P C;  2KNC A;  3OAK A;  1L0N D;  1QEX A;  3VRA C;  1LTB C;  4PD4 D;  2WPS A;  1GU4 A;  1VQK P;  5C3J C;  4LLH A;  1LT9 A;  2KSE A;  3AE5 D;  4WY4 A;  4YSY C;  4N78 D;  3IAO A;  3FXD A;  1T6A A;  4Y99 C;  1FU1 A;  1LTS C;  1FZC A;  1GL2 B;  2A45 I;  2B9B A;  1IK9 A;  1SQP D;  4YXD D;  2OYI C;  3V2R A;  3HE5 A;  1S9K E;  1L4A A;  2ZVO B;  3M0D A;  4I7Z B;  1NTZ J;  1NJI Q;  2WU5 D;  2H89 C;  5TIS E;  1R8E A;  1VF5 C;  2Q3E A;  1FJP A;  1M57 D;  2NPS D;  3H6P A;  4IFM A;  2FYN C;  2JEE A;  2YXR B;  2QG4 A;  3L74 D;  4YSZ D;  2HOD B;  3MZW B;  1VPC A;  2R44 A;  1VQP P;  1BE3 D;  1LNQ A;  1KIL A;  4BRY B;  4RO0 A;  4HJG H;  1M7L A;  1RQU A;  1N73 C;  2ZT9 C;  5AW1 B;  3I5C A;  3JSV C;  1KYO I;  3TF5 A;  3HUS B;  1JY3 O;  5KAF H;  3L70 G;  2WIT A;  3H1K G;  1DEE G;  1SFC D;  1YI2 P;  2Z5I A;  2QJK B;  2N9B A;  5L8R J;  5KLI C;  2HG5 D;  5AVZ B;  1KQS O;  2WDR D;  2JP3 A;  1RF1 A;  3B4S A;  1MFZ A;  3AE1 D;  1YJ9 P;  4H0L D;  1GMJ A;  1HGZ A;  1FS0 E;  1GZL A;  1OXZ A;  2JO1 A;  3SWY A;  1LWU C;  2Z4E A;  5GTI H;  3AE7 D;  2NRG A;  1X0T A;  1QGK B;  3CPW O;  2E5T A;  2AXT E;  4A7P A;  4DCK A;  5DJT B;  1KB9 H;  1VQM P;  3RK2 D;  3CLQ A;  4I6M C;  1DEB A;  5B5E H;  1KYO E;  2CPB A;  2KZI A;  3U1A A;  5AVS B;  4YPC A;  4H13 D;  3L71 D;  3AE3 D;  3P4S D;  4KX6 C;  1SQP E;  4EIJ A;  1NTM J;  3G9R A;  1FZG A;  1URQ C;  1PGQ A;  4YTM C;  2OTL P;  1HUC A;  4DHJ A;  1NAF A;  2KSJ A;  2KYV A;  1NO4 A;  2KZJ A;  2C9L Y;  2ACZ C;  1T8Z A;  2C9N Y;  4W7Y A;  3FX0 A;  2QEX P;  3T97 A;  5CHX A;  1IC2 A;  2R5B A;  3L74 E;  3H1J J;  4C7N A;  4XE5 B;  5AVU B;  1NAY A;  3FWL A;  3HD7 C;  3H1I G;  1M1K Q;  2R5D A;  2WDQ D;  3PTZ A;  2YXQ B;  4M3L A;  1Q82 Q;  1G2C A;  1JY3 P;  3KYQ A;  1LT9 C;  4JPZ B;  2WDV D;  1GL2 D;  4WY4 C;  2YIU B;  4DHI B;  1QL1 A;  2KP8 A;  2WQY C;  5APV A;  1VQ5 P;  2KK7 A;  3RBZ A;  3GG2 A;  1E79 H;  3CWB J;  3SWF A;  1BCC G;  1SQB D;  1L4A C;  1NU1 J;  5KLV D;  2SPZ A;  2P2U A;  4D6T J;  1L0L J;  1NTZ E;  3II6 A;  1ZR2 A;  1KF6 D;  1NOH A;  3CX5 H;  1OW7 A;  3H1L E;  2O01 J;  3AEB C;  1GD2 E;  2YKO A;  1QLE D;  1XTG B;  3MGN A;  1X8Y A;  3HE4 A;  2J58 A;  3EQ2 A;  2WSC H;  4UB8 H;  3W68 A;  1QVG O;  2FXM A;  2Y9Y A;  1SQX D;  1HJ0 A;  3WU2 E;  3CC7 P;  1SQV J;  1IFD A;  2N9Y B;  2B87 B;  5APW A;  4YT0 D;  1R5L A;  3P4Q C;  4B86 A;  2B76 C;  4IL6 H;  1FZF A;  3A5T A;  2IFM A;  2M5A A;  1ZLL A;  2MKV A;  2O3J A;  1OIP A;  1MZ9 A;  3M9Q A;  5CJ4 A;  5BVZ A;  1LTJ A;  4JBZ A;  1A02 J;  1RF1 C;  3L72 J;  3OW2 O;  1SFC A;  4PJ0 H;  1JOC A;  2R3S A;  3LW5 J;  2D2C C;  3VR8 C;  5C2T D;  3EFG A;  2E76 B;  1NTZ K;  1M1J B;  1JM0 A;  1OVR A;  3I55 P;  2QA4 P;  2IBZ E;  1L0V D;  4CPG A;  3TYY A;  2WZ7 A;  4UB6 H;  3RK3 E;  3AEG C;  1JMB A;  4ZMD A;  3FWN A;  1YQ4 C;  1NTM E;  1P84 I;  2BCC J;  3VMA A;  4JQ0 D;  3JCU H;  3P4R D;  4AUW A;  3AE9 D;  2ZYG A;  1TU3 F;  2V7Q J;  3C9I A;  3CCL P;  2M8R A;  3AE6 C;  3CXH H;  3V2P A;  1EZV D;  1BGY G;  3MIW A;  4YSX C;  1FZA A;  2WMM A;  3PHL A;  3B5N B;  2JWA A;  1YBK A;  1KD1 Q;  3A0H E;  1IZN B;  1VQ6 P;  2M3E A;  2WT7 A;  2H88 C;  1AVY A;  2E74 B;  3GF3 A;  2BEQ D;  2FFD C;  1KB9 D;  1Q7Y Q;  2FBW C;  3A3Y B;  3A0B E;  3CCQ P;  1VQ7 P;  2XZR A;  3CME P;  2HLO A;  2K9Y A;  2CPS A;  3L73 D;  4IL6 X;  4RKU J;  2BAS A;  1EXJ A;  1HH0 A;  1N86 A;  1PPJ E;  1ZW0 A;  4GOD A;  1FC2 C;  1RHZ B;  1X22 A;  1GL2 A;  1FE6 A;  1BCC D;  5B66 E;  4WB4 A;  1NTM K;  3QWO C;  1SQQ G;  4LC1 A;  1J1E B;  4OH8 B;  1IFI A;  2VRS A;  1NEK D;  1K73 Q;  1UIX A;  1L0L E;  3K5B A;  4YXD C;  2Q7C A;  2G3A A;  2K88 A;  3NXS A;  3VMY A;  1N2D C;  1L0N J;  3ITK A;  1OVV A;  2WU5 C;  1HWT C;  3AEC D;  5AVV B;  5M1B A;  3GHG C;  2NPS C;  3KQG A;  2IPP A;  2XND H;  2LXB A;  1EC5 A;  1OMI A;  2OYH B;  3R2P A;  1VDF A;  1OW8 A;  2OTJ P;  3AEA C;  4GKG A;  4XA4 A;  1ZXG A;  4NPE A;  3VRB D;  4YSZ C;  1K04 A;  4BRY A;  2RN0 A;  1SQV E;  1HTL C;  1SQP J;  2Q9I A;  1NTZ G;  1JTH A;  3HRN A;  2IYP A;  2E42 A;  1EQ7 A;  3F5H A;  1J1D C;  1AA0 A;  3C1L A;  5AW6 B;  4U3F D;  1LTJ C;  3Q2Y A;  1S2E A;  2E76 D;  1NVO A;  1GW3 A;  1SFC C;  1PGJ A;  1CSB A;  3L72 E;  3VR9 D;  3L74 J;  1NTK D;  2ZAE B;  1NU1 K;  1Z56 A;  4Y99 B;  1VQ9 P;  2ZFC A;  3M9H A;  2Q6Q A;  4HKZ H;  2WDR C;  1Q81 Q;  3CX5 D;  1VQN P;  1BE3 J;  1L0L K;  3AE1 C;  5CBO A;  4H0L C;  1GK4 A;  1IO4 A;  1OX3 A;  4R4M A;  2PRR A;  3AE7 C;  4W7Z A;  3VMX A;  2KI7 B;  1VF5 B;  3SSU A;  3USS A;  2R32 A;  2UWJ E;  3RK2 C;  2QE7 H;  3TSI A;  3M91 A;  1KFY D;  3CCE P;  1LP1 A;  3OA7 A;  1SQV K;  3BCC D;  2ZFY A;  4H13 C;  3AE3 C;  1H8A A;  1K9M Q;  4HYT B;  2BCC E;  4JYB A;  3P4S C;  3V5B A;  3G3Z A;  3B5N D;  4ZKU A;  1AVO A;  2FXP A;  1MKM A;  5APU A;  2N1T D;  3L75 D;  1N73 B;  2HPC A;  3RL0 B;  1BGY D;  2WP9 D;  5KKZ C;  1FDO A;  3PH0 A;  1OZH A;  2E74 D;  2IZ1 A;  3H1L J;  1T3J A;  1HJB A;  1EDJ A;  1RY3 A;  2QM7 A;  3O6Q B;  1NTM G;  1PGP A;  2B89 A;  3L71 J;  4PD4 I;  3QH9 A;  4GT1 A;  4AYC A;  3HTK B;  2KLV A;  3H1H E;  2KOG A;  3MHV A;  2P1J A;  1LWU B;  2WDQ C;  3V2Q A;  2KB7 P;  5APX A;  3NFQ A;  4DJG A;  1H89 A;  1RE4 C;  2A06 D;  3H1J G;  3Q5P A;  1N8R Q;  1JY2 O;  2Z5H A;  1ZOY D;  2WDV C;  1GL2 C;  2WVR A;  1PP9 E;  3CC4 P;  2WU2 D;  2WSS H;  1UII A;  5CCG A;  1SQQ D;  5K5G B;  3D6Y A;  1AFO A;  2QJP B;  5E79 H;  3CX5 E;  4I7Z C;  3RK3 C;  3CXH D;  2WSF H;  4YTN D;  3B71 A;  5H2F H;  1FZE A;  2OAR A;  2W90 A;  4YTP D;  1URQ B;  5CJ0 A;  3H32 B;  1L0N E;  1X9V A;  4PD4 E;  4C46 A;  2PP6 A;  3SFD D;  3GF7 A;  1VL2 A;  1KF6 C;  1FBM A;  1E7P C;  1JY3 N;  4Y28 J;  1VQO P;  1S5L H;  4N78 E;  2W8Z A;  3CWB G;  4IL6 E;  1M56 D;  1H88 A;  3BCC E;  1NU1 G;  1JB0 J;  4FJV A;  1H0T B;  4D6T G;  3EFF K;  5AVX B;  1SQB J;  3HUS C;  3HD7 B;  1L0L G;  1N7S D;  5KLV J;  2IX7 C;  3AE2 D;  1FDI A;  2KNC B;  3SFE C;  4I6L A;  2WSE J;  2FYZ A;  1D7M A;  4YT0 C;  3S1K A;  2QJK C;  1U7J A;  4OGQ B;  3D70 A;  1VQ4 P;  2FYU D;  1LGH B;  4WY4 B;  2AEF A;  4DDG A;  3PLN A;  1NYH A;  4Z1M H;  1SQX J;  1KMI Z;  3WUT A;  1FZC B;  3TGU D;  1SQV G;  1IFM A;  4H44 B;  3TNU A;  2RH0 A;  1BE3 E;  1L4A B;  1SP4 A;  3PP5 A;  3VP8 A;  2P10 A;  4L73 A;  3G71 P;  5C2T C;  1EDI A;  1L0N K;  3WUV A;  2WPR A;  2G8Y A;  1ZP0 D;  3Q3D A;  4DZO A;  2FFD A;  1HGV A;  2H43 A;  4N3Y B;  1JY2 P;  1L0V C;  2YNY A;  3L72 G;  3C8V A;  2XU6 A;  2WWW A;  4GOE A;  3RL0 D;  3UIA A;  1VQL P;  1DD3 A;  1SQP K;  1KIL B;  4L74 A;  1MV8 A;  3VP9 A;  2ZVN B;  4ASV A;  4HB1 A; 
#chains in the Genus database with same CATH homology
 1ZRT E;  4YTM C;  3ABV C;  1KOR A;  4R4L A;  3AE9 D;  3AEC C;  2FXP A;  1MKM A;  1TU3 F;  4H13 B;  4YSZ D;  1OMI A;  2V7Q J;  2ACZ D;  1HJ0 A;  2E75 C;  2IDB A;  2OQQ A;  3AE6 C;  3RL0 g;  3P4R C;  1OW8 A;  1DIP A;  2WSC J;  3AEA C;  1KQF B;  1JB0 J;  5KKZ C;  3AE9 C;  2WP9 D;  4GDO A;  3VRB D;  4OGQ D;  4YSZ C;  2BS3 C;  1K04 A;  2ACZ C;  1IK7 A;  1FDO A;  2FBW D;  4YSX C;  2ZT9 D;  2BEZ F;  2WP9 C;  2E75 B;  3P4Q D;  2B76 D;  3VRB C;  4OGQ C;  2E74 D;  3GLM A;  1KIL E;  4YT0 D;  3IN6 A;  1ZME C;  3AE2 D;  1FDI A;  1RQU A;  1PV3 A;  3SFE C;  2ZT9 C;  2WSE J;  2B76 C;  3P4Q C;  2J5U A;  2E74 C;  2H88 D;  1HF9 A;  3AE8 D;  4YT0 C;  3AE2 C;  2QJK C;  2BS2 C;  3D71 A;  4OGQ B;  3D70 A;  3AEF D;  2H88 C;  3AE8 C;  2ZT9 B;  3P4P D;  1S5L X;  3Q2Y A;  2MKV A;  3AEE D;  1PIX A;  2E74 B;  2QJY C;  2QSI A;  4H44 D;  3AEF C;  2WDQ D;  1Y9B A;  3GF3 A;  5L8R J;  2BEQ D;  3VRA D;  1AJY A;  2YMK A;  2E76 D;  1NEN D;  5KLI C;  3P4P C;  1NYH A;  3AE4 D;  3AEE C;  4H44 C;  1WMK A;  2YIU C;  4Z1M H;  2WDQ C;  3VR9 D;  2D2C D;  1KMI Z;  3VRA C;  3VR8 D;  3O6Q A;  3AED D;  5C3J D;  1QLB C;  2E76 C;  2FBW C;  2JP3 A;  1NEN C;  2WDR D;  3AE4 C;  3R4Y A;  3CIR D;  3AE1 D;  3LW5 J;  4H0L D;  1GMJ A;  2WDV D;  2WQY D;  1OW6 A;  2D2C C;  3VR9 C;  3S9O A;  4YSY D;  2K9Y A;  4PV1 D;  4H44 B;  3AED C;  4KX6 D;  3Q5P A;  2WDR C;  3VR8 C;  5C2T D;  5C3J C;  2QJP C;  1YQ4 D;  4U7J A;  3AE5 D;  3CIR C;  4IL6 X;  3Q1M A;  3AE1 C;  2WS3 D;  4RKU J;  4XFJ A;  2E76 B;  4H0L C;  1EXJ A;  2JO1 A;  1ZOY D;  2WQY C;  2WDV C;  2P10 A;  2WU2 D;  4YSY C;  3IAO A;  5C2T C;  3AE7 D;  1EXI A;  2D2C B;  2NZ2 A;  2WS3 C;  3D6Y A;  2BS4 C;  1ZOY C;  1RQV A;  2WU2 C;  2G8Y A;  4R4M A;  3D6Z A;  1K05 A;  1ZP0 D;  3Q3D A;  1L0V D;  4H0L B;  3AE7 C;  3Q5S A;  4I7Z C;  4PV1 B;  1DD4 A;  1VF5 B;  1NGM B;  3AEA D;  4YXD D;  4YTN D;  3B71 A;  1ZP0 C;  3Q5R A;  1L0V C;  1PL5 A;  3AEG D;  1U57 A;  1NEK D;  3FGA D;  2H89 D;  1UIX A;  2QIW A;  3RK3 E;  4YTP D;  1YQ3 D;  4YSX D;  1VF5 D;  4YXD C;  4YTN C;  4I7Z B;  1KQG B;  2WSF J;  3C8V A;  2G3A A;  3AEG C;  2WU5 D;  4H13 D;  3AEB D;  1NEK C;  2H89 C;  3AE3 D;  4YTP C;  1KF6 D;  1R8E A;  4PV1 C;  3P4S D;  1YQ3 C;  4KX6 C;  3SFE D;  1KTM A;  1VF5 C;  3EWK A;  2WPV B;  1KFY D;  1YQ4 C;  3AE5 C;  1DD3 A;  1Q90 D;  1OW7 A;  4TT3 H;  3SFD D;  2WU5 C;  3GF7 A;  3G9R A;  2O01 J;  3AE3 C;  1VL2 A;  3AEB C;  4H13 C;  4YTM D;  1KF6 C;  3ABV D;  1S1C X;  3GMA A;  3AEC D;  3P4S C;  4KT0 J;  1E7P C;  1KFY C;  5M1B A;  3T97 B;  2FYN C;  3H25 A;  2E75 D;  3SFD C;  3AE6 D;  3P4R D;  4Y28 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...