3AEVA

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
EYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLAAEKLGKDFEAAWREVWVPLEEEWGEVYAAFEDAAKDGIEVLKGHVPDEWLPVLKEIVENYVEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit alpha
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3aevA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aevA01
4B3SL 2L15A 1Y14B 5GROA 3UDFA 1YBYA 4DNIA 4DR6L 1XNRQ 3HOXH 2ATWA 2F52A 3CQZH 3KF8B 4HIOA 1C9OA 3J7ZC 1XPOA 3Q8DA 2OCEA 3UDIA 2A8VA 3BZCA 4P74A 5C44H 1R9TH 1X65A 3E9HA 5IY0A 5LMUL 4LFAL 3CD6A 2EIFA 1A62A 1SRUA 1SMXA 4UP8A 4B3TL 3KFUA 3OTOL 1H95A 3PGZA 2N3SA 2CKZB 2UXDL 2PQAB 1K8GA 4DR2L 1L1OA 2N49A 4L5RC 2UUBL 1E1OA 3CP0A 1FJGL 4AQYQ 1B8AA 2Q2IA 4A3IH 1NTGA 2RCNA 4DR7Q 2OQKA 2WAQG 2LXKA 1N34Q 5IYBH 5ELNA 2F3IA 3K81C 1VQAA 1GO3E 2D62A 1VQMA 5J3BA 1PH4A 1K3RA 3KJPA 4LF7Q 5C44G 2AMCB 4JI0Q 4B3RL 5EAYA 1HJPA 1NMGA 3B6YA 3U58A 3TS0A 4DR1L 1J5EQ 2RHQB 2MNAA 2E8GA 4J15A 1SFOH 2CQOA 3BZKA 3GTMH 3KDFA 2BH2A 1OXSC 4QIWE 4EQ5A 4LUOA 3T1HL 3M4QA 1Y1WG 4JG2A 4LF7L 3NENA 4LUVA 3G71A 2UU9L 4JI0L 1D7QA 3PO3H 4YY3Q 1XNQL 4IFDI 5FJ8H 3TS2A 2NVQH 3BU2A 1U5KA 1TWFH 4JI5L 1YJNA 4JBWA 5GAHC 4A3GH 5HGQA 2MFIA 1I5FA 1VQ5A 4DV7Q 2JK8A 3H3VH 2IX1A 2Z6KC 3CCVA 1YHQA 5GQOA 4BA1I 3EIVA 3RLOA 2MQHA 3I55A 4JI7Q 3GO5A 4MZ9A 4YY3L 3A5UA 2K14A 1EYGA 1XPUA 4DV3Q 3H0GH 1JB7A 1G291 4BA2I 4A3KH 4UY8C 1UWVA 4A93H 1QUQB 3HFZB 3ER0A 1S3OA 4YHHQ 2HT1A 4A76A 1B70B 2JA6H 3RLFA 3S14H 4R1JA 3TQYA 2WAQE 1VQIA 3J80c 2DUDA 3CC2A 2JEBI 5LMNQ 5C0XI 3CCQA 3KDFB 4BBRG 3CCRA 4O0AA 3MEFA 1VQFA 4POFA 4DV3L 4DR4L 2V1CC 5FLMH 3KYHC 5E7NA 3ULPA 4YHHL 4HIKA 4LF8L 1CKNA 2NVXH 2XTIA 4YCWA 1MJEA 4LF5L 1TXYA 4OWXB 2Q2HA 5C0XJ 1YJ9A 2R7ZH 3A74A 2UXBL 1BBWA 4KHPQ 2KENA 2ZM6L 3S2DH 4JYAL 4GLVB 4JOIC 2K5HA 3I2ZA 1ASYA 1KAWA 1KHIA 3CCJA 1OTCA 2JA6G 1NJIC 2F4VL 1X55A 1HZBA 1V9PA 1VQKA 5ELOA 2UXCQ 4A3BH 4PZ7A 1SN8A 2B63H 5IYDG 3G4SA 4JI6Q 4GLAC 4LF6Q 3S15H 4JI4Q 4GN3B 4KHPL 1OXTA 2IY5B 5FLMG 2Z6KA 2GN5A 1PHJA 2RHSB 4LW1A 1Y1VG 3I4MH 2PI2E 4IO9A 3STBC 2I0QA 3GD7A 1KRSA 4PMWA 3TEHB 4LWCA 1HZ9A 1M90C 1AH9A 2RF4A 4BY7G 4GNXC 4JI4L 3FKIG 4A3LH 5JJKA 4DV2Q 4B3MQ 1YEZA 2ZTDA 2IHEA 4IOAA 2CWAA 4IJLA 4JBJA 4TQUS 4DUYQ 2B63G 2YTYA 4WJ3M 1J6QA 4UP9A 3PSIA 4DKAC 3J7A5 4KHZA 3U4VA 4IPGA 2WP8J 2EXDA 4PG3A 2VZAA 1VQLA 4B3SQ 4DUZL 2A19A 4IJHA 2R92H 1LTLA 4B3ML 3I4MG 5JEAG 5AJ3L 4DR6Q 1EOVA 2JJQA 4JI8Q 2BA0A 4BXXH 4POGA 2PMZE 2LXJA 1HZAA 2WB1G 3PIOA 3VDYA 1LYLA 3D31A 4KLKA 1HNXL 3AYHB 3U50C 1XMQL 3CW2C 4R4IA 4R4CA 1QZHA 3CMAA 4PZ8A 4LFAQ 5LMUQ 1YZ6A 1PH6A 1IBKL 1HR0W 4C2MH 2JE6I 4JI8L 3OTOQ 2N78A 3PO2H 4P75A 4P73A 1A8VA 3U4ZA 5C3EG 3RN5A 3S1MH 2UXDQ 3UDXA 2K50A 4DR2Q 2UUBQ 1MIUA 5FLXc 1FJGQ 1FVIA 4BXXG 3PIPA 4KI0A 2HQLA 2BH8A 2KHIA 1PVOA 1KC8C 4HJ8A 5M5YH 3BJUA 1EWIA 1JE5A 4A3CG 1UEBA 2NZHA 5M5XH 2Q2UA 3L0OA 5H1SE 4DR3L 3KF6A 4B3RQ 3F8TA 2GVAA 1PH3A 1XPRA 1TWGH 3A5ZB 3HOXG 4DR1Q 2YTVA 2JEAI 2ZJRA 1W3SA 3RZDH 1E3PA 4HJ7A 3GTGH 3M4OH 3WWVA 1VQOA 3HKSA 1L2FA 4QGUA 3T1HQ 2EQSA 1YHAA 4A3EH 2UU9Q 3JAMi 2JA9A 1BKBA 3RLNA 2QGQA 1HH2P 2JA5H 4RG1A 1XNQQ 1NMFA 2WB1E 2HIXA 4JI5Q 1YZ7A 2NVYH 1CKOA 2NN6G 2VL6A 3E0EA 3J81i 4OONA 1Q1BA 4GOPC 4K0KL 1YI2A 1PH2A 5JJLA 2AWNA 3W1GA 2Z0SA 1I3QH 2E2JH 4A3IG 1N32L 4AH6A 5DLQE 5IYBG 1IL2A 1EIFA 4X64L 3CC7A 2ALYB 3ERSX 1PV4A 1SROA 1I50H 1QVCA 3KF6B 4RMFA 1L1OB 3PUXA 4QL5A 1E7ZA 4A3EG 1VQ4A 1XMOL 1W2BA 1JT8A 1WYDA 2R7FA 2XGTA 1GM5A 1I94Q 2UUAL 3HOUH 1PFSA 1A63A 4JV5L 4A3MH 2PNHA 1EQQA 1X6OA 5IE8A 4DR4Q 1OXUA 4UPAA 2PI2A 3S16H 3SGIA 4DV6L 3GTLH 1PH8A 5IP9H 2IT1A 4R4OA 4LF8Q 3S2HH 4LF5Q 4TVAB 4LF9L 1EQRA 3JC66 3PO3G 5FJ8G 1VQPA 3GTJH 1I94L 2UXBQ 4HIDA 3CCMA 3I4NH 3CF5A 4A3GG 4JI1L 1WCMH 4P72A 2ZM6Q 1JMCA 1VS0A 1K0RA 3KOJA 4DR5Q 1K8AC 2IX0A 5M3FH 1G6PA 1HZCA 3EBEA 4QJFA 1KQSA 4OWWB 1EIYB 2F4VQ 4DPGA 5GADC 3GTKH 3M7NA 2KCTA 2D0OA 1IZ6A 3ULLA 4A3MG 1UE6A 5M5WH 4C3HH 4A93G 3H0GG 1N36L 2B3GA 3M85A 4A3KG 1GKHA 4APVA 4WJ4A 3HOYH 4DR5L 3G48A 1L0WA 3LGJA 3ZJYC 1P8LA 3E9IA 2K4KA 2BA1A 3UE1A 1CKMA 1S72A 1N34L 3NBHB 1KXLA 4X66L 5GAGC 4IFDG 1WCMG 3FHWA 1JJ2A 5IT9c 2Q2TA 4DV5L 1VQ6A 4NPSA 4O2DA 2JA8H 1U0LA 2CWPA 3I56A 1N9WA 1WI5A 4YWKA 4PZ6A 4UP7A 4DAYB 2R7ZG 5C4XH 1PYBA 1TWCH 3IRBA 4DV4L 3AFPA 5IYCH 4X62L 1HR0L 2VQEL 4DUZQ 4A3DH 1HNZL 1FGUA 4OO1I 1PYSB 5JEAJ 2UUCL 5AJ3Q 4OX9L 2OTLA 2VUMH 1CKNB 2NVTH 4ME3A 1HNWL 2QEXA 1UE7A 1X3GA 3T1YQ 4A3BG 1K83H 3W5OA 1HNXQ 1VQBA 1UE5A 1XMQQ 4GLXA 2OWOA 3GTQH 1B7YB 1V1QA 4LF4L 4LFBL 4GKKL 4IPHA 1AE2A 2C35B 2DGYA 1IBKQ 1YHBA 3G6EA 1SE8A 1JJCB 2YV5A 1CUKA 3TREA 3JAMc 4HJ5A 3K7AH 3AFQA 1CSQA 3T1YL 5IYCG 4A3FH 1SLJA 1VCIA 3PUYA 2FXQA 2R6GA 4IPCA 4YWLA 3ULJA 5BR8L 3OW2A 3PUZA 5C4JH 3K7UC 4JBKA 3J81c 4A3DG 2JQOA 4JOIA 1PH5A 4JBMA 4A3LG 3S24A 1PA6A 1EFWA 2VY3A 1XJVA 4XIGS 5LMNW 1Q81C 4GKJQ 2ZJQA 1Q7YC 1IBML 3M3YH 2VQFL 1MKHA 4IPDA 4Y7NH 4DR3Q 4Y52H 2R92G 2PQAA 4YCUA 4DV1L 3RZOH 1QZGA 1QVFA 3TRZA 4R4QA 1VQ7A 1IBLL 2YTXA 1KRTA 1Q86C 4GKJL 3CCLA 1YIJA 3M9BA 3L7ZC 1WOCA 1S40A 3MXNB 2E5LL 5IP7H 3PF4A 2Y0SE 4GNXA 1K9MC 2HHHQ 3HKZE 1MJCA 1YNXA 3K8AA 1VQJA 1NE3A 3EN2A 4DK6C 4DV0Q 3F1ZA 3CC4A 3D0FA 4MTNA 4NXNL 1VQNA 2R93H 2K5NA 4LNQA 3PO2G 4LFCL 1X56A 2E2IH 4H02A 2NZOA 4K0KQ 4OXPA 2R7DA 2D0PA 1X9NA 3H15A 1N8RC 2HHHL 1N32Q 5JJIA 2N8NA 3DM3A 1VQEA 4DV0L 4GN4B 3RN2A 2B29A 4X64Q 1XNRL 2MO1A 1X54A 3RNUA 3I4OA 4JI3Q 4BBSH 5IP7G 1XMOQ 2GVBA 3NEMA 3PUVA 1VQHA 3L2PA 1G51A 1YITA 1QVGA 3S17H 4L5TA 1I6HH 2UUAQ 1Y1WH 4R4TA 2R93G 1Q12A 4JV5Q 3PF5A 5GAEC 4JI3L 4DV6Q 4GNXB 3H3VI 3RR5A 2JA7H 1QUQA 1WJJA 4A4IA 4LF9Q 1YJWA 4GN5A 2CCZA 1LM0A 2JA5G 4AQYL 2HIVA 3F2BA 3FP9A 4JI1Q 1PH9A 4NXMQ 3CAMA 4DR7L 1Q46A 5M3MH 4BBSG 2K75A 4DAMA 4AIMA 4B3TQ 3CMEA 3F2CA 3PUWA 3GTPH 4AYBG 1IXRA 4YCVA 1NBWA 1N36Q 4JCVE 1J5EL 2MO0A 4NB3A 4NXML 1GD7A 4XTCS 4BBRH 3S1RH 2JA7G 2AWOA 4X6AH 3OYYA 1TWHH 1E24A 1RIPA 2K5VA 1P16A 1LUZA 2AHOB 1A0IA 4P71A 4C3IH 4X66Q 3UE0A 2I5LX 1D8LA 2YU9H 3HOUG 4IFDJ 1AE3A 1UE1A 5M3MG 3CPWA 4DV5Q 4GOPA 1X3FA 5K36G 4MNOA 4BY1H 5IP9G 4DV7L 1V43A 5HY6A 3A0JA 4HIMA 4C3JH 4DV4Q 4A3JH 3I4NG 1HR0Q 4X62Q 2QA4A 2VQEQ 5IYDH 1BVSA 4FDBA 4JI7L 1Z9FA 1VQGA 1HNZQ 5M3FG 2I5MX 3HOWH 2KHJA 3F2DA 1KIXA 1X3EA 2UUCQ 4OX9Q 1N33Q 3HOZH 1HNWQ 3K80C 3KJOA 3ICEA 3GTOH 1Y1VH 1YVCA 3CPFA 4L5SA 3HOVH 2CFMA 4OWTB 4EX5A 4QQBX 1OXVA 2KCMA 1T9HA 5LMNL 1C7YA 4BY1G 1JJGA 3HOYG 1Q1EA 4DK3C 4LF4Q 4BY7H 4GKKQ 4LFBQ 4GS3A 1IYJB 2Y0SG 3FKIH 1ASZA 1VQDA 2KBNA 2IHFA 1EUJA 2WFWA 3HKZG 1Z47A 3CCSA 1XTDA 1N33L 1NY4A 3CCEA 1Q82C 4A3JG 4AYBE 2ZTEA 2ES2A 1VQ8A 5BR8Q 4JYAQ 4GOPB 5C0XG 3HOWG 3I7FA 4QY7A 1Q8KA 3AQQA 3NELA 3PCOB 3PV0A 4X65Q 1WFQA 4JI2Q 2ZJPA 2JA8G 1KD1C 3W1BA 3HOZG 2VNUD 3GDEA 2ID0A 1E1TA 4LUZA 3DLLA 2YYZA 3J81j 3CCUA 5IWAQ 2I5HA 2VS1A 3S1NH 5C4XG 4A75A 1IBMQ 3HOVG 1VQCA 2VQFQ 2UXCL 1VQ9A 4JI6L 2K52A 2E2HH 1K73C 2ZTCA 1DGSA 4LF6L 4YWMA 1FL0A 4X65L 3STBD 4DV1Q 4IOCA 1M1KC 4JI2L 2ASBA 1L1OC 2VUMG 1E22A 2OTJA 1IBLQ 1GVPA 4HJ9A 1C0AA 1O7IA 3M4PA 1BBUA 3J80i 5IWAL 2A1AA 3CXCA 1PH1A 2E5LQ 5C3EH 4L5QA 1TWAH 2AKWB 3K0XA 3KLWA 1PH7A 4DV2L 2VW9A 4NXNQ 1OXXK 4HJAA 1CSPA 4LFCQ 4A3FG 3AEVA 4DUYL 2LSSA 2NN6I 4ALPA 3S1QH 3UDGA 4A3CH 1RL2A 1SR3A 2OQ0A 2H5XA 4JC0A 1KL9A 4OO1G
chains in the Genus database with same CATH superfamily
4B3SL 4GXJA 2KHVA 4DR6L 3LYSA 2ATWA 1BPXA 3T5JA 2W04A 1Q3LA 1ICWA 5CV7A 3L3FX 5ALSA 2ALZA 1E2VA 3UI2A 4EENA 1XPOA 3KKAA 4HCEA 2A8VA 1KTQA 4Y2UA 3MR2A 3RJIA 2FMSA 3PO4A 2KV2A 7ICLA 4HMJA 4RKLA 4XRHA 1R9TH 3E9HA 5IY0A 3MC0B 4UP8A 2ZIWB 3KFUA 3R9KA 3OHAA 3OTOL 2N3SA 3OSOA 5EOZA 2UXDL 1RG6A 2PQAB 3SK5A 1G91A 4QNLA 4QWEA 2HI0A 5C3EB 4DR2L 4C8OA 4JK1C 3QE9Y 2UUBL 1ZQYA 4O1NA 1E1OA 4PPXA 4DU9A 2KCNA 2F0UA 1RDFA 1B8AA 3RFAA 4OD0A 2HBLA 2WAQG 2LXKA 4UW9A 5IYBH 1GO3E 4FXGC 1K3RA 4WORA 3S1QB 2AMCB 8ICZA 2QILA 2AUJD 4JI0Q 1HJPA 1X9XA 4QMGA 3TS0A 2RHQB 3R2TA 3GTMH 3KDFA 2BH2A 3OPXA 2LS01 3CQZB 4RQ6A 2AQ2B 3KHLA 4LUOA 1Z00A 2G5IB 2IW3A 1Z3EB 3G71A 1E2ZA 3QX7A 4IFDI 2Y0SC 3C29A 2FMQA 4JI5L 2PXIA 5ALFA 4A3GH 4FBTA 3QOJA 1DM0B 1VQ5A 2LYBA 2JK8A 3D3RA 3H3VH 4I2HA 2SEBD 3KHGA 3CCVA 2PO4A 1YHQA 1UA1A 3VCBA 2XWBB 2KJ5A 4DOBA 3NWSA 1ZQGA 1NK5A 4YY3L 1B9NA 4XQ8A 5BOMA 4MZ9A 2K14A 4DV3Q 1U45A 1F9QA 4A93H 2YMPA 3HFZB 2AQ0A 2F0SA 3ER0A 1S3OA 5IIFA 4YHHQ 2KG5A 1CM9A 5IGBA 5KAIU 3QZ7A 2AGQA 1VQIA 1Z4NA 3OMCA 1ET6A 1LT6D 2JEBI 5C0XI 3J80c 3P1HA 4BBRG 2UVVA 3NK9A 2B2UC 4O0AA 3MEFA 5AKEA 4DR4L 2NVYB 9ICMA 3ZI4A 3KYHC 3E6ZX 1CKNA 1QTMA 2NVXH 2XTIA 4YCWA 3PO5A 5C0XJ 3G6XA 2KTQA 2Q2HA 3D8GA 4OWXB 2N1RA 1PZJD 2LKVA 4GLVB 4JOIC 5ELDA 3ISBA 1T4GA 4BJQA 4R8UB 2IOFK 4L8JA 1PDQA 4YVZA 1RODA 1X55A 1IV8A 4XA5A 2E74C 1VQKA 5F2DA 4PZ7A 4A3BH 2Y9UA 1V1OA 3GIJA 3L5KA 2K5DA 2Z4HA 5KRUA 1ZQSA 1HXYD 3PIO3 4GLAC 2W7PA 3IFTA 2DKXA 1X2IA 2F77X 4ICAA 4KLFA 2IY5B 2E1EA 2N55A 1YNJC 3MFHA 1LKYA 2RHSB 3C28A 4LW1A 4KMOB 2EYOA 3E2EA 5T1GA 1TAUA 1Z4OA 2P35A 3FC4A 2JHDA 2B0CA 3K1RB 2WF6A 9ICNA 3TEHB 4LWCA 2E5SA 1HZ9A 1AH9A 2NRTA 2IJ0A 4OJPA 3U9SA 1MSHA 5KL8B 3MFGA 4NLKA 4F4XA 2CWAA 4IJLA 4NW2A 5JOBA 3JPQA 1WUDA 1EY7A 4B08A 5JTIA 1NR4A 3EPIA 2LM4A 1EY4A 4WJ3M 5ALTA 9ICFA 4HSPA 2KMDA 5F9NA 4KHZA 4IPGA 2YY6A 2ZJ5A 2EXDA 4OJ6A 1VQLA 4B3SQ 1XO0A 2WAQC 3DM1A 3S2DB 4B3ML 3I4MG 5AI5A 5G5GA 5EWGA 4DR6Q 4JI8Q 4HN7A 1SDFA 4POGA 2Y0SB 2PMZE 2KEYA 1HZAA 1SGGA 4QWCA 3TADA 1HNXL 3OJUA 3OGUA 3U50C 2DQNB 3KBBA 4R4IA 4NP5A 4QF4A 3S15B 2BDOA 5HR7A 3SEIA 3R3OA 1TS5A 4ECTA 2PNRC 3BZDB 2TMPA 3OTOQ 5CC4A 4B9UA 2BPGA 3RN5A 2ZIUB 2UXDQ 9ICLA 4YR3A 2K50A 4L63B 5IGDA 4DR2Q 3QU4A 4ECSA 2UUBQ 4RZRA 8ICIA 3S15H 5I2XA 4B9MA 3KTQA 4CDFC 3CKIB 4EYIB 5AHXA 4F2RA 1KEJA 4KHVA 5D14A 1A3UA 1UEBA 5M5XH 3PX0A 1X9WA 5H1SE 4FNFA 4P0QA 1I6VC 1PZKD 1TY0A 2HD3A 4PNYA 5A2QL 2R92B 4J6HA 2EE1A 1MQ3A 2ZJRA 1OO9B 2DF4B 2HMXA 3M4OH 3ND9A 4QGUA 4C4TA 5KFUA 4NL9A 1RQNA 5KG0A 5HGTA 1U4RA 1PMRA 3MGVA 2JA9A 1BKBA 3BS7A 1CA5A 2QGQA 3V6JA 1HH2P 2XY7A 3KBXA 4DQPA 3SK6A 1Y88A 2Z4IA 3TN2A 4JI5Q 2L1BA 2VL6A 1SYBA 8ICXA 5JPMC 4F4WA 1Q1BA 2VJ4A 2Q0ZX 4K0KL 1STYA 3GV7B 3AL0B 4J9NA 4F5QA 1SL2A 1BPYA 1I3QH 2F0NA 2Z0SA 1J9OA 4AH6A 1DXSA 3T51B 3FAHA 1QILA 5IYBG 3NPPA 5J2CA 4X64L 3CC7A 1G2TA 2MU2A 1SROA 1I50H 5HHHA 3KF6B 4A3EG 1XMOL 1QSSA 2NBFA 1E7ZA 4GC6A 5FO9B 1JT8A 2CH4W 4EZ6A 1WYDA 4EQNA 1ESFA 1G8ZD 8ICHA 1W6JA 2XGTA 1I94Q 3M9MB 2ZIVA 3I76A 9ICCA 4XT3B 5AM0A 2V4DA 2PNHA 4ECVA 4G7HC 1X6OA 4DR4Q 1CZGA 1RDPD 4UPAA 1RYUA 2PI2A 5K36H 8ICQA 3SGIA 1QE6A 3IN5A 3Q22A 4H7BA 3GTLH 5J2AA 2XN9C 3O0FA 2NRWA 2Y9TA 1DJRD 3JC66 4LF9L 2CVRA 2E8PA 2FINB 5J0PA 3I1YA 1HUOA 3CCMA 4A3GG 1CI3M 3WK5A 1X9SA 3KOJA 3HW8A 3LVWA 2VA8A 1KQSA 5KAFU 4OWWB 1JUDA 3B9JA 1NSNS 4CF5A 1TVAA 1SBBB 4ECXA 2F0LA 5LHY1 1NNXA 2KCTA 4DGZA 1ZQUA 4A3MG 3SAFA 4R8IA 2LBOA 4EX6A 4A93G 4DO9A 4JVZA 5I9OA 4WJ4A 4DR5L 4CF4A 1TQOA 1SZPA 3G48A 4DAVA 1L0WA 3ONAB 3CYMA 3ZJYC 3NVZA 5AM2A 2B2TC 4YXJA 1S72A 1JE4A 3KBGA 4IUTA 5J22A 1EEFD 1WCMG 3E0FA 4DL5A 2C2RA 1ZQIA 2B2WC 2RDGA 1JJ2A 4F71A 4DOAA 1PK3A 3V72A 4M2YA 2CWPA 5KFRA 3MHBA 1N9WA 2PPBC 5NUCA 4R66A 2PYKA 1ZETA 4OIJA 4DAYB 2P6UA 5DNFA 4RFBA 1UNSA 1EYAA 3DHQA 5ALZA 3S9WA 1X42A 3AFPA 2BZFA 4X62L 4QJFB 3GTJB 4A3DH 1IG6A 4E0DA 3I4NB 2EZVA 1EYCA 4F4KA 3WU2U 2PFNA 2EYHA 2OTLA 1CKNB 2NVTH 1X3GA 4A3BG 4O3NA 4ECZA 2O5JC 3W5OA 1TK8A 1HNXQ 3T53B 4C3IB 3D6JA 2W3SA 4GLXA 3GTKB 4RQ8A 5ALPA 5D65A 5AICA 2XY6A 1V1QA 3AMZA 3NRZA 4GKKL 4OHJA 4Z6FA 5C3WA 4LFBL 2PKEA 2D2CC 5ELBA 5AKHA 5E79U 3JAMc 3K7AH 1CSQA 3T1YL 3HKZB 1VCIA 2H1EA 1GJXA 2R6GA 3SEBA 8ICYA 4JBKA 3KF8A 1GOZA 1NKBA 2LM1A 1A6SA 1U4MA 2JQOA 4KLSA 1B4OA 3KLSA 5DQGA 1LKYB 3KZXA 1U4LA 4JBMA 3HEJA 4NWIA 2W8KA 3RAXA 1TIID 1BCPC 1EIGA 2VY3A 3ZDAA 2EY6A 5LMNW 3HOZB 3TANA 2RDIA 7ICVA 3Q8QB 4KLMA 5EWFA 4IPDA 2FE9A 3B0YA 1TWCB 2DJGC 4LAAA 3TP6A 3HOVB 4YCUA 3GQBA 1QZGA 1KNEA 2K4EA 4IURA 1QVFA 3GDXA 5I6WA 3TRZA 1CA6A 4XYQA 3KHRA 2VUMB 1N62A 2F1MA 3EVQA 2EAPA 3M9BA 4GKJL 4Y2VA 1WOCA 3X3NA 2E5LL 1NCVA 5IP7H 3PF4A 4DSIA 2MHVA 2XCAA 2H3QA 2Y0SE 1K9MC 1RZTA 4G4KA 4PL2A 1T5EA 3BVZA 2ZJ8A 3EN2A 3CC4A 1LT4D 3ZDDA 3D0FA 4EX7A 4YR2A 1IIPA 5KNCA 3ED5A 1X56A 4H02A 2A69D 2EY5A 4K0KQ 3AQEA 4TUQA 4A3FB 3H94A 1X9NA 3WK6A 3D4DA 2E2HB 3NXWA 5C4JB 2HHHL 5CV4A 3SAHA 5JJIA 1D5XC 2N8NA 9ICKA 1RCVD 3DM3A 3MEHA 1S77D 1L6NA 4X64Q 1XNRL 4O9MA 2MO1A 3RNUA 4UARA 1XMOQ 3SK8A 3NSWA 1YITA 2K1BA 4QWBA 2KZ3A 4L5TA 1AN8A 4Y7NB 3J7YW 1WWUA 1FFVA 2NYZD 2R93G 4X5VA 3EYZA 2K04A 3SE0A 5F3XB 5GTIU 2G9HD 2W3RA 1N60A 2DL0A 3PF5A 1RQLA 1BBXC 4P0QB 1UCVA 4GNXB 3H3VI 4BUGA 3RR5A 3I90A 2JA7H 4CGYB 3GFKB 2QDBA 3VR4A 4LF9Q 4PGQA 1YJWA 4DS4A 4G7ZC 8ICFA 3RD4A 2KD1A 3BDLA 1SV4A 1GHKA 3F2BA 5EE3A 3UMBA 1PH9A 5KT4A 3TP7A 4NXMQ 8ICVA 1MC8A 3TACB 5M3MH 4BBSG 3D4RA 4DR7L 4ACOA 1ZYRC 5KFOA 2HHSA 1DZ1A 4B3TQ 3K5MA 5ALXA 4NM1A 3UXOA 3PUWA 4NLBA 4AYBG 1R9TB 2MO0A 4BXOA 3ZDCA 4QW8A 5J8YA 3V7JA 4PQXA 2LYHA 4NJ8A 1LTRD 4I7ZC 3J80E 5KFDA 9ICOA 4PHPA 1RIPA 4XT1B 1LUZA 2AHOB 2YU9H 1DGJA 2A73B 2M0NA 2R3ZA 4I28A 5E1FA 1A6XA 1Z7TA 3FDSA 4IQZA 4DSLA 1SAPA 5AFWA 5K36G 2A3VA 2BR0A 2RLTA 4C3JH 1MI2A 4C56C 4A3JH 3KZIU 1FNUA 4K5XA 5G3LF 2EZYA 1ZQPA 4X62Q 3I73A 4DFJA 3ONNA 5ALGA 4FDBA 3HOWH 2DY7A 1K0SA 5D46A 1PFMA 4PL1A 3NBIA 4BWMA 3GTMB 4RQ4A 5IT9E 3ICEA 4Z6CA 1EOTA 3EWAA 5IIMA 5KFWA 4C4SA 7ICRA 2HCCA 2CFMA 4DOCA 4KLTA 3BVGA 1K1SA 2EYMA 2OF1A 5LMNL 5AK6A 4QQBX 3GTPB 1ZXTA 2QB1A 3LWEA 4BY7H 4GKKQ 4LFBQ 3QXGA 5C5MA 2F44A 1WWVA 1JB3A 2KBNA 2IX1A 5CWRA 2WFWA 3S1RB 1U4PA 3CCSA 1N33L 4N8X1 3CCEA 1TWHB 4MFCA 1EU3A 2OYYA 5AKKA 2ES2A 1PUZA 3J7AF 5KFQA 3PNCA 1EWCA 3PCOB 2HHWA 3TDQA 3SD7A 4B3MQ 3W1BA 4M6WA 1MQ2A 3GDEA 4LUZA 2YYZA 5JEAH 3QEAZ 2V9WA 5KFSA 4NV0A 1VQCA 2UXCL 2KVMA 5DDMA 4GXKA 2ZTCA 2JP1A 5EJWA 8ICMA 3STBD 5K4LA 1PTOF 5AKJA 2XC9A 3PIP3 2FPLA 2YMLA 1GVPA 2EYJA 3FPUB 4HJ9A 1NK0A 1O7IA 2A1AA 3QZ8A 1A77A 1QSLA 1AROP 1Y1VB 2OXPA 4L6TB 4FZMA 4UB5A 1S8OA 2DBYA 1A3VA 2E5LQ 4QUFA 3H0LB 1LACA 1A2UA 5J29A 4OELB 4KN7C 2EY2A 4C1NK 1OXXK 3Q0AA 3FKIB 2GWSA 4YMMA 1ZQ1C 3PSTA 4UHVA 2XO7A 5HHIA 2Q4TA 2K01A 4A3CH 1RL2A 1SE4A 1TT2A 5F9LA 4JC0A 5T14A 1BPDA 4OO1G 4RH6A 2A5HA 5GROA 5I6YA 5IGEA 4BDPA 2A69C 4DNIA 1ML0D 1XNRQ 3HOXH 2BDUA 3E58A 2KSOB 1L7MA 9ICWA 3WKDA 1HA5A 3KF8B 4HIOA 3S1NB 5ALQA 1SL0A 4KTQA 2OCEA 4RGNA 5ALLA 1U47A 4AYBC 5DM73 5LMUL 3CD6A 4Y2YA 3KHHA 2EIFA 4NY8A 1H95A 2B2VC 3PGZA 4ABNA 1TFRA 3BVMA 2CKZB 2ASJA 4RNOA 1TK5A 1QSYA 1SSOA 3C1ZA 4UB4A 4FFDA 4FXKC 2F0DA 1FJGL 1JR0D 2RCNA 1F0MA 3OW7A 4CHTB 4MEYA 3C1YA 3V05A 4DR7Q 1ZQKA 4UAIA 3I8ZA 4RGTA 1J97A 2D3DA 4M9HA 1TS2A 5C44G 1ZQNA 3PIPA 4I2FA 3C1EA 4B3RL 3K57A 4Z9CB 1CRXA 3B6YA 4DR1L 2ZJAA 2E8GA 3H0RB 1SFOH 2CQOA 2K60A 1TKDA 4OJ5A 4EQ5A 3T1HL 4FO6A 3M4QA 4JG2A 1D7QA 1ZQRA 2UU9L 4JI0L 5C5JA 2HBKA 1YNND 4XQQA 5FJ8H 3TS2A 4KKUA 2KEDA 2PZWA 3NASA 1Z1VA 1PRTF 4JBWA 3ZYYX 1J8IA 3N7RC 3BQ0A 4ELTA 3KLRA 4RWSC 5M5XB 1JC7A 1O80A 4R8UA 3RLOA 4I2CA 2KHSA 5L1MA 3TSSA 2JV3A 3PQIA 2KEEA 1EYGA 4YIJA 1JRPA 2DGZA 4KKTA 3H0GH 5BN4A 4A3IB 4BA2I 4A3KH 5A0LA 4R63A 1GUTA 3M4OB 1HQMC 2JEJA 4JK1A 2HT1A 4PHDA 1G2SA 4ZUIA 1D6EC 2RDJA 4DQQA 2BCQA 5LMNQ 1V38A 3KK7A 3CCQA 3E3XA 4K6DA 1KABA 1VQFA 4DV3L 4KLOA 2V1CC 2DFLA 4I2GA 3ULPA 4YHHL 4HIKA 4LF8L 2EQYA 1N63A 4DXGA 1MJEA 1H9SA 1YJ9A 1TVXA 1B4FA 2C28A 3A74A 1I3QB 4KHPQ 4KKSA 4QZGA 3PO3B 2KENA 4FBUA 2ZM6L 1GHJA 1HPCA 1K8MA 3I2ZA 4KLJA 5K5PA 1TWFB 1ASYA 1KAWA 1KHIA 1PVRA 1NJIC 2F4VL 1I50B 1N48A 4QWDA 2BQRA 4C3JG 2NTSA 1GUGA 2UXCQ 1NR2A 3N97B 1EWHA 1SN8A 4QIWC 1ZEQX 1XSPA 2BE5C 5AKLA 2L4NA 3IV6A 3RB3A 3H6MA 5CHGA 2PMZB 1ZD4A 1S10A 5KFYA 4M04A 2HVHA 4TUPA 3I4MH 2PI2E 1ZQAA 3GIIA 1X40A 2DPJA 4CJ1B 3GTLB 2HHUA 3S14B 3GV3A 3STBC 1I4GA 1PVQA 1RF2D 3JAME 1M90C 4BY7G 5TISU 2OH2A 4RQ1A 4A3LH 4F4YA 1I4RA 5JJKA 5KG2A 3WK7A 5D49A 4YR0A 2Q8RE 2H3IA 2WTFA 1D9DA 2KUMA 3SR6A 7ICFA 5D4BA 2YTYA 1J6QA 3DV9A 3F5AA 4UAZA 1GUNA 2KCCA 2K8BB 2BQUA 2BGWA 4OO1J 4PG3A 2R7ZB 1TY2A 2A19A 4DUZL 1BQQT 3L4PA 1SNPA 1LTLA 3A7LA 2EPBA 5EKLA 5JEAG 2CN1A 1EOVA 1PTOB 1B0XA 4F72A 2LXJA 2WB1G 3PIOA 3VDYA 3GU3A 5KT3A 3RJKA 3D31A 3AYHB 1XMQL 3CW2C 4IC9A 2F3WA 4M6WB 2W43A 3NE5B 1UT8A 1XC9A 1ENFA 3ZDEA 4R4CA 5KL1B 4CDDC 3CMAA 4PZ8A 5LMUQ 3ETLA 4GXIA 3T3FA 2IX3A 3PW4A 2ZT9C 4C2MH 2CHBD 4JI8L 4DFPA 2N78A 3H8SA 3RBDA 4P75A 4P73A 4ZRZA 5B5EU 4NLZA 4ZH4A 4ZCKA 4YFKA 1N5WA 1MIUA 1FJGQ 1FVIA 4A3DB 4KI0A 4HCSA 1ZQZA 1F2MA 2PZTA 1KC8C 5JAVA 4HJ8A 5M5YH 2K33A 3P7JA 3BS1A 4P0PA 2NO4A 4A3CG 2NZHA 5CEHA 2YB1A 2XI9A 1NK6A 3A54A 4WJWA 4F88A 1STBA 4DSFA 4CBVA 3KF6A 3BJYA 3J7AV 4B3RQ 7ICKA 4QCLA 2A6ED 2XSCA 1PH3A 1XPRA 4QZ9A 3HOXG 4DR1Q 3ICXA 1WTXA 1XX8A 3BS5A 1B50A 2JEAI 1TAMA 2TSSA 1W3SA 4O3PA 1KFSA 1VQOA 3T1HQ 1II3A 1YHAA 4A3EH 1SYGA 2L5TA 2UU9Q 3RAQA 4M9NA 1X66A 3UXNA 1RTOA 2JEGA 3LK9A 2K7VA 2JA5H 1NMFA 2BCRA 4OJLA 2MJ8A 3QOLA 1TE2A 5CP2A 1PZNA 1CKOA 4CDCC 2RSNA 1F44A 2PW5A 4OONA 4GOPC 4ME5A 3S1MB 1SJED 1YNNC 4RU9A 1YI2A 2IMWP 1NKEA 1T94A 1BNOA 4RCNA 3GQCA 3K59A 3I4LA 1LTAD 2WAQF 2ALYB 2B21A 3ERSX 1SKWA 4RMFA 5ISRA 4QL5A 1C8CA 1SWVA 1ECWA 3U9OA 5G5HA 2UUAL 1Z19A 5IIIA 1NZPA 2BPCA 3K5LA 3HOUH 8ICJA 1QCBD 1TWGB 4A3MH 3AM9A 3DUZA 4JV5L 5DB6A 5IE8A 1OXUA 4IQVA 5ALRA 1PRTB 4IL6U 2Q8TA 1V97A 2IT1A 4LF8Q 3S2HH 4O3MA 2E2DC 1KDBA 2ICEC 4QUCA 1L8OA 1ZQOA 4DAYA 5FJ8G 1EZ6A 1I94L 3NVWA 3CF5A 4JI1L 1WCMH 2ZM6Q 1VS0A 2D6FC 5M3FH 4QJFA 3BQTA 5GTHU 5KFVA 8ICNA 3EBEA 2QLTA 3OIPA 4I2AA 5B66U 4F5RA 1WVLA 4DPGA 1EIYB 2F4VQ 1FIQA 4ODGA 3VYTA 3MDCA 5M5WH 3H0GG 2Z8LA 4A3KG 2HSZA 3J81c 2YX8A 2WB1C 4RUAA 1L8LA 3VR6A 2JA7B 2BA1A 3J80L 1KXLA 2G09A 4F4ZA 1QCKA 1NKCA 1VLBA 5IINA 5GAGC 1EQTA 1ZQJA 2K4HA 1VJ5A 3PSPA 5TZVA 1A15A 1C4QA 3QWNA 5IT9c 2O5IC 1MSGA 4P4PA 3AN1A 2JA8H 7ICSA 4J9KA 1SE2A 1U0LA 5M3MB 4WFN3 3I56A 1WI5A 5T1IA 1S5BD 9ICBA 5DG8A 1SE3A 1DOMA 1WD1A 1H9KA 5C4XH 2GH1A 4DV4L 4C3HG 2ZUDA 1NJXA 1QJOA 2NV3A 3E5SA 3KOOA 2F0VA 4DUZQ 5EE9A 2UVUA 1FGUA 4JB3A 1PYSB 1HEKA 5JEAJ 3T5LA 1S4ZA 1D5ZC 1F9RA 1DONA 2KHQA 1H9SB 1UE7A 2QEXA 3HILA 5AKGA 1K1QA 5DG7A 4B9VA 3MR3A 1SXTA 4PZOA 1XMQQ 4KHPL 3GTQH 3DEPA 3D2QA 4UAUA 4LVSA 1IYVA 1AE2A 2C35B 2I07B 1XSNA 1UUPA 2ZG6A 4EVOA 3G6EA 2NTTA 3HOYB 1I4HA 3A0BU 4JV0A 4JWNA 4M9LA 3PUYA 4YWLA 4IPCA 2ES6A 5BR8L 4C7YA 4A3JB 1S5ED 1STNA 4A3LG 1MD2D 1L7PA 3HOWB 4DLEA 5DLGA 5J1ZA 4TRDA 2FFKB 3PMNA 4B9TA 2B2TA 4WJ3B 1ZQCA 3A8JE 2HQEA 2FLLA 2O4XA 1IBML 2YMQA 4EBCA 1BCPD 1BGXT 2B2WA 1ZJNA 1NK9A 4IUQA 1PXUA 2A6HD 4DV1L 1GUSA 3K5NA 3RZOH 3NTUA 5ELEA 4KLUA 1VMPA 2WIIB 5J0RA 4IN3A 1EY0A 1JALA 2YTXA 5FLXE 4I27A 1Q86C 2W8LA 5L1KA 3G6JB 2BCSA 1S40A 1LB2B 1JOOA 2A6EC 4OJOA 4GNXA 3EUB2 3ZD8A 1D9FA 1HA6A 2KE7A 2QDLA 1J2MA 1NE3A 3NHHA 1T3QA 4DV0Q 3F1ZA 8ICLA 1VQNA 2R93H 3TZDA 3AU7A 3PO2G 1SL1A 3T5HA 4ZQ3A 5ALNA 3V6HA 2DNEA 1B3QA 5CA7A 2QKIC 2D0PA 4RPZA 2M2LA 5DM63 1SEBD 2L5YA 4KLLA 1ED1A 4DL2A 1SYDA 3T56B 1SWWA 1VQEA 2YB4A 4UAYA 5BOLA 2XICA 2Z6BA 1SXEA 3D4WA 3I4OA 4JI3Q 4BBSH 1XWLA 1H9JA 4KJNA 1MSWD 3L2PA 3M3YB 3S17H 2KZMA 1I6HH 3VA7A 2UUAQ 1Y1WH 4R4TA 2UVRA 1U49A 4LJXA 5ALUA 1Q12A 4P0PB 3FEWX 4JV5Q 3H0MB 2W9AA 4G9BA 4TQSA 4K5WA 5J0WA 5L1IA 4P4MA 4ULLA 4V0BA 2IOFA 1QUQA 1WJJA 3M7DA 2A1JA 1KQQA 2VA3A 2F0OA 4RPXA 1LM0A 1FNVA 2JA5G 3BS5B 8ICSA 4AQYL 4DXFA 3NVVA 4JI1Q 1Q46A 2F8LA 1ZRNA 4IUNA 1PYWD 4ZKCB 2RDFA 2LI6A 1BCPF 3FVQA 4ED8A 1FEZA 2WAQB 2E2IB 2JN4A 4LK1C 4DAMA 4PHAA 1KNAA 2B2YA 5H2FU 3CMEA 4PGXA 1ZYRD 1S0NA 3I28A 4YCVA 4JCVE 4NXML 2HBMA 3QYPA 2AWOA 4X6AH 4NLNA 4J9RA 1E24A 1SYEA 1JXEA 2K4PA 1P16A 2PFQA 4RHSA 4B3TL 4DFKA 3N52A 1TU2B 3UM9A 1STHA 1D8LA 2I5LX 2PCFB 2B8FA 2G9DA 2ZXPA 3UE0A 2R61A 1UE1A 4I2JA 5J2FA 1JMSA 2JEFA 4I65A 4J1MA 3NUQA 1X3FA 5KFBA 4I2EA 2KQ3A 3C5GA 3HRDD 1AW7A 1Y8PB 2JR5A 4U6PA 5EPKA 3MR6A 5KYIA 2QB0A 4DV7L 3A0JA 1B22A 2Z9HA 1O78A 4HIMA 4DV4Q 3HGBA 2QA4A 1JQYD 5IYDH 1BVSA 4CGZA 4JI7L 1Z9FA 3RH5A 1JICA 4ZK9B 4RQ0A 2DKZA 3RJHA 1CHQD 5M3FG 3TKAA 2KHJA 4Q5VA 4FZLA 1ZYQA 4O5EA 4KLIA 4PJ0U 2HW3A 3CRXA 2EYPA 3K80C 3C3LA 2K28A 2JMGA 4FO2A 4OWTB 1OXVA 3ZDBA 1T9HA 3EA6A 4BY1G 1JJGA 1Q1EA 1PVPA 4RUCA 2F4IA 4BBRB 1ASZA 3RB4A 2JYOA 5KFJA 4KITB 5KFNA 1XTDA 1NY4A 1Q82C 1JWMD 3Q8PB 2BQ3A 2E8NA 1VQ8A 4QZEA 1LABA 4HSVA 2XRQD 5KFCA 5BR8Q 3K4GA 3I7FA 1Q8KA 2FMMA 5M9OA 3OSNA 4EBDA 1WFQA 4KY5A 4CDEC 2JA8G 1KD1C 3M7NA 5IGGA 5I9PA 1E1TA 4KN4A 5DBAA 3DLLA 3J81j 2O6KA 4HEDA 3CCUA 5IWAQ 1S0MA 4OCZA 5C4XG 3LWMA 4A75A 3TP8A 1IBMQ 2KSOA 2K4IA 3EJIA 1LVHA 4U68A 4DV1Q 2OXOA 5AI9A 4DQRA 1L1OC 4OO1H 4UB8U 2R8JA 1E22A 2OTJA 3TZUA 4FZNA 3MVVA 4NDXA 1XU4A 4IR1A 3GTOB 2A6HC 1PH1A 5C3EH 1FFUA 2NRXA 2GO7A 4DL3A 2AKWB 4NL9C 2RHFA 1SIJA 3KLWA 2E8MA 4I2DA 4JV2A 3JPTA 2VW9A 2DUYA 3UMCA 3RJEA 4DL7A 2PFPA 1IM4A 4DUYL 4ALPA 9ICRA 3J81L 3UDGA 3S1QH 4Q45A 3H4DA 8ICKA 1SR3A 2OQ0A 3BG3A 5ALDA 2L15A 2R8HA 5ALYA 3UDFA 4BX9C 4JUZA 2VB3X 5IGCA 4P2HA 3EFXD 3Q23A 3I4MB 3CQZH 5IOCA 1C9OA 2FI1A 1STAA 3QB3A 1UAPA 3HRZC 3Q8DA 3M4YA 4Y2TA 5C6AA 3H7IA 1TS4A 5C44H 3AUOA 2FLPA 1Q8IA 1DRGA 1A62A 1SMXA 1SRUA 1UHUA 1MBYA 7ICOA 4RQNA 1KFTA 1Q90A 3MTSA 2SOBA 1KLNA 1TWAB 1BNPA 4UAWA 1LLRD 4I2BA 4AQYQ 2DPIA 5J0YA 5AIAA 3SMVA 2Q2IA 2LHTA 4RQ2A 2Y1IA 1ZQEA 2OQKA 2PQEA 3A55A 1CEZA 2F0MA 4TSSA 5ELNA 5J0XA 2F3IA 1R4QB 1JORA 2HVIA 2ASLA 1VQMA 1SNDA 2G5HB 4RCOA 3HX0A 4LF7Q 4Y2RA 1HUZA 4MFFA 2G07A 3W2DA 5EAYA 2HDOA 2VANA 9ICVA 3U58A 1GXDC 2IPKD 5DEHA 5J2KA 5EE0A 4TUSA 1ZQXA 3VR5A 2MNAA 2IHMA 2L12A 4RGMA 5KFLA 2EVBA 2RVLA 4K4IA 1Y1WG 5ALVA 3AQFA 3NENA 4BS9A 3QUCA 5IIKA 3QO2A 3NGDA 5C5LA 2XVTA 4F5NA 3K5OA 1YJNA 5J2IA 2HCFA 5GAHC 5EKIA 2MFIA 1I5FA 4DV7Q 2DN8A 2Z6KC 1Y69U 1Z1BA 1BCPB 3MWYW 3EIVA 4BA1I 2L55A 1ZKOA 4DL6A 2SDFA 2B6GA 1HQRD 2HHVA 3MC1A 2MQHA 3D6CA 2BCUA 3H09A 3GO5A 1SNCA 4JI7Q 2B2VA 2P6RA 3C2PA 1SNQA 1ZQFA 1XPUA 1LO5D 2F0KA 1G291 1MHWC 1XXGA 3EZ5A 1BR9A 1QUQB 5L37A 2A1JB 5HMLA 4U7CA 4F5PA 4K4HA 1VDZA 1HIWA 3JPSA 3RLFA 4NLCA 3TQYA 4A3EB 3OJSA 3HZXA 2FMPA 2WAQE 3BQ7A 3RRGA 3CC2A 3PR5B 4AYBF 1F2ZA 2JH7A 3CCRA 3WKEA 7ICUA 4POFA 3MABA 1KLUD 2B8GA 4U673 4KMUC 3ISCA 5E7NA 5LL6S 4DFMA 2M00A 1KW4A 4J9MA 4IRCA 2UXBL 1PZID 1BBWA 5AKYA 3S2DH 2DNCA 2XGQA 2V4QA 4A3GB 1OUQA 3DWQA 3CCJA 2F1JA 4RQ3A 1OTCA 2JA6G 3UQ0A 4DAPA 1HZBA 1V9PA 1KRPA 5DQHA 1L5UA 3NP8A 5IYDG 8ICRA 3G4SA 3C46A 1D1KA 3LWUA 4JI4Q 2F0FA 1COKA 4M0AA 1EFID 1OXTA 4GN3B 4KY6A 5FLMG 4A3MB 2QB0B 1MN8A 2BE5D 2XIWA 3BDPA 4A93B 3EROA 4EELA 1SKRA 2XVSA 2K5QA 4IO9A 3OTQA 3T79A 2I46A 4PMWA 2SNSA 9ICGA 5FK9C 4CJ0B 5BN3A 1L0YB 4DQIA 1WCMB 2BKEA 1YEZA 1ZQDA 2IHEA 3SYZA 1P7DA 4CKEA 4IOAA 2KIVA 3RH6A 4TQUS 1KDCA 4UBCA 4DUYQ 2B63G 1COOA 2MUTA 2WF5A 3N4MB 3IG5A 4UP9A 2NVXB 3J7A5 3NVYA 3O13A 3U4VA 2WP8J 2VZAA 5EPJA 4RHRA 3Q8KA 2DY8A 3IM1A 4IJHA 5M5WB 2R92H 4MHEA 1HCZA 3QU7A 1CQFA 4IQTA 2JJQA 3QU9A 2BA0A 2VXWA 2RQ5A 1L7NA 2K03A 2EZXA 2R18A 4ECUA 4A3BB 5ALJA 4OL7A 1NAPA 2F0TA 3FM9A 1ILQA 1BUVT 3CHBD 4ED0A 3A8KE 1TR5A 1MGSA 1WTHA 3QUBA 5CRXA 1IBKL 2F1IA 3UXPA 1HR0W 1HHVA 4ECYA 3JPPA 3PMFA 1GUWA 1VMCA 5C3EG 3UDXA 4K6LA 2IWHA 1TKWB 2NWGA 4IUVA 1O7ZA 2KP7A 3QG1A 3I70A 4Z6DA 2FHTA 4KJOA 5FLXc 4BXXG 2BH8A 3MGIA 1PVOA 1KLGD 1CQVA 1SYCA 1T5XD 3BJUA 2F03A 1JE5A 2IHNA 4X3TA 8ICUA 5KT6A 4Q8EA 2A68C 2Q2UA 4DR3L 2ATLA 3F8TA 1SZHA 2K05A 4QIWF 3OPOA 2GVAA 5KG1A 1I4XA 2NZ1D 3A5ZB 3IAYA 1D8BA 4J9QA 4FF4A 2YTVA 3RZDH 2KVSA 3GTGH 3V7LA 1NOMA 3C23A 3PZPA 4QZCA 1UA0A 1L2FA 9ICUA 2BDNA 4C8NA 1JIHA 3WKCA 4UBBA 1SMYC 2YTUA 3P20A 3RLNA 4DF8A 4RG1A 3VYRA 2HIXA 4O3OA 3TP5A 4RQMA 1YZ7A 3RR8A 2WFAA 2NN6G 2ICIA 4C4RA 1A0PA 1BPBA 4DLGA 4FF1A 1ICFB 1STEA 1PH2A 1AZQA 2KFZA 5JJLA 4P2CB 2F0PA 3W1GA 1XS9D 2E2JH 4ED6A 3RZOB 4CKBA 3NWTA 4PZNA 3HP3A 1IL2A 4UB6U 5J0OA 4G57A 2XNAC 3F5EA 5KT2A 9ICEA 5C4HA 1VDVA 1QVCA 3PUXA 3Q24A 4O5KA 2F0EA 1GM5A 4MF2A 3LNNA 5A35A 5CV6A 2R93B 2R8GA 2WHEA 5DGBA 1AEXA 4YCXA 3S16H 1U48A 4DV6L 5IP9H 5L1LA 4TVAB 3TFSA 2UXBQ 3GTJH 1DK3A 4HIDA 3I4NH 4KTAA 2RDHA 3H40A 7ICJA 3OHXC 1VF5C 1K0RA 1DYQA 1K5OA 4P72A 2IX0A 5CGKA 1K8AC 1G6PA 1Y8OB 4BBSB 1V1PB 5EBDA 4DQSA 1K3BC 3SI8A 3A56A 7ICTA 3GTKH 1RJTA 3IHQB 4RQ5A 1S97A 4K14A 5KYLA 1I6HB 2CQAA 1MA7A 1A3TA 1K8OA 4C3HH 1K28A 1N36L 2B3GA 2N88A 5KT5A 4APVA 4QZ8A 4AYBB 1O7YA 2EAOA 5L9XA 3SZ2A 1TAQA 2EH9A 1P8LA 3LGJA 3N7SC 3E9IA 1QH9A 2K4KA 4JW0A 1CKMA 4N9PA 3UE1A 1N34L 9ICQA 3NBHB 2EYFA 2OEHA 1LT5D 4IFDG 4IRDA 3K58A 1ZD2P 4ZAIA 2Q2TA 4DV5L 3SV3A 4NPSA 1VQ6A 3HG9A 5HR6A 3GILA 5D3DA 2QKQA 1NJYA 1L3SA 4PZ6A 3W3AA 4UP7A 3R2IA 3FDTA 5EE1A 3ZD9A 5ALKA 3BQ1A 1TK0A 1BPZA 4US9A 1TWCH 5DAUA 1S0OA 1HR0L 4DA2A 3Q8RB 1HUNA 4IRKA 1LTGD 4X3SA 1QZHA 4OO1I 3BYTB 5JVG3 2UUCL 2VUMH 5CR0A 2VJ5A 5J2BA 1T3NA 3HS0C 5KIXA 2PZUA 4GZYC 2KK0A 3PX4A 1K83H 4FE3A 5CV5A 5IGFA 1VQBA 2QARB 3JPNA 2J6UA 4HTHA 1FGBD 2OWOA 1FNWA 2G08A 1X3PA 2B2UA 1B7YB 4LF4L 3M1YA 1ZQHA 3H4BA 1SV0C 2WF9A 5E4XA 1V8QA 1YHBA 5DG9A 5J0SA 1IBKQ 3TREA 3PY8A 2OEOA 2HHXA 5IYCG 4A3FH 4DWIA 1WTOA 2FXQA 3ULJA 1HTPA 2J7ZA 2K32A 3PUZA 4K5VA 5C4JH 4JYAL 4JOIA 1PH5A 4GIBA 5EKKA 2AH5A 3G7LA 1KBUA 4CNQA 2XGPA 3S24A 5AKIA 1EFWA 4F93B 4DNRB 4KD4A 5CBAE 1T8EA 4XIGS 1XYIA 4YQWA 1M8AA 5DBBA 1Q7YC 2VQFL 2F2AB 1KAAA 3NTHA 1MKHA 2EZZA 2G0AA 4Y7NH 4DR3Q 4Y52H 1B53A 2R92G 5CBEE 1WTQA 1B43A 5KFTA 3C2LA 3QUTA 2AGPA 3C1FA 3A7AB 3ISDA 4R4QA 5KNIA 1IBLL 5JRTA 2MUTB 3TAQA 1KRTA 2NVTB 5EQ0A 2WB1F 3L7ZC 2CPRA 4UQGA 3CNHA 3MXNB 4PMBA 3VA5A 3WKBA 3G6YA 9ICIA 3K0YA 3RMHA 3MFIA 4M9GA 1MJCA 1YNXA 5HMMA 1WCLA 4DK6C 4PHEA 2WF7A 3PR4A 4MTNA 4NXNL 2W55A 3QIAA 4TURA 4LFCL 2X6GA 2NZOA 4C0ZA 3K7AB 3SVMA 2RP5A 3HPOA 1Q3UA 5DQIA 4EQOA 2XCPA 2H4OA 1RM6C 1HRJA 2W9BB 4DV0L 4P4OA 4RPYA 4GN4B 1PFNA 2B29A 4QIWB 4A8EA 2GOLA 3RF9A 3U26A 3HT3A 1X54A 3IL8A 1RKNA 5AI6A 2GVBA 4RGOS 2AU0A 1H9RA 1H9MA 3NEMA 1G51A 5AKXA 5CV8A 7ICMA 1ZOLA 4DNTB 5IILA 5J2GA 5AI4A 5E4WC 2GLEA 1L3VA 2JZBB 3H8MA 3QU2A 3RB0A 7ICQA 4KX3A 4DSJA 1DOLA 2VIXA 1XSLA 3PMLA 4JI3L 4DV6Q 1ZXIA 1B44D 8ICOA 3WOEA 3HJEA 4A4IA 3N7PD 3KFUF 3SDZA 3V7KA 4GN5A 2CCZA 2RSOA 1GUOA 1V85A 1QNUA 2ASDA 2HIVA 4C1NI 5KNDA 3CAMA 4C8MA 2AQ3B 8ICPA 4F3OA 4RNMA 1FR3A 8ICTA 4RNNA 1I4QA 4ELUA 5CYUA 4DS5A 1G6ZA 4F8MA 5C44B 3GTPH 4QWAA 4HYKA 4NM2A 2K8AA 1NBWA 5AI0A 1DK2A 3TQ1A 4NB3A 1N36Q 4XTCS 1J5EL 1ESRA 2RBMA 4XDXA 3S1RH 1NK8A 3OYYA 2GA4B 1TWHH 1SJHD 4X3KA 3TFRA 1EIHA 2K5VA 1RHPA 3RTVA 2ZIXB 4EGVA 2R8KA 2KICA 1N34Q 2E75C 3RRHA 2BHNA 2VA2A 1Y8NB 4IFDJ 2ZXOA 3FPPA 1FD7D 1AE3A 1BPEA 3CPWA 3FMCA 4DV5Q 3T4AC 1QWYA 4BY1H 2Z1CA 1IW7C 2I9GA 5IP9G 1LTBD 1V43A 2HBJA 5HY6A 5FO8B 4YXMA 3Q6SA 5EGTA 3I4NG 4LJZC 1HR0Q 4EEYA 2D8CA 5ELCA 5FOBB 5BN5A 1X32A 1VQGA 4MTKA 3RUZA 3F2DA 1KIXA 4ED3A 2NYVA 2C5CA 4J9PA 2KA7A 2UUCQ 4ZOHC 1ET9A 1XO1A 2AQ1B 4C3IG 3KJOA 3ND8A 4HAIA 1Y1VH 7ICGA 2BCVA 3M6KA 1B1ZA 3CPFA 5KG6A 4N8FA 4DEZA 3DMUA 2KCMA 1C7YA 4Y2PA 1ENAA 4LF4Q 2V4RA 1IYJB 3FKIH 4J8QA 4R65A 1VQDA 2IHFA 1EUJA 3HKZG 1Z47A 1L3TA 2AQ4A 3OHBA 5DDYA 4CE6A 4AYBE 2BOSA 3H91A 1U9LA 2J0TD 4MFAA 2YQEA 3SK4A 2YU9B 2W54A 5IT9L 4GOPB 4JYAQ 4QY7A 3AQQA 4X65Q 1KDAA 3KKAC 2L9HA 3G6VA 4JI2Q 3D6WA 3HOZG 4KLGA 1S5CD 2F0QA 2NRVA 2ODGA 4ECRA 1S5DD 1AP0A 4QZHA 2HHTA 2X6LA 4OIKA 1RXVA 3X3MA 3S1NH 1PK1B 4C8LA 3HOVG 3OWFA 2VQFQ 3PW7A 1EY6A 2G5DA 1H38A 4C3JB 2K52A 4JI6L 2EDUA 1K73C 1DGSA 4LF6L 4YWMA 3I72A 1M1KC 1RXWA 3NTKA 5CR3A 1M4VA 2PW7A 3SQIA 2VUMG 2OHFA 5COYA 3HKZF 5JPNC 5JU5A 1IBLQ 1C0AA 4UB2A 1WCNA 1BBUA 3OOCA 3DEEA 3J80i 5HURA 5IWAL 1LV9A 4G7OC 5ALHA 3TMEA 2XWJB 4L5QA 2FPKA 1O03A 4HMIA 1JWSD 1PH7A 4YD1A 4DV2L 4NXNQ 4BY7B 1UEAB 3Q8LA 3ITPA 4MN3A 1D5MC 4A3FG 4LFCQ 3AEVA 2LSSA 2JXJA 4DCCA 4K2LA 1WTWA 2DJFC 4J9LA 3AU2A 2WF8A 3PSFA 1SXDA 1JOQA 2H5XA 1ZQLA 1I4PA 2HOIA 2HHQA 1Y14B 4XXEA 2EDGA 1RPLA 4NXZA 1YBYA 3VR2A 4CJ2C 5KFKA 2C2DA 1NZBA 8ICEA 2F52A 1IYUA 8ICWA 1CZWA 4WRDA 1L7OA 1X6IA 2WINB 3QR8A 3J7ZC 3UDIA 5KG3A 5KFHA 2WB1B 3BZCA 3BDCA 4P74A 1X65A 2VB2X 3DWPA 4LFAL 5KFZA 1ZD5A 1WYGA 4C80A 1Q3VA 1JN3A 1F2LA 4I7AA 5HP4A 4B6JA 4M47A 1K8GA 4L5RC 1L1OA 2N49A 2E76C 1IKLA 1EU4A 4TKOB 2C22A 4KLHA 3CP0A 4DK1A 4USAA 2HOFA 1L0XB 4A3IH 4R64A 1NTGA 3MZ5A 4FF2A 4PGYA 5KFFA 1CT1D 4R8NA 4DSEA 2ENBA 1F9PA 3R8BA 5IIOA 1Z6HA 3K81C 1VQAA 2D62A 8ICAA 3WOFA 5J3BA 4M9JA 1PH4A 4J9OA 4O5CA 3KJPA 3AMUA 1XWEA 1S5LU 2XIDA 1O08A 3WDNA 3E0JA 4K2KA 2ZXHA 5JJZA 3RBEA 1NMGA 3GV6A 4CKCA 1F77A 5J0TA 5J2EA 3DWAA 1J5EQ 4J15A 3ETRA 3BZKA 1N56A 3HOXB 2KJ9A 1OXSC 2JXMB 3H8WA 1EXNA 1BO0A 4QIWE 1NK7A 5CMDA 3QUQA 4B9WA 5KFMA 1M6YA 1ZRMA 2VKQA 4HAEA 4LF7L 2YMMA 4LUVA 4Q0FA 4IALA 3IP4B 5E3FA 3PO3H 5KFXA 4YY3Q 1XNQL 9ICTA 2NVQH 3M9OB 8ICGA 3HKZC 1TWFH 1U5KA 3QU5A 2KVCA 2LFNA 3BU2A 5HGQA 2KFNA 4H0LC 4Q43A 3VR3A 2W03A 5ALMA 5GQOA 1J2NA 2FLNA 3DDHA 1XNSA 4J03A 4ZKBB 2SNMA 5C3XA 3I55A 3A5UA 5DLFA 5I2YA 3RJGA 1JB7A 1BNZA 1UWVA 4UY8C 2F3NA 3RZDB 3GTGB 5KT7A 9ICXA 2P5ZX 4A76A 3GZFA 1B70B 7ICNA 2JH1A 4R1JA 2JA6H 3S14H 5DB9A 3RJFA 5J0UA 7ICEA 2KJXA 2F76X 2DUDA 4DFAA 5L1JA 1S9FA 3KDFB 3CRKC 9ICPA 3PW2A 1BF4A 5FLMH 1Z00B 4ELVA 2W9MA 4MHVA 4UAVA 3NQIA 1SFOB 3F2UA 3M8RA 2P66A 4O3QA 3PO2H 2E3TA 4O3RA 4LF5L 1NJZA 3NUCA 5EBCA 1TXYA 2R7ZH 8ICBA 2RRDA 1CTMA 2CH4A 3TADC 1ENCA 2E2JB 4EBEA 2MSNA 3SR1A 3A0HU 2K5HA 5ALIA 1PTOH 1SYFA 5JVH3 5AIBA 1W6KA 3IRUA 2F0JA 2ZUCA 3V6KA 5ELOA 1RD9D 2JRZA 2B63H 4JV1A 3QJYA 4JI6Q 4LF6Q 2R8IA 3MDAA 2KECA 2Z6KA 2GN5A 3H0GB 1PHJA 4B9SA 2LMCB 4A3KB 1Y1VG 3S16B 1OW5A 3WKAA 3WK4A 2O2LD 2I0QA 2D5DA 3GD7A 1KRSA 2QCPX 4KD3A 1L3UA 3MBYA 2RF4A 3IG8A 4GNXC 3FKIG 4JI4L 4ED2A 3IDWA 4KLDA 2ZTDA 5CB1A 2KZZA 2F0WA 4DV2Q 3M9NB 2ZXIA 3C21A 2KNJA 4ED7A 4JBJA 3ERQA 5FKAC 4CF3A 4F50A 4S3SA 4O3SA 1HUMA 1DOKA 3PSIA 4DKAC 3FYHA 4EEKA 4EQPA 2OT2A 1U9RA 2EJMA 4KMUA 2C9OA 4C3HB 3MXGA 1LTID 4F5OA 2MPMA 3OMGA 1NUCA 3JAML 1LV5A 4ZUJA 1U4BA 1D1IA 5AJ3L 4BXXH 1C20A 2BDPA 5J2JA 5AM1A 5J0QA 1T7PA 4IQWA 1TV9A 3FRPB 4KK7A 1LYLA 4KLKA 3CP8A 2WV6D 4C8KA 2JSOA 3TI0A 3V2TA 1NJWA 4LZGA 1F5SA 2EANA 3GIMA 4J9SA 4O42A 4LFAQ 4F91B 1YZ6A 5DB8A 4QZAA 5KEEA 1PH6A 3RB6A 4BGDA 2JE6I 3ORYA 1RTNA 2X69A 3A8IE 3DXJC 3EW9A 3U4ZA 3S1MH 4F2SA 4TQRA 4UB1A 2AJQA 2JGAA 1A8VA 1QB5D 1DD2A 4F7XA 4Q44A 2F0IA 3EQLC 4UB3A 3N28A 4XQJA 1GO3F 3CRLC 5LL6X 3SHLA 2H3FA 4IS7A 1RYRA 1EY5A 3GIKA 2HQLA 3GV5B 2KHIA 1AQ6A 1JROA 2HUGA 1UPHA 1HFGA 3NS1A 1EWIA 5DKWA 5AK3A 2FPMA 3M8SA 2NN6H 2A74C 3NRWA 3HWTA 1ZQTA 1K83B 3L0OA 4FS1A 5AM4A 2W9CA 1LTSD 2Q8IB 5C4ZA 5KG7A 1JXLA 4DL4A 2B2YC 4UATA 2A68D 3Q8SB 3BDOA 1QOHA 1NI3A 1TWGH 3VYUA 3AU6A 3CU7A 1ZQMA 5AK4A 1E3PA 2EJGC 4HJ7A 3WWVA 1ILPA 3HKSA 1URJA 5I4DA 3TBIB 2EQSA 1EL0A 4KN7A 3IFDA 1KSPA 4JPBW 4B9XA 3JAMi 5G3LD 4M1UB 1XNQQ 4IR9A 4UDUC 1NK4A 2WB1E 3PVXA 3H3VC 2J6SA 3IKJA 2NVYH 5DBCA 8ICCA 1SMYD 1RYSA 2EXZA 3LDAA 2M9VA 3E0EA 4RA8A 4C2MB 3J81i 3PO2B 1KDHA 1E0BA 2CW0D 4F92B 2AWNA 1V1PA 2D9UA 1N32L 3N6RA 4A3IG 2E8OA 2FDRA 5DLQE 4ED1A 2BCOA 4ECQA 3MFYA 2FMCA 1EIFA 2C2EA 3UMGA 1X3QA 5M5YB 1PV4A 5ALOA 1VQ4A 1L1OB 1W2BA 5KG4A 3P75A 3EPGA 1SNMA 3OIQA 2R7FA 4JWMA 5ELFA 1PFSA 4H44C 5DGAA 4FXDA 1A63A 3NBHA 2ZUBA 1EQQA 2F8KA 5KFPA 1ZD3A 1E2WA 1PH8A 5CJ7A 4R4OA 3JPOA 4LF5Q 1EQRA 3PO3G 4DN4M 1VQPA 1ZQBA 3RH4A 4QZIA 2NUCA 4IFDH 2JA5B 5CV9A 1JMCA 1XTCD 4DR5Q 1PTOD 1HZCA 3UPQA 1EQVA 3T16A 2MRLA 4DFDA 2L0CA 4KN4C 5GADC 2D0OA 2LYAA 1IZ6A 4N9TA 3ULLA 1IKMA 3BQ2A 1UE6A 3C5FA 1WG8A 3UQ2A 5AM5A 3DEOA 4FYDA 2QARA 3M85A 1QG7A 1WTPA 1GKHA 4Y2QA 3HOYH 2MA1A 1X6JA 5C0YA 5J2HA 2WACA 2NB0A 4IQUA 2K5WA 3R93A 2EY1A 3LWLA 4BWGB 4KLEA 2ZIVB 4X66L 1QQ5A 2M9NA 1ZQVA 5ALWA 1EY8A 3FHWA 5IIJA 2KOBA 7ICIA 5C0XH 3HOUB 4O2DA 5TSSA 1CI4A 4ID6A 1QLNA 4YWKA 1O7LA 2IA6A 2LMRA 2R7ZG 4UASA 2Y1JA 1PYBA 3IRBA 1N61A 1JX4A 3S2HB 5IYCH 1UT5A 2PMZF 3D2NA 2ISPA 3NTIA 2VQEL 4M8AA 1HNZL 1ZQWA 3PX6A 9ICSA 3S6JA 1S0VA 2UVWA 5AJ3Q 4Y2JA 4OX9L 5M3FB 2QEJC 1IHZA 1S5FD 4ME3A 1HNWL 3T1YQ 2KKPA 4YN4A 1VF7A 4CDGA 3L3OC 1UE5A 2RKSA 5KFEA 3MXNA 4IPHA 4C7ZA 2DGYA 4K8JA 5KFAA 4BY1B 1SE8A 1JJCB 2YV5A 1CUKA 4HJ5A 2I6XA 2B39A 3D2SA 3WK9A 3AFQA 2K89A 4X3UA 3SAGA 1SLJA 2EJFC 3OW2A 2FJ2A 4CRXA 4KV6A 3MXPA 3K7UC 7ICHA 4A3DG 2DWQA 2FJ6A 2NRZA 2F0GA 1PA6A 1R4PB 4QZBA 1C48A 2JA8B 2W11A 1XJVA 2MUYA 4NKLA 4GKJQ 2HDLA 3KLSX 2W9BA 3MA2B 1KN5A 1Q81C 2ZJQA 2YN4A 2ZIWA 3M3YH 4R9WA 5A2QE 4YP3A 1EY9A 3WK8A 4Z6EA 1EZ8A 1F2YA 5C4XB 5AK5A 2K6AA 2PQAA 4O0IA 2QF7A 2RQXA 4FP5D 5FP0A 3K1ZA 1VQ7A 4XUSA 3MGHA 1D2BA 1PRTD 2JZBA 4PH5A 3CCLA 1YIJA 3KUPA 4US8A 5IODA 4MF8A 1WTRA 1N2XA 4LMQD 1NNLA 3HKZE 2HHHQ 3GTQB 3K8AA 1VQJA 1KKXA 1JCKB 5KTQA 2MAXA 3ALRA 2AXTU 1LTTD 2IL8A 3H8JA 2K5NA 2XRSD 4LNQA 9ICAA 3K75D 4CCHA 1EYDA 1CFMA 5FO7B 3KD3A 2E2IH 3BYYB 4NLGA 4QZDA 3C2MA 5J8YC 2F0HA 3MAQA 4OXPA 1HTLD 2R7DA 4NMZA 5FLXL 3QEBZ 3H15A 2Z7JA 3PW5A 1SV0A 1A2TA 4ZLTF 1N8RC 1N32Q 1S76D 3V96A 1HFNA 2EOTA 3SXHA 3RN2A 3PV8A 2IBKA 5KGUA 2CW0C 4EZ9A 5IP7G 4MIUA 1QVGA 3PUVA 1VQHA 2RCFA 2PMZC 4OGQC 2H3ZA 4RAUC 3SENA 2AGOA 4MEXA 2ZIXA 1YT3A 2KN7A 1KTKA 4E6IA 3VC8A 3GP7A 1SNOA 2HCIA 4PMCA 2F3VA 3OWEB 2XY5A 1IL8A 4PV1C 3LX0A 1ONLA 5GAEC 2W9CB 4KLQA 3MR5A 4I29A 5DB7A 4FF3A 1D8YA 3SV4A 1JWUD 2E1FA 1A76A 2HDMA 2MP1A 3FP9A 5AKZA 3HP6A 4Y2SA 4ECWA 4F8RA 3F53A 1EEID 1QQ6A 2K75A 3K6OA 1AZPA 2CXYA 2KIWA 2I1QA 4XQNA 2ESEA 4I2IA 4AIMA 2CRXA 2JEIA 3T5KA 3F2CA 1PTOC 3HOUG 1IXRA 5JUMA 3LVVA 3TARA 1GD7A 4BBRH 1STGA 2ISOA 1PLFA 3T13A 2AUKA 4DK0A 2JA7G 2LPEA 2NO5A 4KY7A 2LKYA 4C3IH 1A0IA 1BDOA 4P71A 4X66Q 3S17B 3Q8MA 3THVA 4DF7A 2PFOA 1Y1WB 2PI5A 5AM3A 4RT2A 5M3MG 1DXMA 2H3VA 5KG5A 2KJ8A 4GOPA 1ZJMA 4MNOA 5BPCA 5KNBA 3I91A 1X9MA 5ALEA 1ZQQA 4IZ8A 1WD0A 1IW7D 2J6TA 3I3CA 1QNKA 1PK1A 2VQEQ 1DOQA 4DSKA 4BWJA 4G3IA 4QW9A 2KOLA 3AB9A 4IUPA 3GV8B 4K4GA 4ZYSA 2I5MX 2EAMA 1HNZQ 1CHPD 5HNKA 5D3IB 4H13C 4OX9Q 3B0XA 1X3EA 1N33Q 4KX5A 3HOZH 2KKVA 2K8CB 2W7OA 4B9NA 1HNWQ 4GFJA 5EPLA 4F87A 3GTOH 4B9LA 2G06A 1YVCA 3VYSA 4L5SA 3HOVH 4BXOB 4EX5A 4YMNA 2WKDA 3HOYG 1WTVA 4DK3C 2NVQB 2OM6A 4GS3A 4FS2A 2Y0SG 1AFPA 1B3AA 1UQVA 4Q8FA 1JOKA 1B2TA 4RQ7A 4Y2XA 4A3JG 3RR7A 3NQTA 5EWEA 1KFDA 2EYLA 5J39A 2ZTEA 4DF4A 3OSPA 5C0XG 3HOWG 1F9SA 2ZJPA 3NELA 3PV0A 3PW0A 4ILWA 4K8IA 2VNUD 1SB3C 5CORA 1TS3A 3TAPA 2BPFA 2ID0A 4FVMA 4IUUA 1B9MA 1FO4A 9ICJA 2I5HA 1LT3D 2VS1A 2F1HA 5AI8A 1YNJD 2JA6B 4HR7B 1VQ9A 1DCZA 3C2KA 2L11A 4RKBA 2E2HH 2ZIUA 1PFBA 2IOHA 1FL0A 3L9AX 4X65L 3M7GA 4IOCA 4JI2L 2ASBA 5KFGA 4AP9A 2Y0SF 1OXJA 4JMUA 2J4XA 3URYA 4GC7A 3J81E 2PI4A 1FYCA 9ICHA 3M4PA 4OEMB 4LZDA 3CXCA 1SKSA 3RJJA 5J2DA 2MGSA 4YG2A 2WKCA 1TWAH 7ICPA 3K0XA 3M6ZA 4YMOA 1PRTC 5KFIA 4RT3A 2QW7A 1N5XA 4YD2A 1BXTA 4HJAA 1CSPA 3QNMA 2RA4A 2HOQA 1BOSA 3MXUA 1CK1A 2NN6I 2ZXRA 4EYHB 2LY7A 4XYOA 1QQ7A 4V190 4QZFA 1JI7A 4QB4A 2B63B 3JPRA 1KL9A
chains in the Genus database with same CATH topology
4B3SL 2L15A 1Y14B 5GROA 3UDFA 1YBYA 4DNIA 4DR6L 1XNRQ 3HOXH 2ATWA 2F52A 3CQZH 3KF8B 4HIOA 1C9OA 3J7ZC 1XPOA 3Q8DA 2OCEA 3UDIA 2A8VA 3BZCA 4P74A 5C44H 1R9TH 1X65A 3E9HA 5IY0A 5LMUL 4LFAL 3CD6A 2EIFA 1A62A 1SRUA 1SMXA 4UP8A 4B3TL 3KFUA 3OTOL 1H95A 3PGZA 2N3SA 2CKZB 2UXDL 2PQAB 1K8GA 4DR2L 1L1OA 2N49A 4L5RC 2UUBL 1E1OA 3CP0A 1FJGL 4AQYQ 1B8AA 2Q2IA 4A3IH 1NTGA 2RCNA 4DR7Q 2OQKA 2WAQG 2LXKA 1N34Q 5IYBH 5ELNA 2F3IA 3K81C 1VQAA 1GO3E 2D62A 1VQMA 5J3BA 1PH4A 1K3RA 3KJPA 4LF7Q 5C44G 2AMCB 4JI0Q 4B3RL 5EAYA 1HJPA 1NMGA 3B6YA 3U58A 3TS0A 4DR1L 1J5EQ 2RHQB 2MNAA 2E8GA 4J15A 1SFOH 2CQOA 3BZKA 3GTMH 3KDFA 2BH2A 1OXSC 4QIWE 4EQ5A 4LUOA 3T1HL 3M4QA 1Y1WG 4JG2A 4LF7L 3NENA 4LUVA 3G71A 2UU9L 4JI0L 1D7QA 3PO3H 4YY3Q 1XNQL 4IFDI 5FJ8H 3TS2A 2NVQH 3BU2A 1U5KA 1TWFH 4JI5L 1YJNA 4JBWA 5GAHC 4A3GH 5HGQA 2MFIA 1I5FA 1VQ5A 4DV7Q 2JK8A 3H3VH 2IX1A 2Z6KC 3CCVA 1YHQA 5GQOA 4BA1I 3EIVA 3RLOA 2MQHA 3I55A 4JI7Q 3GO5A 4MZ9A 4YY3L 3A5UA 2K14A 1EYGA 1XPUA 4DV3Q 3H0GH 1JB7A 1G291 4BA2I 4A3KH 4UY8C 1UWVA 4A93H 1QUQB 3HFZB 3ER0A 1S3OA 4YHHQ 2HT1A 4A76A 1B70B 2JA6H 3RLFA 3S14H 4R1JA 3TQYA 2WAQE 1VQIA 3J80c 2DUDA 3CC2A 2JEBI 5LMNQ 5C0XI 3CCQA 3KDFB 4BBRG 3CCRA 4O0AA 3MEFA 1VQFA 4POFA 4DV3L 4DR4L 2V1CC 5FLMH 3KYHC 5E7NA 3ULPA 4YHHL 4HIKA 4LF8L 1CKNA 2NVXH 2XTIA 4YCWA 1MJEA 4LF5L 1TXYA 4OWXB 2Q2HA 5C0XJ 1YJ9A 2R7ZH 3A74A 2UXBL 1BBWA 4KHPQ 2KENA 2ZM6L 3S2DH 4JYAL 4GLVB 4JOIC 2K5HA 3I2ZA 1ASYA 1KAWA 1KHIA 3CCJA 1OTCA 2JA6G 1NJIC 2F4VL 1X55A 1HZBA 1V9PA 1VQKA 5ELOA 2UXCQ 4A3BH 4PZ7A 1SN8A 2B63H 5IYDG 3G4SA 4JI6Q 4GLAC 4LF6Q 3S15H 4JI4Q 4GN3B 4KHPL 1OXTA 2IY5B 5FLMG 2Z6KA 2GN5A 1PHJA 2RHSB 4LW1A 1Y1VG 3I4MH 2PI2E 4IO9A 3STBC 2I0QA 3GD7A 1KRSA 4PMWA 3TEHB 4LWCA 1HZ9A 1M90C 1AH9A 2RF4A 4BY7G 4GNXC 4JI4L 3FKIG 4A3LH 5JJKA 4DV2Q 4B3MQ 1YEZA 2ZTDA 2IHEA 4IOAA 2CWAA 4IJLA 4JBJA 4TQUS 4DUYQ 2B63G 2YTYA 4WJ3M 1J6QA 4UP9A 3PSIA 4DKAC 3J7A5 4KHZA 3U4VA 4IPGA 2WP8J 2EXDA 4PG3A 2VZAA 1VQLA 4B3SQ 4DUZL 2A19A 4IJHA 2R92H 1LTLA 4B3ML 3I4MG 5JEAG 5AJ3L 4DR6Q 1EOVA 2JJQA 4JI8Q 2BA0A 4BXXH 4POGA 2PMZE 2LXJA 1HZAA 2WB1G 3PIOA 3VDYA 1LYLA 3D31A 4KLKA 1HNXL 3AYHB 3U50C 1XMQL 3CW2C 4R4IA 4R4CA 1QZHA 3CMAA 4PZ8A 4LFAQ 5LMUQ 1YZ6A 1PH6A 1IBKL 1HR0W 4C2MH 2JE6I 4JI8L 3OTOQ 2N78A 3PO2H 4P75A 4P73A 1A8VA 3U4ZA 5C3EG 3RN5A 3S1MH 2UXDQ 3UDXA 2K50A 4DR2Q 2UUBQ 1MIUA 5FLXc 1FJGQ 1FVIA 4BXXG 3PIPA 4KI0A 2HQLA 2BH8A 2KHIA 1PVOA 1KC8C 4HJ8A 5M5YH 3BJUA 1EWIA 1JE5A 4A3CG 1UEBA 2NZHA 5M5XH 2Q2UA 3L0OA 5H1SE 4DR3L 3KF6A 4B3RQ 3F8TA 2GVAA 1PH3A 1XPRA 1TWGH 3A5ZB 3HOXG 4DR1Q 2YTVA 2JEAI 2ZJRA 1W3SA 3RZDH 1E3PA 4HJ7A 3GTGH 3M4OH 3WWVA 1VQOA 3HKSA 1L2FA 4QGUA 3T1HQ 2EQSA 1YHAA 4A3EH 2UU9Q 3JAMi 2JA9A 1BKBA 3RLNA 2QGQA 1HH2P 2JA5H 4RG1A 1XNQQ 1NMFA 2WB1E 2HIXA 4JI5Q 1YZ7A 2NVYH 1CKOA 2NN6G 2VL6A 3E0EA 3J81i 4OONA 1Q1BA 4GOPC 4K0KL 1YI2A 1PH2A 5JJLA 2AWNA 3W1GA 2Z0SA 1I3QH 2E2JH 4A3IG 1N32L 4AH6A 5DLQE 5IYBG 1IL2A 1EIFA 4X64L 3CC7A 2ALYB 3ERSX 1PV4A 1SROA 1I50H 1QVCA 3KF6B 4RMFA 1L1OB 3PUXA 4QL5A 1E7ZA 4A3EG 1VQ4A 1XMOL 1W2BA 1JT8A 1WYDA 2R7FA 2XGTA 1GM5A 1I94Q 2UUAL 3HOUH 1PFSA 1A63A 4JV5L 4A3MH 2PNHA 1EQQA 1X6OA 5IE8A 4DR4Q 1OXUA 4UPAA 2PI2A 3S16H 3SGIA 4DV6L 3GTLH 1PH8A 5IP9H 2IT1A 4R4OA 4LF8Q 3S2HH 4LF5Q 4TVAB 4LF9L 1EQRA 3JC66 3PO3G 5FJ8G 1VQPA 3GTJH 1I94L 2UXBQ 4HIDA 3CCMA 3I4NH 3CF5A 4A3GG 4JI1L 1WCMH 4P72A 2ZM6Q 1JMCA 1VS0A 1K0RA 3KOJA 4DR5Q 1K8AC 2IX0A 5M3FH 1G6PA 1HZCA 3EBEA 4QJFA 1KQSA 4OWWB 1EIYB 2F4VQ 4DPGA 5GADC 3GTKH 3M7NA 2KCTA 2D0OA 1IZ6A 3ULLA 4A3MG 1UE6A 5M5WH 4C3HH 4A93G 3H0GG 1N36L 2B3GA 3M85A 4A3KG 1GKHA 4APVA 4WJ4A 3HOYH 4DR5L 3G48A 1L0WA 3LGJA 3ZJYC 1P8LA 3E9IA 2K4KA 2BA1A 3UE1A 1CKMA 1S72A 1N34L 3NBHB 1KXLA 4X66L 5GAGC 4IFDG 1WCMG 3FHWA 1JJ2A 5IT9c 2Q2TA 4DV5L 1VQ6A 4NPSA 4O2DA 2JA8H 1U0LA 2CWPA 3I56A 1N9WA 1WI5A 4YWKA 4PZ6A 4UP7A 4DAYB 2R7ZG 5C4XH 1PYBA 1TWCH 3IRBA 4DV4L 3AFPA 5IYCH 4X62L 1HR0L 2VQEL 4DUZQ 4A3DH 1HNZL 1FGUA 4OO1I 1PYSB 5JEAJ 2UUCL 5AJ3Q 4OX9L 2OTLA 2VUMH 1CKNB 2NVTH 4ME3A 1HNWL 2QEXA 1UE7A 1X3GA 3T1YQ 4A3BG 1K83H 3W5OA 1HNXQ 1VQBA 1UE5A 1XMQQ 4GLXA 2OWOA 3GTQH 1B7YB 1V1QA 4LF4L 4LFBL 4GKKL 4IPHA 1AE2A 2C35B 2DGYA 1IBKQ 1YHBA 3G6EA 1SE8A 1JJCB 2YV5A 1CUKA 3TREA 3JAMc 4HJ5A 3K7AH 3AFQA 1CSQA 3T1YL 5IYCG 4A3FH 1SLJA 1VCIA 3PUYA 2FXQA 2R6GA 4IPCA 4YWLA 3ULJA 5BR8L 3OW2A 3PUZA 5C4JH 3K7UC 4JBKA 3J81c 4A3DG 2JQOA 4JOIA 1PH5A 4JBMA 4A3LG 3S24A 1PA6A 1EFWA 2VY3A 1XJVA 4XIGS 5LMNW 1Q81C 4GKJQ 2ZJQA 1Q7YC 1IBML 3M3YH 2VQFL 1MKHA 4IPDA 4Y7NH 4DR3Q 4Y52H 2R92G 2PQAA 4YCUA 4DV1L 3RZOH 1QZGA 1QVFA 3TRZA 4R4QA 1VQ7A 1IBLL 2YTXA 1KRTA 1Q86C 4GKJL 3CCLA 1YIJA 3M9BA 3L7ZC 1WOCA 1S40A 3MXNB 2E5LL 5IP7H 3PF4A 2Y0SE 4GNXA 1K9MC 2HHHQ 3HKZE 1MJCA 1YNXA 3K8AA 1VQJA 1NE3A 3EN2A 4DK6C 4DV0Q 3F1ZA 3CC4A 3D0FA 4MTNA 4NXNL 1VQNA 2R93H 2K5NA 4LNQA 3PO2G 4LFCL 1X56A 2E2IH 4H02A 2NZOA 4K0KQ 4OXPA 2R7DA 2D0PA 1X9NA 3H15A 1N8RC 2HHHL 1N32Q 5JJIA 2N8NA 3DM3A 1VQEA 4DV0L 4GN4B 3RN2A 2B29A 4X64Q 1XNRL 2MO1A 1X54A 3RNUA 3I4OA 4JI3Q 4BBSH 5IP7G 1XMOQ 2GVBA 3NEMA 3PUVA 1VQHA 3L2PA 1G51A 1YITA 1QVGA 3S17H 4L5TA 1I6HH 2UUAQ 1Y1WH 4R4TA 2R93G 1Q12A 4JV5Q 3PF5A 5GAEC 4JI3L 4DV6Q 4GNXB 3H3VI 3RR5A 2JA7H 1QUQA 1WJJA 4A4IA 4LF9Q 1YJWA 4GN5A 2CCZA 1LM0A 2JA5G 4AQYL 2HIVA 3F2BA 3FP9A 4JI1Q 1PH9A 4NXMQ 3CAMA 4DR7L 1Q46A 5M3MH 4BBSG 2K75A 4DAMA 4AIMA 4B3TQ 3CMEA 3F2CA 3PUWA 3GTPH 4AYBG 1IXRA 4YCVA 1NBWA 1N36Q 4JCVE 1J5EL 2MO0A 4NB3A 4NXML 1GD7A 4XTCS 4BBRH 3S1RH 2JA7G 2AWOA 4X6AH 3OYYA 1TWHH 1E24A 1RIPA 2K5VA 1P16A 1LUZA 2AHOB 1A0IA 4P71A 4C3IH 4X66Q 3UE0A 2I5LX 1D8LA 2YU9H 3HOUG 4IFDJ 1AE3A 1UE1A 5M3MG 3CPWA 4DV5Q 4GOPA 1X3FA 5K36G 4MNOA 4BY1H 5IP9G 4DV7L 1V43A 5HY6A 3A0JA 4HIMA 4C3JH 4DV4Q 4A3JH 3I4NG 1HR0Q 4X62Q 2QA4A 2VQEQ 5IYDH 1BVSA 4FDBA 4JI7L 1Z9FA 1VQGA 1HNZQ 5M3FG 2I5MX 3HOWH 2KHJA 3F2DA 1KIXA 1X3EA 2UUCQ 4OX9Q 1N33Q 3HOZH 1HNWQ 3K80C 3KJOA 3ICEA 3GTOH 1Y1VH 1YVCA 3CPFA 4L5SA 3HOVH 2CFMA 4OWTB 4EX5A 4QQBX 1OXVA 2KCMA 1T9HA 5LMNL 1C7YA 4BY1G 1JJGA 3HOYG 1Q1EA 4DK3C 4LF4Q 4BY7H 4GKKQ 4LFBQ 4GS3A 1IYJB 2Y0SG 3FKIH 1ASZA 1VQDA 2KBNA 2IHFA 1EUJA 2WFWA 3HKZG 1Z47A 3CCSA 1XTDA 1N33L 1NY4A 3CCEA 1Q82C 4A3JG 4AYBE 2ZTEA 2ES2A 1VQ8A 5BR8Q