3AEVA

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
EYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLAAEKLGKDFEAAWREVWVPLEEEWGEVYAAFEDAAKDGIEVLKGHVPDEWLPVLKEIVENYVEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
molecule keywords Translation initiation factor 2 subunit alpha
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3aevA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aevA01
2F52A 2K52A 3TS0A 1HZBA 3VDYA 4AYBG 2YV5A 1YJ9A 3H3VH 1N33Q 4GKKL 2YTVA 5DLQE 4APVA 5JEAG 1HR0W 5FJ8G 2N3SA 3FKIG 4UY8C 3OYYA 4EX5A 1SE8A 2I5MX 4LF4Q 1CKNA 1X9NA 1OXUA 1XNQL 3HOVH 4LF9Q 1XTDA 3JC66 4DV5Q 4HIKA 4YCWA 1YIJA 3F8TA 3ICEA 4RG1A 4GOPA 4LUVA 2R7DA 4A3CG 5C4XH 1YEZA 3HFZB 3T1HL 1Q46A 3ER0A 4IPDA 4J15A 4UP8A 4WJ3M 4C3JH 4Y7NH 4DV7Q 4ALPA 1PH1A 2E2HH 4DR1L 2IX0A 4A3IG 4GKKQ 1X3EA 1ASZA 4OX9L 4AH6A 1TWHH 2MFIA 1Z9FA 4A3DG 4MTNA 4LUZA 4QIWE 1HR0Q 1EFWA 3SGIA 2N78A 1RL2A 5M3FH 4JCVE 2KHJA 4GN5A 4GNXB 1FL0A 5LMUL 2HHHL 4KHPQ 3OW2A 4LF6L 4OXPA 3CCRA 2AMCB 1VQMA 3I4MH 1V1QA 4DV1Q 2R93G 1X55A 2MO0A 3GTPH 2K5NA 1NMGA 4DPGA 3L2PA 1SLJA 2JK8A 1VQJA 1PHJA 1I94Q 4JI5L 3GO5A 4MZ9A 1XMOQ 1YBYA 4FDBA 4BXXG 1VQLA 4P75A 1Q81C 1EIYB 1MJCA 4A3BH 4JI1L 1X54A 1KRSA 1YNXA 2R7ZH 1Y1WH 4DV2L 2EIFA 2LXJA 2VQEQ 4IPCA 3UE1A 1HZCA 3CC2A 4DR6L 1OXTA 1C0AA 3PO2G 5FLMH 1YHBA 3IRBA 3J7ZC 4LFCL 2ES2A 2CQOA 2I5HA 5M5YH 4K0KL 4P72A 2PI2E 1B8AA 4IO9A 4LFCQ 3PUZA 2GN5A 1QUQB 1WCMG 2ALYB 1NJIC 2ZJQA 4DR6Q 2UUAQ 2F4VQ 5HGQA 1AE3A 4BBRG 3CP0A 5GQOA 3HOUG 4DV4Q 1AE2A 2PQAA 4POGA 2K75A 4DR2Q 2JA8H 2WFWA 2UUCQ 1Y14B 2L15A 2MQHA 3PV0A 2H5XA 2VY3A 4L5TA 4HIDA 3FP9A 4JI2L 4YWMA 2IT1A 4B3TL 2MO1A 4YY3Q 4DAMA 5IYDH 2K50A 3M4OH 3A74A 4DUZQ 5E7NA 2HHHQ 2Z6KA 2QA4A 2WP8J 4GOPB 1NTGA 5C44G 3CCVA 1QUQA 2IX1A 5JJKA 1P8LA 1XJVA 1UE5A 4DV0Q 3L0OA 1E22A 4A4IA 1ASYA 3KF6A 4LFAL 3TRZA 5C3EH 4DR3Q 3I4OA 3DLLA 4DV7L 2JA6H 1HNWQ 3W1BA 3KYHC 3F1ZA 2JE6I 4X65L 3A5ZB 4DV3L 3S1RH 1FJGQ 4DUZL 2VNUD 3T1YL 1TWGH 1N36Q 5GAEC 4DKAC 2MNAA 1W3SA 2BH8A 1EWIA 1TWFH 5H1SE 4JI4Q 1YZ6A 2F3IA 5IYCH 5AJ3Q 1HNXL 3PO3H 4R4TA 2KCTA 1VQBA 3K7UC 5IE8A 1W2BA 1PH3A 2ID0A 2PNHA 2ZM6L 1CSQA 4YWKA 3HOYG 3STBC 2K5HA 4LFBQ 3CPFA 5GADC 1PH6A 4IJLA 1CKNB 4R4QA 3KF8B 4HJ8A 4C2MH 2ZM6Q 1N34L 1KQSA 2F4VL 1I50H 2JJQA 3NBHB 4YWLA 3ULJA 2Q2IA 4DK6C 1J6QA 5C0XG 4QQBX 4GKJQ 3G6EA 1K3RA 5AJ3L 1HNXQ 3J80i 4X62Q 4JI0L 4JV5L 2UUBL 2V1CC 1L1OA 4BY7G 4TVAB 2B29A 5IWAQ 4A75A 4K0KQ 2UXBQ 1FJGL 4L5QA 2EQSA 2A19A 3S24A 2DUDA 3FHWA 1WJJA 4OONA 1NY4A 4JG2A 3TEHB 4X65Q 2JA5H 4HJ5A 1Q7YC 3AYHB 2NVXH 2CWPA 4HIOA 1P16A 5C0XJ 2Z0SA 2R7FA 5M5WH 4DV6L 5M3MH 1PH9A 1C7YA 4Y52H 1I6HH 3MXNB 1IBMQ 1FVIA 1YHQA 1PH5A 4MNOA 3KFUA 4NXNL 3U50C 4YHHQ 3EBEA 1IBKL 1M1KC 3PUWA 1G6PA 3F2BA 4A3KH 2K14A 4NXNQ 4PG3A 2HT1A 3ERSX 1NE3A 2Q2HA 3BZKA 4BY1G 4A3EG 5GAHC 1IBML 3KDFB 1EIFA 2CKZB 2D0PA 3PUYA 3CCEA 3U58A 5EAYA 4YHHL 1K73C 3HOWG 1S3OA 3U4VA 4A3FG 1FGUA 1VQAA 4DR2L 3M7NA 1H95A 4HJAA 4JBJA 3CCLA 2XGTA 3KLWA 4JOIC 3I55A 2VQFQ 2UUAL 4A3IH 2AWOA 2I0QA 1CKMA 1OXXK 3Q8DA 3KOJA 4GN3B 4B3SQ 3NENA 4O0AA 4A3JG 4GKJL 1OXSC 5M3FG 1KL9A 1MIUA 1VQHA 2OTJA 3PIOA 5ELNA 2E8GA 3CQZH 3F2CA 1N34Q 1N9WA 3D31A 4L5SA 3WWVA 3KJPA 2D0OA 4X62L 1K8GA 3GTKH 3I4MG 2BH2A 1SR3A 3HOZG 3AFQA 3B6YA 3STBD 4C3IH 3RLFA 4GOPC 1IBLL 2B3GA 4B3RQ 1XNQQ 4LF4L 2LSSA 3PUXA 4LF7L 3K80C 1QZHA 2IHFA 4B3RL 1SFOH 4LF8L 3CCUA 1IYJB 1L2FA 1LYLA 4LFBL 4R4CA 4JC0A 1VQGA 3RN2A 5IP9G 1VQNA 4A3GG 2NN6G 4A3BG 3T1YQ 2R7ZG 1I94L 3HKSA 1XMQQ 4X66L 3TQYA 3H15A 1Y1WG 1VS0A 1QVCA 2LXKA 1XPRA 4IFDG 4JBMA 3TREA 4DV3Q 3HOXG 1HNWL 5FLMG 4JI4L 4PZ8A 3S17H 4A93G 2GVAA 2RHSB 5JJIA 4LWCA 3EIVA 3G71A 1PH7A 1VQ9A 5LMUQ 2Q2TA 4DV0L 3RZDH 4ME3A 3PCOB 3G48A 4BA1I 3ULPA 1HR0L 4LF5L 5IYBH 4JYAQ 2ZJPA 2WAQG 1LTLA 4DR4Q 1GKHA 4UPAA 1G291 5LMNQ 1A62A 4B3TQ 1GO3E 2E5LL 4GNXA 1A8VA 1Y1VH 2K4KA 3M9BA 5FLXc 1EOVA 1QVGA 5K36G 1S72A 4YY3L 2WB1G 1XMQL 2RCNA 1E1OA 1IBKQ 4JI2Q 4UP9A 3S1NH 5J3BA 2N49A 4WJ4A 2Y0SG 2NVTH 1JJCB 3GD7A 1KXLA 1WI5A 4LF8Q 1VQ8A 1KAWA 4A3LH 3K8AA 1KC8C 1I5FA 1JJGA 2UUCL 2JEBI 2A8VA 2IHEA 1GD7A 1KHIA 2ZTCA 1LUZA 1OXVA 3I2ZA 2UXDQ 4GLVB 4DUYQ 1B70B 4BA2I 1LM0A 1EUJA 4LW1A 4IJHA 1O7IA 3PF5A 4LNQA 4JOIA 2IY5B 1BVSA 2VW9A 5BR8Q 1SROA 2VQFL 3CF5A 1TWCH 2VUMH 3BU2A 4DUYL 1M90C 4AYBE 3S1QH 2JA9A 4R4OA 4JI1Q 2OQKA 2UXDL 3BZCA 3L7ZC 2JA7G 1JB7A 2CCZA 3GTGH 3UDGA 1WYDA 2VL6A 1UE1A 1UWVA 2NZHA 1J5EL 2VZAA 5LMNW 4LUOA 4A3MH 3ZJYC 1PV4A 4JBKA 2NVQH 3NELA 3I56A 5JEAJ 4JI8L 2HIXA 3EN2A 4GS3A 4AQYQ 4IFDI 1YZ7A 3HKZG 1PFSA 4KLKA 2AWNA 4YCVA 3UDIA 3RNUA 4P71A 3W5OA 4DR5Q 3E9HA 3M4PA 4KHPL 1G51A 1EYGA 1B7YB 1A0IA 4DV1L 2E2IH 4DR7Q 3UDXA 3AFPA 1PH8A 1VQ6A 1VQ4A 2OTLA 2Q2UA 4LF6Q 4BY7H 4LFAQ 1S40A 1PH2A 3GTMH 2DGYA 4LF5Q 4JYAL 1WFQA 1JT8A 1A63A 1L1OC 4GLXA 4OX9Q 4P74A 2B63H 2WB1E 5IWAL 1TXYA 2OCEA 1IXRA 1HJPA 5M3MG 4JI0Q 3G4SA 4JV5Q 4HIMA 3S16H 3H3VI 5IP7H 1NBWA 4O2DA 1XNRQ 4LF9L 1KRTA 2HQLA 4NXMQ 5IY0A 4GN4B 3UE0A 1VQFA 4JI3Q 4IOAA 5HY6A 4A3KG 2OWOA 4DV5L 2R92G 3I4NH 4A3EH 4BY1H 2KCMA 3KJOA 1GM5A 3CC4A 4LF7Q 4EQ5A 1XPUA 3CCQA 3GTLH 3HOWH 1K8AC 2A1AA 1GVPA 4A3FH 4BBSG 2RHQB 1PVOA 1VQIA 2EXDA 3K7AH 4XTCS 3M85A 2UU9L 1N33L 3CMEA 1N36L 1AH9A 3NEMA 3CPWA 2NVYH 3DM3A 2R6GA 1VQKA 1K83H 4POFA 2YU9H 3H0GH 4B3SL 2BA0A 3PIPA 3JAMi 1E3PA 4QY7A 4DR3L 4AIMA 4A3JH 2YTYA 4NB3A 4DV2Q 4AQYL 1WOCA 4JI8Q 3CC7A 3CD6A 3S14H 2QEXA 5FJ8H 3FKIH 1K0RA 1PYBA 4RMFA 1IZ6A 1N32Q 3HOZH 3HOVG 1J5EQ 3E9IA 1VQEA 2NN6I 4JI5Q 4NPSA 1TWAH 2ZJRA 4X6AH 4X64L 4A3CH 4HJ9A 5C4XG 2AHOB 3RR5A 1C9OA 1SN8A 5IP9H 4A3GH 1BBWA 1V9PA 2VS1A 1Q8KA 1N8RC 1HZAA 1Q12A 1VQCA 4R4IA 3RN5A 1CSPA 1X65A 5IT9c 1DGSA 3S1MH 4DV4L 3OTOQ 3HOXH 1V43A 4DV6Q 3TS2A 4A3DH 4QL5A 4A93H 1BKBA 3RLOA 2UU9Q 1Q82C 3J81c 4C3HH 2D62A 1YHAA 3S2DH 5IYBG 3PGZA 2R93H 4QGUA 3T1HQ 1EQQA 1VQPA 2KENA 5GROA 2CFMA 1PA6A 1Y1VG 1Q1BA 4NXML 2VQEL 1XNRL 3J7A5 3S15H 4BXXH 4JI6L 1MJEA 3M3YH 3A0JA 4PZ7A 2KHIA 4X64Q 3LGJA 4GLAC 4YCUA 4A76A 1SMXA 1UEBA 1I3QH 5LMNL 1EQRA 1Z47A 1XMOL 1E24A 1KD1C 4A3LG 3PF4A 4DR4L 3PO2H 1VQ5A 1L1OB 3M4QA 2PQAB 1PYSB 4IFDJ 1BBUA 3GDEA 4KHZA 1XPOA 2WAQE 1HNZQ 1RIPA 4H02A 3CAMA 4JI7Q 1D7QA 3HKZE 3K81C 2NZOA 4JBWA 3KF6B 1HNZL 1WCMH 3CCMA 1YVCA 3W1GA 4DR5L 4BBRH 5C4JH 3HOUH 4OWWB 4JI7L 2PI2A 3E0EA 4DR1Q 2C35B 4UP7A 4IOCA 1QVFA 2JA8G 2VUMG 3D0FA 3RLNA 4QJFA 2OQ0A 3AQQA 5C0XI 2JA7H 1E7ZA 4OO1G 4IPGA 4JI6Q 3K0XA 4B3MQ 2ASBA 3GTOH 5IYDG 2HIVA 3ULLA 4GNXC 1X3FA 1KIXA 1IBLQ 2YTXA 1MKHA 2GVBA 1YJNA 4JI3L 4DK3C 4A3MG 2AKWB 3BJUA 4IPHA 1L0WA 1YI2A 4PMWA 2RF4A 3KDFA 1UE7A 3PUVA 5C44H 1CKOA 2UXCQ 2FXQA 2I5LX 4P73A 5GAGC 1YITA 3RZOH 4OO1I 3J81i 3GTQH 5C3EG 1VQOA 2PMZE 1IL2A 2JA6G 5JJLA 3CCJA 2ZTEA 3OTOL 1PH4A 2YYZA 2UXCL 2CWAA 3UDFA 1UE6A 4XIGS 1JJ2A 3J80c 1VQDA 2B63G 4R1JA 3CMAA 5IYCG 4DR7L 3PO3G 4PZ6A 4TQUS 2Y0SE 1VCIA 4OWTB 1QZGA 1E1TA 2XTIA 1CUKA 1NMFA 4HJ7A 3HOYH 5IP7G 4B3ML 3CCSA 1Q1EA 4KI0A 5M5XH 3J81j 2JQOA 2ATWA 2JEAI 1N32L 4L5RC 4OWXB 2N8NA 1VQ7A 3MEFA 2E5LQ 1X3GA 1OTCA 2R92H 1JE5A 3CXCA 3I4NG 4DAYB 5ELOA 3JAMc 1HH2P 3CW2C 1SRUA 3F2DA 1D8LA 1YJWA 3S2HH 2ZTDA 2KBNA 3U4ZA 1HZ9A 3A5UA 4BBSH 2QGQA 3I7FA 2UXBL 1R9TH 2K5VA 5BR8L 2Z6KC 3GTJH 4DNIA 2JA5G 1X56A 1JMCA 1U0LA 1T9HA 2UUBQ 1X6OA 2E2JH 1U5KA 1Q86C 2BA1A 1K9MC 3PSIA 3AEVA 4X66Q 3H0GG
chains in the Genus database with same CATH superfamily
2F52A 2YN4A 3TS0A 3DEEA 4YG2A 1HZBA 2M9VA 2YV5A 1URJA 4JK1A 2YTVA 3PX4A 1PTOB 4KITB 3MHBA 3V72A 2YTUA 3T13A 1LTBD 1SE8A 4LF4Q 1HHVA 4HN7A 3CRLC 1OXUA 3HOVH 2P6RA 3AQEA 2L5YA 4YCWA 4CDCC 3M4YA 4GXKA 2R7DA 5C4XH 1YEZA 3T1HL 3PW4A 1XSPA 2GOLA 3FRPB 1AZPA 1VDVA 1Q46A 2DBYA 4J15A 1HA6A 1EYDA 5ALDA 1M6YA 3V6KA 1Y8NB 5TISU 2PMZC 2BE5C 2SEBD 3CKIB 3DMUA 1XWEA 5CBAE 4Y7NH 4DV7Q 3TFRA 9ICVA 1EY8A 4ALPA 1PH1A 1K0SA 2KEYA 1TT2A 1TWHH 2MFIA 3C1EA 1KNEA 4NLCA 2NWGA 4MTNA 4LUZA 4QIWE 5DLGA 3SGIA 2N78A 3JPOA 1RL2A 1FL0A 4ZUIA 2XRSD 3VR4A 4KHPQ 1TWHB 5ELDA 4F87A 2AMCB 4YN4A 4OL7A 5DGBA 3D2QA 2B2VC 4DV1Q 2R93G 2MO0A 3MFGA 4C3IG 1KTQA 4FBUA 2WFAA 4B6JA 4KN4C 3QUTA 1SLJA 2EY6A 4PGYA 4K5VA 1VQJA 1PHJA 4RPXA 2IL8A 4JI5L 1I94Q 8ICQA 3H8MA 4PL2A 9ICSA 3GO5A 2G5HB 3KBXA 3P7JA 4KLGA 1XMOQ 3HOYB 2K5DA 3KLSA 3M4OB 2M9NA 4F2SA 4KLFA 1VQLA 4IR9A 2B2WC 2B8FA 3JPPA 3OWEB 1YNXA 2XNAC 2LYBA 4UB8U 1DONA 4KTAA 3ND9A 1Y1WH 1BPEA 5CHGA 2LXJA 2KMDA 4IPCA 2VQEQ 4IFDH 5IILA 1XTCD 3IP4B 5CP2A 1I4XA 3MA2B 2V4QA 2HI0A 1HUMA 3J7ZC 1GUGA 1T4GA 4DOBA 2QDBA 1STAA 7ICQA 1B8AA 1N56A 3PIP3 2KICA 1SKWA 1C4QA 4PMCA 1QUQB 5AIAA 4YR0A 3R2TA 2NO5A 1U9LA 3EZ5A 3OIPA 3L9AX 3I91A 5C44B 5ELEA 5JRTA 1LT6D 5ALQA 5GTHU 2PQAA 1WD1A 4POGA 1MQ3A 4XYOA 2H5XA 2VY3A 3TN2A 2XC9A 4HIDA 5AFWA 3PX6A 3MGVA 1B3QA 1U4RA 1J97A 4A3BB 3ITPA 5IGGA 5LMNQ 4IQWA 3CNHA 1BPDA 3A7AB 4RFBA 3M4OH 2JXMB 3A74A 4RNOA 5AM1A 1XC9A 4RCOA 4EENA 4C7ZA 4DSFA 2KVSA 2WP8J 2QA4A 3CCVA 4QZBA 2RDFA 3ZI4A 2HMXA 1UE5A 2WKCA 2XWJB 1PRTB 3L0OA 1ASYA 3RJIA 3ZDDA 3KF6A 1NZBA 1TS4A 4DR3Q 2JRZA 4DV7L 4F4XA 3QX7A 5LL6X 1VJ5A 2HBJA 2KOLA 3A5ZB 3HKZF 4C8KA 2RCFA 3U9SA 4RU9A 5J2IA 1PXUA 3KBGA 4FO2A 1N36Q 4K2LA 1DRGA 4M9GA 2BH8A 2Y1JA 2V9WA 1YZ6A 1ZYQA 1ZQJA 3RJEA 4KV6A 5IYCH 5CV7A 3R9KA 3CU7A 2ASJA 3U26A 2PNHA 5DLFA 3Q8MA 1SNCA 2K5HA 4LFBQ 2RDIA 3CPFA 3QJYA 2KVMA 3T56B 3I1YA 4OGQC 4IJLA 4R4QA 4C2MH 2KIWA 1N34L 1KQSA 2OM6A 4KLUA 3NBHB 2WKDA 2JYOA 3G6EA 3J80i 5EE3A 4JV5L 4DF8A 7ICHA 4ME5A 3SMVA 2RSOA 3BDCA 5IWAQ 4F92B 4MFCA 2EQYA 2EPBA 4L5QA 5J2AA 1LTAD 2DUDA 3FHWA 3C2KA 3MDCA 1JROA 4HJ5A 2PMZF 4YQWA 1DXMA 2RQ5A 3QWNA 1ZQPA 3GIIA 1P16A 1PH9A 5AK4A 1C7YA 5M3MH 1SJHD 1PH5A 3VYTA 3KFUA 4NXNL 1IBKL 4DSLA 3ICXA 2HOFA 2W9CA 3NUCA 3PUWA 2HHXA 3T3FA 2QF7A 5AKLA 1ILQA 4PG3A 2HT1A 2RBMA 4A3EG 1IBML 4BY1G 1ZOLA 2KIVA 4I2FA 4J9KA 3PUYA 5C6AA 1S3OA 2EYFA 4A3FG 1B44D 4ZYSA 1VQAA 1PLFA 4DR2L 3M7NA 1U47A 3NSWA 2OXOA 4PJ0U 5CC4A 4HJAA 3HILA 7ICKA 4JBJA 1LKYB 1PZNA 3H8WA 3NWTA 5J0PA 4K8IA 1GUTA 1B0XA 1AROP 3QZ8A 4ELVA 9ICLA 1OXXK 1ZYRC 1D1KA 2VB3X 3KOJA 2L55A 4PNYA 4Q0FA 1NR4A 1FGBD 4CJ2C 1PZID 2DPIA 4RQ3A 4ZRZA 4BWGB 1XU4A 3M9OB 4XT1B 3F53A 2JHDA 3HOXB 3SI8A 4J8QA 1FFVA 1I4QA 3I72A 5CEHA 2D0OA 4RT3A 4G4KA 3VR3A 1KSPA 3D3RA 1K8GA 4NM2A 3AFQA 1ZQZA 5J0UA 5AKYA 1CQFA 3B6YA 2P35A 4C3IH 2V4RA 1D8BA 3OMGA 3GZFA 3QG1A 5JOBA 3K80C 1JOOA 1EIHA 4CDDC 4IS7A 3LWMA 3CCUA 4YXJA 4LFBL 3MR5A 5CMDA 4Y2SA 2DUYA 4QZAA 1RQLA 2C2DA 3GFKB 2KTQA 1RHPA 1WWVA 5KT2A 2K8CB 3HKSA 3T1YQ 1ZQRA 5AI5A 2JN4A 4DCCA 4DL5A 3KHRA 2B39A 2LXKA 3E6ZX 1Y1WG 4IFDG 3N28A 2ZJ8A 4PPXA 3NP8A 3S2DB 4IUTA 2IWHA 4G7ZC 1U4LA 5DQHA 4PZ8A 3S17H 2XO7A 3H0RB 4A93G 3TKAA 2BQ3A 1JRPA 3HOUB 4USAA 3EIVA 2AQ1B 5LMUQ 2NRVA 3B0XA 1TK0A 1CA6A 1QH9A 4ME3A 3RZDH 3PCOB 2ZXRA 4LF5L 4JYAQ 5J0YA 1X40A 5IYBH 4NLNA 2K04A 5KFCA 1S10A 1GKHA 1ZXTA 2W9CB 2L0CA 2NZ1D 8ICFA 4IQZA 4RPYA 1SGGA 1Y1VH 5FLXc 3HOWB 2WHEA 2DKZA 3KFUF 2WB1G 2L9HA 2NTSA 1XMQL 1LTTD 2JR5A 4JI2Q 4PZOA 5J3BA 3GTGB 4CNQA 4P0PB 4EYIB 2NRTA 1RCVD 3GD7A 5KIXA 4O3QA 2DY7A 3N4MB 3RAXA 1VQ8A 3S15B 4A3LH 3K8AA 2EZXA 2K5WA 4EQOA 2RQXA 4BWJA 1JWMD 1QCBD 2C5CA 3GQBA 4FP5D 2DN8A 5JJZA 1LVHA 3M8SA 2KEEA 2L12A 1GD7A 2QCPX 5A0LA 2UXDQ 1EY7A 1K83B 5LHY1 2GA4B 4J9SA 1B9NA 1B70B 2NVYB 4RQNA 1SV0A 4BA2I 1LM0A 4N9PA 3M6ZA 4KMUC 4QZDA 4LW1A 4IJHA 2VIXA 9ICQA 3SAHA 4LNQA 4WJ3B 3RB6A 2N88A 2IY5B 2VW9A 3CF5A 2VQFL 2WINB 2VUMH 3BU2A 4DUYL 4CHTB 9ICAA 4AYBE 4R4OA 3VA7A 2UXDL 5D65A 3BZCA 1KLNA 3L7ZC 1SYDA 1RQNA 1LLRD 5CV5A 3UDGA 1WYDA 3F5AA 2NYZD 1ZJNA 3K57A 5CB1A 4A3MH 1PV4A 4RA8A 4FFDA 3GDXA 2CPRA 3I56A 3ZDCA 4JI8L 3KHHA 5I6YA 2H3FA 4GS3A 4GXJA 1DOMA 4M1UB 3HKZG 2XCPA 1VF5C 4YD1A 4DR5Q 3BYTB 3FKIB 4C4TA 1B7YB 4N8X1 3Q8SB 4F5RA 2KFNA 5EJWA 5AKJA 3VYRA 1ZQBA 3RBDA 4A3JB 2OTLA 2E1EA 2YB4A 5AI4A 2F0OA 4L63B 4DOCA 2AUJD 2DGYA 4LF5Q 4JYAL 1CM9A 1FNVA 4HAEA 1L7OA 2E8NA 2B63H 3QNMA 5F9NA 5G5GA 2WB1E 4IALA 4O9MA 1S76D 3K7AB 4R8UB 4YFKA 5M3MG 3MR2A 4JI0Q 2LKVA 4Z6EA 4M8AA 3GTLB 3S16H 1XS9D 5EBDA 4R8IA 4O2DA 3VYUA 1QE6A 1SNOA 2HQLA 5IY0A 2XWBB 4FXKC 4P2CB 4IOAA 2LBOA 4IQTA 5J2CA 2RLTA 1NKCA 1Z7TA 2F1HA 4QZFA 1H9JA 1Y8PB 2KHSA 3DEOA 2RKSA 3I8ZA 4S3SA 4BY1H 3GTKB 3VC8A 1RYRA 3CCQA 1SV0C 4IRDA 2CH4W 1QSLA 5FLXE 4A3FH 2RHQB 5C4HA 1VQIA 4RQ1A 1PVOA 2EXDA 2KZZA 3T51B 4FBTA 3CMEA 4R66A 4NLBA 3ISDA 1J2MA 4OJLA 3GIJA 4OJPA 2PZUA 4BXOB 2R6GA 3IRUA 4HEDA 4POFA 1VQKA 1GUWA 4J9LA 4KJOA 3C3LA 4FS1A 4RGNA 1KQQA 3JAMi 4AIMA 4P0QA 3OWFA 2Y9UA 3CC7A 3CD6A 3S14H 4CRXA 1PYBA 5AKHA 4F4WA 5L1JA 1I6VC 2PW5A 3S1NB 4F8RA 1LTRD 4M6WB 1EEFD 2MRLA 1TWAH 3JPRA 3E3XA 5T1IA 2AGQA 4A3CH 4HJ9A 5C4XG 2A73B 3Q6SA 2AHOB 5DKWA 3RR5A 5IGFA 1TS3A 3I90A 5E4XA 1QQ5A 5M3MB 5IP9H 2YX8A 1Q8KA 1DZ1A 2LKYA 4R4IA 4DF7A 2I0QA 3FC4A 2OTJA 3PW5A 9ICHA 2HOQA 1V43A 3TS2A 4QL5A 3RH5A 4A93H 4ECYA 1PUZA 4TKOB 3PY8A 1ZQWA 1GUNA 1UT8A 4EBCA 4RQ4A 1SNQA 1I50B 2XSCA 3SK6A 2G09A 5L1MA 4C0ZA 3T1HQ 1VQPA 2KENA 2I6XA 3SQIA 2V4DA 4LFCQ 1TFRA 1A77A 2D5DA 4XQNA 1X42A 4F4ZA 5J22A 2VA3A 1LTGD 4KHVA 1QSSA 1NK6A 4DQIA 2RP5A 4GLAC 4YMOA 5LMNL 1EQRA 4DXFA 1E24A 4A3LG 1L1OB 4HYKA 3DEPA 2GO7A 5KG4A 2EJFC 1O78A 4X3KA 1SV4A 4BWMA 3WKCA 4KKTA 4QIWF 1C8CA 5AKGA 4FXGC 3HKZE 4OIJA 2NZOA 1SNPA 2W43A 2K5QA 1COOA 3AU7A 3NQTA 2BOSA 8ICEA 3E0EA 1S5FD 1XWLA 2KP7A 4B9WA 2VUMG 5CV4A 4RQ2A 5IIIA 4GZYC 5C0XI 2FPKA 3RFAA 1E7ZA 1X9SA 4JI6Q 5AI6A 3K0XA 1BNZA 5KFRA 1ZQIA 4C2MB 2BDPA 5IYDG 2ASBA 3ULLA 7ICSA 1X3FA 3QUBA 2KZ3A 2QKQA 4YMMA 4DFJA 1EL0A 2JZBB 5ALKA 1MKHA 1QJOA 1X6JA 3BQ1A 1SL0A 4JI3L 2X6LA 4IPHA 4I2EA 2RF4A 1T8EA 2F0UA 3KDFA 3PUVA 2CQAA 5D46A 4KLOA 4EEYA 1CKOA 3NRWA 1N61A 3I76A 3IDWA 3WK7A 3J81i 3NRZA 3RR7A 3EJIA 1IL2A 2JA6G 3G6JB 1RDPD 3CCJA 1ZQMA 3Q8RB 4CDGA 1JXEA 2K60A 2HHVA 3TDQA 2YYZA 1UE6A 1D5MC 1FYCA 5FP0A 2A6ED 3WKEA 2B63G 1TVAA 2AJQA 1Q8IA 5IYCG 2K03A 2AGOA 3PO3G 1SKSA 3DDHA 2Y0SE 1VCIA 4NM1A 1JORA 4JMUA 1NMFA 4FZNA 3M8RA 3N97B 4B3ML 4XA5A 2ATWA 2JEAI 3KTQA 2JQOA 5KG5A 3IHQB 4YCXA 1QLNA 1EWCA 4BUGA 2I46A 7ICTA 3N52A 1VQ7A 3GTPB 5A35A 1OTCA 3N7PD 1D9DA 3AU6A 3JAMc 2ES6A 1D8LA 4WJWA 3A7LA 3PSTA 3NHHA 5E3FA 1WWUA 1X9XA 5C3EB 3Q8LA 3H8SA 4DNIA 4M04A 5KG1A 1X56A 1T9HA 5HMLA 2R8HA 1BPBA 1BR9A 3RRGA 4YIJA 3C1FA 3PSIA 4R64A 1T3NA 3KKAC 8ICKA 1BBXC 5HR6A 1IM4A 2W7OA 3PV8A 3V05A 4ECXA 3H3VH 1LO5D 2PNRC 4YVZA 1PRTC 1JMSA 3UXNA 3A8JE 3JPSA 4Y2PA 3MZ5A 1IG6A 2QLTA 4KLQA 1UPHA 4UY8C 1J2NA 1PK1B 2I5MX 3H6MA 3H09A 3A56A 4EX5A 1X9NA 1FR3A 4C8LA 1XTDA 3JC66 4DV5Q 4HIKA 4QUFA 4B9VA 2ZIUB 1DOQA 1ZQQA 1QNUA 1O08A 2N55A 1HQRD 4KLEA 1M4VA 4PH5A 2L4NA 4GOPA 4A3CG 2Y0SF 5DB6A 9ICBA 3VR6A 2BR0A 1AZQA 1UA1A 1CZWA 1TAQA 5DBBA 2K4EA 1D9FA 4IPDA 3QUCA 5KT7A 3U9OA 2N1RA 3RH6A 1D6EC 1EXNA 2XN9C 5AKZA 1MD2D 4DR1L 3EW9A 1RDFA 4DSIA 1HUNA 1ASZA 1XSLA 7ICJA 1EY5A 1EFWA 2K4PA 4JCVE 2KHJA 3FDTA 3OW2A 4OXPA 3CCRA 4DAYA 1F9SA 2BPGA 2ZXPA 3I4MH 1OXJA 4TUSA 5ALOA 2K5NA 1NMGA 3TP7A 4EEKA 1H9KA 1PK3A 2XVSA 7ICMA 1X3PA 5G5HA 3MFHA 4MZ9A 2ODGA 4FXDA 2BQUA 3HRDD 3BS5B 1QB5D 5ALMA 4A3BH 1I4HA 7ICOA 3HOVB 2LM4A 1EEID 5CV8A 3TADC 4QNLA 3RJGA 3T5LA 5FLMH 3PO2G 3HKZC 4DFKA 2DF4B 2ZXOA 5KNIA 2OT2A 5M5YH 4C7YA 2W9AA 4IO9A 5KT5A 1EY6A 3A54A 3WDNA 3PZPA 2GN5A 1WCMG 1NJIC 3RAQA 4HSVA 3GTJB 2KJ5A 4ILWA 1AE3A 2NYVA 1EOTA 1A3TA 2VA8A 3QE9Y 2A6HC 4DV4Q 3UQ0A 5K36H 1EQVA 2G9HD 3HJEA 2K75A 2JA8H 2UUCQ 3WK9A 2PO4A 2KOBA 2JH1A 9ICJA 1JC7A 3PSPA 4YWMA 4B3TL 1FO4A 1DOLA 2Z7JA 5IYDH 5KFUA 4CF5A 2D3DA 2KFZA 3AQFA 3G7LA 3ND8A 4QW8A 1DOKA 1F2LA 5KT3A 4ECUA 2Z6KA 5C4JB 4ECVA 1ZQOA 4GOPB 1NTGA 5C44G 4QW9A 3SE0A 5JJKA 1BPZA 1P8LA 2E8PA 1XJVA 1RZTA 4DV0Q 4OEMB 2E2JB 5EE1A 8ICLA 3EWAA 3TADA 2JA6H 1STBA 2JE6I 3MXNA 5J0XA 4DV3L 5ALEA 5KNBA 3D6JA 4IR1A 1ZQXA 1RPLA 1TWFH 5H1SE 3C5GA 3PO3H 1BQQT 4R4TA 3K7UC 4YR2A 9ICPA 1ENFA 1SXDA 3C5FA 1ZQCA 2F3WA 2ID0A 4O42A 1PH3A 4FF2A 1E2ZA 1H38A 1ENCA 3NK9A 1PFNA 3STBC 4ELUA 5C4ZA 1B43A 1U4MA 1GHKA 3KF8B 3GTOB 1ZQAA 1JI7A 2FDRA 4QWCA 4YWLA 4F50A 2Q2IA 1K3RA 5AJ3L 1ZD5A 1DCZA 1KTKA 2FPMA 2F44A 2Q8IB 2HW3A 4CKBA 1WCNA 1S0OA 1FJGL 1RODA 5CGKA 7ICIA 2EQSA 3GTQB 1G2TA 1JALA 2NO4A 1WJJA 2Q8RE 1NY4A 4X65Q 3RZOB 4K4GA 5ALHA 3QR8A 4KY5A 2NVXH 5C0XJ 1HFGA 5D3DA 1PTOF 4DV6L 4NW2A 3THVA 1KW4A 3BQ2A 1FFUA 2B2YC 5ALVA 1FVIA 2BCUA 2ICEC 2ZIUA 1F2MA 4KMOB 3EBEA 5BN4A 2EJGC 1M1KC 1AW7A 2QB0A 4QWAA 1ZQSA 1I3QB 2MGSA 4QMGA 4UAIA 4UB5A 1GHJA 2FJ2A 3ERSX 1CZGA 1NE3A 1TIID 4J6HA 9ICMA 5M5XB 3S14B 2C2EA 1A2TA 1EIFA 3KDFB 5EAYA 3X3NA 1TKDA 1UNSA 3K5MA 5J0TA 4ZOHC 2KHVA 4F5QA 3RUZA 2KVCA 3V7LA 1UA0A 4MEYA 2WAQB 4MF8A 2XGTA 3I55A 2GLEA 5EPLA 5D4BA 4A3IH 2F0TA 1QQ6A 4QIWB 3Q8DA 4GN3B 5FK9C 5BN3A 5KG0A 2W11A 5HHIA 3RH4A 2LI6A 4FVMA 4C3HB 3T5KA 2XY5A 4A3JG 4GKJL 1O7LA 3PR5B 1VQHA 4PV1C 3GV3A 3PIOA 4EQNA 2X69A 4NLZA 3I4MG 3STBD 2QILA 4I29A 4FZMA 1V1PA 3RLFA 3C2PA 3M3YB 4IRKA 4Q8FA 1HUZA 2LSSA 2F0IA 4LF4L 4O5CA 4LF7L 1QZHA 2FINB 5JPNC 4LF8L 2DFLA 5KFNA 1L2FA 2K32A 1VQGA 1VQNA 5IP9G 2K8BB 4A3BG 2R7ZG 3TANA 1MSWD 2G0AA 2A69C 4RGMA 3H15A 2JA7B 1VS0A 2ZXHA 1QVCA 1HXYD 3TREA 1EYAA 4I7AA 4K6DA 1ESRA 2EJMA 2E8MA 3QU7A 3TAQA 1ZQEA 5FLMG 3K6OA 1HNWL 1QQ7A 2LS01 5G3LD 2HHTA 1X3QA 3AMUA 1PTOD 1UAPA 2Z9HA 2AU0A 2Q0ZX 4KK7A 1HR0L 2OXPA 5IIKA 1MQ2A 2WAQG 1LTLA 4RCNA 1UCVA 2KKPA 4DR4Q 1D5XC 4NL9C 1A62A 1BPXA 1GO3E 2W55A 5FO7B 2QARB 2BE5D 3MBYA 1EOVA 2FMQA 4A3MB 4YY3L 5K36G 4UAVA 1O7ZA 1IBKQ 1E1OA 2NRXA 3DV9A 3RJKA 2N49A 5J1ZA 3HZXA 2Y0SG 4WJ4A 1Z00B 1JJCB 3BYYB 1KXLA 1WI5A 4LF8Q 2FPLA 5KFOA 1L3SA 1ICWA 4LJXA 1K8OA 3NASA 1WYGA 4DQPA 1PRTF 2JEBI 3QEBZ 3T79A 2J6SA 3I2ZA 1LUZA 1OXVA 4GC7A 2AUKA 3Q22A 4ECRA 3J7YW 3JPQA 4Y2JA 5KFVA 1PRTD 3KOOA 1EUJA 4DA2A 2W03A 1O7IA 3P1HA 3SYZA 1SSOA 1WTWA 2MUYA 4P0QB 2ZUDA 4J9RA 4QZCA 5AKEA 4FF3A 2KD1A 1SYBA 2EY5A 1M90C 4MFFA 2DQNB 1ZQ1C 1DM0B 1OO9B 2JA9A 4EQPA 4ACOA 5E4WC 4KLSA 3GTGH 2VL6A 3HGBA 2F1JA 1UWVA 2K4IA 3DM1A 2F3NA 2W8KA 4LUOA 1LTSD 3LDAA 2AQ2B 3LVWA 2MUTA 2ZXIA 3DWQA 3SVMA 4EELA 1SMYD 4KLDA 5ALPA 3TP6A 7ICVA 1XYIA 4EX7A 4US9A 4IFDI 1JE4A 3HOZB 1IKLA 4YCVA 4OHJA 3E9HA 3HRZC 1EYGA 1H9MA 5AM5A 1A0IA 2CW0D 4DV1L 3RZDB 2K01A 1ZQVA 3AFPA 2Q2UA 3ZD8A 1EYCA 3M7GA 3GTMH 2F3VA 1ED1A 1PH2A 2Q8TA 4NLGA 2F0HA 5DB8A 4J03A 8ICJA 2F2AB 1L8LA 5I2XA 4US8A 1SMYC 4BDPA 2OCEA 3RR8A 3RJFA 3F2UA 4HIMA 1N2XA 1L7MA 2CRXA 5I9OA 4PHPA 4LF9L 1KRTA 4XQ8A 1VQFA 4IUVA 4IC9A 4IUUA 4G7OC 5HY6A 3RTVA 4XQQA 4YXMA 5DQIA 4J9PA 5ALSA 1HEKA 2KCMA 2H3QA 4IUQA 4EQ5A 1XPUA 5AICA 4RKBA 3QO2A 3GTLH 3HOWH 1K8AC 4JB3A 1GVPA 1KN5A 1D8YA 3A8KE 2IJ0A 4RPZA 3BVMA 3K7AH 2F8KA 4QZEA 5J2FA 2F76X 3V7KA 4KLMA 1U4BA 3UI2A 9ICUA 4DS5A 2W3SA 2MPMA 4EYHB 2F0MA 3H0GH 5DEHA 4B3SL 3GU3A 3MVVA 2KNJA 4RKLA 4BY7B 3WK8A 1S9FA 2K1BA 2K4HA 4A3JH 1N5XA 2YTYA 2HBLA 3SEIA 2W9BB 3WOEA 4AQYL 3GV5B 1BCPF 3V6JA 7ICNA 2QEXA 5FJ8H 5EWGA 4AYBC 1IW7C 2OF1A 1IZ6A 1N32Q 3KK7A 1J5EQ 1O03A 3E9IA 5KFQA 2NN6I 3KF8A 3MFYA 4JI5Q 2KJ8A 3WU2U 4RZRA 3V2TA 3SAFA 7ICEA 4DQSA 2OHFA 2F1MA 4LAAA 2KE7A 4UAZA 2KECA 3A55A 5M5WB 3ZDAA 1Q12A 1D1IA 1VQCA 3RN5A 2DL0A 4C3JG 1CSPA 3GILA 5IT9c 2A74C 2EDUA 1DGSA 5AK6A 2JA5B 4O5EA 3LX0A 2UVVA 2OEOA 3OTOQ 3HOXH 4UP8A 4UBBA 2W8LA 3IKJA 3GP7A 2BDOA 3QYPA 2D9UA 3OSPA 4B9TA 3J81c 1B1ZA 2E2HB 4ECSA 2D62A 4ZKCB 1RG6A 3PO5A 3C2MA 1O7YA 2WB1C 2QB0B 3N6RA 4WFN3 3SDZA 3ZD9A 9ICEA 5BOMA 4U68A 4DLGA 4CDEC 3BS7A 4ED6A 3BVGA 4X3SA 3A0JA 1BOSA 2BZFA 3M7DA 5COYA 3PR4A 1CRXA 2KHIA 4Z9CB 3AL0B 4X64Q 5EE0A 4DN4M 3UMCA 4F5PA 1AN8A 3IAYA 4RHSA 2JH7A 4KMUA 8ICYA 3PO2H 3S1RB 4IFDJ 1X32A 3K5LA 3BDLA 4KX5A 4IZ8A 2WAQE 1F77A 1RIPA 4CGYB 1XX8A 1HNZQ 3M9NB 2DPJA 4KLHA 4JI7Q 4RGTA 1JQYD 4JBWA 1SB3C 4CKCA 2B2YA 4OIKA 1WCMH 3TI0A 4NXZA 3Q8KA 2KSOA 1EZ8A 3W1GA 4DR5L 1SNMA 5C4JH 4EGVA 5T1GA 2W7PA 2PI2A 2PMZB 4IOCA 5ALZA 2JA8G 4P4PA 1MSGA 2DJFC 4C80A 4N9TA 2WACA 1ZRNA 4JV1A 2OQ0A 3AQQA 2JA7H 4E6IA 2EYLA 3Q8QB 4IPGA 4BGDA 4LJZC 4A3KB 1A6XA 3GTOH 4UATA 4UARA 5KFZA 5TSSA 1KIXA 4F72A 2JMGA 5JVG3 4K4IA 1XO0A 1I4GA 5EKKA 1HCZA 1R4PB 8ICNA 1L0WA 1SFOB 4NDXA 1I6HB 1UE7A 5C44H 4OD0A 2MP1A 1SNDA 1A3VA 2RSNA 1II3A 2ESEA 3RZOH 2JXJA 4A8EA 3V96A 5C5MA 5C3EG 4F7XA 5IINA 2PMZE 5M5YB 2ZTEA 3OTOL 2A69D 3IFTA 3MAQA 4XXEA 2OYYA 2MJ8A 2UXCL 1XO1A 4XIGS 1JJ2A 4LZDA 1MSHA 4DAPA 1TR5A 2F0VA 2QDLA 3HKZB 4R1JA 4JWMA 1UHUA 1PFBA 1WTHA 4PZ6A 4RGOS 2R7ZB 2AGPA 5H2FU 3PW7A 4OWTB 2CH4A 2XTIA 1QZGA 5KFTA 1CUKA 2HQEA 2Y1IA 2FI1A 2LFNA 4KLIA 4KI0A 3J81j 2ZUCA 1B4OA 1QSYA 4ED8A 4OWXB 2N8NA 1TWFB 2E5LQ 1X3GA 1JE5A 4Y2YA 3TZDA 1UEAB 1ZQHA 5EKLA 5AI8A 4M9LA 1HH2P 3ORYA 3J80L 2EAOA 2ZTDA 3T5JA 4UB6U 4NKLA 1TV9A 1GUOA 3EROA 7ICFA 3QU4A 3I7FA 2UXBL 1SZHA 5EPKA 5BR8L 4ZLTF 3AB9A 2JA5G 1U0LA 1LKYA 4KN7A 1S5CD 8ICBA 2VKQA 2E2JH 5B66U 2UUBQ 2R3ZA 1T5XD 2BA1A 4V0BA 4PHAA 4CBVA 1Q86C 4XQJA 1K9MC 1NZPA 3AEVA 3D2SA 3H0GG 3FEWX 4X3UA 3VDYA 1YJ9A 4GKKL 1N33Q 2KA7A 3KHGA 1KFDA 1K1SA 4Y2UA 3UXOA 5DBCA 2GWSA 2NTTA 4WORA 4APVA 5FJ8G 2IOFA 3OYYA 5KFAA 1NKBA 2JEFA 3I73A 1MHWC 2E74C 3E5SA 2KG5A 5KFEA 4EVOA 2LMCB 1JB3A 3X3MA 3O0FA 5KFHA 1MGSA 4LUVA 4CCHA 1JR0D 2P6UA 5ALXA 3DWPA 3AMZA 2EDGA 1SDFA 4DQRA 1HUOA 1Q3UA 4UB3A 3ER0A 9ICTA 5A2QE 1HIWA 2B2UA 4C3JH 2G5DA 2DY8A 1IKMA 1KEJA 1SXEA 3W2DA 2IX0A 4A3IG 1X3EA 4OX9L 4AH6A 5KFSA 3PQIA 2L5TA 4I27A 5EBCA 3BDOA 5CBEE 4DL6A 1HR0Q 4BBSB 4O5KA 2EH9A 3D6WA 5KG2A 3BS1A 3OPXA 4GNXB 1Y1WB 5CRXA 1SE2A 1V1QA 1P7DA 3H3VC 3L2PA 4AP9A 1Z6HA 1L8OA 4KN4A 1NK8A 4O3OA 4DL3A 2B2UC 4M9HA 4FDBA 2Z4HA 4BXXG 3IG5A 1B9MA 1PVQA 3GQCA 4DLEA 3FMCA 4JI1L 2R7ZH 1KRSA 2ALZA 4J9OA 1AP0A 2IA6A 2KCNA 4DV2L 1JXLA 2EIFA 1HZCA 4DR6L 1OXTA 2JA8B 2GH1A 3W3AA 1C0AA 4LK1C 1IW7D 4JVZA 5ALGA 3T5HA 1LT3D 4LFCL 2AH5A 3JPTA 2ES2A 4PL1A 2I5HA 3UMBA 1PVPA 2HOIA 1HTPA 1RKNA 3HT3A 2CQOA 3F5EA 4P72A 2PZWA 1CEZA 5FOBB 3K59A 2FFKB 3PUZA 4HCEA 2KN7A 2E5SA 3Q8PB 2ALYB 2B21A 4DR6Q 2UUAQ 9ICOA 2LYHA 3CP0A 3LWLA 5GQOA 2ZIVB 2IBKA 1U48A 1GOZA 4L8JA 2IHMA 5F2DA 4ECWA 2KK0A 2WAQC 2ASDA 5DG7A 2Z8LA 5T14A 3GV8B 2WFWA 1ONLA 1Y14B 2L15A 2MQHA 5J2JA 3FP9A 1WG8A 4ECQA 2Z6BA 3J81L 4NJ8A 4YY3Q 2E2DC 1LT5D 3BQ0A 3K75D 1O80A 3H0MB 1L3VA 5A2QL 4WRDA 1X9WA 3UMGA 1YNNC 2HHHQ 2IX1A 1QUQA 4DL7A 2K7VA 2J6TA 2F0GA 5L1LA 2KQ3A 4LFAL 5J8YA 3AU2A 3TRZA 5C3EH 2F0JA 3DLLA 4P4MA 5J8YC 2A6EC 5J2GA 4Z6CA 1U49A 9ICCA 3F1ZA 4X65L 1NNLA 2I9GA 2HBMA 5KEEA 1FJGQ 5E79U 4DXGA 3PO2B 2PI5A 1TWGH 4JI4Q 2MNAA 4DKAC 1W3SA 1EWIA 1QWYA 5HHHA 3OGUA 2F3IA 1HNXL 1ZQDA 1A6SA 2KCTA 5IE8A 2W3RA 1PYWD 4TUPA 2ZM6L 5ALRA 2Z1CA 8ICCA 7ICPA 1JIHA 1MBYA 2PFOA 3UQ2A 4FZLA 5GADC 2UVRA 4M6WA 4QIWC 1ZXIA 1CKNB 2ICIA 4HJ8A 2C2RA 1L0XB 2ZM6Q 1RYUA 1GO3F 2F4VL 3BQ7A 2CVRA 5D49A 2F0NA 9ICRA 2JJQA 5C0XG 5JTIA 1ZETA 3IV6A 1PTOH 4QQBX 2J7ZA 1HNXQ 4RHRA 3L4PA 4X62Q 4JI0L 2UUBL 2V1CC 1L1OA 4BY7G 2NB0A 3I28A 4TVAB 1LV5A 1JX4A 4U6PA 2A19A 1YNJD 2JA5H 3KLSX 4H7BA 4OONA 3SHLA 1DK3A 4BXOA 3AYHB 3G6VA 1IHZA 1SZPA 3OTQA 2XY7A 5M5WH 2B2TC 2HCCA 4KKUA 1C20A 1I6HH 3H40A 2P66A 1YHQA 2H3VA 2AXTU 5KFIA 4QCLA 5J2BA 4C8NA 4IRCA 3U50C 4YHHQ 2R92B 2VANA 5C0YA 5KFYA 3IN5A 3ZDBA 2SNMA 4XYQA 5DM63 3WK6A 3F2BA 4M0AA 1S8OA 2UVWA 2Q2HA 2YMMA 5IGBA 1BUVT 2Q4TA 2PQEA 4H44C 1NJWA 3U58A 2W9BA 3HOWG 4YHHL 3C23A 5KFWA 5KT4A 4C56C 2DKXA 1FGUA 2HDOA 2DNEA 2OH2A 5EKIA 1H95A 1K28A 5CA7A 4BS9A 2A68D 4R8UA 5JUMA 1B3AA 2O2LD 2XCAA 2R93B 1H9SA 3E2EA 1L7PA 4JOIC 3DUZA 4FO6A 2VQFQ 2FHTA 2UUAL 3AN1A 1TY0A 2AWOA 2K33A 3OMCA 3L5KA 4B3SQ 2KZMA 2EYMA 4V190 1KDCA 3NENA 1OXSC 5M3FG 1ECWA 1MIUA 3EPGA 1XXGA 2E76C 1SJED 3OJSA 2E8GA 3QOJA 3CQZH 3JPNA 1CI4A 3PMFA 4N8FA 4L5SA 3D31A 3KJPA 1PMRA 4Z6FA 4DS4A 3RB4A 1IBLL 2B3GA 5L1KA 1S77D 4B3RQ 5ALJA 3PUXA 1PZJD 2XICA 2A68C 2IHFA 2JEJA 2F0PA 2H3IA 3ED5A 1PVRA 1LYLA 3D2NA 1R4QB 2HHSA 2F0FA 2B6GA 4JC0A 2F1IA 5KGUA 3RN2A 4Y2VA 8ICPA 1E0BA 1CTMA 2M2LA 4X66L 1B50A 3PVXA 3R93A 1XPRA 3E58A 4JBMA 4LMQD 4DV3Q 2IHNA 4I2GA 3HOXG 3NVWA 1IYVA 2PXIA 2Y0SC 4PHDA 9ICGA 2NRZA 4BBRB 4GXIA 1L5UA 3G71A 4QUCA 1PH7A 3H0GB 4DV0L 2NBFA 1NNXA 3G48A 3ULPA 4P4OA 3CRKC 5LL6S 2WV6D 5J0OA 4J9MA 1L3UA 4B3TQ 5ELFA 1STEA 1TVXA 4GNXA 2VXWA 1A8VA 4NLKA 2XY6A 4KY7A 1LABA 3T53B 2MUTB 2QW7A 4H13C 1S72A 4O3RA 3C28A 2IW3A 2RCNA 3S1NH 2QB1A 3WKAA 4UP9A 2R8IA 3D6CA 2B0CA 4P0PA 5ELBA 4X66Q 3VCBA 3S1QB 1QILA 1KAAA 1V38A 1I5FA 3MDAA 4K5WA 1EIGA 1UUPA 3FVQA 7ICUA 4C4SA 5IOCA 4DQQA 2XGQA 2ZTCA 4F5OA 5FKAC 4B9XA 2BCVA 2L1BA 3NVZA 3MR3A 2RHFA 4QWBA 3RD4A 2BDUA 2HVIA 2O4XA 4JOIA 1A0PA 4R63A 5BR8Q 4A3DB 3D4RA 2HDLA 4BY1B 2E2IB 4JI1Q 2OQKA 2JA7G 1Z00A 1JB7A 5F9LA 2CCZA 2J6UA 1EY4A 3FAHA 2EZYA 1TQOA 1UE1A 2HD3A 2NZHA 3C21A 2VZAA 4G7HC 5LMNW 3ZJYC 3NELA 4ELTA 1WTXA 3SZ2A 2FLLA 2HIXA 3EN2A 5C5LA 5IGCA 3MXGA 4UDUC 1YZ7A 3L3FX 5AM2A 1PFSA 4KLKA 3VYSA 4QB4A 1SYEA 4O1NA 5C0XH 1S0MA 1G51A 1HRJA 4XUSA 4FF4A 5J2EA 3HP6A 3UDXA 1PH8A 5KAFU 8ICAA 2ZUBA 1VQ4A 4AYBB 4PZNA 1K1QA 4LF6Q 2EE1A 5AI9A 4DFDA 3SV4A 1ZJMA 5EPJA 4LFAQ 1S40A 4BY7H 3ALRA 1JT8A 4B9NA 4CGZA 1T94A 1KDBA 1L0YB 4GLXA 1L1OC 5ISRA 2PZTA 4P74A 2BCQA 1S5DD 5KRUA 2DGZA 3E0JA 4OX9Q 4O0IA 2AQ3B 1TXYA 4U7CA 3JAME 1IXRA 1HJPA 2MAXA 3URYA 4GFJA 4JV5Q 2I1QA 3LYSA 3K5OA 3H3VI 5IP7H 1XNRQ 2CW0C 4NXMQ 3HP3A 4GN4B 4IURA 3UE0A 1MN8A 4JI3Q 3FPUB 1V1PB 2A6HD 4NMZA 4A3KG 2OWOA 4C1NK 4I2CA 3EA6A 5KTQA 4RWSC 2LM1A 2O5IC 3I4NH 3KJOA 1GM5A 3CC4A 4LF7Q 4YR3A 4ZUJA 1G2SA 1VMCA 1VLBA 4F88A 3NXWA 1X9MA 1Z4NA 3Q0AA 2YMLA 4UB4A 4KD4A 1Y88A 4XTCS 2UU9L 3M85A 1AH9A 1STYA 2WB1F 1N36L 3CPWA 2NVYH 3DM3A 1WTVA 2YU9H 1DGJA 1HQMC 2E8OA 2PKEA 1I4PA 1KLUD 1Q3VA 1KDHA 3MGIA 4FE3A 1NUCA 1BO0A 3SAGA 4R9WA 3PIPA 4I2BA 1CFMA 1E3PA 4QY7A 2HHWA 1WOCA 5JEAH 2KSOB 1ZYRD 4P2HA 2FJ6A 2PFPA 5JVH3 4L6TB 2MU2A 3UM9A 1TK8A 4UB1A 4MFAA 8ICHA 4I2IA 5AKKA 5J39A 4RNNA 5J2KA 1ZQYA 2F0EA 3TBIB 3J81E 2ZJRA 4X64L 4X6AH 4UBCA 2VJ5A 1WTQA 4JUZA 4X5VA 1SN8A 4IL6U 2KUMA 4A3GH 3CHBD 1V9PA 4EBDA 5FLXL 2IOHA 1HZAA 4C3IB 5CV9A 1TS2A 1X65A 2F0LA 2I07B 3S1MH 5ELCA 4DV4L 3RF9A 5D14A 1RTNA 1NKEA 1TWCB 3RLOA 2E3TA 2UU9Q 1CI3M 5AK3A 3NTHA 3H0LB 1TK5A 4O3MA 1F9RA 3R3OA 4M47A 4MN3A 4MEXA 1RYSA 5KFBA 1RM6C 4A3IB 4RQ8A 4DSEA 3PGZA 4HAIA 4K6LA 1BF4A 4G57A 1EQQA 5HNKA 8ICIA 1VF7A 2CFMA 1Z19A 2HDMA 5IT9E 4TURA 1IL8A 4NXML 2ENBA 1F0MA 4R8NA 2VQEL 1SE4A 5DG8A 1XNRL 3S15H 4BXXH 4JI6L 1MJEA 3MC1A 5L1IA 3QEAZ 1ZQFA 4DWIA 1STNA 2NVTB 4DNRB 1ICFB 4YCUA 4A76A 1SMXA 1ZQTA 3QU9A 1TKWB 5AKIA 1TWGB 1Z47A 5CR3A 1KD1C 1RD9D 3M4QA 1AFPA 2C28A 2PQAB 2G5IB 1PYSB 4I65A 2WF8A 3NVYA 3IFDA 4KHZA 1ET6A 2O6KA 2TMPA 3NQIA 2JA6B 9ICXA 3CAMA 3GIMA 3NBHA 4G3IA 1V8QA 3NTUA 1DJRD 4IUNA 1HNZL 2AQ4A 4PQXA 3RJHA 2SOBA 4OCZA 4B9UA 1C48A 4DAVA 1YVCA 4OWWB 3K58A 2F03A 2G06A 3BZDB 4JI7L 3S17B 3N7SC 4DR1Q 2C35B 3PX0A 4UP7A 1QVFA 1BNOA 2TSSA 3D0FA 3RLNA 4QJFA 3RJJA 5HGTA 1I4RA 5DNFA 5GTIU 3L3OC 5BPCA 2HIVA 2KEDA 5KNDA 3VR2A 4GNXC 1IBLQ 3LWUA 1WUDA 1ZRMA 3OIQA 4K14A 1DXSA 4O3SA 2GVBA 3NWSA 4HMJA 1YJNA 1B4FA 3BJUA 1YI2A 4HSPA 3ISCA 3HW8A 2R8GA 4CKEA 4DEZA 1BPYA 4I2DA 1Z3EB 2M0NA 2ISOA 2I5LX 4P73A 2EZVA 1YITA 4OO1I 2BPCA 4Q45A 3KKAA 5I9PA 4EZ9A 5CYUA 5JJLA 2QKIC 5EOZA 2BCRA 1ZQNA 2H3ZA 3UDFA 2MHVA 1ZD4A 3J80c 1WTPA 1SL2A 1FD7D 1RXWA 1LV9A 3TACB 1FIQA 2CXYA 4JV2A 4TQUS 4HCSA 1A76A 1ZQGA 2ZIWB 3C1ZA 3BS5A 2C9OA 3HOYH 5IP7G 5EGTA 1EFID 4I2HA 3MC0B 5KFLA 2EYJA 1N32L 3TAPA 4L5RC 3ISBA 4OJ5A 4PGXA 3SENA 1N5WA 5KAIU 4CE6A 4JW0A 3I4NG 3CXCA 2KJXA 4DAYB 1U9RA 2XVTA 8ICOA 3H94A 1YJWA 1SRUA 3S2HH 1ENAA 4K5XA 2KBNA 4EX6A 5NUCA 1HZ9A 3U4ZA 4PHEA 5I6WA 3A5UA 4BBSH 5J0SA 2QGQA 1HA5A 2B2WA 3VR5A 5DDYA 5DB9A 4YD2A 4Q43A 4EZ6A 2NVXB 1ESFA 1N48A 3QIAA 2K28A 4ODGA 1X6OA 7ICLA 3IL8A 1U5KA 2LPEA 2KJ9A 4KTQA 5D3IB 4ECZA 1BCPB 3GV7B 2K52A 3MTSA 2DJGC 4F5NA 5J2DA 4AYBG 5C4XB 1E2VA 5DLQE 1NJZA 2PFNA 3PMNA 2BQRA 5JEAG 1JOKA 1HR0W 3UXPA 2N3SA 3FKIG 5KFXA 2IX3A 4J9NA 1CKNA 1XNQL 4Y2TA 2B2TA 1G6ZA 4LF9Q 2R18A 4Y2XA 1YIJA 3F8TA 1LACA 4RG1A 3ICEA 5CR0A 2VA2A 1RTOA 2H1EA 1Y69U 3HFZB 1FEZA 1Q90A 1SAPA 1W6KA 1TS5A 1NJYA 1M8AA 4WJ3M 4GC6A 1N63A 2E2HH 3J80E 2NUCA 4GKKQ 2VB2X 2KV2A 2A3VA 5J2HA 2F8LA 2FLPA 1Z9FA 4A3DG 2G07A 1K3BC 2QARA 2WAQF 1F2YA 2B2VA 5M3FH 2EYPA 4GN5A 5LMUL 1EU3A 2HHHL 1SYFA 2YB1A 2HCIA 3ZYYX 9ICIA 5AM3A 2IOFK 4LF6L 5EWFA 1VQMA 2WF9A 3NGDA 3KHLA 1X55A 2KHQA 2R8KA 2L11A 4DK1A 3GTPH 1Q3LA 1S5BD 4DPGA 2YMPA 2JK8A 2F0WA 4QF4A 4XT3B 4HR7B 1G91A 1YBYA 1LT4D 4PGQA 4EBEA 1E2WA 1K5OA 5KG3A 2SDFA 4P75A 1Q81C 1EIYB 1MJCA 1X54A 3N7RC 4RAUC 5HP4A 2JGAA 4DFMA 1D5ZC 4ICAA 1PTOC 4Y2QA 4F3OA 3UE1A 3CC2A 4K0KL 3ERQA 1L3TA 1JCKB 3MXPA 1YHBA 3IRBA 2ZIVA 5FO9B 2ZJAA 4JPBW 3FYHA 4B9LA 4NY8A 4C8MA 4RQ0A 8ICRA 1J9OA 2IMWP 5HR7A 2EOTA 5KFMA 2PI2E 3SD7A 3GV6A 5HMMA 5JAVA 4F4YA 1OW5A 4Y7NB 4ID6A 2EAPA 4C3JB 2K6AA 2JV3A 2ZJQA 2EAMA 4KX3A 4Y2RA 5HGQA 2F4VQ 1RJTA 4BBRG 2EXZA 3HOUG 5AM4A 4TQSA 2A1JA 2ZIXB 1TAUA 1AE2A 4DR2Q 1ZD3A 5KFJA 1JWUD 2JZBA 3S2HB 2H4OA 3H4DA 3PV0A 5J0QA 4L5TA 4JI2L 2IT1A 3I3CA 2ZG6A 1QTMA 2MO1A 2PCFB 4DAMA 3SEBA 1HTLD 4DFPA 2K50A 5DB7A 2XIWA 1UT5A 2YQEA 1Z4OA 1RF2D 2FMCA 4DUZQ 3G6XA 4FYDA 3PSFA 5E7NA 4E0DA 4QZGA 2WF7A 3HG9A 1GJXA 3PNCA 3M1YA 4UAUA 3T4AC 1E22A 4A4IA 1F9PA 4J9QA 3K4GA 1S4ZA 2K8AA 4RQ6A 3I4OA 1HNWQ 3W1BA 3KYHC 5M3FB 2EANA 2NV3A 2YMQA 3VA5A 5IODA 2BKEA 1BXTA 3S1RH 1CK1A 1FNUA 4UW9A 1DYQA 3ETLA 4DUZL 2VNUD 5DGAA 4IN3A 3T1YL 3PMLA 5AI0A 5GAEC 3RB0A 4Q44A 1S0NA 1ZKOA 5AJ3Q 5KL1B 1KFTA 1TY2A 3V6HA 3K0YA 1B22A 3KLRA 1VQBA 2NRWA 1W2BA 1NI3A 2ATLA 1CSQA 4YWKA 3SK8A 4I2AA 1ET9A 3HOYG 3LNNA 3BQTA 3NVVA 5KNCA 3WKBA 4RUAA 1KLGD 2BCSA 4TUQA 3HPOA 1KRPA 3G6YA 3NTKA 1PH6A 1WVLA 1I50H 4DK6C 3ULJA 4A3KH 1ILPA 1J6QA 4GKJQ 5IIJA 5IIOA 1CA5A 4OJ6A 5ALLA 1NR2A 3O13A 2B29A 4A75A 4K0KQ 2UXBQ 1HFNA 3S24A 3J7AF 3SK5A 4RQ7A 3BJYA 3TEHB 4JG2A 4DSKA 5J29A 4ZK9B 4IQVA 1NK7A 1Q7YC 2CWPA 4HIOA 3ONNA 4F93B 1R9TB 2Z0SA 2R7FA 4Y52H 3S1MB 1EU4A 3MXNB 1IBMQ 2FMMA 3CP8A 4IQUA 4KJNA 4MNOA 4DGZA 1U45A 2DNCA 3T16A 1B2TA 1G6PA 4QZ9A 5CV6A 5KFPA 2K14A 1AQ6A 3UPQA 1LTID 2Y0SB 4QZIA 3FDSA 4DF4A 3TARA 4I28A 3BZKA 2WTFA 3EVQA 2JSOA 5GAHC 9ICKA 2VJ4A 3A0HU 4F71A 3RB3A 3QUQA 2CKZB 4BJQA 2D0PA 2SNSA 3LK9A 1STGA 4KN7C 3K5NA 3CCEA 1K73C 3U4VA 1QCKA 3PO4A 1SYGA 3OW7A 4DK0A 8ICWA 3A0BU 1RXVA 4ZCKA 2W04A 1WCMB 1S97A 2G08A 2HHUA 3CCLA 3KLWA 2CN1A 5AHXA 3OHAA 4QJFB 1CKMA 2IPKD 1A15A 1V1OA 3BVZA 1BCPD 4MIUA 3OPOA 1CT1D 1JICA 5HURA 4O0AA 5IIFA 1NK4A 1ZQLA 1KL9A 2R61A 4ABNA 5ELNA 5AKXA 1V85A 1X6IA 5DBAA 1Z1VA 2YY6A 2HSZA 4QZHA 3C29A 3EPIA 3F2CA 4B9SA 1N9WA 3WWVA 4X62L 1WTRA 2P5ZX 2BH2A 1SR3A 3GTKH 1ZQUA 4DFAA 4GOPC 4NXNQ 5ALUA 3ONAB 3HOZG 1XNQQ 3QU5A 2G9DA 4A3GB 1L7NA 1COKA 2F4IA 5C3XA 5BOLA 4B3RL 1SFOH 2K89A 1IYJB 2ZIWA 5I4DA 2PYKA 4R4CA 4A3GG 3M9MB 3IG8A 2NN6G 5DM73 2PPBC 1I94L 4K4HA 1XMQQ 5DG9A 3TQYA 5JU5A 1F44A 1BGXT 3H91A 4JV0A 4ED1A 1A2UA 5EQ0A 4G9BA 5ALNA 4NL9A 4KLLA 4JI4L 2GVAA 2M00A 1KDAA 2RHSB 5JJIA 4LWCA 1VQ9A 2Q2TA 3HWTA 2KKVA 8ICTA 4C3HG 1ZQKA 5I2YA 5L9XA 1NOMA 4BA1I 3S6JA 5IIMA 2ZJPA 1A3UA 4MHVA 4UPAA 1MC8A 1G291 2RVLA 1CHQD 4FNFA 2F0QA 3TMEA 4RUCA 5IT9L 2F0KA 3H7IA 4CJ0B 3JAML 2E5LL 2K4KA 2ZT9C 3ETRA 3M9BA 1QVGA 1VMPA 3BG3A 3P75A 2F0SA 2FMSA 3CYMA 2RDJA 5AIBA 2JEIA 1S5ED 3CRXA 2WIIB 2NVTH 8ICSA 1EWHA 2D2CC 4F4KA 3D8GA 1NK0A 1F5SA 1S0VA 1KAWA 1KC8C 2XGPA 1JJGA 5AM0A 1TAMA 1KBUA 2UUCL 3J7AV 3S16B 2A8VA 2IHEA 1MA7A 1KHIA 5M9OA 2LHTA 4UASA 3Q23A 2CHBD 1CHPD 4GLVB 2YU9B 1PK1A 4DUYQ 2B63B 2UVUA 4KY6A 4RQMA 4FS2A 4CJ1B 3PF5A 1U4PA 2HBKA 2LMRA 1BVSA 4A93B 4TRDA 1SROA 3FPPA 3SV3A 1TWCH 2LYAA 1KNAA 3OSNA 2HVHA 2J4XA 3I4NB 3S1QH 5K4LA 2O5JC 5IGEA 4OO1H 2E75C 4MTKA 4M9JA 3KD3A 4LVSA 4QZ8A 2FMPA 1Y8OB 4Q8EA 1J5EL 1NAPA 1IYUA 4XRHA 4JBKA 2NVQH 1TWAB 3PIO3 2WF6A 4Q5VA 4RQ5A 5JEAJ 5KYIA 1YT3A 2F0DA 4NWIA 3MFIA 4AQYQ 3UDIA 2AWNA 3RNUA 5CJ7A 4P71A 3W5OA 3M4PA 4KHPL 1T3QA 1UQVA 5DDMA 4R65A 2RDGA 2E2IH 4DR7Q 3GTMB 2VUMB 4UHVA 1VQ6A 4DO9A 4X3TA 4HTHA 5AK5A 4PMBA 1PDQA 1WFQA 1Z1BA 4LZGA 1SL1A 1CQVA 1JWSD 2XRQD 3OHXC 4XDXA 3SR1A 1A63A 1KABA 7ICGA 5KG6A 3DHQA 5IWAL 4O3NA 4UAWA 2FLNA 1YNJC 8ICVA 1F9QA 2EVBA 4A3FB 4FF1A 4DNTB 3G4SA 2NVQB 5KT6A 1WCLA 3K1ZA 2ZJ5A 1DD2A 4O3PA 1NBWA 1NK5A 2EZZA 1F2ZA 3KZXA 4A3EB 2BGWA 4UAYA 4HMIA 1FNWA 4BX9C 5B5EU 3WKDA 4DV5L 3NS1A 1STHA 5C3WA 3WK5A 1EY0A 4A3EH 2R92G 4RNMA 3PW0A 4CF3A 3KBBA 1N60A 3RMHA 1QG7A 5K5PA 1X66A 1JN3A 2A1AA 4YP3A 4BBSG 2QEJC 1JUDA 5L37A 4YMNA 1JOQA 8ICZA 5E1FA 4OELB 1N33L 2E1FA 4CF4A 1S5LU 2XIDA 5KFKA 4M9NA 3D4WA 3NEMA 3EFXD 3KUPA 1K83H 3LWEA 3K1RB 3RRHA 5ALIA 5ALYA 2BA0A 2Y9TA 4RH6A 1LB2B 2D6FC 5CORA 4ED3A 4DR3L 3QZ7A 4NB3A 4DV2Q 5KFDA 1WTOA 1PFMA 1KFSA 4Z6DA 4JI8Q 4KKSA 4MHEA 4C8OA 3HEJA 3FKIH 1K0RA 4JWNA 3MXUA 3MABA 2JP1A 4RMFA 3RBEA 1ZD2P 3HOVG 3HOZH 5EE9A 1GUSA 5F3XB 1BNPA 5KYLA 1SYCA 1N62A 1VQEA 8ICUA 4NPSA 4QWDA 3TZUA 4RT2A 1XNSA 1C9OA 2R8JA 4F91B 1L6NA 2BPFA 1BBWA 1W6JA 1OUQA 2NN6H 2VS1A 1N8RC 1K8MA 3H8JA 3DWAA 2J0TD 1KKXA 5ALWA 1VDZA 4ED0A 2AQ0A 2A5HA 1SWVA 4DV6Q 4A3DH 5KL8B 5J0WA 1NJXA 3C1YA 3MR6A 1BKBA 1TU2B 1SE3A 3D4DA 3I70A 4TSSA 1Q82C 3C46A 4C3HH 3A8IE 3C2LA 1DK2A 3V7JA 8ICGA 1YHAA 3P20A 5ALFA 3S2DH 3TQ1A 3OSOA 4DSJA 3KZIU 5IYBG 2R93H 4QGUA 1T5EA 2D8CA 3TP8A 1J8IA 1AEXA 5GROA 3WOFA 1PA6A 1Y1VG 4KLJA 1Q1BA 4CDFC 3SK4A 3B9JA 3SXHA 3J7A5 2JEGA 4C4RA 5KFFA 2LY7A 3M3YH 1NCVA 2WF5A 4PZ7A 5KFGA 3WK4A 3LGJA 3MEHA 5C5JA 1ML0D 1UEBA 1TE2A 4TQRA 3QXGA 1I3QH 3OOCA 4UB2A 1XMOL 1T7PA 2DWQA 3PF4A 4DR4L 3DXJC 1VQ5A 1Y1VB 1SXTA 1BBUA 2BCOA 4IUPA 3GDEA 2PI4A 2ISPA 1XPOA 2F77X 3NBIA 4H0LC 4H02A 1D7QA 4B08A 3EQLC 1SWWA 3K81C 2BHNA 1ZEQX 3Q24A 5BN5A 3KF6B 3NTIA 3TP5A 1IIPA 4DOAA 4B9MA 3CCMA 2B8GA 2HUGA 4DU9A 4BBRH 1WD0A 7ICRA 3HOUH 4J1MA 1GXDC 1SBBB 5JPMC 3ZDEA 2KCCA 9ICNA 3R8BA 2HCFA 2W54A 8ICMA 3HS0C 3QB3A 2W9MA 5EWEA 4OO1G 1HPCA 4QWEA 1NK9A 3NPPA 5KG7A 3H4BA 4ECTA 1H9SB 4KD3A 4B3MQ 2EY2A 1YNND 3HX0A 4ZAIA 2EY1A 3FM9A 2YTXA 2HHQA 5FO8B 4A3MG 4DK3C 2ASLA 2AKWB 1MI2A 3NE5B 4PMWA 3MGHA 3EYZA 4KLTA 1EY9A 4OO1J 5J0RA 3GIKA 3AUOA 4ED2A 1BCPC 3PO3B 4I2JA 4ED7A 2FXQA 5GAGC 2UXCQ 1BDOA 4AYBF 2PW7A 4K2KA 3GTQH 3CQZB 1XSNA 1VQOA 3SR6A 1D2BA 2C22A 1QOHA 3S9WA 3TSSA 2FE9A 2MSNA 4DL4A 3IM1A 4DL2A 1NSNS 3PW2A 4F8MA 1PH4A 4ZH4A 2CWAA 1B53A 3R2IA 1N34Q 1VQDA 5IGDA 1SEBD 3CMAA 4DR7L 1H9RA 4ULLA 3MWYW 1X2IA 4UQGA 3OHBA 4MF2A 1E1TA 8ICXA 1PZKD 1V97A 2A1JB 2ZIXA 5ALTA 5TZVA 9ICWA 4HJ7A 4I7ZC 3OJUA 3AM9A 3TFSA 3B0YA 4M2YA 1Q1EA 1SKRA 5M5XH 4GIBA 3CCSA 3M6KA 4C1NI 1QNKA 1G8ZD 5G3LF 1IV8A 2BDNA 2RRDA 3MEFA 3BDPA 2RA4A 1EQTA 3I4MB 4NP5A 2R92H 2EYOA 5ELOA 3CW2C 5DQGA 3F2DA 2WB1B 3NUQA 3LVVA 2XI9A 4OJOA 2X6GA 3QOLA 2OEHA 3EUB2 3I4LA 4U673 1EZ6A 2MA1A 2RDHA 1R9TH 2K5VA 5CWRA 2Z4IA 2Z6KC 4NV0A 4F2RA 2K05A 4ZQ3A 2EYHA 4JK1C 4ZKBB 3GTJH 1JMCA 5DAUA 1SIJA 9ICFA 3E0FA 4K8JA 2PFQA 3QU2A
chains in the Genus database with same CATH topology
2F52A 2K52A 3TS0A 1HZBA 3VDYA 4AYBG 2YV5A 1YJ9A 3H3VH 1N33Q 4GKKL 2YTVA 5DLQE 4APVA 5JEAG 1HR0W 5FJ8G 2N3SA 3FKIG 4UY8C 3OYYA 4EX5A 1SE8A 2I5MX 4LF4Q 1CKNA 1X9NA 1OXUA 1XNQL 3HOVH 4LF9Q 1XTDA 3JC66 4DV5Q 4HIKA 4YCWA 1YIJA 3F8TA 3ICEA 4RG1A 4GOPA 4LUVA 2R7DA 4A3CG 5C4XH 1YEZA 3HFZB 3T1HL 1Q46A 3ER0A 4IPDA 4J15A 4UP8A 4WJ3M 4C3JH 4Y7NH 4DV7Q 4ALPA 1PH1A 2E2HH 4DR1L 2IX0A 4A3IG 4GKKQ 1X3EA 1ASZA 4OX9L 4AH6A 1TWHH 2MFIA 1Z9FA 4A3DG 4MTNA 4LUZA 4QIWE 1HR0Q 1EFWA 3SGIA 2N78A 1RL2A 5M3FH 4JCVE 2KHJA 4GN5A 4GNXB 1FL0A 5LMUL 2HHHL 4KHPQ 3OW2A 4LF6L 4OXPA 3CCRA 2AMCB 1VQMA 3I4MH 1V1QA 4DV1Q 2R93G 1X55A 2MO0A 3GTPH 2K5NA 1NMGA 4DPGA 3L2PA 1SLJA 2JK8A 1VQJA 1PHJA 1I94Q 4JI5L 3GO5A 4MZ9A 1XMOQ 1YBYA 4FDBA 4BXXG 1VQLA 4P75A 1Q81C 1EIYB 1MJCA 4A3BH 4JI1L 1X54A 1KRSA 1YNXA 2R7ZH 1Y1WH 4DV2L 2EIFA 2LXJA 2VQEQ 4IPCA 3UE1A 1HZCA 3CC2A 4DR6L 1OXTA 1C0AA 3PO2G 5FLMH 1YHBA 3IRBA 3J7ZC 4LFCL 2ES2A 2CQOA 2I5HA 5M5YH 4K0KL 4P72A 2PI2E 1B8AA 4IO9A 4LFCQ 3PUZA 2GN5A 1QUQB 1WCMG 2ALYB 1NJIC 2ZJQA 4DR6Q 2UUAQ 2F4VQ 5HGQA 1AE3A 4BBRG 3CP0A 5GQOA 3HOUG 4DV4Q 1AE2A 2PQAA 4POGA 2K75A 4DR2Q 2JA8H 2WFWA 2UUCQ 1Y14B 2L15A 2MQHA 3PV0A 2H5XA 2VY3A 4L5TA 4HIDA 3FP9A 4JI2L 4YWMA 2IT1A 4B3TL 2MO1A 4YY3Q 4DAMA 5IYDH 2K50A 3M4OH 3A74A 4DUZQ 5E7NA 2HHHQ 2Z6KA 2QA4A 2WP8J 4GOPB 1NTGA 5C44G 3CCVA 1QUQA 2IX1A 5JJKA 1P8LA 1XJVA 1UE5A 4DV0Q 3L0OA 1E22A 4A4IA 1ASYA 3KF6A 4LFAL 3TRZA 5C3EH 4DR3Q 3I4OA 3DLLA 4DV7L 2JA6H 1HNWQ 3W1BA 3KYHC 3F1ZA 2JE6I 4X65L 3A5ZB 4DV3L 3S1RH 1FJGQ 4DUZL 2VNUD 3T1YL 1TWGH 1N36Q 5GAEC 4DKAC 2MNAA 1W3SA 2BH8A 1EWIA 1TWFH 5H1SE 4JI4Q 1YZ6A 2F3IA 5IYCH 5AJ3Q 1HNXL 3PO3H 4R4TA 2KCTA 1VQBA 3K7UC 5IE8A 1W2BA 1PH3A 2ID0A 2PNHA 2ZM6L 1CSQA 4YWKA 3HOYG 3STBC 2K5HA 4LFBQ 3CPFA 5GADC 1PH6A 4IJLA 1CKNB 4R4QA 3KF8B 4HJ8A 4C2MH 2ZM6Q 1N34L 1KQSA 2F4VL 1I50H 2JJQA 3NBHB 4YWLA 3ULJA 2Q2IA 4DK6C 1J6QA 5C0XG 4QQBX 4GKJQ 3G6EA 1K3RA 5AJ3L 1HNXQ 3J80i 4X62Q 4JI0L 4JV5L 2UUBL 2V1CC 1L1OA 4BY7G 4TVAB 2B29A 5IWAQ 4A75A 4K0KQ 2UXBQ 1FJGL 4L5QA 2EQSA 2A19A 3S24A 2DUDA 3FHWA 1WJJA 4OONA 1NY4A 4JG2A 3TEHB 4X65Q 2JA5H 4HJ5A 1Q7YC 3AYHB 2NVXH 2CWPA 4HIOA 1P16A 5C0XJ 2Z0SA 2R7FA 5M5WH 4DV6L 5M3MH 1PH9A 1C7YA 4Y52H 1I6HH 3MXNB 1IBMQ 1FVIA 1YHQA 1PH5A 4MNOA 3KFUA 4NXNL 3U50C 4YHHQ 3EBEA 1IBKL 1M1KC 3PUWA 1G6PA 3F2BA 4A3KH 2K14A 4NXNQ 4PG3A 2HT1A 3ERSX 1NE3A 2Q2HA 3BZKA 4BY1G 4A3EG 5GAHC 1IBML 3KDFB 1EIFA 2CKZB 2D0PA 3PUYA 3CCEA 3U58A 5EAYA 4YHHL 1K73C 3HOWG 1S3OA 3U4VA 4A3FG 1FGUA 1VQAA 4DR2L 3M7NA 1H95A 4HJAA 4JBJA 3CCLA 2XGTA 3KLWA 4JOIC 3I55A 2VQFQ 2UUAL 4A3IH 2AWOA 2I0QA 1CKMA 1OXXK 3Q8DA 3KOJA 4GN3B 4B3SQ 3NENA 4O0AA 4A3JG 4GKJL 1OXSC 5M3FG 1KL9A 1MIUA 1VQHA 2OTJA 3PIOA 5ELNA 2E8GA 3CQZH 3F2CA 1N34Q 1N9WA 3D31A 4L5SA 3WWVA 3KJPA 2D0OA 4X62L 1K8GA 3GTKH 3I4MG 2BH2A 1SR3A 3HOZG 3AFQA 3B6YA 3STBD 4C3IH 3RLFA 4GOPC 1IBLL 2B3GA 4B3RQ 1XNQQ 4LF4L 2LSSA 3PUXA 4LF7L 3K80C 1QZHA 2IHFA 4B3RL 1SFOH 4LF8L 3CCUA 1IYJB 1L2FA 1LYLA 4LFBL 4R4CA 4JC0A 1VQGA 3RN2A 5IP9G 1VQNA 4A3GG 2NN6G 4A3BG 3T1YQ 2R7ZG 1I94L 3HKSA 1XMQQ 4X66L 3TQYA 3H15A 1Y1WG 1VS0A 1QVCA 2LXKA 1XPRA 4IFDG 4JBMA 3TREA 4DV3Q 3HOXG 1HNWL 5FLMG 4JI4L 4PZ8A 3S17H 4A93G 2GVAA 2RHSB 5JJIA 4LWCA 3EIVA 3G71A 1PH7A 1VQ9A 5LMUQ 2Q2TA 4DV0L 3RZDH 4ME3A 3PCOB 3G48A 4BA1I 3ULPA 1HR0L 4LF5L 5IYBH 4JYAQ 2ZJPA 2WAQG 1LTLA 4DR4Q 1GKHA 4UPAA 1G291 5LMNQ 1A62A 4B3TQ 1GO3E 2E5LL 4GNXA 1A8VA 1Y1VH 2K4KA 3M9BA 5FLXc 1EOVA 1QVGA 5K36G 1S72A 4YY3L 2WB1G 1XMQL 2RCNA 1E1OA 1IBKQ 4JI2Q 4UP9A 3S1NH 5J3BA 2N49A 4WJ4A 2Y0SG 2NVTH 1JJCB 3GD7A 1KXLA 1WI5A 4LF8Q 1VQ8A 1KAWA 4A3LH 3K8AA 1KC8C 1I5FA 1JJGA 2UUCL 2JEBI 2A8VA 2IHEA 1GD7A 1KHIA 2ZTCA 1LUZA 1OXVA 3I2ZA 2UXDQ 4GLVB 4DUYQ 1B70B 4BA2I 1LM0A 1EUJA 4LW1A 4IJHA 1O7IA 3PF5A 4LNQA 4JOIA 2IY5B 1BVSA 2VW9A 5BR8Q 1SROA 2VQFL 3CF5A 1TWCH 2VUMH 3BU2A 4DUYL 1M90C 4AYBE 3S1QH 2JA9A 4R4OA 4JI1Q 2OQKA 2UXDL 3BZCA 3L7ZC 2JA7G 1JB7A 2CCZA 3GTGH 3UDGA 1WYDA 2VL6A 1UE1A 1UWVA 2NZHA 1J5EL 2VZAA 5LMNW 4LUOA 4A3MH 3ZJYC 1PV4A 4JBKA 2NVQH 3NELA 3I56A 5JEAJ 4JI8L 2HIXA 3EN2A 4GS3A 4AQYQ 4IFDI 1YZ7A 3HKZG 1PFSA 4KLKA 2AWNA 4YCVA 3UDIA 3RNUA 4P71A 3W5OA 4DR5Q 3E9HA 3M4PA 4KHPL 1G51A 1EYGA 1B7YB 1A0IA 4DV1L 2E2IH 4DR7Q 3UDXA 3AFPA 1PH8A 1VQ6A 1VQ4A 2OTLA 2Q2UA 4LF6Q 4BY7H 4LFAQ 1S40A 1PH2A 3GTMH 2DGYA 4LF5Q 4JYAL 1WFQA 1JT8A 1A63A 1L1OC 4GLXA 4OX9Q 4P74A 2B63H 2WB1E 5IWAL 1TXYA 2OCEA 1IXRA 1HJPA 5M3MG 4JI0Q 3G4SA 4JV5Q 4HIMA 3S16H 3H3VI 5IP7H 1NBWA 4O2DA 1XNRQ 4LF9L 1KRTA 2HQLA 4NXMQ 5IY0A 4GN4B 3UE0A 1VQFA 4JI3Q 4IOAA 5HY6A 4A3KG 2OWOA 4DV5L 2R92G 3I4NH 4A3EH 4BY1H 2KCMA 3KJOA 1GM5A 3CC4A 4LF7Q 4EQ5A 1XPUA 3CCQA 3GTLH 3HOWH 1K8AC 2A1AA 1GVPA 4A3FH 4BBSG 2RHQB 1PVOA 1VQIA 2EXDA 3K7AH 4XTCS 3M85A 2UU9L 1N33L 3CMEA 1N36L 1AH9A 3NEMA 3CPWA 2NVYH 3DM3A 2R6GA 1VQKA 1K83H 4POFA 2YU9H 3H0GH 4B3SL 2BA0A 3PIPA 3JAMi 1E3PA 4QY7A 4DR3L 4AIMA 4A3JH 2YTYA 4NB3A 4DV2Q 4AQYL 1WOCA 4JI8Q 3CC7A 3CD6A 3S14H 2QEXA 5FJ8H 3FKIH 1K0RA 1PYBA 4RMFA 1IZ6A 1N32Q 3HOZH 3HOVG 1J5EQ 3E9IA 1VQEA 2NN6I 4JI5Q 4NPSA 1TWAH 2ZJRA 4X6AH 4X64L 4A3CH 4HJ9A 5C4XG 2AHOB 3RR5A 1C9OA 1SN8A 5IP9H 4A3GH 1BBWA 1V9PA 2VS1A 1Q8KA 1N8RC 1HZAA 1Q12A 1VQCA 4R4IA 3RN5A 1CSPA 1X65A 5IT9c 1DGSA 3S1MH 4DV4L 3OTOQ 3HOXH 1V43A 4DV6Q 3TS2A 4A3DH 4QL5A 4A93H 1BKBA 3RLOA 2UU9Q 1Q82C 3J81c 4C3HH 2D62A 1YHAA 3S2DH 5IYBG 3PGZA 2R93H 4QGUA 3T1HQ 1EQQA 1VQPA 2KENA 5GROA 2CFMA 1PA6A 1Y1VG 1Q1BA 4NXML 2VQEL 1XNRL 3J7A5 3S15H 4BXXH 4JI6L 1MJEA 3M3YH 3A0JA 4PZ7A 2KHIA 4X64Q 3LGJA 4GLAC 4YCUA 4A76A 1SMXA 1UEBA 1I3QH 5LMNL 1EQRA 1Z47A 1XMOL 1E24A 1KD1C 4A3LG 3PF4A 4DR4L 3PO2H 1VQ5A 1L1OB 3M4QA 2PQAB 1PYSB 4IFDJ 1BBUA 3GDEA 4KHZA 1XPOA 2WAQE 1HNZQ 1RIPA 4H02A 3CAMA 4JI7Q 1D7QA 3HKZE 3K81C 2NZOA 4JBWA 3KF6B 1HNZL 1WCMH 3CCMA 1YVCA 3W1GA 4DR5L 4BBRH 5C4JH 3HOUH 4OWWB 4JI7L 2PI2A 3E0EA 4DR1Q 2C35B 4UP7A 4IOCA 1QVFA 2JA8G 2VUMG 3D0FA 3RLNA 4QJFA 2OQ0A 3AQQA 5C0XI 2JA7H 1E7ZA 4OO1G 4IPGA 4JI6Q 3K0XA 4B3MQ 2ASBA 3GTOH 5IYDG 2HIVA 3ULLA 4GNXC 1X3FA 1KIXA 1IBLQ 2YTXA 1MKHA 2GVBA 1YJNA 4JI3L 4DK3C 4A3MG 2AKWB 3BJUA 4IPHA 1L0WA 1YI2A 4PMWA 2RF4A 3KDFA 1UE7A 3PUVA 5C44H 1CKOA 2UXCQ 2FXQA 2I5LX 4P73A 5GAGC 1YITA 3RZOH 4OO1I