3AEVA

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
b'EYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLAAEKLGKDFEAAWREVWVPLEEEWGEVYAAFEDAAKDGIEVLKGHVPDEWLPVLKEIVENYVEVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit alpha
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3aevA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aevA01
4L5RC 3PIPA 4KLKA 1KL9A 3OTOL 1XMQL 2VZAA 1QVGA 4JV5Q 3W5OA 1LYLA 3J7ZC 1V1QA 4A75A 1PH2A 2UXBQ 4X6AH 3KF6B 1M90C 3UE1A 3G6EA 2B63H 3CCLA 4BBRG 3CCRA 1Q46A 3S15H 2JJQA 5LMUL 1OXSC 2OWOA 4LF5L 4K0KQ 2CWAA 4YWKA 2JK8A 4LFBQ 1CKNA 1GO3E 5LMNW 1OXXK 1E1TA 3A74A 4A76A 4YWMA 3GTGH 1YHBA 2ID0A 4JI2Q 3I55A 1JB7A 4JBMA 1XNQL 5JJLA 4DK3C 4DV0Q 4JI0L 3HOWG 2E5LQ 1XJVA 4OX9L 2VL6A 3U50C 2OQKA 4P72A 4UY8C 4A3LH 1BKBA 1K83H 1CUKA 1IBKL 1VQ9A 4XIGS 1N34L 1NBWA 4OWXB 4JI8Q 1FL0A 4GLXA 3GD7A 4A3IG 1PH5A 1OTCA 2NVXH 1FJGL 4IFDJ 1VQFA 4ALPA 4UPAA 3S17H 1X65A 1Q81C 2IHFA 1Y1VH 4LF7Q 3RNUA 4DUZL 4GNXC 4LF8L 2R7ZG 1WYDA 2UUCQ 5C3EH 3I4NG 2R6GA 4X65L 3PF5A 5IYBH 5M3FH 2IX0A 4IOCA 2ZTDA 1XPRA 1G51A 4A3FH 2JA8G 1PFSA 4DR5L 3HOYH 1HJPA 3I2ZA 1EWIA 4B3MQ 4OWTB 1V43A 3J80i 4DV3Q 1GVPA 2BH2A 1OXUA 2JA7G 2R93H 3VDYA 3FKIH 1YVCA 2UXCL 5IT9c 1CSQA 4GKJL 4NXNQ 5LMNQ 4WJ3M 1I94L 1A0IA 1EIFA 4LW1A 3UDGA 3S24A 2RF4A 1EQRA 2NN6I 2AWOA 3HKZG 2MQHA 4DUYQ 4DV1L 3M9BA 3D0FA 3TEHB 2PI2A 1PVOA 1RIPA 4GOPA 1QZGA 1N36Q 4JYAL 4JC0A 4DV5L 1IBLL 3TS0A 2N49A 3GTPH 2GVAA 2UUAL 1N32L 3GTQH 3HOUH 4LFCL 2Y0SE 3Q8DA 3CAMA 4JBJA 4UP7A 3CC7A 1XPUA 1KRTA 1YHAA 2NVQH 3J7A5 4DV7Q 1NY4A 4R4OA 1WCMG 1EYGA 4X62L 2UU9Q 3BZKA 2VS1A 4BA2I 1XNRQ 1YJ9A 2KBNA 1EIYB 3S1NH 3BZCA 2LXJA 2MO1A 5IYCG 4OONA 3J81j 1MJCA 5C44G 1G291 4DV2L 1VQGA 4UP9A 1VQNA 2A1AA 2PMZE 4DV4L 4KHZA 2VQEL 1YIJA 2BH8A 2ZJQA 4JI3Q 4AQYQ 3OW2A 4DR7L 3RZOH 4H02A 4IFDI 3CCEA 3KOJA 3PUYA 4B3RL 2ZJRA 2VNUD 1SRUA 1Y14B 4NPSA 4DAYB 4A3JH 3KF8B 1X3GA 1HNWQ 4A3EH 3A0JA 4L5TA 4GKKQ 1S40A 1YZ6A 4YY3L 1NJIC 1L0WA 4APVA 2YV5A 2VY3A 5IE8A 5FLXc 1XMOQ 3CMEA 1HNZL 4JBKA 1QZHA 1CKNB 5GQOA 4LFAQ 5M5YH 5IP7G 1YJWA 1CKOA 2WFWA 1U5KA 4DR6Q 4A93G 1LM0A 2VQFQ 4DV6L 1PHJA 4FDBA 1N33L 1I3QH 2F52A 4LUVA 3S1QH 1VQBA 4A3BG 5M5XH 2UUBL 3F2DA 2K5HA 1C7YA 1X55A 4LF6L 3M4QA 4IOAA 3SGIA 5JEAG 2BA0A 4JI1Q 4LF4Q 2HIVA 5GAEC 5ELOA 4GN5A 5AJ3L 5BR8L 1JJCB 1HR0L 3CMAA 4WJ4A 3BJUA 1IL2A 1GD7A 2Q2IA 3EBEA 4DR3Q 1BBUA 1NE3A 4OX9Q 2R92G 2JA9A 2D62A 2HQLA 1VQIA 4GNXA 4BY1H 1AH9A 4HIDA 1K8AC 2IHEA 4DR4L 4LF9Q 3MXNB 2AMCB 2D0PA 3RLNA 5IP9H 2A8VA 4A3DH 1SE8A 4BBSG 1VQMA 2V1CC 3L7ZC 3F2BA 3JAMc 4QGUA 2IX1A 3G4SA 2UXDQ 1K9MC 4JI6Q 1KHIA 4X64Q 1IBML 3W1BA 5IWAL 1L2FA 1VQ6A 4YCUA 4DR2Q 2PI2E 3FP9A 3L0OA 1E22A 1NTGA 2C35B 3H0GG 2K50A 3PO2G 5IYDH 3G48A 2GN5A 1VQ8A 4PZ6A 5EAYA 3A5ZB 1TWAH 3CP0A 4A3KG 2VUMH 2YTYA 2KENA 4JI5L 1J5EQ 1KRSA 4PMWA 3I4MG 4A3CH 5C4XG 1Q7YC 4DK6C 3HOXH 2JA6G 2K14A 1W3SA 2I5LX 4C3IH 3HKZE 1N9WA 3HFZB 4X66Q 4B3SL 1TWGH 1X9NA 1SMXA 2PQAB 3KDFA 2HHHQ 1TWCH 2K5VA 4A4IA 2CWPA 2KHIA 3T1HL 3ICEA 5C0XG 4BY7G 3I7FA 4DR1L 1ASZA 1LTLA 2YTXA 3UDFA 2NVTH 2OTJA 4BBRH 3D31A 4AIMA 4OO1G 5ELNA 4OXPA 3NELA 2JEAI 5JJIA 4NXML 1VQAA 4YHHL 4IJLA 1HNWL 2JE6I 3I56A 2XGTA 3RZDH 1PH8A 1CSPA 3BU2A 3E0EA 1D7QA 2MO0A 2Z0SA 4A3GG 1YBYA 4JV5L 3NBHB 1MIUA 4IJHA 2VW9A 1X54A 5FJ8G 3PUWA 1VQ4A 2UXBL 3HOWH 1W2BA 1VQOA 2RCNA 1BVSA 3IRBA 4R4TA 4HIMA 4J15A 2Q2UA 3ULPA 4HJ8A 5FLMH 1QUQA 3T1YQ 4Y52H 3DM3A 4K0KL 1TWHH 4LFBL 3HOZG 2JA5G 4PZ7A 2CKZB 1VQPA 1PH6A 5E7NA 2MNAA 3CF5A 4A3IH 1H95A 4HJ7A 4JI2L 1KAWA 4R4CA 4UP8A 1X6OA 3L2PA 3HOVH 2ATWA 3B6YA 4DV0L 4MTNA 3GTOH 3PO3H 1S3OA 2E5LL 1UE1A 4L5QA 1Y1WH 2MFIA 1FGUA 3S1MH 1PH9A 1JJ2A 1I6HH 2WB1G 1IXRA 2DGYA 1AE2A 2YTVA 4KI0A 2R7ZH 1OXTA 2R7FA 2KHJA 4RMFA 4JI4Q 2E8GA 1EUJA 3UDIA 4B3TQ 4TVAB 5HY6A 4JI7Q 1A62A 2F4VQ 4JI8L 4DV6Q 3JAMi 1S72A 4JCVE 4MNOA 2JA8H 4DKAC 1HNXQ 3RLFA 2WP8J 5M3MG 4A3MG 4BXXG 4DNIA 2JA7H 3K7UC 1KXLA 1X3EA 2NZOA 4BA1I 4KHPQ 4GNXB 4LF7L 1HZ9A 3PUZA 1B8AA 3CXCA 3KJOA 3I4OA 2GVBA 1HH2P 1A8VA 3ERSX 4LUOA 4HIKA 1PV4A 4B3ML 2A19A 4C3HH 1YITA 3RLOA 2OCEA 1VCIA 2ZM6Q 3CCQA 4DV3L 2LXKA 1YJNA 2AHOB 1CKMA 1YZ7A 3KLWA 1L1OC 1IYJB 1XMQQ 3OTOQ 5LMNL 1VQCA 4GN4B 3PSIA 1PYSB 1C9OA 3AQQA 5GROA 3WWVA 4AH6A 5C0XI 2AKWB 2B29A 1GM5A 1O7IA 5DLQE 4DUYL 1E7ZA 2EIFA 1I50H 1WCMH 1Q12A 1V9PA 2RHQB 5C4JH 4HJ5A 2R7DA 1N36L 5LMUQ 4LF5Q 2NZHA 1IZ6A 1HZCA 5IYCH 5IYDG 1YHQA 5C44H 3CCSA 1A63A 1PH4A 4QL5A 2E2JH 1VQKA 4LWCA 1XNQQ 4YCVA 1P8LA 1MKHA 1FVIA 2H5XA 4JI0Q 3M3YH 5IY0A 1BBWA 1QVCA 1VQEA 2N78A 3KDFB 5JEAJ 4DV7L 2B63G 1P16A 2CCZA 3AFPA 2UU9L 2Z6KC 3GDEA 3CC4A 1XNRL 1X56A 3M4OH 3RR5A 4GN3B 4RG1A 3TRZA 1VQ7A 4POFA 1E24A 4R4QA 1IBKQ 2CQOA 3CCMA 3UE0A 1N34Q 2EQSA 2AWNA 2KCMA 3F8TA 1FJGQ 4QY7A 4POGA 4JI3L 4AQYL 4C2MH 4OWWB 3ER0A 1SN8A 1B7YB 5IP7H 5M5WH 3RN5A 3K81C 1KIXA 2K4KA 3CPWA 3ULJA 4DUZQ 1YEZA 4LF8Q 1C0AA 4A3BH 1Q8KA 2EXDA 2IT1A 2NVYH 4MZ9A 4A3LG 2JEBI 1E1OA 4X65Q 4GKKL 1SR3A 3OYYA 1QUQB 3M85A 2KCTA 4NXMQ 1XMOL 3CPFA 3PV0A 4DR5Q 1UE6A 4IPHA 1TXYA 4LFAL 1E3PA 4GOPB 3H3VI 4DAMA 2ZJPA 2PNHA 1GKHA 1VQDA 3PUXA 2LSSA 4DR6L 1G6PA 2VQFL 1Y1VG 3AFQA 4JOIC 4EX5A 4QQBX 2UXCQ 4GKJQ 3ULLA 2CFMA 1I94Q 3STBD 1EFWA 2L15A 5C3EG 2R92H 1Q1EA 2OQ0A 3M4PA 5IYBG 5M3FG 3A5UA 4AYBG 5GADC 3EIVA 2K52A 4JI1L 4DV1Q 4A3FG 4LF4L 3HOYG 1YNXA 1HZBA 2ALYB 4L5SA 3PCOB 4JYAQ 3JC66 3PGZA 2N8NA 4DV5Q 1IBLQ 3K7AH 2R93G 2UUAQ 1K73C 1PH7A 2ZTEA 3PF4A 3FKIG 1N32Q 3CQZH 4LFCQ 2K75A 4BBSH 4PG3A 4IFDG 2B3GA 3MEFA 4DR3L 3EN2A 2WB1E 1KD1C 5FLMG 1SFOH 2Q2TA 3PIOA 2WAQG 3J81c 1Q82C 1UE5A 5C0XJ 3CCJA 4QIWE 3STBC 3H0GH 4X62Q 2QEXA 1HR0W 4LF9L 3PO2H 3S2HH 2IY5B 1VQJA 4A3KH 2HT1A 1PH1A 1D8LA 3AYHB 2HIXA 3H15A 3HOVG 3HOUG 1B70B 4DV2Q 3PO3G 1WI5A 4DV4Q 1I5FA 2YYZA 5J3BA 1Y1WG 3I4MH 2UXDL 2VQEQ 5C4XH 3KJPA 2I5HA 4X64L 4JI6L 1L1OA 4DR7Q 2JA6H 5JJKA 1PH3A 4DR2L 2I0QA 3CD6A 1XPOA 4B3RQ 4GS3A 2N3SA 3S14H 1JT8A 4IPGA 3M7NA 4IO9A 2Q2HA 3KF6A 3KYHC 1OXVA 2I5MX 3RN2A 4YY3Q 1J5EL 2XTIA 3U58A 1JJGA 1U0LA 2DUDA 3F1ZA 5GAGC 1HNZQ 4BY7H 5HGQA 3CW2C 1VS0A 1XTDA 3I4NH 3AEVA 4JG2A 4HJAA 3FHWA 1K8GA 3GTKH 4P73A 2BA1A 3K8AA 4R4IA 2QGQA 4X66L 4A3JG 1UEBA 2D0OA 1X3FA 1N33Q 4A3EG 1JE5A 1UE7A 3U4ZA 5GAHC 4HJ9A 2HHHL 2UUBQ 4A3GH 1WOCA 2Z6KA 4LNQA 1K0RA 4LF6Q 3K0XA 1M1KC 2F3IA 3GTMH 3HKSA 4P71A 5FJ8H 4IPCA 2ES2A 1RL2A 1SROA 4R1JA 2UUCL 4Y7NH 5AJ3Q 5BR8Q 1R9TH 1HR0Q 1N8RC 2ASBA 4GLVB 4ME3A 4PZ8A 3DLLA 2JA5H 3CC2A 3S16H 3HOZH 1K3RA 3LGJA 2PQAA 4YCWA 1PYBA 1Q86C 5H1SE 1J6QA 2ZTCA 1QVFA 3NENA 4P74A 1UWVA 1MJEA 1VQHA 4XTCS 4NXNL 3GTJH 4DR4Q 1HZAA 3UDXA 4TQUS 4QJFA 1YI2A 2YU9H 1WJJA 4IPDA 1TWFH 3T1YL 3NEMA 1VQLA 4GLAC 4OO1I 4DPGA 3CCVA 1T9HA 1NMGA 3E9IA 3G71A 4JOIA 1PA6A 1IBMQ 5IWAQ 2E2IH 4YWLA 4BY1G 3TREA 5M3MH 3K80C 3J81i 4A3MH 4BXXH 3H3VH 1AE3A 2Y0SG 3S2DH 5IP9G 1WFQA 3PUVA 4O2DA 1Z9FA 4P75A 1KQSA 1VQ5A 4A3DG 4JI5Q 3E9HA 4JI4L 3F2CA 1JMCA 4GOPC 4O0AA 4B3TL 1EQQA 4JI7L 2F4VL 4HIOA 1DGSA 2JQOA 1SLJA 3ZJYC 3J80c 1HNXL 3S1RH 1EOVA 4NB3A 3W1GA 4AYBE 4C3JH 2RHSB 2OTLA 3TQYA 4EQ5A 4KHPL 2VUMG 4B3SQ 3KFUA 3CCUA 3GO5A 3U4VA 1Q1BA 4A93H 3T1HQ 4A3CG 3TS2A 1Z47A 1LUZA 2E2HH 2NN6G 3GTLH 3HOXG 4DR1Q 2FXQA 5K36G 2K5NA 1KC8C 1ASYA 4LUZA 2WAQE 2ZM6L 2QA4A 4YHHQ 1NMFA 4JBWA 1L1OB
chains in the Genus database with same CATH superfamily
2H4OA 3RB3A 4L5RC 3OGUA 1KL9A 4G9BA 1QVGA 2VZAA 4JV5Q 4BWGB 2RCFA 3J7ZC 3CRLC 7ICKA 4A75A 9ICEA 1PH2A 3G6YA 4EQPA 3PNCA 4JK1C 3CCLA 2KG5A 4BBRG 5A2QE 4CF4A 3S15H 2JJQA 3HGBA 3SR1A 5LMUL 3GTOB 4CKCA 3OHAA 5HHHA 1OXSC 4C4SA 2EYHA 4YWKA 4I2GA 1GO3E 4Y2RA 1J2NA 4YWMA 2NVQB 2ISOA 5DG7A 5C5MA 2RA4A 4ZRZA 5AM3A 4HAIA 1X40A 5ALRA 2HCFA 2VL6A 2JP1A 3N97B 4UY8C 4J9QA 2RLTA 1JALA 1LVHA 3I3CA 4A3LH 1BKBA 1IBKL 4H7BA 5KFMA 1NJXA 3MZ5A 3GIIA 4XIGS 2HBLA 3MHBA 3PSPA 1NBWA 1FL0A 3GD7A 3KLRA 4IFDJ 4DNTB 2FMMA 3MDCA 1DXMA 1X6JA 5A35A 1RZTA 4QF4A 2BQ3A 3KFUF 2MP1A 4A3JB 2JRZA 4UB5A 3TFRA 4PHPA 1GXDC 2IHFA 5NUCA 5D65A 4QZAA 3WK9A 3TADA 4X65L 5EOZA 4GNXC 1SV4A 2R7ZG 2ZUBA 4ECSA 2DWQA 1SNOA 5ALEA 1L0YB 3PF5A 5M3FH 4NM2A 5KT7A 4IN3A 1H9MA 4IQWA 5KL8B 3ITPA 1UPHA 3HOYH 4UB8U 2YN4A 3K58A 1HJPA 3RTVA 4DR5L 5E4XA 3RR7A 9ICVA 2ZXPA 1QCKA 2ZG6A 2OXOA 5CJ7A 4DL3A 2E8OA 2ZIUA 2BH2A 2F0TA 3S1QB 2R93H 3IG5A 3NTHA 5M5XB 3VDYA 3F2UA 5ALQA 1K1SA 9ICRA 5IT9c 4BUGA 4DF8A 2MGSA 3T5LA 1JE4A 4K8IA 1BNZA 1I94L 4EVOA 1A0IA 1TS5A 2B2YC 5DG8A 2I07B 3S24A 3UDGA 2AWOA 4DUYQ 2F03A 4CKEA 2FFKB 1NK7A 2IOFA 2F1HA 2NRZA 1RIPA 3EQLC 4MEXA 4DV5L 2UUAL 1AFPA 1VF7A 1X9SA 2A6HC 4UAWA 5EPLA 3CAMA 4BY1B 3IAYA 1C4QA 4JBJA 4UP7A 2QCPX 4EQNA 1KRTA 1XPUA 1U49A 2EQYA 4Z6FA 5HURA 3BZKA 4O0IA 2KEDA 1YJ9A 1A76A 3S1NH 2MO1A 4EENA 1BCPF 1GJXA 4J9OA 3L5KA 1MJCA 2VIXA 3I4LA 3HILA 5G3LF 4DV2L 2BGWA 2PMZE 4OJLA 3V7KA 2F0KA 2EAOA 4YMNA 1LABA 2EH9A 4RZRA 3OW2A 2VJ5A 3VYTA 4DR7L 4USAA 3SXHA 4IFDI 4X3SA 3CCEA 4G7ZC 3JPTA 3PUYA 4B3RL 1SWVA 1TWAB 3S6JA 1NSNS 5KFJA 3H8MA 1E2ZA 2H3QA 3KF8B 5CR3A 1Z1BA 1ZQ1C 4A3EH 4JK1A 3KTQA 1G2TA 1RTNA 4YG2A 2X69A 4R8IA 4ZH4A 5IE8A 7ICIA 5DM63 1CKNB 5M5YH 1G91A 5ALKA 1PXUA 5IP7G 3M9MB 1ONLA 3GP7A 3I1YA 3C2MA 5AKLA 5AIBA 4G3IA 1LM0A 1NKEA 2CVRA 2IWHA 2E8NA 4JWNA 4MN3A 4A93G 1SXDA 3C2PA 5HHIA 4Y2XA 5ALWA 4ELUA 5DGBA 1DCZA 1S76D 2NVTB 2C28A 3SGIA 4JI1Q 3QEAZ 3MGHA 4ME5A 4LF4Q 2HIVA 4I28A 3NWSA 5AJ3L 4DO9A 2KV2A 3BS5B 2H3VA 5AKJA 5ALYA 5I6WA 3ISDA 4DOAA 3NWTA 3EBEA 2XGQA 5T1IA 3SV4A 3RD4A 1L7NA 1SKWA 1NE3A 3I72A 4DR3Q 2BQRA 2BPGA 4X3TA 3R93A 2D62A 2R92G 4ZQ3A 5KG6A 4RGNA 1VQIA 4GNXA 3LX0A 3I28A 5IT9E 4DQQA 4BXOB 4RFBA 3MXNB 4F7XA 2D0PA 4RWSC 4FO2A 1ZQEA 2A8VA 3AU7A 4A3DH 4ELVA 4C1NI 4QIWC 2HDLA 4XDXA 1TIID 1AW7A 4O5KA 8ICNA 3W1BA 1VQ6A 1Y1WB 5ALJA 2FMPA 2HOFA 3FP9A 2KTQA 4QIWF 1MSWD 2B2YA 4J6HA 2C35B 2HHQA 5LL6X 5KG0A 5J0SA 2GN5A 3I4NB 1IYUA 2VUMH 5BOLA 2YTYA 3UI2A 1LV5A 5AI8A 3M9NB 2JA8B 3H40A 1H9SB 2O6KA 4X3UA 3SK5A 2Z9HA 3V6JA 5CRXA 5IINA 4CHTB 1RJTA 1BPDA 3HOXH 2F0EA 2JA6G 2O5JC 5K36H 1PMRA 2NYZD 1WWVA 3TP7A 1N9WA 5ALTA 2LKYA 1KLNA 1R9TB 4PGXA 1I4QA 5KG3A 1MBYA 1TWCH 1KNAA 4A4IA 2KHIA 1NKBA 2G5HB 5KFCA 4ED1A 3UMBA 1LT6D 2NWGA 3I7FA 1LTLA 1SBBB 2DJFC 5EQ0A 4DFKA 4F3OA 2FINB 7ICVA 3QU5A 3N4MB 3P20A 2XWBB 1TVAA 2LM4A 2XGTA 2HOQA 3BU2A 5E79U 4UAUA 2MO0A 5EBDA 3K5MA 2KJ9A 3NBHB 3QUBA 2QB0B 2KA7A 1ZQBA 4G57A 4EYHB 1LACA 3LK9A 3OPOA 3PUWA 1VQ4A 5TSSA 3HOWH 5JUMA 3J7AV 3IRBA 4WORA 1PTOH 1QUQA 9ICHA 3E3XA 5C44B 3T1YQ 4Y52H 4CDFC 1G6ZA 1FGBD 4PZ7A 4I7ZC 1VQPA 3CF5A 4A3IH 4RQ6A 1H95A 1B2TA 1F9PA 2AGQA 1FYCA 1KAWA 3L2PA 4DV0L 1J97A 1ZXTA 5CC4A 3GTOH 1S3OA 1DONA 3UPQA 2E5LL 1B4OA 1UE1A 4LMQD 1Y88A 2MFIA 5DDMA 1JJ2A 3PW4A 4N9PA 2J7ZA 2DGYA 1DK3A 1PDQA 4HN7A 3LDAA 2PXIA 3SE0A 3H0MB 1EY4A 4TVAB 1A62A 4QNLA 1WCNA 3IL8A 3MFHA 3ND8A 3L3FX 1TE2A 4MNOA 1HNXQ 1L6NA 2FLLA 1U4LA 4BXXG 1NK5A 2AXTU 3B0YA 4DGZA 2NUCA 2ZIVB 3K7UC 1KXLA 1YNND 2KEYA 1K8OA 1ZJNA 4BA1I 3MC1A 3MDAA 1S0OA 4KHPQ 4LF7L 1U4RA 5EPKA 4EEKA 2A3VA 1SXEA 3EPIA 4M47A 2PNRC 3KJOA 3NUQA 5KFUA 3FPPA 3W3AA 1PV4A 3VR4A 3T4AC 4B3ML 1UHUA 2RDHA 4PJ0U 4OEMB 4C3HH 1SKSA 3RLOA 4AYBF 4YFKA 3CCQA 4DV3L 1OXJA 4F5OA 1CKMA 1XXGA 1PZKD 5KT4A 2LMRA 2JV3A 5CA7A 1ZRNA 1ILQA 1VQCA 4DFJA 3A8KE 4FP5D 4GN4B 2HBMA 4AH6A 4BWJA 1GM5A 1EY9A 5C0XI 1VQ7A 1O7IA 1YNNC 2RSOA 4HSPA 3VC8A 3TI0A 2EIFA 3T56B 2BPFA 1ZQQA 3K7AB 1Q12A 4HJ5A 5TZVA 3FRPB 5LMUQ 3C1EA 2EAPA 2NZHA 1HZCA 5J8YC 1SL2A 2KHSA 1ICWA 4QB4A 4FF3A 5KT6A 1ZQPA 3C1YA 2LY7A 2E2JH 1S5CD 3RB4A 1SYBA 3A54A 2F1JA 1ZQLA 4K5WA 4YCVA 1P8LA 3R3OA 5AI5A 2F0VA 4K5XA 2PKEA 5KFLA 3KDFB 2B63G 5JEAJ 2VXWA 3ZYYX 3SAFA 2UU9L 2W55A 2HHSA 4FZLA 4YXMA 3RR5A 4GN3B 3E58A 3UXOA 1D5MC 1STNA 3I4MB 1E24A 2I46A 1IBKQ 5C4XB 3PR4A 1K8MA 3CCMA 5IIJA 1QB5D 3F8TA 4P0QA 2AWNA 2KCMA 3BDLA 4FF2A 2JH7A 3WOFA 1NOMA 4DEZA 2W9CA 9ICKA 2PZTA 1SN8A 1B7YB 1D6EC 1OUQA 3ER0A 2EJFC 1J9OA 2QF7A 1NR4A 2VA2A 3FMCA 4DSFA 4IALA 2EYJA 1TK0A 2EY6A 3ULJA 2E8MA 1YEZA 2IOFK 3LNNA 5DG9A 4A3BH 4BY7B 4MZ9A 3QG1A 2JEBI 3QWNA 4DF4A 1XMOL 4DR5Q 3PV0A 3CHBD 2DF4B 1TXYA 2DNCA 4EBCA 2ZJPA 1VQDA 4F2SA 2PO4A 4DR6L 1QTMA 3BS1A 3RFAA 4A3GB 2UXCQ 3KF8A 3SENA 3THVA 1I94Q 1JOOA 1EFWA 2L15A 2EZYA 1AZQA 3GTPB 1JXEA 3GTQB 3DEOA 3FVQA 4Y7NB 4AYBG 5KRUA 4WJWA 4CDCC 1PVRA 5KT2A 1BXTA 3E0JA 2QDBA 3PCOB 4F50A 4DV5Q 3HOZB 5FP0A 3D6WA 3K1ZA 2WF5A 4C8NA 2UUAQ 2ZTEA 1BNOA 3JPRA 3QE9Y 3RRGA 3PF4A 4BBSH 3AN1A 1EZ6A 3ETLA 3K6OA 1SIJA 2KHVA 3MEFA 4F93B 4RU9A 9ICPA 3BQTA 1UT5A 3GIKA 5FLMG 3PIOA 2KSOB 5IGFA 3J81c 1SFOH 3GTJB 1Q82C 2QB1A 1Z00A 2Y0SC 2IHMA 4QIWE 4LF9L 1HR0W 3S2HH 4A3KH 4OO1J 4RQ4A 4UASA 4Y2UA 1TY0A 5KFHA 3H15A 1Z19A 3TKAA 1PH1A 4DV2Q 3HOVG 3PO3G 2G07A 1KSPA 1U9RA 3SZ2A 2PZUA 2YYZA 1Y1WG 4JI6L 4I29A 2I5HA 4X64L 4A3MB 4DR7Q 5KFDA 2LYBA 3DWAA 4DR2L 4B3RQ 4GS3A 5D3DA 8ICSA 1V85A 3MXNA 4MHVA 1U48A 4OGQC 5ALGA 3S14H 9ICCA 3RJEA 2BOSA 3M7NA 1COOA 1E0BA 5J0PA 2PI5A 3ZDDA 1OXVA 5ELFA 1TVXA 1K5OA 4LAAA 3RN2A 3J81L 2I1QA 4TQRA 1CM9A 2G0AA 1A0PA 3B9JA 5BOMA 5J8YA 5HGQA 3PW2A 5C0XH 4KK7A 4J1MA 1KDCA 1XTDA 2PPBC 3TSSA 3I4NH 3IN5A 4U673 1TAMA 5DKWA 1TR5A 1L7OA 3EWAA 3QZ7A 4R4IA 3PX4A 4KLSA 3J7YW 3V7JA 4TKOB 1UE7A 2XN9C 3U4ZA 1SV0C 5GAHC 4R64A 2HHHL 3A0HU 1I4RA 1V8QA 1WOCA 1K0RA 2ALZA 1H9SA 1Z6HA 8ICYA 3CU7A 4F92B 5EKIA 4LNQA 3H4BA 5FJ8H 3UM9A 2BKEA 2RQ5A 4O1NA 5KFIA 3TDQA 2K33A 3Q8LA 4ECQA 5AJ3Q 1TQOA 1R9TH 3AM9A 1KW4A 3GIJA 5CBAE 3VCBA 5FO9B 5HMMA 8ICOA 2JA5H 3CC2A 2MRLA 1K3RA 3C29A 1PYBA 3R8BA 2KE7A 2HCIA 1QVFA 2LKVA 2MU2A 3NENA 1VQHA 3D2QA 4MIUA 3S15B 5DBBA 5DB9A 1I4HA 5J0OA 2LMCB 1XWLA 3D4WA 4QJFA 3K5LA 3BS7A 1YI2A 4U7CA 1WVLA 2WINB 5L1IA 3OSOA 1VQLA 1HQRD 1VDVA 4OO1I 3CCVA 2WAQF 5CV6A 3G71A 1BPXA 4GXIA 5KFOA 4R66A 1NJZA 1SEBD 3TREA 4F8MA 2BDOA 4QZBA 1KKXA 1T8EA 3NQIA 2QLTA 5M3MH 3J81i 1WTXA 3S2DH 3JPSA 1T5XD 2Y0SG 5IP9G 3PUVA 1MA7A 2LPEA 2MUYA 3M7GA 2PZWA 2MHVA 4O2DA 1VQ5A 4UDUC 5AFWA 4JI4L 4UAVA 1JMCA 1AN8A 2ATLA 4JI7L 1QSSA 1K28A 4HIOA 2KFNA 3I8ZA 2KVCA 3J80c 1PZID 5KG5A 1GO3F 2RKSA 2W7PA 3C2KA 2VKQA 4AYBE 1J2MA 4FFDA 1PRTD 3LWLA 2FPKA 5J2AA 5KFZA 2BCRA 5EGTA 3TQYA 1PFBA 5M3FB 5J22A 3U4VA 2KVSA 2A1JA 3HOYB 1V1PB 3BYYB 4ECRA 3QJYA 4A3CG 1D1IA 2D3DA 7ICUA 1X42A 1KC8C 2R93B 2K60A 2AQ4A 1DD2A 4LUZA 3S1MB 2XI9A 2ZM6L 2EANA 8ICMA 2ZIVA 8ICXA 1NMFA 1L1OB 2C2EA 3I91A 3PIPA 4KLKA 4QZEA 1WD1A 3J80L 2GOLA 2HHUA 1LKYA 2SDFA 2F1MA 1PRTC 2WTFA 2CPRA 3KF6B 4J9NA 3G6EA 4B08A 8ICWA 3CCRA 4JB3A 3EFXD 2F8KA 1PRTF 3QUCA 3EUB2 3N52A 1IW7D 2LI6A 4DQRA 4GXJA 3QU4A 1E1TA 4ULLA 3NVWA 1KBUA 3A74A 4QCLA 2EZXA 3RH6A 1K3BC 4RUCA 1XNQL 4JBMA 4DQSA 2B21A 4KKUA 4DK3C 4DV0Q 3M6KA 4FS2A 1SV0A 4EGVA 3S1NB 2E5LQ 4GKKL 3PMNA 3U50C 4DN4M 2OQKA 3M7DA 2X6GA 3KBBA 1VQ9A 1LTBD 1N34L 5KL1B 2YMQA 4GLXA 3QOJA 4RT3A 3TANA 2L12A 4LJZC 1IW7C 5ALNA 5IIOA 3CNHA 1ZQCA 4K2KA 4IS7A 4UPAA 3S17H 2OF1A 4A3EB 2VB2X 4LF7Q 3RNUA 4DUZL 4PL2A 4IR1A 1RHPA 2C9OA 2UUCQ 3DDHA 5EE1A 4RA8A 2ASJA 5M5YB 3ND9A 1G51A 1ZQNA 4A3FH 3NTIA 2HHVA 4KKSA 3I2ZA 3ZD9A 4B3MQ 4OWTB 3J80i 2ASLA 3W2DA 4DV3Q 4OIKA 1F0MA 5AKHA 2JXJA 9ICJA 1CZWA 1SNPA 2NO4A 4HCEA 2JA7G 3FKIH 1Q8IA 1Z4OA 3RJJA 2LFNA 4NXNQ 3DV9A 3H8SA 1EIFA 9ICIA 3GIMA 4YCXA 2NN6I 3A7LA 2MQHA 3QZ8A 8ICHA 4DV1L 3D0FA 1TU2B 2PI2A 3Q6SA 5COYA 1QZGA 3EW9A 1GUSA 4JC0A 5AKIA 3GTPH 3A8JE 2ZIXB 4ED0A 1D1KA 4O3OA 1RD9D 3GTQH 1LTRD 3HOUH 1ZQXA 4LFCL 4PZOA 3TZUA 2Y0SE 1ZYQA 2K4HA 4EX6A 5IIFA 4PL1A 3CC7A 3T5HA 4C56C 4GC7A 3N7RC 2DL0A 2AGPA 4IUQA 1WCMG 2EYFA 2ZT9C 2UU9Q 1X9WA 4A3DB 2KBNA 1A3TA 1WYGA 3B0XA 3J7AF 4Z6EA 3WK4A 3OIPA 5IYCG 4OONA 1EY0A 1B50A 8ICCA 4QZIA 4UP9A 4DV4L 2EOTA 4X3KA 2VQEL 9ICNA 3SK4A 3WK7A 2ZJQA 4CDGA 4L63B 2VJ4A 3SQIA 3NBIA 5KT5A 3KOJA 3OSPA 2ZJRA 2VUMB 1QG7A 1Y14B 1Q3VA 1SKRA 1RDFA 2OM6A 3NK9A 3I76A 2AQ1B 2F0FA 1L0WA 3SVMA 3HOXB 2AH5A 2W9MA 2VY3A 4C3JG 2AGOA 3KHRA 1LT3D 1XMOQ 1HNZL 5J2BA 4LVSA 2XVSA 4JBKA 1GOZA 3KBGA 3HP3A 2HCCA 1KFDA 1PUZA 4DR6Q 4O5CA 1F2MA 5LL6S 2K1BA 3CP8A 1N33L 1TWCB 4FDBA 1I3QH 1ZQMA 4LUVA 4NW2A 1VJ5A 2UUBL 3HS0C 2OYYA 1UUPA 1X55A 1KDAA 1LLRD 1B0XA 4B9UA 1STEA 4ECWA 2BA0A 1KQQA 2K4EA 2BQUA 2NZ1D 5ELOA 4GN5A 5CB1A 5BR8L 2DY7A 4RPXA 3MVVA 1JJCB 4XQNA 1HR0L 2Q0ZX 2F3NA 4FBTA 4YD2A 1BPEA 1IL2A 4FXGC 3O13A 4J9MA 3MR2A 3T5JA 1BBUA 4OX9Q 4DWIA 1U4MA 3N7SC 2JA9A 3AU2A 3HOWB 2HQLA 2A6ED 1CEZA 3AB9A 4K4GA 4R65A 1PTOB 2NRWA 4OHJA 4LF9Q 5AM2A 2AMCB 2W7OA 1F2YA 3RLNA 5H2FU 4DOCA 2EZZA 4PV1C 2E1FA 3KKAC 2QEJC 1PZJD 4A3IB 4C4RA 4J03A 3L7ZC 2IX1A 1ZQTA 3G4SA 1HUMA 1EIGA 1K9MC 2BCOA 4JI6Q 1KHIA 4X64Q 3OJSA 3NS1A 3MC0B 1L2FA 3LWEA 4KLFA 1BOSA 3DXJC 4DR2Q 4YQWA 4RGTA 1FNWA 2PI2E 2AQ0A 3TBIB 1DOMA 3H0GG 3PO2G 4I27A 2UVUA 3G48A 4LK1C 3IHQB 1CTMA 2G09A 1VQ8A 3CP0A 4MF2A 2A6EC 7ICLA 4HR7B 4Q45A 2KENA 5DQIA 3ETRA 4R8UA 5CGKA 3Q8RB 4IRCA 4Q8FA 2NN6H 2UVVA 3EYZA 4DK6C 4Q43A 4HTHA 5ALHA 3PY8A 3A7AB 2W9AA 5D46A 3HFZB 1EYCA 5TISU 1W6KA 3RBDA 1JUDA 3HKZB 2HHHQ 3IFDA 1KTKA 1V1OA 1N56A 9ICSA 2BPCA 2UXCL 4C3HB 1ZQJA 4UHVA 4M9JA 5KG2A 2YTXA 4ED8A 3UDFA 4X5VA 2GH1A 2QARA 2J6TA 4BBRH 3D31A 1TY2A 1CI3M 4OXPA 3NELA 3Q8SB 1NJWA 1VQAA 1ENAA 4RPZA 1VDZA 1XC9A 4CF3A 1S77D 2A6HD 1AQ6A 5DB7A 1BUVT 2TSSA 2Z0SA 3NP8A 1D7QA 3WOEA 2E1EA 3I70A 1STGA 4IJHA 1ICFB 3S9WA 3IV6A 5AKGA 4GXKA 1VQOA 2BCSA 2RCNA 2Q2UA 1OW5A 1ZQKA 5HR6A 3X3MA 2WF6A 4PNYA 5ALSA 2E2IB 2YTUA 3DM3A 4K0KL 1TWHH 1ZQDA 3WKEA 2XC9A 5IGDA 2E2JB 2EJGC 2D6FC 5E7NA 1PH6A 1LV9A 8ICRA 1VMCA 4HJ7A 3RBEA 2PFPA 1RODA 4JI2L 4R4CA 4UP8A 1X6OA 4Q44A 2E76C 5I2YA 2JSOA 2LHTA 4L5QA 1N61A 5K4LA 2H1EA 1FGUA 3N6RA 1I6HH 3OHBA 3PX0A 1CRXA 1N62A 1AE2A 2KJ5A 3AMZA 2R7ZH 3D3RA 4RMFA 4JI4Q 3D2SA 2E8GA 3UDIA 2F0MA 4JI7Q 1T7PA 7ICHA 1PVPA 3QO2A 4JI8L 3TQ1A 3GV8B 2A69D 2F0PA 2B39A 4JCVE 4KMOB 3T16A 4DKAC 4TURA 1G2SA 1ZJMA 1JX4A 2KUMA 3HJEA 2G06A 4A3BB 1HZ9A 3PUZA 2ZXHA 4ILWA 5T1GA 2VA8A 2F1IA 3CXCA 1XYIA 4U6PA 2HQEA 4RCNA 1A8VA 4LUOA 3KKAA 5CV8A 4RNOA 1G8ZD 4KX5A 1NK4A 3PIP3 7ICSA 2ZM6Q 3SAGA 1B4FA 3QU9A 2AHOB 2Q8IB 3IP4B 2A69C 4KLLA 4FZMA 3HWTA 4UW9A 3PSIA 1PYSB 3UXPA 5GROA 2AKWB 4RHRA 1PK1B 2L55A 5AICA 1HFNA 4Y2SA 4NMZA 1STHA 4TUQA 1V9PA 2F8LA 4DLEA 4P0PB 1N36L 2Q4TA 4KLDA 4BBSB 2GA4B 1JCKB 4HEDA 2FLPA 1QCBD 3SI8A 1SFOB 2FPMA 3UMGA 4B9LA 1VQKA 1EU4A 4ECZA 4PHEA 1QH9A 1WCLA 1XNQQ 5F2DA 2F0HA 1S9FA 4QWDA 1K83B 2IBKA 3M3YH 2MPMA 3KD3A 5ALXA 4YR0A 3PW7A 3AL0B 1QVCA 2N78A 2SEBD 4DV7L 1NUCA 3S2HB 1SDFA 2NVXB 3FEWX 4A3KB 5AKKA 2L9HA 3AFPA 3CC4A 2W9BB 3KLSA 1B44D 4QZHA 1SL0A 7ICOA 3M4OH 4QZ8A 4RG1A 4CJ2C 3MXUA 4IURA 5J0QA 5EKKA 4YR2A 3MAQA 5J2DA 3QUTA 5ELBA 1U47A 1N34Q 5KFFA 2SNMA 4BS9A 2PW5A 4POGA 5I2XA 4OWWB 2B2WC 4NLBA 5M5WH 3S14B 5EWEA 5IP7H 1NR2A 4JWMA 3ISBA 3K81C 3NRZA 1KIXA 3QU7A 3T79A 3H09A 1QQ7A 4F5NA 4DUZQ 3HPOA 5HMLA 3V6HA 4NP5A 3KK7A 1JICA 4DS5A 3EROA 2EYPA 3NHHA 3M85A 1ZQUA 4M6WA 2CH4A 4G4KA 3CPFA 4FF4A 4IPHA 5C3XA 4LFAL 2FE9A 3H3VI 4OELB 1A3UA 2PNHA 1GKHA 2F0JA 1G6PA 2LSSA 1GHKA 4KLGA 2VQFL 1Y1VG 5DEHA 1KRPA 1RKNA 3AFQA 2DUYA 1F9QA 1HTLD 4EX5A 4DQPA 2ZIWB 5FO7B 3MBYA 5C3EG 2R92H 4F88A 1HIWA 5IYBG 2F44A 4L6TB 3A5UA 3ONAB 1SJHD 5GADC 3EIVA 3BVZA 4DV1Q 4TUSA 5BN3A 5CYUA 2B8GA 2K32A 1HZBA 4L5SA 2GWSA 2W04A 1PLFA 3JC66 2K03A 2N8NA 3PGZA 2JA5B 2V4RA 4EX7A 1Q90A 3FM9A 1WTVA 2K75A 4LFCQ 4B9MA 1IKMA 4NLNA 8ICEA 1TS2A 4PG3A 4IFDG 3U26A 1H9RA 2B3GA 4J8QA 3EN2A 2CN1A 8ICIA 1KD1C 1D9DA 3BQ7A 4K6LA 3URYA 5KFKA 3IG8A 4TRDA 5C0XJ 4CBVA 2KJXA 2WB1B 3UXNA 1QSYA 5CEHA 2QEXA 3AQFA 1EXNA 3HRDD 2B2UC 5KFQA 3TAPA 2PI4A 1SYGA 1PK3A 1D8LA 1ZQZA 3AYHB 3QYPA 3D4RA 4DV4Q 3FPUB 4I2JA 5KIXA 2VQEQ 4F5PA 5M3MB 2LM1A 4QW9A 3RH5A 5EE3A 1HPCA 2K8CB 4F4WA 3SK8A 4DU9A 5KFBA 1PH3A 2I0QA 3K5NA 2F0NA 3CD6A 3S2DB 3CRXA 2W03A 1ZQAA 4DA2A 4KJOA 1O7LA 3VR5A 5AM0A 5KNDA 2I5MX 1J5EL 3M6ZA 2XTIA 3R9KA 3KZIU 5GAGC 1HNZQ 2NTTA 1ZETA 4KLJA 1EL0A 3CW2C 1VS0A 2RP5A 5BPCA 1QILA 1K8GA 1N63A 4K2LA 4P73A 1RPLA 9ICAA 4A3JG 2D0OA 1N33Q 3LWUA 5L1KA 3GQBA 4HJ9A 2UUBQ 4EYIB 2F3IA 2XY6A 4IPCA 3MR5A 5KFAA 7ICFA 1RL2A 1SROA 2CQAA 2UUCL 3K4GA 2DNEA 5BR8Q 3OSNA 3ED5A 1HR0Q 1N8RC 1C20A 1TK8A 2KICA 4RQ8A 2B2WA 2Z4HA 2ES6A 5KFWA 1EYAA 1HXYD 3DLLA 2YX8A 4RHSA 1BR9A 1KNEA 4YCWA 2OXPA 5CMDA 1ZQVA 2W43A 5HP4A 2KZZA 5DQHA 2ZTCA 1J6QA 5JOBA 2YB1A 5ALUA 1UWVA 4K6DA 4NXNL 1JI7A 5AIAA 3UDXA 2YU9H 4RQ3A 3K59A 4IR9A 1TWFH 1EIHA 4KN7C 1S5BD 4MFFA 2IPKD 3NEMA 4GLAC 4NDXA 2JEJA 2F0SA 1K0SA 1NMGA 3HRZC 3C28A 1PA6A 4C8OA 1UNSA 1CT1D 1S0VA 1YITA 4BY1G 3M9OB 2E2IH 1KAAA 4BXXH 3H3VH 4JPBW 4DK0A 1O03A 3MEHA 1U4PA 3KUPA 5B66U 4C3IB 1KQSA 3NXWA 3E9HA 4I2IA 5G5GA 3GV5B 4XRHA 3S17B 1DGSA 5J2IA 2CHBD 1SLJA 2JQOA 3PO2B 4B6JA 4CKBA 3S1RH 3MFYA 4DXFA 2F76X 1QQ6A 4RQ1A 2JEFA 2RHSB 3QX7A 3A0BU 1PFNA 2N55A 4EQ5A 3OIQA 2JA6H 2E3TA 2Q8RE 4LZGA 3C1FA 5JJKA 3N7PD 3GO5A 1SE4A 4A3FB 4DXGA 2R8KA 2B2UA 4B9WA 4EQOA 3TS2A 1WTPA 5KFGA 1N2XA 3PR5B 1A2UA 1B9MA 4FZNA 5ELEA 2K5NA 1D8YA 4NLGA 1A2TA 3FKIB 1ASYA 1X9MA 2KD1A 5B5EU 2F0WA 3RH4A 4IL6U 4JBWA 2MJ8A 1V38A 3GTLH 1XMQL 1X6IA 2ZJ8A 3RB0A 1Y8OB 1II3A 2WAQB 4H44C 4ZK9B 3W5OA 1GUOA 1FNVA 1H9JA 1LYLA 4DL4A 1V1QA 5FO8B 1ZQFA 1QOHA 2AJQA 1S10A 3NUCA 3UE1A 2B63H 2QKQA 3L3OC 4RQ7A 3RJFA 5AM4A 2XNAC 1Q46A 2I9GA 3BZDB 3M4YA 3HOUB 1B43A 4FE3A 2JZBB 1HQMC 3BDOA 4LF5L 4K0KQ 2CWAA 3SYZA 3V2TA 2JK8A 1CKNA 2HHTA 2SOBA 5LMNW 3MFGA 1EOTA 5I6YA 1YHBA 2ID0A 4I2EA 4JI2Q 1JB7A 5JJLA 3U9OA 4RUAA 7ICTA 1UQVA 1O7ZA 1S8OA 5EWFA 2K28A 4CJ0B 4KLMA 1XJVA 4RNNA 4OX9L 2Z6BA 1RCVD 4M9GA 4B9XA 2D9UA 3OOCA 1NZPA 3SR6A 2KN7A 2K5DA 1K83H 1CUKA 2BR0A 3PZPA 3BS5A 4OWXB 4JI8Q 1AP0A 3UMCA 3PVXA 1BO0A 2NVXH 1FJGL 1VQFA 1HUZA 2Y0SF 1ET9A 1X65A 4DL2A 1BBXC 5HR7A 3DM1A 2DKZA 2ZXIA 4GC6A 2K04A 2RDIA 1RG6A 3HZXA 4LF8L 2WFAA 4K4HA 3I4NG 4P4MA 4BXOA 3PSTA 4KLIA 1F5SA 1DYQA 2R6GA 3D6CA 2NBFA 2IX0A 5CV5A 4KN7A 3EA6A 2OEOA 3TP6A 4KY6A 4IOCA 2JA8G 1PFSA 4J9LA 5JTIA 1SB3C 2P35A 2E8PA 1EWIA 4S3SA 4XT3B 1L7MA 1EWCA 1GVPA 4J9RA 1I3QB 5KGUA 2WHEA 2F0LA 4IQUA 3WKDA 1R4PB 2FPLA 3Q24A 4GKJL 1B1ZA 1KLGD 2A74C 4P4PA 2RF4A 1EQRA 1MC8A 1ML0D 3WKCA 5L9XA 3MXGA 2R8HA 4J9KA 2LYHA 1N36Q 1IBLL 2N49A 8ICGA 3U9SA 3BYTB 5EE9A 2HI0A 1Q3LA 4BGDA 1BPYA 3Q8DA 2FHTA 4M8AA 3ERQA 1Z3EB 3WKBA 1YHAA 2R8JA 2NRTA 1EZ8A 4DV7Q 2IJ0A 2EYMA 4R4OA 5DDYA 1DXSA 1NJYA 4KLQA 2VS1A 2KNJA 4I7AA 4X62L 1EYGA 1EIYB 3C3LA 1C48A 3J81j 3VYUA 1LTAD 5C44G 3RRHA 1N5XA 2ZUDA 2A1AA 1XX8A 2F0GA 3GV6A 1M8AA 1VQNA 3RJIA 1YIJA 1EQVA 2BH8A 2NVYB 2YY6A 2E5SA 3RZOH 2PMZB 2R61A 2VNUD 2DY8A 5KFRA 3NBHA 2Z7JA 5AHXA 2VANA 2QB0A 4NPSA 2JYOA 4UBCA 2KECA 3WK6A 3SMVA 4H0LC 3PO4A 1T94A 1XO0A 4L5TA 5EPJA 1KFSA 1YZ6A 1WTQA 2BCVA 1SZHA 1RTOA 1L3TA 4APVA 3C2LA 2YV5A 3EVQA 3CMEA 3HW8A 3J81E 5GQOA 1QZHA 4LFAQ 5I9OA 4F2RA 1HUNA 2EAMA 4YP3A 2WFWA 1JMSA 1YT3A 1U5KA 1DK2A 3QB3A 3V05A 4DSLA 2VQFQ 3R2IA 3VA7A 1PHJA 1EY6A 1AROP 1HA5A 1CHPD 1VQBA 2R8IA 1ZQRA 3DUZA 2MAXA 1C7YA 1NK0A 2FMCA 2DFLA 2K5HA 4CGZA 4F4ZA 3M4QA 8ICTA 1D8BA 4BBRB 5JEAG 1AZPA 7ICEA 3SV3A 3NASA 1ZQOA 4J9SA 2F77X 2HBJA 4DS4A 5AI4A 5KFTA 5KG7A 3QXGA 4DFDA 3F53A 4MFAA 1BNPA 3CMAA 5CR0A 5CHGA 2PQEA 1CA5A 1CK1A 9ICOA 1O78A 4WJ4A 2DJGC 4YN4A 2Q2IA 4Q8EA 2XCPA 2FMQA 2NRXA 3OMCA 4FF1A 1AH9A 3L9AX 4R8NA 5BN5A 4DR4L 1TWHB 3P7JA 1DRGA 5IP9H 3NSWA 4ED3A 4ECXA 5KYIA 1U4BA 3TP5A 1RXVA 1O80A 4RPYA 4P2HA 5AK3A 4F72A 3Q23A 2V1CC 1F2ZA 3JAMc 1MSHA 2ZIUB 4QGUA 1NK6A 1EWHA 1IBML 8ICLA 2LYAA 2RBMA 4UB3A 1I6HB 2OEHA 4G7HC 4FS1A 1E22A 3H7IA 1JOKA 2G9DA 2QILA 4XYQA 2R7ZB 3KZXA 4PHAA 3A5ZB 4JW0A 3GTKB 4JI5L 1J5EQ 4ACOA 4PMWA 4HYKA 5CV7A 3I4MG 4A3CH 1Y69U 4DAPA 5JJZA 4MF8A 2XY5A 2XY7A 4PQXA 5C4XG 1Q7YC 4DCCA 5L1LA 2F0OA 5JU5A 2I5LX 2K14A 4Y2PA 1GHJA 5D49A 2Q8TA 3PMLA 3Q8PB 8ICPA 4C3IH 5AI6A 2E74C 3QEBZ 5AKYA 2IW3A 4FO6A 4GFJA 3JAML 5IILA 1E2VA 2IHNA 4B3SL 1SMXA 3KDFA 4US9A 1RDPD 1BF4A 2WKDA 1WUDA 4BY7G 3MGVA 4QZDA 4YD1A 3ZI4A 4NLKA 1ZOLA 3MXPA 2DQNB 4DSIA 1SYEA 2HDMA 1FFUA 4KY5A 4C1NK 4DR1L 5CP2A 1ASZA 4AIMA 4OO1G 5ELNA 2JEAI 1ET6A 5J2KA 4YHHL 4C0ZA 3OPXA 4IJLA 4A8EA 2JE6I 1F77A 2HBKA 1MD2D 2OT2A 2SNSA 2P66A 1RF2D 4ID6A 5EE0A 3QU2A 2Y1IA 4A3GG 5J0YA 2R8GA 1YBYA 1JN3A 2ZXRA 4IUNA 1XO1A 5IGBA 2VW9A 1D5XC 2UXBL 1HHVA 3MR3A 3J80E 2K01A 5DLFA 1W2BA 3IRUA 1BVSA 3AUOA 1TKDA 4FNFA 3ULPA 3NTKA 8ICQA 3PX6A 5LHY1 4O3RA 4LFBL 2N1RA 2KCNA 3HOZG 4DLGA 3OHXC 2CKZB 4DK1A 4AP9A 3M3YB 2F0QA 4DL7A 1UAPA 4ED7A 2JXMB 5L37A 2ATWA 2MA1A 3B6YA 5HGTA 3WK5A 1N60A 1LTGD 3M4OB 1ED1A 3C5FA 2KZMA 1PH9A 2CRXA 1COKA 3S1MH 2V4QA 1IXRA 2IA6A 1EQTA 1S5LU 2YTVA 4J9PA 4LZDA 1OXTA 4O3NA 3SDZA 3H4DA 1EUJA 3D6JA 5HY6A 3KHHA 5J2HA 3M1YA 3C1ZA 3TN2A 4DV6Q 2IMWP 3JAMi 2VB3X 5M5WB 1S72A 4F8RA 8ICJA 2EDGA 5BN4A 4A93B 1TAUA 2AUJD 2WP8J 4A3MG 1NZBA 4DNIA 2E2HB 5IIIA 2JA7H 3SAHA 5D4BA 5KYLA 3VA5A 2NZOA 2B6GA 3TZDA 1UEAB 2KSOA 4GNXB 5L1JA 4IUTA 1KLUD 2Y9TA 4KTQA 3QR8A 4CRXA 2YB4A 1B8AA 4WFN3 1BPZA 3I4OA 1OO9B 4UBBA 5J2FA 5KFXA 1HH2P 3ERSX 2XRQD 3BQ1A 2XVTA 2A19A 5ALFA 2OH2A 3AU6A 1XTCD 5KFNA 2XWJB 1VCIA 4HSVA 3KBXA 3HT3A 3KLWA 2R92B 4EZ9A 1L1OC 1RM6C 1XMQQ 1XSNA 2E2DC 1ESRA 5LMNL 1ILPA 3RJHA 1IKLA 4HMJA 1T4GA 2B29A 4ZCKA 5DLQE 5A2QL 4ZUJA 1Z4NA 2EYLA 1FIQA 3D2NA 1I50H 1QNKA 1WCMH 1SXTA 2N88A 2RHQB 4RGOS 2C2DA 5F3XB 4LF5Q 1RXWA 1IZ6A 1I4PA 5IYCH 5IYDG 2OHFA 2WACA 1A63A 2EY5A 4XA5A 4QL5A 5CBEE 1NI3A 2AQ3B 1BCPB 4KKTA 4LWCA 2HW3A 3Q8KA 1D5ZC 3H8WA 1FVIA 3PIO3 4ZKCB 2YMPA 1VQEA 4C7ZA 1P16A 2CCZA 2Z6KC 2CXYA 3PW0A 1XNRL 3KHGA 1X56A 3G6JB 2M0NA 4M2YA 1S0MA 4F5RA 4EZ6A 3T13A 5C4HA 2CQOA 4TSSA 1UA1A 3OJUA 2JA6B 3K57A 1FJGQ 4JV2A 3K5OA 4UB6U 2RDFA 1BPBA 4QY7A 4JI3L 4C2MH 4AQYL 1Z1VA 4PH5A 3RN5A 3DHQA 1ZQGA 2K4KA 1CZGA 1O08A 2Z1CA 3ICXA 4DFAA 1H9KA 5CWRA 4LF8Q 4A3LG 1Q8KA 3TARA 2P6RA 1S5FD 2EXDA 2IT1A 2NVYH 3IFTA 4X65Q 9ICUA 3OYYA 1QUQB 4M1UB 1A3VA 4MTKA 4NXMQ 4CE6A 3H0RB 2GLEA 4IQTA 7ICGA 5C5JA 5KAFU 2BE5D 4GOPB 3VR3A 2XGPA 1TT2A 2M2LA 1DOKA 2RSNA 1L8LA 2P6UA 1X3QA 3WK8A 5ELCA 4GZYC 4QW8A 4GKJQ 3E5SA 2WF9A 1HRJA 2NB0A 4HAEA 4I2HA 1Q1EA 1X66A 3M4PA 3TP8A 5M3FG 3HOYG 5DLGA 4NWIA 1YNXA 3P1HA 4PGQA 5GTHU 2QDLA 1IBLQ 1F2LA 5CORA 2R93G 3I73A 3CQZH 1SYCA 1JWMD 4Z9CB 3KLSX 2BE5C 1R4QB 1ZXIA 1FD7D 5J2GA 1FO4A 2KQ3A 2FDRA 1HFGA 2M9VA 4DSKA 1ZKOA 4JV0A 2V4DA 2KKPA 4V0BA 3D4DA 2D2CC 2YU9B 1UE5A 1C8CA 1TWFB 4X62Q 3H0GH 4KY7A 1SNDA 3PO2H 1V1PA 2IY5B 2NV3A 4QWAA 3HG9A 3LVWA 3H8JA 4UARA 2HT1A 4R9WA 2RDJA 2HIXA 1BGXT 4QIWB 5AM1A 3PO5A 1WI5A 5K5PA 4O9MA 2UXDL 1GUTA 1JWSD 2F3VA 5HNKA 1CI4A 1ZD2P 1L1OA 4E6IA 2NYVA 3DWQA 1GUWA 4XQJA 4XQ8A 1XPOA 4I65A 2F4IA 2V9WA 3IM1A 2N3SA 2UVRA 2K8AA 3RF9A 1JT8A 4IPGA 4ABNA 2PFOA 2Q2HA 3KF6A 1V97A 5D14A 1RQLA 1QQ5A 3WDNA 3TMEA 5CV4A 4KV6A 1KEJA 4CDDC 1JJGA 3S1RB 4UAZA 3C46A 1BCPD 1SZPA 4MEYA 5KNIA 4ECUA 1BDOA 3AEVA 1BQQT 5AI9A 1F9SA 2MUTB 3OTQA 3FHWA 5G3LD 3GTKH 4NLCA 2QGQA 4X66L 1X3FA 1NNLA 4QWBA 4A3EG 1L8OA 3WU2U 1PTOD 4EBDA 1PVQA 2IL8A 2Z6KA 1XS9D 1YNJD 1ZQYA 3GTMH 1TAQA 4P71A 2WV6D 2JH1A 2ES2A 1X3PA 4QZGA 3C5GA 2ODGA 1XSPA 4PZNA 5E4WC 5C5LA 4ZKBB 2KFZA 7ICRA 5DB6A 4P0QB 2HD3A 3NVVA 4IUUA 1IYVA 1PYWD 4YXJA 2W9CB 1BCPC 4ME3A 4PZ8A 3S16H 3LGJA 1ZQHA 1Q86C 1B53A 2HVIA 5IT9L 2K5QA 2B63B 2FJ6A 2LS01 4P74A 1CQFA 4MFCA 1MJEA 2G08A 5T14A 4XTCS 4DR4Q 2KOLA 1JRPA 5DB8A 4DOBA 1L0XB 1PTOC 4KLEA 2EXZA 1WJJA 4IPDA 2I6XA 1YNJC 1STBA 4XYOA 5FK9C 1FEZA 1SNQA 2WIIB 1D9FA 4F87A 1I6VC 4DPGA 5J1ZA 3DEEA 1PTOF 1T9HA 4QUCA 4QWCA 3E9IA 3C23A 1IBMQ 1N5WA 2DKXA 8ICZA 4OIJA 4CDEC 3K80C 4OJPA 4BX9C 4NLZA 4K8JA 7ICQA 2HHXA 2K7VA 5FKAC 3GV7B 3V7LA 4Z6CA 1AE3A 2F2AB 2FLNA 4P75A 4A3DG 1KTQA 3JPPA 4KD4A 2QKIC 3H94A 4JI5Q 2F0DA 4F4XA 3F2CA 3BQ2A 4GOPC 3ORYA 5JRTA 4O0AA 1EQQA 4KLOA 4B3TL 2F4VL 1TWGB 5J2EA 2ZIXA 1LTSD 3CRKC 5I4DA 3ZJYC 5J2CA 4KD3A 4O5EA 4OL7A 3W1GA 2C2RA 5C0YA 4I2DA 1S97A 1LTID 2O5IC 2OTLA 8ICVA 1QWYA 2VUMG 4B3SQ 3ZD8A 2W8LA 1KABA 4QZFA 3NQTA 3CCUA 1Z00B 3KFUA 3LVVA 4AYBB 3HKZC 2F3WA 4KTAA 4A93H 1EY7A 3RZDB 1Z47A 3VYSA 2E2HH 4QZCA 1RQNA 3L4PA 3FAHA 3H6MA 2W11A 2G9HD 2FXQA 3HOXG 2HOIA 1MN8A 3EJIA 4DR1Q 5K36G 3HKZF 4C8LA 5KFVA 9ICBA 3SD7A 2QA4A 4YHHQ 3GILA 4N8FA 2ZJAA 1ZRMA 2Y1JA 1NK9A 1IV8A 3OWFA 3GQCA 3QOLA 3OTOL 4P2CB 3NVYA 1P7DA 4KLTA 2UXBQ 4X6AH 1HA6A 1M90C 1DOQA 3HOVB 3PO3B 3RJKA 1DZ1A 2OWOA 3IKJA 4LFBQ 1VLBA 3H3VC 1OXXK 3V96A 4ZOHC 4A76A 3GTGH 2WF7A 4UB2A 7ICPA 2F0UA 3I55A 4I2CA 2K8BB 3ISCA 4H13C 4JI0L 3HOWG 5ELDA 1X2IA 1SGGA 4EELA 4P72A 2DGZA 4GIBA 5J0XA 3RB6A 4KMUC 4KN4C 2K4PA 5CV9A 4WRDA 4DQIA 1J8IA 4KITB 1OTCA 4A3IG 3RZOB 4RGMA 1WD0A 2L1BA 1PH5A 4G7OC 3GV3A 3JPNA 1SL1A 1SYDA 4ALPA 2XCAA 3E6ZX 1Q81C 1DOLA 3UQ0A 4F5QA 4DL5A 2DPIA 3LWMA 3T5KA 1Y1VH 3DWPA 4CNQA 1NAPA 1WYDA 1S4ZA 3VYRA 5C3EH 1A15A 4QJFB 5IYBH 3CKIB 1DGJA 2Y9UA 2ZTDA 5ISRA 1XPRA 2RHFA 3V72A 5AM5A 1DJRD 4OCZA 2AU0A 1V43A 4UATA 4M9NA 3FDTA 1OXUA 4FBUA 1B22A 5KG4A 1YVCA 5C4JB 1PFMA 4ICAA 1CSQA 1TKWB 3MGIA 5LMNQ 4WJ3M 2D8CA 4TQSA 4IFDH 2DBYA 4F4YA 4LW1A 3HKZG 3RR8A 4DNRB 1WG8A 2EJMA 3PQIA 3M9BA 3TEHB 5ALLA 4ECYA 5JVG3 1PVOA 4GOPA 4JYAL 4C3HG 3TS0A 1FR3A 2GVAA 1N32L 3OWEB 3N28A 2IOHA 2W8KA 1L3UA 4K14A 4QUFA 2XIDA 5M9OA 2XSCA 4IUPA 5ALDA 3RAXA 4NKLA 4XUSA 2NVQH 3J7A5 1NCVA 2Y0SB 4V190 2XO7A 2W54A 1NY4A 2A1JB 2Z4IA 4RKLA 4BA2I 1XNRQ 3BZCA 2LXJA 2EDUA 2B0CA 5AKXA 1URJA 3K75D 4JUZA 1G291 1VQGA 3ZDCA 1M6YA 3MA2B 1O7YA 3MFIA 4KHZA 3Q8QB 2J6UA 4JI3Q 4AQYQ 3IDWA 5J0RA 3GDXA 3LYSA 2EE1A 1T5EA 3NPPA 4H02A 3ALRA 4B9SA 1JWUD 1LTTD 3A8IE 3KHLA 1SRUA 1LKYB 4AYBC 4DAYB 4A3JH 1WWUA 2H3ZA 5ALZA 1S0NA 3RJGA 1X3GA 4JMUA 1HNWQ 2WKCA 3A0JA 1CFMA 3DEPA 5IGCA 2RRDA 4YY3L 1S40A 2L5TA 1NJIC 4GKKQ 5IIKA 4CGYB 1XU4A 1HEKA 4IRKA 5FLXc 4ZUIA 2BZFA 1ESFA 1CKOA 1TS3A 2F0IA 1YJWA 3OMGA 4NY8A 1U9LA 3BQ0A 1ZYRD 4Y2QA 4NXZA 4DV6L 4C8KA 5L1MA 1HCZA 1T3NA 3FYHA 3BDCA 1GUGA 2F52A 3VR2A 3S1QH 2BCUA 3Q0AA 4A3BG 5M5XH 3F2DA 1SSOA 1A6XA 3SEIA 4LF6L 1MGSA 4M04A 5IGGA 5EKLA 4IOAA 1X9XA 4O3MA 1SAPA 4KMUA 4DFPA 4KN4A 1B3QA 3NTUA 1SWWA 1RYRA 2FMSA 4DSJA 3E2EA 3TAQA 5GAEC 3TFSA 2MUTA 2KMDA 4BJQA 1IG6A 2EZVA 1D2BA 4B9NA 2ZXOA 3BJUA 1SYFA 4PGYA 5FLXL 1GD7A 4C4TA 1ZYRC 4YMMA 4KLUA 1SNMA 4BY1H 1VMPA 4HIDA 1K8AC 2IHEA 4UAIA 1STYA 2WB1C 2EVBA 2L0CA 3MABA 3QUQA 5IGEA 1JXLA 4UQGA 2KKVA 2PFQA 2PFNA 4YR3A 1SE8A 1W6JA 4XXEA 4Y2YA 1VQMA 4BBSG 2ZJ5A 4UB4A 3F2BA 1TS4A 1ENFA 2UXDQ 2WB1F 4PHDA 2KVMA 5IWAL 2M00A 2LBOA 5KT3A 4UB1A 2XRSD 4YCUA 2JHDA 2KIWA 3F5EA 2TMPA 3BDPA 2G5IB 3PSFA 1NTGA 5A0LA 3L0OA 4IUVA 5C6AA 2K50A 1EY8A 1S5ED 4YIJA 1TFRA 4PZ6A 5EAYA 1PK1A 1TWAH 4A3KG 3TACB 8ICFA 2P5ZX 2YMLA 1JR0D 1M4VA 4IQVA 1KRSA 4P0PA 4RAUC 4DAVA 1HUOA 4NJ8A 2JA7B 3Q8MA 2MSNA 1L3SA 1W3SA 4QWEA 2KP7A 5KTQA 3HKZE 4E0DA 5I9PA 3A56A 4X66Q 2JR5A 4KHVA 5F9NA 2ASDA 4O3QA 4FXKC 2BDPA 1TWGH 1UA0A 3BVMA 2PQAB 1X9NA 4Q5VA 1ZD3A 2K5VA 3X3NA 2CWPA 3CYMA 4ODGA 3T1HL 2W9BA 3ICEA 5C0XG 5E1FA 2W3RA 4YVZA 1EYDA 3JPOA 3JPQA 4ECVA 2NVTH 1JIHA 4US8A 4L8JA 2OTJA 3E0FA 2B2TC 2ZUCA 5JJIA 4RNMA 2HUGA 2K5WA 5J39A 3SK6A 5DM73 5FLXE 4NXML 3RZDH 3I56A 1HNWL 1A77A 1PH8A 1CSPA 3E0EA 5ALIA 5IODA 4JV5L 5D3IB 1MIUA 1PRTB 2K4IA 1I50B 1EEID 4FXDA 1X54A 1WCMB 4RKBA 5AKEA 3SHLA 5FJ8G 1SE2A 2KCCA 1IL8A 3BJYA 2WF8A 4HIMA 4R4TA 4J15A 4OD0A 4LJXA 4HJ8A 5FLMH 4ED2A 2RVLA 2B2VC 1ECWA 3KOOA 1TK5A 2FI1A 1ZQIA 2JA5G 1ZD4A 1ZEQX 3V6KA 3D8GA 2MNAA 2JMGA 3OW7A 5F9LA 1STAA 2X6LA 3HOVH 5KNCA 1L7PA 3PO3H 4MTNA 4FYDA 4M9HA 1TV9A 2ZIWA 2H3FA 1GUNA 1Y1WH 3O0FA 1SMYD 3Q22A 2L5YA 1FNUA 2WB1G 5KEEA 1ZQSA 3ONNA 2K05A 5JVH3 4KI0A 4EBEA 2R7FA 4C3JB 2KHJA 2R18A 2RQXA 2YMMA 3GFKB 1T3QA 2KOBA 8ICUA 4C2MB 3NRWA 4B3TQ 1KDHA 9ICGA 2F4VQ 1H38A 2JA8H 5AK6A 4O3SA 2BDNA 2CW0D 4IQZA 3T51B 3NVZA 2HHWA 3RLFA 5M3MG 4XT1B 3RMHA 1X3EA 5DBAA 4HCSA 3WKAA 1F9RA 2ISPA 8ICAA 3DMUA 2BCQA 2BHNA 1MQ3A 4M9LA 4Y2VA 1SMYC 2GVBA 4ZYSA 3BVGA 4U68A 3VR6A 3MWYW 4EEYA 4HIKA 5JPMC 2HDOA 4C7YA 4B9VA 1XNSA 3HX0A 1EEFD 5EWGA 2OCEA 1YJNA 2LXKA 1YZ7A 5AK5A 1IYJB 2CW0C 3OTOQ 4Y2JA 1Q3UA 3H91A 4CF5A 3HP6A 3AQQA 1C9OA 3WWVA 2WAQC 2O4XA 4DUYL 1LT4D 1E7ZA 3K0YA 1IIPA 2E75C 1K1QA 5C4JH 1SE3A 4KLHA 4R8UB 5IIMA 2R7DA 3CQZB 5KFPA 4QMGA 1IM4A 2Z8LA 1YHQA 5JPNC 4ELTA 5C44H 3CCSA 4XQQA 8ICBA 1PH4A 1VF5C 1MI2A 2QW7A 4ECTA 3T53B 1MKHA 1I4XA 2H5XA 1I4GA 2J4XA 3H0GB 5FOBB 4O3PA 1BBWA 2AUKA 2C5CA 5IY0A 4JI0Q 4I2FA 1NKCA 3MTSA 2ESEA 3GDEA 1WTOA 4KX3A 1RYUA 4P4OA 3UQ2A 5GTIU 4K4IA 3TRZA 4C8MA 4POFA 4CCHA 4R4QA 2QARB 4OJ6A 2B2TA 1KN5A 4JV1A 3UE0A 3M8SA 2EQSA 3GU3A 1UCVA 2KZ3A 4QZ9A 2ICIA 5ALOA 3ZDEA 1MHWC 4KJNA 4TUPA 1EY5A 9ICFA 2J0TD 5C4ZA 8ICKA 5ALVA 1XSLA 1JQYD 4MHEA 4OJ5A 9ICMA 5ALPA 3CPWA 3NE5B 4ZLTF 1C0AA 2C22A 1S5DD 1E1OA 5EBCA 4C3IG 5DGAA 1SR3A 2ICEC 2B2VA 5JAVA 2KCTA 2KEEA 5JEAH 4Y2TA 1KFTA 1UE6A 4NL9C 4BWMA 1QLNA 1E3PA 4DAMA 3AQEA 1N48A 1U45A 3FDSA 3QNMA 1XWEA 3PUXA 1JOQA 1JORA 4I2AA 1JB3A 1HTPA 4JOIC 2G5DA 5J0UA 4DAYA 4QQBX 3ULLA 2CFMA 3M8RA 2GO7A 3GTMB 3STBD 2AQ2B 9ICTA 3FC4A 2OQ0A 4B9TA 1JROA 2K52A 4JI1L 4A3FG 5G5HA 7ICJA 4LF4L 3NGDA 1Z7TA 2JN4A 2ALYB 2ENBA 4JYAQ 1MSGA 4PMBA 2PCFB 3S16B 2PYKA 1RYSA 2J6SA 3K7AH 2BDUA 1K73C 1PH7A 1N32Q 3FKIG 3K1RB 4YMOA 4DR3L 1FFVA 2WB1E 4F91B 2Q2TA 2NO5A 3H0LB 2WAQG 4PPXA 3EZ5A 2NRVA 4RCOA 3AMUA 3CCJA 3STBC 2DPJA 4DL6A 4BDPA 4RH6A 3T3FA 1VQJA 2IX3A 4IZ8A 2A68D 1B3AA 9ICWA 3HOUG 5KFYA 2L11A 1B70B 2EY1A 1ENCA 5IOCA 1I5FA 4IC9A 4DFMA 3R2TA 5J3BA 4F4KA 3I4MH 3GZFA 1QJOA 2KJ8A 3BG3A 5C4XH 3KJPA 4O42A 1WTRA 1NNXA 5EJWA 1WTHA 4RQNA 2PMZC 5DAUA 5J0WA 5KFEA 2KIVA 5DQGA 4IO9A 3KYHC 1PZNA 4YY3Q 2O2LD 3U58A 2PMZF 1U0LA 2DUDA 3F1ZA 2H3IA 4BY7H 2JZBA 5J29A 4RQ5A 1B9NA 2A68C 2B8FA 4OJOA 1NK8A 4JG2A 4RQ0A 4HJAA 1EFID 4OO1H 1ZD5A 2BA1A 3RUZA 5KFSA 3PW5A 3K8AA 4DF7A 3RAQA 1UEBA 2HMXA 2NTSA 2A73B 1JE5A 2VA3A 4A3GH 1A6SA 3G6XA 3JAME 3GTLB 2JGAA 2UVWA 2D5DA 4RT2A 4LF6Q 3K0XA 1M1KC 3HKSA 2W3SA 4UAYA 4R1JA 4N8X1 1UT8A 5DNFA 4Y7NH 3PMFA 2RDGA 4RQ2A 2HVHA 1IHZA 2ASBA 4GLVB 4ED6A 4WJ3B 4NM1A 1DM0B 3HEJA 1X32A 1WTWA 3HOZH 3C21A 2KK0A 2PQAA 5ALMA 1QSLA 7ICMA 5H1SE 1Y8PB 5AKZA 5C3WA 2KHQA 1AEXA 3TADC 1SJED 4FVMA 3GTJH 2R3ZA 3G6VA 1E2WA 1HZAA 5E3FA 2L4NA 4DSEA 4TQUS 3ZDAA 1EU3A 1LT5D 3I90A 3T1YL 4M6WB 5DBCA 5KAIU 4NL9A 1ZQWA 5KNBA 2CH4W 3GTGB 4N9TA 1LO5D 1CHQD 3F5AA 1MQ2A 4CJ1B 4JOIA 1F44A 2JEIA 7ICNA 2HSZA 2M9NA 4C80A 2EYOA 4PMCA 4YWLA 5IWAQ 5AK4A 4A3MH 1Y8NB 3P75A 4R63A 2A5HA 1L3VA 1WFQA 1QE6A 1Z9FA 3QIAA 2EY2A 1JC7A 9ICQA 3A55A 4JVZA 4K5VA 2XIWA 3PV8A 3G7LA 2PW7A 3ZDBA 4M0AA 1HNXL 1EOVA 1Y1VB 4IRDA 4NB3A 4Z6DA 3MR6A 4HMIA 4I2BA 4C3JH 2YQEA 5KG1A 9ICXA 5C3EB 4KHPL 5J0TA 1L5UA 2K89A 1SNCA 4ZAIA 1CA6A 2JEGA 9ICLA 1KDBA 1Q1BA 2DN8A 3EPGA 2K6AA 3T1HQ 5AI0A 2XICA 1LUZA 1CQVA 2NN6G 4NV0A 4RQMA 2EPBA 4Q0FA 1QNUA 2FJ2A 2WAQE 5J2JA 5IYDH 3SEBA 4F71A 1LB2B
chains in the Genus database with same CATH topology
4L5RC 3PIPA 4KLKA 1KL9A 3OTOL 1XMQL 2VZAA 1QVGA 4JV5Q 3W5OA 1LYLA 3J7ZC 1V1QA 4A75A 1PH2A 2UXBQ 4X6AH 3KF6B 1M90C 3UE1A 3G6EA 2B63H 3CCLA 4BBRG 3CCRA 1Q46A 3S15H 2JJQA 5LMUL 1OXSC 2OWOA 4LF5L 4K0KQ 2CWAA 4YWKA 2JK8A 4LFBQ 1CKNA 1GO3E 5LMNW 1OXXK 1E1TA 3A74A 4A76A 4YWMA 3GTGH 1YHBA 2ID0A 4JI2Q 3I55A 1JB7A 4JBMA 1XNQL 5JJLA 4DK3C 4DV0Q 4JI0L 3HOWG 2E5LQ 1XJVA 4OX9L 2VL6A 3U50C 2OQKA 4P72A 4UY8C 4A3LH 1BKBA 1K83H 1CUKA 1IBKL 1VQ9A 4XIGS 1N34L 1NBWA 4OWXB 4JI8Q 1FL0A 4GLXA 3GD7A 4A3IG 1PH5A 1OTCA 2NVXH 1FJGL 4IFDJ 1VQFA 4ALPA 4UPAA 3S17H 1X65A 1Q81C 2IHFA 1Y1VH 4LF7Q 3RNUA 4DUZL 4GNXC 4LF8L 2R7ZG 1WYDA 2UUCQ 5C3EH 3I4NG 2R6GA 4X65L 3PF5A 5IYBH 5M3FH 2IX0A 4IOCA 2ZTDA 1XPRA 1G51A 4A3FH 2JA8G 1PFSA 4DR5L 3HOYH 1HJPA 3I2ZA 1EWIA 4B3MQ 4OWTB 1V43A 3J80i 4DV3Q 1GVPA 2BH2A 1OXUA 2JA7G 2R93H 3VDYA 3FKIH 1YVCA 2UXCL 5IT9c 1CSQA 4GKJL 4NXNQ 5LMNQ 4WJ3M 1I94L 1A0IA 1EIFA 4LW1A 3UDGA 3S24A 2RF4A 1EQRA 2NN6I 2AWOA 3HKZG 2MQHA 4DUYQ 4DV1L 3M9BA 3D0FA 3TEHB 2PI2A 1PVOA 1RIPA 4GOPA 1QZGA 1N36Q 4JYAL 4JC0A 4DV5L 1IBLL 3TS0A 2N49A 3GTPH 2GVAA 2UUAL 1N32L 3GTQH 3HOUH 4LFCL 2Y0SE 3Q8DA 3CAMA 4JBJA 4UP7A 3CC7A 1XPUA 1KRTA 1YHAA 2NVQH 3J7A5 4DV7Q 1NY4A 4R4OA 1WCMG 1EYGA 4X62L 2UU9Q 3BZKA 2VS1A 4BA2I 1XNRQ 1YJ9A 2KBNA 1EIYB 3S1NH 3BZCA 2LXJA 2MO1A 5IYCG 4OONA 3J81j 1MJCA 5C44G 1G291 4DV2L 1VQGA 4UP9A 1VQNA 2A1AA 2PMZE 4DV4L 4KHZA 2VQEL 1YIJA 2BH8A 2ZJQA 4JI3Q 4AQYQ 3OW2A 4DR7L 3RZOH 4H02A 4IFDI 3CCEA 3KOJA 3PUYA 4B3RL 2ZJRA 2VNUD 1SRUA 1Y14B 4NPSA 4DAYB 4A3JH 3KF8B 1X3GA 1HNWQ 4A3EH 3A0JA 4L5TA 4GKKQ 1S40A 1YZ6A 4YY3L 1NJIC 1L0WA 4APVA 2YV5A 2VY3A 5IE8A 5FLXc 1XMOQ 3CMEA 1HNZL 4JBKA 1QZHA 1CKNB 5GQOA 4LFAQ 5M5YH 5IP7G 1YJWA 1CKOA 2WFWA 1U5KA 4DR6Q 4A93G 1LM0A 2VQFQ 4DV6L 1PHJA 4FDBA 1N33L 1I3QH 2F52A 4LUVA 3S1QH 1VQBA 4A3BG 5M5XH 2UUBL 3F2DA 2K5HA 1C7YA 1X55A 4LF6L 3M4QA 4IOAA 3SGIA 5JEAG 2BA0A 4JI1Q 4LF4Q 2HIVA 5GAEC 5ELOA 4GN5A 5AJ3L 5BR8L 1JJCB 1HR0L 3CMAA 4WJ4A 3BJUA 1IL2A 1GD7A 2Q2IA 3EBEA 4DR3Q 1BBUA 1NE3A 4OX9Q 2R92G 2JA9A 2D62A 2HQLA 1VQIA 4GNXA 4BY1H 1AH9A 4HIDA 1K8AC 2IHEA 4DR4L 4LF9Q 3MXNB 2AMCB 2D0PA 3RLNA 5IP9H 2A8VA 4A3DH 1SE8A 4BBSG 1VQMA 2V1CC 3L7ZC 3F2BA 3JAMc 4QGUA 2IX1A 3G4SA 2UXDQ 1K9MC 4JI6Q 1KHIA 4X64Q 1IBML 3W1BA 5IWAL 1L2FA 1VQ6A 4YCUA 4DR2Q 2PI2E 3FP9A 3L0OA 1E22A 1NTGA 2C35B 3H0GG 2K50A 3PO2G 5IYDH 3G48A 2GN5A 1VQ8A 4PZ6A 5EAYA 3A5ZB 1TWAH 3CP0A 4A3KG 2VUMH 2YTYA 2KENA 4JI5L 1J5EQ 1KRSA 4PMWA 3I4MG 4A3CH 5C4XG 1Q7YC 4DK6C 3HOXH 2JA6G 2K14A 1W3SA 2I5LX 4C3IH 3HKZE 1N9WA 3HFZB 4X66Q 4B3SL 1TWGH 1X9NA 1SMXA 2PQAB 3KDFA 2HHHQ 1TWCH 2K5VA 4A4IA 2CWPA 2KHIA 3T1HL 3ICEA 5C0XG 4BY7G 3I7FA 4DR1L 1ASZA 1LTLA 2YTXA 3UDFA 2NVTH 2OTJA 4BBRH 3D31A 4AIMA 4OO1G 5ELNA 4OXPA 3NELA 2JEAI 5JJIA 4NXML 1VQAA 4YHHL 4IJLA 1HNWL 2JE6I 3I56A 2XGTA 3RZDH 1PH8A 1CSPA 3BU2A 3E0EA 1D7QA 2MO0A 2Z0SA 4A3GG 1YBYA 4JV5L 3NBHB 1MIUA 4IJHA 2VW9A 1X54A 5FJ8G 3PUWA 1VQ4A 2UXBL 3HOWH 1W2BA 1VQOA 2RCNA 1BVSA 3IRBA 4R4TA 4HIMA 4J15A 2Q2UA 3ULPA 4HJ8A 5FLMH 1QUQA 3T1YQ 4Y52H 3DM3A 4K0KL 1TWHH 4LFBL 3HOZG 2JA5G 4PZ7A 2CKZB 1VQPA 1PH6A 5E7NA 2MNAA 3CF5A 4A3IH 1H95A 4HJ7A 4JI2L 1KAWA 4R4CA 4UP8A 1X6OA 3L2PA 3HOVH 2ATWA 3B6YA 4DV0L 4MTNA 3GTOH 3PO3H 1S3OA 2E5LL 1UE1A 4L5QA 1Y1WH 2MFIA 1FGUA 3S1MH 1PH9A 1JJ2A 1I6HH 2WB1G 1IXRA 2DGYA 1AE2A 2YTVA 4KI0A 2R7ZH 1OXTA 2R7FA 2KHJA 4RMFA 4JI4Q 2E8GA 1EUJA 3UDIA 4B3TQ 4TVAB 5HY6A 4JI7Q 1A62A 2F4VQ 4JI8L 4DV6Q 3JAMi 1S72A 4JCVE 4MNOA 2JA8H 4DKAC 1HNXQ 3RLFA 2WP8J 5M3MG 4A3MG 4BXXG 4DNIA 2JA7H 3K7UC 1KXLA 1X3EA 2NZOA 4BA1I 4KHPQ 4GNXB 4LF7L 1HZ9A 3PUZA 1B8AA 3CXCA 3KJOA 3I4OA 2GVBA 1HH2P 1A8VA 3ERSX 4LUOA 4HIKA 1PV4A 4B3ML 2A19A 4C3HH 1YITA 3RLOA 2OCEA 1VCIA 2ZM6Q 3CCQA 4DV3L 2LXKA 1YJNA 2AHOB 1CKMA 1YZ7A 3KLWA 1L1OC 1IYJB 1XMQQ 3OTOQ 5LMNL 1VQCA 4GN4B 3PSIA 1PYSB 1C9OA 3AQQA 5GROA 3WWVA 4AH6A 5C0XI 2AKWB 2B29A 1GM5A 1O7IA 5DLQE 4DUYL 1E7ZA 2EIFA 1I50H 1WCMH 1Q12A 1V9PA 2RHQB 5C4JH 4HJ5A 2R7DA 1N36L 5LMUQ 4LF5Q 2NZHA 1IZ6A 1HZCA 5IYCH 5IYDG 1YHQA 5C44H 3CCSA 1A63A 1PH4A 4QL5A 2E2JH 1VQKA 4LWCA 1XNQQ 4YCVA 1P8LA 1MKHA 1FVIA 2H5XA 4JI0Q 3M3YH 5IY0A 1BBWA 1QVCA 1VQEA 2N78A 3KDFB 5JEAJ 4DV7L 2B63G 1P16A 2CCZA 3AFPA 2UU9L 2Z6KC 3GDEA 3CC4A 1XNRL 1X56A 3M4OH 3RR5A 4GN3B 4RG1A 3TRZA 1VQ7A 4POFA 1E24A 4R4QA 1IBKQ 2CQOA 3CCMA 3UE0A 1N34Q 2EQSA 2AWNA 2KCMA 3F8TA 1FJGQ 4QY7A 4POGA 4JI3L 4AQYL 4C2MH 4OWWB 3ER0A 1SN8A 1B7YB 5IP7H 5M5WH 3RN5A 3K81C 1KIXA 2K4KA 3CPWA 3ULJA 4DUZQ 1YEZA 4LF8Q 1C0AA 4A3BH 1Q8KA 2EXDA 2IT1A 2NVYH 4MZ9A 4A3LG 2JEBI 1E1OA 4X65Q 4GKKL 1SR3A 3OYYA 1QUQB 3M85A 2KCTA 4NXMQ 1XMOL 3CPFA 3PV0A 4DR5Q 1UE6A 4IPHA 1TXYA 4LFAL 1E3PA 4GOPB 3H3VI 4DAMA 2ZJPA 2PNHA 1GKHA 1VQDA 3PUXA 2LSSA 4DR6L 1G6PA 2VQFL 1Y1VG 3AFQA 4JOIC 4EX5A 4QQBX 2UXCQ 4GKJQ 3ULLA 2CFMA 1I94Q 3STBD 1EFWA 2L15A 5C3EG 2R92H 1Q1EA 2OQ0A 3M4PA 5IYBG 5M3FG 3A5UA 4AYBG 5GADC 3EIVA 2K52A 4JI1L 4DV1Q 4A3FG 4LF4L 3HOYG 1YNXA 1HZBA 2ALYB 4L5SA 3PCOB 4JYAQ 3JC66 3PGZA 2N8NA 4DV5Q 1IBLQ 3K7AH 2R93G 2UUAQ 1K73C 1PH7A 2ZTEA 3PF4A 3FKIG 1N32Q 3CQZH 4LFCQ 2K75A 4BBSH 4PG3A 4IFDG 2B3GA 3MEFA 4DR3L 3EN2A 2WB1E 1KD1C 5FLMG 1SFOH 2Q2TA 3PIOA 2WAQG 3J81c 1Q82C 1UE5A 5C0XJ 3CCJA 4QIWE 3STBC 3H0GH 4X62Q 2QEXA 1HR0W 4LF9L 3PO2H 3S2HH 2IY5B 1VQJA 4A3KH 2HT1A 1PH1A 1D8LA 3AYHB 2HIXA 3H15A 3HOVG 3HOUG 1B70B 4DV2Q 3PO3G 1WI5A 4DV4Q 1I5FA 2YYZA 5J3BA 1Y1WG 3I4MH 2UXDL 2VQEQ 5C4XH 3KJPA 2I5HA 4X64L 4JI6L 1L1OA 4DR7Q 2JA6H 5JJKA 1PH3A 4DR2L 2I0QA 3CD6A 1XPOA 4B3RQ 4GS3A 2N3SA 3S14H 1JT8A 4IPGA 3M7NA 4IO9A 2Q2HA 3KF6A 3KYHC 1OXVA 2I5MX 3RN2A 4YY3Q 1J5EL 2XTIA 3U58A 1JJGA 1U0LA 2DUDA 3F1ZA 5GAGC 1HNZQ 4BY7H 5HGQA 3CW2C 1VS0A 1XTDA 3I4NH 3AEVA 4JG2A 4HJAA 3FHWA 1K8GA 3GTKH 4P73A 2BA1A 3K8AA 4R4IA 2QGQA 4X66L 4A3JG 1UEBA 2D0OA 1X3FA 1N33Q 4A3EG 1JE5A 1UE7A 3U4ZA 5GAHC 4HJ9A 2HHHL 2UUBQ 4A3GH 1WOCA 2Z6KA 4LNQA 1K0RA 4LF6Q 3K0XA 1M1KC 2F3IA 3GTMH 3HKSA 4P71A 5FJ8H 4IPCA 2ES2A 1RL2A 1SROA 4R1JA 2UUCL 4Y7NH 5AJ3Q 5BR8Q 1R9TH 1HR0Q 1N8RC 2ASBA 4GLVB 4ME3A 4PZ8A 3DLLA 2JA5H 3CC2A 3S16H 3HOZH 1K3RA 3LGJA 2PQAA 4YCWA 1PYBA 1Q86C 5H1SE 1J6QA 2ZTCA 1QVFA 3NENA 4P74A 1UWVA 1MJEA 1VQHA 4XTCS 4NXNL 3GTJH 4DR4Q 1HZAA 3UDXA 4TQUS