3AEVA

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
EYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLAAEKLGKDFEAAWREVWVPLEEEWGEVYAAFEDAAKDGIEVLKGHVPDEWLPVLKEIVENYVEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
molecule keywords Translation initiation factor 2 subunit alpha
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3aevA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aevA01
1KHIA 1HNXQ 2ATWA 5FLMH 4IFDI 2F4VL 1OXVA 5FLXc 3S1QH 1C7YA 2N3SA 2MFIA 4DV0L 3PO3G 4DK3C 4BY1G 4RMFA 3SGIA 3BU2A 3LGJA 3M7NA 2IX0A 1VQIA 1AE2A 4B3TL 3HOWG 1X54A 4DR5L 1VCIA 3HKZG 5H1SE 3CXCA 1K73C 1K8AC 4B3SQ 1X55A 4XIGS 1MJEA 2MO1A 4A3LH 1VQGA 2DGYA 2NVQH 4ALPA 4P75A 5E7NA 3TEHB 3AQQA 4DR2Q 3KJOA 4GNXA 1YEZA 4JI5Q 1D8LA 4A3MG 3AFPA 3CPFA 1XPRA 1VQDA 2NN6I 3CC7A 2Q2IA 1PFSA 4DR6Q 1C0AA 1S3OA 3VDYA 4LFBL 1NE3A 3K80C 5C4XH 2LXJA 2QGQA 3W1GA 2B63G 2Z6KA 3A5UA 4GLAC 4H02A 1L1OC 5M5XH 4A3DH 1H95A 4A3EG 4MZ9A 3H0GG 4DV7Q 2CKZB 3PSIA 4PMWA 5C44G 4JI6L 4LF4Q 4YHHQ 1JE5A 2MQHA 1FJGQ 2YTYA 2XTIA 3KYHC 3KFUA 4KHPQ 3JAMc 5HY6A 4JI4Q 4KHPL 3OTOL 4A3KG 1VQPA 2UXBQ 4IPGA 1QZHA 4JYAL 2BA1A 2R92H 2K4KA 1MJCA 1SMXA 2ZTEA 3RR5A 1U5KA 1VS0A 1Y1WH 2JA8G 5IYCH 1WYDA 4QQBX 4GKJL 2EIFA 4LFAL 3UDFA 2B29A 4BXXH 3L7ZC 4DPGA 3CQZH 5JJLA 3GTLH 2JA5H 3FKIH 3ULLA 2KENA 4A3BH 1PH6A 3CCSA 5IYDH 3G6EA 1NTGA 1L1OB 1E24A 2AWOA 2RCNA 3PCOB 2B3GA 4NXNQ 3GTQH 4C2MH 4YY3Q 5GQOA 3KJPA 3M4PA 4JBWA 4TVAB 4B3RL 5FLMG 3J81c 4A3GG 4IFDJ 2HIVA 3PIPA 3CMEA 1PH4A 4MTNA 1EIFA 4NB3A 2V1CC 2K52A 3B6YA 4LWCA 4BBRH 5IE8A 2YU9H 4L5SA 3PO3H 3E0EA 2KHIA 1B7YB 4HIDA 2MO0A 1K83H 5IP9H 1Q86C 2CCZA 2KCTA 3OTOQ 4R4TA 1ASYA 1G6PA 3STBD 2Q2UA 1TWCH 3KF6A 1HNXL 3F2BA 3AEVA 5LMUQ 4DV7L 2GVBA 4LNQA 1Q12A 2CWPA 3J7ZC 2PNHA 2MNAA 1EFWA 1FL0A 4DV3L 3GTJH 3ZJYC 1PH8A 1Q81C 1YJ9A 2AKWB 3RNUA 4JBKA 3H3VI 4HIMA 1W3SA 2WB1E 1K0RA 1Q1EA 3M4QA 3NELA 2EXDA 3A0JA 1PH3A 1XNQQ 1JMCA 1EIYB 1SRUA 2UXCQ 3CCVA 4OO1I 4B3ML 1YZ7A 2E5LQ 1KRSA 2OWOA 4BY1H 3NBHB 4L5RC 3CP0A 1E22A 1VQAA 4DAMA 2PQAB 1T9HA 3HOYH 1X56A 5C4JH 4P73A 2R93H 1V43A 3Q8DA 4UP9A 2NN6G 4LF9Q 1M90C 3RN5A 1WCMH 5IP7G 4JC0A 5ELOA 2N78A 1UE6A 1Q46A 3CCJA 1IZ6A 1Y14B 2Z0SA 3AYHB 1RL2A 3S17H 5GADC 4C3HH 1QZGA 4OO1G 1YJWA 1VQ5A 2Z6KC 2H5XA 3RLOA 1KQSA 4DK6C 2F52A 4YWMA 4X65L 1XNRQ 3PUWA 3TS2A 3S2HH 3TS0A 3ULPA 1I94L 3S2DH 2PQAA 1EWIA 2R7ZG 5C0XJ 1XMOQ 3NENA 3JC66 3HOZG 2OTJA 1FGUA 4DR2L 3I2ZA 2L15A 4HJAA 2JA7G 4WJ4A 2B63H 2VW9A 4LFCQ 4JI3Q 4XTCS 4LF5L 4A3DG 4DV5Q 1HR0Q 1IBML 3J81i 4EX5A 2AWNA 4BY7G 4A3CH 2NVTH 1U0LA 1CKOA 4LF9L 5JJKA 4R4OA 3UDIA 1UEBA 1B8AA 4NPSA 1KC8C 5GAHC 1GD7A 1NJIC 4Y52H 1X3FA 1KRTA 3KF6B 1WI5A 4X64L 1OXSC 2IY5B 1WOCA 4X6AH 1S72A 1BVSA 1EQRA 2D0PA 1GM5A 3ER0A 1YNXA 4NXNL 1K9MC 1CKNB 3M85A 1K8GA 2UUAQ 1VQNA 1PH5A 3HFZB 4BBSH 1N36L 5C3EH 4YWKA 1IXRA 2WAQG 3W1BA 4IJHA 5LMNQ 4GOPB 1XNQL 1UE7A 3PO2G 1XMQL 2ID0A 1VQOA 1YI2A 2CQOA 2E2IH 2Q2TA 1E1TA 3CC4A 3JAMi 4JBJA 3S24A 4LFAQ 4POGA 1Q82C 2UXDL 3HOXG 4DR6L 3CCMA 2GVAA 4A3GH 1N36Q 4IPHA 1AH9A 1OXTA 2VY3A 5K36G 1Q8KA 3WWVA 1PH1A 1XTDA 1PH2A 2YTXA 3OYYA 4JOIA 3U50C 1PA6A 1CUKA 4GKKL 5DLQE 2R6GA 1YIJA 1FJGL 5IP9G 1RIPA 1N8RC 4A93H 3ERSX 4HIKA 4IOCA 1VQMA 3T1HL 4DR5Q 4P72A 3GDEA 4QL5A 5C0XG 2ZTDA 4P74A 4GOPA 2VQFL 3G48A 1KAWA 1YHQA 1PVOA 1EOVA 3J81j 4JBMA 3H3VH 4C3IH 2GN5A 2A8VA 2FXQA 1J5EL 2OTLA 1YVCA 2D0OA 1J5EQ 2ES2A 3U58A 2VNUD 4JI3L 1N9WA 2C35B 2CWAA 4LFCL 1VQLA 2YTVA 4IJLA 2VS1A 5FJ8H 2Y0SE 2ZJRA 1PV4A 5LMUL 4OX9Q 3HOZH 2VZAA 1XMOL 3PF5A 2IX1A 3FP9A 4KI0A 1OTCA 4LUOA 5ELNA 1N34Q 1I5FA 2UXBL 2JEAI 1SFOH 1PHJA 3I4NH 1NBWA 1P8LA 3HOVH 1X3EA 2Q2HA 2A1AA 2PMZE 1IBLL 4DNIA 2UU9L 1V9PA 2RHQB 4IPCA 3KDFB 3H15A 1HZBA 3NEMA 4LF4L 4LF7L 4AQYL 2RHSB 3AFQA 1YITA 2JA6G 2HQLA 3E9IA 4J15A 1OXUA 4JI2Q 1FVIA 1MIUA 3PUYA 1SN8A 1Y1VH 1S40A 2F4VQ 2PI2A 2RF4A 3F8TA 3CCRA 4DV2L 4NXML 4OWWB 1Z47A 4A3JG 3K0XA 4LF5Q 3BJUA 1HZ9A 1TWHH 4BBSG 2E5LL 5AJ3Q 3PO2H 4YWLA 5AJ3L 1N33Q 2NZOA 3MXNB 4A3MH 4OX9L 2ASBA 3GTPH 4A3FG 3ICEA 2LSSA 2E8GA 5IWAL 4BA1I 2JA7H 4UP7A 2YYZA 4YCVA 1I50H 4R4CA 1V1QA 2IHFA 2HT1A 1LUZA 3CF5A 1QVCA 1UWVA 3D0FA 3KF8B 3S1NH 1QVFA 4PZ6A 5GAEC 4A3CG 4A75A 3KLWA 4LF7Q 4GN5A 4UPAA 1LTLA 4QGUA 4JG2A 4GLVB 4X62L 1IBLQ 2D62A 2I5HA 2UU9Q 3HOWH 4DR3Q 1HR0L 1IBMQ 1VQ7A 1VQJA 1D7QA 3CMAA 1JT8A 3S1MH 3RLNA 1X65A 2KHJA 4B3TQ 1VQBA 1X6OA 2ALYB 4PZ8A 2YV5A 1E1OA 1BBUA 1VQFA 1EQQA 4GS3A 4DAYB 3I56A 2WFWA 3DM3A 5IWAQ 1IL2A 4K0KQ 1HNZL 4PZ7A 4R4QA 4K0KL 1L2FA 3IRBA 3EIVA 4DV3Q 2OQ0A 2HHHQ 3DLLA 5M3FH 2KBNA 4O2DA 5FJ8G 1XJVA 3PUXA 3CCEA 3T1YL 4LF8Q 1EYGA 3T1HQ 2NVYH 4DUZQ 3D31A 4HJ7A 1Q7YC 4A3EH 3I4OA 4B3SL 3UDGA 1I3QH 4FDBA 4WJ3M 3I4NG 4GKJQ 1B70B 4L5QA 5BR8L 3M4OH 1YJNA 1QVGA 1G51A 4JI1Q 4OXPA 1YHBA 2JA6H 4HJ8A 2E2JH 3K8AA 4A93G 3HKSA 4DR7L 3PGZA 2OQKA 3HKZE 4JI0L 4AQYQ 2NZHA 1A62A 4OONA 1EUJA 4QIWE 1Y1WG 1VQEA 1YZ6A 1WFQA 2IT1A 4YHHL 4A3JH 5IYBH 2VUMG 1P16A 1NMFA 1Y1VG 1CKMA 4HJ5A 3A74A 5LMNL 1WJJA 4DKAC 1CSPA 1K3RA 1VQ4A 3EN2A 2K5VA 1AE3A 4A3BG 3T1YQ 4LF8L 4BA2I 2DUDA 3HOUH 3PV0A 2R7DA 4LFBQ 1L0WA 5M3MG 1I6HH 4LF6Q 3CCLA 1VQKA 3BZKA 1XNRL 4DV1Q 3S16H 1IBKQ 1HH2P 3BZCA 2N49A 1XPUA 1CSQA 5C0XI 1J6QA 1TWFH 1LM0A 2K50A 4JOIC 5EAYA 2R93G 1SE8A 2BA0A 1PH9A 1KD1C 1E7ZA 4JI1L 4GKKQ 2K5HA 5IP7H 3I55A 1JJCB 4JI6Q 3RN2A 3U4ZA 1BKBA 1PYSB 2LXKA 3TQYA 4DR1Q 3GO5A 5IY0A 4P71A 4B3MQ 2JEBI 2BH8A 2WB1G 2WP8J 2VQEL 1JB7A 3M9BA 4AH6A 3CC2A 3PIOA 1KIXA 4DR4Q 1SR3A 1TWGH 4DV6L 4DUYL 2PI2E 3E9HA 2K5NA 1HZCA 5M3FG 3M3YH 4KLKA 1Q1BA 2IHEA 3FHWA 3L2PA 1LYLA 4EQ5A 5J3BA 4LW1A 2UUCL 3S15H 4JYAQ 3K81C 1N32Q 4RG1A 1GO3E 1TWAH 2HIXA 4JI4L 4LUZA 3HOYG 4BY7H 2JJQA 4C3JH 4JV5Q 3MEFA 3PUVA 4DV2Q 1HR0W 3CD6A 2JE6I 4X64Q 1WCMG 2NVXH 4IPDA 4JI8Q 2ZTCA 4X66L 1X3GA 4A4IA 1N32L 1OXXK 2I5MX 3CAMA 4QJFA 4HJ9A 4DV4Q 4GOPC 3UE1A 5M5WH 4R4IA 4DV0Q 3F2DA 3ULJA 1VQHA 3F1ZA 3GD7A 2I5LX 5BR8Q 1GKHA 4APVA 4YY3L 5IYBG 4DV6Q 1GVPA 4GLXA 3RZDH 2F3IA 3PUZA 2VUMH 4TQUS 3I4MH 4YCUA 3S14H 1HNWQ 2R7ZH 1VQ8A 4R1JA 3UDXA 4A3IH 3K7AH 2UUCQ 1R9TH 1N33L 4QY7A 3J7A5 1I94Q 3CW2C 3KOJA 4GN4B 2A19A 4DUYQ 2Y0SG 4NXMQ 5C4XG 4X65Q 1UE1A 1HNZQ 3RZOH 3HOXH 2UUBQ 1W2BA 4ME3A 4POFA 2AMCB 4GNXC 1YBYA 4O0AA 5JJIA 1DGSA 3RLFA 5C44H 2I0QA 1VQ6A 4DR7Q 3TREA 4IOAA 1A0IA 1E3PA 1PYBA 4GN3B 4JI7L 3OW2A 4UY8C 4DV1L 4DR3L 2E2HH 3TRZA 2WAQE 4AIMA 4A3LG 4LUVA 1JJ2A 1KXLA 5LMNW 3A5ZB 4DV5L 1L1OA 4LF6L 3W5OA 1HJPA 1N34L 3J80i 2AHOB 4IO9A 2UXCL 2KCMA 5GROA 5C3EG 1HNWL 2UUBL 2QEXA 1YHAA 2ZM6Q 1X9NA 1NY4A 1UE5A 4A76A 3CCQA 3HOUG 2ZJPA 1C9OA 5M3MH 3G4SA 2JA5G 2BH2A 3GTKH 1BBWA 4DR4L 1G291 2K75A 4HIOA 5IYDG 1A8VA 3GTGH 1Z9FA 2EQSA 1HZAA 2VQEQ 2VQFQ 1SLJA 3G71A 4GNXB 4AYBG 4X66Q 2UUAL 4JI8L 4UP8A 3UE0A 1MKHA 1CKNA 4Y7NH 4DR1L 3HOVG 2VL6A 1A63A 3H0GH 4MNOA 5M5YH 4BBRG 4OWTB 1XPOA 2XGTA 4L5TA 2JA9A 4A3KH 4AYBE 1O7IA 4X62Q 4DV4L 4JI7Q 3PF4A 4IFDG 3U4VA 4JI2L 1M1KC 4OWXB 4JCVE 3L0OA 3K7UC 2JK8A 5IT9c 1VQ9A 4DUZL 1PH7A 2ZJQA 4JI0Q 2JQOA 3GTOH 3I7FA 3J80c 1NMGA 1QUQA 2QA4A 4YCWA 3CCUA 2R92G 5IYCG 2R7FA 1SROA 2K14A 3KDFA 5GAGC 3CPWA 4JV5L 2UXDQ 4B3RQ 1IBKL 3I4MG 2JA8H 4BXXG 1TXYA 2ZM6L 3F2CA 3GTMH 5JEAJ 1KL9A 4JI5L 3FKIG 4KHZA 2N8NA 1QUQB 5HGQA 1XMQQ 1ASZA 1JJGA 2OCEA 4A3FH 5JEAG 1IYJB 3STBC 2CFMA 4A3IG 4PG3A 3S1RH 2HHHL 3EBEA 1VQCA
chains in the Genus database with same CATH superfamily
4ACOA 1D5ZC 2O2LD 1A3UA 1KRPA 5D14A 1HNXQ 5FLMH 1KSPA 1ML0D 4Q44A 2EY5A 1C7YA 2N3SA 4O3NA 4DV0L 4ZOHC 4Z6CA 3HRDD 2ZIWA 4DSEA 3RRHA 1LACA 4GC7A 3UXNA 3LGJA 3TBIB 1X66A 4TRDA 4RQ3A 3NTUA 3CKIB 4RQ6A 2KKVA 1WTXA 4FF3A 2LKYA 1ZQZA 3QNMA 2IBKA 1VCIA 3HKZG 5C5LA 1PTOB 3CXCA 2K89A 1X55A 4HSVA 4DAYA 4B3SQ 4P0QB 2CHBD 3E3XA 3BQ1A 3BDCA 2M0NA 2YY6A 2AQ4A 1QG7A 2JZBB 1XTCD 3AQQA 2JEFA 2GO7A 1S97A 3FPUB 1RG6A 3D4RA 3PY8A 3CPFA 1XPRA 4YMNA 2NO4A 2J0TD 1S3OA 1K28A 1WTRA 2KCCA 3S1NB 1ZQPA 2BCVA 5DDYA 2LXJA 5J0TA 8ICUA 2WKCA 3IFTA 2YB1A 4GLAC 3AU2A 2IHMA 1L1OC 5M5XH 3A5UA 8ICZA 4NW2A 2IOFK 3GU3A 3H0GG 4DV7Q 4YP3A 2C2RA 5CORA 7ICSA 4NY8A 3A8KE 2MHVA 1S76D 5HY6A 4CHTB 3OTOL 4A3KG 3PIP3 5ALLA 1KFTA 2BA1A 2R92H 2K4KA 2G06A 1MJCA 5EWFA 1SMXA 4C3IB 3GFKB 3KHHA 4Q8EA 3TQ1A 9ICMA 4YG2A 4M2YA 3SEIA 1X42A 1QOHA 1U5KA 1SL2A 4XQNA 4Y2UA 2F0NA 1ICWA 2L5YA 2EIFA 3PX4A 3RH5A 5TZVA 1FIQA 2UVUA 3HOZB 4DPGA 3TDQA 5M3FB 4JW0A 4RQ4A 5J2HA 1T94A 1B0XA 3FKIH 3QIAA 3GTLH 2B2VA 2EQYA 1X9SA 3CCSA 4DL5A 3LYSA 2XCAA 2E76C 1L1OB 4KLOA 2B3GA 4C2MH 1X6JA 4FZNA 5GQOA 4YY3Q 4JBWA 4A3GG 4DAPA 4IFDJ 4F50A 1PH4A 3ZD8A 1EIFA 4NB3A 4L5SA 1FFVA 4Q43A 2B2WA 4YXJA 3B9JA 4QCLA 4I27A 5A35A 1PUZA 2AUJD 1S9FA 4X3KA 3T56B 1T3QA 1F9QA 5IILA 2XVTA 3NVWA 2DBYA 3STBD 2BE5C 3JPNA 2KTQA 1EU4A 1XXGA 5DB6A 3KF6A 3WK7A 3SI8A 2EOTA 4B08A 1H9MA 1HUOA 1NKBA 2H3VA 5KFPA 3GILA 1A0PA 4YR0A 5B5EU 1EFWA 4YR2A 4DV3L 3IRUA 4A3BB 3GTJH 2W9CA 2B8FA 4J6HA 4HIMA 4OIKA 4IQWA 1Q1EA 3CHBD 1SYCA 3NELA 3S1QB 2F0TA 1T4GA 4DXGA 2OWOA 4DAMA 2KJXA 1KFSA 1X56A 5C4JH 1V43A 4UP9A 4PMCA 1M90C 1WCMH 1AP0A 4OCZA 4JB3A 4QWDA 1WTPA 3HW8A 4KLGA 2N78A 8ICLA 1TWCB 3OIPA 4L8JA 3ZYYX 5KT5A 5HMLA 1EYDA 2W43A 1WTHA 2EY2A 1UNSA 2IL8A 1VQ5A 2WV6D 1XNRQ 2NYVA 3EROA 2BHNA 3PUWA 3TS2A 3TS0A 1I94L 1TS3A 2SEBD 2PQAA 3Q8RB 2ZIUA 3S2DH 1CI4A 2JYOA 1XMOQ 2W7PA 3NENA 1ZQVA 3H8WA 1Z19A 3JC66 1Z4OA 3J81E 3HOZG 3GP7A 3GTMB 4RQ0A 5KG1A 3HOUB 1I3QB 1KNAA 1NUCA 2L15A 3BS7A 1BPXA 4C80A 2XN9C 2G5IB 3DHQA 4LFCQ 4O3OA 4XTCS 8ICGA 2Q4TA 1B2TA 3J7AF 1IBML 3ZDEA 4EX5A 4BY7G 1FD7D 3NQTA 4A3CH 4R4OA 1ZYRD 1UHUA 3UDIA 1IYUA 1X40A 3KLSX 3NQIA 1MI2A 4Z6DA 1GD7A 4Y52H 4B9VA 2B2TA 2MPMA 1WI5A 4X64L 3HZXA 4RWSC 5KFGA 1ZXTA 1SE2A 5I2XA 3QU7A 4DL6A 3QEAZ 3BVZA 4QZIA 4HCSA 3EVQA 3GV8B 3JAME 4BWGB 1K8GA 1XYIA 4RUAA 2RDJA 3GV6A 5J2DA 2UUAQ 1SL0A 1IXRA 5LMNQ 3PO2G 1EZ6A 4JWMA 9ICAA 3ITPA 2Q2TA 1NKEA 4JBJA 4DK0A 3KK7A 4LFAQ 4POGA 1HRJA 1ZQMA 1C4QA 1RYUA 3HOXG 4WORA 4RQNA 3CCMA 3PW5A 3CNHA 1BGXT 2YTUA 1N36Q 5ALFA 4L63B 2AQ1B 3KKAC 3IN5A 4WJWA 5K36G 1PH1A 2QKQA 5AFWA 4XT1B 4EQNA 2K28A 2K4PA 3U50C 1K83B 4V0BA 1CUKA 2JA6B 4GKKL 1EY7A 5DLQE 3QUTA 3R8BA 4R64A 4DK1A 5FLXL 4IOCA 1HA6A 2NO5A 2FI1A 2ZXPA 3BYTB 4EYIB 4UASA 5C0XG 5ALXA 3MDCA 4Y2RA 2ZTDA 1PVOA 1LTGD 1B22A 4RPXA 5L1LA 1VDVA 1B44D 4RPZA 4PHAA 1J5EQ 2VNUD 4TUSA 1ESFA 5FO9B 1NK4A 2ZXIA 4IJLA 5KFSA 4JK1A 5BN3A 2ZJRA 1PV4A 5LMUL 4OX9Q 1F2ZA 2VZAA 2FPLA 3AU7A 4KI0A 1CA5A 3MBYA 4J1MA 1N34Q 5ELNA 1G8ZD 1OTCA 1XSNA 1PK1B 3D4WA 3Q23A 3I4NH 1NBWA 4DFJA 1SMYD 9ICPA 1V9PA 4M47A 3H15A 4QZFA 1EY0A 4LF4L 4YCXA 4KY5A 5CV8A 2JA6G 4DWIA 3MVVA 4BBRB 3E9IA 3DWAA 3HOVB 5C3EB 1KEJA 2F3VA 1G6ZA 1MIUA 1O7YA 3NWTA 3T4AC 2F4VQ 1ZQDA 1UCVA 2RF4A 3F8TA 2GH1A 4Q8FA 5EE1A 4F7XA 2KN7A 1SWWA 2E5LL 1NK5A 3PO2H 4RGOS 5F9LA 2D2CC 4PJ0U 2A6EC 5ALQA 2K5DA 2E8MA 2NZOA 3NE5B 4OX9L 4UHVA 3D6WA 2N55A 4EZ6A 3OHBA 3H0MB 3ICEA 3UM9A 5J1ZA 1KTQA 2GOLA 2E8GA 4F92B 3DEOA 3EWAA 4CF3A 3RAQA 1I50H 5J0XA 1PYWD 2F0IA 2H1EA 5M9OA 4KLQA 5KG6A 2TSSA 2HT1A 1SNCA 1QVCA 2KG5A 2F1MA 3KF8B 3QU9A 5JU5A 1A15A 4O3MA 3BQ2A 5E79U 3C29A 1U48A 3OJSA 5DB9A 1IBLQ 3A7AB 4C4SA 2G5HB 3DXJC 3ISBA 1HR0L 2KA7A 4IZ8A 3TAQA 4TQSA 1NI3A 2Y1JA 4TUQA 3QWNA 2AUKA 5B66U 2FPKA 3KF8A 2YV5A 1N2XA 1E1OA 1VQFA 2MJ8A 5ALKA 4O9MA 2SDFA 3M7DA 1GUWA 3BG3A 7ICHA 4FBUA 4R4QA 2HW3A 1BO0A 4K0KL 1DD2A 1LTAD 4U7CA 4E0DA 5DG7A 3DLLA 2ODGA 1M4VA 4B9UA 5M3FH 5FJ8G 3PMLA 1PVPA 3I72A 4KKSA 1JOOA 3CCEA 5C4HA 4LF8Q 4DSKA 2NVYH 2XIWA 4HJ7A 3K0YA 5KFIA 4A3EH 3AMZA 9ICNA 5HGTA 3PSTA 4IQUA 8ICTA 4QWEA 3QXGA 4NLCA 1SV4A 2J6TA 1I3QH 2VB3X 4FDBA 4QIWB 2B63B 3GV7B 1YJNA 4Y2XA 2SOBA 2ISOA 4HJ8A 3DV9A 1D8YA 3K8AA 5KFUA 2OQKA 4KTQA 2E74C 4JI0L 5ALGA 4OJPA 3RJFA 4AQYQ 5C0XH 2NZHA 3DEPA 4Z9CB 4C7YA 4A3MB 3OSPA 4PGQA 2IT1A 1W6KA 4YHHL 1ZQJA 4DQQA 5IYBH 1LTBD 1P16A 1NMFA 1CHQD 3IG8A 1ZQGA 2DY8A 5KFLA 2K4EA 1JICA 4R8UA 4F87A 4NV0A 5KFKA 1V8QA 2BDPA 3A7LA 3PV0A 3SK6A 2KFZA 2E5SA 5DM73 1VQKA 1RPLA 1XNRL 3MA2B 3PSFA 4DV1Q 1IBKQ 2V4DA 4DLGA 3RMHA 4WRDA 4QZGA 1XPUA 3LX0A 1CSQA 5C0XI 1J6QA 3P1HA 1TWFH 4EENA 1GUGA 4K8IA 1U9LA 1X9WA 1PH9A 4KITB 1XNSA 1E7ZA 4JI1L 1DOQA 4NLZA 2K5HA 3K1RB 3ZD9A 2F1IA 2G9DA 4O3RA 5ALUA 1PK1A 1CTMA 1NJWA 3RN2A 1BKBA 1PZNA 2LXKA 2PZTA 4K14A 4DOCA 2JEBI 2RDFA 2WB1G 2HVHA 5ALRA 5KFTA 5D46A 2DKZA 1TY2A 2M2LA 5KFZA 3Q8LA 4I2AA 2F76X 2B2UC 3NXWA 4DUYL 5KFWA 2XSCA 1ZRNA 2XCPA 4FS2A 2IHEA 3FHWA 2UVRA 3MC0B 4YD1A 3OMCA 4KLMA 2JEGA 5J3BA 3L2PA 2MU2A 3I8ZA 4CDEC 4KLUA 1QE6A 4RG1A 2Y0SB 5J39A 1GO3E 1TWAH 1TKDA 2JJQA 3KLSA 2W9BA 1M6YA 4JV5Q 2PW5A 3QJYA 4HAEA 1QWYA 4IFDH 2ASDA 2QARA 4H13C 3QU4A 4RH6A 1OW5A 4IPDA 2ZTCA 3H8JA 4NL9C 5J2AA 3WDNA 1L5UA 4N8FA 2W7OA 2M00A 4LAAA 1F2LA 4A4IA 1UUPA 4R8UB 2KD1A 4BY7B 2R8JA 5JPNC 3VCBA 4DV4Q 4GOPC 5M5WH 4CDCC 1VQHA 5BR8Q 5ALIA 3H8SA 4YY3L 1JR0D 4GLXA 1YNJD 3MAQA 2A69D 1A3VA 3RZOB 2H4OA 1XC9A 5C3XA 2R7ZH 3DEEA 1VQ8A 1KDHA 5IOCA 1BCPF 1JXEA 1Q3VA 1N33L 3N6RA 3J7A5 5KEEA 1Z00B 2B2VC 2AQ3B 4X65Q 1HUNA 1URJA 1RD9D 1S5CD 1W2BA 2K04A 3M9OB 3LWEA 2KVMA 2Y0SC 2PW7A 4I2FA 5K36H 4GNXC 1L0XB 1YBYA 2CVRA 2I0QA 1VQ6A 5KG2A 2JXJA 4RNMA 2MP1A 1LTTD 3ICXA 3BQ0A 1E3PA 3HS0C 1WWVA 5ALMA 2HHWA 3OW2A 9ICTA 4DR3L 3J7YW 1B53A 2WAQE 1SNDA 4IUUA 3TRZA 2JV3A 2HDMA 5LMNW 1ZQXA 3AU6A 1MQ2A 4UBCA 5HMMA 4IS7A 4CDGA 2AHOB 3AUOA 1FNUA 1SYDA 3FVQA 1K0SA 5GROA 5IIMA 5K4LA 1X9NA 1LABA 4KLIA 1NY4A 1UE5A 2QLTA 2AGQA 1GHJA 3G4SA 3TARA 2F4IA 3PX6A 4QZ8A 4M6WB 1KKXA 5JVG3 4PMBA 2PPBC 3OIQA 5AM1A 2ISPA 4BY1B 1Z9FA 3SAGA 1HZAA 2XWBB 4FZLA 4O3SA 1BR9A 2YN4A 3D6CA 2VQFQ 1V97A 5L1IA 1EY4A 4MTKA 4UP8A 3UE0A 2ASLA 1JOQA 2LHTA 2A6HC 5J2BA 2VL6A 3T16A 3H0GH 5M5YH 4UAZA 4BBRG 9ICIA 2PMZB 4L5TA 4DV4L 2IOHA 4X5VA 2W03A 2CQAA 3WK4A 2HBJA 2L12A 4IUQA 4F91B 2GA4B 5E4WC 2KJ8A 3U4VA 3RZDB 3K7UC 1PFMA 1VQ9A 2JHDA 1PH7A 1EEFD 4C7ZA 1BNZA 2R92G 4DA2A 3CCUA 3ZDCA 3HKZC 1SROA 2BCOA 3MZ5A 1SEBD 4QUCA 3BS1A 3N28A 1J9OA 4JV5L 5J22A 1JIHA 2UXDQ 5DBCA 8ICSA 4BXXG 3BJYA 1QJOA 3Q22A 2DPJA 3IHQB 3GTOB 1EWCA 3MDAA 5HGQA 3Q8PB 1GJXA 4O5KA 3OSNA 1MSHA 4XYQA 4DLEA 1IW7C 2HHHL 4PG3A 9ICSA 3EBEA 1KHIA 2CW0D 1WYGA 4IFDI 2F4VL 3H91A 5IT9E 2A73B 2X6LA 1CQVA 3V72A 1SE3A 3S1QH 3BDPA 4QWBA 3PO3G 4DK3C 3R3OA 4RMFA 1F5SA 4A3KB 1ZJMA 2EYLA 1KDBA 1LKYA 4XUSA 3H4BA 1VQIA 5KL8B 1ZQQA 1X54A 2WF9A 1WTWA 3FM9A 1LV9A 4K6DA 3BDOA 2NYZD 2MO1A 3MABA 4FVMA 3Q8KA 4XIGS 1D9FA 1MJEA 1IV8A 2R8HA 2NVQH 3WK6A 2HDLA 4P75A 4F2SA 1Q90A 1TV9A 1F44A 3M7GA 4J9RA 3KJOA 4GNXA 2O4XA 1Y1WB 2QB0B 4DOBA 1DOMA 1PXUA 3P20A 2BCRA 4CF4A 1VQDA 2FHTA 2NN6I 2HHVA 1A2TA 3F5AA 4DR6Q 1L7MA 2R8KA 1PDQA 3BS5A 5KG0A 4RAUC 3H40A 1L3UA 2FMMA 3K80C 3S16B 5CV7A 3WK5A 3H4DA 2B63G 2YB4A 3RUZA 5DBBA 4H02A 1H95A 3ETRA 2WAQC 5EE9A 2ALZA 2CKZB 3R93A 2ESEA 1JMSA 3H0LB 2D5DA 2NN6H 2FE9A 2K8CB 2PCFB 1A77A 3HGBA 4YHHQ 2YTYA 5KNIA 2MGSA 3KFUA 1TY0A 1L7PA 3JAMc 4LZGA 4KHPL 1Z7TA 2F0UA 2UXBQ 1UPHA 1ET6A 8ICHA 1Q3LA 3MXNA 3E5SA 1IM4A 2LPEA 3W2DA 4S3SA 1SNOA 4H0LC 4F4YA 1VS0A 3H09A 2KCNA 1WYDA 4LFAL 2LYAA 2UVWA 4OJ6A 2KV2A 2RSNA 3MXPA 4K5VA 3UDFA 2B29A 2WB1C 4HTHA 3OTQA 2B2UA 3CRLC 3CQZH 1UA0A 4K8JA 2Q8IB 2FMSA 4F4WA 1MSGA 4A3BH 2XNAC 2I46A 2AWOA 5CEHA 3PCOB 3SXHA 2KZZA 4DSIA 2EY1A 4RQ8A 4DF8A 2M9VA 3KJPA 4RZRA 4DL3A 3FAHA 4DFMA 3J81c 1FFUA 4KLLA 9ICQA 2V1CC 4LWCA 4IUNA 4BBRH 5IE8A 1U4BA 2X6GA 5J0OA 3THVA 2KOLA 1B7YB 5I6YA 5ALEA 4NM1A 2PZWA 3HOWB 2R93B 3SMVA 4FXKC 4NKLA 5IP9H 1Q86C 3LWUA 2CCZA 3M9MB 4KK7A 7ICQA 2IJ0A 4RQMA 2DUYA 4RHSA 1SE4A 5IIJA 3AEVA 4I29A 2G09A 3QUBA 3WOFA 4QIWF 3J7ZC 2PI4A 4YMMA 3SR6A 2IPKD 1R9TB 3ONAB 3UXPA 8ICXA 5J2FA 4I2BA 1PH8A 3H3VI 2AKWB 3RNUA 1S0NA 4NDXA 1K0RA 4IC9A 2JR5A 1STBA 3CCVA 2NV3A 2TMPA 4B3ML 1YZ7A 2E5LQ 1KRSA 4G7HC 1LTRD 3NBHB 4QZHA 2K03A 3PSPA 1PZID 2OH2A 2MSNA 3HOYH 1IW7D 5CV5A 4LF9Q 1WG8A 2K4HA 2Y9UA 4QZDA 4LMQD 3RN5A 1S5FD 5AIAA 5ELOA 7ICTA 2EYJA 4ELTA 2OXPA 3CCJA 1CRXA 2Z0SA 1ZQWA 5CRXA 9ICLA 1VDZA 1RL2A 3S17H 3RJIA 1QZGA 4PQXA 1YJWA 2Z6KC 1LV5A 1KDCA 4BDPA 1XSPA 4PGYA 2IMWP 5K5PA 4X65L 3GTQB 1COOA 3PQIA 2B2WC 3BDLA 3ULPA 1JX4A 2BPCA 3GZFA 4J9LA 4J9KA 1IHZA 1EWIA 2R7ZG 4M9JA 1I4XA 2DJGC 4CDDC 4F88A 2OTJA 1TR5A 4DR2L 2F44A 2LBOA 4QB4A 2G5DA 1N61A 2VW9A 4LF5L 1HR0Q 4KLSA 3JPSA 3J81i 3JAML 1CKOA 4XDXA 3HOXB 4EELA 3WKEA 1STYA 4FYDA 1GXDC 4NPSA 5GAHC 1PLFA 3QUCA 1Q8IA 1X3FA 4DFPA 4PGXA 2PXIA 1NZBA 1OXSC 3K5NA 3NPPA 1S72A 1BVSA 1N60A 1NCVA 5FO7B 2F0KA 1GM5A 5J2IA 2KNJA 1CKNB 3M85A 3QU2A 1N36L 5AKXA 4YWKA 4GOPB 2AJQA 3W1BA 3JPPA 3KOOA 1XMQL 1VQOA 1YI2A 3GIJA 3TKAA 3WU2U 1V1PB 3JAMi 2EYMA 2N1RA 1NJXA 3Q24A 1Q82C 4GXJA 4BBSB 5JUMA 5J0QA 4A3GH 1HFGA 2VY3A 3RB6A 2JMGA 2HHQA 2QILA 3K6OA 1EZ8A 1SFOB 8ICQA 9ICFA 4CE6A 1JWSD 4USAA 1FR3A 2YTXA 3OYYA 1PH2A 3RJGA 1E2ZA 1X32A 3BS5B 4I2CA 2EDGA 4A93H 1N8RC 4I2JA 2BQRA 3T1HL 4RQ7A 1F9SA 4DR5Q 2UVVA 3GDEA 4P72A 3RBEA 2KKPA 4P74A 8ICEA 4IUTA 1LTID 4US9A 1YHQA 3J81j 3UI2A 4OJOA 5JTIA 2R92B 1U4MA 2GN5A 3SK5A 4QZBA 2FXQA 2X69A 1J5EL 3PV8A 5AI9A 5CV6A 2OTLA 3SZ2A 3GTJB 3I4LA 1VMCA 2CWAA 2RP5A 5ALZA 4I2HA 4LFCL 3J80L 5BPCA 1BOSA 2VS1A 3MC1A 1PTOF 1LKYB 4TQRA 5HR6A 1DXMA 1XMOL 2IX1A 1EEID 3KTQA 3FP9A 2RLTA 3PVXA 2EJFC 3ONNA 2JEAI 2EYPA 1PHJA 3MTSA 5I2YA 1TAUA 1P8LA 4FF2A 2F0FA 2UU9L 4QZ9A 1GUNA 2OF1A 4IPCA 5KFYA 3KDFB 3IV6A 2D3DA 1HZBA 2P5ZX 3NEMA 2RHSB 3AFQA 3FPPA 4AQYL 4LF7L 1AZQA 1KDAA 1IIPA 3JPTA 4HCEA 3WKAA 2EJMA 1Z3EB 3C2MA 1B43A 4NXML 1QSSA 1Z47A 3L3FX 3K0XA 1K5OA 4DN4M 3TFRA 4A3JG 4UB6U 1LB2B 4IRKA 5F9NA 5AJ3Q 5AJ3L 5FO8B 2EXZA 3MXNB 1KW4A 2ASBA 4A3FG 2KHQA 2ASJA 4BXOA 5KL1B 1FNWA 4BA1I 5KAIU 4YCVA 1B4FA 1JROA 2JRZA 3FC4A 2QW7A 4R4CA 1C8CA 1LUZA 4CCHA 5AM4A 1NK0A 2BCSA 1Q3UA 3Q8QB 2PMZF 3E2EA 1L6NA 3D0FA 1TFRA 1ZRMA 5GAEC 4A3CG 3KLWA 4LF7Q 4GN5A 4ZUIA 4UPAA 4QGUA 4K4GA 1QQ7A 3WKDA 4GLVB 3T53B 4X62L 2I5HA 5JRTA 2UU9Q 3HOWH 2NRXA 3FYHA 4RT2A 1TS2A 1IBMQ 2OM6A 2WF6A 1MBYA 2I6XA 2W55A 1JT8A 3S1MH 3RLNA 3PO4A 1X65A 4NLKA 2NWGA 4C56C 1TU2B 3C3LA 1X6OA 1K3BC 2DQNB 5M5WB 5EPJA 1SYGA 1EQQA 5AIBA 5A2QE 2RHFA 3RJEA 4GS3A 4C3IG 2NBFA 2WFWA 3DM3A 4PZ7A 2DN8A 1ZQFA 3IRBA 4QW8A 3ISCA 2K32A 2OQ0A 2F0OA 1EYCA 4O2DA 2KQ3A 9ICCA 4HMJA 5AI5A 4I7AA 2O6KA 1KLUD 3G6JB 4NMZA 4TURA 3H0GB 3T1HQ 1Q7YC 4C4TA 4JV2A 4ELUA 4JVZA 1U4RA 1B70B 1ECWA 1RDPD 1G51A 1QVGA 4YFKA 4OXPA 1NKCA 2E2JH 1ZQCA 1EU3A 1RQNA 3HKZE 4LK1C 3D6JA 2ATLA 1A62A 4H7BA 4C3JB 1ESRA 4DL2A 1XSLA 4C3HB 3IFDA 1Y1WG 1VQEA 1YZ6A 1LVHA 4A3JH 3B0XA 3L3OC 3UQ2A 1SKRA 2NVQB 4I2GA 5IGCA 4IRCA 1ZQKA 4HJ5A 3M3YH 1WJJA 2F0SA 5HHIA 3MFYA 2A1JB 5KFEA 4F3OA 1CSPA 1RYRA 1QB5D 2PQEA 2K5VA 3FRPB 1AE3A 3VA7A 4PL1A 1DM0B 2SNMA 4LF8L 4BA2I 2FMPA 1NAPA 2R7DA 1IYVA 4DS4A 3CCLA 5ALSA 1COKA 9ICKA 4UB1A 2QDLA 3S16H 1XU4A 5A0LA 3I28A 2V4RA 4DNTB 5HURA 3PO3B 5COYA 3BZCA 1ZJNA 3C2PA 4CNQA 2VANA 1PZJD 3K5LA 3UMGA 4QZEA 5EKKA 3A0HU 2EE1A 5FK9C 3SAHA 5EAYA 4ZUJA 3M8SA 2BA0A 3OHAA 1KD1C 3RB0A 2A6ED 4GKKQ 5E3FA 1QNKA 1X2IA 2MRLA 2RQ5A 5AM0A 2RSOA 4MF2A 3VYRA 2W9MA 1JJCB 3SQIA 4B9NA 4JI6Q 3U4ZA 5DQHA 2E8PA 1PYSB 2EDUA 2KMDA 4DOAA 2EZXA 4P71A 5CV4A 2JEIA 3VYTA 1C20A 1H38A 2BH8A 2WP8J 1VLBA 1TE2A 3RAXA 4N9PA 9ICVA 5EQ0A 4AH6A 5DQIA 3CC2A 3LVWA 4Y2TA 1ED1A 3PIOA 5TISU 4CDFC 2EANA 3OSOA 2NRWA 1Z4NA 1EY9A 2G08A 3K7AB 4ECTA 5JEAH 2C22A 4OEMB 1L7NA 3SDZA 1LYLA 4F5PA 9ICBA 4UB4A 1J97A 3PO5A 1Z1VA 4EQ5A 4IQZA 5KT4A 4AYBB 5AM2A 5J0RA 2HIXA 3ORYA 5IGDA 4LUZA 1AW7A 4JMUA 2PO4A 3LNNA 3MEFA 4BY7H 4UATA 1B1ZA 1HR0W 2O5IC 5DLGA 2JE6I 4X64Q 5ALHA 1Z00A 4NL9A 2NVXH 1GHKA 2PZUA 1N63A 1JB3A 4E6IA 2HCIA 2GWSA 4HJ9A 5KG5A 1I4QA 8ICFA 3V96A 3F2DA 2JGAA 4F71A 2I5LX 1P7DA 3RZDH 4P0PA 1GVPA 3EFXD 3PUZA 1U9RA 4TQUS 5CV9A 4YCUA 4DEZA 2B2YA 5G3LD 3T3FA 1DK2A 1S5BD 3UDXA 1L0YB 5CHGA 2ZT9C 3K7AH 2UUCQ 3L4PA 3JPOA 2EYOA 4JK1C 1I94Q 2VIXA 3CW2C 2BPGA 1SZPA 3T5HA 1RJTA 2A19A 4ECWA 1GUOA 4GN4B 2Y0SG 3MR6A 3PW4A 4A3EB 1UE1A 2CH4A 3HOXH 3VR3A 4KLJA 4ME3A 7ICRA 1WD1A 2DF4B 5DQGA 2XC9A 1EIGA 4ZH4A 1DGSA 3RLFA 5C44H 4IOAA 3RFAA 1A0IA 2ZG6A 5ELFA 2KZMA 1PYBA 3BZDB 4JI7L 2OEHA 2DL0A 5LL6S 5KFJA 1O7LA 4ICAA 4ECSA 7ICIA 4Q5VA 5IIKA 4ABNA 2YX8A 1L1OA 3W5OA 3SEBA 1AFPA 4B9MA 3IKJA 5IT9L 4IO9A 1C48A 4J9OA 1F9PA 5C3EG 1HNWL 4K5XA 3HWTA 1XX8A 8ICYA 5JAVA 4A3IB 5AHXA 2ZJPA 1C9OA 4ID6A 4KX5A 5DEHA 4DSJA 2I07B 2R3ZA 5KFXA 5IYDG 5M5YB 3GIMA 2EZVA 5CJ7A 3UXOA 2P35A 2C2EA 2EQSA 4K6LA 2K8AA 3HOYB 4CJ0B 3D8GA 1SLJA 4MHVA 3G71A 4GNXB 4ECXA 4X66Q 2KSOB 1U45A 1F77A 2WF8A 3ERQA 1WUDA 1CKNA 1MKHA 2E2DC 3HRZC 4JI8L 4Y7NH 4UB2A 4MNOA 5EPKA 4OWTB 2XGQA 2FLLA 2XGTA 4A3KH 4AYBE 4JI7Q 3WK8A 4YXMA 2EAMA 2HOQA 1M1KC 3M4OB 4OWXB 5IT9c 3I1YA 3SV4A 1I4GA 2W8KA 2JQOA 3GTOH 3I7FA 4EYHB 3LWMA 4M8AA 2HMXA 5JOBA 1QH9A 4B9SA 2R7FA 5J0SA 1FYCA 2ICIA 1SL1A 1IBKL 4I2IA 4EX6A 2FMQA 2OT2A 2ZM6L 1LT6D 2BZFA 1Y8PB 2EY6A 5IGBA 2YMMA 4NJ8A 1SNQA 3FKIG 4KHZA 2BCUA 3H94A 1J2MA 2ES6A 4A3FH 2JZBA 9ICEA 3STBC 5ALYA 2LKVA 1NK8A 4LJXA 3OPOA 4FS1A 3HP6A 4PL2A 4RHRA 2L9HA 5T1IA 2H3ZA 1SYBA 4ZYSA 4XXEA 1OXVA 2KIVA 5FLXc 4TSSA 1X3QA 4I2EA 2KECA 3I3CA 3BU2A 1JXLA 4CRXA 3SV3A 3M7NA 2IX0A 1BPEA 1AE2A 2JP1A 1PVRA 4B3TL 5G5GA 3QOJA 4DR5L 3OOCA 1O78A 2W8LA 2YU9B 4PHEA 3HG9A 4A3LH 1VQGA 4RCOA 3H3VC 3KHGA 5BOLA 2NB0A 5E7NA 2VUMB 1BNPA 2KVSA 4UW9A 4O5EA 4IUPA 1YEZA 1D8LA 1S10A 4A3MG 3HX0A 3L9AX 4ZLTF 3AB9A 1UT5A 3CC7A 2Q2IA 1PFSA 2NZ1D 1ZQLA 3C23A 1ILQA 4BWMA 2WAQB 5G5HA 1C0AA 3M6ZA 4FXGC 4Y2PA 2EJGC 5CC4A 4OJ5A 2BGWA 1CEZA 3K5OA 4C1NK 3U26A 2Z6KA 4DF4A 1EQTA 1N56A 3Q0AA 1M8AA 4Y2QA 4A3EG 4YD2A 3NVYA 5CR0A 2PFQA 4PMWA 4JI6L 3RB3A 2MQHA 3S1MB 3KYHC 3PW0A 1O7ZA 4KHPQ 3M9NB 2Q8RE 2VA8A 4QWAA 4IR9A 4IPGA 1T7PA 4ELVA 1TKWB 5IIFA 2DPIA 2F8LA 2HBKA 5C4JB 4ED6A 2PFOA 1JQYD 4Q0FA 1IKLA 2EAOA 1Y1WH 4UAYA 2NUCA 5IYCH 1RZTA 1ZETA 8ICKA 4RNOA 3T51B 2A3VA 4GKJL 4QQBX 3PIO3 5J0WA 1RYSA 4M04A 5F3XB 4IL6U 3RR7A 3L7ZC 4KX3A 5JJLA 3ZDBA 4P4PA 1UAPA 4XQQA 3TMEA 3K75D 5J2JA 2KENA 2CN1A 2G07A 4EX7A 4F4ZA 9ICUA 2CW0C 1T3NA 1GUSA 3I4MB 3V7JA 1H9KA 1NTGA 3G6EA 4J8QA 4NXNQ 5AKGA 4B3RL 2W04A 2WTFA 4DAVA 3G6XA 1D5XC 2R61A 3B6YA 2K52A 5ALDA 3K1ZA 4OO1J 2YU9H 3E0EA 1Y8NB 2D8CA 1QSYA 4Y2SA 1A3TA 2RQXA 4QZCA 3UMBA 3FDTA 1ILPA 3TACB 2MO0A 1FEZA 1K83H 1AZPA 4PZOA 4LJZC 3Q8MA 3OTOQ 5I4DA 2WB1B 1JN3A 3I76A 4EEKA 1XWEA 3TZUA 1TWCH 4DL7A 4PV1C 3PW2A 3S17B 2JH7A 3TFSA 2K6AA 5LMUQ 1A76A 3G6VA 2GVBA 4DV7L 1B4OA 1Q12A 2CWPA 1WCLA 4AP9A 3RD4A 3GTLB 2H3QA 3MXUA 5DG8A 4MIUA 1DYQA 7ICFA 1X9XA 2ZXHA 3C1ZA 5AK4A 1V85A 1IG6A 1W3SA 4J9PA 2WB1E 3M4QA 2KP7A 2EXDA 1TT2A 1PH3A 1XNQQ 5E1FA 1EIYB 1QILA 1SRUA 5IGFA 4OO1I 2UXCQ 4QJFB 3OMGA 3H7IA 1V38A 5J2GA 3MEHA 4L5RC 2BQUA 5AKJA 1E22A 5EGTA 3GTGB 8ICCA 1T9HA 1X9MA 4P73A 2R93H 1JC7A 1MGSA 5J2CA 1RCVD 4K5WA 4UARA 3DDHA 5IP7G 4JC0A 5J2KA 1UE6A 3M4YA 1Y14B 2CH4W 4XRHA 3AYHB 3V2TA 2QEJC 1S5DD 5KGUA 2F03A 5EE3A 3D3RA 3MR3A 2H5XA 1KQSA 5D4BA 1KBUA 2KE7A 2F52A 4YWMA 3QG1A 4EQPA 2QKIC 4NP5A 2P6RA 2AU0A 4FBTA 4UAUA 5ELBA 1BPZA 4HN7A 3H8MA 4UAWA 5C0XJ 1BBXC 1FGUA 2LY7A 2F0DA 4HJAA 2JA7G 3RR8A 3BYYB 2FJ2A 3R2TA 1I4HA 2B63H 4Y2YA 2L0CA 5M5XB 4JI3Q 4BS9A 3HP3A 2NTTA 3CRKC 3QUQA 1NJYA 1TS5A 2AWNA 1KAAA 1PFBA 1U0LA 4KJNA 4LF9L 5JJKA 1ENFA 3OPXA 1ONLA 1WCMB 1ZQ1C 5EPLA 2B2TC 1KC8C 4JUZA 1B3QA 1WWUA 3RF9A 7ICEA 3TP7A 2IY5B 5C44B 4NLNA 1L8OA 1PZKD 3A8IE 4X6AH 7ICVA 1EQRA 4MFAA 3A56A 1QCKA 1PRTD 4J03A 1K9MC 1PTOH 3MXGA 3O13A 4L6TB 4O3PA 5AK6A 5DB7A 2HOIA 5KT6A 4EZ9A 3HKZB 5LL6X 1PH5A 1VQNA 5C3EH 4ED7A 3KZIU 2WAQG 2VB2X 1XNQL 1UE7A 4F5NA 1SYFA 5ALTA 1E1TA 2Z4IA 2OHFA 2DNCA 3S24A 2PMZC 4DR6L 2GVAA 1XO1A 1K8OA 4IPHA 2E1FA 1W6JA 1GO3F 1TAQA 2DNEA 4QUFA 3WWVA 1TWAB 7ICKA 2H3FA 1XTDA 2LS01 2MA1A 8ICVA 1CK1A 3E0JA 5IODA 1PA6A 2HHTA 4N9TA 1FJGL 1STGA 3M1YA 1RIPA 1BNOA 5IP9G 5EBCA 1ZD4A 3ERSX 4HIKA 1JRPA 1F2MA 4QL5A 1DCZA 2PYKA 2WAQF 4DCCA 1KAWA 1EOVA 1KLGD 3LDAA 3PMNA 4JBMA 3D2QA 2L1BA 2PFNA 3H3VH 4UQGA 1HEKA 3C28A 5M3MB 3PR4A 2WKDA 1N62A 1YVCA 2D0OA 2JSOA 2B6GA 1N9WA 3NVZA 2C35B 3OWEB 2FLNA 5KT2A 1MA7A 2YTVA 3SHLA 1VQLA 4B9LA 4C8OA 2M9NA 2KUMA 5FJ8H 5DAUA 2N88A 5J0YA 3PF5A 4A3GB 5ALNA 1SV0A 3MR2A 1NK7A 4LUOA 1I5FA 5CBAE 1T8EA 1RDFA 4ULLA 2UXBL 4J9NA 3NUCA 1IBLL 1ZQSA 4DNIA 4DSLA 3D2NA 1JUDA 3JPRA 4FZMA 4ZQ3A 5KNCA 1ZXIA 2HQLA 2K60A 4J15A 3K5MA 1OXUA 2JEJA 4CKBA 3EUB2 1T5EA 4JI2Q 5T14A 2VJ5A 4ZRZA 1FVIA 3PUYA 5IGGA 1UQVA 1SN8A 1S40A 2PI2A 1BCPB 2ZIXB 4OWWB 2F1HA 3CRXA 3NSWA 4NM2A 5EKLA 2KSOA 4LF5Q 4GIBA 1TWHH 4YR3A 3MGIA 2WIIB 2XIDA 3NASA 4PZNA 1SKWA 5KFHA 3VYSA 2LI6A 2Q0ZX 5DKWA 1D5MC 4A3MH 3GTPH 2JA5B 4B9WA 5AK3A 2LSSA 2LM4A 5IWAL 3H0RB 5AM3A 4UP7A 1AQ6A 1TWHB 4IRDA 3MFGA 2K7VA 2F8KA 1UEAB 3V6KA 3CF5A 4ZKCB 2KZ3A 3V6JA 1Z1BA 2Z4HA 5ELCA 4PZ6A 5HHHA 3DM1A 3KFUF 1ZQTA 3S1NH 4RFBA 4ED1A 1I6HB 4C3JG 1LTLA 2HBMA 2LYHA 4K4HA 4ZK9B 1L8LA 3VC8A 3LWLA 3TP8A 4DR3Q 1VQ7A 1D7QA 2YMPA 1BQQT 3CMAA 1MQ3A 1ZD5A 4B3TQ 2WF5A 3NP8A 1ZD3A 2W9AA 1S0VA 7ICLA 2HCCA 5ELDA 4FXDA 3CU7A 3SVMA 4G7OC 1DZ1A 1BCPC 3KKAA 3SK4A 5KG3A 2WF7A 4KN4A 3HPOA 4DAYB 2QARB 1JE4A 3Q6SA 1IL2A 3IAYA 4K0KQ 2R7ZB 8ICIA 3PW7A 5BN5A 1VF7A 2KBNA 3PUXA 1ZEQX 4ED0A 4M9HA 3I4OA 4IALA 4DNRB 5FOBB 3UDGA 4B3SL 3I4NG 1LTSD 3M4OH 4L5QA 5BR8L 4BWJA 4F93B 2PKEA 4DSFA 1AN8A 5D3IB 3N7SC 4A93G 4DR7L 3PGZA 5D3DA 9ICWA 5KFAA 1D8BA 1DOLA 2PFPA 1FO4A 3SE0A 4MN3A 1SV0C 1SXDA 4Y2VA 3NBIA 2K1BA 3TN2A 3E0FA 1WFQA 2IW3A 4KMOB 4ECYA 4I7ZC 1Y1VG 1QNUA 2ZXOA 1L3SA 3VYUA 2FDRA 4BXOB 5LHY1 5LMNL 1VMPA 4DKAC 1AEXA 1K3RA 1DJRD 3NK9A 1TS4A 1DGJA 1EY5A 1HHVA 4HMIA 3T1YQ 3HOUH 4LFBQ 2F0GA 1L0WA 3ALRA 1I6HH 1RQLA 2ZUBA 2P66A 2QF7A 3EJIA 3P7JA 4DU9A 5DGBA 3BZKA 1JALA 3JPQA 1HH2P 1CT1D 3R9KA 1TK0A 3MWYW 1QSLA 4EEYA 2BDUA 3N97B 4M6WA 2K50A 1DXSA 2ZJAA 4EGVA 2PI5A 1U49A 1L3VA 3TP6A 8ICPA 5IP7H 3C5GA 2EPBA 2QDBA 3A8JE 3I55A 5GTHU 1S77D 3KUPA 3X3NA 2KJ5A 4DO9A 2DGZA 3TQYA 3K59A 4DR1Q 1EIHA 3GO5A 4DQSA 5CYUA 4Z6FA 3T5KA 2VQEL 1SXTA 5EWGA 3PMFA 3ND9A 3M9BA 2C2DA 9ICJA 3GTPB 2RKSA 1SSOA 5T1GA 4I28A 1LT4D 5GTIU 1KIXA 4DR4Q 3SK8A 5ALVA 1TWGH 3GIKA 3C2KA 1F9RA 5EKIA 1Q1BA 2ZIVB 5KYIA 4MF8A 8ICRA 2UUCL 2FINB 3S15H 4LW1A 3QOLA 2IOFA 1G2TA 4JYAQ 1CI3M 1NR4A 3SD7A 4RT3A 3K4GA 1Y8OB 4JI4L 1ZYQA 2JH1A 1NK9A 4C3JH 3RTVA 4DV2Q 1S5LU 3D4DA 2KHSA 5AKYA 2RDIA 4ECZA 1K1QA 1HTPA 1SDFA 4JI8Q 4A93B 4X66L 2WB1F 5L37A 1OXXK 4F2RA 2BDOA 3CAMA 3T5JA 5IINA 3UE1A 4IQVA 1QQ5A 4A8EA 4R4IA 4ZCKA 1QCBD 2BQ3A 1I4RA 5L1MA 3ULJA 3GD7A 2XWJB 4DQIA 3FMCA 2WINB 2VUMH 3O0FA 1V1PA 3TI0A 2F3IA 3VA5A 1MD2D 4XQJA 5KFBA 1SYEA 1RODA 1ZQAA 1MN8A 5KT7A 2VXWA 3M3YB 1HNWQ 4R1JA 2RDHA 2E8OA 4DGZA 4G4KA 2XY5A 3MGVA 3PO2B 1JOKA 1BF4A 2W11A 4NLBA 1CHPD 4NXMQ 5C4XG 1BPYA 9ICXA 2A6HD 4MFCA 2B39A 2KFNA 7ICJA 2Y9TA 3DWQA 4X3UA 5KRUA 2UUBQ 4RPYA 2F0PA 1JWUD 3GV5B 2AMCB 4C0ZA 2HVIA 4O0AA 4R9WA 3LK9A 3P75A 4BX9C 1BXTA 1R4QB 4G57A 4DR7Q 3TREA 1RTNA 8ICNA 1RHPA 3KBXA 4ECUA 1ENCA 5ELEA 2BPFA 1EXNA 5C4ZA 4ED2A 4DV1L 4FF4A 1TK8A 4LUVA 1KXLA 4DF7A 2P6UA 3A5ZB 5J2EA 7ICGA 1SAPA 4DFDA 4EBDA 3J80i 2KCMA 8ICWA 4Y2JA 3UMCA 1KN5A 5J0PA 3N7RC 2IHNA 2QEXA 2E75C 2UUBL 4P0QA 1B50A 1STHA 3K58A 1JWMD 4JI2L 2XRQD 4CGZA 3KBBA 5J8YC 3FKIB 2JA5G 1BBWA 3NGDA 1G291 2K75A 4KV6A 4HIOA 5EWEA 3GTGH 2E8NA 2F2AB 3FDSA 1TQOA 4KKUA 1SJED 3C1EA 4QMGA 2V4QA 2AQ2B 3L5KA 3E58A 4FO2A 4KN7A 3TADA 5DBAA 1II3A 3V05A 4IFDG 1O7IA 5ISRA 3IG5A 1XO0A 2L55A 5C6AA 1WVLA 4JCVE 3L0OA 2JK8A 2K33A 2Q8TA 4Y7NB 5CBEE 2KICA 4DL4A 1NMGA 1QUQA 4C8LA 4YCWA 1SGGA 5IYCG 5GAGC 1GUTA 2K14A 3DWPA 5J0UA 4PNYA 2BR0A 2OEOA 1NOMA 2I1QA 2YQEA 4Z6EA 1CZGA 1OO9B 3S1RB 3I4MG 2G0AA 3BVMA 3URYA 4KN4C 4F4KA 1STEA 2JA8H 4HAIA 1KLNA 2F0LA 3AQEA 1TWGB 1KL9A 4KMUA 3T13A 4EVOA 2N8NA 2KK0A 5AKEA 4H44C 1XMQQ 1ASZA 3ETLA 1JJGA 3RRGA 5KFMA 4QF4A 4UB8U 5CP2A 1T5XD 5JEAG 3V7KA 4A3IG 2CFMA 4GZYC 3M8RA 5AI8A 3GQBA 1VQCA 4OGQC 2JA8B 1ZKOA 5KFOA 3EPIA 2ATWA 4YMOA 5C3WA 2RA4A 3RJKA 2KOBA 2MFIA 4BY1G 2AH5A 3SGIA 2L4NA 3HILA 2E2JB 3GQCA 3K57A 3MGHA 3SYZA 3PF4A 2EZYA 3V7LA 9ICHA 1H9RA 3E6ZX 8ICOA 1S5ED 3NHHA 3HOWG 4JV1A 4U68A 5H1SE 1K73C 3KHRA 2FLPA 3KLRA 1SKSA 2DGYA 2RRDA 4KKTA 4CJ1B 4ALPA 1ZQUA 3TEHB 2XY7A 1HPCA 3EQLC 4OL7A 4DR2Q 1WTOA 3ZI4A 3IL8A 4JI5Q 5H2FU 4BGDA 1STAA 3AFPA 5KFRA 2F0VA 3BVGA 3EA6A 3I73A 1LO5D 1S4ZA 3S2DB 4QIWC 2OXOA 3NTKA 3WKBA 4P4OA 2F0HA 2MUTA 3VDYA 4AYBC 4IN3A 5ALPA 1OUQA 4LFBL 4BUGA 1NE3A 5C4XH 1ENAA 2KIWA 2HHXA 1RKNA 4F5RA 2QGQA 3W1GA 2F3NA 2HSZA 2XGPA 3HT3A 9ICOA 4RKLA 1ZYRC 4A3DH 2NRZA 2ZUDA 4MZ9A 3PSIA 2QB1A 1NSNS 5C44G 4LF4Q 1R4PB 1JE5A 1SXEA 1FJGQ 4KD4A 4ECRA 2XTIA 3CYMA 1NZPA 5HNKA 5CA7A 4KLDA 3A55A 4IUVA 4JI4Q 3VR2A 3MFIA 2KEYA 1VQPA 5DNFA 2W3SA 2NTSA 1QZHA 4ECQA 1AROP 3QZ7A 4JYAL 4UDUC 3S9WA 1B9MA 3PR5B 2ZTEA 3ND8A 5EBDA 5KFQA 3AMUA 4MFFA 1PTOC 4FFDA 3RR5A 2J4XA 2C28A 4YIJA 2JA8G 3MFHA 3AQFA 3HKZF 1NJZA 1D2BA 1PFNA 4BXXH 2B2YC 3TANA 2EZZA 2JA5H 3GTKB 1WCNA 3ULLA 3EZ5A 4PH5A 1PH6A 5IYDH 2J7ZA 4F4XA 1E24A 2RCNA 5L1JA 4M9NA 3B0YA 2Z9HA 1I4PA 3GTQH 1NNLA 4J9SA 3M4PA 4TVAB 1UA1A 3I70A 1U47A 4M0AA 5BOMA 4MHEA 2HIVA 2LMCB 5FLMG 4R8IA 3PIPA 1HQRD 3IDWA 4MTNA 3CMEA 3N7PD 8ICJA 4KLTA 3PO3H 4O3QA 2HHSA 1DOKA 5G3LF 1YNJC 2KHIA 4HIDA 5KFFA 3KBGA 4RGTA 2C9OA 5JJZA 3RJHA 4KJOA 1YNND 2EH9A 3QEBZ 2KCTA 8ICBA 2ZJ5A 4R4TA 2EVBA 1ASYA 4F5OA 4DFKA 4OELB 4QNLA 4OIJA 1G6PA 3GDXA 2Q2UA 3J7AV 5CR3A 5IIIA 5AI0A 4KLHA 2IWHA 1HNXL 5I9OA 3F2BA 2L11A 4LNQA 1D9DA 2AGOA 3NS1A 4J9MA 1XWLA 4RGMA 2PNHA 3F2UA 3FEWX 4KLFA 2MNAA 5I9PA 4AYBF 1FL0A 3V6HA 1VJ5A 3ZJYC 1Q81C 2C5CA 1YJ9A 4JBKA 1YT3A 3PNCA 3F5EA 3AM9A 5KG7A 3A0JA 3H6MA 1JMCA 1EFID 3PX0A 2QB0A 2VA2A 2DY7A 1TVXA 4B9XA 3N52A 4BY1H 3CP0A 4IURA 1VQAA 5KFVA 2PQAB 4XQ8A 2BOSA 3IM1A 3Q8DA 2NN6G 2CXYA 4ZKBB 4DFAA 4DQPA 4CBVA 4J9QA 1Q46A 5AKKA 1IZ6A 4C8KA 2G9HD 2KEEA 4V190 1ZOLA 1HFNA 4RQ2A 2RBMA 5IIOA 5GADC 1ZQNA 4C3HH 4OO1G 5KFNA 3RLOA 4RUCA 5F2DA 4DK6C 4R8NA 3NUQA 3BQTA 3AL0B 3C46A 9ICRA 2K5QA 1BUVT 1QLNA 3S2HH 4ME5A 4UAVA 4P4MA 4GXIA 2IA6A 5J8YA 3MR5A 2LYBA 2HUGA 4OJLA 2NVTB 1PRTC 4JPBW 3I2ZA 1WTQA 3M6KA 4WJ4A 4B9TA 1ZQRA 3R2IA 1I50B 4A3DB 1NK6A 4A3DG 1ZQEA 3D2SA 4DV5Q 4WJ3B 3SAFA 2MUTB 5DG9A 1S0MA 7ICNA 4KTAA 4FP5D 2NVTH 2O5JC 3AN1A 4KN7C 2AGPA 1MSWD 1UEBA 1B8AA 1BCPD 1O08A 2PNRC 3DMUA 4WFN3 1NJIC 1EYAA 5C0YA 2NRVA 1JI7A 1KRTA 2ENBA 3KF6B 2ZIUB 2XI9A 1HQMC 5KNBA 1WOCA 1S0OA 2EYFA 3QYPA 2D0PA 2FFKB 3OWFA 3ER0A 1YNXA 4EBEA 4NXNL 2E2HB 1G2SA 3RH6A 4DQRA 2NRTA 3HFZB 3RB4A 4BBSH 4KMUC 1JORA 4ODGA 4IJHA 2Z7JA 2B8GA 3QX7A 4A3FB 2ID0A 5CGKA 2CRXA 4GXKA 2CQOA 4K2LA 2E2IH 3CC4A 1HA5A 2WACA 4UBBA 2E1EA 2J6UA 2XO7A 2WHEA 1A2UA 4RU9A 1NR2A 2UXDL 3F53A 3OW7A 2VA3A 3S15B 1AH9A 1OXTA 1HCZA 3KD3A 1Q8KA 1S8OA 4P2CB 2E2IB 4F8MA 1ZQIA 4N8X1 5KIXA 3RBDA 5L1KA 2JA7B 4JOIA 2R6GA 2R8IA 1ET9A 1YIJA 4G7ZC 1VQMA 4O1NA 1QTMA 4EQOA 3S2HB 4XYOA 4LZDA 9ICGA 4OO1H 2AQ0A 2A74C 4U673 1J2NA 4UAIA 5AICA 4GOPA 2VQFL 3G48A 1RM6C 4PHDA 3OHXC 8ICAA 3TSSA 3QE9Y 4HEDA 4C3IH 1MC8A 2HCFA 1D1IA 5IGEA 2A8VA 5NUCA 2ES2A 4G3IA 5CMDA 3U58A 4JI3L 1PVQA 4US8A 1I6VC 4QW9A 5FLXE 3RH4A 2Y0SE 3U9OA 5AK5A 3HOZH 2GLEA 5L9XA 4QWCA 1E2VA 5AI4A 3NWSA 4C1NI 3UQ0A 1B9NA 1O03A 2Z6BA 1SFOH 4FF1A 1N5WA 3HOVH 1X3EA 2Q2HA 2A1AA 3BQ7A 2PMZE 1HUZA 2RHQB 2H3IA 4TKOB 2XICA 4HR7B 1PRTB 1YITA 1SZHA 1CFMA 7ICPA 1L7OA 3NRZA 3EYZA 2F0MA 3VR4A 5D49A 5AKHA 3PZPA 2ZXRA 5JVH3 3GV3A 2D9UA 4CJ2C 1Y1VH 1ZQYA 4UB3A 5EE0A 3CCRA 1CM9A 5DLFA 4DV2L 4BBSG 2HD3A 3W3AA 2JXMB 3BJUA 1HZ9A 2F77X 4NXZA 4C4RA 4ED8A 2F1JA 4G9BA 4JWNA 2HDOA 4YWLA 3CQZB 3I91A 4JV0A 1N33Q 1E2WA 4R66A 2WFAA 4XT3B 3TZDA 5JPMC 2ZIXA 3N4MB 2RVLA 3C1FA 3SENA 4PHPA 2JA7H 4C8NA 1A6XA 2YYZA 3VR5A 1K8MA 5KT3A 1V1QA 2IHFA 4CGYB 1BPDA 1UWVA 4O0IA 5C4XB 1KTKA 1DK3A 2K8BB 1QVFA 4A75A 2Y1IA 4UB5A 4GFJA 2A68C 4JG2A 4F8RA 2D62A 3EPGA 1N5XA 2FMCA 5C5JA 2NVXB 1VQJA 1UT8A 1X6IA 3J81L 5KTQA 5D65A 1HXYD 4KHVA 2AXTU 2KHJA 4K4IA 1WTVA 1VQBA 1SMYC 1STNA 1KABA 1Y88A 2ALYB 4PZ8A 1J8IA 3WOEA 1BBUA 3TP5A 3LVVA 3NVVA 1DONA 3I56A 1Z6HA 1K8AC 5IWAQ 1HNZL 5CWRA 1L2FA 1H9SA 3S14B 3EIVA 5TSSA 4DV3Q 1JCKB 2HHHQ 2R8GA 2LM1A 3C5FA 1XJVA 2RCFA 3T1YL 1F0MA 1EYGA 4DUZQ 3D31A 2DWQA 4I65A 5ALJA 5DDMA 4DS5A 4WJ3M 4GKJQ 1E0BA 1EY8A 4C2MB 1L3TA 4JI1Q 1YHBA 4MEYA 2JA6H 4IR1A 4KLEA 5ALOA 3TADC 3HKSA 2K5WA 2VJ4A 3OGUA 2LFNA 2W54A 1Y69U 1KNEA 2D6FC 4OHJA 4OONA 4F5QA 2B0CA 2F0QA 3CP8A 2LMRA 1EUJA 4QIWE 2KHVA 4CF5A 7ICUA 4HSPA 4RNNA 2FJ6A 1IL8A 5KG4A 4RQ5A 2W9BB 4FO6A 2EYHA 3ED5A 2F0JA 2VUMG 1CKMA 2W9CB 1X3PA 3A74A 5EOZA 5J29A 1O80A 5ALWA 4U6PA 3KHLA 1TK5A 1BDOA 4X3TA 1FNVA 1VQ4A 1SWVA 3EN2A 3GIIA 4A3BG 4ED3A 2DUDA 1SJHD 4EBCA 5M3MG 1ZD2P 4LF6Q 2YMQA 2I9GA 3QB3A 1EL0A 1YNNC 1FGBD 5FKAC 5KFCA 2K01A 1U4LA 4R63A 5CB1A 2N49A 1PTOD 2JN4A 1CA6A 3ZDAA 2KVCA 1LM0A 1XS9D 2FPMA 2Y0SF 4JOIC 2ZIVA 4M9LA 4ECVA 5AKZA 1SE8A 1SNPA 4X3SA 2R93G 3G7LA 5EJWA 2DFLA 4DXFA 1Y1VB 2XY6A 2DKXA 1CZWA 1TIID 5IY0A 4B3MQ 2ZJ8A 4TUPA 3QZ8A 2XRSD 4C3HG 1JB7A 4P2HA 2F3WA 1SR3A 5C5MA 4DV6L 3A54A 5HP4A 4Q45A 2PI2E 3E9HA 2K5NA 1HZCA 5M3FG 4O5CA 2Z8LA 2QCPX 5AI6A 2MAXA 4KLKA 3SR1A 2OYYA 4R65A 1DRGA 3MHBA 1EQVA 1KFDA 2A1JA 3K81C 1N32Q 3S6JA 4OD0A 2KJ9A 3HOYG 2R18A 1H9SB 3PUVA 5I6WA 5DM63 3CD6A 2YMLA 2CPRA 4FE3A 1WCMG 5DGAA 3J80E 2HI0A 1X3GA 1N32L 2V9WA 2IX3A 2I5MX 4QJFA 2J6SA 3NTHA 1LT5D 1G91A 8ICMA 1F2YA 4YN4A 1HTLD 5BN4A 2W3RA 4PPXA 4DV0Q 1SIJA 4NLGA 2XVSA 1ZQBA 2A69C 3F1ZA 5KFDA 1H9JA 1GKHA 2F0EA 4APVA 5IYBG 4MEXA 2HQEA 4DV6Q 1SB3C 3X3MA 7ICMA 3I4MH 4I2DA 1RTOA 3S14H 2Z1CA 4A3IH 1EOTA 4QZAA 1R9TH 1K1SA 2ZIWB 3C2LA 4QY7A 3KOJA 3OJUA 1TWFB 2NVYB 1RXWA 3A0BU 4DUYQ 1HNZQ 3KZXA 2RDGA 3RZOH 4M9GA 4KY6A 1PRTF 1PMRA 4K2KA 2BE5D 4RA8A 4POFA 2UUAL 2KEDA 2B21A 5JJIA 1MHWC 1SNMA 1EY6A 1ZQHA 4C8MA 2A5HA 5A2QL 3UPQA 3QU5A 4GN3B 4YQWA 1D1KA 4P0PB 1ZQOA 5HR7A 4UY8C 5AKLA 2E2HH 4A3LG 1HUMA 4AIMA 2EAPA 4A3JB 1U4PA 2L5TA 1JJ2A 1VF5C 4DV5L 3NTIA 1CQFA 4LF6L 4GC6A 3Q8SB 1HJPA 2VKQA 4F72A 5DB8A 3NBHA 3U9SA 5KYLA 1N34L 2F0WA 3QO2A 2UXCL 3I90A 1SBBB 1TAMA 3WKCA 1RXVA 4LVSA 1YHAA 2ZM6Q 1ICFB 4A76A 3CCQA 3HOUG 2ZUCA 3IP4B 2A68D 1WD0A 3HJEA 1LLRD 4RKBA 2DJFC 4M1UB 2K4IA 5M3MH 1D6EC 3HEJA 5E4XA 2BH2A 5KNDA 3GTKH 4DR4L 4YVZA 1OXJA 3DUZA 5AKIA 2HOFA 1N48A 1A8VA 3QR8A 1IKMA 5FP0A 2BKEA 2VQEQ 4CKEA 4AYBG 2HHUA 1BPBA 4ZAIA 3ZDDA 3C1YA 4DR1L 4O42A 2BDNA 4RGNA 4CKCA 4RCNA 3HOVG 1A63A 1XPOA 3C21A 4FNFA 1LT3D 2JA9A 4BJQA 4X62Q 3TAPA 1GOZA 3WK9A 3EW9A 5KAFU 2HBLA 2BCQA 4DUZL 2ZJQA 4JI0Q 3T79A 1A6SA 3J80c 2K05A 1NNXA 2QA4A 2ICEC 4KY7A 1TVAA 1V1OA 2E3TA 4B6JA 3KDFA 1B3AA 5AM5A 1EWHA 2SNSA 4KD3A 3T5LA 4XA5A 3VR6A 1QQ6A 3CPWA 4B3RQ 1TXYA 3G6YA 1RF2D 3F2CA 4IQTA 5JEAJ 3GTMH 4RQ1A 1KQQA 2MUYA 3NRWA 7ICOA 3RJJA 1QUQB 4JI5L 1PK3A 3ISDA 2OCEA 4ILWA 4NWIA 1HIWA 1IYJB 3S1RH 3I4NB 4HYKA
chains in the Genus database with same CATH topology
1KHIA 1HNXQ 2ATWA 5FLMH 4IFDI 2F4VL 1OXVA 5FLXc 3S1QH 1C7YA 2N3SA 2MFIA 4DV0L 3PO3G 4DK3C 4BY1G 4RMFA 3SGIA 3BU2A 3LGJA 3M7NA 2IX0A 1VQIA 1AE2A 4B3TL 3HOWG 1X54A 4DR5L 1VCIA 3HKZG 5H1SE 3CXCA 1K73C 1K8AC 4B3SQ 1X55A 4XIGS 1MJEA 2MO1A 4A3LH 1VQGA 2DGYA 2NVQH 4ALPA 4P75A 5E7NA 3TEHB 3AQQA 4DR2Q 3KJOA 4GNXA 1YEZA 4JI5Q 1D8LA 4A3MG 3AFPA 3CPFA 1XPRA 1VQDA 2NN6I 3CC7A 2Q2IA 1PFSA 4DR6Q 1C0AA 1S3OA 3VDYA 4LFBL 1NE3A 3K80C 5C4XH 2LXJA 2QGQA 3W1GA 2B63G 2Z6KA 3A5UA 4GLAC 4H02A 1L1OC 5M5XH 4A3DH 1H95A 4A3EG 4MZ9A 3H0GG 4DV7Q 2CKZB 3PSIA 4PMWA 5C44G 4JI6L 4LF4Q 4YHHQ 1JE5A 2MQHA 1FJGQ 2YTYA 2XTIA 3KYHC 3KFUA 4KHPQ 3JAMc 5HY6A 4JI4Q 4KHPL 3OTOL 4A3KG 1VQPA 2UXBQ 4IPGA 1QZHA 4JYAL 2BA1A 2R92H 2K4KA 1MJCA 1SMXA 2ZTEA 3RR5A 1U5KA 1VS0A 1Y1WH 2JA8G 5IYCH 1WYDA 4QQBX 4GKJL 2EIFA 4LFAL 3UDFA 2B29A 4BXXH 3L7ZC 4DPGA 3CQZH 5JJLA 3GTLH 2JA5H 3FKIH 3ULLA 2KENA 4A3BH 1PH6A 3CCSA 5IYDH 3G6EA 1NTGA 1L1OB 1E24A 2AWOA 2RCNA 3PCOB 2B3GA 4NXNQ 3GTQH 4C2MH 4YY3Q 5GQOA 3KJPA 3M4PA 4JBWA 4TVAB 4B3RL 5FLMG 3J81c 4A3GG 4IFDJ 2HIVA 3PIPA 3CMEA 1PH4A 4MTNA 1EIFA 4NB3A 2V1CC 2K52A 3B6YA 4LWCA 4BBRH 5IE8A 2YU9H 4L5SA 3PO3H 3E0EA 2KHIA 1B7YB 4HIDA 2MO0A 1K83H 5IP9H 1Q86C 2CCZA 2KCTA 3OTOQ 4R4TA 1ASYA 1G6PA 3STBD 2Q2UA 1TWCH 3KF6A 1HNXL 3F2BA 3AEVA 5LMUQ 4DV7L 2GVBA 4LNQA 1Q12A 2CWPA 3J7ZC 2PNHA 2MNAA 1EFWA 1FL0A 4DV3L 3GTJH 3ZJYC 1PH8A 1Q81C 1YJ9A 2AKWB 3RNUA 4JBKA 3H3VI 4HIMA 1W3SA 2WB1E 1K0RA 1Q1EA 3M4QA 3NELA 2EXDA 3A0JA 1PH3A 1XNQQ 1JMCA 1EIYB 1SRUA 2UXCQ 3CCVA 4OO1I 4B3ML 1YZ7A 2E5LQ 1KRSA 2OWOA 4BY1H 3NBHB 4L5RC 3CP0A 1E22A 1VQAA 4DAMA 2PQAB 1T9HA 3HOYH 1X56A 5C4JH 4P73A 2R93H 1V43A 3Q8DA 4UP9A 2NN6G 4LF9Q 1M90C 3RN5A 1WCMH 5IP7G 4JC0A 5ELOA 2N78A 1UE6A 1Q46A 3CCJA 1IZ6A 1Y14B 2Z0SA 3AYHB 1RL2A 3S17H 5GADC 4C3HH 1QZGA 4OO1G 1YJWA 1VQ5A 2Z6KC 2H5XA 3RLOA 1KQSA 4DK6C 2F52A 4YWMA 4X65L 1XNRQ 3PUWA 3TS2A 3S2HH 3TS0A 3ULPA 1I94L 3S2DH 2PQAA 1EWIA 2R7ZG 5C0XJ 1XMOQ 3NENA 3JC66 3HOZG 2OTJA 1FGUA 4DR2L 3I2ZA 2L15A 4HJAA 2JA7G 4WJ4A 2B63H 2VW9A 4LFCQ 4JI3Q 4XTCS 4LF5L 4A3DG 4DV5Q 1HR0Q 1IBML 3J81i 4EX5A 2AWNA 4BY7G 4A3CH 2NVTH 1U0LA 1CKOA 4LF9L 5JJKA 4R4OA 3UDIA 1UEBA 1B8AA 4NPSA 1KC8C 5GAHC 1GD7A 1NJIC 4Y52H 1X3FA 1KRTA 3KF6B 1WI5A 4X64L 1OXSC 2IY5B 1WOCA 4X6AH 1S72A 1BVSA 1EQRA 2D0PA 1GM5A 3ER0A 1YNXA 4NXNL 1K9MC 1CKNB 3M85A 1K8GA 2UUAQ 1VQNA 1PH5A 3HFZB 4BBSH 1N36L 5C3EH 4YWKA 1IXRA 2WAQG 3W1BA 4IJHA 5LMNQ 4GOPB 1XNQL 1UE7A 3PO2G 1XMQL 2ID0A 1VQOA 1YI2A 2CQOA 2E2IH 2Q2TA 1E1TA 3CC4A 3JAMi 4JBJA 3S24A 4LFAQ 4POGA 1Q82C 2UXDL 3HOXG 4DR6L 3CCMA 2GVAA 4A3GH 1N36Q 4IPHA 1AH9A 1OXTA 2VY3A 5K36G 1Q8KA 3WWVA 1PH1A 1XTDA 1PH2A 2YTXA 3OYYA 4JOIA 3U50C 1PA6A 1CUKA 4GKKL 5DLQE 2R6GA 1YIJA 1FJGL 5IP9G 1RIPA 1N8RC 4A93H 3ERSX 4HIKA 4IOCA 1VQMA 3T1HL 4DR5Q 4P72A 3GDEA 4QL5A 5C0XG 2ZTDA 4P74A 4GOPA 2VQFL 3G48A 1KAWA 1YHQA 1PVOA 1EOVA 3J81j 4JBMA 3H3VH 4C3IH 2GN5A 2A8VA 2FXQA 1J5EL 2OTLA 1YVCA 2D0OA 1J5EQ 2ES2A 3U58A 2VNUD 4JI3L 1N9WA 2C35B 2CWAA 4LFCL 1VQLA 2YTVA 4IJLA 2VS1A 5FJ8H 2Y0SE 2ZJRA 1PV4A 5LMUL 4OX9Q 3HOZH 2VZAA 1XMOL 3PF5A 2IX1A 3FP9A 4KI0A 1OTCA 4LUOA 5ELNA 1N34Q 1I5FA 2UXBL 2JEAI 1SFOH 1PHJA 3I4NH 1NBWA 1P8LA 3HOVH 1X3EA 2Q2HA 2A1AA 2PMZE 1IBLL 4DNIA 2UU9L 1V9PA 2RHQB 4IPCA 3KDFB 3H15A 1HZBA 3NEMA 4LF4L 4LF7L 4AQYL 2RHSB 3AFQA 1YITA 2JA6G 2HQLA 3E9IA 4J15A 1OXUA 4JI2Q 1FVIA 1MIUA 3PUYA 1SN8A 1Y1VH 1S40A 2F4VQ 2PI2A 2RF4A 3F8TA 3CCRA 4DV2L 4NXML 4OWWB 1Z47A 4A3JG 3K0XA 4LF5Q 3BJUA 1HZ9A 1TWHH 4BBSG 2E5LL 5AJ3Q 3PO2H 4YWLA 5AJ3L 1N33Q 2NZOA 3MXNB 4A3MH 4OX9L 2ASBA 3GTPH 4A3FG 3ICEA 2LSSA 2E8GA 5IWAL 4BA1I 2JA7H 4UP7A 2YYZA 4YCVA 1I50H 4R4CA 1V1QA 2IHFA 2HT1A 1LUZA 3CF5A 1QVCA 1UWVA 3D0FA 3KF8B 3S1NH 1QVFA 4PZ6A 5GAEC 4A3CG 4A75A 3KLWA 4LF7Q 4GN5A 4UPAA 1LTLA 4QGUA 4JG2A 4GLVB 4X62L 1IBLQ 2D62A 2I5HA 2UU9Q 3HOWH 4DR3Q 1HR0L 1IBMQ 1VQ7A 1VQJA 1D7QA 3CMAA 1JT8A 3S1MH 3RLNA 1X65A 2KHJA 4B3TQ 1VQBA 1X6OA 2ALYB 4PZ8A 2YV5A 1E1OA 1BBUA 1VQFA 1EQQA 4GS3A 4DAYB 3I56A 2WFWA 3DM3A 5IWAQ 1IL2A 4K0KQ 1HNZL 4PZ7A 4R4QA 4K0KL 1L2FA 3IRBA 3EIVA 4DV3Q 2OQ0A 2HHHQ 3DLLA 5M3FH 2KBNA 4O2DA 5FJ8G 1XJVA 3PUXA 3CCEA 3T1YL 4LF8Q 1EYGA 3T1HQ 2NVYH 4DUZQ 3D31A 4HJ7A 1Q7YC 4A3EH 3I4OA 4B3SL 3UDGA 1I3QH 4FDBA 4WJ3M 3I4NG 4GKJQ 1B70B 4L5QA 5BR8L 3M4OH 1YJNA 1QVGA 1G51A 4JI1Q 4OXPA 1YHBA 2JA6H 4HJ8A 2E2JH 3K8AA 4A93G 3HKSA 4DR7L 3PGZA 2OQKA 3HKZE 4JI0L 4AQYQ 2NZHA 1A62A 4OONA 1EUJA 4QIWE 1Y1WG 1VQEA 1YZ6A 1WFQA 2IT1A 4YHHL 4A3JH 5IYBH 2VUMG 1P16A 1NMFA 1Y1VG 1CKMA 4HJ5A 3A74A 5LMNL 1WJJA 4DKAC 1CSPA 1K3RA 1VQ4A 3EN2A 2K5VA 1AE3A 4A3BG 3T1YQ 4LF8L 4BA2I 2DUDA 3HOUH 3PV0A 2R7DA 4LFBQ 1L0WA 5M3MG 1I6HH 4LF6Q 3CCLA 1VQKA 3BZKA 1XNRL 4DV1Q 3S16H 1IBKQ 1HH2P 3BZCA 2N49A 1XPUA 1CSQA 5C0XI 1J6QA 1TWFH 1LM0A 2K50A 4JOIC 5EAYA 2R93G 1SE8A 2BA0A 1PH9A 1KD1C 1E7ZA 4JI1L 4GKKQ 2K5HA 5IP7H 3I55A 1JJCB 4JI6Q 3RN2A 3U4ZA 1BKBA 1PYSB 2LXKA 3TQYA 4DR1Q 3GO5A 5IY0A 4P71A 4B3MQ 2JEBI 2BH8A 2WB1G 2WP8J 2VQEL 1JB7A 3M9BA 4AH6A 3CC2A 3PIOA 1KIXA 4DR4Q 1SR3A 1TWGH 4DV6L 4DUYL 2PI2E 3E9HA 2K5NA 1HZCA 5M3FG 3M3YH 4KLKA 1Q1BA 2IHEA 3FHWA 3L2PA 1LYLA 4EQ5A 5J3BA 4LW1A 2UUCL 3S15H 4JYAQ 3K81C 1N32Q 4RG1A 1GO3E 1TWAH 2HIXA 4JI4L 4LUZA 3HOYG 4BY7H 2JJQA 4C3JH 4JV5Q 3MEFA 3PUVA 4DV2Q 1HR0W 3CD6A 2JE6I 4X64Q 1WCMG 2NVXH 4IPDA 4JI8Q 2ZTCA 4X66L 1X3GA 4A4IA 1N32L 1OXXK 2I5MX 3CAMA 4QJFA 4HJ9A 4DV4Q 4GOPC 3UE1A 5M5WH 4R4IA 4DV0Q 3F2DA 3ULJA 1VQHA 3F1ZA 3GD7A 2I5LX 5BR8Q 1GKHA 4APVA 4YY3L 5IYBG 4DV6Q 1GVPA 4GLXA 3RZDH 2F3IA 3PUZA 2VUMH 4TQUS 3I4MH 4YCUA 3S14H 1HNWQ 2R7ZH 1VQ8A 4R1JA 3UDXA 4A3IH 3K7AH 2UUCQ 1R9TH 1N33L 4QY7A 3J7A5 1I94Q 3CW2C 3KOJA 4GN4B 2A19A 4DUYQ 2Y0SG 4NXMQ 5C4XG 4X65Q 1UE1A 1HNZQ 3RZOH 3HOXH 2UUBQ 1W2BA 4ME3A 4POFA 2AMCB 4GNXC 1YBYA 4O0AA 5JJIA 1DGSA 3RLFA 5C44H 2I0QA 1VQ6A 4DR7Q 3TREA 4IOAA 1A0IA 1E3PA 1PYBA 4GN3B 4JI7L 3OW2A 4UY8C 4DV1L 4DR3L 2E2HH 3TRZA 2WAQE 4AIMA 4A3LG 4LUVA 1JJ2A 1KXLA 5LMNW 3A5ZB 4DV5L 1L1OA 4LF6L 3W5OA 1HJPA 1N34L 3J80i 2AHOB 4IO9A 2UXCL 2KCMA 5GROA 5C3EG 1HNWL 2UUBL 2QEXA 1YHAA 2ZM6Q 1X9NA 1NY4A 1UE5A 4A76A 3CCQA 3HOUG 2ZJPA 1C9OA 5M3MH 3G4SA 2JA5G 2BH2A 3GTKH 1BBWA 4DR4L 1G291 2K75A 4HIOA 5IYDG 1A8VA 3GTGH