3AEVA

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
EYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLAAEKLGKDFEAAWREVWVPLEEEWGEVYAAFEDAAKDGIEVLKGHVPDEWLPVLKEIVENYVEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
molecule keywords Translation initiation factor 2 subunit alpha
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3aevA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aevA01
2K50A 5C3EG 4WJ3M 4DUYL 3K7UC 5FLMG 2IX0A 5FLMH 1EQQA 5C3EH 1XJVA 4OWTB 3RLNA 2N3SA 4C3HH 1SLJA 1EFWA 4GKKL 3CCEA 1Z9FA 1YJWA 1VQ6A 2C35B 1CSPA 2MQHA 1I94Q 4NXML 3JAMc 5M5YH 4L5QA 1EIYB 5JEAJ 2WB1E 3PF4A 1L1OA 3J7A5 2D0PA 4IO9A 5LMNQ 5IYDH 1NY4A 2E2IH 1X6OA 1X56A 2EIFA 4XIGS 4AYBG 4B3SL 3UE0A 1YHBA 1VQCA 4BBRH 4LF6Q 4PZ8A 4AQYQ 2BH2A 4IJLA 4OXPA 3NBHB 1YVCA 4X66Q 4DV1Q 1P8LA 5LMUQ 4ME3A 5IYDG 4QGUA 5DLQE 2ZJQA 4LF8Q 1K0RA 3CMAA 4GOPC 4HJ8A 3AEVA 5IYBH 1AH9A 4BY1G 3I2ZA 2WP8J 4LFAQ 2K75A 1U0LA 3A5UA 5C4JH 1JJ2A 1ASZA 3DM3A 4A93G 3B6YA 4JG2A 1CKNB 1MIUA 4A3EG 4JI7L 3U58A 4A3CH 3L2PA 3FKIH 3H15A 1PYBA 2Q2IA 3F2BA 2I0QA 2ATWA 4YY3Q 3PUWA 3E0EA 4JI7Q 3FKIG 2Q2TA 2OQ0A 4JBMA 1YI2A 3MXNB 1VQJA 4DAMA 5M5XH 1IZ6A 1WJJA 4APVA 1E22A 2R7FA 1KQSA 3GTMH 1Y1WH 1DGSA 3S2HH 1QUQA 2UXCL 3TREA 5IP7G 4LFCL 4GNXB 3ULPA 1YHAA 1QZGA 2B29A 1IBMQ 4JI1Q 5JJLA 3I4OA 3RLOA 4DNIA 1AE3A 4DR3L 2CWPA 1Q86C 2VS1A 1K83H 1UE1A 3HOYG 4UP7A 1Q1EA 1N36Q 4P75A 3W1GA 4OONA 4IPGA 3J81j 5C44G 5JEAG 4A3MH 1XMQQ 4JBJA 3U50C 2WAQE 1VQ5A 3PIOA 4A93H 5BR8L 4JI3L 5HGQA 3TS0A 4LF9L 2MO0A 2NN6I 5M3MG 5IE8A 4NB3A 1VQ7A 2K52A 2WFWA 2UUBQ 4HIDA 3HOZH 5C44H 4A3JH 1Q7YC 2E2JH 4BBRG 1PFSA 4LUZA 3PUVA 4X65Q 3G4SA 1VQKA 2Q2UA 4JI4L 2QGQA 3HOUG 2Z0SA 1CUKA 2VY3A 3CCJA 3KOJA 3PUYA 4JOIA 1V9PA 4JI5Q 1SROA 4X66L 4AYBE 4KI0A 2A19A 4X65L 3OTOQ 1VQNA 5IP7H 2ALYB 1W3SA 1SRUA 2PMZE 3A5ZB 4UP9A 3ULJA 2CCZA 1IL2A 2UUCL 3ICEA 1RIPA 3HOVG 2JEAI 1HNZL 2JA6G 1QVCA 4TQUS 1PV4A 3I4NG 4IPHA 2YV5A 2ZTDA 3G48A 3PO3G 4RG1A 1WFQA 1UWVA 3L7ZC 1VQBA 4PMWA 3UDGA 4A3CG 5GROA 1TWAH 5C4XG 4X6AH 1FL0A 2I5MX 1BVSA 4GKJL 1N36L 1XPRA 2NVYH 4A3FG 3AYHB 2HIXA 4BY1H 4B3MQ 3DLLA 2VQEL 3M4OH 4BA2I 4GKJQ 4B3RL 2KCMA 3CCQA 1N8RC 4JI0Q 3GTOH 1KHIA 4A76A 1QZHA 4NXNL 4QJFA 5GAHC 2JE6I 4B3ML 4KHPQ 2IHEA 4X64Q 1VQOA 1JE5A 3CC2A 2F4VQ 4AQYL 1P16A 4KLKA 1I94L 1VQDA 1GM5A 3TRZA 4GOPB 2VUMG 1JJGA 4DUZL 4A75A 1G6PA 1OXXK 2Y0SG 1TWFH 2JEBI 2N49A 2K5VA 5FLXc 4B3TQ 3UDXA 3TS2A 3UE1A 5JJKA 4OWWB 4B3SQ 1B7YB 3RZDH 1XNQL 4GN4B 3CP0A 2N78A 3H3VH 1B8AA 2ZJPA 1VQAA 3RN5A 3KLWA 3S1RH 5C0XG 4DV0Q 2UUCQ 2DUDA 4FDBA 4DR4Q 2IT1A 4A3DG 4JBKA 1HNZQ 2RHQB 4LWCA 1KRSA 1X55A 2ID0A 4JI2Q 1O7IA 1EWIA 1CKNA 2CFMA 1KIXA 1KL9A 4DR6L 3I56A 2LXJA 1HZAA 1M1KC 2UXDQ 4DV4Q 1V43A 3PIPA 1FJGQ 1WCMH 3PUZA 1XPOA 4LF7Q 3PSIA 2OTLA 2ZTCA 2E8GA 3JC66 5M3FG 2UXDL 3KDFB 4AH6A 2JA5H 4Y52H 5K36G 4WJ4A 4BBSH 1HJPA 1H95A 2NZHA 1AE2A 1BBWA 2AWNA 1NE3A 3IRBA 1K8GA 1Q8KA 2JA8H 1TXYA 1VQPA 3KDFA 4LFCQ 5IWAL 1IBKQ 1VQHA 2HHHQ 3D31A 4HJ5A 4LFBQ 1SMXA 2JA9A 2GVAA 1C7YA 4DR7Q 1NTGA 4JOIC 2OCEA 2WB1G 4DPGA 4GKKQ 3KF6A 3CD6A 2PNHA 1XMOQ 4H02A 3M7NA 4LFBL 1OXTA 1NMGA 3HKSA 5GADC 3GTPH 3I4MH 2R7ZG 1XTDA 2LSSA 1PH4A 1KAWA 2YU9H 1Q12A 1SN8A 5GAEC 1RL2A 3K81C 2UU9L 4LUOA 5H1SE 2R93H 2JA7H 5LMNL 3F1ZA 4C3IH 4X62Q 5IP9H 4P71A 5IYCH 3HOXH 4XTCS 1GVPA 4YCUA 5AJ3Q 1PH9A 4A3BH 1KD1C 4K0KL 1HZBA 2UUBL 1JJCB 4JI8L 2WAQG 1UE6A 4HJ9A 1A63A 1J5EQ 1YJ9A 3CMEA 4BXXH 4UP8A 3HOWH 3CPFA 1IBLL 3G6EA 3J80c 2AMCB 4JI5L 2NVTH 4YWLA 3S2DH 3I7FA 2VZAA 2A1AA 4DR1L 1KC8C 4A3LH 2UXBL 2B3GA 4A3IG 3CCMA 1FJGL 1OXSC 2L15A 3A74A 4DV3Q 4MNOA 3S1NH 3A0JA 4L5TA 4JI2L 2K14A 4DV6Q 2B63G 3E9HA 2N8NA 2NN6G 4AIMA 1QVFA 1LTLA 4JBWA 1LYLA 1HR0L 1GKHA 2IX1A 4GLXA 2ASBA 4JYAQ 4PG3A 1W2BA 1TWCH 1EIFA 4A3GG 4QQBX 1N32Q 1UE5A 3BU2A 1SFOH 3RLFA 2JJQA 4JI0L 4LF5Q 1XMQL 2UXCQ 2YTXA 4JI6L 5ELNA 1VCIA 1XMOL 2OTJA 4DUYQ 3STBC 2R6GA 1Z47A 4LNQA 4PZ7A 1E7ZA 4LF4Q 2VQEQ 2PI2E 3PGZA 1L2FA 2HHHL 3PO2H 1EOVA 1C9OA 4O0AA 3CC4A 4X64L 3W5OA 1VQ4A 4MZ9A 3CF5A 4DV1L 1OXUA 3CCUA 2AHOB 2PQAA 4MTNA 3CC7A 1L1OB 3WWVA 1CSQA 4DV5Q 3E9IA 5M5WH 2KBNA 1J5EL 4IOAA 1VQGA 1N9WA 1WYDA 4R4OA 1PH1A 2DGYA 4A3KH 3S1QH 2UU9Q 4JCVE 1WOCA 2D62A 3K80C 3Q8DA 1FGUA 4O2DA 5J3BA 2VW9A 4B3TL 4JV5Q 3GD7A 3K0XA 2I5HA 4A3BG 1E24A 4DR1Q 5IP9G 1UE7A 3NENA 1R9TH 4IPCA 4YY3L 3RNUA 3GTJH 4HIKA 1NJIC 4DV0L 1TWGH 4HIOA 4OX9Q 2R93G 3KFUA 4DV6L 2NVXH 1J6QA 1YIJA 2UUAQ 2E5LQ 3OYYA 3K7AH 3UDFA 3KJOA 2Q2HA 3I4MG 1S40A 2Z6KA 1KRTA 3S1MH 1A62A 2BA0A 3M3YH 4OO1I 1YNXA 1I50H 1OTCA 2R92H 2QA4A 1Q46A 1PA6A 1K8AC 5FJ8G 4DR6Q 1YHQA 1PVOA 4LF5L 4BY7G 4BY7H 3L0OA 2RF4A 2CWAA 2B63H 3M85A 1Q82C 3JAMi 2YTVA 1IBKL 3VDYA 4IJHA 5C0XI 2JA8G 1EQRA 2R92G 3S15H 3H3VI 1B70B 4C2MH 1Y1VG 3H0GG 1ASYA 4NXMQ 1QUQB 4Y7NH 4LF4L 4A3LG 4KHPL 2VQFL 3S24A 3RN2A 3CW2C 4GLVB 5M3FH 2V1CC 1X3EA 2ZJRA 1K73C 1VS0A 1HNXL 4JI6Q 1YITA 3AQQA 4DUZQ 4RMFA 1IXRA 2AKWB 4DK6C 4NXNQ 4EX5A 1E1TA 3J81c 2I5LX 2ZM6L 1S3OA 3HOXG 3OW2A 2GN5A 4YCVA 4IFDG 1PH3A 4LF9Q 2HT1A 4GOPA 2F52A 1HR0W 4A3DH 1K3RA 2ZM6Q 1YBYA 1YEZA 3M9BA 3J80i 2VNUD 1N34L 2F3IA 4POGA 2RHSB 3CCVA 4KHZA 4LF6L 2MFIA 4IFDI 3CCLA 3J81i 1Y14B 1M90C 4X62L 1Y1VH 3H0GH 3KF8B 5IY0A 2LXKA 3HKZG 4OO1G 3PV0A 5C0XJ 1D7QA 4UY8C 2ZTEA 1FVIA 2FXQA 1I5FA 3NEMA 3GTQH 2IY5B 1XNRL 1L1OC 2KENA 4LW1A 5FJ8H 4L5RC 3M4PA 4TVAB 4A4IA 3CPWA 1L0WA 1PH8A 4IPDA 4DV2L 2RCNA 1IBLQ 2BA1A 4LF7L 1N33Q 3G71A 3EIVA 3GTLH 3ULLA 1I6HH 2MNAA 1X3GA 4BBSG 3T1YL 2JA5G 3CAMA 1GO3E 2HQLA 4DV2Q 4HJ7A 3GDEA 1LM0A 2PI2A 1BBUA 5LMNW 1SR3A 4DR3Q 1Q81C 4A3GH 3J7ZC 5EAYA 3CCRA 1XPUA 1V1QA 5HY6A 3T1HL 1QVGA 1GD7A 1LUZA 2R7DA 3FHWA 4YWMA 4DR2Q 1MKHA 5GAGC 4HIMA 4B3RQ 4A3FH 2GVBA 2BH8A 4DV7Q 1IBML 4JC0A 4DR2L 1CKMA 1HR0Q 4A3IH 3AFQA 4A3KG 2K5HA 1MJEA 1VQ9A 1T9HA 3LGJA 4JI3Q 2JQOA 4DR5L 4DV7L 2VQFQ 2ES2A 3NELA 3HOWG 1G291 2Y0SE 4P73A 4GNXA 1CKOA 4DK3C 4IOCA 2A8VA 4BXXG 4DR5Q 3CCSA 2KCTA 1VQLA 3GTGH 3HOVH 4IFDJ 5AJ3L 5LMUL 3PO2G 2F4VL 4JI4Q 3M4QA 5BR8Q 3EN2A 4JI8Q 1WI5A 2E2HH 2NVQH 4JV5L 3PF5A 4R1JA 4R4QA 4LFAL 2JA7G 2XGTA 4YWKA 1E1OA 3OTOL 1YZ7A 2AWOA 2HIVA 4GLAC 2CKZB 2XTIA 2H5XA 1PH6A 2K5NA 3AFPA 4EQ5A 4R4CA 1N34Q 2MO1A 1VQFA 5JJIA 2JK8A 3HOZG 2KHJA 3TQYA 1VQMA 2YTYA 2D0OA 3MEFA 4DV3L 3ERSX 1I3QH 3CXCA 4L5SA 4DR4L 3KF6B 4ALPA 1VQEA 3EBEA 3PUXA 4GN5A 4GN3B 4HJAA 3T1YQ 3RZOH 1KXLA 3SGIA 1NMFA 3HFZB 3ZJYC 1BKBA 4BA1I 1IYJB 4JYAL 2UXBQ 3T1HQ 1HNWQ 3BZCA 3STBD 1K9MC 4JI1L 4QY7A 4R4IA 4DV4L 3ER0A 4YCWA 5IWAQ 1S72A 3HOYH 5IT9c 1WCMG 2KHIA 3PO3H 3I4NH 2JA6H 3HKZE 3GTKH 1MJCA 2PQAB 1N32L 1HNXQ 4YHHQ 3S14H 4R4TA 4C3JH 3U4ZA 1X65A 3K8AA 3F2DA 1Y1WG 3S16H 4NPSA 1PHJA 5IYCG 1PH7A 3TEHB 1D8LA 2OQKA 1VQIA 2K4KA 3BZKA 3HOUH 4J15A 4DR7L 1UEBA 1OXVA 4DV5L 2R7ZH 1PH2A 5C4XH 1X54A 1SE8A 4A3JG 1X9NA 3BJUA 3RR5A 4A3EH 2IHFA 1A8VA 3I55A 4LF8L 1E3PA 3GO5A 4OWXB 3F2CA 1YJNA 1EUJA 5M3MH 1PH5A 5IYBG 1EYGA 3UDIA 2EQSA 4GS3A 1PYSB 3F8TA 1U5KA 4P74A 2VUMH 1XNRQ 1HH2P 4P72A 1YZ6A 4POFA 1XNQQ 3D0FA 3FP9A 4LUVA 1Q1BA 4K0KQ 1JT8A 4A3MG 2E5LL 5GQOA 1A0IA 3KYHC 1N33L 4GNXC 4DAYB 2OWOA 2CQOA 2VL6A 2YYZA 3W1BA 1HZ9A 4QIWE 1NBWA 3U4VA 5E7NA 1TWHH 2NZOA 2EXDA 4OX9L 3KJPA 3S17H 1G51A 4QL5A 4UPAA 1VQ8A 4PZ6A 2UUAL 1JB7A 1HZCA 4DKAC 3PCOB 2Z6KC 5ELOA 1C0AA 3CQZH 4YHHL 1JMCA 2QEXA 1HNWL 1X3FA
chains in the Genus database with same CATH superfamily
5EWFA 1SYCA 4F5PA 4H13C 3AU6A 4IUNA 4KN7A 5C3EH 1XJVA 3KD3A 4OWTB 3Q0AA 1AZPA 4UAYA 5LL6S 3IKJA 2FI1A 2KNJA 2Q4TA 3DHQA 5DM63 4OJ5A 9ICLA 1LVHA 3HKZC 1YJWA 1CSPA 1BCPB 5FLXE 4Y2UA 5IIIA 7ICIA 1QOHA 4DFAA 5KAFU 3BVMA 3T56B 4UARA 1ZQNA 2DKZA 1WCLA 2EJGC 4FNFA 2E2IH 2YQEA 4F93B 4AYBG 1F9QA 5KG1A 1XC9A 2BH2A 4AQYQ 4QZAA 4B6JA 3S2DB 4IJLA 1MN8A 4M47A 4QZGA 4DV1Q 2RHFA 4EZ6A 1VMPA 1P8LA 2G0AA 2HMXA 5DLQE 2CW0D 2ZJQA 1AP0A 8ICEA 4LFAQ 1U0LA 1JJ2A 1NNLA 5ALVA 2MSNA 2B2TC 1L7OA 3B6YA 4ABNA 3ED5A 5J1ZA 2A6EC 1CKNB 3TQ1A 4EX7A 3G6JB 4LMQD 3U58A 1GOZA 3RF9A 2B2VC 1YNNC 2QB1A 3SXHA 4GC7A 4F8RA 2BZFA 3MVVA 4ID6A 2KVCA 3JAML 3GTLB 1UCVA 2HDLA 1U9RA 3ISCA 3D2NA 3E0EA 1G8ZD 4JI7Q 2LS01 1ZD4A 2TMPA 1YI2A 1PRTD 4APVA 4YXJA 5CWRA 1Y1WH 3RJHA 2EZXA 2UXCL 4YP3A 1ICWA 1IBMQ 4XQJA 1ZQZA 4JI1Q 3UM9A 3I4OA 4PPXA 3RLOA 4DNIA 1HR0Q 2K6AA 1K83H 4RQ0A 4ULLA 4HMJA 4DWIA 5DDMA 4P75A 1PK3A 4RPYA 3CU7A 3W1GA 4LJXA 5AKHA 3HEJA 5I2XA 1B4FA 4A3DB 1G91A 3J81j 1O80A 5C44G 2WKCA 4JBJA 2YMLA 3EPGA 1ZJNA 3MR6A 5ELDA 2IHMA 4CF5A 4B9XA 2LPEA 4JI3L 5HGQA 1VLBA 2NN6I 3DEEA 5KL1B 3MAQA 1WD0A 1UT8A 1T3NA 4IRCA 1ICFB 5KT3A 5AI6A 3SV4A 2AUJD 4DQSA 5M3FB 4O9MA 1EWCA 2K4IA 2OYYA 1XSLA 3VA5A 3BZDB 4BBRG 1VQKA 3GIMA 1STAA 3PUVA 2Q2UA 4MHEA 2QGQA 1CUKA 3CCJA 2DNCA 4JOIA 2MU2A 2KEEA 4JI5Q 4OJLA 4RQ4A 2AU0A 3MFGA 4AYBE 2XWJB 4KI0A 2B63B 1Y69U 1HRJA 3AQEA 3R8BA 3OTOQ 1ZJMA 2HOIA 2F0QA 4BY7B 2KK0A 5IP7H 1W3SA 3ICEA 4CNQA 4KTAA 1GUSA 1PTOH 2WF8A 5I9PA 5J2IA 2JGAA 1PV4A 1N63A 3I4NG 1N62A 2ZTDA 2A3VA 2PZTA 4KJOA 1KAAA 2FLLA 3A7AB 1WFQA 1K8MA 4DL3A 3L7ZC 4ECWA 3M8RA 2VXWA 7ICFA 3EVQA 3HW8A 4A3CG 1S5CD 5HP4A 1R9TB 2I46A 3GTOB 2EANA 5EBDA 4I2IA 1RXVA 1SJHD 1ZQJA 1TVXA 4A3FG 4PHAA 1DXSA 3SE0A 4BY1B 4BY1H 4RUAA 4A3KB 2J6UA 3DLLA 2CPRA 3WKBA 2F0UA 3F2UA 1BCPD 1TKWB 2R8IA 4RA8A 4OJPA 4EGVA 3CCQA 3MXNA 4A76A 1AN8A 1QZHA 4NXNL 3GTOH 4B9UA 4B3ML 3KBBA 4NKLA 4B9LA 4IR1A 1VQOA 2WAQC 4UHVA 4FF2A 1HQRD 3NQTA 5C4HA 4AYBF 1VQDA 1GM5A 3D6WA 5K4LA 1GJXA 2VUMG 2JZBB 2MPMA 2A6ED 5KFPA 4MFCA 1STGA 2R8HA 3H3VC 2KP7A 2N49A 2LY7A 2OEHA 2K5VA 2RA4A 2IWHA 3JAME 4B3TQ 1S5FD 3SK5A 3UE1A 5JJKA 1UNSA 4YD2A 3CP0A 3H4BA 3NUCA 3N7RC 2CW0C 1X42A 1QQ5A 3PW7A 3RH6A 1D9DA 2JRZA 5KL8B 2UUCQ 4DR4Q 4UBCA 2WKDA 1EL0A 4JBKA 3K5LA 4LWCA 5C44B 1L7NA 1X6JA 2XC9A 4C8MA 4Q8FA 1X9MA 1MSHA 3TMEA 4CJ2C 4QUFA 3IG8A 1EWIA 1UT5A 2CFMA 3P1HA 2HOQA 1VJ5A 5AI8A 2EJMA 2QKIC 1KIXA 4KLTA 1RYSA 4Y2TA 1K3BC 4KLJA 1CT1D 2MUTB 1DOMA 1RPLA 2YMQA 4YD1A 1PZNA 9ICWA 1WTWA 1TY2A 2C9OA 3JC66 5M3FG 3AU7A 1NR4A 4UASA 5K36G 4AH6A 2JA5H 1H95A 1TAQA 4RWSC 1HJPA 4ACOA 3PW4A 5FLXL 1X9XA 2HQEA 4UW9A 5BN3A 2JA8H 3FMCA 3PW5A 4EEYA 2LM4A 4XDXA 1DXMA 1IBKQ 2PMZF 8ICZA 3R93A 2E5SA 4YQWA 4DR7Q 3I73A 4DPGA 2WB1G 1KQQA 1DD2A 1Y1WB 3W2DA 5AM2A 3Q8MA 1X3PA 1XMOQ 5M5XB 3M7NA 2HHUA 2LYAA 2EZYA 5CHGA 3LNNA 5GADC 4ECSA 2PI4A 2WIIB 1UA0A 4UB5A 4C80A 2KJ9A 4RNNA 2LSSA 1XTCD 2O6KA 1Q12A 1PK1B 1HHVA 7ICPA 1RL2A 5KT7A 2B2YC 3K81C 4LUOA 5H1SE 1NOMA 4OJ6A 1UHUA 2UU9L 1GUTA 3F1ZA 4X62Q 1PH9A 3FVQA 1TK8A 1XXGA 4YCUA 5AJ3Q 4P4MA 1JOKA 1XNSA 5C4JB 1JC7A 1WTRA 2NRWA 1NZBA 1UE6A 4FO2A 4HJ9A 1SNDA 1ZOLA 2BCRA 7ICUA 2JA5B 2C2RA 2W9BA 5ALJA 1IBLL 1XWLA 1NK9A 1E2VA 3TI0A 2RDIA 5KG7A 2DN8A 5CV4A 3S2DH 1JI7A 3GV8B 2D5DA 1AEXA 5KFVA 2B3GA 1FJGL 3CCMA 2RDHA 4ZYSA 3A74A 1VDVA 2BGWA 4MNOA 3S1NH 5GTIU 3A0JA 1HTPA 3MR2A 1SEBD 2DY8A 1KTQA 2NN6G 5KG6A 2IX1A 3C2LA 5HNKA 1D8BA 1Q3VA 5K5PA 2BDOA 4DL2A 4F5NA 5E79U 5KFSA 5B66U 3BU2A 1SKWA 1KDCA 1PUZA 4YMOA 3NRZA 4JI0L 4LF5Q 2P6RA 3HWTA 4O5KA 4EYHB 5AIBA 1L5UA 3ISDA 1H9SA 2R6GA 1Z47A 9ICRA 1TWFB 2H3IA 4J9QA 1DOLA 4PZ7A 1ZQCA 3JPNA 5DLFA 4R9WA 4F5OA 4O3SA 4O0AA 1CEZA 4EX6A 2Z9HA 9ICTA 3SAFA 1BOSA 2N88A 4CGYB 1VQ4A 1CQFA 2W3RA 4QIWF 4O3PA 4FVMA 4MZ9A 5AKKA 5C6AA 3CF5A 4MTNA 2GO7A 8ICJA 5J0QA 2MUTA 4DV5Q 2F03A 1IHZA 3D6CA 4IFDH 3M4OB 1DRGA 1N2XA 5ALLA 4A3KH 2UU9Q 4JCVE 5DM73 1CFMA 1WOCA 1ZYQA 4UB1A 4O2DA 3NTKA 1NJXA 1ZQOA 5J3BA 5DB7A 2VW9A 4B3TL 1TK5A 4ZKCB 2FMCA 5BPCA 2GA4B 8ICVA 3AM9A 1TWAB 4FP5D 2E76C 5DBBA 1XWEA 4O5CA 3RNUA 2R93G 3ONAB 4HIKA 4HIOA 5J2HA 3TP8A 1J6QA 3V7JA 1YNND 1YIJA 5KNIA 3A56A 3ONNA 4JVZA 1LO5D 2RQ5A 2E5LQ 3I4MG 2PZWA 1CM9A 4DL6A 3D2SA 2AQ2B 3SV3A 1ZRNA 4RQ7A 1ZQSA 4OO1I 2R92H 1SYEA 2EYPA 4EQOA 3OPXA 4KN4A 3MABA 2LHTA 4HSVA 1YHQA 1S5ED 4BY7H 1EEFD 5C0YA 3LYSA 4ECXA 4DL7A 2B63H 3M85A 1IG6A 1IBKL 2EAPA 2YB4A 1ZQQA 1NK0A 4J6HA 4CDCC 3F5AA 1B70B 3H0GG 4C2MH 4KHPL 4DFPA 4I29A 1O7YA 4LF4L 5KFHA 4EQNA 4A3JB 3ZD8A 3S24A 1SNCA 3HOYB 2V1CC 3WK5A 5EJWA 3OSNA 3C2MA 3TP6A 5EKLA 1DK2A 3I8ZA 4KY5A 4C4TA 3AQQA 4HR7B 2AKWB 3NRWA 2ASJA 4WJ3B 1U48A 4KV6A 1E1TA 9ICBA 3K0YA 4ZQ3A 3J81c 1B2TA 3PSFA 5AI0A 1X6IA 4J9SA 3QYPA 4Y2JA 2B2TA 3V2TA 2GN5A 4C3IG 3RZOB 1PXUA 3PSPA 5G5HA 2F3VA 3Q22A 3RB6A 2Z1CA 1JJGA 1HR0W 4A3DH 3AMZA 1IL8A 1YBYA 3PW2A 1YEZA 3TZUA 2ZM6Q 1N34L 4Q8EA 3IHQB 2W9CA 1NNXA 1Y8NB 4USAA 4KHZA 2JH7A 3KBXA 3J81i 3CCLA 4LF6L 4IFDI 1HIWA 1BPZA 1E0BA 5I2YA 3K57A 4HMIA 2LYBA 4TUPA 2KUMA 4QZ9A 3J7YW 4NM1A 4PHPA 3H0RB 2PW5A 1Q3LA 4QZ8A 1J8IA 1UA1A 2KZMA 2F4IA 4LW1A 5A35A 1QVFA 1KNEA 4IPDA 2NRXA 2RCNA 4ECQA 8ICXA 1V85A 3QU2A 4KLUA 3ZDBA 5EBCA 3G6VA 2SEBD 1TK0A 3M4YA 5J2EA 2JA5G 1O03A 2HQLA 3E0JA 4Q43A 3EYZA 1JQYD 2PI2A 1NKEA 1BBUA 4A3GH 1T5XD 1MSGA 1XPUA 5HY6A 1HNWL 1N32Q 2ISPA 2H4OA 5AFWA 2V4QA 2EYFA 4CKEA 4KY6A 4DFJA 5JVG3 2KIWA 2FE9A 2DQNB 4XRHA 7ICEA 4JC0A 3KKAC 1DGJA 2ZIVA 4A3IH 1XO1A 4JK1C 1VQ9A 4JB3A 2WFAA 4JI3Q 5LHY1 4ZKBB 4CJ0B 3NTHA 2ES2A 4CCHA 1EOTA 4C8KA 1N56A 2X69A 9ICUA 4IUTA 1EQTA 3KHHA 4DK3C 4UBBA 3DDHA 4DR5Q 4KKTA 3HOVH 5LMUL 3WKDA 4KLEA 3QJYA 5KFGA 3PO2G 1LKYA 2EOTA 3M6KA 2NVQH 3C21A 4J9KA 5AM5A 4C8NA 1ML0D 2LBOA 2XGTA 3I4LA 4R4QA 3PF5A 4F72A 1ZQ1C 5KFAA 2AWOA 3OTOL 2JXMB 3C1EA 3KOOA 4V0BA 2K5NA 2WF5A 1HUMA 1M4VA 4PH5A 1N34Q 4R4CA 5DQIA 2PI5A 4DQIA 2G5IB 2XSCA 2C22A 3L3OC 1TE2A 2IX3A 4DLEA 2D0OA 3MEFA 2L9HA 5E4WC 2DGZA 1LTGD 3CXCA 4DR4L 3KF6B 2JV3A 4U68A 4KX3A 4ALPA 9ICGA 1F0MA 4GN3B 2C28A 2I07B 2EAOA 3MGVA 4UAVA 1IYJB 2JZBA 1SSOA 4JYAL 3T1HQ 3V6HA 2V9WA 1I6VC 3ZDEA 1RXWA 4O3QA 5D3DA 4IRKA 5J29A 3K59A 5KFMA 5KT5A 4EBEA 1MQ3A 1OO9B 1Z6HA 1J97A 5G3LF 1S72A 5IT9c 1WCMG 2BDUA 2KZZA 2EYJA 3I4NH 2VUMB 3B0XA 3BVGA 2JA6H 5KT4A 1MJCA 2PQAB 4QJFB 1N32L 1J2NA 3VR3A 2CH4W 1SXEA 3QUCA 2HVIA 1FNVA 1RHPA 1SNMA 1X65A 1S5BD 2NBFA 1WTHA 4I27A 1IM4A 5IYCG 3O0FA 1PH7A 3TEHB 1JUDA 1STHA 2OQKA 4IQVA 1B53A 2B8GA 1QQ6A 3RBDA 5C4XB 2K4KA 2R7ZB 1TKDA 1I50B 3ZDAA 3BZKA 4DR7L 1OXVA 4KMOB 2X6LA 4G7HC 2D6FC 3K7AB 2TSSA 3I55A 1RYRA 4UB8U 2W8LA 3T5HA 3S14B 5D3IB 4M9GA 1EYDA 3RAXA 2EE1A 2EYOA 1EYGA 3HRDD 1Q90A 2EJFC 4GS3A 1COOA 4B9TA 9ICJA 3F8TA 4P74A 2WINB 4C1NI 1C8CA 1HH2P 4P72A 4NLNA 3ZDDA 4NJ8A 1JT8A 4A3MG 2DWQA 4X3UA 5GQOA 2RSNA 5J0RA 4RGTA 1N33L 2FDRA 2OWOA 4JUZA 1S76D 8ICHA 2F1IA 1U47A 9ICMA 2CQOA 4HN7A 4QIWE 2HHSA 3W1BA 2HBKA 2LMCB 5E7NA 1B50A 2IOFA 2DF4B 3S17H 2K5WA 4ELTA 1B4OA 4HTHA 4UPAA 4LAAA 4ZH4A 2UUAL 3PO2B 2EDUA 2QDLA 3RFAA 2E8PA 2W9AA 3ICXA 3MBYA 1KSPA 2V4DA 1SE3A 5ELOA 1C0AA 4C3HG 1NKBA 9ICKA 5DQGA 7ICMA 1SBBB 1YNJD 4WJ3M 4DUYL 3K7UC 5DNFA 4PL2A 1EY8A 5FLMG 3QZ8A 5IGDA 4C3HH 4KITB 2K04A 2K4EA 2ATLA 1RTNA 4KKUA 1UPHA 3RB0A 3ITPA 4A8EA 1JCKB 1I94Q 4NXML 2E2HB 2JMGA 5ALZA 1HUZA 3MDAA 4YXMA 4L5QA 2L55A 5JEAJ 1F9PA 2WB1E 3J81L 1L1OA 3GTGB 2HHVA 1A77A 1H9SB 2D0PA 1SXDA 4QMGA 4NV0A 5TZVA 5D49A 3OPOA 3A0BU 1B44D 2BR0A 1X56A 2NO4A 1EU3A 4PQXA 3UE0A 1YHBA 1BGXT 1VQCA 2LKVA 4NP5A 3PR4A 1ZQBA 2AQ3B 5L1IA 4F4WA 1GUNA 1ZQXA 4OXPA 2E8NA 3PMFA 3V7KA 5CGKA 4J8QA 4R8UA 2KHVA 4QGUA 5KFBA 4C56C 4GXIA 3NS1A 4ED2A 2F8LA 4QZCA 1BR9A 4HJ8A 4GOPC 4IL6U 1QQ7A 3I2ZA 5KRUA 3A5UA 3GIJA 1J2MA 1GXDC 3O13A 4JG2A 1DM0B 4FBTA 1MIUA 2F3WA 4JI7L 5DBAA 2EYHA 3L2PA 3FDSA 1PYBA 5ALKA 2Q2IA 2I0QA 2F0WA 2ATWA 4YY3Q 2Y1JA 5CBAE 3TFSA 3MXNB 1VQJA 4DAMA 1KLNA 3A54A 1IZ6A 1SWWA 1SZPA 4B9WA 1KQSA 5D65A 4Z9CB 5I6WA 1DGSA 4QW9A 4QZEA 3GTMH 3FPPA 3S2HH 1QUQA 4RQ1A 4MFFA 2HUGA 1N5WA 5JJLA 1T3QA 1HEKA 3ULPA 4FXDA 2KMDA 1VMCA 1AE3A 2CWPA 2VS1A 3ZI4A 1TIID 1JWMD 3LX0A 1CA6A 2HCIA 1Q1EA 1N36Q 3RBEA 1F2YA 1SKSA 2RQXA 4IPGA 1DZ1A 3ND9A 5JEAG 2MJ8A 4A3MH 2PFPA 4OJOA 5L1JA 2ZUBA 4GFJA 4KLHA 3C29A 2IW3A 2WAQE 5AI5A 3PIOA 1ZQFA 3BQ0A 1EXNA 1KEJA 2MRLA 4MIUA 4A93H 4RHSA 2W9BB 4UAZA 2M00A 2QDBA 2YB1A 4NB3A 2I6XA 5IGBA 1SYGA 4MEYA 5JEAH 3PVXA 5KEEA 3BDLA 1X3QA 2NUCA 4O3RA 3G4SA 5HMLA 3ERQA 3RJEA 5CA7A 2B2UC 4J03A 2VY3A 4I2GA 1V9PA 3WKCA 4X66L 2A19A 3M7DA 4X65L 1TAMA 1PH2A 2N55A 8ICWA 2K8AA 3TARA 2PMZE 3CRLC 4I2JA 2XRSD 3EA6A 2CCZA 5F9NA 5KG0A 3CYMA 2FLPA 4DOBA 4P0PB 1F2ZA 3M3YB 2F0LA 1QVCA 2JA6G 4HSPA 3Q8LA 4R66A 2W9MA 1TV9A 4UB6U 3GV5B 1FR3A 5G3LD 2JP1A 3QEAZ 1TWGB 3GTJB 5KFJA 1L0XB 4JPBW 7ICTA 2HI0A 4ICAA 5GROA 1NK4A 1FL0A 4ED3A 1BVSA 3EW9A 2NVYH 1XSNA 4O0IA 4K4GA 2EVBA 3AYHB 3BYTB 2HIXA 1XS9D 4DSIA 2CQAA 3DWAA 2J4XA 1RD9D 2F0VA 4CDDC 4QJFA 5GAHC 2JE6I 1NJZA 2EQYA 1HA5A 4QIWC 3TFRA 2F4VQ 3AMUA 1ZEQX 3DEOA 5KNDA 1I94L 5J8YA 1L3UA 3OMGA 2E3TA 2ICEC 1DK3A 5KFFA 9ICAA 4A75A 1OXXK 4IALA 1H9RA 3E2EA 1QH9A 4UAUA 4F7XA 5ISRA 5FLXc 3UDXA 3IAYA 3TS2A 4RKLA 3DXJC 4OWWB 1XNQL 3LWLA 3E6ZX 2N78A 3ND8A 1D9FA 5CP2A 4I65A 8ICSA 9ICXA 1ESRA 1B8AA 2HD3A 3LVWA 4DK1A 1EWHA 3S1RH 4DSEA 1XX8A 4DV0Q 1CRXA 2IT1A 5J0SA 4A3DG 1QSYA 2ZIVB 1WUDA 5AI9A 1KRSA 1X55A 4DS4A 3HOZB 2R8GA 5C5LA 3B0YA 3WK7A 1W6KA 4O3NA 5KFRA 2NV3A 1DCZA 3SK4A 3PIPA 1WTVA 5DDYA 5ALTA 1STNA 3PSIA 1FD7D 2NB0A 2E8GA 3H6MA 1ZYRD 3L5KA 3QZ7A 5JPMC 4A3MB 2IMWP 4JWNA 4F2RA 4JV1A 2ISOA 3M8SA 4DOAA 4KLFA 3KTQA 1NE3A 4JMUA 2AWNA 5KT2A 2EY2A 1K8GA 1Q8KA 1R4QB 4RT3A 5IINA 3KDFA 1VQPA 5L1LA 1A3TA 2ZXOA 2W8KA 1WTXA 1LTSD 2FMSA 1VQHA 2HHHQ 3HOXB 3D31A 4F87A 3TP7A 2JA9A 2JA7B 1NK6A 5IIJA 1C7YA 2EY1A 2GVAA 3BDOA 4JOIC 4GKKQ 3KF6A 4H02A 2XCAA 4UAWA 4UB2A 3WU2U 1FYCA 3GTPH 4QUCA 3I4MH 3I4MB 2R7ZG 5E4XA 1PH4A 2WTFA 2OHFA 3KZXA 8ICNA 1SN8A 4OGQC 2DNEA 5EPKA 4Q44A 4EEKA 3QNMA 2VJ4A 2J6TA 3D4RA 5LMNL 4C3IH 1BPEA 1U4LA 3VYRA 5IYCH 2K5DA 5EOZA 4A3BH 3GV6A 1BNOA 4K0KL 3PV8A 4DSJA 4O3MA 2KJXA 5DB9A 1JJCB 1MBYA 2XIWA 4KLLA 3D4DA 2ZIWB 1J5EQ 4I2DA 3TANA 7ICVA 2SDFA 3CMEA 2Z4IA 3MGHA 4L8JA 1L8OA 5ELBA 1YJ9A 4BXXH 4BBSB 4IN3A 3CKIB 3IV6A 1DOKA 2ZXRA 2BPFA 3I7FA 1KC8C 4BBRB 4A3LH 4IUUA 4RGMA 9ICVA 1OXSC 5IODA 2L15A 2J0TD 4M0AA 8ICQA 4RQNA 4L5TA 2IL8A 4Y2XA 2B63G 4P2CB 5AK3A 1LT4D 2FPLA 2F0SA 5AKYA 1LTLA 2OEOA 2QB0A 2BE5C 4QQBX 3VR6A 4PG3A 1PZJD 2RP5A 2KEDA 5KNCA 3H4DA 1UE5A 1WWUA 8ICOA 3V6KA 2R8JA 5B5EU 2KVMA 2LYHA 2XN9C 2HBMA 3MWYW 3RLFA 5A0LA 3S1RB 5FK9C 2UXCQ 3LDAA 4KMUA 1HQMC 4G7OC 2KFZA 1VCIA 3FKIB 4OIKA 1XMOL 4I2BA 3STBC 3TAQA 3PO4A 5KIXA 1O7LA 4LF4Q 3PGZA 2RBMA 3E0FA 1L2FA 2HHHL 3PO2H 4FZNA 1C9OA 2PCFB 4QF4A 1S0OA 5DAUA 3CC4A 1JX4A 4KLQA 4X64L 1X66A 1RDPD 2KCNA 4DV1L 2RDGA 2PQAA 1PZID 1L1OB 2K4PA 1CSQA 2KCCA 4P0QA 2UVVA 5J2AA 2BCSA 3HG9A 4O1NA 4Y2QA 2PMZB 1JICA 2DGYA 2XNAC 3GFKB 2FMQA 1UQVA 2D62A 4K6LA 3Q8DA 5TISU 4ME5A 1MGSA 5AKIA 2ZXIA 3K0XA 4CF4A 4A3BG 3MXGA 4C8OA 2ZG6A 1ILQA 1UE7A 1L8LA 4XQ8A 3GTJH 2F1JA 4P4PA 3KFUA 4P4OA 4YR3A 3K7AH 3KJOA 3D2QA 1Z1BA 2C2EA 4B9VA 3NP8A 2BA0A 3LVVA 1SAPA 1KRTA 1S40A 3M3YH 3H0MB 1F2MA 1I50H 3HOUB 1EIHA 2MA1A 4C0ZA 1Q46A 2L5YA 1JWSD 4G57A 2KJ8A 4LF5L 2CN1A 3L0OA 3GIKA 5NUCA 1KDAA 1Q82C 1S5DD 3ETLA 2JA8G 3P7JA 3N52A 3H3VI 5C5JA 1ZQDA 1Y1VG 4NXMQ 1ZQKA 3GTKB 1QUQB 2VQFL 2LM1A 4DSKA 2W03A 3FRPB 4KY7A 1A0PA 1XU4A 3CW2C 4RZRA 1JOQA 4IUPA 4KLOA 1VS0A 7ICOA 4FE3A 1X40A 3W3AA 1YITA 1JR0D 3N4MB 1IXRA 2L1BA 2CRXA 1IV8A 2H3VA 3PR5B 2XI9A 1S3OA 1RZTA 3N28A 2XWBB 2F0MA 4NLCA 1ZQGA 1GUGA 2KOBA 4HAEA 1PH3A 4LF9Q 2HT1A 2F52A 1TVAA 3H8JA 1WWVA 1KTKA 2VNUD 1LTAD 2F3IA 2RHSB 4TSSA 1QG7A 1Y1VH 5HHHA 3C5GA 4IS7A 8ICGA 1D7QA 1BO0A 5C0XJ 1DOQA 3S2HB 3NEMA 2IY5B 1Q3UA 4R63A 1I5FA 1A15A 1II3A 1XNRL 3GTMB 4K4HA 2NVQB 3RAQA 2W7OA 2ZXHA 3NTIA 4L5RC 3M4PA 1NJWA 4DCCA 1U49A 2PYKA 2NTSA 4OIJA 3GV7B 5T1GA 2HCFA 4LF7L 1Z3EB 1PVQA 3G71A 3N97B 2MNAA 3FM9A 3GQCA 2PXIA 4BBSG 1ZKOA 1KDHA 5L9XA 2A68D 1GO3E 1Z4NA 1FFUA 2DFLA 3CAMA 9ICQA 4R64A 4Y2YA 3J7ZC 5EAYA 1L6NA 1V1QA 3T1HL 5T1IA 1LUZA 1LTTD 5F9LA 3FHWA 1MKHA 3SI8A 1G2SA 5ALIA 4A3FH 4UDUC 2E8OA 4NW2A 3BG3A 4F4YA 1OUQA 3Q24A 2H3QA 2QCPX 2K5HA 4A3KG 4DLGA 1Z00A 2ZIUB 4ZOHC 2JEGA 1T9HA 2JQOA 4DR5L 1ET6A 2VQFQ 4MF2A 3NELA 3HOWG 1NK8A 4QCLA 4MF8A 1SL2A 1I6HH 2FJ6A 3FYHA 2KCTA 2KN7A 2BPCA 2F2AB 4TURA 1BPYA 3SAHA 2IA6A 2Y1IA 5IILA 4FXKC 5KGUA 4JI4Q 3RJGA 5BR8Q 4BX9C 2BCVA 2B21A 4JV5L 1F9RA 2RCFA 1CQVA 3C1ZA 4NLBA 2XO7A 5DG9A 3IG5A 4C3HB 1SIJA 1QILA 2ZIXA 2HIVA 2XTIA 3I1YA 4S3SA 2VJ5A 1EY9A 5KFWA 2MO1A 5ALGA 3C23A 4XYQA 4CRXA 5ALNA 3C46A 1ZQVA 3TQYA 3D4WA 2DBYA 2B6GA 3EBEA 4F5QA 3T1YQ 4C4SA 4PV1C 1JIHA 3ZJYC 3Q23A 2G9HD 4BA1I 2UXBQ 1HNWQ 1URJA 5CC4A 3G7LA 3BZCA 4PNYA 1K9MC 2UVRA 3F53A 1SE4A 4JI1L 3GILA 4PGYA 3R3OA 3NWSA 1SV0C 3PQIA 3UQ2A 4R4IA 4DV4L 3ER0A 2CHBD 2KHIA 2QB0B 2F3NA 2M0NA 2JEJA 3HKZE 2Y0SB 3TKAA 3S14H 1V1OA 2F0HA 1VDZA 3F2DA 1Y1WG 3S16H 4NPSA 4WFN3 1SKRA 4C1NK 5CV7A 3N7SC 4CF3A 2NRZA 1VQIA 1LTID 5FO7B 4QWBA 3OHXC 2AH5A 2R7ZH 4G3IA 1X54A 4JV0A 1X9NA 3F5EA 3QO2A 8ICBA 3OIQA 4TRDA 2A69D 1S4ZA 2Y0SC 4P2HA 2WAQF 2IHFA 1PFMA 2PFQA 1E3PA 2IPKD 4OWXB 3QOLA 5HR7A 4G9BA 1EUJA 2EZZA 5CJ7A 3WK9A 1STYA 1ZETA 5DG8A 1UAPA 3H09A 1PYSB 2BCUA 1YZ6A 2Y9TA 5IGCA 4K0KQ 1KFTA 4NXZA 3C1YA 1KFSA 5EWEA 5D14A 4GNXC 1ZQUA 5M5WB 5EE3A 2VL6A 2G07A 3ZDCA 5J2JA 1CTMA 3FC4A 5JVH3 1PLFA 5BOMA 2YTUA 3SD7A 1FNWA 1G51A 4DA2A 1VQ8A 5AKZA 1TY0A 4PZ6A 1JB7A 2Z4HA 1I3QB 4FBUA 3VYTA 2NRTA 1UEAB 4I2CA 3SEBA 8ICTA 1JMCA 4I2AA 5AIAA 1X3FA 3GV3A 5C3EG 1AW7A 5FLMH 4BUGA 4RKBA 2HHQA 1A6XA 4F4XA 2KQ3A 2OH2A 4ZCKA 2N3SA 3RLNA 1Z00B 1SLJA 1SMYD 4OHJA 4TKOB 3RMHA 2F0NA 3CCEA 5DLGA 1L7PA 3HP3A 1TWCB 1Z9FA 3A8IE 3SHLA 2C35B 2MQHA 2WF6A 4FF3A 1VQ6A 2HVHA 2A6HC 4M6WB 5M5YH 3HOVB 1EIYB 3Q8RB 2RDFA 4FF1A 3PF4A 2Q8TA 3J7A5 3KHGA 2HBLA 3S1NB 5LMNQ 5IGGA 1NY4A 3ZD9A 4XIGS 2EIFA 4B3SL 2M9NA 4Q0FA 2KOLA 4LF6Q 4PZ8A 3I76A 1NAPA 3VA7A 4IRDA 3NBHB 3QEBZ 5DEHA 5IOCA 3HOWB 2FHTA 5IYDG 4LF8Q 5DKWA 1K0RA 3T16A 2Y0SF 2VB3X 1D5MC 1JN3A 4FO6A 3AEVA 5DB6A 4QIWB 3UPQA 1V97A 3OTQA 3TSSA 1IYUA 1ASZA 5C4JH 4DK0A 2MHVA 3UXOA 3OGUA 4A3GB 1ED1A 2F77X 5KFNA 4OO1J 2FINB 4A3CH 2EYMA 3Q8SB 4F2SA 3S9WA 3H15A 5E3FA 3BQ7A 3F2BA 2IBKA 4I2FA 3DEPA 1D5ZC 2EPBA 4RQ6A 4Z6CA 1B22A 5HGTA 1A2UA 4JBMA 1HUOA 2HW3A 5M5XH 1JRPA 8ICRA 4NLGA 1GHKA 5J2KA 5IP7G 2JXJA 1EFWA 5ALDA 4DFKA 1X9SA 2B29A 5JJIA 4DR3L 4JW0A 1T7PA 1Y8PB 1NUCA 2EY6A 2JA8B 4JWMA 3HOYG 4RNOA 5HHIA 1YT3A 2DUYA 4PJ0U 5EE1A 4K2KA 1XMQQ 3U50C 3NK9A 2R3ZA 1VQ5A 2R18A 1FIQA 5FOBB 4IURA 4NDXA 1HFNA 4DQPA 4DSFA 1PK1A 5CV8A 2MO0A 5HR6A 2F0JA 4EENA 2B2YA 3QIAA 2RRDA 4F71A 5M3MG 1T4GA 4ECYA 1VQ7A 2K52A 2WFWA 8ICLA 3PIO3 2UUBQ 3MFHA 1TS4A 2KVSA 3U9OA 5C44H 5FP0A 4A3JH 1Q7YC 5C4XG 4LUZA 3M6ZA 4X65Q 3HOUG 4DF8A 1G6ZA 5CR0A 1R4PB 3PUYA 2RLTA 3SMVA 3WKEA 1KNAA 1SROA 3QWNA 1QB5D 1SV4A 2EY5A 5ALSA 4XT3B 4BWGB 4C8LA 5CEHA 2ALYB 2K5QA 1FFVA 1SRUA 2JR5A 5CRXA 4UP9A 3RZDB 1IL2A 4DXGA 7ICQA 3HOVG 3J81E 2R92B 3MTSA 4P0QB 5AKJA 1PRTF 1U4MA 3CRKC 4DAYA 2JEAI 2H3ZA 4WORA 4XQQA 2ASDA 4XXEA 1S8OA 1ZQYA 2BQ3A 7ICHA 2K01A 1SWVA 1BPXA 2YV5A 4RU9A 4ZK9B 4RG1A 3PO3G 1UWVA 4PMWA 3UDGA 1IKMA 1NI3A 1TWAH 4U673 3SYZA 2J7ZA 4X6AH 2DJFC 4L63B 3V72A 7ICNA 4GKJL 2F44A 1N36L 2Z7JA 2HHWA 1XPRA 2A5HA 1VF5C 2WF7A 2SNMA 1RQNA 4O3OA 2VQEL 3M4OH 4BA2I 4B3RL 2KG5A 3I28A 2K8CB 3H91A 1N8RC 4JI0Q 1KHIA 2KFNA 3THVA 3NQIA 2P66A 4GXKA 1JE5A 5ELFA 3NUQA 5AHXA 1D5XC 8ICYA 1ZD3A 3CC2A 4CDGA 5L1KA 1P16A 4AQYL 3D8GA 2KD1A 3TRZA 7ICGA 3DMUA 4QW8A 3H0LB 8ICCA 1G6PA 1TWFH 2NZ1D 1PTOB 2L11A 3T4AC 5JOBA 5IIKA 1TS5A 4B3SQ 1SL0A 3RZDH 2AGPA 4GN4B 2KTQA 4YIJA 4PL1A 2ZJPA 1VQAA 4CDEC 3RN5A 4BJQA 2DUDA 4FDBA 3H8WA 3MR5A 3OWEB 4I28A 2FMPA 4HYKA 4GC6A 1QLNA 3MFIA 2ZIXB 5FO9B 1HNZQ 4CE6A 4RQ3A 4QWEA 3L4PA 2ID0A 3URYA 4JI2Q 3PIP3 4Z6EA 1L3VA 5J0TA 1CKNA 1RG6A 2M9VA 1LT5D 2QEJC 2PMZC 1AZQA 1KL9A 4DR6L 2PO4A 8ICIA 2LXJA 1HZAA 3M7GA 4HCSA 5C5MA 1Z7TA 1V43A 3PUZA 1ZQIA 4LF7Q 3PO5A 4QZHA 3SK6A 2V4RA 3AL0B 1JROA 3H40A 2UXDL 3KDFB 2O2LD 4PMBA 5KFQA 1PVPA 4K5XA 1AE2A 2QLTA 3IRBA 4F92B 2JN4A 1EY6A 1NK5A 1K83B 2D3DA 2BE5D 4RQ8A 2F1MA 4FS1A 4HJ5A 2A1JB 1E2WA 1IW7D 1SMXA 2R93B 4IQWA 2OCEA 2AGQA 3WK8A 3HRZC 2ESEA 2B2UA 3CD6A 4C7ZA 4DL5A 1CZGA 2K7VA 2BKEA 4LFBL 1OXTA 3HKSA 3L3FX 3GDXA 1WVLA 5J0PA 3JPOA 2QILA 3PY8A 3AN1A 1S77D 5GAEC 4IC9A 2PFNA 2E8MA 2R93H 1F2LA 5IT9E 2B2WC 1F5SA 1JOOA 5IP9H 1N61A 3BS5B 1KABA 4XTCS 1GVPA 3V05A 4K8JA 5J0WA 1KD1C 1PDQA 2A73B 2YN4A 2UUBL 4JI8L 2OT2A 1COKA 1A63A 4G4KA 4NLZA 3DV9A 3RH5A 5ALXA 2J6SA 2NWGA 4UP8A 1NSNS 5T14A 3HOWH 5J8YC 2A69C 3G6EA 3JPRA 3J80c 2AMCB 4JI5L 2W7PA 4YWLA 4KJNA 2VZAA 2UXBL 3NPPA 1P7DA 3C28A 5J39A 4QWAA 3VYSA 4DV3Q 2E2IB 4JI2L 3ORYA 2K14A 1BNPA 3X3MA 3HS0C 4K6DA 1RKNA 1D8YA 1OXJA 1GKHA 3EROA 1ZQAA 3NVVA 4GLXA 2DPIA 2ICIA 3OWFA 5E1FA 1W2BA 1TWCH 1KW4A 5AM1A 4ZRZA 4H7BA 1ZXIA 1KBUA 5C3EB 1QJOA 3TZDA 4JI6L 1L7MA 5AM0A 5F3XB 2XIDA 3DM1A 4LZDA 3RB4A 5AK4A 4AYBC 1E7ZA 2AQ1B 2VQEQ 4LNQA 3SZ2A 1S9FA 3MHBA 1EOVA 3CRXA 2JH1A 3I91A 3SENA 1QSSA 2SOBA 4HCEA 4PGQA 1LKYB 1OXUA 3R2IA 2AHOB 2FPMA 2MGSA 4ZAIA 3GQBA 3CC7A 3CCUA 4ODGA 2G08A 2ZUDA 5KFOA 2JSOA 5CYUA 2F0GA 3E9IA 5M5WH 2DY7A 2KBNA 1J5EL 4IOAA 1N9WA 1WYDA 5ELEA 5CMDA 1PH1A 4J9MA 4JV2A 5KFIA 3KHLA 9ICEA 3N7PD 1FGUA 3QE9Y 3K80C 3GD7A 1ZQWA 3C5FA 1C20A 2K32A 1I4PA 2P35A 2I5HA 4RQ5A 1E24A 4DR1Q 8ICKA 2F0TA 4Q5VA 1R9TH 5M3MB 3LWEA 1NCVA 4YY3L 3BDCA 4OX9Q 2E1EA 4DV6L 2NVXH 1ZQHA 3SK8A 4E6IA 3BS1A 4A3EB 3LWMA 1JORA 2Q2HA 4BWJA 2HHTA 3VR2A 4KX5A 1VF7A 1OTCA 3BQTA 5DGBA 3KFUF 2ZIUA 2QA4A 3K58A 5J22A 1PA6A 5IGFA 1RQLA 1K8AC 3CP8A 4DR6Q 1TS2A 1PVOA 2QF7A 4K4IA 4RNMA 1V38A 3T5KA 2CH4A 2LMRA 3VR5A 4QNLA 3JAMi 1EY4A 2YTVA 4C3JB 5ALHA 3WK6A 2G06A 1EQRA 2F0IA 1JB3A 3S15H 2Z8LA 3KZIU 4FXGC 5EWGA 2UVWA 1F44A 2KJ5A 9ICPA 2RKSA 4QWCA 3QXGA 1SMYC 2VA2A 2HDMA 5AKGA 3CHBD 3RN2A 5K36H 4CDFC 5M3FH 5DG7A 1X3EA 2BCOA 3NHHA 5HURA 4JI6Q 1MQ2A 1B3AA 1XSPA 4DUZQ 2HDOA 2WF9A 4U6PA 4RCNA 4DK6C 4EX5A 1B43A 2A74C 2E2DC 2I9GA 4Z6DA 2WB1F 5EKIA 1BBXC 3IN5A 2LKYA 2ALZA 3JPSA 3HOXG 4Y2PA 4YCVA 4PZOA 3WDNA 3HPOA 1K3RA 4ED7A 5JUMA 3CCVA 4P0PA 2MFIA 4WRDA 2ODGA 1Y14B 1T8EA 4X62L 3KLSA 2EAMA 3H0GH 5COYA 3NGDA 5BOLA 2F1HA 2LXKA 1WYGA 5EE0A 3PV0A 4X3TA 3P20A 1BPBA 2VA3A 1FVIA 2FXQA 1QTMA 4B9SA 4IUVA 1L1OC 5KFCA 2KENA 4OELB 3C2PA 2FMMA 4TVAB 4ZUJA 1HPCA 4YMMA 5J0XA 4IQZA 1L0WA 4A4IA 4DV2L 2BA1A 3SEIA 4N9PA 1IBLQ 1N33Q 3EIVA 3GTLH 1MI2A 3ULLA 5ALOA 4RH6A 2E1FA 1SE2A 3J80L 3T1YL 3QB3A 4J9PA 5D4BA 5ELCA 4J9RA 3PSTA 4EELA 3RH4A 1LM0A 4KN7C 1SR3A 5LMNW 4DR3Q 3GZFA 1IIPA 1Q81C 3WKAA 3AQFA 2P5ZX 1QVGA 1LTBD 4Z6FA 4DR2Q 3MXUA 5GAGC 2SNSA 4HIMA 1IW7C 2BH8A 3MC0B 1IBML 4A3FB 3PX0A 4TUSA 1CKMA 5JJZA 1T5EA 1MJEA 3K6OA 4Y2VA 7ICJA 3TADC 2IOFK 4DV7L 3HILA 1I4QA 3BJYA 1G291 2A1JA 3IP4B 4NL9A 1CKOA 4G7ZC 1ZQMA 4BXXG 4RQ2A 4QB4A 3CCSA 4HAIA 2RSOA 1EY5A 2W3SA 1C48A 5M5YB 3AB9A 5KTQA 1RDFA 3EUB2 5J2FA 3EN2A 3VC8A 4F88A 2ASLA 2AUKA 2KA7A 1HTLD 4PMCA 3GTQB 4YWKA 3ISBA 1E1OA 1B1ZA 1YZ7A 5EQ0A 3ALRA 1HCZA 2B8FA 4GLAC 4J1MA 1JMSA 1RCVD 4DNRB 5D46A 2ES6A 1Y1VB 2PW7A 3H8SA 2K05A 1BXTA 2JK8A 1CA5A 3ERSX 1I3QH 4OD0A 2CVRA 2BCQA 2EYLA 3VYUA 2NYVA 1VQEA 4GN5A 3PUXA 1RODA 2NN6H 2HBJA 1NMFA 1TWHB 1CHPD 1ENAA 1WTQA 5EPJA 5EPLA 1DJRD 1V8QA 8ICMA 4YVZA 2AGOA 5F2DA 3KF8A 3STBD 4OCZA 3QG1A 4DEZA 2KV2A 3M9OB 1TT2A 1EYCA 2MUYA 2O5JC 1GUWA 4Y2RA 1CHQD 5M9OA 3PO3H 4FS2A 1KDBA 1QWYA 2JEFA 1AROP 2IHNA 3GTKH 4N9TA 4EYIB 2D8CA 1EZ6A 7ICKA 4R4TA 1KN5A 4C4RA 3K8AA 3TN2A 1JALA 1RTOA 4CBVA 2W9CB 5AM3A 3IDWA 1D8LA 4KLIA 3DWPA 2XVTA 2KECA 3SR6A 1JWUD 1U4PA 3UXNA 2F0DA 5ALQA 3HOUH 4J15A 5ALYA 5DGAA 3KLRA 3LWUA 2KIVA 4ECTA 1L0YB 1SE8A 3OHAA 1TQOA 2A68C 2L4NA 3BJUA 3U9SA 4A3JG 3BVZA 3KBGA 2W43A 3OJSA 5H2FU 2ZXPA 3TAPA 5EE9A 3S16B 4PGXA 1W6JA 1X32A 3GO5A 3F2CA 1QSLA 3EFXD 2GH1A 1PH5A 5IYBG 3UDIA 2EQSA 1S0VA 1BUVT 1U5KA 2Q0ZX 3NVZA 3HX0A 3MXPA 4LUVA 3BDPA 2WHEA 5KAIU 1SDFA 2MAXA 3PNCA 1A0IA 3OSPA 5CV5A 3AUOA 3IL8A 2YYZA 2GLEA 4YG2A 3U4VA 4DL4A 3RJFA 1BCPF 1LV5A 3PMLA 1EU4A 2NZOA 2EXDA 2K28A 3KJPA 5J2GA 1SZHA 4JK1A 4QL5A 4N8X1 2L12A 2ZJ8A 5CB1A 1HZCA 4R8NA 1ZQEA 1TS3A 3PX4A 3PCOB 1RYUA 1ZD5A 2Z6KC 3CQZH 4YHHL 3QX7A 2QEXA 4QZBA 3FKIH 3SQIA 2K50A 1B9NA 4I7AA 1EQQA 2IX0A 5C0XH 4YFKA 1TR5A 1G2TA 1I4GA 2MP1A 4ECRA 3NVYA 3R2TA 2YMMA 2G09A 3JAMc 5KG2A 1ZD2P 5AI4A 2BDNA 1LV9A 5KFTA 1N5XA 1JXLA 1A6SA 4IO9A 2NYZD 3MDCA 1I6HB 2F0EA 5IYDH 5DBCA 1K1QA 1FO4A 1X6OA 3RUZA 1PYWD 4UB4A 3BQ1A 3RB3A 4BBRH 1D2BA 2R8KA 5AK5A 1MD2D 1U4BA 1BDOA 3J7AF 8ICFA 1YVCA 7ICRA 4RHRA 4F5RA 4X66Q 5LMUQ 4ME3A 3H8MA 1D1IA 3IRUA 5L1MA 5IYBH 1AH9A 2E75C 4BY1G 2EDGA 2Z6BA 2WP8J 1A76A 2Y9UA 2K75A 4YMNA 4A93G 3DM3A 2BDPA 4KMUC 1H9KA 3U26A 4F4ZA 4RT2A 1L3TA 2EXZA 1QCBD 4KHVA 4C3IB 4DQRA 4A3EG 3TBIB 3MC1A 4RPXA 1D1KA 2FFKB 3KLSX 1SGGA 5KG5A 2YU9B 1ENCA 1QE6A 3PUWA 4UAIA 3FKIG 5GTHU 2Q2TA 3GTPB 2OQ0A 2HHXA 5CORA 3HJEA 4LVSA 3SDZA 3S6JA 5AKEA 1WJJA 1E22A 2R7FA 5I4DA 2ZT9C 5J2CA 4I7ZC 4C3JG 3UQ0A 4QWDA 1MA7A 3DWQA 3TREA 4LFCL 4GNXB 1QZGA 1YHAA 4DSLA 2F0PA 4J9NA 4ECZA 1Q86C 1UE1A 4KLGA 4B9NA 4UP7A 1K5OA 5TSSA 8ICPA 4OONA 3WOEA 1CK1A 2WV6D 3QUTA 4RGOS 4X3SA 3EWAA 2PZUA 1V1PA 1S0NA 1U45A 1WCMB 1S97A 3AU2A 5KYLA 5BR8L 3TS0A 4F91B 4LF9L 1S5LU 1BF4A 2BQRA 1HFGA 4ZUIA 5IE8A 1U4RA 8ICUA 5I6YA 4HIDA 3HOZH 2DJGC 1XYIA 3E58A 4Y2SA 4PHDA 2E2JH 1PFSA 4Y7NB 2AQ4A 4JI4L 1K1SA 2Z0SA 3KOJA 1WG8A 4RAUC 1M6YA 3OW7A 1H9MA 3M9NB 2B39A 5G5GA 4M9NA 5C4ZA 1VQNA 3NASA 2PNRC 3A5ZB 5BN5A 3ULJA 2UUCL 1RIPA 4XT1B 2G5HB 2QARA 4BXOA 1HNZL 4BGDA 5KFXA 2FPKA 4TQUS 3S1MB 4LK1C 1AFPA 4IPHA 4X5VA 3G48A 4V190 3PMNA 1BPDA 5J2BA 4CGZA 2EH9A 1VQBA 4XYOA 2ENBA 2I5MX 4FZLA 2XCPA 1SYBA 3T79A 5J0OA 1RJTA 2WAQB 3OMCA 5ALPA 2XRQD 2XICA 3S1QB 4B3MQ 3LK9A 4KLMA 4GKJQ 9ICFA 1FNUA 3NVWA 3MZ5A 1CI4A 2KCMA 1SYFA 2OXPA 4DS5A 4R8UB 5AKXA 3T3FA 4KHPQ 4RPZA 2IJ0A 4MFAA 2IHEA 4X64Q 4RUCA 5C3WA 4UQGA 3UMCA 3HT3A 2NRVA 1S10A 4KLKA 1Q8IA 1SNPA 1F9SA 4GOPB 2KSOA 4RGNA 3K1ZA 4DUZL 2G5DA 1STEA 3NSWA 2Y0SG 2VIXA 2JEBI 4PZNA 5KG4A 3C2KA 1JXEA 4BS9A 3S1MH 1CI3M 1B7YB 3GIIA 1KLUD 4ELUA 3H3VH 2DKXA 3H7IA 3RTVA 1ZYRC 2B2WA 3KLWA 3MA2B 3NXWA 2H1EA 1E2ZA 4C7YA 3G6XA 4ZLTF 5C0XG 1K0SA 3NTUA 5CBEE 4OEMB 1Z4OA 2E2JB 2RHQB 3K5NA 1H38A 1LT3D 5AKLA 2K89A 2K8BB 2AXTU 3HZXA 2NO5A 1O7IA 2QKQA 3QUBA 3UMGA 2W54A 3RR8A 7ICLA 4LJZC 2BQUA 4DXFA 2JEIA 1B3QA 1PFNA 3I56A 4NLKA 3NWTA 1M1KC 2UXDQ 4FZMA 9ICOA 1LTRD 1PRTB 4DV4Q 4A93B 9ICNA 3NBIA 1FJGQ 1WCMH 2JYOA 1XPOA 2NVTB 1AQ6A 2P6UA 3J80E 2ZTCA 2OTLA 4UB3A 4ED6A 4DF4A 2YY6A 4FFDA 3RRGA 3A8KE 4Y52H 4HEDA 4WJ4A 1KRPA 3UXPA 4BBSH 5KFYA 4DOCA 2NZHA 4R65A 2KE7A 1YNJC 1BBWA 4AP9A 1S0MA 4MEXA 3GP7A 5J0YA 4FF4A 2ZJ5A 1STBA 1GHJA 1Z19A 4FYDA 1TXYA 5J2DA 5KFKA 2XY7A 2M2LA 4LFCQ 3T5JA 4US8A 5IWAL 1T94A 2IOHA 3EJIA 3CMAA 4A3BB 1ONLA 3DUZA 5CV6A 4K5VA 5A2QL 4LFBQ 3BYYB 4QZDA 4DF7A 1NTGA 2RDJA 3MEHA 1OW5A 2PNHA 4EQPA 3CNHA 7ICSA 2KZ3A 1NMGA 9ICIA 1JE4A 4NM2A 2QARB 3I3CA 4O5EA 1XTDA 5CV9A 1KAWA 2YU9H 4IQTA 1RM6C 3HGBA 1B0XA 2JA7H 4M04A 1PFBA 3V6JA 4KTQA 9ICCA 1EEID 3VDYA 4P71A 3HOXH 5DB8A 3JPQA 4NMZA 3QU9A 4XUSA 3V96A 2O4XA 8ICAA 1HZBA 2Q8RE 2WAQG 1ZQLA 4DNTB 3QU5A 4ED8A 3OHBA 4KK7A 1X2IA 5FO8B 1Z1VA 9ICHA 3FAHA 2L0CA 1PTOD 1NZPA 3X3NA 5I9OA 3CPFA 2NVTH 3Q8QB 1SJED 2A1AA 4DR1L 5J0UA 4NY8A 3E5SA 2X6GA 4A3IG 3TACB 2KKVA 2DL0A 2ZUCA 3P75A 1WD1A 4YN4A 1TAUA 4DV6Q 3V7LA 3E9HA 2VB2X 2N8NA 4AIMA 1WTOA 3QR8A 4JBWA 1LYLA 1HR0L 2XY6A 5KFLA 2PPBC 2FJ2A 1NKCA 2ASBA 4JYAQ 2PFOA 4E0DA 1EIFA 1KLGD 2O5IC 4A3GG 4F4KA 1ZQRA 1EYAA 2B2VA 5DQHA 3TDQA 4DAPA 1SFOH 4EZ9A 2JJQA 2KEYA 4QZFA 1XMQL 2KICA 3UMBA 2YTXA 1HUNA 2ZJAA 1DONA 3E3XA 1N48A 2HSZA 5ELNA 2OTJA 4DUYQ 1ZQTA 3K1RB 1LT6D 1WCNA 3CQZB 4IZ8A 4K14A 3ETRA 1EQVA 3NBHA 2PI2E 5ALRA 4BWMA 5JU5A 3FDTA 1J9OA 5BN4A 1ESFA 1TFRA 4DU9A 3S17B 2GWSA 3W5OA 4X3KA 4L6TB 4ED1A 2W11A 4M9HA 3WWVA 1SNOA 4U7CA 2XY5A 1QNKA 4AYBB 4DN4M 4DAVA 3A55A 1VQGA 4LZGA 4R4OA 5ALWA 2F0KA 2EZVA 1ECWA 3S1QH 3B9JA 3QOJA 1LACA 3T13A 3T51B 4GXJA 2NVYB 4JV5Q 3N6RA 2K03A 1I4XA 1ENFA 4TUQA 1SFOB 4RQMA 5IP9G 3NENA 3IM1A 1HXYD 3QU4A 5IIMA 4F8MA 4IPCA 1NJIC 4K5WA 1ET9A 3QU7A 2LI6A 3G6YA 1TWGH 4MHVA 4DV0L 4DFMA 3BQ2A 3KK7A 3NE5B 2B0CA 1LLRD 4CHTB 1M8AA 2UUAQ 4US9A 3OYYA 2BPGA 3UDFA 2Z6KA 1A62A 2BOSA 1YNXA 3VR4A 1SB3C 1O7ZA 2K4HA 1BCPC 5FJ8G 5HMMA 4M8AA 4GZYC 3EPIA 4BY7G 3VCBA 2RF4A 4RCOA 3UI2A 1WTPA 2CWAA 2K33A 3A8JE 4O42A 1SYDA 5KT6A 2W04A 4IJHA 3SAGA 5C0XI 4OO1H 2R92G 1FEZA 1ASYA 1XO0A 4Y7NH 2JA6B 1QNUA 1ZRMA 3FPUB 4A3LG 2K60A 2FLNA 1HA6A 3PO3B 4GLVB 1IYVA 1H9JA 5EKKA 2ZJRA 4RFBA 1K73C 1BNZA 1I4RA 1HNXL 4M2YA 1PTOF 2D9UA 2I1QA 4CJ1B 3RJIA 3T53B 4RMFA 1CZWA 2WACA 3PW0A 3FEWX 3WK4A 2OM6A 3QUQA 2PKEA 4B08A 4NXNQ 2OXOA 2OF1A 4XQNA 2I5LX 5IT9L 2ZM6L 4CKCA 3OW2A 1O08A 1DYQA 1ILPA 4K2LA 4TQRA 4IUQA 2BHNA 4IFDG 2WB1B 4GOPA 3RR7A 3M9BA 1N60A 3J80i 4POGA 4DGZA 1M90C 2DPJA 4MN3A 5JAVA 1SL1A 3KF8B 1UUPA 3D3RA 2KHQA 3Q8KA 1EIGA 2ZIWA 1PTOC 3HKZG 5IY0A 5JPNC 4OO1G 4KLSA 4UY8C 2ZTEA 4XA5A 3GTQH 1MHWC 5KFUA 1KKXA 1EZ8A 2L5TA 2PQEA 3C3LA 4PHEA 1A3UA 2WB1C 5FJ8H 3CPWA 1PH8A 2K1BA 1A3VA 3I90A 1SV0A 3PX6A 4UATA 1GUOA 5KYIA 1X3GA 2C5CA 3I70A 1IKLA 1A2TA 4DV2Q 4HJ7A 4EBCA 5AICA 5JTIA 2C2DA 1KFDA 3GDEA 4KKSA 2D2CC 1PVRA 3BS7A 3CCRA 1L3SA 4I2EA 3H94A 1GD7A 2R7DA 4YWMA 1NR2A 4ED0A 4A3IB 2VKQA 4B3RQ 2JHDA 4YR2A 5IGEA 3GU3A 4GKKL 2GVBA 4R8IA 2CXYA 4NWIA 5ALMA 1SNQA 4DV7Q 2NTTA 3SVMA 4DR2L 5L37A 4ILWA 2YX8A 1PRTC 2N1RA 3AFQA 5C3XA 3LGJA 3MGIA 1BQQT 1I4HA 3M1YA 5CR3A 2H3FA 1EY7A 2Y0SE 3K4GA 1ZXTA 2E74C 3K5OA 4P73A 4GNXA 4IOCA 2A8VA 3GTGH 1VQLA 5LL6X 1O78A 4ECVA 4IFDJ 5AJ3L 2F76X 4IR9A 1QCKA 1FGBD 4TQSA 4J9LA 1TU2B 2F4VL 3M4QA 4M1UB 3C1FA 4JI8Q 1WI5A 2E2HH 5AM4A 4NL9C 4R1JA 2QW7A 3TP5A 4LFAL 2JA7G 4YR0A 2GOLA 1PH6A 4DQQA 1RF2D 2CKZB 2H5XA 2VANA 2VA8A 3TADA 3A7LA 3RJKA 1F77A 2KKPA 3H0GB 3AFPA 4EQ5A 4EVOA 1VQFA 3KKAA 2HOFA 3HOZG 3PZPA 2KHJA 1ZQPA 3RJJA 2YTYA 3IFDA 4CKBA 4DV3L 1VQMA 4L5SA 4YCXA 4M9LA 3KHRA 2XVSA 4H44C 1LABA 3RZOH 4HJAA 1KXLA 3SGIA 5ALUA 1U9LA 4I2HA 3HFZB 2KHSA 4KD4A 1BKBA 4KLDA 5A2QE 4EBDA 2A6HD 3M9MB 1Y8OB 2KSOB 2RVLA 3IFTA 5AK6A 2XGPA 3K5MA 4ELVA 3Q6SA 3T5LA 2R61A 4QY7A 1EFID 3SR1A 2AJQA 4YCWA 3HOYH 3D6JA 5JRTA 4BXOB 3OSOA 1Y88A 5IIFA 5KFDA 2F8KA 1MSWD 3KUPA 3JPTA 4C2MB 1HNXQ 4J9OA 4YHHQ 1SXTA 4WJWA 4C3JH 3U4ZA 3S15B 4GIBA 3OOCA 1B9MA 1PHJA 3J7AV 4F50A 3JPPA 2AQ0A 5KFZA 2LFNA 1MC8A 3BS5A 3HP6A 5ALFA 2Q8IB 1NK7A 1PZKD 4ECUA 3L9AX 4MTKA 2YMPA 1EY0A 2W55A 4F3OA 4M6WA 1UEBA 4N8FA 5C4XH 5KNBA 4DFDA 4QZIA 4DV5L 3EZ5A 3RD4A 3OIPA 3RR5A 4A3EH 1A8VA 1K28A 4LF8L 2NVXB 1PMRA 1YJNA 5M3MH 4M9JA 4H0LC 9ICSA 1GO3F 4KD3A 3I72A 1C4QA 2VUMH 3I4NB 3EQLC 4IQUA 1XNRQ 3ZYYX 3WOFA 4POFA 1XNQQ 3D0FA 3FP9A 1Q1BA 3MFYA 5ALEA 2E5LL 1LB2B 3KYHC 3RRHA 4DAYB 2XGQA 2UVUA 1HZ9A 2HCCA 3R9KA 1NBWA 3K75D 3HKZF 1K8OA 5FKAC 1TWHH 4OX9L 4Q45A 5KFEA 2F0FA 5KG3A 5IIOA 4DO9A 3OJUA 2G9DA 3HKZB 4KN4C 4BDPA 4K8IA 4DKAC 3MR3A 1X9WA 1V1PB 3A0HU 4OL7A 1NJYA 1D6EC 4B9MA 3Q8PB 2F0OA 5EGTA 5IWAQ
chains in the Genus database with same CATH topology
2K50A 5C3EG 4WJ3M 4DUYL 3K7UC 5FLMG 2IX0A 5FLMH 1EQQA 5C3EH 1XJVA 4OWTB 3RLNA 2N3SA 4C3HH 1SLJA 1EFWA 4GKKL 3CCEA 1Z9FA 1YJWA 1VQ6A 2C35B 1CSPA 2MQHA 1I94Q 4NXML 3JAMc 5M5YH 4L5QA 1EIYB 5JEAJ 2WB1E 3PF4A 1L1OA 3J7A5 2D0PA 4IO9A 5LMNQ 5IYDH 1NY4A 2E2IH 1X6OA 1X56A 2EIFA 4XIGS 4AYBG 4B3SL 3UE0A 1YHBA 1VQCA 4BBRH 4LF6Q 4PZ8A 4AQYQ 2BH2A 4IJLA 4OXPA 3NBHB 1YVCA 4X66Q 4DV1Q 1P8LA 5LMUQ 4ME3A 5IYDG 4QGUA 5DLQE 2ZJQA 4LF8Q 1K0RA 3CMAA 4GOPC 4HJ8A 3AEVA 5IYBH 1AH9A 4BY1G 3I2ZA 2WP8J 4LFAQ 2K75A 1U0LA 3A5UA 5C4JH 1JJ2A 1ASZA 3DM3A 4A93G 3B6YA 4JG2A 1CKNB 1MIUA 4A3EG 4JI7L 3U58A 4A3CH 3L2PA 3FKIH 3H15A 1PYBA 2Q2IA 3F2BA 2I0QA 2ATWA 4YY3Q 3PUWA 3E0EA 4JI7Q 3FKIG 2Q2TA 2OQ0A 4JBMA 1YI2A 3MXNB 1VQJA 4DAMA 5M5XH 1IZ6A 1WJJA 4APVA 1E22A 2R7FA 1KQSA 3GTMH 1Y1WH 1DGSA 3S2HH 1QUQA 2UXCL 3TREA 5IP7G 4LFCL 4GNXB 3ULPA 1YHAA 1QZGA 2B29A 1IBMQ 4JI1Q 5JJLA 3I4OA 3RLOA 4DNIA 1AE3A 4DR3L 2CWPA 1Q86C 2VS1A 1K83H 1UE1A 3HOYG 4UP7A 1Q1EA 1N36Q 4P75A 3W1GA 4OONA 4IPGA 3J81j 5C44G 5JEAG 4A3MH 1XMQQ 4JBJA 3U50C 2WAQE 1VQ5A 3PIOA 4A93H 5BR8L 4JI3L 5HGQA 3TS0A 4LF9L 2MO0A 2NN6I 5M3MG 5IE8A 4NB3A 1VQ7A 2K52A 2WFWA 2UUBQ 4HIDA 3HOZH 5C44H 4A3JH 1Q7YC 2E2JH 4BBRG 1PFSA 4LUZA 3PUVA 4X65Q 3G4SA 1VQKA 2Q2UA 4JI4L 2QGQA 3HOUG 2Z0SA 1CUKA 2VY3A 3CCJA 3KOJA 3PUYA 4JOIA 1V9PA 4JI5Q 1SROA 4X66L 4AYBE 4KI0A 2A19A 4X65L 3OTOQ 1VQNA 5IP7H 2ALYB 1W3SA 1SRUA 2PMZE 3A5ZB 4UP9A 3ULJA 2CCZA 1IL2A 2UUCL 3ICEA 1RIPA 3HOVG 2JEAI 1HNZL 2JA6G 1QVCA 4TQUS 1PV4A 3I4NG 4IPHA 2YV5A 2ZTDA 3G48A 3PO3G 4RG1A 1WFQA 1UWVA 3L7ZC 1VQBA 4PMWA 3UDGA 4A3CG 5GROA 1TWAH 5C4XG 4X6AH 1FL0A 2I5MX 1BVSA 4GKJL 1N36L 1XPRA 2NVYH 4A3FG 3AYHB 2HIXA 4BY1H 4B3MQ 3DLLA 2VQEL 3M4OH 4BA2I 4GKJQ 4B3RL 2KCMA 3CCQA 1N8RC 4JI0Q 3GTOH 1KHIA 4A76A 1QZHA 4NXNL 4QJFA 5GAHC 2JE6I 4B3ML 4KHPQ 2IHEA 4X64Q 1VQOA 1JE5A 3CC2A 2F4VQ 4AQYL 1P16A 4KLKA 1I94L 1VQDA 1GM5A 3TRZA 4GOPB 2VUMG 1JJGA 4DUZL 4A75A 1G6PA 1OXXK 2Y0SG 1TWFH 2JEBI 2N49A 2K5VA 5FLXc 4B3TQ 3UDXA 3TS2A 3UE1A 5JJKA 4OWWB 4B3SQ 1B7YB 3RZDH 1XNQL 4GN4B 3CP0A 2N78A 3H3VH 1B8AA 2ZJPA 1VQAA 3RN5A 3KLWA 3S1RH 5C0XG 4DV0Q 2UUCQ 2DUDA 4FDBA 4DR4Q 2IT1A 4A3DG 4JBKA 1HNZQ 2RHQB 4LWCA 1KRSA 1X55A 2ID0A 4JI2Q 1O7IA 1EWIA 1CKNA 2CFMA 1KIXA 1KL9A 4DR6L 3I56A 2LXJA 1HZAA 1M1KC 2UXDQ 4DV4Q 1V43A 3PIPA 1FJGQ 1WCMH 3PUZA 1XPOA 4LF7Q 3PSIA 2OTLA 2ZTCA 2E8GA 3JC66 5M3FG 2UXDL 3KDFB 4AH6A 2JA5H 4Y52H 5K36G 4WJ4A 4BBSH 1HJPA 1H95A 2NZHA 1AE2A 1BBWA 2AWNA 1NE3A 3IRBA 1K8GA 1Q8KA 2JA8H 1TXYA 1VQPA 3KDFA 4LFCQ 5IWAL 1IBKQ 1VQHA 2HHHQ 3D31A 4HJ5A 4LFBQ 1SMXA 2JA9A 2GVAA 1C7YA 4DR7Q 1NTGA 4JOIC 2OCEA 2WB1G 4DPGA 4GKKQ 3KF6A 3CD6A 2PNHA 1XMOQ 4H02A 3M7NA 4LFBL 1OXTA 1NMGA 3HKSA 5GADC 3GTPH 3I4MH 2R7ZG 1XTDA 2LSSA 1PH4A 1KAWA 2YU9H 1Q12A 1SN8A 5GAEC 1RL2A 3K81C 2UU9L 4LUOA 5H1SE 2R93H 2JA7H 5LMNL 3F1ZA 4C3IH 4X62Q 5IP9H 4P71A 5IYCH 3HOXH 4XTCS 1GVPA 4YCUA 5AJ3Q 1PH9A 4A3BH 1KD1C 4K0KL 1HZBA 2UUBL 1JJCB 4JI8L 2WAQG 1UE6A 4HJ9A 1A63A 1J5EQ 1YJ9A 3CMEA 4BXXH 4UP8A 3HOWH 3CPFA 1IBLL 3G6EA 3J80c 2AMCB 4JI5L 2NVTH 4YWLA 3S2DH 3I7FA 2VZAA 2A1AA 4DR1L 1KC8C 4A3LH 2UXBL 2B3GA 4A3IG 3CCMA 1FJGL 1OXSC 2L15A 3A74A 4DV3Q 4MNOA 3S1NH 3A0JA 4L5TA 4JI2L 2K14A 4DV6Q 2B63G 3E9HA 2N8NA 2NN6G 4AIMA 1QVFA 1LTLA 4JBWA 1LYLA 1HR0L 1GKHA 2IX1A 4GLXA 2ASBA 4JYAQ 4PG3A 1W2BA 1TWCH 1EIFA 4A3GG 4QQBX 1N32Q 1UE5A 3BU2A 1SFOH 3RLFA 2JJQA 4JI0L 4LF5Q 1XMQL 2UXCQ 2YTXA 4JI6L 5ELNA 1VCIA 1XMOL 2OTJA 4DUYQ 3STBC 2R6GA 1Z47A 4LNQA 4PZ7A 1E7ZA 4LF4Q 2VQEQ 2PI2E 3PGZA 1L2FA 2HHHL 3PO2H 1EOVA 1C9OA 4O0AA 3CC4A 4X64L 3W5OA 1VQ4A 4MZ9A 3CF5A 4DV1L 1OXUA 3CCUA 2AHOB 2PQAA 4MTNA 3CC7A 1L1OB 3WWVA 1CSQA 4DV5Q 3E9IA 5M5WH 2KBNA 1J5EL 4IOAA 1VQGA 1N9WA 1WYDA 4R4OA 1PH1A 2DGYA 4A3KH 3S1QH 2UU9Q 4JCVE 1WOCA 2D62A 3K80C 3Q8DA 1FGUA 4O2DA 5J3BA 2VW9A 4B3TL 4JV5Q 3GD7A 3K0XA 2I5HA 4A3BG 1E24A 4DR1Q 5IP9G 1UE7A 3NENA 1R9TH 4IPCA 4YY3L 3RNUA 3GTJH 4HIKA 1NJIC 4DV0L 1TWGH 4HIOA 4OX9Q 2R93G 3KFUA 4DV6L 2NVXH 1J6QA 1YIJA 2UUAQ 2E5LQ 3OYYA 3K7AH 3UDFA 3KJOA 2Q2HA 3I4MG 1S40A 2Z6KA 1KRTA 3S1MH 1A62A 2BA0A 3M3YH 4OO1I 1YNXA 1I50H 1OTCA 2R92H 2QA4A 1Q46A 1PA6A 1K8AC 5FJ8G 4DR6Q 1YHQA 1PVOA 4LF5L 4BY7G 4BY7H 3L0OA 2RF4A 2CWAA 2B63H 3M85A 1Q82C 3JAMi 2YTVA 1IBKL 3VDYA 4IJHA 5C0XI 2JA8G 1EQRA 2R92G 3S15H 3H3VI 1B70B 4C2MH 1Y1VG 3H0GG 1ASYA 4NXMQ 1QUQB 4Y7NH 4LF4L 4A3LG 4KHPL 2VQFL 3S24A 3RN2A 3CW2C 4GLVB 5M3FH 2V1CC 1X3EA 2ZJRA 1K73C 1VS0A 1HNXL 4JI6Q 1YITA 3AQQA 4DUZQ 4RMFA 1IXRA 2AKWB 4DK6C 4NXNQ 4EX5A 1E1TA 3J81c 2I5LX 2ZM6L 1S3OA 3HOXG 3OW2A 2GN5A 4YCVA 4IFDG 1PH3A 4LF9Q 2HT1A 4GOPA 2F52A 1HR0W 4A3DH 1K3RA 2ZM6Q 1YBYA 1YEZA 3M9BA 3J80i 2VNUD 1N34L 2F3IA 4POGA 2RHSB 3CCVA 4KHZA 4LF6L 2MFIA 4IFDI 3CCLA 3J81i 1Y14B 1M90C 4X62L 1Y1VH 3H0GH 3KF8B 5IY0A 2LXKA 3HKZG 4OO1G 3PV0A 5C0XJ 1D7QA 4UY8C 2ZTEA 1FVIA 2FXQA 1I5FA 3NEMA 3GTQH 2IY5B 1XNRL 1L1OC 2KENA 4LW1A 5FJ8H 4L5RC 3M4PA 4TVAB 4A4IA 3CPWA 1L0WA 1PH8A 4IPDA 4DV2L 2RCNA 1IBLQ 2BA1A 4LF7L 1N33Q 3G71A 3EIVA 3GTLH 3ULLA 1I6HH 2MNAA 1X3GA 4BBSG 3T1YL 2JA5G 3CAMA 1GO3E 2HQLA 4DV2Q 4HJ7A 3GDEA 1LM0A 2PI2A 1BBUA 5LMNW 1SR3A 4DR3Q 1Q81C 4A3GH 3J7ZC 5EAYA 3CCRA 1XPUA 1V1QA 5HY6A 3T1HL 1QVGA 1GD7A 1LUZA 2R7DA 3FHWA 4YWMA 4DR2Q 1MKHA 5GAGC 4HIMA 4B3RQ 4A3FH 2GVBA 2BH8A 4DV7Q 1IBML 4JC0A 4DR2L 1CKMA 1HR0Q 4A3IH 3AFQA 4A3KG 2K5HA 1MJEA 1VQ9A 1T9HA 3LGJA 4JI3Q 2JQOA 4DR5L 4DV7L 2VQFQ 2ES2A 3NELA 3HOWG 1G291 2Y0SE 4P73A 4GNXA 1CKOA 4DK3C 4IOCA 2A8VA 4BXXG 4DR5Q 3CCSA 2KCTA 1VQLA 3GTGH 3HOVH 4IFDJ 5AJ3L 5LMUL 3PO2G 2F4VL 4JI4Q 3M4QA 5BR8Q 3EN2A 4JI8Q 1WI5A 2E2HH 2NVQH 4JV5L 3PF5A 4R1JA 4R4QA 4LFAL 2JA7G 2XGTA 4YWKA 1E1OA 3OTOL 1YZ7A 2AWOA 2HIVA 4GLAC 2CKZB 2XTIA 2H5XA 1PH6A 2K5NA 3AFPA 4EQ5A 4R4CA 1N34Q 2MO1A 1VQFA 5JJIA 2JK8A 3HOZG 2KHJA 3TQYA 1VQMA 2YTYA 2D0OA 3MEFA 4DV3L 3ERSX 1I3QH 3CXCA 4L5SA 4DR4L 3KF6B 4ALPA 1VQEA 3EBEA 3PUXA 4GN5A 4GN3B 4HJAA 3T1YQ 3RZOH 1KXLA 3SGIA 1NMFA 3HFZB 3ZJYC 1BKBA 4BA1I 1IYJB 4JYAL 2UXBQ 3T1HQ 1HNWQ 3BZCA 3STBD 1K9MC 4JI1L 4QY7A 4R4IA 4DV4L 3ER0A 4YCWA 5IWAQ 1S72A 3HOYH 5IT9c 1WCMG 2KHIA 3PO3H 3I4NH 2JA6H 3HKZE 3GTKH 1MJCA 2PQAB 1N32L 1HNXQ 4YHHQ 3S14H 4R4TA 4C3JH 3U4ZA 1X65A 3K8AA 3F2DA 1Y1WG 3S16H