3AEVA

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
EYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLAAEKLGKDFEAAWREVWVPLEEEWGEVYAAFEDAAKDGIEVLKGHVPDEWLPVLKEIVENYVEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit alpha
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3aevA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aevA01
1FVIA 2MNAA 2B63G 4FDBA 3AQQA 1N34Q 3OTOL 2K5NA 3CCQA 4DR7Q 1SLJA 3BZCA 4NXMQ 4ALPA 2VQFQ 4LF4Q 5BR8L 2R92G 1VQLA 4IPHA 2LXKA 3G48A 3RR5A 3CF5A 2OQKA 4LNQA 1UEBA 1SN8A 3RN2A 4DV1Q 3PO3H 2EQSA 4B3SQ 4DUZQ 3A5ZB 4BBRH 2UUCL 4JI4L 3GTKH 2PMZE 1IBKQ 4C3JH 4GOPB 3S2DH 1G291 2IX0A 3LGJA 4YY3L 5C4XG 4X62Q 2K14A 4A93G 4L5TA 1EOVA 3GTLH 3F1ZA 2K52A 1YNXA 4JI5L 1KIXA 1VQCA 5LMUL 4JC0A 4LF6Q 1Q12A 3FP9A 2JA7G 3F8TA 1FJGQ 4KHPQ 5IYDH 4DAMA 1L1OC 1EIFA 3ERSX 3W1BA 1XPOA 2OCEA 4KI0A 4X64L 4LF5Q 3HOYH 4GKKL 2AHOB 2UXDL 3T1HL 5IP9G 2R6GA 3JAMi 3MXNB 1D7QA 4HIKA 1CSQA 4A3FG 4A3BG 4GN4B 4BY1G 1IBLL 3HOUH 3I4MG 3ULPA 1N36L 3KLWA 3RLOA 1CKOA 1CKNA 3AEVA 4DV7Q 2DUDA 2R7FA 2PI2A 2LXJA 2NVXH 3CMAA 1SE8A 3ULLA 3H0GG 4A3EH 3I4OA 3J81j 4L5QA 2JA9A 2MO1A 3J81c 4A3MH 4DV3L 1KXLA 2KCMA 2NVQH 1VCIA 1WFQA 4QIWE 3HOXG 4ME3A 1X3GA 1I94Q 2B29A 1VQFA 4MTNA 1BKBA 1KHIA 4GN5A 3U50C 3A5UA 4JI8L 3UDIA 4EQ5A 1VQ8A 1ASZA 1L2FA 5ELNA 3RLNA 3IRBA 1Y1WG 4OO1G 4WJ4A 4A3JG 1YZ6A 2ZTEA 4DV5L 3KF6A 4GKJL 1J5EQ 3E9IA 1AE3A 2JJQA 3FKIH 2CWAA 1Q1EA 1CKNB 4IJHA 4LW1A 5IYBH 4DUYL 3ULJA 2RHSB 1PFSA 4X65L 3J80i 1KC8C 2VUMG 2RF4A 1AE2A 3HOVG 4JI2Q 5H1SE 3S1MH 1HZAA 2Z0SA 2K5VA 5FLMG 1HH2P 4GS3A 4P73A 1Z9FA 3HKZE 4UY8C 4X66L 2R7ZG 1HR0Q 3UE0A 4C2MH 2JA6G 3W5OA 4P75A 4IFDG 1HZBA 1YVCA 3I2ZA 3I7FA 2WB1E 3U4VA 4A3GH 1E7ZA 3ER0A 1XMQQ 3T1YQ 1BBUA 2NZOA 4A3KG 1XMOQ 2UU9Q 1HNXL 2ASBA 4DV6Q 2I5HA 1V1QA 1M90C 1VQDA 3KF6B 3CC2A 4GNXC 3CCSA 2ZTDA 2MFIA 4JI7Q 3TRZA 1LTLA 4AQYL 4AIMA 2F52A 1VQJA 4JI6Q 3S16H 2Y0SE 1EQQA 5AJ3Q 4R4OA 1NY4A 3PUZA 1OTCA 3GTOH 5C4JH 1N34L 3J7A5 4JYAL 3CCEA 4L5SA 1R9TH 1JMCA 2AWOA 4YWMA 1A62A 4DR7L 3EIVA 4IOAA 1UE5A 4NXML 4J15A 4JI3Q 5C44H 3HFZB 2VQFL 1WOCA 1Y1VG 3E0EA 5M5WH 1EYGA 2E2IH 4LF4L 4R4TA 4A3IG 3F2DA 3S14H 2D0PA 1OXUA 2D62A 2FXQA 2HIXA 4LUZA 1UE6A 4AYBE 4PZ7A 3CAMA 4DV1L 1HNWQ 4B3SL 2PNHA 3H15A 4DUZL 1IBMQ 3PUYA 2Q2IA 1YHBA 1YZ7A 5E7NA 3S15H 4DR2Q 2HT1A 1NJIC 2N78A 1Q8KA 2WAQE 2NN6G 1W3SA 4DR1Q 2NVTH 3RZOH 2XGTA 3I4NH 3PF4A 4JBKA 1QVGA 1XJVA 4DR5Q 2RHQB 3K7AH 1Q82C 1JT8A 3HKZG 2WP8J 1EIYB 4LF8L 4LF6L 4POGA 3PIOA 4BY7G 4KHPL 4DNIA 5FJ8G 1NBWA 1FJGL 2Z6KC 4KLKA 3BZKA 2K4KA 3TS0A 3RN5A 4R4IA 4LF5L 3F2CA 1WYDA 1CUKA 1OXVA 2IX1A 3CP0A 5IP7G 3L7ZC 2ZM6Q 2E2HH 1N9WA 4DR6Q 5GADC 2ATWA 2VQEQ 5M3MH 1Q46A 4BXXG 2KBNA 3PGZA 4DV7L 4MNOA 5HY6A 1OXTA 2Y0SG 4TQUS 5GQOA 4A4IA 1HR0W 2JA8G 5IT9c 3KDFA 5C3EG 2NVYH 4A3LG 3M4OH 2C35B 3UE1A 2N8NA 1TWHH 1XNRQ 1RIPA 1GD7A 1I3QH 2AMCB 2K5HA 5C0XI 4B3TL 1IL2A 4JV5Q 3A0JA 3A74A 1Q86C 1Q81C 4JG2A 1QUQA 4IFDI 1TXYA 2A19A 3DLLA 2R93H 2QGQA 1V43A 1X3EA 1N32Q 1D8LA 1PH1A 4XTCS 4PZ6A 4DK3C 2UUAQ 1J5EL 1PH6A 4C3IH 3CPWA 5M3FH 3GD7A 3Q8DA 4H02A 4OONA 2YU9H 1VQ4A 4DKAC 1VQMA 3EN2A 2WAQG 1QVCA 2AKWB 4B3MQ 3KDFB 1YBYA 2Q2TA 4JI2L 3G6EA 3NENA 1QZHA 5IYCH 3M4QA 3TQYA 3G71A 1ASYA 1X6OA 1LUZA 2BH8A 3H3VI 4O2DA 1GKHA 1XTDA 4DV2L 4JBWA 3PO3G 4RMFA 3J7ZC 4Y52H 1GVPA 1QUQB 3S1QH 2GN5A 1XMQL 1VQ9A 4YWLA 4BBRG 3FHWA 4PZ8A 2JA5H 3CCVA 4DV6L 4LFAQ 4Y7NH 2A8VA 4GNXA 1EQRA 3GDEA 1MKHA 4YHHQ 1JJ2A 5M5XH 1IYJB 1K73C 4LF8Q 4QGUA 4JI7L 1BBWA 1JB7A 2Q2HA 4DR4Q 4P74A 4R4QA 5IYDG 3CXCA 2XTIA 3ICEA 1SMXA 3K80C 5AJ3L 4GOPC 3PF5A 2UXCL 1SR3A 1WJJA 2DGYA 3HOYG 5J3BA 1PA6A 1B7YB 1CKMA 1OXSC 4IOCA 4APVA 3E9HA 4EX5A 4QY7A 3HOZH 4BA1I 3CCMA 1QVFA 3KJOA 1WI5A 2I5MX 4JI3L 2VW9A 3S17H 1VQ7A 1W2BA 4LFCQ 2Q2UA 3HOUG 4GNXB 4HIDA 5GAEC 2OWOA 1HJPA 4LUVA 1L0WA 2E5LQ 3JC66 1IBML 2OQ0A 2KHIA 4A3EG 4JI4Q 2YTYA 1PH8A 1H95A 4JBMA 1YHAA 3S24A 4DR2L 4A3MG 2EXDA 1FGUA 1GM5A 1G6PA 5IE8A 1N33Q 3M4PA 4YY3Q 4DR1L 3S2HH 2CFMA 2GVBA 5HGQA 4DR5L 5K36G 2QEXA 4LF7L 1LYLA 2IHFA 2Z6KA 4WJ3M 4OWXB 1JJCB 3NELA 1VQBA 3I56A 3H3VH 1IZ6A 1K8GA 1YEZA 4JOIA 4X6AH 3FKIG 1LM0A 1VQ6A 1VS0A 3ZJYC 5IYBG 3BU2A 4DV0L 1YITA 4P71A 1K83H 2MO0A 1YJWA 4DAYB 1HNZQ 3PUWA 3HOWH 3GTJH 1X65A 3GTQH 4JBJA 4K0KQ 1IBLQ 3K7UC 2ZM6L 4A75A 3TREA 3CCLA 4BBSH 2AWNA 4DR6L 2VQEL 1PH5A 2JE6I 4A3DH 2D0OA 5LMNQ 2IY5B 2HHHQ 1JE5A 1WCMH 4A3GG 3STBC 3TS2A 3PV0A 1XNQQ 1SFOH 2RCNA 4PMWA 4HJ9A 1C9OA 1XNRL 4JV5L 2IT1A 2KENA 2UUBQ 1PH3A 1IBKL 2UXBQ 2IHEA 2CWPA 3PO2H 1PHJA 1X55A 2E8GA 1VQKA 4X62L 1Z47A 3JAMc 2BH2A 1I5FA 4HIOA 1CSPA 3J81i 3KJPA 4DV5Q 4A3CG 4B3RQ 4GKJQ 4IPCA 1L1OA 1OXXK 4R4CA 4P72A 4LFBQ 2VS1A 2F4VQ 3AFQA 2PI2E 3RNUA 2WB1G 1B70B 2ALYB 2H5XA 3KYHC 2B63H 5C44G 4PG3A 4JI0Q 1PH4A 2PQAA 4NB3A 1BVSA 5ELOA 3OW2A 1VQ5A 1J6QA 2YTVA 5GROA 2JEBI 4GLVB 2R92H 2E2JH 4OO1I 1Y14B 1PH9A 4O0AA 4R1JA 3WWVA 2OTLA 4LFAL 1S3OA 1K8AC 2BA1A 1VQGA 3M85A 2VNUD 4YHHL 1G51A 1L1OB 1VQAA 2ID0A 4LWCA 4L5RC 3CW2C 1VQNA 3L0OA 1NTGA 4NXNQ 3I4NG 3SGIA 1PH7A 4A76A 4GN3B 1YI2A 4DR4L 5C4XH 4UP7A 1U5KA 2KHJA 3J80c 1YHQA 1I94L 4A93H 2PQAB 1UE7A 2JA7H 4BA2I 1TWAH 5JJLA 4JYAQ 2B3GA 3CQZH 4AYBG 5IWAQ 3CC4A 2A1AA 1PH2A 3D31A 4IPDA 3F2BA 1A0IA 1X56A 4LFCL 1B8AA 5IP9H 1EFWA 5JJIA 1RL2A 5EAYA 4A3BH 4A3FH 2I5LX 1HZCA 1UWVA 5M3MG 1YIJA 1X54A 4BY1H 2E5LL 3I4MH 2YYZA 1PYBA 2BA0A 3S1RH 2JK8A 1IXRA 1HR0L 3AFPA 1Q7YC 4QQBX 1I50H 3KFUA 4LF9Q 2R7DA 4DV4Q 5LMNW 4OX9Q 3KF8B 3H0GH 1E3PA 4JCVE 3T1YL 4OWWB 1N33L 2YV5A 1XMOL 2UU9L 5JEAJ 1C0AA 4YWKA 2CCZA 1K0RA 3HOXH 4DR3Q 4DK6C 2R93G 5FLXc 3CMEA 1DGSA 1YJNA 2OTJA 4JI1Q 1FL0A 3CD6A 3DM3A 1Y1WH 5M3FG 1TWCH 1VQHA 1UE1A 4A3JH 4JI6L 2JEAI 5JEAG 2WFWA 4HJ5A 2JQOA 1K9MC 1HNZL 2NN6I 4YCVA 4AH6A 5GAHC 3OTOQ 4K0KL 3B6YA 2VUMH 4LUOA 5IYCG 1E22A 3HOVH 1U0LA 4DPGA 3I55A 2KCTA 1A8VA 3K8AA 3NEMA 3W1GA 1EWIA 4POFA 4C3HH 5FLMH 2QA4A 5BR8Q 1TWGH 5LMNL 4MZ9A 4UP9A 2R7ZH 2HHHL 3GTGH 2JA6H 2HIVA 1XPUA 1E24A 2ZJRA 2JA5G 1MJEA 1XNQL 1S40A 1MJCA 1SRUA 1HNWL 3L2PA 1VQPA 3TEHB 4B3TQ 3CC7A 4A3KH 1O7IA 2UUCQ 4UP8A 2UUBL 1EUJA 5IY0A 1KD1C 3GTPH 2UXBL 1NMFA 3K0XA 5C0XJ 1S72A 2MQHA 2F3IA 3S1NH 4OXPA 3PIPA 2ZJPA 4B3RL 4JI5Q 4IFDJ 1A63A 5LMUQ 4LFBL 4UPAA 2I0QA 2F4VL 2ZJQA 1KAWA 4HJAA 1JJGA 3M3YH 1NE3A 3HOZG 2GVAA 4X64Q 4GLXA 3CCRA 2V1CC 1VQIA 1T9HA 3UDXA 4GKKQ 1I6HH 2YTXA 1V9PA 2UXDQ 3T1HQ 5C0XG 4JI0L 1VQEA 3M7NA 2CQOA 3NBHB 5JJKA 4DV2Q 4A3CH 1Y1VH 1K3RA 3AYHB 4HJ7A 3CCJA 4HJ8A 1YJ9A 4A3IH 1X9NA 1N36Q 4IJLA 4IO9A 3EBEA 4QL5A 3G4SA 3VDYA 1NMGA 1N8RC 3RLFA 2VZAA 2VY3A 3UDFA 3STBD 1AH9A 2LSSA 4NXNL 4DV3Q 1KRSA 2CKZB 2N3SA 3PUVA 3GTMH 3U58A 2K75A 3D0FA 4YCUA 4HIMA 3RZDH 1E1OA 5M5YH 3M9BA 3CCUA 4JI8Q 1SROA 2UXCQ 3MEFA 1GO3E 2VL6A 4BY7H 5FJ8H 1N32L 3U4ZA 3UDGA 2HQLA 4TVAB 5IWAL 2UUAL 4QJFA 4YCWA 4DUYQ 1X3FA 3HOWG 3OYYA 4X65Q 4GLAC 3BJUA 4OWTB 1P8LA 4B3ML 4BBSG 2N49A 1C7YA 1Q1BA 1TWFH 5IP7H 4A3DG 1QZGA 4X66Q 3GO5A 1WCMG 5DLQE 4BXXH 2NZHA 2ZTCA 4LF9L 1E1TA 4XIGS 4DV4L 4OX9L 1PVOA 3PCOB 1PV4A 1HZ9A 4A3LH 2JA8H 5C3EH 3HKSA 1HNXQ 1XPRA 1M1KC 3PO2G 3KOJA 5GAGC 4LF7Q 3PSIA 4DR3L 2ES2A 1KQSA 1KRTA 1MIUA 4NPSA 4KHZA 4JI1L 3PUXA 3K81C 2K50A 1P16A 1PYSB 1KL9A 2EIFA 4RG1A 4JOIC 4GOPA 4AQYQ 2L15A 4DV0Q 1VQOA 4IPGA 3CPFA
chains in the Genus database with same CATH superfamily
1Q3VA 2F8KA 3K5MA 2W8LA 3V7JA 1B4FA 3IP4B 3VYTA 4NXMQ 5BR8L 4AP9A 1FYCA 3NS1A 3G48A 3RR5A 1CA6A 3AM9A 2OQKA 4N8X1 4LNQA 1SN8A 1ZXIA 2MGSA 3RN2A 4DV1Q 4EQPA 3PO3H 2WF7A 2M0NA 3OSPA 3MXNA 4C56C 3BZDB 4JI4L 3HOWB 2PMZE 3ZDAA 4C3JH 4GOPB 2VANA 4F3OA 4ED7A 1CHQD 2HW3A 1SNOA 4ZH4A 5BN3A 1CM9A 3V7KA 5J22A 5DEHA 4QCLA 2JEIA 9ICKA 9ICPA 2EZXA 5CHGA 3Q8SB 3GTLH 2HOQA 3F1ZA 4ACOA 2K52A 4LF8Q 2JA7G 3UQ2A 4ECXA 2EY6A 5L1KA 3LVVA 1TS4A 3NTIA 4QMGA 4P2HA 4UW9A 2B2WC 2R18A 2IOHA 1L0XB 1RTOA 1M6YA 3HOYH 1KTQA 2F0IA 3H8WA 2UXDL 2AUKA 3MXNB 1D7QA 4FXKC 3N7SC 4A3BG 4GC6A 4A3FG 3RJHA 1AP0A 5KG7A 4BY1G 3ULPA 1N36L 3NVVA 4U6PA 2QDLA 3KLWA 3RLOA 1CKNA 3E0FA 1KFDA 1ZQSA 3LVWA 2PFOA 3HW8A 1JB3A 1ZRNA 1ZJNA 3A56A 4IUTA 4DFAA 4CKCA 3H0GG 5ELDA 1XNSA 4RQ1A 2DJFC 5ELCA 4A3MH 3M7DA 4DV3L 1B4OA 4PZNA 3F53A 4Y2XA 3QZ8A 1SDFA 2L1BA 2Z9HA 4QIWE 1BCPD 4ME3A 3L5KA 3VR2A 1U4PA 4GN5A 5K36H 4JI8L 3KHHA 3MAQA 2YTUA 2W43A 2F3NA 3IRBA 4F5PA 7ICRA 1SYDA 4DV5L 3E3XA 1S8OA 1SNCA 1C20A 4G4KA 4LW1A 1N48A 3ISDA 1CKNB 1XWEA 4HTHA 4KY6A 5COYA 3K5NA 2VUMG 2BCSA 4JI2Q 5H1SE 2QEJC 4IC9A 2VA3A 2Z0SA 2K5VA 4HAEA 2QARA 1Z9FA 1A15A 3HKZE 1J2MA 5ALHA 3SR6A 1J97A 9ICNA 2J6TA 2BCVA 1C48A 4C2MH 2G09A 4P75A 3SAHA 4KJNA 4X3KA 3I2ZA 3GDXA 1VF5C 1PMRA 2WB1E 7ICKA 3I7FA 3OSOA 1H38A 1ZQAA 4KLFA 1BBUA 1RG6A 3JPOA 3E5SA 4A3KG 2I5HA 4KY7A 2OM6A 5I6WA 3VR5A 1PTOB 1ZJMA 4RT3A 5IIJA 1HUMA 2BDOA 1S9FA 3QYPA 4CKBA 1JXEA 1LTLA 1NK8A 3MXUA 3J81E 4C3JB 3KBGA 3S16H 5A2QE 5AJ3Q 1EYDA 4R4OA 4XYOA 4UBBA 3FVQA 4UB1A 2BR0A 3T13A 1N34L 3F5AA 3GTOH 1HRJA 1XXGA 4JV1A 1R9TH 4F5QA 1JMCA 2K6AA 5AKJA 3EIVA 4DGZA 2KQ3A 1UE5A 5C4ZA 1K0SA 4A3CG 1ZQ1C 5KFWA 1S0MA 5M5WH 5BOMA 3LDAA 2E2IH 5AK4A 5KFTA 2XY6A 5EWEA 1D8YA 1GUOA 3ERQA 2KOLA 4A3IG 2F2AB 1RM6C 2D0PA 1SZHA 2FXQA 3WKCA 4ZYSA 1UE6A 4AYBE 3H15A 5DKWA 5FKAC 3AU6A 2Y1IA 4DR2Q 1NJIC 4IUQA 3R2TA 4FE3A 1Q8KA 3UPQA 3EJIA 1D1KA 1B43A 5KFNA 3ISBA 3PVXA 4DR1Q 3RZOH 2XGTA 1YNJD 1WD1A 5AI5A 3I4NH 2R7ZB 1G91A 1Q82C 1G2SA 4PL1A 4NXZA 2WP8J 2ZXRA 3RRGA 4BY7G 4KHPL 1L7OA 1AW7A 1S97A 1NZPA 3BZKA 1OUQA 1D1IA 1A3VA 3RN5A 4Z6DA 2KJ5A 1AFPA 3GTPB 2QB1A 1TVAA 1SV0A 4RGOS 4C80A 2IHNA 4YIJA 4IQVA 2HDOA 5ALKA 1N9WA 2YB4A 3B0XA 2W8KA 5KYIA 3LWMA 4DV7L 1LT6D 4HAIA 4DL3A 1OXTA 2K5QA 1HR0W 4LAAA 3TADC 3I3CA 4A4IA 2F4IA 2XVTA 4QZAA 2C35B 5DG8A 2PCFB 4FZMA 3CRLC 5C0XI 2FMCA 3A0JA 1Q86C 4DSLA 2NRZA 1SBBB 5KG6A 4JG2A 5KFHA 3SK5A 1TK5A 1KSPA 5K4LA 3D4WA 2R93H 2QGQA 2HSZA 1N32Q 5ALDA 3SEIA 5EE0A 1ZQFA 5J29A 1QJOA 3SVMA 2UUAQ 4S3SA 2EOTA 3MHBA 1A2UA 5DGAA 2LM1A 2OEHA 3CPWA 1PH6A 1YNNC 1ZD3A 3Q8DA 4H02A 4F5NA 3URYA 4DKAC 1TAMA 3GTMB 1QVCA 1ZD4A 2AKWB 3MBYA 2Q8TA 1AQ6A 3G6EA 3S16B 2ZXPA 1STEA 5IYCH 1WTHA 1L3TA 1N5WA 4KTQA 2C9OA 1R9TB 3J7ZC 4Y52H 4KX5A 4Z6EA 4GXJA 3MGVA 4YR0A 1SE4A 4J9KA 3KOOA 3CCVA 1XMQL 5M5WB 2E2IB 3QZ7A 1JQYD 1LACA 4KTAA 4GNXA 4XDXA 1F2ZA 4KHVA 3NASA 5AKLA 1MKHA 2JN4A 4YHHQ 1K73C 8ICSA 1V1OA 4CNQA 3QU9A 2JXJA 2V9WA 1TR5A 2PQEA 2A1JA 5IT9E 3TSSA 4KD4A 3ZD8A 5IYDG 4QWBA 1GUGA 2XTIA 4B9VA 3NTHA 5ELEA 2K4IA 4RQNA 2Y0SB 2MAXA 1D5ZC 4GOPC 3PF5A 5C3EB 2SNMA 1LB2B 2HOFA 3MGIA 4KN7A 2LKYA 1JRPA 5J3BA 5EE1A 1CKMA 5CJ7A 4EX5A 1BBXC 2I5MX 2W55A 1CK1A 1VQ7A 1W2BA 2W9BA 1ET6A 2O4XA 3HOUG 1URJA 4GNXB 4HIDA 2RVLA 5GTIU 3Q22A 1Y8NB 1PVQA 3UXPA 2E8MA 3JC66 2A1JB 3P7JA 4A3EG 2YTYA 2DJGC 2JYOA 4BXOA 2EXDA 3SXHA 1GM5A 2EYOA 1G6PA 1QCKA 4B9NA 1ZQWA 2OHFA 2YMQA 3DV9A 1MQ3A 3DXJC 4CGYB 1EIHA 4DR5L 3QB3A 4RA8A 5ISRA 2IHFA 4RUCA 1T7PA 4Q44A 3IN5A 4ECWA 2W9BB 1K8GA 4JOIA 1B2TA 4FNFA 3J81L 5A2QL 3H91A 9ICVA 3AB9A 3BU2A 1DXSA 3F5EA 1K83H 1H9MA 5BN5A 1GO3F 1T94A 1BQQT 1X65A 4K0KQ 1JWUD 5CBEE 4BXOB 2F0GA 5KFSA 3CCLA 3RJJA 2D5DA 4DR6L 4QZBA 1BPZA 4DWIA 3RH6A 4B9UA 1JN3A 4A3DH 5KIXA 5CV9A 4WFN3 2XC9A 1JE5A 1Z3EB 4M9GA 4DQSA 3PV0A 2K8AA 4RZRA 1PRTD 4US8A 2W9MA 1C9OA 1SYGA 3OHAA 4O3MA 4PHPA 1G8ZD 1TAQA 2EY1A 2KENA 3DWQA 3KBXA 5T1IA 4F7XA 4DA2A 2UXBQ 1ZD2P 2IHEA 1JMSA 3R2IA 3WDNA 5JVG3 2B39A 2RSOA 3ND8A 2K04A 3D2QA 1I5FA 2PI4A 3PMFA 3MFGA 4HIOA 2NVXB 5ALSA 5AKEA 1I4RA 2RHFA 1PTOF 4IPCA 4GKJQ 1L1OA 2ZIUA 1K3BC 4LFBQ 2VS1A 2AGOA 1D8BA 3AFQA 3DEOA 4FBTA 5ALQA 2PI2E 3RNUA 2NVQB 4EGVA 2I07B 1B70B 5FOBB 2H5XA 1RYUA 3AMZA 3V72A 1CZGA 4PG3A 9ICHA 3NBIA 5J2BA 4I7AA 3PW4A 2PQAA 4NB3A 2FE9A 1X9XA 4KKTA 5ALEA 1JCKB 4LK1C 2Q8IB 5JVH3 2JEBI 2YMLA 5CV7A 3SD7A 4EBEA 4UAVA 4RAUC 1Q90A 4ECQA 2LY7A 4R8IA 5L1LA 2IBKA 2JMGA 1SXEA 1DRGA 1S3OA 4IQUA 4YFKA 1MI2A 4Z9CB 4DN4M 3S1MB 1VQNA 1L1OB 2ZIUB 2JSOA 4RQ6A 4L5RC 1NTGA 4NXNQ 4NL9A 2HDLA 2AQ3B 4YCXA 5IIOA 1NKBA 4A76A 1ESFA 3LNNA 4DR4L 4KLUA 4QIWB 2EQYA 4C8LA 2LKVA 1I94L 2PFPA 1IHZA 1LTSD 2PQAB 5DB8A 1SL1A 2A6EC 2JA7H 2FDRA 3V96A 3OPOA 3CQZH 2KD1A 1KTKA 4B6JA 3ONAB 1BPXA 1PK1B 3CC4A 4IPDA 2B2YC 5ALRA 4DOBA 4ELUA 2ZT9C 4KV6A 4CJ0B 5JJIA 3G6JB 5DBCA 2RKSA 4UDUC 4A3FH 4A3BH 5M3MG 1YIJA 1X54A 2FINB 2E5LL 5JTIA 8ICBA 4KY5A 1EIGA 4PGQA 1STNA 2JZBA 4PV1C 1IXRA 5KG5A 1K83B 1RD9D 8ICQA 3S1RH 2MSNA 1XSNA 5C4JB 3KFUA 1B44D 1Y88A 5KFMA 2R7DA 5LMNW 2AGPA 4OX9Q 2HBLA 1PYWD 7ICTA 2WB1B 3H0GH 3T1YL 4OWWB 5C44B 2YV5A 2UU9L 1IIPA 5JEAJ 1TS3A 3WOFA 4YWKA 4XA5A 4PHDA 2ZIVB 2B2TC 1DOMA 4YD2A 1K0RA 1PFNA 4DR3Q 3G7LA 3OMCA 5IT9L 3E2EA 4JI1Q 1FL0A 2HHSA 4ABNA 1X6JA 2ZIXA 9ICOA 1KRPA 3MDAA 1S0OA 4ECZA 3DM3A 2M00A 3LWUA 1SKSA 1UE1A 2F0QA 2HHWA 5M3FG 3FC4A 4NMZA 4K14A 2JZBB 5JEAG 1JWMD 4ED8A 1BCPB 2WV6D 3PW0A 2NN6I 4AH6A 3OTOQ 1HNZL 2YN4A 3B6YA 2VUMH 1CI4A 3K7AB 3I55A 3OJUA 1NUCA 1SB3C 5A35A 1KAAA 1TWGH 3A7LA 5LMNL 5ALVA 3X3MA 1CQVA 5FP0A 4ED6A 3K5OA 2JA5G 1MJEA 3PSFA 1MJCA 1UA0A 3E6ZX 4BX9C 1U4BA 8ICGA 1A3TA 2J0TD 1H9SB 3TEHB 3L2PA 3CC7A 4A3KH 4B3TQ 2UUBL 2I1QA 1CZWA 5DM73 4RQ7A 4DO9A 5C0XJ 1UHUA 2MQHA 4NW2A 1EEFD 1TE2A 1ESRA 2P35A 4B3RL 4NP5A 2NVYB 3M4OB 1AEXA 2D8CA 2I0QA 3RBDA 4HJAA 1VJ5A 4X64Q 1U4MA 1T9HA 3PNCA 2CQAA 4FF1A 5CV8A 2RP5A 2Y0SF 3IL8A 5C0XG 1VQEA 1O08A 2AGQA 3H40A 5TISU 1STBA 2CQOA 2Z6BA 2JA7B 3GILA 4MFCA 4DV2Q 3KLSA 4I29A 5J0QA 3AYHB 4A3CH 3CCJA 3CQZB 4A3IH 2E3TA 2M2LA 2OEOA 1K8OA 4PNYA 5IODA 4QL5A 2B21A 4C3IB 1N8RC 4DQPA 5KG2A 4NLGA 1GJXA 2R8KA 2BE5C 2L4NA 4GZYC 1RDFA 1FFVA 4BY1B 1QB5D 2KEYA 4HSPA 4ZAIA 2DNEA 1KRSA 2XWBB 3IFDA 3ITPA 4QB4A 3NWTA 5ALXA 1A6SA 1EYCA 4RGMA 2K75A 3OMGA 4K2LA 4NKLA 4OIJA 1T4GA 3CCUA 1MN8A 1UEAB 1GO3E 2VL6A 3V7LA 4C8MA 8ICCA 4BY7H 2KVMA 3BS7A 2PKEA 2XSCA 2AQ4A 4KN7C 1KDCA 3IG5A 4TVAB 1UAPA 4Y2PA 4QJFA 1KDHA 3C1YA 5DG7A 2RA4A 2XCAA 5J2CA 4BBSG 2N49A 2KHSA 8ICWA 1Z6HA 1QZGA 4CDFC 3BQTA 4X66Q 2DKZA 5T14A 5CV6A 3RJKA 3RFAA 3TZUA 2VUMB 1HZ9A 3HOZB 1N62A 2FJ2A 4OEMB 5DLGA 5AM3A 2PI5A 1TY2A 1HNXQ 1TWGB 1CT1D 4PGYA 2E76C 3PO2G 3KOJA 4LF7Q 3Q8KA 1F2YA 3PSIA 4QJFB 2KMDA 2JV3A 3C2LA 4RCOA 3DWPA 4KHZA 8ICMA 3QE9Y 5I9PA 4RG1A 1P16A 3TANA 1ILPA 3I90A 4JOIC 5KNCA 4G7OC 1ZQOA 4JMUA 2PMZC 2A6ED 5HHHA 3CPFA 5D49A 2B63G 4FDBA 1SAPA 2DUYA 4NM2A 1C4QA 2K5NA 4J9NA 2Z4IA 2FLNA 2B2VC 3QG1A 4QUCA 5FO7B 4DR7Q 1SGGA 3WK5A 2CRXA 2NRVA 1JOOA 3V2TA 2BHNA 2R92G 1ZKOA 4F72A 2LXKA 4IPHA 3CF5A 1VDVA 2E8PA 1BUVT 2FPMA 3CNHA 2L12A 1L0WA 3K5LA 2EQSA 3SHLA 4B3SQ 4KLLA 4O5KA 3C29A 8ICIA 1V97A 4F5OA 1QNKA 3GTKH 5AM2A 2GLEA 1HCZA 1IBKQ 3GTJB 1HTLD 1G291 4NLBA 1UT8A 3LGJA 4YY3L 5C4XG 1QCBD 3KTQA 5EQ0A 2RDJA 1EQVA 4I2EA 2K14A 1WCMB 2F0PA 2KKVA 3PV8A 3OIPA 4JI5L 1KIXA 4JC0A 1TK0A 1Q12A 5C5JA 5IYDH 3ISCA 4RHRA 1MC8A 1L1OC 3QIAA 3PX0A 3ERSX 3W1BA 1Y8PB 4QIWF 1D6EC 2YB1A 2C5CA 2EYJA 4KI0A 4LF5Q 3UQ0A 2Z7JA 2QDBA 4GKKL 4DL6A 4QIWC 3RD4A 2I9GA 2M9VA 2R6GA 3JAMi 5GTHU 1D2BA 3RUZA 5KG0A 1NK0A 4BY7B 4ED0A 2KHVA 1QE6A 4K5XA 3I4MG 3HOUH 3R93A 2KEDA 3WKAA 1KLGD 2XCPA 4U7CA 4M9HA 2DUDA 2R7FA 2PI2A 5J1ZA 1K5OA 3CMAA 4A3EH 7ICJA 4C7ZA 1A76A 5AK6A 4JUZA 2BDPA 3J81j 1NSNS 1VDZA 4R64A 4B9LA 3M6KA 2MO1A 5JU5A 4B9TA 4DF7A 3J81c 1ZETA 4NL9C 4DFMA 3HKZC 1RYSA 3QU5A 2A68D 3PX4A 3Q8LA 3TP6A 3A5UA 2WB1F 5KFDA 1LV9A 4MTNA 4Y2YA 1D5XC 2E2JB 3I76A 4EQ5A 3IV6A 3C5FA 3GU3A 2WB1C 1UCVA 1L2FA 5CR3A 4ED3A 1Y1WG 4WJ4A 4A3JG 4MTKA 2ZTEA 3T5LA 3T56B 3KF6A 1J5EQ 2JJQA 4MEXA 4DNRB 8ICYA 4DUYL 2RHSB 2KSOA 3PO4A 4ZUJA 5G3LF 2RF4A 1AE2A 3HOVG 5CP2A 1SWWA 1KBUA 1HZAA 5IGBA 2KJXA 4P73A 4A93B 4Y2UA 4QZ9A 1S4ZA 3SR1A 2WKCA 3UE0A 2JA6G 3K1RB 1BCPF 1H9RA 1YVCA 4FBUA 4KD3A 1ZYQA 2Q0ZX 2F1HA 4M2YA 1E7ZA 2A69D 4GIBA 2WKDA 1HA5A 4P4OA 2LYBA 1NK4A 2IWHA 4DV6Q 2ASBA 2L55A 2ES6A 3K57A 1M90C 4QZFA 5J8YA 1VQDA 3KF6B 3VYRA 3CC2A 2G0AA 3VA5A 1PFMA 3CCSA 2AJQA 3C5GA 4AYBC 5EBCA 4AQYL 1I50B 4AIMA 4KMUA 5AIAA 1PRTB 2F52A 2Y0SE 4QZCA 4X3TA 4ME5A 2A5HA 2UVRA 4YXMA 4F5RA 2P6RA 4IRKA 1SKRA 3J7A5 4CDEC 3CCEA 1N5XA 2GH1A 3FDSA 4YWMA 5NUCA 1AZQA 1Y69U 1S0VA 3HOXB 3J7AV 4OGQC 5KFFA 4JI3Q 4NXML 4PH5A 1SV4A 1Y1VG 3M1YA 5ALYA 2RDFA 4IUNA 4J9LA 4XYQA 2W03A 2L5TA 1KFTA 1T5XD 2HIXA 4LUZA 4DV1L 1ICFB 2KV2A 4Z6FA 4ZCKA 2LFNA 2LI6A 1IBMQ 4JPBW 3I4LA 3PUYA 5IIMA 1RHPA 1YZ7A 2DWQA 4ZUIA 3S15H 5AK3A 4O3SA 2BQRA 4OJ5A 3HOUB 2NN6G 1I4PA 1W3SA 4CE6A 2EAPA 3BJYA 5IIIA 2F1MA 5C6AA 4IURA 1FEZA 1QVGA 4JBKA 3NUCA 1SKWA 3W2DA 3HKZG 4A3EB 4LF8L 4POGA 1K1QA 4DNIA 4MEYA 4DOAA 5K5PA 4J9QA 4C8NA 1DXMA 2K4KA 4DQQA 1YT3A 4R4IA 4DLGA 1WYDA 2EY5A 1IM4A 1CUKA 4NLKA 9ICLA 2BDUA 4NM1A 5IGDA 2AQ0A 3BQ0A 2IX1A 2HVHA 3S1NB 2E2HH 2H3QA 3E0JA 3THVA 2VQEQ 3LWLA 4KX3A 3PZPA 5M3MH 4HMJA 1HUNA 2CXYA 5HY6A 2MHVA 4F50A 4QWEA 1GOZA 2JA8G 5IT9c 4YD1A 2HCIA 4K2KA 3T79A 2NUCA 5HP4A 1X3PA 5C3XA 2G08A 3SENA 1I3QH 2AMCB 4JV5Q 2DF4B 4KLMA 1Q3LA 5AKKA 3WKDA 4KLSA 3VR3A 4QWCA 2Z4HA 4IFDI 3GV8B 1TXYA 3I70A 3NK9A 3DLLA 2XRQD 1X9WA 3MGHA 3A8KE 1XYIA 1PH1A 3NXWA 4XTCS 5L9XA 2P6UA 3MR5A 3CRXA 4TURA 1FD7D 1GUSA 2OT2A 4PZ6A 5JAVA 2F0TA 5M3FH 4X3UA 1JE4A 5JJZA 4V0BA 1SYCA 2YU9H 1VQ4A 1U47A 5JEAH 1VQMA 4JI2L 2PZWA 3NENA 1QZHA 3TARA 2HHQA 3RZDB 5DB9A 4Y2TA 3TQYA 1ECWA 1ASYA 1T8EA 4O2DA 3BVZA 3D2SA 1A6XA 1D9FA 4RMFA 3S1QH 2BPCA 3I72A 4BBRG 3KK7A 4PZ8A 2JA5H 1ZQPA 4UBCA 4O5CA 4C4TA 2G5IB 1EQRA 2MRLA 4RQ8A 1V85A 4IL6U 3HP3A 4U68A 1TKWB 1BBWA 1PZNA 4ECTA 2Q2HA 3MC0B 3QOJA 4R4QA 4CDDC 3S15B 3CXCA 1QOHA 1SMXA 8ICJA 5AJ3L 4WJ3B 4Q8EA 1W6KA 1XU4A 3J80E 2LHTA 3O13A 2CN1A 4QWDA 3AN1A 1SYEA 1MGSA 1VF7A 4APVA 3E9HA 4IOCA 1PA6A 2WF9A 4YXJA 1WI5A 4EQNA 2VW9A 1NNXA 4B08A 3MXGA 3S17H 5C0XH 4LFCQ 3QU7A 4F4ZA 1BPEA 1HJPA 4MFFA 1LO5D 3BVGA 4LUVA 3NGDA 3ONNA 1ZRMA 3RJFA 3VC8A 3H8MA 2WHEA 9ICBA 1QTMA 2OQ0A 4JI4Q 1BF4A 5ALMA 1YHAA 4DR2L 3U9OA 1FGUA 5DNFA 1L3UA 2E2HB 1X66A 9ICGA 3JPSA 2WAQB 1N33Q 4DR1L 3T53B 3Q23A 2CFMA 8ICEA 2GVBA 1LT3D 1V8QA 4M1UB 2CW0C 4EZ6A 2Z6KA 5EKIA 5HMLA 3PO3B 3HJEA 1U9LA 3I56A 1YEZA 4XXEA 1RZTA 3TAQA 3FKIG 3QU4A 1XO0A 1LM0A 1VQ6A 1WG8A 1VS0A 1N60A 9ICFA 1DYQA 1PZKD 4DV0L 4YMOA 1RJTA 1QLNA 2J6SA 4R63A 1S77D 3N97B 2K8CB 2BDNA 4XUSA 5KT6A 3GTLB 4A75A 1QG7A 4BBSH 2AWNA 3SI8A 1HPCA 1PH5A 3FPPA 2M9NA 3EVQA 1BDOA 3T5HA 3ALRA 1MA7A 5AM1A 3MR6A 1I4HA 3GQCA 3RB0A 4PQXA 3HOYB 1XNQQ 4YN4A 4TQSA 5KG1A 3T5JA 1EWCA 2F0VA 4M6WA 1SMYC 1EY7A 5IIKA 1PH3A 5KFLA 3GQBA 9ICUA 3PO2H 5KT3A 3GFKB 1X55A 3CRKC 4UAIA 2E8GA 1TVXA 5I9OA 4FZNA 1VQKA 3BVMA 4X62L 2JA5B 1Z47A 3T51B 2BH2A 1PXUA 2QKQA 3BQ1A 8ICHA 3KJPA 4DV5Q 2VKQA 4O42A 3UMCA 4A3MB 3DEPA 4IR1A 2HOIA 4F4WA 2UVVA 3K0YA 3OIQA 2ALYB 5KFVA 7ICIA 2RQXA 2B63H 1PRTF 2RDHA 2JHDA 4CF4A 1FO4A 4KMOB 1PH4A 5ELOA 1J6QA 4M6WB 3P75A 1L8OA 3NSWA 3IHQB 5CV4A 3QEBZ 1LVHA 1LTGD 4GLVB 4BDPA 2R92H 4UB6U 4OO1I 3BDLA 1ZXTA 1Y14B 4O0AA 3S17B 3Q8MA 3WWVA 5EE3A 1DK2A 2BA1A 3K58A 3HT3A 3WK6A 2VNUD 4YHHL 2NV3A 1ZQGA 1VQAA 2ID0A 4N8FA 4FF3A 2HHTA 3MEHA 3OWEB 5IGEA 1PH7A 4C2MB 3NWSA 1YI2A 3IDWA 5C4XH 4UP7A 1U5KA 2KHJA 1B3QA 2O6KA 3VYUA 3QOLA 3KF8A 4DEZA 1UE7A 4KMUC 1FNUA 1TWAH 4FVMA 5AM0A 4DCCA 2BCQA 2Q4TA 4RT2A 3M8SA 2D6FC 5IWAQ 3BS1A 2L5YA 2A1AA 2F77X 4F4YA 4PL2A 1JICA 3JAME 5KFBA 5L1IA 1QSSA 1TIID 2XY5A 2C2EA 1X56A 1B8AA 3TP7A 1HXYD 3PR4A 1OO9B 1QSYA 1EFID 3QEAZ 1JWSD 1SL2A 1UWVA 4MN3A 3I4MH 3AU7A 2E75C 1HR0L 1Q7YC 1N56A 3GTOB 4QQBX 4FO6A 4LF9Q 1S76D 4DV4Q 1G2TA 2JEJA 3BYTB 5CB1A 3KF8B 1KNAA 1BO0A 4BBSB 3RB6A 4R8NA 1XMOL 5HGTA 1JC7A 2A6HC 1ZEQX 3EWAA 2AXTU 4OJOA 1WTXA 2DFLA 2BQUA 5DQGA 1O03A 4R8UB 4DK6C 4XQNA 5IGFA 4EENA 3DUZA 1YJNA 4V190 5KFPA 2KIVA 2ODGA 3CD6A 4DFDA 1JI7A 3SEBA 1Y1WH 2H1EA 4M8AA 3CP8A 1NCVA 3L3OC 4CKEA 4A3JH 4JI6L 3ICXA 2F44A 3HZXA 3BQ7A 2WFWA 3RZOB 4RUAA 2JQOA 1K9MC 3I4NB 4K0KL 2KEEA 4M9NA 5HURA 3HOVH 1EZ8A 1WTPA 4Q45A 2ZJ8A 1A8VA 4K8JA 3SZ2A 5JUMA 1U48A 2EYMA 4I65A 2QA4A 1PK3A 4KITB 1EOTA 2AQ1B 1Z1BA 1TFRA 4MZ9A 2E5SA 4DSJA 2JA6H 1XPUA 2F0EA 3GTGH 2B63B 4EBDA 2SEBD 4OHJA 3ZYYX 2LMCB 2ZJRA 2KA7A 1S40A 1SRUA 5EPJA 1HNWL 1BXTA 1UPHA 4EYIB 5JOBA 2UUCQ 4M04A 8ICLA 1SNQA 1EUJA 1KD1C 2UXBL 4ULLA 1EY9A 1ZQJA 4UAYA 1ZQQA 1NMFA 4I27A 2DY7A 3KLSX 2IX3A 4HCEA 4CRXA 1ZD5A 2DQNB 3PMNA 2EYFA 4OXPA 2ZUBA 2IOFK 4J03A 3TDQA 4IFDJ 1WTOA 4EYHB 4Q0FA 2C2RA 5LMUQ 3D8GA 4RNNA 4J6HA 1RODA 4LFBL 1ZQRA 5L37A 2W7PA 1KAWA 1X9SA 2F0KA 3M3YH 3M9MB 4NJ8A 4GLXA 4XT1B 5AI4A 2V1CC 3UDXA 5FLXE 1A2TA 1LTRD 4CJ2C 3T1HQ 3TFSA 2EDGA 2PPBC 2KVSA 4J9MA 2R93B 1NNLA 5KAFU 3GZFA 1Y1VH 1K3RA 3A8IE 4WRDA 4HJ7A 3ZDEA 1X9NA 2PXIA 3GP7A 4B9XA 3A7AB 4F8MA 3EUB2 3G4SA 5J0SA 8ICUA 2VZAA 2VY3A 3UDFA 1L6NA 3BDPA 3HX0A 2NRWA 1TU2B 4NXNL 1S5FD 3K6OA 2CKZB 2NN6H 3D4DA 2O5JC 3NP8A 1UQVA 2NRXA 1JORA 3L3FX 4B9SA 1NR4A 2WAQF 3M9BA 5AI0A 5JPNC 5AKXA 3MEFA 4CF5A 3H4DA 3E58A 1ENAA 5CV5A 4G7ZC 4FZLA 4C7YA 5DQIA 4J9SA 7ICFA 5DAUA 1DGJA 4F91B 2ICEC 3HOWG 1PTOC 5TSSA 4OELB 1I6VC 4QUFA 4X65Q 3HWTA 5KTQA 3BJUA 1P8LA 4OWTB 3SMVA 9ICTA 4B3ML 1C7YA 4US9A 2XI9A 5C5LA 1PLFA 1TWFH 4KKUA 2BKEA 4KLQA 5J0XA 3AQEA 3GO5A 5DLQE 2IOFA 4X5VA 2BCOA 4ZK9B 2NZHA 1E1TA 4OX9L 4LJXA 1PVOA 2RQ5A 4DSEA 1QQ7A 3TMEA 1PV4A 1PK1A 3BYYB 2JA8H 2HI0A 1I4QA 2F1IA 4ZQ3A 2NO4A 5KFKA 4YQWA 2EXZA 5EJWA 4O3PA 4DQIA 3GTGB 1G6ZA 5GAGC 2KJ9A 4NWIA 4IR9A 4DR3L 2ES2A 1NJZA 1KABA 1KRTA 4NPSA 3DWAA 4JI1L 2XICA 3MDCA 3K81C 5H2FU 2K50A 1PYSB 2OXPA 4JK1A 5HMMA 1S5CD 2G9DA 1VQOA 1AN8A 1FVIA 4HEDA 4UARA 1IG6A 3OTOL 2ZIVA 3BZCA 1SLJA 2KICA 1Z00A 2B8GA 3NQTA 3JAML 1I4GA 1U4LA 1YNND 2VQFQ 2BCRA 4ALPA 4LF4Q 1VQLA 5DG9A 3LK9A 4DS4A 2W3SA 5D3IB 2VA2A 3M3YB 1DOKA 1UEBA 4FS1A 3TQ1A 3KKAA 4KN4A 2MP1A 4DUZQ 1QH9A 4B9MA 4BBRH 1CI3M 3D6CA 3VCBA 3ZD9A 1Y1VB 5I4DA 4LVSA 3S9WA 4KLIA 3S2DH 2IX0A 3D4RA 2BGWA 5ALPA 4A3DB 2A6HD 3FAHA 1MSHA 1F2LA 4L5TA 1EOVA 3IM1A 3KHRA 2WINB 3OWFA 4HMIA 5J2AA 1Z00B 4LF6Q 3FP9A 3F8TA 2CHBD 1FJGQ 4Z6CA 1I4XA 3IG8A 3K75D 4P0QB 1H9SA 2G5DA 3C1EA 2F3WA 2F8LA 4X64L 1XPOA 1WYGA 1PUZA 4KLHA 2AHOB 5JRTA 5DLFA 2NYVA 3CYMA 1OW5A 1DZ1A 2FFKB 3QUTA 4GN4B 1X40A 1SV0C 1IBLL 4Q43A 4F2RA 1UA1A 2EVBA 1CKOA 3K1ZA 4F4XA 1KEJA 2C28A 4M9LA 2LXJA 2B6GA 4ED1A 4OO1J 5KAIU 1RCVD 2Y9UA 1B0XA 3I4OA 4L5QA 1TWFB 3ED5A 1KXLA 4PJ0U 5AI6A 4JWNA 2F0SA 1E2WA 1VCIA 4EX6A 1WFQA 4X3SA 3PO5A 4MF2A 1I94Q 2B29A 5AI8A 1PFBA 1KHIA 3U50C 2EH9A 2FMSA 3CU7A 1VQ8A 3C46A 1UUPA 2F0HA 5ELNA 1FNVA 1EWHA 2JA8B 4OO1G 3I91A 1TQOA 3SK4A 5AHXA 4KK7A 1YZ6A 1FIQA 3E9IA 3FKIH 2EZYA 4IJHA 2F0JA 3PSPA 1T5EA 4JV0A 5EPLA 3ULJA 4UATA 1XSPA 1PFSA 3J80i 5J2HA 1KC8C 2KVCA 3SAFA 5FLXL 2EE1A 9ICJA 2VJ4A 4GS3A 5CWRA 2R7ZG 4X66L 2EJMA 5KG3A 2Y0SC 2KNJA 5D65A 3TAPA 3QNMA 3B9JA 5TZVA 3PW5A 1IL8A 2NZOA 1JALA 3T1YQ 1HNXL 3V6KA 2UU9Q 5F2DA 2Y1JA 3S6JA 1V1QA 3C2MA 2UVUA 2N55A 1HFGA 4A3FB 1JXLA 2NB0A 4GNXC 4A3BB 3H8SA 1JX4A 2V4DA 2ZTDA 2MFIA 4QZDA 4JI7Q 3S1RB 4I2IA 1V1PA 3TRZA 2MPMA 4NV0A 2KP7A 3S2DB 4Y2RA 3KD3A 1L0YB 2WF5A 1VQJA 1EQQA 3H0GB 3F2UA 3UMBA 1NY4A 3PUZA 1OTCA 2FPKA 4JYAL 3RAXA 4L5SA 2AWOA 4DXFA 4ECVA 1A62A 4DR7L 3U26A 3H0RB 3HILA 3WK4A 2QLTA 2PYKA 4C1NK 1PTOD 3H4BA 2F1JA 4J15A 3VR6A 1WOCA 3E0EA 3R8BA 4RNOA 1EYGA 2R8HA 2HCCA 3F2DA 1P7DA 2D62A 5HR7A 3I8ZA 5HHIA 3Q8RB 5J0RA 4B3SL 2PNHA 5ALZA 1H9JA 2PNRC 4QNLA 2XO7A 1ZQTA 1FNWA 1V1PB 1YHBA 2K05A 5E7NA 1IYUA 1LT5D 2WAQE 4UAZA 1PZID 2NVTH 2Z8LA 1NK6A 4R66A 5J2DA 3PF4A 1HUZA 1WWUA 2RHQB 3BS5A 3TZDA 1JT8A 2KKPA 1F9PA 2AQ2B 2EAOA 1NBWA 2B2WA 5FJ8G 4KLKA 1CA5A 1EQTA 4K6DA 2AUJD 4A3KB 4LF5L 3F2CA 4G9BA 4NLCA 4M9JA 4TUQA 2F0LA 4J1MA 1CRXA 2PW7A 3HGBA 2QB0A 1ZQMA 1R4PB 4C8OA 3ND9A 3CP0A 1NJWA 5IP7G 1EZ6A 1NR2A 3L7ZC 2ZM6Q 3FKIB 9ICRA 5GADC 4RGNA 3FM9A 4BXXG 3PGZA 2J6UA 5A0LA 4MNOA 2EDUA 3JPQA 2EJGC 3BS5B 2EY2A 2Y0SG 4TQUS 4L6TB 1K8MA 3KDFA 1ZYRC 5C3EG 3RB4A 3EW9A 5DB6A 2ASJA 3EA6A 1XNRQ 4YG2A 1TWHH 1GD7A 1SE2A 2K5HA 1L7NA 3SAGA 3A74A 2I6XA 4A3IB 4BWJA 1GHJA 2SDFA 5I2XA 2QB0B 2JEGA 4KLEA 1V43A 1ENCA 1X3EA 5J0OA 2TSSA 1SNMA 1D8LA 1BPYA 1WTRA 1DD2A 3W3AA 4DK3C 5F9LA 5ALNA 1Z4OA 1B3AA 2HQEA 2JXMB 1J5EL 2PW5A 2E1FA 5KFXA 4RH6A 4DFJA 4OONA 5CORA 2VB3X 3J7YW 2PZUA 3RH4A 3KDFB 2Q2TA 5KFRA 4O3NA 4RPZA 2MUTA 1UNSA 2LYAA 2BH8A 5CR0A 4YP3A 3H3VI 1GKHA 1XTDA 2DL0A 2JEFA 2X69A 4JBWA 5AKZA 4PMCA 2CVRA 1GVPA 3Q0AA 2GN5A 7ICMA 4UASA 4C0ZA 2D2CC 3FHWA 3PY8A 4DV6L 4LFAQ 5LL6S 2A8VA 3DHQA 4P4PA 1GUNA 3GDEA 3T5KA 2JH7A 1VMPA 5M5XH 1IYJB 5KG4A 1E0BA 5C5MA 4I2HA 1QQ6A 3P1HA 4P74A 4DK0A 3WK8A 1R4QB 2RRDA 4FFDA 2K32A 3OPXA 3ICEA 1RTNA 5F9NA 2MUTB 3GIKA 2UXCL 3SQIA 1NJYA 2C22A 5KFOA 3KZXA 2P66A 2HHUA 1B7YB 4K4IA 4BA1I 3GV5B 1QVFA 3KJOA 3G6VA 4JI3L 1B22A 8ICKA 1ZQLA 2C2DA 4F93B 4XQQA 3I73A 3PMLA 3HRDD 4IFDH 3C23A 5J2GA 4EZ9A 2ESEA 3H09A 1TS2A 4B9WA 2KHIA 4DAYA 1IBML 4JBMA 2W7OA 2F0NA 4HCSA 1BCPC 3IRUA 1AZPA 1DM0B 4TSSA 4DNTB 3Q8QB 2EAMA 3M4PA 2RLTA 5ALOA 4YY3Q 3S2HH 5KFYA 1PVPA 2NRTA 8ICOA 3QR8A 5HGQA 2BE5D 3N28A 1BGXT 5IINA 2B2UA 3IKJA 4WJ3M 2LPEA 1JJCB 2BPGA 1VMCA 2HBJA 1IZ6A 1B53A 3J7AF 4X6AH 3GTKB 4LMQD 4IQZA 2E2DC 5IYBG 4XRHA 1YITA 3C28A 5KFIA 4P71A 1YJWA 2MO0A 4DAYB 1F9SA 3HOWH 2DN8A 3K7UC 2DKXA 2JR5A 2W11A 4DL4A 1S5ED 3AQFA 2VQEL 2KIWA 2ZIWA 9ICWA 2D0OA 2IY5B 4MHVA 2HHHQ 3MA2B 5E79U 4A3GG 4EVOA 4F71A 3TS2A 2LMRA 2KZZA 1F9RA 2PO4A 2ATLA 5C4HA 3FMCA 2KK0A 3HPOA 9ICIA 3NTUA 4JV5L 1BR9A 1X9MA 4DAPA 2W3RA 4I2DA 1CEZA 1Y8OB 2X6GA 2CWPA 1EY4A 2QCPX 7ICSA 5T1GA 5KYLA 4CDCC 1SJED 3L4PA 2HHXA 3JAMc 1WVLA 2KHQA 1L3SA 1IYVA 2L0CA 4GFJA 5ALUA 4P72A 4TUPA 2F4VQ 4ICAA 2ZIWB 4QF4A 3MTSA 3I1YA 2CH4A 1EY0A 2WB1G 2PZTA 3KYHC 9ICSA 2G06A 4IRCA 5C44G 2LS01 5ELBA 2F03A 3MFIA 1LLRD 5CGKA 3OW2A 2YTVA 4C4SA 1SYFA 5DQHA 8ICNA 5G5GA 1D5MC 1FGBD 2W04A 5LHY1 3H0LB 3IAYA 3N4MB 5KT2A 1PH9A 2OTLA 2HHVA 3MR2A 1YNJC 1K8AC 3IFTA 2FJ6A 3M85A 4F2SA 1L8LA 1G51A 4LWCA 4KLDA 2DNCA 4YR3A 3ZDDA 2RCFA 3OSNA 4IN3A 3QU2A 1RYRA 1S5BD 4GN3B 4J9OA 3BQ2A 1A3UA 1YHQA 3C2PA 2YQEA 4RQ2A 1EY6A 1SL0A 2IMWP 4BA2I 4J9RA 4PZOA 2ICIA 3VA7A 3S2HB 1SSOA 2F0UA 4IUPA 4FF4A 3DMUA 4IUUA 4AYBG 5B5EU 1II3A 2AH5A 4F87A 3F2BA 3D31A 4RU9A 1A0IA 2ZUCA 4Y2JA 1ZQHA 4ELTA 4LFCL 1EFWA 2ISOA 5EAYA 7ICNA 1DOLA 1HZCA 1PTOH 8ICXA 4YVZA 2KECA 4TRDA 4UB8U 1E2VA 2W9AA 5KL1B 1PYBA 1LKYA 3AUOA 2HCFA 2JK8A 2YYZA 3RJIA 2SNSA 4RGTA 2LYHA 1IKMA 1BNZA 3OGUA 1E3PA 1EU4A 5JPMC 1N33L 3MVVA 5DDMA 4G57A 4F88A 1U45A 1HUOA 4DL5A 3H3VC 1L7MA 1WTWA 2DPJA 4CCHA 3T16A 3EQLC 2FI1A 1DGSA 5FLXc 3CMEA 2OTJA 5KFUA 1F77A 3JPTA 1ENFA 3M8RA 3UXNA 2RDGA 4C3IG 4OO1H 4I28A 1VQHA 2BOSA 1B50A 3MWYW 2K03A 4MHEA 2JEAI 3PR5B 1LKYB 3C3LA 1JR0D 4YCVA 1OXJA 3NRZA 1V38A 5AIBA 2KCCA 4ODGA 4LUOA 2ZXIA 4GXKA 4DPGA 2KCTA 1K1SA 3K8AA 3NEMA 2Q8RE 1M8AA 2QW7A 5BR8Q 4UP9A 2R7ZH 3LWEA 1ZOLA 2HIVA 4FS2A 2E8OA 2XNAC 3C1ZA 1E24A 4QW8A 5G3LD 3NVYA 1XNQL 2IW3A 5EKLA 2W54A 3H8JA 3NBHA 1O7IA 2KTQA 5CRXA 4UP8A 4ECUA 3CKIB 3DDHA 2WTFA 1NK5A 3GTPH 4ECYA 4NLZA 3G6YA 1ZQKA 3K0XA 5M3MB 1S72A 1LT4D 2F3IA 4K6LA 3SYZA 3UMGA 5BPCA 3SV4A 1EYAA 8ICRA 3PIPA 1T3NA 3EROA 2EJFC 2WF6A 1NJXA 1JJGA 4NLNA 3N7PD 1I3QB 1NE3A 4PMBA 3HOZG 2GVAA 1I6HH 3TP5A 1V9PA 3QX7A 7ICEA 2UXDQ 4ED2A 2KOBA 4K8IA 1NI3A 2EANA 5AM4A 3NBHB 5JJKA 3N52A 3GV3A 2K1BA 4ELVA 4HJ8A 1YJ9A 1IKLA 1O7ZA 1N36Q 2E1EA 8ICZA 4IO9A 3VDYA 5EE9A 5M3FB 3RLFA 2YU9B 5AKYA 2QKIC 4NDXA 1AH9A 2O2LD 2IA6A 4DV3Q 3GTMH 2G5HB 3D0FA 3KUPA 3H0MB 4QZGA 3JPRA 2VJ5A 2QARB 1ZQNA 1E1OA 5M5YH 3S1QB 1M4VA 4JI8Q 1CFMA 1SROA 5J0WA 1JROA 2WF8A 4BWMA 5FJ8H 4O3OA 2EYLA 4CBVA 1N32L 3U4ZA 4KLOA 1XTCD 3MXPA 5DM63 5IWAL 2B2YA 2UUAL 3VYSA 4RQMA 1HA6A 3WK9A 3OYYA 4GLAC 1STYA 3TBIB 1LV5A 1NK9A 5KNBA 5IP7H 3ETRA 5KNDA 1PRTC 4DK1A 1JIHA 1WCMG 1WTQA 2BZFA 4BXXH 2ZTCA 4LF9L 4DV4L 3PCOB 5CBAE 4ECRA 1UT5A 4EEKA 5C3WA 5C3EH 2H3ZA 1HTPA 2B2TA 3EPGA 3V6JA 2XY7A 1XC9A 3R3OA 1KKXA 1KDAA 5KFGA 4DSIA 4O9MA 5G5HA 1MSWD 5J8YC 4EEYA 3FPUB 3KLRA 1KQSA 4IQTA 2B2UC 2OF1A 4O3RA 1MIUA 3BDCA 5ALFA 3PUXA 1F44A 3KHGA 2EIFA 3WU2U 2L15A 4DV0Q 4R9WA 1AROP 3HG9A 1DOQA 1O78A 1NOMA 2MNAA 3AQQA 3HRZC 1ED1A 1N34Q 4I2AA 2G9HD 2GWSA 3CCQA 4P0PA 1GHKA 1F2MA 5AI9A 1J2NA 4R8UA 1EY5A 1NZBA 4PHAA 2X6LA 3U9SA 5E4XA 1ICWA 3LX0A 4QZHA 1F0MA 1LTBD 5ELFA 1I6HB 3KHLA 5E3FA 1HHVA 2K60A 1F5SA 3A5ZB 2UUCL 3WOEA 3ZDCA 1KN5A 2YMPA 2BPFA 5IILA 4WJWA 5FO8B 4H13C 3G6XA 4I2GA 4X62Q 4RQ5A 4JI0L 4JV2A 4DS5A 4EQOA 3RB3A 4A93G 2BCUA 5J2FA 4P0PB 1YNXA 1WTVA 1VQCA 5LMUL 4KHPQ 4DAMA 1EIFA 5HR6A 2R3ZA 4A8EA 1XSLA 2XN9C 3A55A 1NAPA 3NUQA 2OCEA 2V4QA 3FRPB 2KCNA 3T1HL 3PO2B 5IP9G 5M5YB 1QSLA 3J80L 4OJ6A 1SXTA 4HIKA 2FMPA 1CSQA 3RR7A 2RDIA 4JWMA 1TT2A 5CYUA 4GC7A 3NVZA 4C8KA 1TS5A 2HBKA 2KUMA 3AEVA 4DV7Q 2KZMA 4Y2QA 4QZIA 3P20A 1SXDA 2NVXH 3R9KA 1SE8A 3ULLA 3FEWX 1TKDA 1KLUD 7ICUA 1S10A 2JA9A 5EBDA 1FFUA 2KCMA 2NVQH 1X2IA 4P4MA 3HOXG 3PX6A 1X3GA 2R92B 5ALGA 4DFPA 1VQFA 5J0YA 1BKBA 2EPBA 3UDIA 3N7RC 4MF8A 3Q24A 3RLNA 1ASZA 2P5ZX 4DSKA 5KT7A 1B9NA 2FMMA 2XIDA 2CW0D 1JUDA 4GKJL 1LTTD 1AE3A 3D6JA 1Q1EA 2CWAA 3EYZA 5IYBH 2NO5A 4CJ1B 4X65L 2HVIA 7ICOA 2HMXA 2DBYA 5D4BA 1B9MA 3S1MH 5C4XB 3GV6A 2GO7A 9ICCA 4C3HG 2J7ZA 5FLMG 1HH2P 5EWGA 1SIJA 3MZ5A 5FO9B 4UY8C 1HR0Q 5KFJA 4M0AA 3W5OA 1TWAB 2QILA 1U4RA 3SDZA 4IFDG 3H7IA 1HZBA 2OH2A 1EU3A 2Y9TA 3U4VA 2H3FA 2XGQA 5I2YA 4A3GH 3ER0A 1XMQQ 1XMOQ 2KE7A 3EZ5A 3D2NA 1NK7A 5AKGA 1LTID 4RKBA 1J8IA 4U673 2TMPA 4DXGA 3I4MB 4EBCA 1SMYD 4UAWA 1EL0A 4DLEA 2MUYA 2K4HA 9ICEA 1HNZQ 1QWYA 5DDYA 1DJRD 1XO1A 3RAQA 4OCZA 1N63A 3MR3A 1QNUA 4JI6Q 4MFAA 1TAUA 4K5WA 3X3NA 1K28A 2JP1A 2E8NA 3A0BU 2B2VA 1GUWA 5C4JH 2WAQC 1ET9A 2K5WA 4BGDA 5DBAA 5ALTA 3M9NB 2VB2X 1COOA 3MFYA 3QXGA 4IOAA 2YX8A 4OD0A 4I2CA 2XGPA 2CPRA 4Q8FA 2HUGA 3HFZB 5C44H 2VQFL 4LF4L 4R4TA 1BOSA 1L3VA 4OJPA 3S14H 1OXUA 1Y1WB 4J9PA 1GUTA 4LZGA 4A3JB 4PZ7A 1BNOA 3CAMA 5BOLA 1HNWQ 4DUZL 2JH1A 3WKEA 4XT3B 4P2CB 5J39A 2FHTA 5EKKA 4DL7A 2Q2IA 3RJGA 4DFKA 2PMZB 4QW9A 2HT1A 1O80A 1ONLA 2N78A 2L9HA 2F0WA 5KGUA 3HOVB 4ZKCB 1C8CA 1Z1VA 2V4RA 5KFAA 4DAVA 2XIWA 1XJVA 4DU9A 4DR5Q 5D46A 3K7AH 2JA6B 3ETLA 1EIYB 2FMQA 4LF6L 3PIOA 2O5IC 1SE3A 2KFNA 3V6HA 2Z1CA 4GXIA 1FJGL 2Z6KC 3SK6A 2EZZA 2F0FA 2NYZD 1MHWC 1CHPD 4EELA 1S5DD 1Q3UA 3TS0A 2K01A 2NZ1D 1KQQA 4RCNA 2R61A 3O0FA 3RRHA 1OXVA 3OJSA 4K4HA 4BJQA 3JPPA 3TKAA 2A3VA 1EY8A 1RPLA 4DR6Q 4CDGA 2K89A 4FXGC 2ATWA 1Q46A 5CC4A 1Z4NA 2FLLA 3JPNA 2KBNA 2R8GA 4P0QA 5AM5A 1XS9D 3M9OB 3D6WA 5GQOA 4A3LG 4H44C 1ML0D 2NVYH 5E4WC 3M4OH 3UE1A 5EPKA 2XRSD 1CQFA 2HBMA 1JOKA 1RIPA 2K28A 2N8NA 4ZKBB 2IHMA 4B3TL 1IL2A 2OXOA 3UM9A 3D3RA 1FR3A 1Q81C 1B1ZA 1QUQA 4A3GB 2A19A 1ZQXA 4RQ4A 3T3FA 1SNPA 4G7HC 1A77A 4C3IH 2H3VA 2F76X 1QILA 3GD7A 3QUQA 4OIKA 1EXNA 2ENBA 3Q6SA 7ICQA 1HIWA 2WAQG 3EN2A 5EGTA 5J0PA 1YBYA 4B3MQ 1RQLA 4DF8A 4H0LC 4DOCA 3M4QA 3HKZB 3G71A 1X6OA 3MFHA 1LUZA 2ZJAA 4QWAA 5BN4A 4DV2L 1WD0A 4R65A 3HS0C 3PO3G 4FXDA 5HNKA 4Y2SA 5C0YA 1QUQB 1VQ9A 3BDOA 1PZJD 4YWLA 3A54A 4C3JG 4Y7NH 2NBFA 1WCNA 1JJ2A 3S14B 4ZOHC 2KFZA 4JVZA 4QGUA 4TUSA 1KLNA 4UB3A 8ICPA 1NKEA 1HQMC 1JB7A 4JI7L 4DR4Q 3CHBD 4DSFA 5AICA 4I2JA 1ZQYA 3NHHA 2D9UA 3OW7A 4TQRA 3DEEA 3K80C 3K4GA 4FF2A 2J4XA 4DQRA 2K4EA 1SR3A 4XQ8A 1WJJA 2DGYA 2EYHA 3HOYG 2PFNA 1X32A 3A0HU 3RF9A 5EWFA 1OXSC 2F0MA 1XWLA 4QY7A 4CHTB 3NRWA 3HOZH 3OHXC 3CCMA 2YMMA 3PIP3 4BY1H 9ICQA 4O1NA 4YR2A 4F4KA 4K4GA 1L7PA 4JW0A 5I6YA 2OWOA 5GAEC 2Q2UA 4RQ3A 3ZI4A 1ZQUA 9ICAA 3UXOA 3GIJA 1MD2D 1ZQCA 3OOCA 1BNPA 3FDTA 2RBMA 3V05A 4AYBB 2E5LQ 3EFXD 1Z19A 2HDMA 3NE5B 2ZIXB 1H95A 3RR8A 1PH8A 4PGXA 1ZQVA 3S24A 2A68C 1MQ2A 4H7BA 3AU2A 4ZLTF 4A3MG 7ICPA 1T3QA 4IRDA 5IE8A 4UB2A 2K8BB 3NPPA 3RJEA 4E0DA 2F0OA 1CTMA 5K36G 2QEXA 1BPDA 4JB3A 1LYLA 7ICLA 4LF7L 4OWXB 1J9OA 4Y2VA 3NELA 1VQBA 5KT5A 1SJHD 4ID6A 3H3VH 4I2BA 2B8FA 2VIXA 4BBRB 2PFQA 1W6JA 3ZJYC 4KJOA 2JGAA 2L11A 2ZXHA 3RBEA 1ZQBA 1WCLA 2FPLA 8ICAA 1HEKA 4CGZA 7ICVA 3PUWA 4JBJA 2WIIB 3GTJH 1IBLQ 3GTQH 1ZQZA 4BWGB 2ZM6L 2EZVA 3TREA 2B0CA 1PVRA 1RDPD 2A69C 2JE6I 3NTKA 5LMNQ 4HR7B 3UI2A 1WCMH 3STBC 1LABA 1SFOH 2RCNA 1RXVA 4PMWA 2DY8A 4HJ9A 1XNRL 9ICMA 4RNMA 3TFRA 2IT1A 3RMHA 2EYPA 2UUBQ 1GXDC 2LBOA 1IBKL 2ASLA 1RF2D 1SEBD 3KBBA 1TV9A 4IQWA 3QUCA 1PHJA 8ICTA 3BG3A 3PW2A 3B0YA 2ZUDA 4Y7NB 1S5LU 1CSPA 3J81i 4B3RQ 4RWSC 5J2EA 1OXXK 3KZIU 3ORYA 2R8JA 3NQIA 1WWVA 4R4CA 3TN2A 3OHBA 4IS7A 5L1MA 1IV8A 5KFCA 1MBYA 1D9DA 1Z7TA 3AMUA 2A73B 4JI0Q 1BVSA 1SZPA 1VQ5A 4RPYA 5GROA 3FYHA 1VLBA 2GA4B 4F92B 4UB4A 1H9KA 2E2JH 1DCZA 1XX8A 2K7VA 4R1JA 5D14A 1L5UA 1IW7C 4LFAL 4K5VA 4O5EA 1F9QA 1VQGA 1SNDA 2E74C 2I46A 1PDQA 3CW2C 5J2KA 3L0OA 5KEEA 2RSNA 3H6MA 3SGIA 3I4NG 5F3XB 4L8JA 1X6IA 2PMZF 3J80c 3QUBA 5ALIA 8ICVA 2H4OA 4A93H 2G07A 5KFEA 4KLTA 1U49A 5J2JA 2HD3A 3K59A 5JJLA 3WKBA 4JYAQ 2B3GA 2CH4W 4HN7A 2ISPA 4OL7A 7ICGA 2WFAA 2WACA 3DM1A 1PH2A 5FK9C 5KNIA 2VA8A 4XQJA 2R8IA 3TP8A 3LYSA 5AK5A 2H3IA 1RL2A 4LJZC 5IGCA 5IP9H 2N1RA 2I5LX 4ECSA 1MSGA 4RKLA 3NVWA 2D3DA 2MU2A 4DF4A 2IL8A 4MIUA 2BA0A 4KLJA 1N2XA 5CA7A 5M9OA 5DGBA 3GIIA 2BQ3A 2DPIA 9ICXA 1RKNA 1X3QA 3A8JE 3AFPA 4CF3A 1I50H 3HEJA 3GTQB 3PSTA 1KDBA 1HQRD 4YMMA 2ASDA 2DGZA 4JCVE 5AKHA 1RXWA 5AFWA 4O0IA 5KRUA 1NKCA 1TY0A 2W9CA 1C0AA 2CCZA 4IUVA 3VR4A 3HOXH 2R93G 1SFOB 4HYKA 4UHVA 4UAUA 5KFZA 4USAA 5KFQA 3HP6A 4HSVA 2MA1A 4WORA 4E6IA 4DL2A 5ALWA 1O7YA 4FO2A 1TWCH 2VXWA 1DONA 4JK1C 4YMNA 1A0PA 1ILQA 2JRZA 2NVTB 4HJ5A 3SK8A 4L63B 5GAHC 5ALJA 2K4PA 2KN7A 5IYCG 1E22A 1KW4A 1LTAD 1U0LA 5D3DA 3W1GA 1EWIA 4POFA 4C3HH 5FLMH 3SV3A 4PHEA 1S0NA 2XWJB 2W9CB 2HHHL 4C1NI 4OJLA 1O7LA 4TKOB 5J2IA 2FLPA 5J0UA 3HKZF 3KKAC 1TK8A 5IOCA 1VQPA 4KN4C 3QJYA 3M6ZA 5LL6X 2IJ0A 5ALLA 5IY0A 4IALA 4LZDA 1STAA 2ZXOA 4KLGA 2K5DA 4PPXA 3PW7A 3S1NH 8ICFA 4I7ZC 2ZJPA 4JI5Q 4EX7A 1A63A 1ZQDA 3M7GA 4I2FA 4UPAA 2AU0A 2F4VL 1STGA 3TI0A 2ZJQA 1TWHB 3M4YA 7ICHA 1HFNA 2OYYA 1VQIA 3CCRA 4GKKQ 1N61A 1JOQA 2YTXA 4RHSA 1RQNA 5IGGA 1KNEA 3M7NA 3T4AC 2F0DA 3KFUF 4RQ0A 2NTSA 4F8RA 2A74C 1SYBA 4KKSA 2NWGA 1EEID 4IJLA 3EBEA 1NMGA 5KT4A 2N88A 5E1FA 3TADA 1COKA 2XVSA 3STBD 3SE0A 3TACB 4N9PA 4FP5D 4AYBF 1E2ZA 1DK3A 2LSSA 3RH5A 2KSOB 2UVWA 2N3SA 4J8QA 3L9AX 1SWVA 3PUVA 1STHA 2KZ3A 4YCUA 3U58A 4HIMA 3I28A 3RZDH 4RPXA 1Q8IA 3WK7A 1KFSA 2UXCQ 3QO2A 2GOLA 1ZQEA 5KL8B 2NTTA 3C1FA 4ILWA 2YY6A 3UDGA 2HQLA 4UB5A 3PQIA 3Q8PB 5M5XB 3EPIA 4YCWA 4DUYQ 1X3FA 1WUDA 5EOZA 1X42A 5J0TA 2F3VA 2K33A 4RFBA 3OTQA 3PIO3 2LM4A 4QZ8A 4UQGA 5L1JA 4G3IA 3GIMA 1QQ5A 1TWCB 1Q1BA 4A3DG 3C21A 4Q5VA 5DB7A 1ZQIA 5AKIA 5B66U 4XIGS 4BUGA 1U9RA 4N9TA 4QZEA 5CEHA 4A3LH 5DBBA 2ALZA 4IZ8A 4C4RA 2SOBA 5CMDA 3HKSA 3ZDBA 1IW7D 2IPKD 4C3HB 1XPRA 1M1KC 3MABA 2QF7A 3AL0B 1BPBA 1ZYRD 3QWNA 4FYDA 2KG5A 2MJ8A 4ZRZA 4NY8A 4M47A 4BS9A 4O3QA 3GV7B 3C2KA 3MC1A 1KL9A 4AQYQ 2ZG6A 3H94A 4GOPA 2ZJ5A 3N6RA 5IIFA 4IPGA 3RTVA 2KJ8A
chains in the Genus database with same CATH topology
1FVIA 2MNAA 2B63G 4FDBA 3AQQA 1N34Q 3OTOL 2K5NA 3CCQA 4DR7Q 1SLJA 3BZCA 4NXMQ 4ALPA 2VQFQ 4LF4Q 5BR8L 2R92G 1VQLA 4IPHA 2LXKA 3G48A 3RR5A 3CF5A 2OQKA 4LNQA 1UEBA 1SN8A 3RN2A 4DV1Q 3PO3H 2EQSA 4B3SQ 4DUZQ 3A5ZB 4BBRH 2UUCL 4JI4L 3GTKH 2PMZE 1IBKQ 4C3JH 4GOPB 3S2DH 1G291 2IX0A 3LGJA 4YY3L 5C4XG 4X62Q 2K14A 4A93G 4L5TA 1EOVA 3GTLH 3F1ZA 2K52A 1YNXA 4JI5L 1KIXA 1VQCA 5LMUL 4JC0A 4LF6Q 1Q12A 3FP9A 2JA7G 3F8TA 1FJGQ 4KHPQ 5IYDH 4DAMA 1L1OC 1EIFA 3ERSX 3W1BA 1XPOA 2OCEA 4KI0A 4X64L 4LF5Q 3HOYH 4GKKL 2AHOB 2UXDL 3T1HL 5IP9G 2R6GA 3JAMi 3MXNB 1D7QA 4HIKA 1CSQA 4A3FG 4A3BG 4GN4B 4BY1G 1IBLL 3HOUH 3I4MG 3ULPA 1N36L 3KLWA 3RLOA 1CKOA 1CKNA 3AEVA 4DV7Q 2DUDA 2R7FA 2PI2A 2LXJA 2NVXH 3CMAA 1SE8A 3ULLA 3H0GG 4A3EH 3I4OA 3J81j 4L5QA 2JA9A 2MO1A 3J81c 4A3MH 4DV3L 1KXLA 2KCMA 2NVQH 1VCIA 1WFQA 4QIWE 3HOXG 4ME3A 1X3GA 1I94Q 2B29A 1VQFA 4MTNA 1BKBA 1KHIA 4GN5A 3U50C 3A5UA 4JI8L 3UDIA 4EQ5A 1VQ8A 1ASZA 1L2FA 5ELNA 3RLNA 3IRBA 1Y1WG 4OO1G 4WJ4A 4A3JG 1YZ6A 2ZTEA 4DV5L 3KF6A 4GKJL 1J5EQ 3E9IA 1AE3A 2JJQA 3FKIH 2CWAA 1Q1EA 1CKNB 4IJHA 4LW1A 5IYBH 4DUYL 3ULJA 2RHSB 1PFSA 4X65L 3J80i 1KC8C 2VUMG 2RF4A 1AE2A 3HOVG 4JI2Q 5H1SE 3S1MH 1HZAA 2Z0SA 2K5VA 5FLMG 1HH2P 4GS3A 4P73A 1Z9FA 3HKZE 4UY8C 4X66L 2R7ZG 1HR0Q 3UE0A 4C2MH 2JA6G 3W5OA 4P75A 4IFDG 1HZBA 1YVCA 3I2ZA 3I7FA 2WB1E 3U4VA 4A3GH 1E7ZA 3ER0A 1XMQQ 3T1YQ 1BBUA 2NZOA 4A3KG 1XMOQ 2UU9Q 1HNXL 2ASBA 4DV6Q 2I5HA 1V1QA 1M90C 1VQDA 3KF6B 3CC2A 4GNXC 3CCSA 2ZTDA 2MFIA 4JI7Q 3TRZA 1LTLA 4AQYL 4AIMA 2F52A 1VQJA 4JI6Q 3S16H 2Y0SE 1EQQA 5AJ3Q 4R4OA 1NY4A 3PUZA 1OTCA 3GTOH 5C4JH 1N34L 3J7A5 4JYAL 3CCEA 4L5SA 1R9TH 1JMCA 2AWOA 4YWMA 1A62A 4DR7L 3EIVA 4IOAA 1UE5A 4NXML 4J15A 4JI3Q 5C44H 3HFZB 2VQFL 1WOCA 1Y1VG 3E0EA 5M5WH 1EYGA 2E2IH 4LF4L 4R4TA 4A3IG 3F2DA 3S14H 2D0PA 1OXUA 2D62A 2FXQA 2HIXA 4LUZA 1UE6A 4AYBE 4PZ7A 3CAMA 4DV1L 1HNWQ 4B3SL 2PNHA 3H15A 4DUZL 1IBMQ 3PUYA 2Q2IA 1YHBA 1YZ7A 5E7NA 3S15H 4DR2Q 2HT1A 1NJIC 2N78A 1Q8KA 2WAQE 2NN6G 1W3SA 4DR1Q 2NVTH 3RZOH 2XGTA 3I4NH 3PF4A 4JBKA 1QVGA 1XJVA 4DR5Q 2RHQB 3K7AH 1Q82C 1JT8A 3HKZG 2WP8J 1EIYB 4LF8L 4LF6L 4POGA 3PIOA 4BY7G 4KHPL 4DNIA 5FJ8G 1NBWA 1FJGL 2Z6KC 4KLKA 3BZKA 2K4KA 3TS0A 3RN5A 4R4IA 4LF5L 3F2CA 1WYDA 1CUKA 1OXVA 2IX1A 3CP0A 5IP7G 3L7ZC 2ZM6Q 2E2HH 1N9WA 4DR6Q 5GADC 2ATWA 2VQEQ 5M3MH 1Q46A 4BXXG 2KBNA 3PGZA 4DV7L 4MNOA 5HY6A 1OXTA 2Y0SG 4TQUS 5GQOA 4A4IA 1HR0W 2JA8G 5IT9c 3KDFA 5C3EG 2NVYH 4A3LG 3M4OH 2C35B 3UE1A 2N8NA 1TWHH 1XNRQ 1RIPA 1GD7A 1I3QH 2AMCB 2K5HA 5C0XI 4B3TL 1IL2A 4JV5Q 3A0JA 3A74A 1Q86C 1Q81C 4JG2A 1QUQA 4IFDI 1TXYA 2A19A 3DLLA 2R93H 2QGQA 1V43A 1X3EA 1N32Q 1D8LA 1PH1A 4XTCS 4PZ6A 4DK3C 2UUAQ 1J5EL 1PH6A 4C3IH 3CPWA 5M3FH 3GD7A 3Q8DA 4H02A 4OONA 2YU9H 1VQ4A 4DKAC 1VQMA 3EN2A 2WAQG 1QVCA 2AKWB 4B3MQ 3KDFB 1YBYA 2Q2TA 4JI2L 3G6EA 3NENA 1QZHA 5IYCH 3M4QA 3TQYA 3G71A 1ASYA 1X6OA 1LUZA 2BH8A 3H3VI 4O2DA 1GKHA 1XTDA 4DV2L 4JBWA 3PO3G 4RMFA 3J7ZC 4Y52H 1GVPA 1QUQB 3S1QH 2GN5A 1XMQL 1VQ9A 4YWLA 4BBRG 3FHWA 4PZ8A 2JA5H 3CCVA 4DV6L 4LFAQ 4Y7NH 2A8VA 4GNXA 1EQRA 3GDEA 1MKHA 4YHHQ 1JJ2A 5M5XH 1IYJB 1K73C 4LF8Q 4QGUA 4JI7L 1BBWA 1JB7A 2Q2HA 4DR4Q 4P74A 4R4QA 5IYDG 3CXCA 2XTIA 3ICEA 1SMXA 3K80C 5AJ3L 4GOPC 3PF5A 2UXCL 1SR3A 1WJJA 2DGYA 3HOYG 5J3BA 1PA6A 1B7YB 1CKMA 1OXSC 4IOCA 4APVA 3E9HA 4EX5A 4QY7A 3HOZH 4BA1I 3CCMA 1QVFA 3KJOA 1WI5A 2I5MX 4JI3L 2VW9A 3S17H 1VQ7A 1W2BA 4LFCQ 2Q2UA 3HOUG 4GNXB 4HIDA 5GAEC 2OWOA 1HJPA 4LUVA 1L0WA 2E5LQ 3JC66 1IBML 2OQ0A 2KHIA 4A3EG 4JI4Q 2YTYA 1PH8A 1H95A 4JBMA 1YHAA 3S24A 4DR2L 4A3MG 2EXDA 1FGUA 1GM5A 1G6PA 5IE8A 1N33Q 3M4PA 4YY3Q 4DR1L 3S2HH 2CFMA 2GVBA 5HGQA 4DR5L 5K36G 2QEXA 4LF7L 1LYLA 2IHFA 2Z6KA 4WJ3M 4OWXB 1JJCB 3NELA 1VQBA 3I56A 3H3VH 1IZ6A 1K8GA 1YEZA 4JOIA 4X6AH 3FKIG 1LM0A 1VQ6A 1VS0A 3ZJYC 5IYBG 3BU2A 4DV0L 1YITA 4P71A 1K83H 2MO0A 1YJWA 4DAYB 1HNZQ 3PUWA 3HOWH 3GTJH 1X65A 3GTQH 4JBJA 4K0KQ 1IBLQ 3K7UC 2ZM6L 4A75A 3TREA 3CCLA 4BBSH 2AWNA 4DR6L 2VQEL 1PH5A 2JE6I 4A3DH 2D0OA 5LMNQ 2IY5B 2HHHQ 1JE5A 1WCMH 4A3GG 3STBC 3TS2A 3PV0A 1XNQQ 1SFOH 2RCNA 4PMWA 4HJ9A 1C9OA 1XNRL 4JV5L 2IT1A 2KENA 2UUBQ 1PH3A 1IBKL 2UXBQ 2IHEA 2CWPA 3PO2H 1PHJA 1X55A 2E8GA 1VQKA 4X62L 1Z47A 3JAMc 2BH2A 1I5FA 4HIOA 1CSPA 3J81i 3KJPA 4DV5Q 4A3CG 4B3RQ 4GKJQ 4IPCA 1L1OA 1OXXK 4R4CA 4P72A 4LFBQ 2VS1A 2F4VQ 3AFQA 2PI2E 3RNUA 2WB1G 1B70B 2ALYB 2H5XA 3KYHC 2B63H 5C44G 4PG3A 4JI0Q 1PH4A 2PQAA 4NB3A 1BVSA 5ELOA 3OW2A 1VQ5A 1J6QA 2YTVA 5GROA 2JEBI 4GLVB 2R92H 2E2JH 4OO1I 1Y14B 1PH9A 4O0AA 4R1JA 3WWVA 2OTLA 4LFAL 1S3OA 1K8AC 2BA1A 1VQGA 3M85A 2VNUD 4YHHL 1G51A 1L1OB 1VQAA 2ID0A 4LWCA 4L5RC 3CW2C 1VQNA 3L0OA 1NTGA 4NXNQ 3I4NG 3SGIA 1PH7A 4A76A 4GN3B 1YI2A 4DR4L 5C4XH 4UP7A 1U5KA 2KHJA 3J80c 1YHQA 1I94L 4A93H 2PQAB 1UE7A 2JA7H 4BA2I 1TWAH 5JJLA 4JYAQ 2B3GA 3CQZH 4AYBG 5IWAQ 3CC4A 2A1AA 1PH2A 3D31A 4IPDA 3F2BA 1A0IA 1X56A 4LFCL 1B8AA 5IP9H 1EFWA 5JJIA 1RL2A 5EAYA 4A3BH 4A3FH 2I5LX 1HZCA 1UWVA 5M3MG 1YIJA 1X54A 4BY1H 2E5LL 3I4MH 2YYZA 1PYBA 2BA0A 3S1RH 2JK8A 1IXRA 1HR0L 3AFPA 1Q7YC 4QQBX 1I50H 3KFUA 4LF9Q 2R7DA 4DV4Q 5LMNW 4OX9Q 3KF8B 3H0GH 1E3PA 4JCVE 3T1YL 4OWWB 1N33L 2YV5A 1XMOL 2UU9L 5JEAJ 1C0AA 4YWKA 2CCZA 1K0RA 3HOXH 4DR3Q 4DK6C 2R93G 5FLXc 3CMEA 1DGSA 1YJNA 2OTJA 4JI1Q 1FL0A 3CD6A 3DM3A 1Y1WH 5M3FG 1TWCH 1VQHA 1UE1A 4A3JH 4JI6L 2JEAI 5JEAG 2WFWA 4HJ5A 2JQOA 1K9MC 1HNZL 2NN6I 4YCVA 4AH6A 5GAHC 3OTOQ 4K0KL 3B6YA 2VUMH 4LUOA 5IYCG 1E22A 3HOVH 1U0LA 4DPGA 3I55A 2KCTA 1A8VA 3K8AA 3NEMA 3W1GA 1EWIA 4POFA 4C3HH 5FLMH 2QA4A 5BR8Q 1TWGH 5LMNL 4MZ9A 4UP9A 2R7ZH 2HHHL 3GTGH 2JA6H 2HIVA 1XPUA 1E24A 2ZJRA 2JA5G 1MJEA 1XNQL 1S40A 1MJCA 1SRUA 1HNWL 3L2PA 1VQPA 3TEHB 4B3TQ 3CC7A 4A3KH 1O7IA 2UUCQ 4UP8A 2UUBL 1EUJA 5IY0A 1KD1C 3GTPH 2UXBL 1NMFA 3K0XA 5C0XJ 1S72A 2MQHA 2F3IA 3S1NH 4OXPA 3PIPA 2ZJPA 4B3RL 4JI5Q 4IFDJ 1A63A 5LMUQ 4LFBL 4UPAA 2I0QA 2F4VL 2ZJQA 1KAWA 4HJAA 1JJGA 3M3YH 1NE3A 3HOZG 2GVAA 4X64Q 4GLXA 3CCRA 2V1CC 1VQIA 1T9HA 3UDXA 4GKKQ 1I6HH 2YTXA 1V9PA 2UXDQ 3T1HQ 5C0XG 4JI0L 1VQEA 3M7NA 2CQOA 3NBHB 5JJKA 4DV2Q 4A3CH 1Y1VH 1K3RA 3AYHB 4HJ7A 3CCJA 4HJ8A 1YJ9A 4A3IH 1X9NA 1N36Q 4IJLA 4IO9A 3EBEA 4QL5A 3G4SA 3VDYA 1NMGA 1N8RC 3RLFA 2VZAA 2VY3A 3UDFA 3STBD 1AH9A 2LSSA 4NXNL