3AFAA

The human nucleosome structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaA00
1N1JB 2CV5D 4Z66D 3NQUA 1P3FC 4XZQA 5BT1C 3AZLD 1KX4A 4CSRA 3KWQD 4ZBJC 4KGCB 4QLCD 4AWLC 5CPIA 4LD9D 3W98C 4LD9A 3AZJB 2NZDB 1ID3B 4WU9B 1S32A 4WU8C 5B1LB 1M1AB 1S32D 3LZ0D 1JFIB 3AZEA 3VH5W 1M19A 3WA9C 1HQ3D 3MNNC 3AZED 4Z5TC 2YFWB 3X1UC 5AVBD 1F66D 3W96C 2CV5C 4Z66C 3AZMA 1P3FD 3LJAA 3AZMD 5BS7C 5AV9A 3X1SB 3V9RA 5KDMA 5AV6A 5GT0B 3KXBD 5AV6D 4JJNC 4H9RB 3UTAA 1M18B 4XUJD 3AZJA 3LZ0C 4HGAC 3LELB 4WU9A 1U35A 3AZJD 5AY8A 3MGPB 1U35D 4J8VD 3W97D 1JFIA 2AROB 3MNND 3AZEC 5B0ZD 3AFAD 2YFWA 3AZFB 4UUZA 5B0YA 3REJA 4CAYA 5GXQC 3AV2A 1ZLAC 3KXBC 4J8UC 5DNMB 3AV2D 3X1SA 1AOIB 3B6GB 3UTBD 4H9NB 3AYWA 3NQJA 3X1SD 3NQUB 1BH9B 3B0CT 3AYWD 1P3OB 5G49B 5B33A 3WAAA 5BNXB 1KX3D 1P34C 2YFVB 4ZUXC 3AV1C 5B33D 5FUGA 3AZKA 3AZJC 4WU9C 5B2JA 3RELB 2F8NB 3A6NB 3O62D 4J8XC 3AZNB 4H9OA 3O62A 2AROA 1P3BD 1S32B 3AZIC 1P3BA 2AROD 3MNNB 3MGRB 4NE3A 3TU4A 3UT9D 3AZGC 4X23C 5JRGC 4CAYB 3KSYA 5GXQA 4J8UD 3AV2C 1ZLAA 4WNNA 1BH8A 5B40B 5CPKC 1AOIA 3AYWC 3B6GA 5JA4A 1KX3C 4YS3A 2NQBA 3WKJB 4JJNB 3X1VC 5CP6D 1P3KB 5B31C 4G92C 1P3FB 5B24C 3C1CD 5B2JB 5AV8C 5F99A 4KHAB 1P3PD 2HIOA 3REHC 3AZLB 3AZIA 1A7WA 1EQZC 5AV5C 1M1AA 1KX4B 5B1MD 3REKA 2NZDD 5C3IC 1M18A 4QLCB 3REKD 3AFAB 1P3MA 4KUDC 1BFMA 2JSSA 5E5AB 4KGCA 5CPIB 1P3MD 5GXQB 5CPJC 2PYOA 4J8UB 5B1LA 3W97B 5DNMD 4YM6D 3W98A 4YS3B 5DNMA 5GSUB 1TZYA 1H3OB 4YM6A 5B31A 1P34B 1F66B 3C1BB 3WAAB 3X1TB 2CWEA 5F99C 5GT0C 3W96D 4R8PC 5BO0A 4H9RA 3UTAB 3AZNC 1EQZD 5B32B 5AV9B 1P3OA 3AZIB 1EQZA 4WZSB 3AZMC 5GT3D 1P3AA 4G91B 2YFVA 3MVDC 1P3OD 2F8NG 3W99B 4H9OB 4WV4B 1P3MC 2RVQC 4KUDA 1P3LA 2L5AA 5AV6C 3RELA 1KX5C 4E45A 3VH6W 3RELD 1P3IC 3MGPD 3O62B 5B0YB 3LZ1C 1U35B 4XUJC 5AY8B 3MGPA 4AWLB 1ID3D 3AN2D 3MGRA 3AZFC 3X1VB 1M19B 3MGRD 3WKJD 1ZLAB 3WKJA 2NQBB 1BH9A 3WA9B 1BH8B 3AZHB 4R8PA 3LJAB 5FUGB 5BT1D 3AZLC 3REIA 2CV5B 3MGSD 1TAFA 4M6BA 4Z66B 1P3AC 1EQZB 1KX4C 1N1JA 3REID 3B6FC 4XZQD 3REHD 4QLCC 4EO5C 1P3LC 3X1SC 5B31G 3RELC 1P3ID 5CPIC 4J8XB 3REKB 1ULYA 4H9SA 1B6WA 3AV1D 1HQ3C 3LELC 4Z5TA 5JRGB 1R4VA 1M19D 5B0ZB 2AROC 3AZEB 2FJ7C 3C1BD 5AVBA 4R8PB 3W98B 1P3FA 5AV9C 3B6FD 3LJAD 4JJND 3B6FA 3NQJB 4JJNA 3KUYD 1WWIA 5AV6B 1AOIC 3B6GC 5AV8B 5CP6C 3X1UB 5B2ID 3UTAD 4XUJB 4WU8A 5AV5B 5B2IA 3AV1B 3C1CC 4WU8D 4J8WC 5B24A 2BYMB 3AFAC 4KUDB 1M19C 4J8VA 3W97A 3A6NC 3MNNA 5B0ZA 5E5AD 2IO5B 4CSRB 3R45A 2FJ7A 1H3OA 4YM6B 5E5AA 5B0YD 1M18C 5BNVA 3AZHD 5BS7A 1HTAA 3AZHA 5B40A 3AV2B 5BO0B 5B40D 2PYOC 3UTBA 5B33C 5B32G 5AVCD 3UTAC 3AZKC 5CHLB 5G49A 5AVCA 1TAFB 3W99C 4J8XA 4KHAA 5B2JD 5DNNC 3A6ND 5GT0D 3KXBB 4J8VC 3V9RB 1P3PB 3AZND 2F8NA 5GT0A 4X23D 2FJ7B 1P3OC 4X23A 4ZUXB 3TU4D 3KWQC 4NFTA 2F8NK 5GXQD 4J8UA 1ZLAD 1F1EA 3X1VA 5GSUA 1S32C 3AN2C 4YS3D 5GSUD 3MGSB 5CP6B 3MGRC 4Z2MG 5AV8D 3AZFA 3WA9A 3AZGB 1F66C 3C1CB 3REHA 3WTPA 5AV5D 2NZDC 3REIB 2CV5A 1P3PA 4XZQB 3WTPD 5AV5A 5F99B 1M1AC 3REKC 3AZID 1KX3B 2IO5C 2HUEC 5GT3B 3AZLA 1KX4D 5BNXA 4Z5TB 4G91C 5JRGA 3MVDB 3KWQA 3VH5T 4Z2MH 5JRGD 4QLCA 5CPID 5B24B 4KGCD 4LD9B 5CPKA 3B0DC 3MGQC 5CPKD 2PYOB 5B1LD 4E44A 1TZYC 3LZ0A 3LZ1B 1U35C 3W98D 5AY8C 1HQ3A 5B31D 1F66A 5AVBB 3KUYB 3VH6T 3X1UA 3W96A 3REJC 3X1UD 5KDMB 2RVQD 5AV9D 3LJAC 3KXBA 5GT3A 4ZBJB 1P3BB 4KUDD 5CPJA 1Q9CA 3WAAC 4ZUXD 3TU4B 1ID3C 3X1TC 5CPJD 3MGQD 4XUJA 4WU8B 4ZUXA 3MGQA 4WU9D 5AY8D 1KU5A 4DRAA 5B32C 4YM6C 4J8WD 5JA4B 1HQ3B 4J8WA 3AFAA 1P3MB 1P3KA 1KX5B 3VH6A 3REJD 3UT9C 3AZGD 5B0ZC 1P3KD 3REIC 4R8PD 5B0YC 3AZGA 4XZQC 3MGSA 3WTPB 3UTBB 3WAAD 2BYKA 3X1TD 1KX3A 2NQBC 1P3IA 3X1TA 4HGAB 3AZKD 4X23B 5B32D 5B2IB 3AV1A 3W99D 5B32A 1P3AB 5DNND 3W99A 2HIOC 3KWQB 5DNNA 4J8WB 4Z5TD 5B1MC 1P3LB 5AVBC 4G92B 3UT9A 3C1BA 3REJB 3AN2B 4H9PA 1P3GC 3MGSC 3REHB 1AOID 3B6GD 2LY8A 4DRBA 2NQBD 3KUYA 2BYKB 5CP6A 5C3IB 3VH5A 5B33B 5AVCB 3C1CA 5CPJB 5F99D 2HIOD 4NE5A 3W97C 3LELA 3B0CW 4NE6A 5B24D 3LELD 1M1AD 2NZDA 3MVDD 5B1MA 4J8VB 1P3PC 1M18D 3MVDA 2FJ7D 3MGQB 3C1BC 3R45B 1KX5D 1P3GD 5B40C 5CPKB 2PYOD 1KX5A 4KGCC 1P3GA 3UTBC 3AZMB 5B31B 5B1LC 3KUYC 1P34A 1TZYD 1P34D 4H9QB 5DNMC 5B2JC 5B2IC 1P3IB 3O62C 4J8XD 3W96B 1P3BC 2F8NH 3A6NA 2HIOB 1P3AD 3AZNA 2F8ND 3TU4C 5B1MB 5E5AC 1P3LD 3AZKB 2HUEB 5GT3C 3AZHC 1P3GB 4H9SC 4YS3C 5DNNB 2BYMA 4LD9C 5GSUC 1ID3A 3AN2A 4WNNB 3LZ0B 3LZ1A 3B0DB 3X1VD 3MGPC 3B6FB 3LZ1D 3WTPE 3UT9B 4H9QA 4UUZB 4EO5B 1TZYB 5AVCC 3AZFD 4H9NA 5AV8A 3B0BA 3AYWB 4H9PB 3WA9D 3WTPC 5BNVB 3WKJC 1WWSA 1B67A 1P3KC 4Z66A
chains in the Genus database with same CATH superfamily
1N1JB 2CV5D 4Z66D 3NQUA 1P3FC 4XZQA 5BT1C 2XD1A 3AZLD 1KX4A 4CSRA 3KWQD 4ZBJC 4KGCB 4QLCD 4AWLC 2Y2HA 5CPIA 4LD9D 3W98C 4LD9A 3AZJB 2NZDB 1ID3B 2JE5A 4WU9B 1S32A 4WU8C 5B1LB 1M1AB 1S32D 3LZ0D 1JFIB 3AZEA 3VH5W 1M19A 3WA9C 1HQ3D 2Y2OA 3MNNC 3AZED 4Z5TC 2YFWB 2W8SA 3X1UC 5AVBD 1F66D 3W96C 2CV5C 4Z66C 3AZMA 1P3FD 3LJAA 3AZMD 5BS7C 5AV9A 3X1SB 3V9RA 5KDMA 5AV6A 5GT0B 3KXBD 5AV6D 2DF4C 4JJNC 4H9RB 3UTAA 1M18B 4XUJD 3AZJA 3LZ0C 4HGAC 3LELB 4WU9A 1U35A 3AZJD 5AY8A 3MGPB 1U35D 4J8VD 3W97D 1JFIA 2AROB 3MNND 3AZEC 5B0ZD 3AFAD 2YFWA 3AZFB 4UUZA 5B0YA 3REJA 4CAYA 5GXQC 3AV2A 1ZLAC 3A1IA 3KXBC 4J8UC 5DNMB 3AV2D 3X1SA 1AOIB 3B6GB 3UTBD 4H9NB 3AYWA 3NQJA 3X1SD 3NQUB 1BH9B 3B0CT 3AYWD 1P3OB 5G49B 5B33A 3WAAA 5BNXB 1KX3D 1P34C 2YFVB 4ZUXC 3AV1C 5B33D 5FUGA 3AZKA 3AZJC 2RIQA 4WU9C 5B2JA 3RELB 2F8NB 3A6NB 3O62D 4J8XC 2Y2IA 3AZNB 4H9OA 3O62A 2AROA 1P3BD 2Y2PA 1S32B 3AZIC 1P3BA 2AROD 3MNNB 3MGRB 3FDDA 4NE3A 3TU4A 3UT9D 3AZGC 4X23C 5JRGC 4CAYB 3KSYA 5GXQA 4J8UD 3AV2C 1ZLAA 4WNNA 1BH8A 5B40B 5CPKC 1AOIA 3AYWC 3B6GA 5JA4A 1KX3C 4YS3A 2NQBA 3WKJB 4JJNB 3X1VC 5CP6D 1P3KB 5B31C 4G92C 1P3FB 5B24C 3C1CD 5B2JB 5AV8C 5F99A 4KHAB 1P3PD 2HIOA 3REHC 3AZLB 3AZIA 1A7WA 1EQZC 5AV5C 1M1AA 1KX4B 5B1MD 3REKA 2NZDD 5C3IC 1M18A 4UPKA 4QLCB 3REKD 3AFAB 1P3MA 4KUDC 1BFMA 2JSSA 2ZY2A 3H0MC 5E5AB 5CPIB 4KGCA 1P3MD 5GXQB 3KFUG 5CPJC 2PYOA 4J8UB 5B1LA 3W97B 5DNMD 4YM6D 3W98A 4YS3B 5DNMA 5GSUB 1TZYA 1H3OB 4YM6A 5B31A 1P34B 1F66B 2Y2GA 3C1BB 3WAAB 3X1TB 2CWEA 5F99C 5GT0C 3W96D 4R8PC 5BO0A 4H9RA 3UTAB 3AZNC 1EQZD 5B32B 5AV9B 1P3OA 3AZIB 1EQZA 4WZSB 3AZMC 5GT3D 1P3AA 4G91B 2YFVA 3MVDC 1P3OD 2F8NG 3W99B 4H9OB 4WV4B 1P3MC 2RVQC 4KUDA 1P3LA 2L5AA 5AV6C 3RELA 3EPKA 1KX5C 4E45A 3VH6W 3RELD 1P3IC 2ZY3A 3O62B 3MGPD 5B0YB 3LZ1C 1U35B 4XUJC 5AY8B 3MGPA 4AWLB 1ID3D 3AN2D 3MGRA 3AZFC 3X1VB 1M19B 3MGRD 3P5JB 3WKJD 1ZLAB 3WKJA 2NQBB 1BH9A 3WA9B 1BH8B 3AZHB 4R8PA 3LJAB 5FUGB 5BT1D 3AZLC 3REIA 2CV5B 3MGSD 1TAFA 4M6BA 4Z66B 1P3AC 1EQZB 1KX4C 1N1JA 3REID 3B6FC 4XZQD 3REHD 4QLCC 4EO5C 1P3LC 3X1SC 5B31G 3RELC 1P3ID 5CPIC 4J8XB 2ZM5A 3REKB 1ULYA 4H9SA 2F2AC 1B6WA 3AV1D 1HQ3C 3AL0C 3LELC 4Z5TA 5JRGB 1R4VA 1M19D 5B0ZB 1Z2CB 2AROC 3AZEB 2FJ7C 3C1BD 5AVBA 4R8PB 3W98B 1P3FA 5AV9C 3B6FD 3LJAD 4JJND 3B6FA 3NQJB 4JJNA 3KUYD 1WWIA 5AV6B 1AOIC 3B6GC 5AV8B 2XD5A 5CP6C 3X1UB 3EPHA 2DQNC 5B2ID 3IP4C 3UTAD 4WU8A 4XUJB 5AV5B 5B2IA 3AV1B 3C1CC 4WU8D 4J8WC 5B24A 2BYMB 3AFAC 4KUDB 1M19C 4J8VA 3W97A 3A6NC 3MNNA 2Y2LA 2Y2NA 5B0ZA 3R45A 5E5AD 4CSRB 2IO5B 2FJ7A 1H3OA 4YM6B 5E5AA 5B0YD 2J8PA 3EPJA 2Y2MA 1M18C 5BNVA 3EPLA 3AZHD 5BS7A 1HTAA 3AZHA 5B40A 2Y2QA 3AV2B 5BO0B 5B40D 2PYOC 3UTBA 5B33C 5B32G 5AVCD 3UTAC 3AZKC 5CHLB 5G49A 5AVCA 1TAFB 3W99C 4J8XA 4KHAA 5B2JD 5DNNC 3A6ND 5GT0D 3KXBB 4J8VC 3V9RB 1P3PB 3AZND 2F8NA 5GT0A 4X23D 2FJ7B 1P3OC 4X23A 4ZUXB 3TU4D 3KWQC 4NFTA 2F8NK 2UWXA 5GXQD 4J8UA 1ZLAD 1F1EA 3EG5B 3X1VA 5GSUA 1S32C 3AN2C 2G5IC 2Y2JA 4YS3D 5GSUD 3MGSB 5CP6B 3MGRC 4Z2MG 5AV8D 3AZFA 3H0RC 3H0LC 1PZRA 3WA9A 3AZGB 1F66C 3C1CB 3REHA 3WTPA 5AV5D 2NZDC 3REIB 2CV5A 1P3PA 4XZQB 3WTPD 5AV5A 5F99B 1M1AC 3REKC 3AZID 1KX3B 2IO5C 2HUEC 5GT3B 3AZLA 1KX4D 5BNXA 4Z5TB 4G91C 5JRGA 3MVDB 3KWQA 3VH5T 4Z2MH 5JRGD 4QLCA 5CPID 2JCHA 5B24B 4KGCD 4LD9B 5CPKA 3B0DC 3MGQC 5CPKD 2PYOB 5B1LD 4E44A 1TZYC 3LZ0A 3LZ1B 1U35C 3W98D 5AY8C 1HQ3A 2BG1A 3A1KA 5B31D 1F66A 5AVBB 3KUYB 3VH6T 3X1UA 3W96A 3REJC 3X1UD 5KDMB 2RVQD 5AV9D 3LJAC 3KXBA 5GT3A 4ZBJB 1P3BB 4KUDD 5CPJA 1Q9CA 3WAAC 4ZUXD 3TU4B 1ID3C 3X1TC 5CPJD 3MGQD 4XUJA 4WU8B 4ZUXA 3MGQA 4WU9D 5AY8D 1KU5A 4DRAA 5B32C 4YM6C 4J8WD 5JA4B 1HQ3B 4J8WA 3AFAA 1P3MB 1P3KA 1KX5B 3VH6A 3REJD 3UT9C 3AZGD 5B0ZC 1P3KD 3REIC 4R8PD 5B0YC 3AZGA 4XZQC 3MGSA 3WTPB 3UTBB 3WAAD 2BYKA 3X1TD 1KX3A 2NQBC 1P3IA 3X1TA 4HGAB 3AZKD 4X23B 5B32D 5B2IB 3AV1A 2VQRA 3W99D 5B32A 1P3AB 5DNND 3W99A 2HIOC 3KWQB 5DNNA 4J8WB 4Z5TD 4DQYB 5B1MC 1P3LB 5AVBC 4G92B 3UT9A 3C1BA 3REJB 3AN2B 3F6TA 4H9PA 1P3GC 3MGSC 3REHB 1AOID 3B6GD 2LY8A 4DRBA 2NQBD 3KUYA 2BYKB 5CP6A 5C3IB 3VH5A 5B33B 5AVCB 2ZY5A 1T3UA 3C1CA 5CPJB 5F99D 2HIOD 4NE5A 3W97C 3LELA 3B0CW 4NE6A 5B24D 3LELD 1M1AD 2NZDA 3MVDD 5B1MA 4WJ3C 4J8VB 1P3PC 1M18D 3MVDA 2FJ7D 3MGQB 3C1BC 3R45B 1KX5D 1P3GD 5B40C 5CPKB 2PYOD 1KX5A 4KGCC 1P3GA 1W2EA 3UTBC 2G5HC 3AZMB 5B31B 5B1LC 3KUYC 1P34A 1TZYD 1P34D 4H9QB 5DNMC 5B2JC 5B2IC 1P3IB 3O62C 4J8XD 3W96B 1P3BC 2F8NH 3A6NA 2HIOB 1P3AD 3AZNA 2F8ND 3TU4C 5B1MB 5E5AC 1P3LD 3AZKB 2HUEB 5GT3C 3AZHC 1P3GB 4H9SC 4YS3C 5DNNB 2BYMA 4LD9C 5GSUC 1ID3A 3AN2A 4WNNB 3LZ0B 3LZ1A 3B0DB 3X1VD 3MGPC 3B6FB 3LZ1D 3WTPE 3UT9B 2Y2KA 4H9QA 4UUZB 4EO5B 1TZYB 5AVCC 3AZFD 4H9NA 5AV8A 3B0BA 2ZY4A 3AYWB 2FFFB 4H9PB 3WA9D 3WTPC 5BNVB 3WKJC 1WWSA 1B67A 1P3KC 4Z66A
chains in the Genus database with same CATH topology
1N1JB 2CV5D 4Z66D 3NQUA 1P3FC 4XZQA 5BT1C 2XD1A 3AZLD 1KX4A 4CSRA 3KWQD 4ZBJC 4KGCB 4QLCD 4AWLC 2Y2HA 5CPIA 4LD9D 3W98C 4LD9A 3AZJB 2NZDB 1ID3B 2JE5A 4WU9B 1S32A 4WU8C 5B1LB 1M1AB 1S32D 3LZ0D 1JFIB 3AZEA 3VH5W 1M19A 3WA9C 1HQ3D 2Y2OA 3MNNC 3AZED 4Z5TC 2YFWB 2W8SA 3X1UC 5AVBD 1F66D 3W96C 2CV5C 4Z66C 3AZMA 1P3FD 3LJAA 3AZMD 5BS7C 5AV9A 3X1SB 3V9RA 5KDMA 5AV6A 5GT0B 3KXBD 5AV6D 2DF4C 4JJNC 4H9RB 3UTAA 1M18B 4XUJD 3AZJA 3LZ0C 4HGAC 3LELB 4WU9A 1U35A 3AZJD 5AY8A 3MGPB 1U35D 4J8VD 3W97D 1JFIA 2AROB 3MNND 3AZEC 5B0ZD 3AFAD 2YFWA 3AZFB 4UUZA 5B0YA 3REJA 4CAYA 5GXQC 3AV2A 1ZLAC 3A1IA 3KXBC 4J8UC 5DNMB 3AV2D 3X1SA 1AOIB 3B6GB 3UTBD 4H9NB 3AYWA 3NQJA 3X1SD 3NQUB 1BH9B 3B0CT 3AYWD 1P3OB 5G49B 5B33A 3WAAA 5BNXB 1KX3D 1P34C 2YFVB 4ZUXC 3AV1C 5B33D 5FUGA 3AZKA 3AZJC 2RIQA 4WU9C 5B2JA 3RELB 2F8NB 3A6NB 3O62D 4J8XC 2Y2IA 3AZNB 4H9OA 3O62A 2AROA 1P3BD 2Y2PA 1S32B 3AZIC 1P3BA 2AROD 3MNNB 3MGRB 3FDDA 4NE3A 3TU4A 3UT9D 3AZGC 4X23C 5JRGC 4CAYB 3KSYA 5GXQA 4J8UD 3AV2C 1ZLAA 4WNNA 1BH8A 5B40B 5CPKC 1AOIA 3AYWC 3B6GA 5JA4A 1KX3C 4YS3A 2NQBA 3WKJB 4JJNB 3X1VC 5CP6D 1P3KB 5B31C 4G92C 1P3FB 5B24C 3C1CD 5B2JB 5AV8C 5F99A 4KHAB 1P3PD 2HIOA 3REHC 3AZLB 3AZIA 1A7WA 1EQZC 5AV5C 1M1AA 1KX4B 5B1MD 3REKA 2NZDD 5C3IC 1M18A 4UPKA 4QLCB 3REKD 3AFAB 1P3MA 4KUDC 1BFMA 2JSSA 2ZY2A 3H0MC 5E5AB 5CPIB 4KGCA 1P3MD 5GXQB 3KFUG 5CPJC 2PYOA 4J8UB 5B1LA 3W97B 5DNMD 4YM6D 3W98A 4YS3B 5DNMA 5GSUB 1TZYA 1H3OB 4YM6A 5B31A 1P34B 1F66B 2Y2GA 3C1BB 3WAAB 3X1TB 2CWEA 5F99C 5GT0C 3W96D 4R8PC 5BO0A 4H9RA 3UTAB 3AZNC 1EQZD 5B32B 5AV9B 1P3OA 3AZIB 1EQZA 4WZSB 3AZMC 5GT3D 1P3AA 4G91B 2YFVA 3MVDC 1P3OD 2F8NG 3W99B 4H9OB 4WV4B 1P3MC 2RVQC 4KUDA 1P3LA 2L5AA 5AV6C 3RELA 3EPKA 1KX5C 4E45A 3VH6W 3RELD 1P3IC 2ZY3A 3O62B 3MGPD 5B0YB 3LZ1C 1U35B 4XUJC 5AY8B 3MGPA 4AWLB 1ID3D 3AN2D 3MGRA 3AZFC 3X1VB 1M19B 3MGRD 3P5JB 3WKJD 1ZLAB 3WKJA 2NQBB 1BH9A 3WA9B 1BH8B 3AZHB 4R8PA 3LJAB 5FUGB 5BT1D 3AZLC 3REIA 2CV5B 3MGSD 1TAFA 4M6BA 4Z66B 1P3AC 1EQZB 1KX4C 1N1JA 3REID 3B6FC 4XZQD 3REHD 4QLCC 4EO5C 1P3LC 3X1SC 5B31G 3RELC 1P3ID 5CPIC 4J8XB 2ZM5A 3REKB 1ULYA 4H9SA 2F2AC 1B6WA 3AV1D 1HQ3C 3AL0C 3LELC 4Z5TA 5JRGB 1R4VA 1M19D 5B0ZB 1Z2CB 2AROC 3AZEB 2FJ7C 3C1BD 5AVBA 4R8PB 3W98B 1P3FA 5AV9C 3B6FD 3LJAD 4JJND 3B6FA 3NQJB 4JJNA 3KUYD 1WWIA 5AV6B 1AOIC 3B6GC 5AV8B 2XD5A 5CP6C 3X1UB 3EPHA 2DQNC 5B2ID 3IP4C 3UTAD 4WU8A 4XUJB 5AV5B 5B2IA 3AV1B 3C1CC 4WU8D 4J8WC 5B24A 2BYMB 3AFAC 4KUDB 1M19C 4J8VA 3W97A 3A6NC 3MNNA 2Y2LA 2Y2NA 5B0ZA 3R45A 5E5AD 4CSRB 2IO5B 2FJ7A 1H3OA 4YM6B 5E5AA 5B0YD 2J8PA 3EPJA 2Y2MA 1M18C 5BNVA 3EPLA 3AZHD 5BS7A 1HTAA 3AZHA 5B40A 2Y2QA 3AV2B 5BO0B 5B40D 2PYOC 3UTBA 5B33C 5B32G 5AVCD 3UTAC 3AZKC 5CHLB 5G49A 5AVCA 1TAFB 3W99C 4J8XA 4KHAA 5B2JD 5DNNC 3A6ND 5GT0D 3KXBB 4J8VC 3V9RB 1P3PB 3AZND 2F8NA 5GT0A 4X23D 2FJ7B 1P3OC 4X23A 4ZUXB 3TU4D 3KWQC 4NFTA 2F8NK 2UWXA 5GXQD 4J8UA 1ZLAD 1F1EA 3EG5B 3X1VA 5GSUA 1S32C 3AN2C 2G5IC 2Y2JA 4YS3D 5GSUD 3MGSB 5CP6B 3MGRC 4Z2MG 5AV8D 3AZFA 3H0RC 3H0LC 1PZRA 3WA9A 3AZGB 1F66C 3C1CB 3REHA 3WTPA 5AV5D 2NZDC 3REIB 2CV5A 1P3PA 4XZQB 3WTPD 5AV5A 5F99B 1M1AC 3REKC 3AZID 1KX3B 2IO5C 2HUEC 5GT3B 3AZLA 1KX4D 5BNXA 4Z5TB 4G91C 5JRGA 3MVDB 3KWQA 3VH5T 4Z2MH 5JRGD 4QLCA 5CPID 2JCHA 5B24B 4KGCD 4LD9B 5CPKA 3B0DC 3MGQC 5CPKD 2PYOB 5B1LD 4E44A 1TZYC 3LZ0A 3LZ1B 1U35C 3W98D 5AY8C 1HQ3A 2BG1A 3A1KA 5B31D 1F66A 5AVBB 3KUYB 3VH6T 3X1UA 3W96A 3REJC 3X1UD 5KDMB 2RVQD 5AV9D 3LJAC 3KXBA 5GT3A 4ZBJB 1P3BB 4KUDD 5CPJA 1Q9CA 3WAAC 4ZUXD 3TU4B 1ID3C 3X1TC 5CPJD 3MGQD 4XUJA 4WU8B 4ZUXA 3MGQA 4WU9D 5AY8D 1KU5A 4DRAA 5B32C 4YM6C 4J8WD 5JA4B 1HQ3B 4J8WA 3AFAA 1P3MB 1P3KA 1KX5B 3VH6A 3REJD 3UT9C 3AZGD 5B0ZC 1P3KD 3REIC 4R8PD 5B0YC 3AZGA 4XZQC 3MGSA 3WTPB 3UTBB 3WAAD 2BYKA 3X1TD 1KX3A 2NQBC 1P3IA 3X1TA 4HGAB 3AZKD 4X23B 5B32D 5B2IB 3AV1A 2VQRA 3W99D 5B32A 1P3AB 5DNND 3W99A 2HIOC 3KWQB 5DNNA 4J8WB 4Z5TD 4DQYB 5B1MC 1P3LB 5AVBC 4G92B 3UT9A 3C1BA 3REJB 3AN2B 3F6TA 4H9PA 1P3GC 3MGSC 3REHB 1AOID 3B6GD 2LY8A 4DRBA 2NQBD 3KUYA 2BYKB 5CP6A 5C3IB 3VH5A 5B33B 5AVCB 2ZY5A 1T3UA 3C1CA 5CPJB 5F99D 2HIOD 4NE5A 3W97C 3LELA 3B0CW 4NE6A 5B24D 3LELD 1M1AD 2NZDA 3MVDD 5B1MA 4WJ3C 4J8VB 1P3PC 1M18D 3MVDA 2FJ7D 3MGQB 3C1BC 3R45B 1KX5D 1P3GD 5B40C 5CPKB 2PYOD 1KX5A 4KGCC 1P3GA 1W2EA 3UTBC 2G5HC 3AZMB 5B31B 5B1LC 3KUYC 1P34A 1TZYD 1P34D 4H9QB 5DNMC 5B2JC 5B2IC 1P3IB 3O62C 4J8XD 3W96B 1P3BC 2F8NH 3A6NA 2HIOB 1P3AD 3AZNA 2F8ND 3TU4C 5B1MB 5E5AC 1P3LD 3AZKB 2HUEB 5GT3C 3AZHC 1P3GB 4H9SC 4YS3C 5DNNB 2BYMA 4LD9C 5GSUC 1ID3A 3AN2A 4WNNB 3LZ0B 3LZ1A 3B0DB 3X1VD 3MGPC 3B6FB 3LZ1D 3WTPE 3UT9B 2Y2KA 4H9QA 4UUZB 4EO5B 1TZYB 5AVCC 3AZFD 4H9NA 5AV8A 3B0BA 2ZY4A 3AYWB 2FFFB 4H9PB 3WA9D 3WTPC 5BNVB 3WKJC 1WWSA 1B67A 1P3KC 4Z66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1J B;  2CV5 D;  4Z66 D;  3NQU A;  1P3F C;  4XZQ A;  5BT1 C;  3AZL D;  1KX4 A;  4CSR A;  3KWQ D;  4ZBJ C;  4KGC B;  4QLC D;  4AWL C;  5CPI A;  4LD9 D;  3W98 C;  4LD9 A;  3AZJ B;  2NZD B;  1ID3 B;  4WU9 B;  1S32 A;  4WU8 C;  5B1L B;  1M1A B;  1S32 D;  3LZ0 D;  1JFI B;  3AZE A;  3VH5 W;  1M19 A;  3WA9 C;  1HQ3 D;  3MNN C;  3AZE D;  4Z5T C;  2YFW B;  3X1U C;  5AVB D;  1F66 D;  3W96 C;  2CV5 C;  4Z66 C;  3AZM A;  1P3F D;  3LJA A;  3AZM D;  5BS7 C;  5AV9 A;  3X1S B;  3V9R A;  5KDM A;  5AV6 A;  5GT0 B;  3KXB D;  5AV6 D;  4JJN C;  4H9R B;  3UTA A;  1M18 B;  4XUJ D;  3AZJ A;  3LZ0 C;  4HGA C;  3LEL B;  4WU9 A;  1U35 A;  3AZJ D;  5AY8 A;  3MGP B;  1U35 D;  4J8V D;  3W97 D;  1JFI A;  2ARO B;  3MNN D;  3AZE C;  5B0Z D;  3AFA D;  2YFW A;  3AZF B;  4UUZ A;  5B0Y A;  3REJ A;  4CAY A;  5GXQ C;  3AV2 A;  1ZLA C;  3KXB C;  4J8U C;  5DNM B;  3AV2 D;  3X1S A;  1AOI B;  3B6G B;  3UTB D;  4H9N B;  3AYW A;  3NQJ A;  3X1S D;  3NQU B;  1BH9 B;  3B0C T;  3AYW D;  1P3O B;  5G49 B;  5B33 A;  3WAA A;  5BNX B;  1KX3 D;  1P34 C;  2YFV B;  4ZUX C;  3AV1 C;  5B33 D;  5FUG A;  3AZK A;  3AZJ C;  4WU9 C;  5B2J A;  3REL B;  2F8N B;  3A6N B;  3O62 D;  4J8X C;  3AZN B;  4H9O A;  3O62 A;  2ARO A;  1P3B D;  1S32 B;  3AZI C;  1P3B A;  2ARO D;  3MNN B;  3MGR B;  4NE3 A;  3TU4 A;  3UT9 D;  3AZG C;  4X23 C;  5JRG C;  4CAY B;  3KSY A;  5GXQ A;  4J8U D;  3AV2 C;  1ZLA A;  4WNN A;  1BH8 A;  5B40 B;  5CPK C;  1AOI A;  3AYW C;  3B6G A;  5JA4 A;  1KX3 C;  4YS3 A;  2NQB A;  3WKJ B;  4JJN B;  3X1V C;  5CP6 D;  1P3K B;  5B31 C;  4G92 C;  1P3F B;  5B24 C;  3C1C D;  5B2J B;  5AV8 C;  5F99 A;  4KHA B;  1P3P D;  2HIO A;  3REH C;  3AZL B;  3AZI A;  1A7W A;  1EQZ C;  5AV5 C;  1M1A A;  1KX4 B;  5B1M D;  3REK A;  2NZD D;  5C3I C;  1M18 A;  4QLC B;  3REK D;  3AFA B;  1P3M A;  4KUD C;  1BFM A;  2JSS A;  5E5A B;  4KGC A;  5CPI B;  1P3M D;  5GXQ B;  5CPJ C;  2PYO A;  4J8U B;  5B1L A;  3W97 B;  5DNM D;  4YM6 D;  3W98 A;  4YS3 B;  5DNM A;  5GSU B;  1TZY A;  1H3O B;  4YM6 A;  5B31 A;  1P34 B;  1F66 B;  3C1B B;  3WAA B;  3X1T B;  2CWE A;  5F99 C;  5GT0 C;  3W96 D;  4R8P C;  5BO0 A;  4H9R A;  3UTA B;  3AZN C;  1EQZ D;  5B32 B;  5AV9 B;  1P3O A;  3AZI B;  1EQZ A;  4WZS B;  3AZM C;  5GT3 D;  1P3A A;  4G91 B;  2YFV A;  3MVD C;  1P3O D;  2F8N G;  3W99 B;  4H9O B;  4WV4 B;  1P3M C;  2RVQ C;  4KUD A;  1P3L A;  2L5A A;  5AV6 C;  3REL A;  1KX5 C;  4E45 A;  3VH6 W;  3REL D;  1P3I C;  3MGP D;  3O62 B;  5B0Y B;  3LZ1 C;  1U35 B;  4XUJ C;  5AY8 B;  3MGP A;  4AWL B;  1ID3 D;  3AN2 D;  3MGR A;  3AZF C;  3X1V B;  1M19 B;  3MGR D;  3WKJ D;  1ZLA B;  3WKJ A;  2NQB B;  1BH9 A;  3WA9 B;  1BH8 B;  3AZH B;  4R8P A;  3LJA B;  5FUG B;  5BT1 D;  3AZL C;  3REI A;  2CV5 B;  3MGS D;  1TAF A;  4M6B A;  4Z66 B;  1P3A C;  1EQZ B;  1KX4 C;  1N1J A;  3REI D;  3B6F C;  4XZQ D;  3REH D;  4QLC C;  4EO5 C;  1P3L C;  3X1S C;  5B31 G;  3REL C;  1P3I D;  5CPI C;  4J8X B;  3REK B;  1ULY A;  4H9S A;  1B6W A;  3AV1 D;  1HQ3 C;  3LEL C;  4Z5T A;  5JRG B;  1R4V A;  1M19 D;  5B0Z B;  2ARO C;  3AZE B;  2FJ7 C;  3C1B D;  5AVB A;  4R8P B;  3W98 B;  1P3F A;  5AV9 C;  3B6F D;  3LJA D;  4JJN D;  3B6F A;  3NQJ B;  4JJN A;  3KUY D;  1WWI A;  5AV6 B;  1AOI C;  3B6G C;  5AV8 B;  5CP6 C;  3X1U B;  5B2I D;  3UTA D;  4XUJ B;  4WU8 A;  5AV5 B;  5B2I A;  3AV1 B;  3C1C C;  4WU8 D;  4J8W C;  5B24 A;  2BYM B;  3AFA C;  4KUD B;  1M19 C;  4J8V A;  3W97 A;  3A6N C;  3MNN A;  5B0Z A;  5E5A D;  2IO5 B;  4CSR B;  3R45 A;  2FJ7 A;  1H3O A;  4YM6 B;  5E5A A;  5B0Y D;  1M18 C;  5BNV A;  3AZH D;  5BS7 A;  1HTA A;  3AZH A;  5B40 A;  3AV2 B;  5BO0 B;  5B40 D;  2PYO C;  3UTB A;  5B33 C;  5B32 G;  5AVC D;  3UTA C;  3AZK C;  5CHL B;  5G49 A;  5AVC A;  1TAF B;  3W99 C;  4J8X A;  4KHA A;  5B2J D;  5DNN C;  3A6N D;  5GT0 D;  3KXB B;  4J8V C;  3V9R B;  1P3P B;  3AZN D;  2F8N A;  5GT0 A;  4X23 D;  2FJ7 B;  1P3O C;  4X23 A;  4ZUX B;  3TU4 D;  3KWQ C;  4NFT A;  2F8N K;  5GXQ D;  4J8U A;  1ZLA D;  1F1E A;  3X1V A;  5GSU A;  1S32 C;  3AN2 C;  4YS3 D;  5GSU D;  3MGS B;  5CP6 B;  3MGR C;  4Z2M G;  5AV8 D;  3AZF A;  3WA9 A;  3AZG B;  1F66 C;  3C1C B;  3REH A;  3WTP A;  5AV5 D;  2NZD C;  3REI B;  2CV5 A;  1P3P A;  4XZQ B;  3WTP D;  5AV5 A;  5F99 B;  1M1A C;  3REK C;  3AZI D;  1KX3 B;  2IO5 C;  2HUE C;  5GT3 B;  3AZL A;  1KX4 D;  5BNX A;  4Z5T B;  4G91 C;  5JRG A;  3MVD B;  3KWQ A;  3VH5 T;  4Z2M H;  5JRG D;  4QLC A;  5CPI D;  5B24 B;  4KGC D;  4LD9 B;  5CPK A;  3B0D C;  3MGQ C;  5CPK D;  2PYO B;  5B1L D;  4E44 A;  1TZY C;  3LZ0 A;  3LZ1 B;  1U35 C;  3W98 D;  5AY8 C;  1HQ3 A;  5B31 D;  1F66 A;  5AVB B;  3KUY B;  3VH6 T;  3X1U A;  3W96 A;  3REJ C;  3X1U D;  5KDM B;  2RVQ D;  5AV9 D;  3LJA C;  3KXB A;  5GT3 A;  4ZBJ B;  1P3B B;  4KUD D;  5CPJ A;  1Q9C A;  3WAA C;  4ZUX D;  3TU4 B;  1ID3 C;  3X1T C;  5CPJ D;  3MGQ D;  4XUJ A;  4WU8 B;  4ZUX A;  3MGQ A;  4WU9 D;  5AY8 D;  1KU5 A;  4DRA A;  5B32 C;  4YM6 C;  4J8W D;  5JA4 B;  1HQ3 B;  4J8W A;  3AFA A;  1P3M B;  1P3K A;  1KX5 B;  3VH6 A;  3REJ D;  3UT9 C;  3AZG D;  5B0Z C;  1P3K D;  3REI C;  4R8P D;  5B0Y C;  3AZG A;  4XZQ C;  3MGS A;  3WTP B;  3UTB B;  3WAA D;  2BYK A;  3X1T D;  1KX3 A;  2NQB C;  1P3I A;  3X1T A;  4HGA B;  3AZK D;  4X23 B;  5B32 D;  5B2I B;  3AV1 A;  3W99 D;  5B32 A;  1P3A B;  5DNN D;  3W99 A;  2HIO C;  3KWQ B;  5DNN A;  4J8W B;  4Z5T D;  5B1M C;  1P3L B;  5AVB C;  4G92 B;  3UT9 A;  3C1B A;  3REJ B;  3AN2 B;  4H9P A;  1P3G C;  3MGS C;  3REH B;  1AOI D;  3B6G D;  2LY8 A;  4DRB A;  2NQB D;  3KUY A;  2BYK B;  5CP6 A;  5C3I B;  3VH5 A;  5B33 B;  5AVC B;  3C1C A;  5CPJ B;  5F99 D;  2HIO D;  4NE5 A;  3W97 C;  3LEL A;  3B0C W;  4NE6 A;  5B24 D;  3LEL D;  1M1A D;  2NZD A;  3MVD D;  5B1M A;  4J8V B;  1P3P C;  1M18 D;  3MVD A;  2FJ7 D;  3MGQ B;  3C1B C;  3R45 B;  1KX5 D;  1P3G D;  5B40 C;  5CPK B;  2PYO D;  1KX5 A;  4KGC C;  1P3G A;  3UTB C;  3AZM B;  5B31 B;  5B1L C;  3KUY C;  1P34 A;  1TZY D;  1P34 D;  4H9Q B;  5DNM C;  5B2J C;  5B2I C;  1P3I B;  3O62 C;  4J8X D;  3W96 B;  1P3B C;  2F8N H;  3A6N A;  2HIO B;  1P3A D;  3AZN A;  2F8N D;  3TU4 C;  5B1M B;  5E5A C;  1P3L D;  3AZK B;  2HUE B;  5GT3 C;  3AZH C;  1P3G B;  4H9S C;  4YS3 C;  5DNN B;  2BYM A;  4LD9 C;  5GSU C;  1ID3 A;  3AN2 A;  4WNN B;  3LZ0 B;  3LZ1 A;  3B0D B;  3X1V D;  3MGP C;  3B6F B;  3LZ1 D;  3WTP E;  3UT9 B;  4H9Q A;  4UUZ B;  4EO5 B;  1TZY B;  5AVC C;  3AZF D;  4H9N A;  5AV8 A;  3B0B A;  3AYW B;  4H9P B;  3WA9 D;  3WTP C;  5BNV B;  3WKJ C;  1WWS A;  1B67 A;  1P3K C;  4Z66 A; 
#chains in the Genus database with same CATH topology
 1N1J B;  2CV5 D;  4Z66 D;  3NQU A;  1P3F C;  4XZQ A;  5BT1 C;  2XD1 A;  3AZL D;  1KX4 A;  4CSR A;  3KWQ D;  4ZBJ C;  4KGC B;  4QLC D;  4AWL C;  2Y2H A;  5CPI A;  4LD9 D;  3W98 C;  4LD9 A;  3AZJ B;  2NZD B;  1ID3 B;  2JE5 A;  4WU9 B;  1S32 A;  4WU8 C;  5B1L B;  1M1A B;  1S32 D;  3LZ0 D;  1JFI B;  3AZE A;  3VH5 W;  1M19 A;  3WA9 C;  1HQ3 D;  2Y2O A;  3MNN C;  3AZE D;  4Z5T C;  2YFW B;  2W8S A;  3X1U C;  5AVB D;  1F66 D;  3W96 C;  2CV5 C;  4Z66 C;  3AZM A;  1P3F D;  3LJA A;  3AZM D;  5BS7 C;  5AV9 A;  3X1S B;  3V9R A;  5KDM A;  5AV6 A;  5GT0 B;  3KXB D;  5AV6 D;  2DF4 C;  4JJN C;  4H9R B;  3UTA A;  1M18 B;  4XUJ D;  3AZJ A;  3LZ0 C;  4HGA C;  3LEL B;  4WU9 A;  1U35 A;  3AZJ D;  5AY8 A;  3MGP B;  1U35 D;  4J8V D;  3W97 D;  1JFI A;  2ARO B;  3MNN D;  3AZE C;  5B0Z D;  3AFA D;  2YFW A;  3AZF B;  4UUZ A;  5B0Y A;  3REJ A;  4CAY A;  5GXQ C;  3AV2 A;  1ZLA C;  3A1I A;  3KXB C;  4J8U C;  5DNM B;  3AV2 D;  3X1S A;  1AOI B;  3B6G B;  3UTB D;  4H9N B;  3AYW A;  3NQJ A;  3X1S D;  3NQU B;  1BH9 B;  3B0C T;  3AYW D;  1P3O B;  5G49 B;  5B33 A;  3WAA A;  5BNX B;  1KX3 D;  1P34 C;  2YFV B;  4ZUX C;  3AV1 C;  5B33 D;  5FUG A;  3AZK A;  3AZJ C;  2RIQ A;  4WU9 C;  5B2J A;  3REL B;  2F8N B;  3A6N B;  3O62 D;  4J8X C;  2Y2I A;  3AZN B;  4H9O A;  3O62 A;  2ARO A;  1P3B D;  2Y2P A;  1S32 B;  3AZI C;  1P3B A;  2ARO D;  3MNN B;  3MGR B;  3FDD A;  4NE3 A;  3TU4 A;  3UT9 D;  3AZG C;  4X23 C;  5JRG C;  4CAY B;  3KSY A;  5GXQ A;  4J8U D;  3AV2 C;  1ZLA A;  4WNN A;  1BH8 A;  5B40 B;  5CPK C;  1AOI A;  3AYW C;  3B6G A;  5JA4 A;  1KX3 C;  4YS3 A;  2NQB A;  3WKJ B;  4JJN B;  3X1V C;  5CP6 D;  1P3K B;  5B31 C;  4G92 C;  1P3F B;  5B24 C;  3C1C D;  5B2J B;  5AV8 C;  5F99 A;  4KHA B;  1P3P D;  2HIO A;  3REH C;  3AZL B;  3AZI A;  1A7W A;  1EQZ C;  5AV5 C;  1M1A A;  1KX4 B;  5B1M D;  3REK A;  2NZD D;  5C3I C;  1M18 A;  4UPK A;  4QLC B;  3REK D;  3AFA B;  1P3M A;  4KUD C;  1BFM A;  2JSS A;  2ZY2 A;  3H0M C;  5E5A B;  5CPI B;  4KGC A;  1P3M D;  5GXQ B;  3KFU G;  5CPJ C;  2PYO A;  4J8U B;  5B1L A;  3W97 B;  5DNM D;  4YM6 D;  3W98 A;  4YS3 B;  5DNM A;  5GSU B;  1TZY A;  1H3O B;  4YM6 A;  5B31 A;  1P34 B;  1F66 B;  2Y2G A;  3C1B B;  3WAA B;  3X1T B;  2CWE A;  5F99 C;  5GT0 C;  3W96 D;  4R8P C;  5BO0 A;  4H9R A;  3UTA B;  3AZN C;  1EQZ D;  5B32 B;  5AV9 B;  1P3O A;  3AZI B;  1EQZ A;  4WZS B;  3AZM C;  5GT3 D;  1P3A A;  4G91 B;  2YFV A;  3MVD C;  1P3O D;  2F8N G;  3W99 B;  4H9O B;  4WV4 B;  1P3M C;  2RVQ C;  4KUD A;  1P3L A;  2L5A A;  5AV6 C;  3REL A;  3EPK A;  1KX5 C;  4E45 A;  3VH6 W;  3REL D;  1P3I C;  2ZY3 A;  3O62 B;  3MGP D;  5B0Y B;  3LZ1 C;  1U35 B;  4XUJ C;  5AY8 B;  3MGP A;  4AWL B;  1ID3 D;  3AN2 D;  3MGR A;  3AZF C;  3X1V B;  1M19 B;  3MGR D;  3P5J B;  3WKJ D;  1ZLA B;  3WKJ A;  2NQB B;  1BH9 A;  3WA9 B;  1BH8 B;  3AZH B;  4R8P A;  3LJA B;  5FUG B;  5BT1 D;  3AZL C;  3REI A;  2CV5 B;  3MGS D;  1TAF A;  4M6B A;  4Z66 B;  1P3A C;  1EQZ B;  1KX4 C;  1N1J A;  3REI D;  3B6F C;  4XZQ D;  3REH D;  4QLC C;  4EO5 C;  1P3L C;  3X1S C;  5B31 G;  3REL C;  1P3I D;  5CPI C;  4J8X B;  2ZM5 A;  3REK B;  1ULY A;  4H9S A;  2F2A C;  1B6W A;  3AV1 D;  1HQ3 C;  3AL0 C;  3LEL C;  4Z5T A;  5JRG B;  1R4V A;  1M19 D;  5B0Z B;  1Z2C B;  2ARO C;  3AZE B;  2FJ7 C;  3C1B D;  5AVB A;  4R8P B;  3W98 B;  1P3F A;  5AV9 C;  3B6F D;  3LJA D;  4JJN D;  3B6F A;  3NQJ B;  4JJN A;  3KUY D;  1WWI A;  5AV6 B;  1AOI C;  3B6G C;  5AV8 B;  2XD5 A;  5CP6 C;  3X1U B;  3EPH A;  2DQN C;  5B2I D;  3IP4 C;  3UTA D;  4WU8 A;  4XUJ B;  5AV5 B;  5B2I A;  3AV1 B;  3C1C C;  4WU8 D;  4J8W C;  5B24 A;  2BYM B;  3AFA C;  4KUD B;  1M19 C;  4J8V A;  3W97 A;  3A6N C;  3MNN A;  2Y2L A;  2Y2N A;  5B0Z A;  3R45 A;  5E5A D;  4CSR B;  2IO5 B;  2FJ7 A;  1H3O A;  4YM6 B;  5E5A A;  5B0Y D;  2J8P A;  3EPJ A;  2Y2M A;  1M18 C;  5BNV A;  3EPL A;  3AZH D;  5BS7 A;  1HTA A;  3AZH A;  5B40 A;  2Y2Q A;  3AV2 B;  5BO0 B;  5B40 D;  2PYO C;  3UTB A;  5B33 C;  5B32 G;  5AVC D;  3UTA C;  3AZK C;  5CHL B;  5G49 A;  5AVC A;  1TAF B;  3W99 C;  4J8X A;  4KHA A;  5B2J D;  5DNN C;  3A6N D;  5GT0 D;  3KXB B;  4J8V C;  3V9R B;  1P3P B;  3AZN D;  2F8N A;  5GT0 A;  4X23 D;  2FJ7 B;  1P3O C;  4X23 A;  4ZUX B;  3TU4 D;  3KWQ C;  4NFT A;  2F8N K;  2UWX A;  5GXQ D;  4J8U A;  1ZLA D;  1F1E A;  3EG5 B;  3X1V A;  5GSU A;  1S32 C;  3AN2 C;  2G5I C;  2Y2J A;  4YS3 D;  5GSU D;  3MGS B;  5CP6 B;  3MGR C;  4Z2M G;  5AV8 D;  3AZF A;  3H0R C;  3H0L C;  1PZR A;  3WA9 A;  3AZG B;  1F66 C;  3C1C B;  3REH A;  3WTP A;  5AV5 D;  2NZD C;  3REI B;  2CV5 A;  1P3P A;  4XZQ B;  3WTP D;  5AV5 A;  5F99 B;  1M1A C;  3REK C;  3AZI D;  1KX3 B;  2IO5 C;  2HUE C;  5GT3 B;  3AZL A;  1KX4 D;  5BNX A;  4Z5T B;  4G91 C;  5JRG A;  3MVD B;  3KWQ A;  3VH5 T;  4Z2M H;  5JRG D;  4QLC A;  5CPI D;  2JCH A;  5B24 B;  4KGC D;  4LD9 B;  5CPK A;  3B0D C;  3MGQ C;  5CPK D;  2PYO B;  5B1L D;  4E44 A;  1TZY C;  3LZ0 A;  3LZ1 B;  1U35 C;  3W98 D;  5AY8 C;  1HQ3 A;  2BG1 A;  3A1K A;  5B31 D;  1F66 A;  5AVB B;  3KUY B;  3VH6 T;  3X1U A;  3W96 A;  3REJ C;  3X1U D;  5KDM B;  2RVQ D;  5AV9 D;  3LJA C;  3KXB A;  5GT3 A;  4ZBJ B;  1P3B B;  4KUD D;  5CPJ A;  1Q9C A;  3WAA C;  4ZUX D;  3TU4 B;  1ID3 C;  3X1T C;  5CPJ D;  3MGQ D;  4XUJ A;  4WU8 B;  4ZUX A;  3MGQ A;  4WU9 D;  5AY8 D;  1KU5 A;  4DRA A;  5B32 C;  4YM6 C;  4J8W D;  5JA4 B;  1HQ3 B;  4J8W A;  3AFA A;  1P3M B;  1P3K A;  1KX5 B;  3VH6 A;  3REJ D;  3UT9 C;  3AZG D;  5B0Z C;  1P3K D;  3REI C;  4R8P D;  5B0Y C;  3AZG A;  4XZQ C;  3MGS A;  3WTP B;  3UTB B;  3WAA D;  2BYK A;  3X1T D;  1KX3 A;  2NQB C;  1P3I A;  3X1T A;  4HGA B;  3AZK D;  4X23 B;  5B32 D;  5B2I B;  3AV1 A;  2VQR A;  3W99 D;  5B32 A;  1P3A B;  5DNN D;  3W99 A;  2HIO C;  3KWQ B;  5DNN A;  4J8W B;  4Z5T D;  4DQY B;  5B1M C;  1P3L B;  5AVB C;  4G92 B;  3UT9 A;  3C1B A;  3REJ B;  3AN2 B;  3F6T A;  4H9P A;  1P3G C;  3MGS C;  3REH B;  1AOI D;  3B6G D;  2LY8 A;  4DRB A;  2NQB D;  3KUY A;  2BYK B;  5CP6 A;  5C3I B;  3VH5 A;  5B33 B;  5AVC B;  2ZY5 A;  1T3U A;  3C1C A;  5CPJ B;  5F99 D;  2HIO D;  4NE5 A;  3W97 C;  3LEL A;  3B0C W;  4NE6 A;  5B24 D;  3LEL D;  1M1A D;  2NZD A;  3MVD D;  5B1M A;  4WJ3 C;  4J8V B;  1P3P C;  1M18 D;  3MVD A;  2FJ7 D;  3MGQ B;  3C1B C;  3R45 B;  1KX5 D;  1P3G D;  5B40 C;  5CPK B;  2PYO D;  1KX5 A;  4KGC C;  1P3G A;  1W2E A;  3UTB C;  2G5H C;  3AZM B;  5B31 B;  5B1L C;  3KUY C;  1P34 A;  1TZY D;  1P34 D;  4H9Q B;  5DNM C;  5B2J C;  5B2I C;  1P3I B;  3O62 C;  4J8X D;  3W96 B;  1P3B C;  2F8N H;  3A6N A;  2HIO B;  1P3A D;  3AZN A;  2F8N D;  3TU4 C;  5B1M B;  5E5A C;  1P3L D;  3AZK B;  2HUE B;  5GT3 C;  3AZH C;  1P3G B;  4H9S C;  4YS3 C;  5DNN B;  2BYM A;  4LD9 C;  5GSU C;  1ID3 A;  3AN2 A;  4WNN B;  3LZ0 B;  3LZ1 A;  3B0D B;  3X1V D;  3MGP C;  3B6F B;  3LZ1 D;  3WTP E;  3UT9 B;  2Y2K A;  4H9Q A;  4UUZ B;  4EO5 B;  1TZY B;  5AVC C;  3AZF D;  4H9N A;  5AV8 A;  3B0B A;  2ZY4 A;  3AYW B;  2FFF B;  4H9P B;  3WA9 D;  3WTP C;  5BNV B;  3WKJ C;  1WWS A;  1B67 A;  1P3K C;  4Z66 A; 
#chains in the Genus database with same CATH homology
 1N1J B;  2CV5 D;  4Z66 D;  3NQU A;  1P3F C;  4XZQ A;  5BT1 C;  2XD1 A;  3AZL D;  1KX4 A;  4CSR A;  3KWQ D;  4ZBJ C;  4KGC B;  4QLC D;  4AWL C;  2Y2H A;  5CPI A;  4LD9 D;  3W98 C;  4LD9 A;  3AZJ B;  2NZD B;  1ID3 B;  2JE5 A;  4WU9 B;  1S32 A;  4WU8 C;  5B1L B;  1M1A B;  1S32 D;  3LZ0 D;  1JFI B;  3AZE A;  3VH5 W;  1M19 A;  3WA9 C;  1HQ3 D;  2Y2O A;  3MNN C;  3AZE D;  4Z5T C;  2YFW B;  2W8S A;  3X1U C;  5AVB D;  1F66 D;  3W96 C;  2CV5 C;  4Z66 C;  3AZM A;  1P3F D;  3LJA A;  3AZM D;  5BS7 C;  5AV9 A;  3X1S B;  3V9R A;  5KDM A;  5AV6 A;  5GT0 B;  3KXB D;  5AV6 D;  2DF4 C;  4JJN C;  4H9R B;  3UTA A;  1M18 B;  4XUJ D;  3AZJ A;  3LZ0 C;  4HGA C;  3LEL B;  4WU9 A;  1U35 A;  3AZJ D;  5AY8 A;  3MGP B;  1U35 D;  4J8V D;  3W97 D;  1JFI A;  2ARO B;  3MNN D;  3AZE C;  5B0Z D;  3AFA D;  2YFW A;  3AZF B;  4UUZ A;  5B0Y A;  3REJ A;  4CAY A;  5GXQ C;  3AV2 A;  1ZLA C;  3A1I A;  3KXB C;  4J8U C;  5DNM B;  3AV2 D;  3X1S A;  1AOI B;  3B6G B;  3UTB D;  4H9N B;  3AYW A;  3NQJ A;  3X1S D;  3NQU B;  1BH9 B;  3B0C T;  3AYW D;  1P3O B;  5G49 B;  5B33 A;  3WAA A;  5BNX B;  1KX3 D;  1P34 C;  2YFV B;  4ZUX C;  3AV1 C;  5B33 D;  5FUG A;  3AZK A;  3AZJ C;  2RIQ A;  4WU9 C;  5B2J A;  3REL B;  2F8N B;  3A6N B;  3O62 D;  4J8X C;  2Y2I A;  3AZN B;  4H9O A;  3O62 A;  2ARO A;  1P3B D;  2Y2P A;  1S32 B;  3AZI C;  1P3B A;  2ARO D;  3MNN B;  3MGR B;  3FDD A;  4NE3 A;  3TU4 A;  3UT9 D;  3AZG C;  4X23 C;  5JRG C;  4CAY B;  3KSY A;  5GXQ A;  4J8U D;  3AV2 C;  1ZLA A;  4WNN A;  1BH8 A;  5B40 B;  5CPK C;  1AOI A;  3AYW C;  3B6G A;  5JA4 A;  1KX3 C;  4YS3 A;  2NQB A;  3WKJ B;  4JJN B;  3X1V C;  5CP6 D;  1P3K B;  5B31 C;  4G92 C;  1P3F B;  5B24 C;  3C1C D;  5B2J B;  5AV8 C;  5F99 A;  4KHA B;  1P3P D;  2HIO A;  3REH C;  3AZL B;  3AZI A;  1A7W A;  1EQZ C;  5AV5 C;  1M1A A;  1KX4 B;  5B1M D;  3REK A;  2NZD D;  5C3I C;  1M18 A;  4UPK A;  4QLC B;  3REK D;  3AFA B;  1P3M A;  4KUD C;  1BFM A;  2JSS A;  2ZY2 A;  3H0M C;  5E5A B;  5CPI B;  4KGC A;  1P3M D;  5GXQ B;  3KFU G;  5CPJ C;  2PYO A;  4J8U B;  5B1L A;  3W97 B;  5DNM D;  4YM6 D;  3W98 A;  4YS3 B;  5DNM A;  5GSU B;  1TZY A;  1H3O B;  4YM6 A;  5B31 A;  1P34 B;  1F66 B;  2Y2G A;  3C1B B;  3WAA B;  3X1T B;  2CWE A;  5F99 C;  5GT0 C;  3W96 D;  4R8P C;  5BO0 A;  4H9R A;  3UTA B;  3AZN C;  1EQZ D;  5B32 B;  5AV9 B;  1P3O A;  3AZI B;  1EQZ A;  4WZS B;  3AZM C;  5GT3 D;  1P3A A;  4G91 B;  2YFV A;  3MVD C;  1P3O D;  2F8N G;  3W99 B;  4H9O B;  4WV4 B;  1P3M C;  2RVQ C;  4KUD A;  1P3L A;  2L5A A;  5AV6 C;  3REL A;  3EPK A;  1KX5 C;  4E45 A;  3VH6 W;  3REL D;  1P3I C;  2ZY3 A;  3O62 B;  3MGP D;  5B0Y B;  3LZ1 C;  1U35 B;  4XUJ C;  5AY8 B;  3MGP A;  4AWL B;  1ID3 D;  3AN2 D;  3MGR A;  3AZF C;  3X1V B;  1M19 B;  3MGR D;  3P5J B;  3WKJ D;  1ZLA B;  3WKJ A;  2NQB B;  1BH9 A;  3WA9 B;  1BH8 B;  3AZH B;  4R8P A;  3LJA B;  5FUG B;  5BT1 D;  3AZL C;  3REI A;  2CV5 B;  3MGS D;  1TAF A;  4M6B A;  4Z66 B;  1P3A C;  1EQZ B;  1KX4 C;  1N1J A;  3REI D;  3B6F C;  4XZQ D;  3REH D;  4QLC C;  4EO5 C;  1P3L C;  3X1S C;  5B31 G;  3REL C;  1P3I D;  5CPI C;  4J8X B;  2ZM5 A;  3REK B;  1ULY A;  4H9S A;  2F2A C;  1B6W A;  3AV1 D;  1HQ3 C;  3AL0 C;  3LEL C;  4Z5T A;  5JRG B;  1R4V A;  1M19 D;  5B0Z B;  1Z2C B;  2ARO C;  3AZE B;  2FJ7 C;  3C1B D;  5AVB A;  4R8P B;  3W98 B;  1P3F A;  5AV9 C;  3B6F D;  3LJA D;  4JJN D;  3B6F A;  3NQJ B;  4JJN A;  3KUY D;  1WWI A;  5AV6 B;  1AOI C;  3B6G C;  5AV8 B;  2XD5 A;  5CP6 C;  3X1U B;  3EPH A;  2DQN C;  5B2I D;  3IP4 C;  3UTA D;  4WU8 A;  4XUJ B;  5AV5 B;  5B2I A;  3AV1 B;  3C1C C;  4WU8 D;  4J8W C;  5B24 A;  2BYM B;  3AFA C;  4KUD B;  1M19 C;  4J8V A;  3W97 A;  3A6N C;  3MNN A;  2Y2L A;  2Y2N A;  5B0Z A;  3R45 A;  5E5A D;  4CSR B;  2IO5 B;  2FJ7 A;  1H3O A;  4YM6 B;  5E5A A;  5B0Y D;  2J8P A;  3EPJ A;  2Y2M A;  1M18 C;  5BNV A;  3EPL A;  3AZH D;  5BS7 A;  1HTA A;  3AZH A;  5B40 A;  2Y2Q A;  3AV2 B;  5BO0 B;  5B40 D;  2PYO C;  3UTB A;  5B33 C;  5B32 G;  5AVC D;  3UTA C;  3AZK C;  5CHL B;  5G49 A;  5AVC A;  1TAF B;  3W99 C;  4J8X A;  4KHA A;  5B2J D;  5DNN C;  3A6N D;  5GT0 D;  3KXB B;  4J8V C;  3V9R B;  1P3P B;  3AZN D;  2F8N A;  5GT0 A;  4X23 D;  2FJ7 B;  1P3O C;  4X23 A;  4ZUX B;  3TU4 D;  3KWQ C;  4NFT A;  2F8N K;  2UWX A;  5GXQ D;  4J8U A;  1ZLA D;  1F1E A;  3EG5 B;  3X1V A;  5GSU A;  1S32 C;  3AN2 C;  2G5I C;  2Y2J A;  4YS3 D;  5GSU D;  3MGS B;  5CP6 B;  3MGR C;  4Z2M G;  5AV8 D;  3AZF A;  3H0R C;  3H0L C;  1PZR A;  3WA9 A;  3AZG B;  1F66 C;  3C1C B;  3REH A;  3WTP A;  5AV5 D;  2NZD C;  3REI B;  2CV5 A;  1P3P A;  4XZQ B;  3WTP D;  5AV5 A;  5F99 B;  1M1A C;  3REK C;  3AZI D;  1KX3 B;  2IO5 C;  2HUE C;  5GT3 B;  3AZL A;  1KX4 D;  5BNX A;  4Z5T B;  4G91 C;  5JRG A;  3MVD B;  3KWQ A;  3VH5 T;  4Z2M H;  5JRG D;  4QLC A;  5CPI D;  2JCH A;  5B24 B;  4KGC D;  4LD9 B;  5CPK A;  3B0D C;  3MGQ C;  5CPK D;  2PYO B;  5B1L D;  4E44 A;  1TZY C;  3LZ0 A;  3LZ1 B;  1U35 C;  3W98 D;  5AY8 C;  1HQ3 A;  2BG1 A;  3A1K A;  5B31 D;  1F66 A;  5AVB B;  3KUY B;  3VH6 T;  3X1U A;  3W96 A;  3REJ C;  3X1U D;  5KDM B;  2RVQ D;  5AV9 D;  3LJA C;  3KXB A;  5GT3 A;  4ZBJ B;  1P3B B;  4KUD D;  5CPJ A;  1Q9C A;  3WAA C;  4ZUX D;  3TU4 B;  1ID3 C;  3X1T C;  5CPJ D;  3MGQ D;  4XUJ A;  4WU8 B;  4ZUX A;  3MGQ A;  4WU9 D;  5AY8 D;  1KU5 A;  4DRA A;  5B32 C;  4YM6 C;  4J8W D;  5JA4 B;  1HQ3 B;  4J8W A;  3AFA A;  1P3M B;  1P3K A;  1KX5 B;  3VH6 A;  3REJ D;  3UT9 C;  3AZG D;  5B0Z C;  1P3K D;  3REI C;  4R8P D;  5B0Y C;  3AZG A;  4XZQ C;  3MGS A;  3WTP B;  3UTB B;  3WAA D;  2BYK A;  3X1T D;  1KX3 A;  2NQB C;  1P3I A;  3X1T A;  4HGA B;  3AZK D;  4X23 B;  5B32 D;  5B2I B;  3AV1 A;  2VQR A;  3W99 D;  5B32 A;  1P3A B;  5DNN D;  3W99 A;  2HIO C;  3KWQ B;  5DNN A;  4J8W B;  4Z5T D;  4DQY B;  5B1M C;  1P3L B;  5AVB C;  4G92 B;  3UT9 A;  3C1B A;  3REJ B;  3AN2 B;  3F6T A;  4H9P A;  1P3G C;  3MGS C;  3REH B;  1AOI D;  3B6G D;  2LY8 A;  4DRB A;  2NQB D;  3KUY A;  2BYK B;  5CP6 A;  5C3I B;  3VH5 A;  5B33 B;  5AVC B;  2ZY5 A;  1T3U A;  3C1C A;  5CPJ B;  5F99 D;  2HIO D;  4NE5 A;  3W97 C;  3LEL A;  3B0C W;  4NE6 A;  5B24 D;  3LEL D;  1M1A D;  2NZD A;  3MVD D;  5B1M A;  4WJ3 C;  4J8V B;  1P3P C;  1M18 D;  3MVD A;  2FJ7 D;  3MGQ B;  3C1B C;  3R45 B;  1KX5 D;  1P3G D;  5B40 C;  5CPK B;  2PYO D;  1KX5 A;  4KGC C;  1P3G A;  1W2E A;  3UTB C;  2G5H C;  3AZM B;  5B31 B;  5B1L C;  3KUY C;  1P34 A;  1TZY D;  1P34 D;  4H9Q B;  5DNM C;  5B2J C;  5B2I C;  1P3I B;  3O62 C;  4J8X D;  3W96 B;  1P3B C;  2F8N H;  3A6N A;  2HIO B;  1P3A D;  3AZN A;  2F8N D;  3TU4 C;  5B1M B;  5E5A C;  1P3L D;  3AZK B;  2HUE B;  5GT3 C;  3AZH C;  1P3G B;  4H9S C;  4YS3 C;  5DNN B;  2BYM A;  4LD9 C;  5GSU C;  1ID3 A;  3AN2 A;  4WNN B;  3LZ0 B;  3LZ1 A;  3B0D B;  3X1V D;  3MGP C;  3B6F B;  3LZ1 D;  3WTP E;  3UT9 B;  2Y2K A;  4H9Q A;  4UUZ B;  4EO5 B;  1TZY B;  5AVC C;  3AZF D;  4H9N A;  5AV8 A;  3B0B A;  2ZY4 A;  3AYW B;  2FFF B;  4H9P B;  3WA9 D;  3WTP C;  5BNV B;  3WKJ C;  1WWS A;  1B67 A;  1P3K C;  4Z66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...