3AFAA

The human nucleosome structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaA00
4H9SC 2HIOC 2HIOB 3AN2D 4R8PC 4R8PB 5B24A 1P3KC 1P3OD 3REIB 2NZDC 2NQBC 2NQBB 4H9NB 3AZGD 5B0YB 2NZDB 1P3PC 4JJNA 3V9RA 3AZKC 3WKJD 5DNND 3AN2A 5AV5A 3W97B 3W97C 3NQJA 3AYWB 3AYWC 3AZGA 4J8VC 4J8VB 3WKJA 2FJ7A 5DNNA 5JRGC 3UT9C 3AV2A 2PYOC 2PYOB 3WTPB 3LZ0A 4YM6B 3X1VC 5CPJC 3W98A 1ZLAD 1TZYA 4X23D 5AV6D 1KX4C 1S32A 3C1CB 3C1CC 3LZ1D 3AZEB 3C1BB 5B2IB 3AFAA 5AV9D 5AV6A 4WU9D 1F1EA 5BO0B 4YS3A 1M1AB 4NE6A 3WA9B 3WA9C 1BH9A 1P34A 4NFTA 3MGSB 3MGSC 3LZ1A 5G49A 1P3PA 5AV9A 3X1TA 5GT0D 2F8ND 5BS7C 4CAYB 5F99D 5B0ZB 3LELC 5B31B 4H9RA 5B31C 3UTAD 3AV1C 5AVCB 1Q9CA 5AVCC 3UTBA 1AOID 3W96B 5CPKA 3MGQC 3UT9A 5B32B 5B32C 3R45A 4DRBA 1M19D 4CSRB 3X1VA 5GXQB 5GXQC 5B2JA 1ID3A 3MGPB 3WAAB 3REKD 1M18D 3AZFD 5C3IB 5C3IC 4UUZB 5B40B 5B40C 5BT1D 4Z5TD 3AZMC 3AZMB 3VH5T 3REKA 3B0CW 3REJD 3MGRB 5B1LD 3MGRC 1KX3C 3AZIB 3AZIC 3AZHD 2AROA 2BYMA 1P3IC 1P3IB 1P3GD 3LELA 4ZUXD 4KUDA 4NE3A 3KWQC 4H9PA 3KWQB 5AVBA 1WWSA 3KXBB 1P3GA 5AY8A 5GT3D 1P3FB 4ZUXA 1HQ3A 3KUYD 4XZQA 3A6ND 4LD9D 2CV5C 4J8UB 4J8UC 4KGCA 4WU8A 3B0BA 1EQZA 1TAFB 3KUYA 3W99D 3MVDB 3A6NA 5B1MA 2BYKA 4LD9A 5CP6B 5CP6C 4H9OB 3MNND 1KX5D 3W99A 5GSUA 5BNXA 3WTPE 5B33B 4QLCD 2RVQD 5E5AD 3B6FD 1KX5A 1P3MA 5AV8D 2IO5B 4ZBJC 4ZBJB 5DNMC 5E5AA 1P3LA 3X1UC 5JA4B 1BH8A 4J8WD 5B24D 5AV8A 3VH6A 4XUJC 4XUJB 1U35C 1U35B 3RELA 3B6GC 4JJND 1P3BD 1P3OC 1P3OB 4G92B 1P3AC 4J8WA 5AV5D 3REIC 3AZGB 3WKJB 5BNVA 3AZND 5B0YC 3TU4D 1P3BA 2FJ7D 4KHAA 3AV2D 3LZ0D 3AZNA 3W98D 3LJAA 3TU4A 3AZLD 1TZYD 1F66B 1F66C 4Z66A 1S32D 3WTPC 5CPID 4YM6C 1ZLAC 1ZLAB 3AZJD 4X23C 4X23B 3AFAD 5AV6B 3AZLA 1BH9B 1P3KD 4YS3D 1P34D 5G49B 5CPIA 4WNNB 3AZEC 3C1BC 3AZJA 5B2IC 1P3PD 3AZKD 3X1TD 4WU9B 4WU9C 4H9QB 4H9SA 2HIOA 4R8PA 1BFMA 1P3KA 1M1AC 3REIA 2NZDA 2NQBA 5GT0B 5GT0C 2F8NB 3UTBD 5F99C 5F99B 4J8VD 3AZKA 5KDMA 5JRGD 5CPKD 5B0ZC 3UT9D 3UTAC 3UTAB 1B6WA 3W97A 3AYWA 1AOIB 1AOIC 5CPJD 3X1VD 5B2JD 1ID3D 4J8VA 5B31G 3W96C 5JRGA 1M19C 1M19B 1KX4D 2PYOA 4NE5A 4G91B 4G91C 5CPJA 5B32G 1M18B 1M18C 3MGPC 1N1JB 3AZFC 3WAAC 3AZFB 1KX4A 3WA9D 4DRAA 3MGSD 3VH5W 4Z5TB 4Z5TC 3C1CA 2AROD 5BO0A 3LELD 3REJB 3REJC 3WA9A 5B1LB 5B1LC 4KUDD 3MGSA 3AZHB 3AZHC 5AVCD 3AV1D 3X1SB 3X1SC 1P3GB 5BS7A 4CAYA 5AVBD 4ZUXB 3MGQD 5B0ZA 5AY8D 4AWLB 5B31A 1HQ3D 3AV1A 5AVCA 4XZQD 5GT3C 5GT3B 3MGQA 3KXBC 5B32A 3KUYB 4KGCD 4WU8D 1P3FC 1A7WA 1EQZD 5GXQA 2BYKB 4LD9B 4J8XC 4J8XB 5B1MD 1H3OB 3KSYA 1KX3D 5B40A 3AZMA 2F8NK 3MVDC 4HGAC 4HGAB 5GSUD 3VH6T 3MNNC 3MNNB 1KX5B 3MGRA 1KX3A 3AZIA 1WWIA 3KWQD 3REHB 3REHC 4QLCC 4QLCB 1P3MD 2RVQC 1P3IA 3O62C 3O62B 5B33C 3B6FB 2YFVB 3NQUB 3B6FC 1P3LD 4Z2MG 3KWQA 2CV5D 2IO5C 2YFWB 5FUGB 3RELD 1JFIA 5B24B 5B24C 2HUEB 2CV5A 4J8UA 4JJNB 3V9RB 4JJNC 1P3BB 1TAFA 3AN2B 3AN2C 4G92C 5AV5C 5AV5B 3NQJB 4WV4B 5CP6A 3AZGC 4H9OA 3TU4B 3WKJC 2FJ7B 5DNNB 5DNNC 3LJAD 4Z2MH 3AV2B 3AV2C 1HTAA 3LZ0B 3LZ0C 4Z66D 5B33A 5DNMD 3W98B 3W98C 1TZYB 1TZYC 3X1UD 1S32B 1S32C 5CPIB 5DNMA 3AZJB 3AFAC 3AFAB 3B6GD 5AV6C 3X1UA 5JA4A 4YS3C 4YS3B 1P3AD 1P3KB 1P34B 2HIOD 1P34C 4R8PD 3LZ1B 3LZ1C 3REID 4XUJA 3B0DC 3B0DB 1P3PB 5AV9C 5AV9B 3AZKB 3X1TC 3X1TB 1U35A 2NQBD 5B0YD 2NZDD 5KDMB 3B6GA 1P3OA 1P3AA 4H9RB 3W97D 3UTBB 3UTBC 3AYWD 4H9NA 5B0YA 5JRGB 5CPKB 5CPKC 3UT9B 1F66D 3R45B 2F8NG 2PYOD 3X1VB 3WTPD 5CPJB 5B2JC 5B2JB 1ID3C 4YM6D 1ID3B 1KX4B 1F66A 3WTPA 3C1CD 4YM6A 3AZED 1ZLAA 3C1BD 4X23A 5B2ID 3REKB 3REKC 1M1AD 5CHLB 5BT1C 4WNNA 3AZEA 2AROC 2AROB 4E45A 3C1BA 2BYMB 5B2IA 4WU9A 3LELB 4H9QA 2F8NH 5B0ZD 4KUDB 4KUDC 3AV1B 1M1AA 5B31D 4H9PB 5GT0A 2F8NA 5AVBC 5AVBB 5F99A 3MGQB 1P3GC 3W96D 5AY8C 5AY8B 4ZUXC 1HQ3C 1HQ3B 5B32D 3UTAA 4AWLC 4XZQB 4XZQC 1AOIA 5GXQD 3MGPD 3W96A 4KGCB 4KGCC 1M19A 4WU8B 4WU8C 3WAAD 1EQZC 1EQZB 3KUYC 3A6NC 5B1MB 5B1MC 4CSRA 5B40D 3A6NB 4LD9C 3AZMD 2LY8A 1M18A 3MGPA 1N1JA 3AZFA 3WAAA 1KX3B 3W99C 4Z5TA 3W99B 4UUZA 3MGRD 5GSUB 3VH6W 5BNXB 5GSUC 3AZID 3X1SD 3B0CT 1P3ID 3REJA 5B1LA 1KX5C 3AZHA 1B67A 4EO5C 4EO5B 1P3MB 1P3MC 3X1SA 1KU5A 5E5AC 5E5AB 3KXBD 1P3LB 1P3LC 1JFIB 1P3FD 1BH8B 3VH5A 4J8XD 2CV5B 5AV8B 5AV8C 5GT3A 3KXBA 3RELB 3RELC 4J8UD 1P3FA 4J8WB 4J8WC 3MVDD 4J8XA 2HUEC 5BNVB 5CP6D 1H3OA 1P3BC 4KHAB 3MVDA 1ULYA 3REHD 3O62D 5B33D 3AZNB 3AZNC 2CWEA 3LJAB 3LJAC 3MNNA 3TU4C 2FJ7C 4Z66B 4Z66C 5DNMB 3REHA 4QLCA 2L5AA 3B6FA 3O62A 2YFVA 3NQUA 4M6BA 3X1UB 3AZLB 3AZLC 1R4VA 4E44A 4WZSB 5CPIC 4XUJD 3AZJC 3B6GB 2YFWA 5FUGA 1U35D 1P3AB 2JSSA
chains in the Genus database with same CATH superfamily
4H9SC 2HIOC 2HIOB 3AN2D 4R8PC 4R8PB 5B24A 1P3KC 1P3OD 3REIB 2DF4C 2NZDC 2NQBC 2NQBB 4H9NB 3AZGD 5B0YB 2NZDB 1P3PC 4JJNA 3V9RA 3AZKC 3WKJD 5DNND 3AN2A 5AV5A 3W97B 3W97C 2J8PA 3NQJA 3AYWB 3AYWC 3AZGA 3KFUG 4J8VC 4J8VB 3WKJA 2FJ7A 5DNNA 5JRGC 3UT9C 3AV2A 2PYOC 2PYOB 3WTPB 3LZ0A 4YM6B 3X1VC 5CPJC 3W98A 1ZLAD 1TZYA 4X23D 5AV6D 1KX4C 1S32A 3C1CB 3C1CC 3LZ1D 3AZEB 3C1BB 5B2IB 3AFAA 5AV9D 5AV6A 4WU9D 1F1EA 5BO0B 4YS3A 1M1AB 3IP4C 4NE6A 3WA9B 1BH9A 1P34A 3WA9C 4NFTA 3MGSB 3MGSC 1Z2CB 3LZ1A 4WJ3C 2W8SA 5G49A 1P3PA 5AV9A 3X1TA 5GT0D 2F8ND 5BS7C 4CAYB 5F99D 5B0ZB 2G5IC 3LELC 5B31C 5B31B 4H9RA 2ZY5A 3UTAD 3AV1C 5AVCB 1Q9CA 5AVCC 3UTBA 1AOID 3W96B 5CPKA 3MGQC 3P5JB 3UT9A 5B32B 3H0LC 5B32C 3R45A 4DRBA 1M19D 4CSRB 3X1VA 5GXQB 5GXQC 5B2JA 1ID3A 3MGPB 3A1KA 3WAAB 3REKD 1M18D 3AZFD 3AL0C 5C3IB 5C3IC 4UUZB 2JCHA 5B40B 5B40C 5BT1D 4Z5TD 3AZMC 3AZMB 3VH5T 3REKA 3B0CW 3REJD 3MGRB 5B1LD 3MGRC 1KX3C 3AZIB 3AZIC 3AZHD 2AROA 2BYMA 1T3UA 1P3IC 2Y2HA 1P3GD 1P3IB 3LELA 2JE5A 4ZUXD 4KUDA 3H0RC 4NE3A 3KWQC 4H9PA 3KWQB 5AVBA 1WWSA 3KXBB 1P3GA 5AY8A 5GT3D 1P3FB 4ZUXA 1HQ3A 3KUYD 4XZQA 3A6ND 4LD9D 2CV5C 4J8UB 4J8UC 4KGCA 4WU8A 3B0BA 1EQZA 1TAFB 3KUYA 3W99D 3A1IA 3MVDB 3A6NA 5B1MA 2BYKA 4LD9A 5CP6B 5CP6C 4H9OB 3MNND 1KX5D 3W99A 5GSUA 5BNXA 3WTPE 5B33B 4QLCD 2RVQD 5E5AD 3B6FD 2VQRA 1KX5A 1P3MA 5AV8D 2IO5B 4ZBJC 4ZBJB 5DNMC 5E5AA 1P3LA 2Y2JA 3X1UC 5JA4B 1BH8A 4J8WD 5B24D 5AV8A 3VH6A 4XUJC 4XUJB 1U35C 1U35B 3RELA 3B6GC 4JJND 1P3BD 1P3OC 1P3OB 4G92B 1P3AC 4J8WA 2XD1A 5AV5D 3REIC 3AZGB 3WKJB 5BNVA 3AZND 5B0YC 3TU4D 1P3BA 2FJ7D 4KHAA 3AV2D 3LZ0D 3AZNA 3W98D 3LJAA 3TU4A 3AZLD 1TZYD 1F66B 1F66C 3F6TA 4Z66A 1S32D 3WTPC 5CPID 2XD5A 4YM6C 1ZLAC 1ZLAB 2FFFB 3AZJD 4X23C 4X23B 3AFAD 2ZM5A 5AV6B 3AZLA 1BH9B 4UPKA 1P3KD 4YS3D 1P34D 5G49B 5CPIA 4WNNB 3AZEC 3C1BC 3AZJA 5B2IC 1P3PD 3AZKD 3X1TD 4WU9B 4WU9C 4H9QB 4H9SA 2HIOA 3EPHA 4R8PA 1BFMA 1P3KA 1M1AC 3REIA 2NZDA 2NQBA 5GT0B 5GT0C 2F8NB 3UTBD 5F99C 2ZY2A 5F99B 4J8VD 3AZKA 5KDMA 5JRGD 5CPKD 5B0ZC 3UT9D 3UTAC 3UTAB 1B6WA 3W97A 3EPKA 1PZRA 2Y2GA 3AYWA 1AOIB 1AOIC 5CPJD 3X1VD 5B2JD 1ID3D 4J8VA 5B31G 3W96C 2BG1A 5JRGA 1M19C 1M19B 1KX4D 2PYOA 4NE5A 4G91B 4G91C 5CPJA 2Y2OA 5B32G 1M18B 1M18C 3MGPC 1N1JB 3AZFC 3WAAC 3AZFB 1KX4A 3WA9D 4DRAA 3MGSD 3VH5W 4Z5TB 4Z5TC 3C1CA 2AROD 5BO0A 3LELD 3REJB 3REJC 3WA9A 5B1LB 5B1LC 4KUDD 3MGSA 3AZHB 3AZHC 5AVCD 3AV1D 3X1SB 3X1SC 1P3GB 2RIQA 5BS7A 4CAYA 5AVBD 4ZUXB 3MGQD 5B0ZA 5AY8D 4AWLB 5B31A 1HQ3D 3AV1A 5AVCA 4XZQD 5GT3C 5GT3B 2Y2IA 3MGQA 3KXBC 5B32A 3KUYB 4KGCD 4WU8D 1P3FC 3EPLA 1A7WA 1EQZD 5GXQA 2BYKB 4LD9B 4J8XC 4J8XB 5B1MD 3H0MC 1H3OB 3KSYA 1KX3D 5B40A 3AZMA 2F8NK 3MVDC 4HGAC 4HGAB 5GSUD 3VH6T 3MNNC 3MNNB 1KX5B 2DQNC 3MGRA 1KX3A 3AZIA 1WWIA 3KWQD 3REHB 3REHC 4QLCC 4QLCB 1P3MD 2RVQC 1P3IA 3O62C 3O62B 5B33C 3B6FB 2YFVB 3NQUB 3B6FC 1P3LD 4Z2MG 3KWQA 2CV5D 2IO5C 2YFWB 5FUGB 3RELD 1JFIA 5B24C 5B24B 2HUEB 2CV5A 2Y2QA 4J8UA 4JJNB 3V9RB 4JJNC 1P3BB 1TAFA 3AN2B 3AN2C 4G92C 5AV5C 5AV5B 3NQJB 4WV4B 2Y2LA 5CP6A 1W2EA 3AZGC 4H9OA 3TU4B 3WKJC 2FJ7B 5DNNB 5DNNC 3LJAD 4Z2MH 3AV2B 3AV2C 1HTAA 3LZ0B 3LZ0C 4Z66D 5B33A 5DNMD 3W98B 3W98C 1TZYB 1TZYC 3X1UD 1S32B 1S32C 5CPIB 5DNMA 3AZJB 3AFAC 3AFAB 3B6GD 5AV6C 3X1UA 5JA4A 4YS3C 4DQYB 4YS3B 1P3AD 1P3KB 1P34B 2HIOD 1P34C 4R8PD 3LZ1B 3LZ1C 3REID 4XUJA 3B0DC 3B0DB 1P3PB 5AV9C 5AV9B 3AZKB 3X1TC 3X1TB 1U35A 2NQBD 5B0YD 2NZDD 5KDMB 3B6GA 1P3OA 1P3AA 4H9RB 3W97D 3UTBB 3UTBC 3AYWD 4H9NA 5B0YA 5JRGB 2F2AC 5CPKB 5CPKC 3UT9B 1F66D 3R45B 2F8NG 2Y2KA 2PYOD 3X1VB 3WTPD 5CPJB 5B2JC 5B2JB 1ID3C 4YM6D 1ID3B 1KX4B 1F66A 3WTPA 3C1CD 4YM6A 2Y2PA 3AZED 1ZLAA 3C1BD 4X23A 5B2ID 3REKB 3REKC 1M1AD 5CHLB 5BT1C 4WNNA 3AZEA 2AROC 2AROB 4E45A 3C1BA 2BYMB 5B2IA 4WU9A 3EPJA 3LELB 4H9QA 2F8NH 5B0ZD 4KUDB 4KUDC 3AV1B 1M1AA 5B31D 4H9PB 5GT0A 2F8NA 5AVBC 5AVBB 5F99A 3MGQB 1P3GC 3W96D 5AY8C 5AY8B 4ZUXC 1HQ3C 1HQ3B 2Y2MA 5B32D 3UTAA 4AWLC 4XZQB 4XZQC 1AOIA 5GXQD 2ZY3A 3MGPD 3W96A 4KGCB 4KGCC 1M19A 4WU8B 4WU8C 3WAAD 1EQZC 1EQZB 3KUYC 3A6NC 5B1MB 5B1MC 4CSRA 5B40D 3A6NB 4LD9C 3AZMD 2LY8A 1M18A 3MGPA 1N1JA 3AZFA 3WAAA 1KX3B 3W99C 4Z5TA 3W99B 4UUZA 2Y2NA 3MGRD 3FDDA 5GSUB 3VH6W 5BNXB 5GSUC 3AZID 3X1SD 3B0CT 1P3ID 3REJA 5B1LA 1KX5C 3AZHA 1B67A 4EO5C 4EO5B 1P3MB 1P3MC 3X1SA 1KU5A 5E5AC 5E5AB 3KXBD 1P3LB 1P3LC 1JFIB 1P3FD 1BH8B 3VH5A 4J8XD 2CV5B 5AV8B 5AV8C 5GT3A 2ZY4A 3KXBA 3RELB 3RELC 4J8UD 1P3FA 4J8WB 4J8WC 2G5HC 3MVDD 4J8XA 2HUEC 5BNVB 5CP6D 3EG5B 1H3OA 1P3BC 4KHAB 3MVDA 1ULYA 3REHD 3O62D 5B33D 3AZNB 3AZNC 2CWEA 3LJAB 3LJAC 3MNNA 3TU4C 2FJ7C 4Z66B 4Z66C 5DNMB 3REHA 4QLCA 2L5AA 3B6FA 3O62A 2YFVA 3NQUA 4M6BA 3X1UB 3AZLB 3AZLC 1R4VA 4E44A 4WZSB 5CPIC 2UWXA 4XUJD 3AZJC 3B6GB 2YFWA 5FUGA 1U35D 1P3AB 2JSSA
chains in the Genus database with same CATH topology
4H9SC 2HIOC 2HIOB 3AN2D 4R8PC 4R8PB 5B24A 1P3KC 1P3OD 3REIB 2DF4C 2NZDC 2NQBC 2NQBB 4H9NB 3AZGD 5B0YB 2NZDB 1P3PC 4JJNA 3V9RA 3AZKC 3WKJD 5DNND 3AN2A 5AV5A 3W97B 3W97C 2J8PA 3NQJA 3AYWB 3AYWC 3AZGA 3KFUG 4J8VC 4J8VB 3WKJA 2FJ7A 5DNNA 5JRGC 3UT9C 3AV2A 2PYOC 2PYOB 3WTPB 3LZ0A 4YM6B 3X1VC 5CPJC 3W98A 1ZLAD 1TZYA 4X23D 5AV6D 1KX4C 1S32A 3C1CB 3C1CC 3LZ1D 3AZEB 3C1BB 5B2IB 3AFAA 5AV9D 5AV6A 4WU9D 1F1EA 5BO0B 4YS3A 1M1AB 3IP4C 4NE6A 3WA9B 1BH9A 1P34A 3WA9C 4NFTA 3MGSB 3MGSC 1Z2CB 3LZ1A 4WJ3C 2W8SA 5G49A 1P3PA 5AV9A 3X1TA 5GT0D 2F8ND 5BS7C 4CAYB 5F99D 5B0ZB 2G5IC 3LELC 5B31C 5B31B 4H9RA 2ZY5A 3UTAD 3AV1C 5AVCB 1Q9CA 5AVCC 3UTBA 1AOID 3W96B 5CPKA 3MGQC 3P5JB 3UT9A 5B32B 3H0LC 5B32C 3R45A 4DRBA 1M19D 4CSRB 3X1VA 5GXQB 5GXQC 5B2JA 1ID3A 3MGPB 3A1KA 3WAAB 3REKD 1M18D 3AZFD 3AL0C 5C3IB 5C3IC 4UUZB 2JCHA 5B40B 5B40C 5BT1D 4Z5TD 3AZMC 3AZMB 3VH5T 3REKA 3B0CW 3REJD 3MGRB 5B1LD 3MGRC 1KX3C 3AZIB 3AZIC 3AZHD 2AROA 2BYMA 1T3UA 1P3IC 2Y2HA 1P3GD 1P3IB 3LELA 2JE5A 4ZUXD 4KUDA 3H0RC 4NE3A 3KWQC 4H9PA 3KWQB 5AVBA 1WWSA 3KXBB 1P3GA 5AY8A 5GT3D 1P3FB 4ZUXA 1HQ3A 3KUYD 4XZQA 3A6ND 4LD9D 2CV5C 4J8UB 4J8UC 4KGCA 4WU8A 3B0BA 1EQZA 1TAFB 3KUYA 3W99D 3A1IA 3MVDB 3A6NA 5B1MA 2BYKA 4LD9A 5CP6B 5CP6C 4H9OB 3MNND 1KX5D 3W99A 5GSUA 5BNXA 3WTPE 5B33B 4QLCD 2RVQD 5E5AD 3B6FD 2VQRA 1KX5A 1P3MA 5AV8D 2IO5B 4ZBJC 4ZBJB 5DNMC 5E5AA 1P3LA 2Y2JA 3X1UC 5JA4B 1BH8A 4J8WD 5B24D 5AV8A 3VH6A 4XUJC 4XUJB 1U35C 1U35B 3RELA 3B6GC 4JJND 1P3BD 1P3OC 1P3OB 4G92B 1P3AC 4J8WA 2XD1A 5AV5D 3REIC 3AZGB 3WKJB 5BNVA 3AZND 5B0YC 3TU4D 1P3BA 2FJ7D 4KHAA 3AV2D 3LZ0D 3AZNA 3W98D 3LJAA 3TU4A 3AZLD 1TZYD 1F66B 1F66C 3F6TA 4Z66A 1S32D 3WTPC 5CPID 2XD5A 4YM6C 1ZLAC 1ZLAB 2FFFB 3AZJD 4X23C 4X23B 3AFAD 2ZM5A 5AV6B 3AZLA 1BH9B 4UPKA 1P3KD 4YS3D 1P34D 5G49B 5CPIA 4WNNB 3AZEC 3C1BC 3AZJA 5B2IC 1P3PD 3AZKD 3X1TD 4WU9B 4WU9C 4H9QB 4H9SA 2HIOA 3EPHA 4R8PA 1BFMA 1P3KA 1M1AC 3REIA 2NZDA 2NQBA 5GT0B 5GT0C 2F8NB 3UTBD 5F99C 2ZY2A 5F99B 4J8VD 3AZKA 5KDMA 5JRGD 5CPKD 5B0ZC 3UT9D 3UTAC 3UTAB 1B6WA 3W97A 3EPKA 1PZRA 2Y2GA 3AYWA 1AOIB 1AOIC 5CPJD 3X1VD 5B2JD 1ID3D 4J8VA 5B31G 3W96C 2BG1A 5JRGA 1M19C 1M19B 1KX4D 2PYOA 4NE5A 4G91B 4G91C 5CPJA 2Y2OA 5B32G 1M18B 1M18C 3MGPC 1N1JB 3AZFC 3WAAC 3AZFB 1KX4A 3WA9D 4DRAA 3MGSD 3VH5W 4Z5TB 4Z5TC 3C1CA 2AROD 5BO0A 3LELD 3REJB 3REJC 3WA9A 5B1LB 5B1LC 4KUDD 3MGSA 3AZHB 3AZHC 5AVCD 3AV1D 3X1SB 3X1SC 1P3GB 2RIQA 5BS7A 4CAYA 5AVBD 4ZUXB 3MGQD 5B0ZA 5AY8D 4AWLB 5B31A 1HQ3D 3AV1A 5AVCA 4XZQD 5GT3C 5GT3B 2Y2IA 3MGQA 3KXBC 5B32A 3KUYB 4KGCD 4WU8D 1P3FC 3EPLA 1A7WA 1EQZD 5GXQA 2BYKB 4LD9B 4J8XC 4J8XB 5B1MD 3H0MC 1H3OB 3KSYA 1KX3D 5B40A 3AZMA 2F8NK 3MVDC 4HGAC 4HGAB 5GSUD 3VH6T 3MNNC 3MNNB 1KX5B 2DQNC 3MGRA 1KX3A 3AZIA 1WWIA 3KWQD 3REHB 3REHC 4QLCC 4QLCB 1P3MD 2RVQC 1P3IA 3O62C 3O62B 5B33C 3B6FB 2YFVB 3NQUB 3B6FC 1P3LD 4Z2MG 3KWQA 2CV5D 2IO5C 2YFWB 5FUGB 3RELD 1JFIA 5B24C 5B24B 2HUEB 2CV5A 2Y2QA 4J8UA 4JJNB 3V9RB 4JJNC 1P3BB 1TAFA 3AN2B 3AN2C 4G92C 5AV5C 5AV5B 3NQJB 4WV4B 2Y2LA 5CP6A 1W2EA 3AZGC 4H9OA 3TU4B 3WKJC 2FJ7B 5DNNB 5DNNC 3LJAD 4Z2MH 3AV2B 3AV2C 1HTAA 3LZ0B 3LZ0C 4Z66D 5B33A 5DNMD 3W98B 3W98C 1TZYB 1TZYC 3X1UD 1S32B 1S32C 5CPIB 5DNMA 3AZJB 3AFAC 3AFAB 3B6GD 5AV6C 3X1UA 5JA4A 4YS3C 4DQYB 4YS3B 1P3AD 1P3KB 1P34B 2HIOD 1P34C 4R8PD 3LZ1B 3LZ1C 3REID 4XUJA 3B0DC 3B0DB 1P3PB 5AV9C 5AV9B 3AZKB 3X1TC 3X1TB 1U35A 2NQBD 5B0YD 2NZDD 5KDMB 3B6GA 1P3OA 1P3AA 4H9RB 3W97D 3UTBB 3UTBC 3AYWD 4H9NA 5B0YA 5JRGB 2F2AC 5CPKB 5CPKC 3UT9B 1F66D 3R45B 2F8NG 2Y2KA 2PYOD 3X1VB 3WTPD 5CPJB 5B2JC 5B2JB 1ID3C 4YM6D 1ID3B 1KX4B 1F66A 3WTPA 3C1CD 4YM6A 2Y2PA 3AZED 1ZLAA 3C1BD 4X23A 5B2ID 3REKB 3REKC 1M1AD 5CHLB 5BT1C 4WNNA 3AZEA 2AROC 2AROB 4E45A 3C1BA 2BYMB 5B2IA 4WU9A 3EPJA 3LELB 4H9QA 2F8NH 5B0ZD 4KUDB 4KUDC 3AV1B 1M1AA 5B31D 4H9PB 5GT0A 2F8NA 5AVBC 5AVBB 5F99A 3MGQB 1P3GC 3W96D 5AY8C 5AY8B 4ZUXC 1HQ3C 1HQ3B 2Y2MA 5B32D 3UTAA 4AWLC 4XZQB 4XZQC 1AOIA 5GXQD 2ZY3A 3MGPD 3W96A 4KGCB 4KGCC 1M19A 4WU8B 4WU8C 3WAAD 1EQZC 1EQZB 3KUYC 3A6NC 5B1MB 5B1MC 4CSRA 5B40D 3A6NB 4LD9C 3AZMD 2LY8A 1M18A 3MGPA 1N1JA 3AZFA 3WAAA 1KX3B 3W99C 4Z5TA 3W99B 4UUZA 2Y2NA 3MGRD 3FDDA 5GSUB 3VH6W 5BNXB 5GSUC 3AZID 3X1SD 3B0CT 1P3ID 3REJA 5B1LA 1KX5C 3AZHA 1B67A 4EO5C 4EO5B 1P3MB 1P3MC 3X1SA 1KU5A 5E5AC 5E5AB 3KXBD 1P3LB 1P3LC 1JFIB 1P3FD 1BH8B 3VH5A 4J8XD 2CV5B 5AV8B 5AV8C 5GT3A 2ZY4A 3KXBA 3RELB 3RELC 4J8UD 1P3FA 4J8WB 4J8WC 2G5HC 3MVDD 4J8XA 2HUEC 5BNVB 5CP6D 3EG5B 1H3OA 1P3BC 4KHAB 3MVDA 1ULYA 3REHD 3O62D 5B33D 3AZNB 3AZNC 2CWEA 3LJAB 3LJAC 3MNNA 3TU4C 2FJ7C 4Z66B 4Z66C 5DNMB 3REHA 4QLCA 2L5AA 3B6FA 3O62A 2YFVA 3NQUA 4M6BA 3X1UB 3AZLB 3AZLC 1R4VA 4E44A 4WZSB 5CPIC 2UWXA 4XUJD 3AZJC 3B6GB 2YFWA 5FUGA 1U35D 1P3AB 2JSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9S C;  2HIO C;  2HIO B;  3AN2 D;  4R8P C;  4R8P B;  5B24 A;  1P3K C;  1P3O D;  3REI B;  2NZD C;  2NQB C;  2NQB B;  4H9N B;  3AZG D;  5B0Y B;  2NZD B;  1P3P C;  4JJN A;  3V9R A;  3AZK C;  3WKJ D;  5DNN D;  3AN2 A;  5AV5 A;  3W97 B;  3W97 C;  3NQJ A;  3AYW B;  3AYW C;  3AZG A;  4J8V C;  4J8V B;  3WKJ A;  2FJ7 A;  5DNN A;  5JRG C;  3UT9 C;  3AV2 A;  2PYO C;  2PYO B;  3WTP B;  3LZ0 A;  4YM6 B;  3X1V C;  5CPJ C;  3W98 A;  1ZLA D;  1TZY A;  4X23 D;  5AV6 D;  1KX4 C;  1S32 A;  3C1C B;  3C1C C;  3LZ1 D;  3AZE B;  3C1B B;  5B2I B;  3AFA A;  5AV9 D;  5AV6 A;  4WU9 D;  1F1E A;  5BO0 B;  4YS3 A;  1M1A B;  4NE6 A;  3WA9 B;  3WA9 C;  1BH9 A;  1P34 A;  4NFT A;  3MGS B;  3MGS C;  3LZ1 A;  5G49 A;  1P3P A;  5AV9 A;  3X1T A;  5GT0 D;  2F8N D;  5BS7 C;  4CAY B;  5F99 D;  5B0Z B;  3LEL C;  5B31 B;  4H9R A;  5B31 C;  3UTA D;  3AV1 C;  5AVC B;  1Q9C A;  5AVC C;  3UTB A;  1AOI D;  3W96 B;  5CPK A;  3MGQ C;  3UT9 A;  5B32 B;  5B32 C;  3R45 A;  4DRB A;  1M19 D;  4CSR B;  3X1V A;  5GXQ B;  5GXQ C;  5B2J A;  1ID3 A;  3MGP B;  3WAA B;  3REK D;  1M18 D;  3AZF D;  5C3I B;  5C3I C;  4UUZ B;  5B40 B;  5B40 C;  5BT1 D;  4Z5T D;  3AZM C;  3AZM B;  3VH5 T;  3REK A;  3B0C W;  3REJ D;  3MGR B;  5B1L D;  3MGR C;  1KX3 C;  3AZI B;  3AZI C;  3AZH D;  2ARO A;  2BYM A;  1P3I C;  1P3I B;  1P3G D;  3LEL A;  4ZUX D;  4KUD A;  4NE3 A;  3KWQ C;  4H9P A;  3KWQ B;  5AVB A;  1WWS A;  3KXB B;  1P3G A;  5AY8 A;  5GT3 D;  1P3F B;  4ZUX A;  1HQ3 A;  3KUY D;  4XZQ A;  3A6N D;  4LD9 D;  2CV5 C;  4J8U B;  4J8U C;  4KGC A;  4WU8 A;  3B0B A;  1EQZ A;  1TAF B;  3KUY A;  3W99 D;  3MVD B;  3A6N A;  5B1M A;  2BYK A;  4LD9 A;  5CP6 B;  5CP6 C;  4H9O B;  3MNN D;  1KX5 D;  3W99 A;  5GSU A;  5BNX A;  3WTP E;  5B33 B;  4QLC D;  2RVQ D;  5E5A D;  3B6F D;  1KX5 A;  1P3M A;  5AV8 D;  2IO5 B;  4ZBJ C;  4ZBJ B;  5DNM C;  5E5A A;  1P3L A;  3X1U C;  5JA4 B;  1BH8 A;  4J8W D;  5B24 D;  5AV8 A;  3VH6 A;  4XUJ C;  4XUJ B;  1U35 C;  1U35 B;  3REL A;  3B6G C;  4JJN D;  1P3B D;  1P3O C;  1P3O B;  4G92 B;  1P3A C;  4J8W A;  5AV5 D;  3REI C;  3AZG B;  3WKJ B;  5BNV A;  3AZN D;  5B0Y C;  3TU4 D;  1P3B A;  2FJ7 D;  4KHA A;  3AV2 D;  3LZ0 D;  3AZN A;  3W98 D;  3LJA A;  3TU4 A;  3AZL D;  1TZY D;  1F66 B;  1F66 C;  4Z66 A;  1S32 D;  3WTP C;  5CPI D;  4YM6 C;  1ZLA C;  1ZLA B;  3AZJ D;  4X23 C;  4X23 B;  3AFA D;  5AV6 B;  3AZL A;  1BH9 B;  1P3K D;  4YS3 D;  1P34 D;  5G49 B;  5CPI A;  4WNN B;  3AZE C;  3C1B C;  3AZJ A;  5B2I C;  1P3P D;  3AZK D;  3X1T D;  4WU9 B;  4WU9 C;  4H9Q B;  4H9S A;  2HIO A;  4R8P A;  1BFM A;  1P3K A;  1M1A C;  3REI A;  2NZD A;  2NQB A;  5GT0 B;  5GT0 C;  2F8N B;  3UTB D;  5F99 C;  5F99 B;  4J8V D;  3AZK A;  5KDM A;  5JRG D;  5CPK D;  5B0Z C;  3UT9 D;  3UTA C;  3UTA B;  1B6W A;  3W97 A;  3AYW A;  1AOI B;  1AOI C;  5CPJ D;  3X1V D;  5B2J D;  1ID3 D;  4J8V A;  5B31 G;  3W96 C;  5JRG A;  1M19 C;  1M19 B;  1KX4 D;  2PYO A;  4NE5 A;  4G91 B;  4G91 C;  5CPJ A;  5B32 G;  1M18 B;  1M18 C;  3MGP C;  1N1J B;  3AZF C;  3WAA C;  3AZF B;  1KX4 A;  3WA9 D;  4DRA A;  3MGS D;  3VH5 W;  4Z5T B;  4Z5T C;  3C1C A;  2ARO D;  5BO0 A;  3LEL D;  3REJ B;  3REJ C;  3WA9 A;  5B1L B;  5B1L C;  4KUD D;  3MGS A;  3AZH B;  3AZH C;  5AVC D;  3AV1 D;  3X1S B;  3X1S C;  1P3G B;  5BS7 A;  4CAY A;  5AVB D;  4ZUX B;  3MGQ D;  5B0Z A;  5AY8 D;  4AWL B;  5B31 A;  1HQ3 D;  3AV1 A;  5AVC A;  4XZQ D;  5GT3 C;  5GT3 B;  3MGQ A;  3KXB C;  5B32 A;  3KUY B;  4KGC D;  4WU8 D;  1P3F C;  1A7W A;  1EQZ D;  5GXQ A;  2BYK B;  4LD9 B;  4J8X C;  4J8X B;  5B1M D;  1H3O B;  3KSY A;  1KX3 D;  5B40 A;  3AZM A;  2F8N K;  3MVD C;  4HGA C;  4HGA B;  5GSU D;  3VH6 T;  3MNN C;  3MNN B;  1KX5 B;  3MGR A;  1KX3 A;  3AZI A;  1WWI A;  3KWQ D;  3REH B;  3REH C;  4QLC C;  4QLC B;  1P3M D;  2RVQ C;  1P3I A;  3O62 C;  3O62 B;  5B33 C;  3B6F B;  2YFV B;  3NQU B;  3B6F C;  1P3L D;  4Z2M G;  3KWQ A;  2CV5 D;  2IO5 C;  2YFW B;  5FUG B;  3REL D;  1JFI A;  5B24 B;  5B24 C;  2HUE B;  2CV5 A;  4J8U A;  4JJN B;  3V9R B;  4JJN C;  1P3B B;  1TAF A;  3AN2 B;  3AN2 C;  4G92 C;  5AV5 C;  5AV5 B;  3NQJ B;  4WV4 B;  5CP6 A;  3AZG C;  4H9O A;  3TU4 B;  3WKJ C;  2FJ7 B;  5DNN B;  5DNN C;  3LJA D;  4Z2M H;  3AV2 B;  3AV2 C;  1HTA A;  3LZ0 B;  3LZ0 C;  4Z66 D;  5B33 A;  5DNM D;  3W98 B;  3W98 C;  1TZY B;  1TZY C;  3X1U D;  1S32 B;  1S32 C;  5CPI B;  5DNM A;  3AZJ B;  3AFA C;  3AFA B;  3B6G D;  5AV6 C;  3X1U A;  5JA4 A;  4YS3 C;  4YS3 B;  1P3A D;  1P3K B;  1P34 B;  2HIO D;  1P34 C;  4R8P D;  3LZ1 B;  3LZ1 C;  3REI D;  4XUJ A;  3B0D C;  3B0D B;  1P3P B;  5AV9 C;  5AV9 B;  3AZK B;  3X1T C;  3X1T B;  1U35 A;  2NQB D;  5B0Y D;  2NZD D;  5KDM B;  3B6G A;  1P3O A;  1P3A A;  4H9R B;  3W97 D;  3UTB B;  3UTB C;  3AYW D;  4H9N A;  5B0Y A;  5JRG B;  5CPK B;  5CPK C;  3UT9 B;  1F66 D;  3R45 B;  2F8N G;  2PYO D;  3X1V B;  3WTP D;  5CPJ B;  5B2J C;  5B2J B;  1ID3 C;  4YM6 D;  1ID3 B;  1KX4 B;  1F66 A;  3WTP A;  3C1C D;  4YM6 A;  3AZE D;  1ZLA A;  3C1B D;  4X23 A;  5B2I D;  3REK B;  3REK C;  1M1A D;  5CHL B;  5BT1 C;  4WNN A;  3AZE A;  2ARO C;  2ARO B;  4E45 A;  3C1B A;  2BYM B;  5B2I A;  4WU9 A;  3LEL B;  4H9Q A;  2F8N H;  5B0Z D;  4KUD B;  4KUD C;  3AV1 B;  1M1A A;  5B31 D;  4H9P B;  5GT0 A;  2F8N A;  5AVB C;  5AVB B;  5F99 A;  3MGQ B;  1P3G C;  3W96 D;  5AY8 C;  5AY8 B;  4ZUX C;  1HQ3 C;  1HQ3 B;  5B32 D;  3UTA A;  4AWL C;  4XZQ B;  4XZQ C;  1AOI A;  5GXQ D;  3MGP D;  3W96 A;  4KGC B;  4KGC C;  1M19 A;  4WU8 B;  4WU8 C;  3WAA D;  1EQZ C;  1EQZ B;  3KUY C;  3A6N C;  5B1M B;  5B1M C;  4CSR A;  5B40 D;  3A6N B;  4LD9 C;  3AZM D;  2LY8 A;  1M18 A;  3MGP A;  1N1J A;  3AZF A;  3WAA A;  1KX3 B;  3W99 C;  4Z5T A;  3W99 B;  4UUZ A;  3MGR D;  5GSU B;  3VH6 W;  5BNX B;  5GSU C;  3AZI D;  3X1S D;  3B0C T;  1P3I D;  3REJ A;  5B1L A;  1KX5 C;  3AZH A;  1B67 A;  4EO5 C;  4EO5 B;  1P3M B;  1P3M C;  3X1S A;  1KU5 A;  5E5A C;  5E5A B;  3KXB D;  1P3L B;  1P3L C;  1JFI B;  1P3F D;  1BH8 B;  3VH5 A;  4J8X D;  2CV5 B;  5AV8 B;  5AV8 C;  5GT3 A;  3KXB A;  3REL B;  3REL C;  4J8U D;  1P3F A;  4J8W B;  4J8W C;  3MVD D;  4J8X A;  2HUE C;  5BNV B;  5CP6 D;  1H3O A;  1P3B C;  4KHA B;  3MVD A;  1ULY A;  3REH D;  3O62 D;  5B33 D;  3AZN B;  3AZN C;  2CWE A;  3LJA B;  3LJA C;  3MNN A;  3TU4 C;  2FJ7 C;  4Z66 B;  4Z66 C;  5DNM B;  3REH A;  4QLC A;  2L5A A;  3B6F A;  3O62 A;  2YFV A;  3NQU A;  4M6B A;  3X1U B;  3AZL B;  3AZL C;  1R4V A;  4E44 A;  4WZS B;  5CPI C;  4XUJ D;  3AZJ C;  3B6G B;  2YFW A;  5FUG A;  1U35 D;  1P3A B;  2JSS A; 
#chains in the Genus database with same CATH topology
 4H9S C;  2HIO C;  2HIO B;  3AN2 D;  4R8P C;  4R8P B;  5B24 A;  1P3K C;  1P3O D;  3REI B;  2DF4 C;  2NZD C;  2NQB C;  2NQB B;  4H9N B;  3AZG D;  5B0Y B;  2NZD B;  1P3P C;  4JJN A;  3V9R A;  3AZK C;  3WKJ D;  5DNN D;  3AN2 A;  5AV5 A;  3W97 B;  3W97 C;  2J8P A;  3NQJ A;  3AYW B;  3AYW C;  3AZG A;  3KFU G;  4J8V C;  4J8V B;  3WKJ A;  2FJ7 A;  5DNN A;  5JRG C;  3UT9 C;  3AV2 A;  2PYO C;  2PYO B;  3WTP B;  3LZ0 A;  4YM6 B;  3X1V C;  5CPJ C;  3W98 A;  1ZLA D;  1TZY A;  4X23 D;  5AV6 D;  1KX4 C;  1S32 A;  3C1C B;  3C1C C;  3LZ1 D;  3AZE B;  3C1B B;  5B2I B;  3AFA A;  5AV9 D;  5AV6 A;  4WU9 D;  1F1E A;  5BO0 B;  4YS3 A;  1M1A B;  3IP4 C;  4NE6 A;  3WA9 B;  1BH9 A;  1P34 A;  3WA9 C;  4NFT A;  3MGS B;  3MGS C;  1Z2C B;  3LZ1 A;  4WJ3 C;  2W8S A;  5G49 A;  1P3P A;  5AV9 A;  3X1T A;  5GT0 D;  2F8N D;  5BS7 C;  4CAY B;  5F99 D;  5B0Z B;  2G5I C;  3LEL C;  5B31 C;  5B31 B;  4H9R A;  2ZY5 A;  3UTA D;  3AV1 C;  5AVC B;  1Q9C A;  5AVC C;  3UTB A;  1AOI D;  3W96 B;  5CPK A;  3MGQ C;  3P5J B;  3UT9 A;  5B32 B;  3H0L C;  5B32 C;  3R45 A;  4DRB A;  1M19 D;  4CSR B;  3X1V A;  5GXQ B;  5GXQ C;  5B2J A;  1ID3 A;  3MGP B;  3A1K A;  3WAA B;  3REK D;  1M18 D;  3AZF D;  3AL0 C;  5C3I B;  5C3I C;  4UUZ B;  2JCH A;  5B40 B;  5B40 C;  5BT1 D;  4Z5T D;  3AZM C;  3AZM B;  3VH5 T;  3REK A;  3B0C W;  3REJ D;  3MGR B;  5B1L D;  3MGR C;  1KX3 C;  3AZI B;  3AZI C;  3AZH D;  2ARO A;  2BYM A;  1T3U A;  1P3I C;  2Y2H A;  1P3G D;  1P3I B;  3LEL A;  2JE5 A;  4ZUX D;  4KUD A;  3H0R C;  4NE3 A;  3KWQ C;  4H9P A;  3KWQ B;  5AVB A;  1WWS A;  3KXB B;  1P3G A;  5AY8 A;  5GT3 D;  1P3F B;  4ZUX A;  1HQ3 A;  3KUY D;  4XZQ A;  3A6N D;  4LD9 D;  2CV5 C;  4J8U B;  4J8U C;  4KGC A;  4WU8 A;  3B0B A;  1EQZ A;  1TAF B;  3KUY A;  3W99 D;  3A1I A;  3MVD B;  3A6N A;  5B1M A;  2BYK A;  4LD9 A;  5CP6 B;  5CP6 C;  4H9O B;  3MNN D;  1KX5 D;  3W99 A;  5GSU A;  5BNX A;  3WTP E;  5B33 B;  4QLC D;  2RVQ D;  5E5A D;  3B6F D;  2VQR A;  1KX5 A;  1P3M A;  5AV8 D;  2IO5 B;  4ZBJ C;  4ZBJ B;  5DNM C;  5E5A A;  1P3L A;  2Y2J A;  3X1U C;  5JA4 B;  1BH8 A;  4J8W D;  5B24 D;  5AV8 A;  3VH6 A;  4XUJ C;  4XUJ B;  1U35 C;  1U35 B;  3REL A;  3B6G C;  4JJN D;  1P3B D;  1P3O C;  1P3O B;  4G92 B;  1P3A C;  4J8W A;  2XD1 A;  5AV5 D;  3REI C;  3AZG B;  3WKJ B;  5BNV A;  3AZN D;  5B0Y C;  3TU4 D;  1P3B A;  2FJ7 D;  4KHA A;  3AV2 D;  3LZ0 D;  3AZN A;  3W98 D;  3LJA A;  3TU4 A;  3AZL D;  1TZY D;  1F66 B;  1F66 C;  3F6T A;  4Z66 A;  1S32 D;  3WTP C;  5CPI D;  2XD5 A;  4YM6 C;  1ZLA C;  1ZLA B;  2FFF B;  3AZJ D;  4X23 C;  4X23 B;  3AFA D;  2ZM5 A;  5AV6 B;  3AZL A;  1BH9 B;  4UPK A;  1P3K D;  4YS3 D;  1P34 D;  5G49 B;  5CPI A;  4WNN B;  3AZE C;  3C1B C;  3AZJ A;  5B2I C;  1P3P D;  3AZK D;  3X1T D;  4WU9 B;  4WU9 C;  4H9Q B;  4H9S A;  2HIO A;  3EPH A;  4R8P A;  1BFM A;  1P3K A;  1M1A C;  3REI A;  2NZD A;  2NQB A;  5GT0 B;  5GT0 C;  2F8N B;  3UTB D;  5F99 C;  2ZY2 A;  5F99 B;  4J8V D;  3AZK A;  5KDM A;  5JRG D;  5CPK D;  5B0Z C;  3UT9 D;  3UTA C;  3UTA B;  1B6W A;  3W97 A;  3EPK A;  1PZR A;  2Y2G A;  3AYW A;  1AOI B;  1AOI C;  5CPJ D;  3X1V D;  5B2J D;  1ID3 D;  4J8V A;  5B31 G;  3W96 C;  2BG1 A;  5JRG A;  1M19 C;  1M19 B;  1KX4 D;  2PYO A;  4NE5 A;  4G91 B;  4G91 C;  5CPJ A;  2Y2O A;  5B32 G;  1M18 B;  1M18 C;  3MGP C;  1N1J B;  3AZF C;  3WAA C;  3AZF B;  1KX4 A;  3WA9 D;  4DRA A;  3MGS D;  3VH5 W;  4Z5T B;  4Z5T C;  3C1C A;  2ARO D;  5BO0 A;  3LEL D;  3REJ B;  3REJ C;  3WA9 A;  5B1L B;  5B1L C;  4KUD D;  3MGS A;  3AZH B;  3AZH C;  5AVC D;  3AV1 D;  3X1S B;  3X1S C;  1P3G B;  2RIQ A;  5BS7 A;  4CAY A;  5AVB D;  4ZUX B;  3MGQ D;  5B0Z A;  5AY8 D;  4AWL B;  5B31 A;  1HQ3 D;  3AV1 A;  5AVC A;  4XZQ D;  5GT3 C;  5GT3 B;  2Y2I A;  3MGQ A;  3KXB C;  5B32 A;  3KUY B;  4KGC D;  4WU8 D;  1P3F C;  3EPL A;  1A7W A;  1EQZ D;  5GXQ A;  2BYK B;  4LD9 B;  4J8X C;  4J8X B;  5B1M D;  3H0M C;  1H3O B;  3KSY A;  1KX3 D;  5B40 A;  3AZM A;  2F8N K;  3MVD C;  4HGA C;  4HGA B;  5GSU D;  3VH6 T;  3MNN C;  3MNN B;  1KX5 B;  2DQN C;  3MGR A;  1KX3 A;  3AZI A;  1WWI A;  3KWQ D;  3REH B;  3REH C;  4QLC C;  4QLC B;  1P3M D;  2RVQ C;  1P3I A;  3O62 C;  3O62 B;  5B33 C;  3B6F B;  2YFV B;  3NQU B;  3B6F C;  1P3L D;  4Z2M G;  3KWQ A;  2CV5 D;  2IO5 C;  2YFW B;  5FUG B;  3REL D;  1JFI A;  5B24 C;  5B24 B;  2HUE B;  2CV5 A;  2Y2Q A;  4J8U A;  4JJN B;  3V9R B;  4JJN C;  1P3B B;  1TAF A;  3AN2 B;  3AN2 C;  4G92 C;  5AV5 C;  5AV5 B;  3NQJ B;  4WV4 B;  2Y2L A;  5CP6 A;  1W2E A;  3AZG C;  4H9O A;  3TU4 B;  3WKJ C;  2FJ7 B;  5DNN B;  5DNN C;  3LJA D;  4Z2M H;  3AV2 B;  3AV2 C;  1HTA A;  3LZ0 B;  3LZ0 C;  4Z66 D;  5B33 A;  5DNM D;  3W98 B;  3W98 C;  1TZY B;  1TZY C;  3X1U D;  1S32 B;  1S32 C;  5CPI B;  5DNM A;  3AZJ B;  3AFA C;  3AFA B;  3B6G D;  5AV6 C;  3X1U A;  5JA4 A;  4YS3 C;  4DQY B;  4YS3 B;  1P3A D;  1P3K B;  1P34 B;  2HIO D;  1P34 C;  4R8P D;  3LZ1 B;  3LZ1 C;  3REI D;  4XUJ A;  3B0D C;  3B0D B;  1P3P B;  5AV9 C;  5AV9 B;  3AZK B;  3X1T C;  3X1T B;  1U35 A;  2NQB D;  5B0Y D;  2NZD D;  5KDM B;  3B6G A;  1P3O A;  1P3A A;  4H9R B;  3W97 D;  3UTB B;  3UTB C;  3AYW D;  4H9N A;  5B0Y A;  5JRG B;  2F2A C;  5CPK B;  5CPK C;  3UT9 B;  1F66 D;  3R45 B;  2F8N G;  2Y2K A;  2PYO D;  3X1V B;  3WTP D;  5CPJ B;  5B2J C;  5B2J B;  1ID3 C;  4YM6 D;  1ID3 B;  1KX4 B;  1F66 A;  3WTP A;  3C1C D;  4YM6 A;  2Y2P A;  3AZE D;  1ZLA A;  3C1B D;  4X23 A;  5B2I D;  3REK B;  3REK C;  1M1A D;  5CHL B;  5BT1 C;  4WNN A;  3AZE A;  2ARO C;  2ARO B;  4E45 A;  3C1B A;  2BYM B;  5B2I A;  4WU9 A;  3EPJ A;  3LEL B;  4H9Q A;  2F8N H;  5B0Z D;  4KUD B;  4KUD C;  3AV1 B;  1M1A A;  5B31 D;  4H9P B;  5GT0 A;  2F8N A;  5AVB C;  5AVB B;  5F99 A;  3MGQ B;  1P3G C;  3W96 D;  5AY8 C;  5AY8 B;  4ZUX C;  1HQ3 C;  1HQ3 B;  2Y2M A;  5B32 D;  3UTA A;  4AWL C;  4XZQ B;  4XZQ C;  1AOI A;  5GXQ D;  2ZY3 A;  3MGP D;  3W96 A;  4KGC B;  4KGC C;  1M19 A;  4WU8 B;  4WU8 C;  3WAA D;  1EQZ C;  1EQZ B;  3KUY C;  3A6N C;  5B1M B;  5B1M C;  4CSR A;  5B40 D;  3A6N B;  4LD9 C;  3AZM D;  2LY8 A;  1M18 A;  3MGP A;  1N1J A;  3AZF A;  3WAA A;  1KX3 B;  3W99 C;  4Z5T A;  3W99 B;  4UUZ A;  2Y2N A;  3MGR D;  3FDD A;  5GSU B;  3VH6 W;  5BNX B;  5GSU C;  3AZI D;  3X1S D;  3B0C T;  1P3I D;  3REJ A;  5B1L A;  1KX5 C;  3AZH A;  1B67 A;  4EO5 C;  4EO5 B;  1P3M B;  1P3M C;  3X1S A;  1KU5 A;  5E5A C;  5E5A B;  3KXB D;  1P3L B;  1P3L C;  1JFI B;  1P3F D;  1BH8 B;  3VH5 A;  4J8X D;  2CV5 B;  5AV8 B;  5AV8 C;  5GT3 A;  2ZY4 A;  3KXB A;  3REL B;  3REL C;  4J8U D;  1P3F A;  4J8W B;  4J8W C;  2G5H C;  3MVD D;  4J8X A;  2HUE C;  5BNV B;  5CP6 D;  3EG5 B;  1H3O A;  1P3B C;  4KHA B;  3MVD A;  1ULY A;  3REH D;  3O62 D;  5B33 D;  3AZN B;  3AZN C;  2CWE A;  3LJA B;  3LJA C;  3MNN A;  3TU4 C;  2FJ7 C;  4Z66 B;  4Z66 C;  5DNM B;  3REH A;  4QLC A;  2L5A A;  3B6F A;  3O62 A;  2YFV A;  3NQU A;  4M6B A;  3X1U B;  3AZL B;  3AZL C;  1R4V A;  4E44 A;  4WZS B;  5CPI C;  2UWX A;  4XUJ D;  3AZJ C;  3B6G B;  2YFW A;  5FUG A;  1U35 D;  1P3A B;  2JSS A; 
#chains in the Genus database with same CATH homology
 4H9S C;  2HIO C;  2HIO B;  3AN2 D;  4R8P C;  4R8P B;  5B24 A;  1P3K C;  1P3O D;  3REI B;  2DF4 C;  2NZD C;  2NQB C;  2NQB B;  4H9N B;  3AZG D;  5B0Y B;  2NZD B;  1P3P C;  4JJN A;  3V9R A;  3AZK C;  3WKJ D;  5DNN D;  3AN2 A;  5AV5 A;  3W97 B;  3W97 C;  2J8P A;  3NQJ A;  3AYW B;  3AYW C;  3AZG A;  3KFU G;  4J8V C;  4J8V B;  3WKJ A;  2FJ7 A;  5DNN A;  5JRG C;  3UT9 C;  3AV2 A;  2PYO C;  2PYO B;  3WTP B;  3LZ0 A;  4YM6 B;  3X1V C;  5CPJ C;  3W98 A;  1ZLA D;  1TZY A;  4X23 D;  5AV6 D;  1KX4 C;  1S32 A;  3C1C B;  3C1C C;  3LZ1 D;  3AZE B;  3C1B B;  5B2I B;  3AFA A;  5AV9 D;  5AV6 A;  4WU9 D;  1F1E A;  5BO0 B;  4YS3 A;  1M1A B;  3IP4 C;  4NE6 A;  3WA9 B;  1BH9 A;  1P34 A;  3WA9 C;  4NFT A;  3MGS B;  3MGS C;  1Z2C B;  3LZ1 A;  4WJ3 C;  2W8S A;  5G49 A;  1P3P A;  5AV9 A;  3X1T A;  5GT0 D;  2F8N D;  5BS7 C;  4CAY B;  5F99 D;  5B0Z B;  2G5I C;  3LEL C;  5B31 C;  5B31 B;  4H9R A;  2ZY5 A;  3UTA D;  3AV1 C;  5AVC B;  1Q9C A;  5AVC C;  3UTB A;  1AOI D;  3W96 B;  5CPK A;  3MGQ C;  3P5J B;  3UT9 A;  5B32 B;  3H0L C;  5B32 C;  3R45 A;  4DRB A;  1M19 D;  4CSR B;  3X1V A;  5GXQ B;  5GXQ C;  5B2J A;  1ID3 A;  3MGP B;  3A1K A;  3WAA B;  3REK D;  1M18 D;  3AZF D;  3AL0 C;  5C3I B;  5C3I C;  4UUZ B;  2JCH A;  5B40 B;  5B40 C;  5BT1 D;  4Z5T D;  3AZM C;  3AZM B;  3VH5 T;  3REK A;  3B0C W;  3REJ D;  3MGR B;  5B1L D;  3MGR C;  1KX3 C;  3AZI B;  3AZI C;  3AZH D;  2ARO A;  2BYM A;  1T3U A;  1P3I C;  2Y2H A;  1P3G D;  1P3I B;  3LEL A;  2JE5 A;  4ZUX D;  4KUD A;  3H0R C;  4NE3 A;  3KWQ C;  4H9P A;  3KWQ B;  5AVB A;  1WWS A;  3KXB B;  1P3G A;  5AY8 A;  5GT3 D;  1P3F B;  4ZUX A;  1HQ3 A;  3KUY D;  4XZQ A;  3A6N D;  4LD9 D;  2CV5 C;  4J8U B;  4J8U C;  4KGC A;  4WU8 A;  3B0B A;  1EQZ A;  1TAF B;  3KUY A;  3W99 D;  3A1I A;  3MVD B;  3A6N A;  5B1M A;  2BYK A;  4LD9 A;  5CP6 B;  5CP6 C;  4H9O B;  3MNN D;  1KX5 D;  3W99 A;  5GSU A;  5BNX A;  3WTP E;  5B33 B;  4QLC D;  2RVQ D;  5E5A D;  3B6F D;  2VQR A;  1KX5 A;  1P3M A;  5AV8 D;  2IO5 B;  4ZBJ C;  4ZBJ B;  5DNM C;  5E5A A;  1P3L A;  2Y2J A;  3X1U C;  5JA4 B;  1BH8 A;  4J8W D;  5B24 D;  5AV8 A;  3VH6 A;  4XUJ C;  4XUJ B;  1U35 C;  1U35 B;  3REL A;  3B6G C;  4JJN D;  1P3B D;  1P3O C;  1P3O B;  4G92 B;  1P3A C;  4J8W A;  2XD1 A;  5AV5 D;  3REI C;  3AZG B;  3WKJ B;  5BNV A;  3AZN D;  5B0Y C;  3TU4 D;  1P3B A;  2FJ7 D;  4KHA A;  3AV2 D;  3LZ0 D;  3AZN A;  3W98 D;  3LJA A;  3TU4 A;  3AZL D;  1TZY D;  1F66 B;  1F66 C;  3F6T A;  4Z66 A;  1S32 D;  3WTP C;  5CPI D;  2XD5 A;  4YM6 C;  1ZLA C;  1ZLA B;  2FFF B;  3AZJ D;  4X23 C;  4X23 B;  3AFA D;  2ZM5 A;  5AV6 B;  3AZL A;  1BH9 B;  4UPK A;  1P3K D;  4YS3 D;  1P34 D;  5G49 B;  5CPI A;  4WNN B;  3AZE C;  3C1B C;  3AZJ A;  5B2I C;  1P3P D;  3AZK D;  3X1T D;  4WU9 B;  4WU9 C;  4H9Q B;  4H9S A;  2HIO A;  3EPH A;  4R8P A;  1BFM A;  1P3K A;  1M1A C;  3REI A;  2NZD A;  2NQB A;  5GT0 B;  5GT0 C;  2F8N B;  3UTB D;  5F99 C;  2ZY2 A;  5F99 B;  4J8V D;  3AZK A;  5KDM A;  5JRG D;  5CPK D;  5B0Z C;  3UT9 D;  3UTA C;  3UTA B;  1B6W A;  3W97 A;  3EPK A;  1PZR A;  2Y2G A;  3AYW A;  1AOI B;  1AOI C;  5CPJ D;  3X1V D;  5B2J D;  1ID3 D;  4J8V A;  5B31 G;  3W96 C;  2BG1 A;  5JRG A;  1M19 C;  1M19 B;  1KX4 D;  2PYO A;  4NE5 A;  4G91 B;  4G91 C;  5CPJ A;  2Y2O A;  5B32 G;  1M18 B;  1M18 C;  3MGP C;  1N1J B;  3AZF C;  3WAA C;  3AZF B;  1KX4 A;  3WA9 D;  4DRA A;  3MGS D;  3VH5 W;  4Z5T B;  4Z5T C;  3C1C A;  2ARO D;  5BO0 A;  3LEL D;  3REJ B;  3REJ C;  3WA9 A;  5B1L B;  5B1L C;  4KUD D;  3MGS A;  3AZH B;  3AZH C;  5AVC D;  3AV1 D;  3X1S B;  3X1S C;  1P3G B;  2RIQ A;  5BS7 A;  4CAY A;  5AVB D;  4ZUX B;  3MGQ D;  5B0Z A;  5AY8 D;  4AWL B;  5B31 A;  1HQ3 D;  3AV1 A;  5AVC A;  4XZQ D;  5GT3 C;  5GT3 B;  2Y2I A;  3MGQ A;  3KXB C;  5B32 A;  3KUY B;  4KGC D;  4WU8 D;  1P3F C;  3EPL A;  1A7W A;  1EQZ D;  5GXQ A;  2BYK B;  4LD9 B;  4J8X C;  4J8X B;  5B1M D;  3H0M C;  1H3O B;  3KSY A;  1KX3 D;  5B40 A;  3AZM A;  2F8N K;  3MVD C;  4HGA C;  4HGA B;  5GSU D;  3VH6 T;  3MNN C;  3MNN B;  1KX5 B;  2DQN C;  3MGR A;  1KX3 A;  3AZI A;  1WWI A;  3KWQ D;  3REH B;  3REH C;  4QLC C;  4QLC B;  1P3M D;  2RVQ C;  1P3I A;  3O62 C;  3O62 B;  5B33 C;  3B6F B;  2YFV B;  3NQU B;  3B6F C;  1P3L D;  4Z2M G;  3KWQ A;  2CV5 D;  2IO5 C;  2YFW B;  5FUG B;  3REL D;  1JFI A;  5B24 C;  5B24 B;  2HUE B;  2CV5 A;  2Y2Q A;  4J8U A;  4JJN B;  3V9R B;  4JJN C;  1P3B B;  1TAF A;  3AN2 B;  3AN2 C;  4G92 C;  5AV5 C;  5AV5 B;  3NQJ B;  4WV4 B;  2Y2L A;  5CP6 A;  1W2E A;  3AZG C;  4H9O A;  3TU4 B;  3WKJ C;  2FJ7 B;  5DNN B;  5DNN C;  3LJA D;  4Z2M H;  3AV2 B;  3AV2 C;  1HTA A;  3LZ0 B;  3LZ0 C;  4Z66 D;  5B33 A;  5DNM D;  3W98 B;  3W98 C;  1TZY B;  1TZY C;  3X1U D;  1S32 B;  1S32 C;  5CPI B;  5DNM A;  3AZJ B;  3AFA C;  3AFA B;  3B6G D;  5AV6 C;  3X1U A;  5JA4 A;  4YS3 C;  4DQY B;  4YS3 B;  1P3A D;  1P3K B;  1P34 B;  2HIO D;  1P34 C;  4R8P D;  3LZ1 B;  3LZ1 C;  3REI D;  4XUJ A;  3B0D C;  3B0D B;  1P3P B;  5AV9 C;  5AV9 B;  3AZK B;  3X1T C;  3X1T B;  1U35 A;  2NQB D;  5B0Y D;  2NZD D;  5KDM B;  3B6G A;  1P3O A;  1P3A A;  4H9R B;  3W97 D;  3UTB B;  3UTB C;  3AYW D;  4H9N A;  5B0Y A;  5JRG B;  2F2A C;  5CPK B;  5CPK C;  3UT9 B;  1F66 D;  3R45 B;  2F8N G;  2Y2K A;  2PYO D;  3X1V B;  3WTP D;  5CPJ B;  5B2J C;  5B2J B;  1ID3 C;  4YM6 D;  1ID3 B;  1KX4 B;  1F66 A;  3WTP A;  3C1C D;  4YM6 A;  2Y2P A;  3AZE D;  1ZLA A;  3C1B D;  4X23 A;  5B2I D;  3REK B;  3REK C;  1M1A D;  5CHL B;  5BT1 C;  4WNN A;  3AZE A;  2ARO C;  2ARO B;  4E45 A;  3C1B A;  2BYM B;  5B2I A;  4WU9 A;  3EPJ A;  3LEL B;  4H9Q A;  2F8N H;  5B0Z D;  4KUD B;  4KUD C;  3AV1 B;  1M1A A;  5B31 D;  4H9P B;  5GT0 A;  2F8N A;  5AVB C;  5AVB B;  5F99 A;  3MGQ B;  1P3G C;  3W96 D;  5AY8 C;  5AY8 B;  4ZUX C;  1HQ3 C;  1HQ3 B;  2Y2M A;  5B32 D;  3UTA A;  4AWL C;  4XZQ B;  4XZQ C;  1AOI A;  5GXQ D;  2ZY3 A;  3MGP D;  3W96 A;  4KGC B;  4KGC C;  1M19 A;  4WU8 B;  4WU8 C;  3WAA D;  1EQZ C;  1EQZ B;  3KUY C;  3A6N C;  5B1M B;  5B1M C;  4CSR A;  5B40 D;  3A6N B;  4LD9 C;  3AZM D;  2LY8 A;  1M18 A;  3MGP A;  1N1J A;  3AZF A;  3WAA A;  1KX3 B;  3W99 C;  4Z5T A;  3W99 B;  4UUZ A;  2Y2N A;  3MGR D;  3FDD A;  5GSU B;  3VH6 W;  5BNX B;  5GSU C;  3AZI D;  3X1S D;  3B0C T;  1P3I D;  3REJ A;  5B1L A;  1KX5 C;  3AZH A;  1B67 A;  4EO5 C;  4EO5 B;  1P3M B;  1P3M C;  3X1S A;  1KU5 A;  5E5A C;  5E5A B;  3KXB D;  1P3L B;  1P3L C;  1JFI B;  1P3F D;  1BH8 B;  3VH5 A;  4J8X D;  2CV5 B;  5AV8 B;  5AV8 C;  5GT3 A;  2ZY4 A;  3KXB A;  3REL B;  3REL C;  4J8U D;  1P3F A;  4J8W B;  4J8W C;  2G5H C;  3MVD D;  4J8X A;  2HUE C;  5BNV B;  5CP6 D;  3EG5 B;  1H3O A;  1P3B C;  4KHA B;  3MVD A;  1ULY A;  3REH D;  3O62 D;  5B33 D;  3AZN B;  3AZN C;  2CWE A;  3LJA B;  3LJA C;  3MNN A;  3TU4 C;  2FJ7 C;  4Z66 B;  4Z66 C;  5DNM B;  3REH A;  4QLC A;  2L5A A;  3B6F A;  3O62 A;  2YFV A;  3NQU A;  4M6B A;  3X1U B;  3AZL B;  3AZL C;  1R4V A;  4E44 A;  4WZS B;  5CPI C;  2UWX A;  4XUJ D;  3AZJ C;  3B6G B;  2YFW A;  5FUG A;  1U35 D;  1P3A B;  2JSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...