3AFCA

Mouse semaphorin 6a extracellular domain
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
550
structure length
534
Chain Sequence
b'GFPEDSEPISISHGNYTKQYPVFVGHKHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-6A
molecule tags Signaling protein
source organism Mus musculus
publication title Structural basis for semaphorin signalling through the plexin receptor.
pubmed doi rcsb
total genus 132
structure length 534
sequence length 550
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3afcA01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3afcA02
4A0AA 3FRXA 4CY5A 3C5MA 5C2VB 4Z7OB 3MXXA 4FA4D 2CO0C 5TDHB 1PBYB 4TZ4A 3PVWB 5CXCB 3RSEC 2YBAA 3AH8B 2VDPB 4IA9A 4CC9A 3V9FA 4Z7NB 3L4OD 3NVQA 5IT9g 4LGNA 2H6NA 3ULEC 3RN1D 3J81g 2UZYB 2PBIB 2Q7QA 4A09B 4U1EI 4PNKB 3EI4B 2W18A 5SXMA 4QQEA 3NVNA 4A7JA 4CY2A 4BL0A 2H9PA 3KRWB 4FHLA 3EI4A 5IJ8E 1JJUB 3EI3A 3OKYB 1NR0A 4O3UB 4A0AB 3OL2B 2GC4A 3IIWA 4AEZA 3UVKA 4WK4B 4X61B 5GXIA 5GXHA 3OKYA 3UKUC 3PVUB 4L3HD 5HE0B 2H47A 1Q47A 3DXMC 1SSLA 4XEIC 5HE1B 5TEFA 2AGYA 4X3EA 1YFQA 3VGZA 4J8BA 3MKQA 3RMZD 2BBKH 2XYIA 3MZLA 4PBZA 4A09A 3CIKB 3FCUB 2TRCB 3C75H 4J0WA 2CO0A 2HXCA 3I89A 3BWSA 4PC0A 2IUVA 2YNNA 5EALA 5H17A 4JSXC 5H14A 3VI3B 1OMWB 3T3MB 2OK6A 5IGOA 3ORVD 3JZNA 4GGAA 4LG9A 2CN3A 1S4UX 1U8CB 3I2NA 4H5IA 3FM0A 5FKQA 4X60B 5I5IA 3EI1B 2H9MA 2CNXA 4O1QD 3F3FA 5KDOB 3SJLD 3W15A 5CXBA 4L3GD 3PXWD 4HDJA 5EAPA 5E6UB 3OW8A 4UI9R 3UVMA 4J77A 4JD2C 4O9DA 3JAMg 3ZDYB 1JMZB 2B5NA 3E0CA 5I5MA 1MG2A 4NSXA 4EWRA 4J0XA 2I0TA 1FWXA 5AFU3 2I3TA 5CYKA 3MMYA 2AGZA 4KFMB 4AOWA 3EI2A 2VDKB 2AGXA 2P26A 1XIPA 1N6DA 2QC5A 2HYEA 4O45A 2H9NA 5IGQA 3UR4A 2P9UC 2B5LA 1U2VC 3C9CA 3ZWLB 2H13A 1QNIA 3DSMA 3RN0D 3SFZA 3I7HA 5IC7A 2P9KC 5FKRA 4JT5C 2IURA 2VDQB 2H68A 1GG2B 2GNQA 2Z2OA 4A11B 4CZXA 2H14A 4J84A 2OIZA 2P9SC 5C2WB 4D6VA 2BCJB 4ES0A 2AQ5A 5GMKn 4IMMA 3KRXB 2G99A 4J79A 5EMMB 4J87A 4BUJC 4FWWA 2PM9B 3SBPA 5AJAA 2Z2PA 5EM2B 3HFQA 3SVWD 3I7PA 4XYHA 3EU7A 2XL2A 2HKMA 2VDLB 1ERJA 3IIYA 2G9AA 4J86A 3FGBA 2VDOB 5HE3B 2O9KA 3K26A 3P4FA 3T3PB 2OK4A 4A0BA 4J81A 4ERZA 4WK0B 2OJYA 4E54B 2CN2A 4K3ID 4FAND 2IWKA 4L1QD 3JB9L 4CI3A 4GQ1A 1PGUA 2VDRB 3UVNA 3SHFA 2PM7B 3I7NA 3DXKC 1SQ9A 5AMSA 1K32A 5EMJB 1TBGA 3AL8B 5HDBB 2P9NC 4GZ8A 1JOFA 4R7AB 4QRJA 3V5WB 2IUQA 3N0DA 4CY1A 3L4MD 4FB1D 2P28A 4JSPC 4UM9D 3I7LA 5HQGA 4I79A 3EI3B 3C99A 3CFVA 2VDNB 1N6FA 2IAAA 3JPXA 5FA5B 4OWRA 4ZOXA 4A11A 1B9YA 5FXYA 3JZGA 2EBSA 2H6KA 1GXRA 3UVOA 3SXTD 1A0RB 3IKOA 4ZOYA 4YVDA 4J8GA 2IUPA 4K3JB 4O3TB 4A0BB 4Z7QB 3ODTA 3V7DB 3OKWA 2I0SA 2PM9A 4GQBB 3GFCA 2J55H 5B4WA 3DWLC 4GMBA 4ERYA 5C9ZB 4GGDA 4UM8B 3IJCA 3EI2B 1OLZA 3N0EA 2CE8A 2XL3A 4WJKB 2PM6B 4Y7RA 3DM0A 5EMKB 5HE2B 3ZE1B 2QXVA 2I0RA 2P9LC 3PSLA 4LG8A 4D0KA 4A2MA 2OVPB 3OL2A 2XU7A 4Y5RD 3EMHA 4E5ZB 4ZOZA 5GSAA 5K1CC 4JSNC 5I5JA 5TEEA 5FLXg 3RRMC 3OKTA 2Z2NA 3I7KA 4FA9D 4BH6A 2P9IC 4CY3A 3I8CA 3NVXA 1JMXB 4H5JA 2P9PC 3BG1A 4MK0B 3NIDB 3SMRA 3SLED 5K19A 1U4CA 3IJ0A 1GOTB 3PXTD 3UKRC 3BG0A 5HYNB 3AL8A 4E54A 4ERQA 4FA5D 3J80g 5FKSA 1B9XA 4CZVA 4CI8A 3I7OA 2H6QA 5H1MA 5E6RB 4L9OA 4FA1D 2I3SA 1MDAH 2VC2B 4J73A 4Z8LA 4A08B 2H9LA 4PSWB 3RFGA 2H3XA 2VDMB 4GM8A 5CXCA 4QL1A 1VYHC 2AGWA 3ZDZB 1N6EA 4A08A 4X63B 3PXSD 5FKTA 3IJ1A 4G56B 4J82A 1SQJA 4JT6C 5THAA 3JZHA 4ZN4A 4CZYA 2AH1A 5EAMA 4CI2A 1XKSA 5FQDA 2HJBA 4JXMA 3JRPA 3SBQA 2HKRA 4ZOVA 2YNOA 5JWZA 3SBRA 3RFHA 2UZXB 1YUKA 3UVLA 3SWSD 4CI1A 3AL9A 3F3GA 1XHMA 4FAVD 1K8KC 5TF2A 3ZE2B 1R5MA 3VA6A 1RI6A 3MZKA 3SCYA 4GM9A 2GC7A 2AH0A 3EG6A 5EM2A 3A0FA 5E6SB 4A2LA 5EMLB 2IWFA 3NIFB 2YMUA 3NIGB 4E5ZA 2AGLA 5A2Qg 4PBYA 2YNPA 2HESX 3PE7A 4WK2B 2OVQB 4ESGA 5EARA 3AFCA 2B4EA 3SN6B 1L0QA 3K27A 3MKSB 3VI4B 3F3PA 3GREA 1PI6A 3PSCB 4QT8A 1MG3A 3RLMD 4XYIA 5IJ7E 4GQ2P 1P22A 2YB8B 3JROA 1NEXB 3CFSB 3OTTA 1GP2B 3ZDXB 4GGCA 4J78A 2HJ4A 4U7AA 2J57G 1TYQC 2MTAH 2J56H 3I8EA 3EI1A 1TYEB 4JSVC 1PEVA 2OVRB 5CYKB 3U4YA 4PXWA 3VH0A 3EWEA 4UM9B 4GM3A 1SHYB 5CXBB 3ZE0B 2B5MA 4N14A 4OZUA 2CE9A 4PSXB 3B7FA
chains in the Genus database with same CATH superfamily
3ZDXA 1A12A 4A0AA 4AX4A 3FRXA 4CY5A 3C5MA 5C2VB 4Z7OB 3MXXA 3GD1I 4FA4D 2CO0C 5TDHB 1PBYB 4TZ4A 2EICA 3FCUA 3PVWB 5CXCB 2YBAA 3AH8B 3RSEC 4IA9A 4CC9A 2VDPB 3V9FA 4Z7NB 3L4OD 3NVQA 3V4PA 5M61A 2WQ8A 5IT9g 4LGNA 5C86A 2H6NA 3ULEC 3RN1D 1I2MB 2EIDA 3J81g 2UZYB 2PBIB 2Q7QA 4A09B 4U1EI 4PNKB 3EI4B 2W18A 5SXMA 3T3MA 3K6SA 4QQEA 3NVNA 4A7JA 4CY2A 4BL0A 2H9PA 3KRWB 4FHLA 4AMYA 3EI4A 5IJ8E 1JJUB 3EI3A 2EIEA 3OKYB 1NR0A 4O3UB 4A0AB 3OL2B 3IUJA 2GC4A 4D9SA 1TYEA 4NENA 3IIWA 4AEZA 3UVKA 4WK4A 4WK4B 4X61B 5GXIA 5GXHA 3OKYA 3UKUC 3ZE0A 3PVUB 4L3HD 5HE0B 2H47A 1Q47A 3DXMC 1SSLA 4XEIC 5HE1B 1M1XA 5TEFA 2EIBA 1VE7A 2AGYA 3EQ9A 3T3PA 4X3EA 1YFQA 3VGZA 4J8BA 3MKQA 3RMZD 2BBKH 2XYIA 3MZLA 4PBZA 3VI3A 4A09A 3VI4A 3CIKB 2JWHA 3FCUB 2TRCB 3C75H 4J0WA 2CO0A 2HXCA 4NAAA 3I89A 1K3IA 3BWSA 4G1MA 4PC0A 2IUVA 2YNNA 5EALA 4O02A 5H17A 4JSXC 5H14A 3VI3B 2VDOA 1OMWB 3K71A 5FFOA 3T3MB 2QZPA 2OK6A 3O4GA 3IVMA 5IGOA 3ORVD 3JZNA 4GGAA 4LG9A 2CN3A 1S4UX 4NBMA 1U8CB 2VDQA 3I2NA 3FM0A 4H5IA 4X60B 5FKQA 5I5IA 3EI1B 2H9MA 2CNXA 4O2WA 4O1QD 3F3FA 5KDOB 1UTCA 3SJLD 3W15A 4QAMA 5FFGA 5CXBA 4L3GD 3IULA 3PXWD 4HDJA 5EAPA 5E6UB 3OW8A 1H2YA 4UI9R 3UVMA 4J77A 3MVDK 4JD2C 4O9DA 3JAMg 3ZDYB 1JMZB 2B5NA 3E0CA 4Z7OA 5I5MA 1MG2A 3ZE2A 4NSXA 4EWRA 4J0XA 2I0TA 1FWXA 5AFU3 2XDWA 2I3TA 5CYKA 3MMYA 2AGZA 4KFMB 4AOWA 1JTDB 3EI2A 2VDKB 1GOFA 2AGXA 2P26A 3FCSA 1XIPA 3IUNA 3IJEA 1N6DA 2QC5A 2HYEA 4O45A 2H9NA 5IGQA 4WK2A 2P9UC 2B5LA 3UR4A 1U2VC 3C9CA 3ZWLB 1O6GA 2H13A 1QNIA 3DSMA 3NIGA 3RN0D 2VDKA 3SFZA 3I7HA 4DNWA 5IC7A 2P9KC 4MMXA 5FKRA 4JT5C 2IURA 2VDQB 1GG2B 2H68A 2GNQA 2Z2OA 4A11B 4CZXA 2H14A 4DNUA 4J84A 2OIZA 2P9SC 5C2WB 1C9IA 4D6VA 2BCJB 4ES0A 2AQ5A 5GMKn 4IMMA 1C9LA 3KRXB 2G99A 4J79A 5M5VA 5EMMB 5E6UA 4J87A 4BUJC 4FWWA 2PM9B 4JHNA 3SBPA 5AJAA 2Z2PA 5EM2B 3HFQA 3SVWD 1E8NA 3I7PA 4XYHA 3EU7A 2XL2A 2HKMA 2VDLB 1ERJA 3IIYA 4JHPC 2G9AA 4J86A 3FGBA 2HU8A 2VDOB 5HE3B 1UOPA 2HU5A 2O9KA 1VZ2A 3P4FA 3K26A 3T3PB 2OK4A 4A0BA 4J81A 4ERZA 4WK0B 1UOOA 2OJYA 4E54B 2CN2A 4K3ID 4FAND 2IWKA 4L1QD 2JKXA 3JB9L 4CI3A 4GQ1A 4PSXB 1PGUA 2VDPA 2VDRB 3ZDYA 3UVNA 3SHFA 2PM7B 3I7NA 3DXKC 1SQ9A 5AMSA 1K32A 4MMZA 5EMJB 1TBGA 3AL8B 5HDBB 3OF7A 2P9NC 4GZ8A 1JOFA 3MUNA 4R7AB 4BCCA 4QRJA 3V5WB 2IUQA 4UM9A 3N0DA 4CY1A 2VDMA 1JV2A 3L4MD 4FB1D 2P28A 3IUQA 2HU7A 4JSPC 4DNVA 4UM9D 3I7LA 5HQGA 3DDUA 4I79A 3EI3B 3C99A 3CFVA 2VDNB 1N6FA 2IAAA 3JPXA 5FA5B 4OWRA 4ZOXA 4A11A 1B9YA 5FXYA 3JZGA 2EBSA 2VZ3A 2H6KA 1GXRA 3UVOA 3SXTD 1A0RB 3IKOA 3QI0A 4ZOYA 4YVDA 4BCBA 4J8GA 2IUPA 1YR2A 3EQ7A 4K3JB 4O3TB 4A0BB 4Z7QB 3ODTA 3V7DB 4Z7NA 3OKWA 2I0SA 2PM9A 1H2WA 4GQBB 2VDNA 3GFCA 2J55H 4MMYA 5B4WA 3DWLC 4GMBA 4ERYA 5C9ZB 4GGDA 4UM8B 4UM8A 3IJCA 1E8MA 1O6FA 3EI2B 1OLZA 3N0EA 2CE8A 2XL3A 1BPOA 4WJKB 2PM6B 4Y7RA 3DM0A 5EMKB 5HE2B 3ZE1B 1GOGA 2QXVA 2I0RA 2P9LC 3PSLA 4LG8A 1E5TA 3ZDZA 4D0KA 4A2MA 2OVPB 3OL2A 2XU7A 4Y5RD 3EMHA 4E5ZB 4ZOZA 5GSAA 5K1CC 4JSNC 5I5JA 5TEEA 5FLXg 3RRMC 3NIDA 3OKTA 2Z2NA 4WK0A 3I7KA 4FA9D 2QR5A 2P9IC 4BH6A 3IUMA 4CY3A 3I8CA 5E6RA 3NVXA 1JMXB 4BP9A 4H5JA 2P9PC 3BG1A 3MUOA 4MK0B 4AN0A 3NIDB 3SMRA 3SLED 5K19A 1U4CA 3IJ0A 1GOTB 3PXTD 3UKRC 3BG0A 4Z7QA 5HYNB 3AL8A 4E54A 4ERQA 4FA5D 3J80g 2VDLA 5FKSA 1B9XA 4CZVA 4CI8A 3I7OA 2H6QA 3O4HA 2VDRA 5H1MA 5E6RB 1VE6A 4L9OA 4FA1D 1QFMA 1QFSA 2I3SA 3GC3B 1MDAH 2VC2B 4J73A 4Z8LA 4A08B 2H9LA 4PSWB 5HDBA 3RFGA 4AN1A 2H3XA 2VDMB 4GM8A 5CXCA 4QL1A 1VYHC 2AGWA 4RE6A 3ZDZB 1N6EA 4A08A 3NIFA 1H2ZA 3PXSD 4X63B 5FKTA 3IJ1A 4G56B 1SQJA 4JT6C 4IRZA 5THAA 3JZHA 4ZN4A 4CZYA 2AH1A 4BCDA 5EAMA 4CI2A 1XKSA 5FQDA 2HJBA 3O4IA 4JXMA 3JRPA 1GOHA 4RE5A 3SBQA 2HKRA 4ZOVA 2YNOA 5JWZA 3SBRA 3RFHA 2UZXB 1YUKA 2BKLA 2XE4A 1VZ3A 3UVLA 3SWSD 4CI1A 3AL9A 3F3GA 1XHMA 4FAVD 1K8KC 5TF2A 3QHYB 5E6SA 3KCIA 1R5MA 3ZE2B 3VA6A 3ZE1A 1RI6A 3MZKA 3SCYA 4GM9A 2GC7A 2AH0A 3EG6A 2XZGA 4AMZA 5EM2A 3A0FA 5M5SA 4A2LA 5EMLB 2IWFA 3NIFB 2YMUA 5E6SB 3NIGB 4E5ZA 5M5TA 2AGLA 5A2Qg 4L1MA 4PBYA 2YNPA 2HESX 3PE7A 3EQ8A 3O4JA 4NC4A 1L5GA 4WK2B 2OVQB 4ESGA 5EARA 1UOQA 3AFCA 4G1EA 2B4EA 4WJKA 3SN6B 1L0QA 3K27A 3MKSB 3K72A 5M5UA 3VI4B 1T2XA 3F3PA 3GREA 1U8CA 1PI6A 3PSCB 2VZ1A 4QT8A 1MG3A 3RLMD 3V4VA 4XYIA 5IJ7E 4GQ2P 1P22A 2YB8B 3IURA 1NEXB 3JROA 3CFSB 3OTTA 1GP2B 5C92A 3ZDXB 4GGCA 4J78A 5M5RA 2HJ4A 4U7AA 2J57G 2VC2A 1TYQC 1H2XA 4BP8A 2MTAH 2J56H 3I8EA 3EI1A 1TYEB 4JSVC 1PEVA 2OVRB 5CYKB 3U4YA 4PXWA 3VH0A 3EWEA 2JWGA 4UM9B 4GM3A 1SHYB 5CXBB 3ZE0B 2B5MA 4G55A 4N14A 4OZUA 2CE9A 4J82A 3B7FA
chains in the Genus database with same CATH topology
4A0AA 3FRXA 4CY5A 3C5MA 5C2VB 4Z7OB 3MXXA 4FA4D 2CO0C 5TDHB 1PBYB 4TZ4A 3PVWB 5CXCB 3RSEC 2YBAA 3AH8B 2VDPB 4IA9A 4CC9A 3V9FA 4Z7NB 3L4OD 3NVQA 5IT9g 4LGNA 2H6NA 3ULEC 3RN1D 3J81g 2UZYB 2PBIB 2Q7QA 4A09B 4U1EI 4PNKB 3EI4B 2W18A 5SXMA 4QQEA 3NVNA 4A7JA 4CY2A 4BL0A 2H9PA 3KRWB 4FHLA 3EI4A 5IJ8E 1JJUB 3EI3A 3OKYB 1NR0A 4O3UB 4A0AB 3OL2B 2GC4A 3IIWA 4AEZA 3UVKA 4WK4B 4X61B 5GXIA 5GXHA 3OKYA 3UKUC 3PVUB 4L3HD 5HE0B 2H47A 1Q47A 3DXMC 1SSLA 4XEIC 5HE1B 5TEFA 2AGYA 4X3EA 1YFQA 3VGZA 4J8BA 3MKQA 3RMZD 2BBKH 2XYIA 3MZLA 4PBZA 4A09A 3CIKB 2JWHA 3FCUB 2TRCB 3C75H 4J0WA 2CO0A 2HXCA 3I89A 3BWSA 4PC0A 2IUVA 2YNNA 5EALA 5H17A 4JSXC 5H14A 3VI3B 1OMWB 3T3MB 2OK6A 5IGOA 3ORVD 3JZNA 4GGAA 4LG9A 2CN3A 1S4UX 1U8CB 3I2NA 4H5IA 3FM0A 5FKQA 4X60B 5I5IA 3EI1B 2H9MA 2CNXA 4O1QD 3F3FA 5KDOB 3SJLD 3W15A 5CXBA 4L3GD 3PXWD 4HDJA 5EAPA 5E6UB 3OW8A 4UI9R 3UVMA 4J77A 4JD2C 4O9DA 3JAMg 3ZDYB 1JMZB 2B5NA 3E0CA 5I5MA 1MG2A 4NSXA 4EWRA 4J0XA 2I0TA 1FWXA 5AFU3 2I3TA 5CYKA 3MMYA 2AGZA 4KFMB 4AOWA 3EI2A 2VDKB 2AGXA 2P26A 1XIPA 1N6DA 2QC5A 2HYEA 4O45A 2H9NA 5IGQA 3UR4A 2P9UC 2B5LA 1U2VC 3C9CA 3ZWLB 2H13A 1QNIA 3DSMA 3RN0D 3SFZA 3I7HA 5IC7A 2P9KC 5FKRA 4JT5C 2IURA 2VDQB 2H68A 1GG2B 2GNQA 2Z2OA 4A11B 4CZXA 2H14A 4J84A 2OIZA 2P9SC 5C2WB 4D6VA 2BCJB 4ES0A 2AQ5A 5GMKn 4IMMA 3KRXB 2G99A 4J79A 5EMMB 4J87A 4BUJC 4FWWA 2PM9B 3SBPA 5AJAA 2Z2PA 5EM2B 3HFQA 3SVWD 3I7PA 4XYHA 3EU7A 2XL2A 2HKMA 2VDLB 1ERJA 3IIYA 2G9AA 4J86A 3FGBA 2VDOB 5HE3B 2O9KA 3K26A 3P4FA 3T3PB 2OK4A 4A0BA 4J81A 4ERZA 4WK0B 2OJYA 4E54B 2CN2A 4K3ID 4FAND 2IWKA 4L1QD 3JB9L 4CI3A 4GQ1A 1PGUA 2VDRB 3UVNA 3SHFA 2PM7B 3I7NA 3DXKC 1SQ9A 5AMSA 1K32A 5EMJB 1TBGA 3AL8B 5HDBB 2P9NC 4GZ8A 1JOFA 4R7AB 4QRJA 3V5WB 2IUQA 3N0DA 4CY1A 3L4MD 4FB1D 2P28A 4JSPC 4UM9D 3I7LA 5HQGA 4I79A 3EI3B 3C99A 3CFVA 2VDNB 1N6FA 2IAAA 3JPXA 5FA5B 4OWRA 4ZOXA 4A11A 1B9YA 5FXYA 3JZGA 2EBSA 2H6KA 1GXRA 3UVOA 3SXTD 1A0RB 3IKOA 4ZOYA 4YVDA 4J8GA 2IUPA 4K3JB 4O3TB 4A0BB 4Z7QB 3ODTA 3V7DB 3OKWA 2I0SA 2PM9A 4GQBB 3GFCA 2J55H 5B4WA 3DWLC 4GMBA 4ERYA 5C9ZB 4GGDA 4UM8B 3IJCA 3EI2B 1OLZA 3N0EA 2CE8A 2XL3A 4WJKB 2PM6B 4Y7RA 3DM0A 5EMKB 5HE2B 3ZE1B 2QXVA 2I0RA 2P9LC 3PSLA 4LG8A 4D0KA 4A2MA 2OVPB 3OL2A 2XU7A 4Y5RD 3EMHA 4E5ZB 4ZOZA 5GSAA 5K1CC 4JSNC 5I5JA 5TEEA 5FLXg 3RRMC 3OKTA 2Z2NA 3I7KA 4FA9D 4BH6A 2P9IC 4CY3A 3I8CA 3NVXA 1JMXB 4H5JA 2P9PC 3BG1A 4MK0B 3NIDB 3SMRA 3SLED 5K19A 1U4CA 3IJ0A 1GOTB 3PXTD 3UKRC 3BG0A 5HYNB 3AL8A 4E54A 4ERQA 4FA5D 3J80g 5FKSA 1B9XA 4CZVA 4CI8A 3I7OA 2H6QA 5H1MA 5E6RB 4L9OA 4FA1D 2I3SA 1MDAH 2VC2B 4J73A 4Z8LA 4A08B 2H9LA 4PSWB 3RFGA 2H3XA 2VDMB 4GM8A 5CXCA 4QL1A 1VYHC 2AGWA 3ZDZB 1N6EA 4A08A 4X63B 3PXSD 5FKTA 3IJ1A 4G56B 4J82A 1SQJA 4JT6C 5THAA 3JZHA 4ZN4A 4CZYA 2AH1A 5EAMA 4CI2A 1XKSA 5FQDA 2HJBA 4JXMA 3JRPA 3SBQA 2HKRA 4ZOVA 2YNOA 5JWZA 3SBRA 3RFHA 2UZXB 1YUKA 3UVLA 3SWSD 4CI1A 3AL9A 3F3GA 1XHMA 4FAVD 1K8KC 5TF2A 3ZE2B 1R5MA 3VA6A 1RI6A 3MZKA 3SCYA 4GM9A 2GC7A 2AH0A 3EG6A 5EM2A 3A0FA 5E6SB 4A2LA 5EMLB 2IWFA 3NIFB 2YMUA 3NIGB 4E5ZA 2AGLA 5A2Qg 4PBYA 2YNPA 2HESX 3PE7A 4WK2B 2OVQB 4ESGA 5EARA 3AFCA 2B4EA 3SN6B 1L0QA 3K27A 3MKSB 3VI4B 3F3PA 3GREA 1PI6A 3PSCB 4QT8A 1MG3A 3RLMD 4XYIA 5IJ7E 4GQ2P 1P22A 2YB8B 3JROA 1NEXB 3CFSB 3OTTA 1GP2B 3ZDXB 4GGCA 4J78A 2HJ4A 4U7AA 2J57G 1TYQC 2MTAH 2J56H 3I8EA 3EI1A 1TYEB 4JSVC 1PEVA 2OVRB 5CYKB 3U4YA 4PXWA 3VH0A 3EWEA 2JWGA 4UM9B 4GM3A 1SHYB 5CXBB 3ZE0B 2B5MA 4N14A 4OZUA 2CE9A 4PSXB 3B7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0A A;  3FRX A;  4CY5 A;  3C5M A;  5C2V B;  4Z7O B;  3MXX A;  4FA4 D;  2CO0 C;  5TDH B;  1PBY B;  4TZ4 A;  3PVW B;  5CXC B;  3RSE C;  2YBA A;  3AH8 B;  2VDP B;  4IA9 A;  4CC9 A;  3V9F A;  4Z7N B;  3L4O D;  3NVQ A;  5IT9 g;  4LGN A;  2H6N A;  3ULE C;  3RN1 D;  3J81 g;  2UZY B;  2PBI B;  2Q7Q A;  4A09 B;  4U1E I;  4PNK B;  3EI4 B;  2W18 A;  5SXM A;  4QQE A;  3NVN A;  4A7J A;  4CY2 A;  4BL0 A;  2H9P A;  3KRW B;  4FHL A;  3EI4 A;  5IJ8 E;  1JJU B;  3EI3 A;  3OKY B;  1NR0 A;  4O3U B;  4A0A B;  3OL2 B;  2GC4 A;  3IIW A;  4AEZ A;  3UVK A;  4WK4 B;  4X61 B;  5GXI A;  5GXH A;  3OKY A;  3UKU C;  3PVU B;  4L3H D;  5HE0 B;  2H47 A;  1Q47 A;  3DXM C;  1SSL A;  4XEI C;  5HE1 B;  5TEF A;  2AGY A;  4X3E A;  1YFQ A;  3VGZ A;  4J8B A;  3MKQ A;  3RMZ D;  2BBK H;  2XYI A;  3MZL A;  4PBZ A;  4A09 A;  3CIK B;  3FCU B;  2TRC B;  3C75 H;  4J0W A;  2CO0 A;  2HXC A;  3I89 A;  3BWS A;  4PC0 A;  2IUV A;  2YNN A;  5EAL A;  5H17 A;  4JSX C;  5H14 A;  3VI3 B;  1OMW B;  3T3M B;  2OK6 A;  5IGO A;  3ORV D;  3JZN A;  4GGA A;  4LG9 A;  2CN3 A;  1S4U X;  1U8C B;  3I2N A;  4H5I A;  3FM0 A;  5FKQ A;  4X60 B;  5I5I A;  3EI1 B;  2H9M A;  2CNX A;  4O1Q D;  3F3F A;  5KDO B;  3SJL D;  3W15 A;  5CXB A;  4L3G D;  3PXW D;  4HDJ A;  5EAP A;  5E6U B;  3OW8 A;  4UI9 R;  3UVM A;  4J77 A;  4JD2 C;  4O9D A;  3JAM g;  3ZDY B;  1JMZ B;  2B5N A;  3E0C A;  5I5M A;  1MG2 A;  4NSX A;  4EWR A;  4J0X A;  2I0T A;  1FWX A;  5AFU 3;  2I3T A;  5CYK A;  3MMY A;  2AGZ A;  4KFM B;  4AOW A;  3EI2 A;  2VDK B;  2AGX A;  2P26 A;  1XIP A;  1N6D A;  2QC5 A;  2HYE A;  4O45 A;  2H9N A;  5IGQ A;  3UR4 A;  2P9U C;  2B5L A;  1U2V C;  3C9C A;  3ZWL B;  2H13 A;  1QNI A;  3DSM A;  3RN0 D;  3SFZ A;  3I7H A;  5IC7 A;  2P9K C;  5FKR A;  4JT5 C;  2IUR A;  2VDQ B;  2H68 A;  1GG2 B;  2GNQ A;  2Z2O A;  4A11 B;  4CZX A;  2H14 A;  4J84 A;  2OIZ A;  2P9S C;  5C2W B;  4D6V A;  2BCJ B;  4ES0 A;  2AQ5 A;  5GMK n;  4IMM A;  3KRX B;  2G99 A;  4J79 A;  5EMM B;  4J87 A;  4BUJ C;  4FWW A;  2PM9 B;  3SBP A;  5AJA A;  2Z2P A;  5EM2 B;  3HFQ A;  3SVW D;  3I7P A;  4XYH A;  3EU7 A;  2XL2 A;  2HKM A;  2VDL B;  1ERJ A;  3IIY A;  2G9A A;  4J86 A;  3FGB A;  2VDO B;  5HE3 B;  2O9K A;  3K26 A;  3P4F A;  3T3P B;  2OK4 A;  4A0B A;  4J81 A;  4ERZ A;  4WK0 B;  2OJY A;  4E54 B;  2CN2 A;  4K3I D;  4FAN D;  2IWK A;  4L1Q D;  3JB9 L;  4CI3 A;  4GQ1 A;  1PGU A;  2VDR B;  3UVN A;  3SHF A;  2PM7 B;  3I7N A;  3DXK C;  1SQ9 A;  5AMS A;  1K32 A;  5EMJ B;  1TBG A;  3AL8 B;  5HDB B;  2P9N C;  4GZ8 A;  1JOF A;  4R7A B;  4QRJ A;  3V5W B;  2IUQ A;  3N0D A;  4CY1 A;  3L4M D;  4FB1 D;  2P28 A;  4JSP C;  4UM9 D;  3I7L A;  5HQG A;  4I79 A;  3EI3 B;  3C99 A;  3CFV A;  2VDN B;  1N6F A;  2IAA A;  3JPX A;  5FA5 B;  4OWR A;  4ZOX A;  4A11 A;  1B9Y A;  5FXY A;  3JZG A;  2EBS A;  2H6K A;  1GXR A;  3UVO A;  3SXT D;  1A0R B;  3IKO A;  4ZOY A;  4YVD A;  4J8G A;  2IUP A;  4K3J B;  4O3T B;  4A0B B;  4Z7Q B;  3ODT A;  3V7D B;  3OKW A;  2I0S A;  2PM9 A;  4GQB B;  3GFC A;  2J55 H;  5B4W A;  3DWL C;  4GMB A;  4ERY A;  5C9Z B;  4GGD A;  4UM8 B;  3IJC A;  3EI2 B;  1OLZ A;  3N0E A;  2CE8 A;  2XL3 A;  4WJK B;  2PM6 B;  4Y7R A;  3DM0 A;  5EMK B;  5HE2 B;  3ZE1 B;  2QXV A;  2I0R A;  2P9L C;  3PSL A;  4LG8 A;  4D0K A;  4A2M A;  2OVP B;  3OL2 A;  2XU7 A;  4Y5R D;  3EMH A;  4E5Z B;  4ZOZ A;  5GSA A;  5K1C C;  4JSN C;  5I5J A;  5TEE A;  5FLX g;  3RRM C;  3OKT A;  2Z2N A;  3I7K A;  4FA9 D;  4BH6 A;  2P9I C;  4CY3 A;  3I8C A;  3NVX A;  1JMX B;  4H5J A;  2P9P C;  3BG1 A;  4MK0 B;  3NID B;  3SMR A;  3SLE D;  5K19 A;  1U4C A;  3IJ0 A;  1GOT B;  3PXT D;  3UKR C;  3BG0 A;  5HYN B;  3AL8 A;  4E54 A;  4ERQ A;  4FA5 D;  3J80 g;  5FKS A;  1B9X A;  4CZV A;  4CI8 A;  3I7O A;  2H6Q A;  5H1M A;  5E6R B;  4L9O A;  4FA1 D;  2I3S A;  1MDA H;  2VC2 B;  4J73 A;  4Z8L A;  4A08 B;  2H9L A;  4PSW B;  3RFG A;  2H3X A;  2VDM B;  4GM8 A;  5CXC A;  4QL1 A;  1VYH C;  2AGW A;  3ZDZ B;  1N6E A;  4A08 A;  4X63 B;  3PXS D;  5FKT A;  3IJ1 A;  4G56 B;  4J82 A;  1SQJ A;  4JT6 C;  5THA A;  3JZH A;  4ZN4 A;  4CZY A;  2AH1 A;  5EAM A;  4CI2 A;  1XKS A;  5FQD A;  2HJB A;  4JXM A;  3JRP A;  3SBQ A;  2HKR A;  4ZOV A;  2YNO A;  5JWZ A;  3SBR A;  3RFH A;  2UZX B;  1YUK A;  3UVL A;  3SWS D;  4CI1 A;  3AL9 A;  3F3G A;  1XHM A;  4FAV D;  1K8K C;  5TF2 A;  3ZE2 B;  1R5M A;  3VA6 A;  1RI6 A;  3MZK A;  3SCY A;  4GM9 A;  2GC7 A;  2AH0 A;  3EG6 A;  5EM2 A;  3A0F A;  5E6S B;  4A2L A;  5EML B;  2IWF A;  3NIF B;  2YMU A;  3NIG B;  4E5Z A;  2AGL A;  5A2Q g;  4PBY A;  2YNP A;  2HES X;  3PE7 A;  4WK2 B;  2OVQ B;  4ESG A;  5EAR A;  3AFC A;  2B4E A;  3SN6 B;  1L0Q A;  3K27 A;  3MKS B;  3VI4 B;  3F3P A;  3GRE A;  1PI6 A;  3PSC B;  4QT8 A;  1MG3 A;  3RLM D;  4XYI A;  5IJ7 E;  4GQ2 P;  1P22 A;  2YB8 B;  3JRO A;  1NEX B;  3CFS B;  3OTT A;  1GP2 B;  3ZDX B;  4GGC A;  4J78 A;  2HJ4 A;  4U7A A;  2J57 G;  1TYQ C;  2MTA H;  2J56 H;  3I8E A;  3EI1 A;  1TYE B;  4JSV C;  1PEV A;  2OVR B;  5CYK B;  3U4Y A;  4PXW A;  3VH0 A;  3EWE A;  4UM9 B;  4GM3 A;  1SHY B;  5CXB B;  3ZE0 B;  2B5M A;  4N14 A;  4OZU A;  2CE9 A;  4PSX B;  3B7F A; 
#chains in the Genus database with same CATH topology
 3ZDX A;  1A12 A;  4A0A A;  4AX4 A;  3FRX A;  4CY5 A;  3C5M A;  5C2V B;  4Z7O B;  3MXX A;  3GD1 I;  4FA4 D;  2CO0 C;  5TDH B;  1PBY B;  4TZ4 A;  2EIC A;  3FCU A;  3PVW B;  5CXC B;  2YBA A;  3AH8 B;  3RSE C;  4IA9 A;  4CC9 A;  2VDP B;  3V9F A;  4Z7N B;  3L4O D;  3NVQ A;  3V4P A;  5M61 A;  2WQ8 A;  5IT9 g;  4LGN A;  5C86 A;  2H6N A;  3ULE C;  3RN1 D;  1I2M B;  2EID A;  3J81 g;  2UZY B;  2PBI B;  2Q7Q A;  4A09 B;  4U1E I;  4PNK B;  3EI4 B;  2W18 A;  5SXM A;  3T3M A;  3K6S A;  4QQE A;  3NVN A;  4A7J A;  4CY2 A;  4BL0 A;  2H9P A;  3KRW B;  4FHL A;  4AMY A;  3EI4 A;  5IJ8 E;  1JJU B;  3EI3 A;  2EIE A;  3OKY B;  1NR0 A;  4O3U B;  4A0A B;  3OL2 B;  3IUJ A;  2GC4 A;  4D9S A;  1TYE A;  4NEN A;  3IIW A;  4AEZ A;  3UVK A;  4WK4 A;  4WK4 B;  4X61 B;  5GXI A;  5GXH A;  3OKY A;  3UKU C;  3ZE0 A;  3PVU B;  4L3H D;  5HE0 B;  2H47 A;  1Q47 A;  3DXM C;  1SSL A;  4XEI C;  5HE1 B;  1M1X A;  5TEF A;  2EIB A;  1VE7 A;  2AGY A;  3EQ9 A;  3T3P A;  4X3E A;  1YFQ A;  3VGZ A;  4J8B A;  3MKQ A;  3RMZ D;  2BBK H;  2XYI A;  3MZL A;  4PBZ A;  3VI3 A;  4A09 A;  3VI4 A;  3CIK B;  2JWH A;  3FCU B;  2TRC B;  3C75 H;  4J0W A;  2CO0 A;  2HXC A;  4NAA A;  3I89 A;  1K3I A;  3BWS A;  4G1M A;  4PC0 A;  2IUV A;  2YNN A;  5EAL A;  4O02 A;  5H17 A;  4JSX C;  5H14 A;  3VI3 B;  2VDO A;  1OMW B;  3K71 A;  5FFO A;  3T3M B;  2QZP A;  2OK6 A;  3O4G A;  3IVM A;  5IGO A;  3ORV D;  3JZN A;  4GGA A;  4LG9 A;  2CN3 A;  1S4U X;  4NBM A;  1U8C B;  2VDQ A;  3I2N A;  3FM0 A;  4H5I A;  4X60 B;  5FKQ A;  5I5I A;  3EI1 B;  2H9M A;  2CNX A;  4O2W A;  4O1Q D;  3F3F A;  5KDO B;  1UTC A;  3SJL D;  3W15 A;  4QAM A;  5FFG A;  5CXB A;  4L3G D;  3IUL A;  3PXW D;  4HDJ A;  5EAP A;  5E6U B;  3OW8 A;  1H2Y A;  4UI9 R;  3UVM A;  4J77 A;  3MVD K;  4JD2 C;  4O9D A;  3JAM g;  3ZDY B;  1JMZ B;  2B5N A;  3E0C A;  4Z7O A;  5I5M A;  1MG2 A;  3ZE2 A;  4NSX A;  4EWR A;  4J0X A;  2I0T A;  1FWX A;  5AFU 3;  2XDW A;  2I3T A;  5CYK A;  3MMY A;  2AGZ A;  4KFM B;  4AOW A;  1JTD B;  3EI2 A;  2VDK B;  1GOF A;  2AGX A;  2P26 A;  3FCS A;  1XIP A;  3IUN A;  3IJE A;  1N6D A;  2QC5 A;  2HYE A;  4O45 A;  2H9N A;  5IGQ A;  4WK2 A;  2P9U C;  2B5L A;  3UR4 A;  1U2V C;  3C9C A;  3ZWL B;  1O6G A;  2H13 A;  1QNI A;  3DSM A;  3NIG A;  3RN0 D;  2VDK A;  3SFZ A;  3I7H A;  4DNW A;  5IC7 A;  2P9K C;  4MMX A;  5FKR A;  4JT5 C;  2IUR A;  2VDQ B;  1GG2 B;  2H68 A;  2GNQ A;  2Z2O A;  4A11 B;  4CZX A;  2H14 A;  4DNU A;  4J84 A;  2OIZ A;  2P9S C;  5C2W B;  1C9I A;  4D6V A;  2BCJ B;  4ES0 A;  2AQ5 A;  5GMK n;  4IMM A;  1C9L A;  3KRX B;  2G99 A;  4J79 A;  5M5V A;  5EMM B;  5E6U A;  4J87 A;  4BUJ C;  4FWW A;  2PM9 B;  4JHN A;  3SBP A;  5AJA A;  2Z2P A;  5EM2 B;  3HFQ A;  3SVW D;  1E8N A;  3I7P A;  4XYH A;  3EU7 A;  2XL2 A;  2HKM A;  2VDL B;  1ERJ A;  3IIY A;  4JHP C;  2G9A A;  4J86 A;  3FGB A;  2HU8 A;  2VDO B;  5HE3 B;  1UOP A;  2HU5 A;  2O9K A;  1VZ2 A;  3P4F A;  3K26 A;  3T3P B;  2OK4 A;  4A0B A;  4J81 A;  4ERZ A;  4WK0 B;  1UOO A;  2OJY A;  4E54 B;  2CN2 A;  4K3I D;  4FAN D;  2IWK A;  4L1Q D;  2JKX A;  3JB9 L;  4CI3 A;  4GQ1 A;  4PSX B;  1PGU A;  2VDP A;  2VDR B;  3ZDY A;  3UVN A;  3SHF A;  2PM7 B;  3I7N A;  3DXK C;  1SQ9 A;  5AMS A;  1K32 A;  4MMZ A;  5EMJ B;  1TBG A;  3AL8 B;  5HDB B;  3OF7 A;  2P9N C;  4GZ8 A;  1JOF A;  3MUN A;  4R7A B;  4BCC A;  4QRJ A;  3V5W B;  2IUQ A;  4UM9 A;  3N0D A;  4CY1 A;  2VDM A;  1JV2 A;  3L4M D;  4FB1 D;  2P28 A;  3IUQ A;  2HU7 A;  4JSP C;  4DNV A;  4UM9 D;  3I7L A;  5HQG A;  3DDU A;  4I79 A;  3EI3 B;  3C99 A;  3CFV A;  2VDN B;  1N6F A;  2IAA A;  3JPX A;  5FA5 B;  4OWR A;  4ZOX A;  4A11 A;  1B9Y A;  5FXY A;  3JZG A;  2EBS A;  2VZ3 A;  2H6K A;  1GXR A;  3UVO A;  3SXT D;  1A0R B;  3IKO A;  3QI0 A;  4ZOY A;  4YVD A;  4BCB A;  4J8G A;  2IUP A;  1YR2 A;  3EQ7 A;  4K3J B;  4O3T B;  4A0B B;  4Z7Q B;  3ODT A;  3V7D B;  4Z7N A;  3OKW A;  2I0S A;  2PM9 A;  1H2W A;  4GQB B;  2VDN A;  3GFC A;  2J55 H;  4MMY A;  5B4W A;  3DWL C;  4GMB A;  4ERY A;  5C9Z B;  4GGD A;  4UM8 B;  4UM8 A;  3IJC A;  1E8M A;  1O6F A;  3EI2 B;  1OLZ A;  3N0E A;  2CE8 A;  2XL3 A;  1BPO A;  4WJK B;  2PM6 B;  4Y7R A;  3DM0 A;  5EMK B;  5HE2 B;  3ZE1 B;  1GOG A;  2QXV A;  2I0R A;  2P9L C;  3PSL A;  4LG8 A;  1E5T A;  3ZDZ A;  4D0K A;  4A2M A;  2OVP B;  3OL2 A;  2XU7 A;  4Y5R D;  3EMH A;  4E5Z B;  4ZOZ A;  5GSA A;  5K1C C;  4JSN C;  5I5J A;  5TEE A;  5FLX g;  3RRM C;  3NID A;  3OKT A;  2Z2N A;  4WK0 A;  3I7K A;  4FA9 D;  2QR5 A;  2P9I C;  4BH6 A;  3IUM A;  4CY3 A;  3I8C A;  5E6R A;  3NVX A;  1JMX B;  4BP9 A;  4H5J A;  2P9P C;  3BG1 A;  3MUO A;  4MK0 B;  4AN0 A;  3NID B;  3SMR A;  3SLE D;  5K19 A;  1U4C A;  3IJ0 A;  1GOT B;  3PXT D;  3UKR C;  3BG0 A;  4Z7Q A;  5HYN B;  3AL8 A;  4E54 A;  4ERQ A;  4FA5 D;  3J80 g;  2VDL A;  5FKS A;  1B9X A;  4CZV A;  4CI8 A;  3I7O A;  2H6Q A;  3O4H A;  2VDR A;  5H1M A;  5E6R B;  1VE6 A;  4L9O A;  4FA1 D;  1QFM A;  1QFS A;  2I3S A;  3GC3 B;  1MDA H;  2VC2 B;  4J73 A;  4Z8L A;  4A08 B;  2H9L A;  4PSW B;  5HDB A;  3RFG A;  4AN1 A;  2H3X A;  2VDM B;  4GM8 A;  5CXC A;  4QL1 A;  1VYH C;  2AGW A;  4RE6 A;  3ZDZ B;  1N6E A;  4A08 A;  3NIF A;  1H2Z A;  3PXS D;  4X63 B;  5FKT A;  3IJ1 A;  4G56 B;  1SQJ A;  4JT6 C;  4IRZ A;  5THA A;  3JZH A;  4ZN4 A;  4CZY A;  2AH1 A;  4BCD A;  5EAM A;  4CI2 A;  1XKS A;  5FQD A;  2HJB A;  3O4I A;  4JXM A;  3JRP A;  1GOH A;  4RE5 A;  3SBQ A;  2HKR A;  4ZOV A;  2YNO A;  5JWZ A;  3SBR A;  3RFH A;  2UZX B;  1YUK A;  2BKL A;  2XE4 A;  1VZ3 A;  3UVL A;  3SWS D;  4CI1 A;  3AL9 A;  3F3G A;  1XHM A;  4FAV D;  1K8K C;  5TF2 A;  3QHY B;  5E6S A;  3KCI A;  1R5M A;  3ZE2 B;  3VA6 A;  3ZE1 A;  1RI6 A;  3MZK A;  3SCY A;  4GM9 A;  2GC7 A;  2AH0 A;  3EG6 A;  2XZG A;  4AMZ A;  5EM2 A;  3A0F A;  5M5S A;  4A2L A;  5EML B;  2IWF A;  3NIF B;  2YMU A;  5E6S B;  3NIG B;  4E5Z A;  5M5T A;  2AGL A;  5A2Q g;  4L1M A;  4PBY A;  2YNP A;  2HES X;  3PE7 A;  3EQ8 A;  3O4J A;  4NC4 A;  1L5G A;  4WK2 B;  2OVQ B;  4ESG A;  5EAR A;  1UOQ A;  3AFC A;  4G1E A;  2B4E A;  4WJK A;  3SN6 B;  1L0Q A;  3K27 A;  3MKS B;  3K72 A;  5M5U A;  3VI4 B;  1T2X A;  3F3P A;  3GRE A;  1U8C A;  1PI6 A;  3PSC B;  2VZ1 A;  4QT8 A;  1MG3 A;  3RLM D;  3V4V A;  4XYI A;  5IJ7 E;  4GQ2 P;  1P22 A;  2YB8 B;  3IUR A;  1NEX B;  3JRO A;  3CFS B;  3OTT A;  1GP2 B;  5C92 A;  3ZDX B;  4GGC A;  4J78 A;  5M5R A;  2HJ4 A;  4U7A A;  2J57 G;  2VC2 A;  1TYQ C;  1H2X A;  4BP8 A;  2MTA H;  2J56 H;  3I8E A;  3EI1 A;  1TYE B;  4JSV C;  1PEV A;  2OVR B;  5CYK B;  3U4Y A;  4PXW A;  3VH0 A;  3EWE A;  2JWG A;  4UM9 B;  4GM3 A;  1SHY B;  5CXB B;  3ZE0 B;  2B5M A;  4G55 A;  4N14 A;  4OZU A;  2CE9 A;  4J82 A;  3B7F A; 
#chains in the Genus database with same CATH homology
 4A0A A;  3FRX A;  4CY5 A;  3C5M A;  5C2V B;  4Z7O B;  3MXX A;  4FA4 D;  2CO0 C;  5TDH B;  1PBY B;  4TZ4 A;  3PVW B;  5CXC B;  3RSE C;  2YBA A;  3AH8 B;  2VDP B;  4IA9 A;  4CC9 A;  3V9F A;  4Z7N B;  3L4O D;  3NVQ A;  5IT9 g;  4LGN A;  2H6N A;  3ULE C;  3RN1 D;  3J81 g;  2UZY B;  2PBI B;  2Q7Q A;  4A09 B;  4U1E I;  4PNK B;  3EI4 B;  2W18 A;  5SXM A;  4QQE A;  3NVN A;  4A7J A;  4CY2 A;  4BL0 A;  2H9P A;  3KRW B;  4FHL A;  3EI4 A;  5IJ8 E;  1JJU B;  3EI3 A;  3OKY B;  1NR0 A;  4O3U B;  4A0A B;  3OL2 B;  2GC4 A;  3IIW A;  4AEZ A;  3UVK A;  4WK4 B;  4X61 B;  5GXI A;  5GXH A;  3OKY A;  3UKU C;  3PVU B;  4L3H D;  5HE0 B;  2H47 A;  1Q47 A;  3DXM C;  1SSL A;  4XEI C;  5HE1 B;  5TEF A;  2AGY A;  4X3E A;  1YFQ A;  3VGZ A;  4J8B A;  3MKQ A;  3RMZ D;  2BBK H;  2XYI A;  3MZL A;  4PBZ A;  4A09 A;  3CIK B;  2JWH A;  3FCU B;  2TRC B;  3C75 H;  4J0W A;  2CO0 A;  2HXC A;  3I89 A;  3BWS A;  4PC0 A;  2IUV A;  2YNN A;  5EAL A;  5H17 A;  4JSX C;  5H14 A;  3VI3 B;  1OMW B;  3T3M B;  2OK6 A;  5IGO A;  3ORV D;  3JZN A;  4GGA A;  4LG9 A;  2CN3 A;  1S4U X;  1U8C B;  3I2N A;  4H5I A;  3FM0 A;  5FKQ A;  4X60 B;  5I5I A;  3EI1 B;  2H9M A;  2CNX A;  4O1Q D;  3F3F A;  5KDO B;  3SJL D;  3W15 A;  5CXB A;  4L3G D;  3PXW D;  4HDJ A;  5EAP A;  5E6U B;  3OW8 A;  4UI9 R;  3UVM A;  4J77 A;  4JD2 C;  4O9D A;  3JAM g;  3ZDY B;  1JMZ B;  2B5N A;  3E0C A;  5I5M A;  1MG2 A;  4NSX A;  4EWR A;  4J0X A;  2I0T A;  1FWX A;  5AFU 3;  2I3T A;  5CYK A;  3MMY A;  2AGZ A;  4KFM B;  4AOW A;  3EI2 A;  2VDK B;  2AGX A;  2P26 A;  1XIP A;  1N6D A;  2QC5 A;  2HYE A;  4O45 A;  2H9N A;  5IGQ A;  3UR4 A;  2P9U C;  2B5L A;  1U2V C;  3C9C A;  3ZWL B;  2H13 A;  1QNI A;  3DSM A;  3RN0 D;  3SFZ A;  3I7H A;  5IC7 A;  2P9K C;  5FKR A;  4JT5 C;  2IUR A;  2VDQ B;  2H68 A;  1GG2 B;  2GNQ A;  2Z2O A;  4A11 B;  4CZX A;  2H14 A;  4J84 A;  2OIZ A;  2P9S C;  5C2W B;  4D6V A;  2BCJ B;  4ES0 A;  2AQ5 A;  5GMK n;  4IMM A;  3KRX B;  2G99 A;  4J79 A;  5EMM B;  4J87 A;  4BUJ C;  4FWW A;  2PM9 B;  3SBP A;  5AJA A;  2Z2P A;  5EM2 B;  3HFQ A;  3SVW D;  3I7P A;  4XYH A;  3EU7 A;  2XL2 A;  2HKM A;  2VDL B;  1ERJ A;  3IIY A;  2G9A A;  4J86 A;  3FGB A;  2VDO B;  5HE3 B;  2O9K A;  3K26 A;  3P4F A;  3T3P B;  2OK4 A;  4A0B A;  4J81 A;  4ERZ A;  4WK0 B;  2OJY A;  4E54 B;  2CN2 A;  4K3I D;  4FAN D;  2IWK A;  4L1Q D;  3JB9 L;  4CI3 A;  4GQ1 A;  1PGU A;  2VDR B;  3UVN A;  3SHF A;  2PM7 B;  3I7N A;  3DXK C;  1SQ9 A;  5AMS A;  1K32 A;  5EMJ B;  1TBG A;  3AL8 B;  5HDB B;  2P9N C;  4GZ8 A;  1JOF A;  4R7A B;  4QRJ A;  3V5W B;  2IUQ A;  3N0D A;  4CY1 A;  3L4M D;  4FB1 D;  2P28 A;  4JSP C;  4UM9 D;  3I7L A;  5HQG A;  4I79 A;  3EI3 B;  3C99 A;  3CFV A;  2VDN B;  1N6F A;  2IAA A;  3JPX A;  5FA5 B;  4OWR A;  4ZOX A;  4A11 A;  1B9Y A;  5FXY A;  3JZG A;  2EBS A;  2H6K A;  1GXR A;  3UVO A;  3SXT D;  1A0R B;  3IKO A;  4ZOY A;  4YVD A;  4J8G A;  2IUP A;  4K3J B;  4O3T B;  4A0B B;  4Z7Q B;  3ODT A;  3V7D B;  3OKW A;  2I0S A;  2PM9 A;  4GQB B;  3GFC A;  2J55 H;  5B4W A;  3DWL C;  4GMB A;  4ERY A;  5C9Z B;  4GGD A;  4UM8 B;  3IJC A;  3EI2 B;  1OLZ A;  3N0E A;  2CE8 A;  2XL3 A;  4WJK B;  2PM6 B;  4Y7R A;  3DM0 A;  5EMK B;  5HE2 B;  3ZE1 B;  2QXV A;  2I0R A;  2P9L C;  3PSL A;  4LG8 A;  4D0K A;  4A2M A;  2OVP B;  3OL2 A;  2XU7 A;  4Y5R D;  3EMH A;  4E5Z B;  4ZOZ A;  5GSA A;  5K1C C;  4JSN C;  5I5J A;  5TEE A;  5FLX g;  3RRM C;  3OKT A;  2Z2N A;  3I7K A;  4FA9 D;  4BH6 A;  2P9I C;  4CY3 A;  3I8C A;  3NVX A;  1JMX B;  4H5J A;  2P9P C;  3BG1 A;  4MK0 B;  3NID B;  3SMR A;  3SLE D;  5K19 A;  1U4C A;  3IJ0 A;  1GOT B;  3PXT D;  3UKR C;  3BG0 A;  5HYN B;  3AL8 A;  4E54 A;  4ERQ A;  4FA5 D;  3J80 g;  5FKS A;  1B9X A;  4CZV A;  4CI8 A;  3I7O A;  2H6Q A;  5H1M A;  5E6R B;  4L9O A;  4FA1 D;  2I3S A;  1MDA H;  2VC2 B;  4J73 A;  4Z8L A;  4A08 B;  2H9L A;  4PSW B;  3RFG A;  2H3X A;  2VDM B;  4GM8 A;  5CXC A;  4QL1 A;  1VYH C;  2AGW A;  3ZDZ B;  1N6E A;  4A08 A;  4X63 B;  3PXS D;  5FKT A;  3IJ1 A;  4G56 B;  4J82 A;  1SQJ A;  4JT6 C;  5THA A;  3JZH A;  4ZN4 A;  4CZY A;  2AH1 A;  5EAM A;  4CI2 A;  1XKS A;  5FQD A;  2HJB A;  4JXM A;  3JRP A;  3SBQ A;  2HKR A;  4ZOV A;  2YNO A;  5JWZ A;  3SBR A;  3RFH A;  2UZX B;  1YUK A;  3UVL A;  3SWS D;  4CI1 A;  3AL9 A;  3F3G A;  1XHM A;  4FAV D;  1K8K C;  5TF2 A;  3ZE2 B;  1R5M A;  3VA6 A;  1RI6 A;  3MZK A;  3SCY A;  4GM9 A;  2GC7 A;  2AH0 A;  3EG6 A;  5EM2 A;  3A0F A;  5E6S B;  4A2L A;  5EML B;  2IWF A;  3NIF B;  2YMU A;  3NIG B;  4E5Z A;  2AGL A;  5A2Q g;  4PBY A;  2YNP A;  2HES X;  3PE7 A;  4WK2 B;  2OVQ B;  4ESG A;  5EAR A;  3AFC A;  2B4E A;  3SN6 B;  1L0Q A;  3K27 A;  3MKS B;  3VI4 B;  3F3P A;  3GRE A;  1PI6 A;  3PSC B;  4QT8 A;  1MG3 A;  3RLM D;  4XYI A;  5IJ7 E;  4GQ2 P;  1P22 A;  2YB8 B;  3JRO A;  1NEX B;  3CFS B;  3OTT A;  1GP2 B;  3ZDX B;  4GGC A;  4J78 A;  2HJ4 A;  4U7A A;  2J57 G;  1TYQ C;  2MTA H;  2J56 H;  3I8E A;  3EI1 A;  1TYE B;  4JSV C;  1PEV A;  2OVR B;  5CYK B;  3U4Y A;  4PXW A;  3VH0 A;  3EWE A;  2JWG A;  4UM9 B;  4GM3 A;  1SHY B;  5CXB B;  3ZE0 B;  2B5M A;  4N14 A;  4OZU A;  2CE9 A;  4PSX B;  3B7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...