3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Subtilisin-like serine protease
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
4M1ZA 3A3OB 3WIUA 3VHQA 1OYOA 2XVKA 3TI7A 1IC6A 2SECE 1A2QA 3WHIA 2Z58B 3Q5GA 4OV6B 1EA7A 4CFZA 3F7MA 1PTKA 1P7VA 1SCJA 3A3OA 1CNMA 2PWAA 1Y1KE 2W2QP 1KDVA 4KPGA 1WMFA 1Y3DE 1C9NA 1TM7E 1AQNA 1T1IA 1YJBA 1SIBE 2Z2YB 1Y4AE 1Y33E 4I3GA 3UNXA 1YJAA 2Z57B 4NE7A 2V8BA 3DVQX 3GCXA 1KDZA 3DF0A 2SNIE 2Z2ZA 1T1GA 5JXJA 5FFNA 1GT91 1KE1A 3DE7X 1MPTA 2O8OA 4DZGA 3A3NA 3OSZA 3BPSA 4YN3B 5B1EA 1TM4E 4H6WA 3JQWA 2W2NP 1BFKA 3GT4A 1S02A 1NQDA 1P7WA 2ZWPA 1YU6A 2XRMA 2P4EA 3BGOS 1SPBP 4BWGA 2Z56A 3BPSP 2DUJA 3SQOP 1AK9A 2ZWOA 4DY3A 1SUEA 2GKOA 1NLUA 3CNQS 5FBZA 1GTL1 2PWBA 3Q40A 2SICE 3VTAA 4CFYA 3DE1X 2LUWA 3EIFA 2WUWE 3H42A 3DE5X 1SBIA 2ZRQA 4HVLA 2ST1A 3F7OA 2XVGA 2DP4E 4AKSA 1WMDA 3QTLA 3A3PB 3P5BA 1C9JA 2W2OP 1SBHA 3L1KA 1T1EA 3DDZX 2QFEA 1SUPA 5ARDA 5I9SA 4JP8A 2Z30A 4NMXA 1WMEA 2Z2XA 2Z58A 5SV5A 3H42B 1ITPA 1OYVA 3JQXA 2SBTA 1IAVA 1Q5PA 3LPDA 1S2NA 5JMOA 3D9QX 1AU9A 3GCWP 1GNSA 4OMCA 2B6NA 1KFXL 1AF4A 4K8RB 4NMXB 3GT3A 1BH6A 3DE4X 1BFUA 1C3LA 1SCBA 2IXTA 3VV3A 4HPKB 1GTG1 2E1PA 3DYBA 3CNQP 2PRKA 1KDYA 3DE3X 4K8RA 3BOWA 3DWEX 4RYDA 3DE6X 5AMXA 4DXZA 1R64A 3DW1X 1V6CA 2WWTA 2X8JA 1SUAA 4OMDA 5ARBA 1U5IA 1AV7A 3I2YX 1JEAA 1VSBA 4YN3A 1WVMA 4DZTA 1NDUA 3EDYA 5JXIA 4OV6A 1Y4DE 3VSBA 3AJ9A 4H6VA 3DVSX 4ZARA 5FAXA 1SIOA 2W2QA 1TMGE 4WOBA 1AH2A 1GA6A 2Z2YA 1SIUA 3I30X 3BGOP 2PYZA 4I0WB 1KE2A 2Z56B 1TO2E 3SQOA 1DUIA 3WIVA 1UBNA 1S01A 1DBIA 3DE0X 1SBTA 1Y3CE 3ZXYA 3VYVA 2QTWB 4J94A 2W2MA 1Y3BE 3I37X 2WV7A 4HPKA 1SCAA 3T41A 1TM1E 1C9MA 2ID4A 3HJRA 3LPAA 4MZDA 5SICE 3AJ8A 3WQBA 5JXHA 1SBNE 1R6VA 1YJCA 1KFUL 3LXUX 1GNVA 2QTWA 4G9SB 3I34X 1SUCA 4LVOA 1TM5E 2X8JB 2PMWA 1SVNA 1LW6E 1SCNE 4H6XA 3GCXP 1GCIA 4C3UA 3SICE 5B1DA 2W2NA 3AFGA 1V5IB 4Z2AA 1BJRE 1GA1A 2WUVA 4GI3A 2PMWB 2HPZA 1THMA 1GA4A 3A3NB 3CO0S 1TK2A 2W2PP 2XTJA 1MEEA 1Y48E 1SCJB 1NDQA 4DY5A 1QXPA 3P5BP 2XTJP 1PFGA 1ST3A 1SUBA 4NE9A 3D43A 3QFHA 1SUDA 1Y9ZA 2PQ2A 2ID8A 2HD4A 1XF1A 4DWWA 3LPCA 3VV2A 1TECE 4KB5A 5CW1A 2W2PA 2TECE 3ZXXA 4LVNA 3EE6A 1BE6A 2G4VA 1ST2A 5AQEA 5K7SA 1AVTA 1OT5A 1TO1E 1R0RE 3DVRX 2IY9A 1SH7A 3PTLA 4KG7A 3A3PA 1CSEE 1NQJA 4FONA 1V5IA 2PKCA 3DW3X 4NE9C 3BX1A 1Y34E 1Y3FE 2DQKA 2Z30B 4ZOQI 4B5LA 1SBCA 4CG0A 1PEKE 1ZVJA 1ZVKA 1PJ8A 3DE2X 4WOCA 2Z57A 1P8JA 1WSDA 1HT3A 2W2MP 5AVKA 4C3VA 3QMPA 1GTJ1 1BE8A 1SCDA 1EGQA 5AVJA 5ARCA 1SN7A 4DJ5X 1TM3E 1SPBS 2XVLA 5JXGA 1DF0A 2W2OA 4AKTA 3TECE 3PRKE 3F49S 3VV2B 4HX2A 1SELA 3CO0P 3TI9A 3GCWA
chains in the Genus database with same CATH superfamily
4M5NA 4O0NA 4HP8A 3BL5A 3I8OA 4ON9A 4EK9A 3TI7A 4XX0A 4NV3A 3NBQA 2IHVA 2FK8A 1CX1A 1PYOA 1F0YA 1TTPB 2OYRA 3NJVA 5CLFA 2LCFA 4DUYJ 3RU2A 2X2EA 3L0YA 2BNNA 1X9PA 2QQIA 4OUDA 1QGZA 1AQNA 5FYYA 3P4YA 4CEYB 4HK8A 1Q43A 3OKPA 4HDSA 2C04A 1XVUA 2GH2A 4C2MA 2HPVA 3KSAC 2Z2ZA 2RQCA 4JI0J 1FSGA 2O3SA 2O7QA 4B33A 1U5YA 1NJZA 4BL5A 1AKEA 3UC9A 1G5IA 4WZMA 1Z47A 1RUG2 2OEMA 3CB2A 2VUHB 2QDNA 2VXRA 3IMQJ 3P9ZA 3RS2A 4LF4B 2GD0A 3DKRA 3OUTA 1N4AA 1DKOA 1N0HA 3IAS6 3R3JA 4D4IA 3AHCA 3BTXA 1FXWF 4XFKA 3FYUC 2OPQB 1TL5A 3WNQA 4AW7A 1ZBE2 3PNVA 1R37A 3CRZA 3GHNA 3CNBA 4RMJA 2JHCA 5IFPA 3F1KA 1SFRA 1FNBA 2QLFA 3L06A 2OFWA 2QUKA 5IXUA 1W2GA 1RS0A 2ID7A 3ESZA 1Q0SA 4DFSA 1XZBA 1L5GB 3S5AA 5CP8A 2F9DA 3DVLA 2DH5A 1NCRA 1H2ZA 4ED5A 3HB7A 1SVMA 3D2CA 2BZSA 3E3LA 3FHOA 3ZE8A 4BHTA 2AH5A 5ERLA 3T7EA 3QEBZ 2NXNA 3S1AB 3AVUA 1JUIA 1ARZA 1P4HA 2WBLC 1GRQA 4MLCA 1E2EA 1MVOA 4AP6A 4EUSA 2QK4A 4XDDA 5CBPB 2QBXA 2C4VA 1D4OA 2HWWA 4PY2A 1J42A 2UVDA 4XGNA 3DBLA 1S1CA 4YCBA 2JVRA 5AW9A 3W9YA 2JAPA 2ZGOA 1EY2A 2VL1A 3HI9A 3EXCX 1QIGA 1BE0A 2ACEA 3HKBB 4WXWA 2FZCB 5CYGA 1CULA 3LZZA 1D4VB 3NALA 1SD5A 3ZYCA 4NAUA 3ZGLA 5C3QA 1VKOA 2ZYUX 5HILA 5EE0A 3AILA 4AW9A 4Y2JA 3KDPA 5ICGA 3QVUA 3BRQA 2VVTA 4RVFA 3STUA 3QPIA 2YYYA 3KV3O 3OPXA 3MIFA 1XMBA 4QXMA 1NVVR 4C87A 5J3UA 4J9SA 3AJEA 4KJIA 1CZSA 2JG3A 4YI5A 4G0OA 5L3QA 1URXA 1SHWB 1JHRA 3AU9A 1XBTA 4LE2A 3SFZA 2W9CB 2VA3A 3ZBUA 1RUE1 3GF6A 3ZFEC 2LDXA 1FDRA 4LSZA 3SDEB 2XNCA 3ZXDA 5ELXA 4KUGA 5LSAA 1XZEA 2WDBA 1UJ5A 2GJ9A 1U24A 5I4IA 2XYGB 1N78A 3UGGA 1O57A 4Q29A 4HH0A 1W03A 3NUGA 3TR6A 3WAKA 1NB2A 2E44A 4N8SA 1UFWA 1HG1A 2Q43A 4IS3A 1AKYA 1QM5A 5HMLA 3WRYC 2GO7A 1TA4A 3D8SA 3IH5A 3IJ5A 2YGMA 4E9KA 5LP6C 5HBMA 4OYAA 3OTOB 4JWTA 2Z2LA 3GLIB 4ENUA 4GEGA 2IZ1A 4XCVA 3A1VA 2DH8A 3HPOA 4N54A 1A69A 4DR5J 2W2VA 1DC8A 4RTNA 5E0KB 4NULA 1B0TA 1UWAA 3D3NA 3ZKWA 2AYGA 3PFHA 1FP1D 4NABA 3POSA 1KBZA 3K8ZA 3Q2SC 4HDHA 1A9YA 5JZ9A 1JZ3A 1D5CA 1GRRA 2XUZA 1IY0A 4GXQA 5L36A 3PQ2A 3KT0A 5CU1A 2N3LA 1M1UA 1MC8A 4Q2FA 4YM3A 3EE6A 1MZ6A 4LDRA 1RAHB 4XILA 4YJ3F 3GLHB 4O23A 4AY5A 4Q8FA 4D7AA 2A6ZA 4AOCA 1FQKA 1GGFA 3D31A 1LBQA 2AB0A 3E61A 4I0WA 3GEDA 4BNJA 2ZAIA 1LF0A 3ZPYA 5H02A 2NNWB 2GM4A 1UFKA 1DG6A 2IXCA 3LO8A 3I2GA 2FCAA 4JQYA 3ZTSA 2VK4A 1JG6A 3VYUB 5DYNA 3NU1A 1RE1B 3SH5A 1F8UA 3WX5A 1HBNB 4QDQA 3HWWA 3OIYA 2HJGA 4MWDA 4CG0A 1H9BA 1VIMA 3FTPA 5ACA1 2W43A 3NAPA 1NPKA 2WNUC 3IESA 4DVJA 5T50A 2GYUA 2RBKA 4H27A 3G2NA 3SQWA 4D0QA 3M5CA 1OAOA 3F9CA 3IIIA 2VOJA 2P7IA 1BHGA 3A25A 1QOZA 1QX4A 4RHV1 2C3OA 3NTXA 4IEEA 2WY2D 1ZVVA 4UBJA 4IGFA 3WGYA 1MNAA 1BHJA 1QZUA 4IF6A 2IYGA 3WJAA 4JV2A 4EY8A 4M87A 1O6FA 1WIWA 3R24A 2PIDA 1S1WB 1EWTA 5LDGA 4OYWA 4ALZA 1FUUA 1W2UA 4CL3A 2DXEA 3OBIA 4UEOA 2HWUA 3QV2A 3NNCA 3AVPA 1EIZA 4TWTA 4Z99A 1LS6A 3QQPA 3QYJA 3DB1A 1VI7A 3E15A 2F9JA 2WTMA 2E9TA 1V8DA 4G09A 5J2NA 4MT1A 5K2OA 4P4NA 1KGYA 5DW3A 4JI6F 5AKIA 2ACVA 2IM1A 3C6MA 1R5OA 4UVDA 2I45A 4L15A 2ZR7A 3RC9A 1A8SA 1PIWA 4H59A 3DPRC 5T5QA 4Y0NA 4ZVRB 2HQSA 2O7RA 2HT6A 3TMKA 2A5ZA 2X8LA 1DTQB 3E51A 3QEMB 4DTCA 1TJ3A 1SL2A 1GN9A 4BIMA 2WINI 2PEBA 4EY3A 4JKOA 5AYVA 2ZJBA 2YV4A 1EU1A 5KX5A 5FKCA 2FLVA 3H6KA 1S7GA 2JHAA 2Q6VA 2F7VA 3PFEA 3HFSA 4IZ6A 5JWHA 5E6RB 4EB3A 3OVBA 1NASA 1XQIA 4OFGA 1RW4A 4GI5A 4I4TB 4WBFA 3MIEA 1YU6A 4Q7EA 2HO5A 1W2TA 4NRQA 1TA0A 4QD3A 3FOWA 2FYXA 3MPBA 5IN5A 4O3SA 1VBB2 2BLNA 4DYHA 5A4AA 1FIUA 3ZSEA 3CCRS 4IIBA 5IFTA 3T7DA 3H3ZA 1H73A 4I8IA 3F6CA 2ZJRQ 1CR4A 2BKAA 2PWYA 1KOJA 3ZNQA 3HHPA 1SBIA 4YP0A 3EVNA 4EG6A 1KMQA 5A3PA 3VHLB 1K8ZB 2Z1NA 4OGGA 2GGPA 2C7VA 2A71A 2XWBF 4D94A 3P4XA 4HX5A 3QG5A 3J7TA 2RRBA 1H9WA 5FEUA 3D0HE 2B46X 2SKDA 1DC7A 4WKOA 1O3TA 1FCAA 3KVYA 1D2MA 1DAGA 1CJKB 4A7KA 2NVUA 4XB6B 4B4KA 3ILVA 5DU2A 1J24A 1QFMA 3I23A 4M7WA 2OCYC 2P9BA 3D3QA 1PIV2 4JGYA 1SLAA 1Q2UA 5HBAA 2OENG 5ENVA 4P71A 4HDCA 3CD7A 2DCYA 2LM3A 5CFCC 4FVCA 1T29A 5EE9A 1KORA 5AMXA 3TSYA 3SZLA 2B4AA 1XLUA 3Q7PA 5HVHA 2HMIB 3HB5X 2PH7A 4EW1A 4AFFA 4PCLA 2GCNA 4TKMA 3ELDA 1DCFA 3HVUA 3P6BA 4DYVA 4XDQA 2FQQA 2H7CA 1Q50A 4WP3A 4HTFA 5CB4A 3U3JA 1RI7A 4HV4A 1WXIA 3GK3A 1YMVA 4GH4B 2Z2YA 1V7ZA 1HEYA 4KAJA 4QM7A 3KYBA 4N3CA 1RFGE 3OQBA 1IR2A 1VGQA 1IBMF 3UWTA 2VW0A 2BFAA 3AB3A 1WF0A 2H4ZA 5AJYA 4ECYA 4NA1A 1LRJA 1QSSA 3CTRA 5L3RA 3L2YA 3FTQA 3AWDA 3RBXA 4TT3D 1X39A 2PX2A 1KY2A 3DFIA 1OGIA 2WOOA 2VM9A 1RZVA 1YS1X 2HQCA 1PG2A 2NO1A 4EZBA 1TD9A 1S48A 3A27A 4DQLA 2NSYA 3KJZA 2XD4A 4AI3A 3FBTA 1LH0A 2B51A 1IU9A 3DECA 4GX1A 2BYTA 5SYAA 4XE5A 4QWAA 1U8UA 3PNOA 5FP7A 4B0PA 3R6LB 5AW5A 1JYVA 4YY3F 2N42A 3O8NA 3NKLA 1B42A 4Y9TA 4N77A 3OO0A 3BKUA 4HGRA 4CODB 1WDLA 2GN8A 4X62B 3K4QA 1HY3A 2JLZA 1TMF2 4V0NA 2GN3A 2A86A 3H8XA 3WKCA 3TOVA 1CUSA 2YX4A 1IUPA 3FMIA 1YQ2A 4YW7A 1TNRA 4L4RA 1XF9A 3ZI7A 1GVHA 2GMPA 3DM2B 1RZMA 1PO22 3WLKX 4BNFA 3VVTA 2VK1A 2IT1A 1AV6A 2Q0AA 2RIPA 1TCUA 4LI3X 1DQ0A 2PMCA 2K9ZA 3S28A 2FN8A 3OZVA 3MPOA 3R1LA 3VA7A 2HHHJ 3OX3A 1AR83 3WA7A 2C24A 2YN0A 2P30A 2LS6A 2BABA 4XM2A 2ET7A 2G2OA 4Y1RA 3KM5A 4TUYA 4MWCA 3QLUA 4QC2A 4UJ5A 5H9FK 1KDOA 2DU0A 1FW8A 3PUKA 5DIZA 3TOQA 5JNLA 4MQ5A 4DA9A 4M5HA 3TLBA 2GN6A 3N8NA 3S2EA 2KBFA 5JMCA 4DBZA 4O61A 2C4UA 4AMUA 4X4SA 3OU6A 4DRYA 1N47A 4N43C 4QFBA 3MTBA 3JSMA 3LP5A 1QPBA 4ZJPA 5L7OA 5JV5A 1NUQA 4XJWA 3LMKA 3HZZA 5C5IA 2EIXA 1J2JA 2YKMB 2NTEA 5FYQA 3DG9A 1EGQA 1IN4A 5ALMA 5L38A 2AYXA 5IYZB 4D8VA 1DZ5A 3FPCA 3MTDA 3U4HA 4B82A 2YWGA 3JQDA 3MK31 1RYYA 1Z3IX 2F4LA 1DNPA 4XUDA 5ALIA 1RUC2 2I03A 4YW3A 3RNLA 1OX5A 1I9CA 1SK9A 4LMAA 1H0HA 3UMSA 2Q6BA 3C48A 1T03B 1RIRA 1KSHA 1MMNA 1PO11 4WIIA 1H8HA 4G8JA 3A05A 1OLUB 3M3DA 2WTNA 3JVIA 2HWC1 4DYDA 1RBLA 1O91A 3CXUA 3UUWA 4RTKA 1Y1KE 1U6IA 4ZT4A 3TZLA 5LA6F 5KMGB 1Z34A 2FMTA 1GGVA 1B15A 2IZ7A 2IHUA 2Z69A 4B3XA 4PXCA 1KOFA 2A67A 4R8MA 3DZJA 5C46F 2OEKA 1SJFA 4CXYA 1PQPA 4LVNP 1S3SA 2OP0A 1FRHA 5HI0A 1NUHA 4B3BA 4JLVA 1FTSA 2EZ9A 2R5NA 1JDNA 3HN1A 1YC61 2C3YA 3E7FA 4DXLA 3JWIA 4DIUA 1QH6A 5LPNA 3RAFC 4U9HS 2GTIA 5B1EA 1R5JA 3V0BB 2FJXA 1DYPA 2WYWA 2JE7A 3FZGA 1W8NA 4Q6WA 1Y7TA 3VBOA 1O7FA 3LDUA 3BS9A 3IP5A 1N6KA 1SOMA 5JLAA 3QPAA 2W1WA 1KS9A 3IBYA 2ARCA 1AX0A 4IEOA 5JSKA 3TZWA 5TS2A 2J9RA 4PQUA 2ZDOA 2GIQA 3RC3A 1FS5A 5CK5A 3H6GA 4FNGA 3WLQA 2C07A 4TS3A 4CKWA 1IJFA 3R77A 3B5EA 2FEXA 2QMZA 3DTTA 5KKNB 2SKEA 3KK2A 2Z1DA 3CRNA 3EFBA 5TSWA 4OI0A 1F5AA 3NHAA 5JY6A 4D25A 1B26A 3PFFA 3IM0A 2BGRA 3M6VA 2ARAA 5HVNA 2QFEA 5CKMA 1E2HA 1K7FB 1QHFA 2RQKA 4KTVE 3V8MA 3WDVA 5FBVB 4TTRA 2C4TA 5FUWA 1SJ9A 4FT2A 2YQ3A 2QZ8A 3UXEA 4RD6A 3H8SA 4MGIR 3NS7A 4NDNE 1M5TA 1PFWA 1ECPA 2YVSA 2EXJA 3NJ8A 4LC0A 3JYLA 3MW2A 4Q6BA 4WX2B 4KHZA 4D0RA 2JHEA 3O21A 4HJRA 1GAWA 3D8BA 1DTTA 3RSFA 2VZ1A 3MIDA 4JN6B 1FMFA 1QGOA 3CLSD 4GI7A 5BUCA 4J0DA 4LF8F 2JBWA 1JE1A 2DC1A 1KI7A 4MWEA 2DV9A 3IR7B 4M53A 1D4M1 4BBYA 5CU7A 4KGZA 1QG4A 3W62A 1LSSA 5KNBH 1HWYA 2YU2A 3KUXA 1WHYA 1GXLA 1B8NA 3LYUA 3ZYIB 2BJ8A 1D2CA 1H7XA 1BXZA 1GFWB 2B3DA 4DTIA 2BRLA 4QHSA 4DHWA 1W581 1OLXA 5L3SB 1XYNA 3STWA 1QJEA 2ZTSA 2J9CA 1NVMB 1OLSA 3NXZA 2RDQA 2GXQA 4GJZA 3HNRA 1AKQA 4JGIA 2XMZA 4IG0B 4KHPJ 4Q48A 4ZPVR 3MPUB 3IAAA 4Q24A 4UD2A 3T15A 2GYYA 4U7CA 4PQGA 1VXOA 4ZEMA 2FZCA 1TGVA 3SH3A 4AJ4A 1JTVA 5LT5A 1CBUA 4ZJZA 3WRXA 3MB5A 4IEPA 1Y1RA 3DEFA 1QVWA 2E4UA 1RWNA 5JSOA 4Y6IA 1GWKA 1V16B 2Q2QA 4D74A 2PI4A 3M32A 2ZRLA 4XFHA 4B44A 4UBKA 1C41A 3J81j 1U48A 1P0MA 3USUB 1MDBA 4GL4A 1ULBA 1PX3A 5AVZA 1I4OA 4EHLA 1GHTA 3KE8A 4X6XA 3WC2A 1W8HA 1ODSA 1GLGA 2ORED 5G0WA 1OKQA 3AFGA 3L0SA 2UWCA 4USVA 4GVLA 3JAWB 2GX6A 1SC1A 2I7XA 4ALMA 3EMBA 2A3WA 4Y65A 1VIOA 2H1RA 4WK2B 1SZCA 2OVBA 3ZD7A 4ZC1A 2IFWA 1F5CA 4KGMA 2V9CA 4DY5A 2BFPA 4HKOA 1POWA 4NE9A 1CB7A 3HVIA 4W9NA 1OTHA 1PR4A 3GDOA 2H1OA 3WADA 4MW1A 4CI0B 2RHJA 2B25A 1JYNA 1HW8A 2FW8A 4YROA 5EUBA 2VEDA 3P27A 2PFKA 3O1HB 1L5MA 1EX9A 5G41A 3MILA 5BUZA 2PA3A 5DBGA 1KZ6A 4C7XA 4X6RB 1BWVA 4QIEA 2ADMA 1UK7A 3ZZMA 2Q7XA 3VR5A 4DVGA 1IM5A 3TE7A 2VWGA 2ZEXA 4WM7B 4CEJA 2L3MA 4DPLA 3TYTA 3L7DA 4BWYA 4JMLA 3WKEA 2RR11 2H0QA 2X4LA 3SMZA 3PA6A 3K48A 4RENA 1TL3B 2XYVA 1CIPA 1RXUA 1HUQA 1L7QA 4CDUB 3IQIX 5HI7A 2OCLA 2QLXA 4TMKA 1BD4A 4UUNA 4XWGA 2GPTA 5GADU 1GM5A 2DR6A 1HT2E 1E69A 5LM7E 5CABA 3OOHA 4HH1A 4K2AA 1BO6A 1OX4A 1SMKA 3G85A 4CIWA 4MW4A 4WY5A 5AVJA 1HNWB 4XLLA 3LYLA 5ALQA 3T7RA 2H1SA 4UCQA 3LF2A 1JYCA 3WHTA 3Q12A 3PFIA 1Q7GA 4I02A 4L78A 5FORA 3CW8X 2FFQA 4K0KJ 1XCGB 4C7MA 3D6MA 1BMQB 4UZCA 1XNHA 3UDEA 2UUBJ 3RFCA 2DR8A 2EFOA 4KIAA 3FDZA 4UYBA 3CULA 2YNIA 4YAGA 4C3LA 4R6XA 3S2FA 1XB9A 2PL3A 4DV5B 4KYUA 3BFJA 4ZXKA 2V6AA 2MDAA 1W2AX 1HSZA 3QWUA 4I7FB 2X7JA 2G7ZA 4RLHA 4LPLA 4Q03A 3LTOA 1VPDA 4P4GA 2IA6A 4C76A 3JYPA 2KO1A 3WWEA 5JRZA 3NH6A 1N34F 3MN1A 4JUZA 1X7XB 2VZLA 4NR0A 1MA0A 1B0UA 3DUIA 1KI6B 3H5UA 1U2DA 3HKEA 1TGYA 5D3ZA 4DLZA 4J90A 3DP9A 2AG5A 4FEGA 1U2DC 2CQDA 4TVOA 2KD7A 3EMDA 4FFIA 2BRUC 3BG5A 2EIBA 5A7SA 2ZBCA 2QRUA 2MTBA 3EB7A 4D69A 3L82B 5LQAA 5TQ0B 3F3MA 4N7JA 1YIJS 3SF8B 2PV0A 5C33A 4LBHA 5A1TA 3TO8A 3EXAA 4O02B 3K4DA 3FJ2A 5KTMA 3TEJA 2HT1A 4YMVA 3MTKA 2Z6QA 2AJCA 4OQ9A 3DRSA 2BFDA 1VIVA 3B9IA 1FWLA 1P61B 3MUEA 1ZUD1 4AKSA 3RAPR 2JC1A 4M5DB 1RTIB 2V8DA 1HO3A 1LEDA 4LY9A 2BW7A 1KS5A 2CWKA 2XHKA 3Q8RB 1TK5A 4NG5A 1R27A 4V0OA 1ULGA 1II8B 1W6OB 3OBZA 5EHDA 4FMBB 1QMGA 3E6BA 1VC0A 1I5OA 1IOWA 3DDSA 4UFLA 3DZKA 1JN2P 3MW8A 1NW8A 1DIOB 1VOTA 3VTZA 3VHOA 3ZX5A 1W0NA 1NTRA 3I32A 4HG2A 2X5XA 3RVNA 4R3UC 3LPYA 5EMLA 1X4DA 4KIGA 2ZGRA 4CLSA 1XZDA 3VUOA 4AHXA 1GEHA 4XO0A 4EA6A 3VKOA 1M8GA 1FOD2 1JHAA 2KR2A 2HWC3 1KDYA 4QT6A 4ZVTB 3IUPA 4UTVA 1U6KA 5I0DA 1E8MA 1IVYA 2RD5C 1A9SA 4JGYB 1YC2A 4ZQIA 1K6JA 3HR4A 3JQMA 4L2NA 2DNKA 2QNRA 3WTCA 5MN6A 3Q9UA 1O96B 4F4DA 1GAQA 3PVSA 2XYPA 4HGOA 3UV3A 3TRSB 1MEC1 3EDYA 3JS5A 3PI7A 4FBFA 1ENSA 4XQDA 4V2VA 1R0ZA 2HNYB 1PYGA 2I29A 2LXFA 1EM6A 2CNOA 2ARBA 5BNOC 3U0ZA 3HP6A 2HWYA 1YNSA 4NONA 4RDHA 3PGJA 1HRV3 3ZSMA 1H8ED 4MEJA 1J06A 1D6NA 2P3KA 5A3MA 2JHFA 4D57A 3JAKA 3WP3A 4FJ2A 4TLBA 3E5QA 2APJA 4OX7A 3FK4A 4BS2A 4BQXA 1YJ7A 1XK8A 4AWAA 4L02A 1LOCA 4WGFA 5K03A 4MZUA 1NN1A 1WBJB 3R1IA 1XQWA 5H7XA 4HQNA 4RFT0 1LVHA 3U9LA 3IAXA 4BNLA 4QYWA 1ZMBA 4AC9A 4B3OB 1JLHA 1LW6E 2W6ID 2WJAA 4BFWA 4NHOA 3GLSA 2OCKA 3E27A 4FFFA 1CN1A 3QSYB 5H80A 2WKKA 4EG0A 3TX2A 3WWYA 3NM6B 3V80A 4EDHA 4QBKA 2XPJA 2HFKA 3HR7A 3REQA 3I0RB 1YZGA 3NL1A 5FF9A 1E6CA 1XRJA 2W48A 1M2OB 1NT4A 2C8VA 3HB1A 1MS0A 3HT1A 2O0HA 1CFJA 2P35A 4X6UA 2AG6A 5K8MA 1VRTB 1DJNA 4C4SA 4DXDA 4WK0B 3TW4A 2FW0A 4HPWA 2V4JA 1VE0A 1QGUB 4XBNA 3O26A 4G0PA 1DAHA 1UP4A 1P1RA 4LOLA 5HS6A 4PPFA 3IQEA 1HSOA 3K0AB 4EVIA 4UE2A 4P73A 5B0GA 2Q4OA 1I3KA 3V4RA 5C5EA 3KT1A 1Z7EA 4GMHA 3M6MD 4LWOA 4MS1B 4FONA 3E82A 2ONCA 5KVAA 4CHTA 3FCHA 1NXXA 3EGWB 1JDTA 1KRWA 4EFKA 3GSIA 4QPTA 2F4FA 1KJJA 1PEKE 1Y3IA 3E3MA 4Y1RB 3N2KB 2EDCA 5EN1A 1Y63A 3O4HA 3TRFA 4RHEA 2DUOA 4AS1A 3HHLC 1IPEA 4Q4X2 2VP4A 1H5NA 4RTLA 2QMUA 3DA8A 2I6XA 3F6EX 1ZQ9A 1H6KX 2G28A 4RUHA 3RZZA 3LHIA 3NNFA 1E0SA 1L3VA 3KQPA 1ULEA 3KPUA 2ZBIA 4HAXA 4LYFA 1QHYA 4CIYA 4RX6A 3LGNA 1BCSB 2ZJAA 1FTRA 2JH8A 4MAAA 4OHKA 2GEDA 2XO6A 2YL2A 3NGTA 4YP3A 3P20A 2SXLA 1OC2A 1MJNA 5B36A 4FN4A 2YMQA 3VR2D 3EPIA 4ES3A 3UA3A 2PUGA 3J7YU 5EA2A 4NWWA 2UXBB 5HIAA 3ZDVA 4FX5A 4EJSC 3U39A 3PUHA 1G8HA 4WM8B 3B5LB 5GIPE 4NQRA 2VP0A 2L9NA 5BW8A 3IPVA 4Q0SA 3V1UA 5K0ZA 1XSRA 4WVZA 2LQ5A 1ENPA 3ZY4A 1EP3B 2MSLA 1XALA 4UM7A 3RYRA 3ZYRA 1N75A 3QKSA 3U07A 4H7JA 1NP7A 5K0SA 1IUNA 3HCFA 1P0QA 1QSYA 3WL8A 1IQDC 4MRVA 5B08A 1GLVA 4TLFA 3BE4A 2RS52 1CC8A 3UK6A 2AKYA 1ZK0A 3ORQA 5C53B 5B1IA 1ZY2A 2IS2A 2GVDA 2C54A 3SYRA 1G2QA 1P75A 3QU4A 2E1CA 2CUYA 3P1IA 3FCCA 4IIJB 3USZA 2Q0HA 5F2SA 3GOHA 1Y82A 5SUHA 5A33A 1T9GS 2GPSA 4AZSA 2JEZA 2QPAA 4N53A 1UADA 3DLKA 1VQ9S 3IBCA 4LTNA 2KJVA 1I4WA 5DNDA 5IZCA 1BS9A 2Z3VA 3KCYA 3PQEA 4X62J 2IPMA 4IUYA 2B2NA 2EQBA 1VISA 3IC5A 4FVMA 4XM0A 3WIEA 1LLDA 1UC8A 1DADA 2WKWA 4RZ3A 2RUGA 1DGWX 3CJ8A 1ZS6A 3DMTC 1GZWB 1HDXA 2KXLA 1XTSA 1Q3KA 3TLAA 1UFQA 2XCPA 3K1ZA 4HEJA 2W83A 4UKDA 3R7DA 2QVYX 1RWPA 3NS7B 2ARKA 3DFMA 4MIAA 4KKVA 3JBG3 1H0RA 1BDHA 2BV3A 1LZLA 2V7TA 5BV1A 3VD4A 2QC3A 3K4ZA 4C4XA 2K7FA 4E2XA 1FJGF 4L72A 3RLIA 4RW6A 4GPEA 2M6LA 3ROGA 3S7TA 4ZI3A 2PH3A 1M5UA 3V2UA 3GFSA 4DY6A 5GMKa 4ZTUB 2BU9A 1MHPA 4TM8A 2VY0A 4WOBA 1O8BA 2ACYA 3A4VA 3A04A 4ARSA 4XWTA 3ZWKA 4EJ2A 4INOA 2LRPA 3N01A 1EVEA 1RYHA 5ELLA 2K6GA 4LJKA 2V6FA 4FCWA 1FPQA 1P2VA 1XZJA 3EO6A 1RQXA 3QY9A 4YVWA 5H9EK 3Q15C 1O3RA 5M0TA 4MIOA 2ID4A 4K9DA 4C4WA 3DXTA 2AGQA 1DEHA 1OPZA 1ND2C 4GP9A 4PFJA 4S1VA 2WKQA 3L7CA 1F4HA 2B4YA 2FZ5A 4K2HA 1S2OA 3N7TA 4FFNA 1PSWA 3H7AA 3I83A 3FMBA 4NI2A 4FPKA 4ICLB 1SKUB 2Q1TA 2IXIA 1XK7A 2V03A 2VJQA 3GG9A 4GXLA 4Y22B 3WNKA 4QWDA 4H3KB 1S8NA 1DTQA 4LF5F 2JFBA 4CH7A 3GD7A 3TGWA 4OJTA 2O23A 1BX1A 1VBYA 3I9NA 2H1FA 6PFKA 2Q1MA 1S2DA 4XYLA 1Z8FA 4LQ4A 1KJWA 1RT1B 4B2LA 2CHHA 1AN9A 3EYWA 2YBEA 2PGIA 4BNDB 3QJJA 3GLGE 1DZ3A 1RUI1 5FJ4A 4CZ2A 4WFIA 4KR2A 3IBFA 1XMOB 1M5SA 4ET7A 3HWSA 1Z75A 3I9OA 5CW1A 3TB4A 2TECE 2ZUBA 4B2PA 2VFTA 2VHQA 1RHRA 2DCMA 2LIVA 4UDNA 1CAVA 1ULCA 3O2JA 5TMPA 4AVBA 4XEUA 3NBFA 4IFTA 5FUQA 121PA 3SHTA 3U26A 1B14A 1TKDA 1GZVA 3ZK9A 1RAGA 1GFF2 5CX4A 5FPPA 1DCSA 3DDNA 1Z8HA 1X5OA 1T9AA 1QP0A 2F3PA 3K1YA 4ZOCA 1KH2A 3MIBA 2ZJFA 4N5MA 4DPWA 3QLJA 4TWIA 2O67A 1ZVKA 3CUWA 4ZHRA 1UIRA 3AHDA 2IYPA 3ME2A 1SBDA 1GFSA 3PQFA 2Y6HA 1R6AA 2RONA 4HYYA 4GWNA 1P9QC 4KNVA 3DCJA 4PNPA 3OTGA 3OE7D 1VRUA 2OIHA 1C1CA 5E3CA 3LRXA 5BNZA 1F9FA 3H1AA 5A0TA 4RNNA 2OYSA 1SCDA 1VDMA 2F00A 4K4YA 5JASA 2DY9A 2QMUB 2R5FA 2G88A 5J2QA 5A8KB 4UUAA 4BKQA 3MAAA 1QWOA 1GT8A 3RJ2X 3ADKA 4LRYA 3MAAC 3TNFA 2X1HA 2DNGA 2A0KA 2LECA 2FPKA 1O5OA 1DOHA 3QUCA 4CR6A 2JIMA 4OV6B 2KT2A 1ABBA 4BQRA 1NLYA 3BWMA 4WDQA 3M1LA 1WP4A 4IG0A 1O8PA 1SCJA 3I4PA 4HC4A 3KQRA 1H4GA 3NHJA 4Q1VA 3GILA 4HZUB 2AKWB 2FSIA 2X58A 3D3WA 4PSKA 1OXKB 5AUPB 1SM4A 3BOPA 2HRCA 4D9BA 1G0OA 5FP4A 1HQUB 3MO4A 2KZMA 3MVEA 4PIPA 1XJAA 3W60A 4Z8XA 5J5AA 1NJXA 1GU7A 4YW6A 4P6QA 4Y3OA 4KXVA 2DWPA 2AGVA 3R7AA 3EGOA 1SG6A 4WN3A 4NOMA 3K8WA 1H8HD 2RG1A 2ZRFA 1T2FA 3SM3A 4MYDA 5LDDC 2IPLA 4MA0A 3D3EA 1NJ5A 5H16A 3BPSP 2MHCA 4ZP1A 1XBWA 1WTFA 4LK3A 1VMFA 2YY5A 4S05A 2OV1A 1VIWB 2HV9A 5ICEA 4FPLA 4DIQA 3LLCA 2X41A 4EO8A 1E59A 2RM21 1D1UA 4PAOA 3U37A 2WQ7A 2PUTA 3JD4A 2P69A 4CLHA 3O8BA 1XAGA 1WMSA 1XMQB 2VDJA 1ENZA 3RGIA 3GRFA 3TWIA 1LVUA 3KB1A 4EJFA 1NZAA 2FKAA 1LV8A 3GFGA 1F9AA 2ZW9A 2XQVA 1IHUA 1UY2A 3GEBA 3GXOA 3SVZA 1VHLA 4MB6A 4I6AA 1A7JA 2H4FA 2UYCA 4LCBA 4PXSA 1P0FA 3WHUA 2FJVA 2AK2A 4CDGA 1RHI3 1P3JA 2JJ1D 4PPGA 4LF2A 2GA7A 1OVPA 1TAUA 2CNKA 3GRRA 4HJXA 5JCJD 1P2SA 1V6LA 3N87A 4IKAA 2DPXA 3FTCA 5C0OE 2CYFA 1FX2A 1STOA 1K4YA 2VP3A 3OU2A 4AAYA 1YASA 3DBIA 6FD1A 2M1ZA 4G1PA 4RR3C 2V5DA 3DWEX 4PGHA 1CEXA 3UGTA 1CUVA 4AQ7A 1NKEA 3WF1A 3RB3A 5K5MA 2ZTUA 3IT0A 4F84A 4LE3A 3LP0A 1U5CA 1SQFA 5IM0B 3THYB 4IVNA 2AIRB 4N03A 4E13A 3E9MA 4UCWA 5K6RA 4OJNA 2PFWA 3EF0A 4NS1A 4K21A 4UTOA 2H1CA 4N7IA 2VBDA 2FX5A 5IHRA 3SZOA 3V1LA 5I9NA 1P5ZB 1FMD2 2NZVG 3GFVA 4B48A 4W5OA 4PJYA 2GRUA 3VVMA 4I2QB 3VMFA 4LF7J 4CYUB 3I6BA 4KWKA 3IO3A 3WSOA 1GPLA 3EZLA 4TZDA 1QVZA 4CL0A 2OUGA 3NT2A 1P6XA 5EHXA 2HIHA 5C8CC 1ZCFA 1U1PA 5B3KA 2WONB 1I13A 4DR2B 3I34X 3GLJA 4O29A 4UASA 5FZMA 1TC1A 4FE3A 5DI3A 3ZZUA 2WK1A 3TW0A 3ZIAD 2HA6A 1N6LA 3T34A 4ALLA 2CLKB 5K3FA 2R4FA 2JGFA 2XTZA 2MGZB 3OFND 5CFLA 2V2QA 2GHVC 4H0FA 1E5TA 1OQ3A 2F3TA 3JS9A 5CDFA 3NV4A 3Q8SB 3CRRA 4OCZA 1HK7A 2XUFA 4F4JA 4LBIA 3MJFA 4QU0A 2HSGA 5BSWA 5FLXY 2X5OA 4GMP0 3UMCA 1XTIA 2CDNA 3RGGA 4I0AA 2YINC 3BD9A 3LPNA 3ICEA 4J7AA 2NLRA 3VKGA 1G9SA 4ZDIA 2HHPA 3VGPA 3LLVA 3INAA 5JH7F 1CDEA 3DHEA 2R6FA 1H4SA 3KLSA 1T4MA 3OFJA 1UOBA 3ZWOA 1WC3A 4LW8A 1FNCA 1JYEA 1ST2A 1YI7A 5ED0A 3PUQA 4AZ0A 3TQIA 4EK2A 4TY9A 3X1XA 4J16A 1XU7A 3C6XA 3GAFA 3CT9A 2ZBUA 3RIXA 4GYJA 4J16C 3PX6A 4QLOA 1I2DA 4Q93A 1LQTA 2OS2A 7REQB 4ICIA 4KLCA 5D4OA 4FQ4A 4M7RA 3FWPA 1J39A 1RUD2 2UAGA 1JKHA 4OL9A 1FPN1 3FTNA 3ZSJA 5B7QA 3QJYA 2LKDA 2ECQA 3O73A 3LH5A 4B3RF 5JQGF 2RSQA 4YR2A 3K0KA 3RLFA 2HWC2 1U94A 4DJEC 4ITUA 2GP5A 4QHTA 2ORYA 5BWNA 3NMRA 4C14A 1LD3A 3K75B 1YFXA 3HI6A 3UQYS 1SB9A 4GC5A 4Z6KA 5KR7A 2JDAA 1FJHA 3W1EA 2PDAA 4UOJA 4HWGA 5FQOA 3U19A 4RF5A 1EB9A 2N4CA 3QUQA 5F2EA 1EETB 1YIOA 2C88A 1XD2A 4DFJA 2F63A 1VHFA 2WJWA 1MR5A 3F7MA 2FZKA 2YMLA 1VZ3A 5DT2A 2CWWA 3AKQA 1NKSA 1Y7PA 1WCIB 5C3OA 4I1VA 5AM5A 3UHOA 3CE8A 5IM4A 3C3WA 4RVSA 3REFA 2RSLA 1IUKA 1TJ4A 2C57A 1XTVA 1EI9A 3ZQUA 3H9QA 4TL8A 3VZOA 1QGED 3IAEA 2QMQA 1LSOA 1OE0A 1QMPA 1VALA 3S29A 1BKYA 2EWMA 3QGGA 2ZDQA 2G5PA 3M6IA 2ZHKA 3M6UA 5HRAA 5GZDA 4YMGA 4B7ZA 4CCAA 3KNGA 1JDBB 4UAPA 2DNYA 4K9RA 5H9SA 1KOGA 1S0CA 1RTVA 4G23A 1TT5A 4OHCA 2D97A 5IXYA 1R8JA 3USSA 1NNUA 2VXYA 1WCXA 4CLDA 5LQDA 3TL6A 4RS5B 1I7LA 3TSWA 3A70A 2GCOB 3BH6B 4FB4A 2Z6VA 3L4BC 3TA1A 4L99A 1T0UA 3CX8A 3UGFA 3T35A 1VK3A 1RCOB 1RT5A 2R66A 5KOHA 1MVNA 3EIFA 5FPXA 1BAPA 4NPLA 2TBVA 3F7OA 1FQJA 3W8GA 2VSNA 4DCVA 1KFSA 5TY0A 2O59A 3A1UA 2GVDB 3T4HB 1DRJA 4LRWA 4ZV4A 4G6VB 4TMFA 3UV6A 4H4KC 3LFTA 1IDOA 3U3DA 2QN9A 1OWXA 5CCLA 4ZEVA 5ETJA 1G8WA 3IVXA 2EXKA 3ZN6A 3K4PA 2EWVA 1W19A 4BMCA 3BZWA 3KQWA 3VBRC 1NQ5A 2CPDA 4J9OA 1UXHA 1JMVA 3ZBPA 2FN4A 1HTBA 4HSGA 4ZHQB 3A13A 3PT9A 3UL2A 1OV4A 2IS4A 2HJHA 1QUEA 4LXQA 1M6EX 4DG5A 4LE0A 5E9QA 2YPDA 3WW2A 3GG1A 1N2XA 2QI9F 4GB31 1HBOA 1GQHA 4DSKA 4LNUB 2HBZB 5FYVA 3DKQA 3HBZA 4D45A 4ZEWA 1JLEA 4J75A 1UINA 4O2BB 1AJOA 1T9TA 2C95A 2QN8A 3IIAA 2OZVA 3WQHA 1B16A 4CMCA 2C1FA 5B6IA 1D09A 3OM0A 1VGRA 2LQBA 4H3WA 3RZJA 5GAJA 3TLKA 1C5HA 4QGLA 4IUCS 2EZ8A 5FWEA 2P17A 3SSQA 4GUDA 4ZYZA 3ZN4A 2ZMKA 5C4MA 2FEPA 4RIFA 4B7AA 2IPOB 4CMAA 1Z4UA 5I7WA 4DMHA 4EA8A 4GKAA 1CPZA 1RDFA 2OZJA 1QP7A 3I0SB 1I6WA 2ARXA 1G4HA 1JBKA 4K6KA 4Y6RA 1RUI2 1JXEA 4HRYA 1BRTA 1T36B 1XCLA 2QAJA 2AMVA 1E5SA 3JR7A 5C8YB 5L46A 5FOVA 3JU9A 3B1ZA 3LDKA 1NUTA 3B53X 3IBGA 3GJTB 3QBDA 3HT3A 3NI2A 1ZTWA 2G1MA 2B4UA 2XWJB 1ISSA 2P6TA 2JA1A 4FF1A 2J30A 2JFNA 3GNSA 1T6YA 4HGQA 4L95C 1NW3A 1N6QB 2DCJA 4F3OA 4IW3A 1IBKB 5CEHA 3COYA 1UNBA 3ZO7A 3EMKA 3QFCA 2JJ1A 5A6VA 1LI7A 4MCIA 2M6SA 2ZRGA 4B6PA 5H3LA 5I93A 2HHVA 4GMXA 2AOTB 2RNEA 4EHIA 1KSGA 4M8KA 4IRKA 3ZD6A 1PFGA 1FYEA 2ZJPQ 2D0PB 3OY8B 4GNKA 1NAIA 4ZO6A 1W28A 4GAEA 2EKLA 5F7XA 1SKBA 3JX9A 1NBEA 1J00A 1YB4A 2Q2OA 1ZM4A 2HJ9A 3FAZA 2ZVQX 3GRZA 2QRRA 3RRDA 3ZNNA 3C14A 5JZGA 2QUOA 2PSJA 4CV2A 1MOQA 3M1VA 4ZDWA 4ZCPA 5HJEA 4KGQA 4O3NA 4OQJA 1VRH2 3ORSA 2CPXA 1L7LA 1EZ4A 1YJ8A 1A2BA 4OZ5A 3DFZA 1R0CA 1T4CB 3QE4A 4CKCB 5F64A 2BQ3A 2J48A 2QFJA 2WWVD 1WCDJ 1HYGA 1YR1A 1DQ9A 1GTHA 2FZGA 2HMTA 1NYQA 2PC6A 1Q15A 3NBKA 3PC7A 4V38A 1EUDA 3PHGA 5LKRA 4DZDA 3DE2X 5B12A 1SUWA 5FY8A 1FNMA 3U3MA 3NANA 2O5CA 3ME5A 1VLMA 4P9GA 4MHOA 3ZNJ1 4IJWA 4QM9A 4HT7A 4O3QA 1N9KA 2Y6UA 2FHRA 1JYWA 3LU1A 1JR4A 5KT5A 2PN1A 5BRNA 4DUPA 4EL0A 3TWZA 1XAHA 5KVSA 4PABA 4OF4A 4I55A 1Q0UA 1UZYA 3R5JA 4C01A 1TUBB 3BB1A 1REVB 2NYUA 4CM4B 4XW3A 4O4LB 1XQVA 5F3EA 4YP1A 3LHDA 1PIV1 4QJ5A 5FJKA 2M5YA 1XN1A 1SUSA 4B3MB 4QFDA 1DO0A 3O7WA 2XYPB 1PMIA 1W29A 3L7BA 2HQBA 3OZAA 2W2QP 2WZR1 2HBYA 4JZRA 3QWHA 1F5JA 1DC6A 2CLFB 1Z29A 1LTEA 5ITZA 3H13A 1C1DB 2C1EA 3G6XA 2ZH1A 3GCXA 3S1SA 1TQ8A 4TWZA 2XMTA 3KT7A 3JTOA 3GLGB 2SNIE 1KEPA 2I2BA 1AO3A 5JXJA 5AT1B 4WASA 3LP1B 2V5AA 3HHEA 1JGTA 3CPJB 1REEA 2E48A 4AI8A 1C8LA 2QLMA 3N9NA 2EERA 2DHXA 2J85A 3IDOA 3KSRA 2FJUA 2IJFA 1DXOA 3RHTA 5BNPC 3ZGXA 3A14A 4MMYB 1BU5A 1KFKB 1E2PA 4A92A 3GT4A 1E62A 2FDIA 2NS1B 4C6RA 2OVUA 3OEEA 1AZSC 1XRPA 2VDKB 1Z83A 4P32A 3G0DA 4YR7A 4AL6A 3H4DA 2JIGA 1L3BA 3OLQA 1UEJA 2J3KA 2WNEA 4B9SA 2MY7A 3AX6A 4CO3A 2IA5A 1Y4ZB 3U3RA 2JFDA 4U2DA 4LE1A 1AR93 1OX6A 1GPAA 1P29A 5HP1A 2R32A 3EUWA 4PN3A 1YI1A 3K4AA 4PRYA 2UP1A 3DDHA 1NVFA 4QPIC 4AJNA 4BMZA 2AE2A 4NZZA 2JIZD 3LNTA 4F4XA 3NOVA 1QFXA 1VC6A 2PKRA 1T5IA 2GCPA 1TYAE 2V09A 3CLSC 4KGDA 1QAQA 2O7VA 4PX2A 5EHHA 3DHVA 2VMHA 5ESWA 4FHEA 3VH3A 3CH7A 2WJJA 3EPJA 3L5KA 2KM1A 5BQ5A 3M3OA 4FYVB 3H0PA 4XPVA 5JIUA 4NENB 4NCJA 5KS2A 1UKBA 3U49A 4RPCA 1QQP2 3VBCA 4WBNA 1FTCA 2ZIUB 1KAMA 4MSUA 4TLEA 3G49A 1A1SA 4Q5OA 2FWBA 1MB0A 4HWKA 2O7SA 2VS1A 4YUVA 4WA8A 2BPA2 4K28A 1ZH4A 1Z22A 2VMEA 3NO4A 3CO2A 3H5YA 1P74A 4ZOLB 5TGTA 2HOQA 4ECUA 3WL4A 1DAEA 3M4NA 3OCVA 1H74A 3ZW7A 1C4OA 3REOA 2OT7A 2VHJA 2IV2X 5C7GA 1RC1A 3COZA 1NXTA 3MELA 1Z28A 2BGJA 2RG7A 1Y9JA 3PNIA 3Q8WA 4EHDA 3LCPA 4XPCA 2NIPA 1XMJA 4E2FB 5KWSA 1T8WA 3P9RA 3TZEA 4K5SA 1DQYA 1JLSA 4ILRA 1T5TA 4IKEA 1MMDA 2PKQO 3SCJE 4XAKA 3ZHXA 3ETQA 4MGYE 1MGOA 3UK0A 3SI7A 3PKIA 1N5QA 3RB6A 4DNYA 1TKXA 1Z26A 1EFVB 4HZGA 1NXD1 3UB2A 1QQP3 4OZ1A 2E9SA 3T41A 2UXCJ 2MMGA 4R0EA 2GQ0A 4HFRA 3VDQA 3M1AA 4RPJA 4IJMA 1TME1 2AZ5A 2UVPB 5FYZA 2MLXA 1PRYA 3GUVA 1PGJA 4KOEC 5IBCA 2Z4PA 4Z54A 5A02A 5FDFA 3N7LA 4XF4A 2ZH9A 2BKPA 4CTMA 4LK7A 5HK9A 2VZUA 1N3PA 3GELA 4XVQA 2NTJA 1ODFA 1SU4A 3S4YA 2P2LA 1MFZA 3R5XA 1ZI8A 5A9RA 2OD6A 5ALRA 4MDYA 5JD3A 4XJAA 3CVVA 4L11A 1K42A 3ANYB 2GJ8A 3U80A 1AYM1 2XVYA 4ER8A 4G0NA 4JJEA 4FMDF 3FFZA 1ZMOA 2DPHA 4MVJI 3FDIA 1JHYA 1P4GA 1AG9A 5KYYA 4JQTA 4BNGA 3ZFFA 3TTXA 3O93A 1EARA 4NIAA 4LC9A 2FDNA 3AR6A 5B64A 5FPAA 2HNAA 1QS0B 2ZITA 2W6OA 1PS9A 4N4AA 4DL7A 5IUQA 2RHOA 5CJJA 1PZMA 1H6YA 3NRBA 2ZB2A 2DLCX 3ZWDA 1CJUA 4Y33A 3NNHA 4LLFA 2ORXA 3HVWA 4JI8B 1LNSA 2GO9A 3W5NA 3Q2IA 1MZVA 1R0RE 3CGWA 1BMTA 4U1RA 2LDBA 2NP6A 4HDRB 1XU1A 2RAPA 4IQ0A 2OLJA 2KL8A 3AONB 2VBZA 1RRGA 1XCJA 4F0JA 2XUGA 1FZTA 3UKTA 2A78A 4Q3BA 4XR4A 3WKBA 4RD7A 1DPFA 1NE6A 3A6PC 4BMSA 2Q8QA 1BQXA 3L5OA 3CKLA 1YHYA 4U3JB 3I9ZA 1BVP1 4W9RA 4BY9E 2VJMA 3CD0A 3HDQA 3UCXA 1E1CA 2HHHF 1AVBA 3H19A 5EYYA 5E6SA 5KWJA 3A11A 5A70A 1DX6A 3W9SA 2DEJA 2EFJA 1HIYA 1SN7A 4DUYB 1TM3E 3WJ1A 5JOXA 4GB32 3U4SA 2QQMA 3PHIA 1AGPA 3PENA 2D9PA 4GMDA 2UXBF 1BVRA 3K9LA 3RS7A 4JDMA 2K46A 3L7NA 1CJKA 1IC6A 2RAUA 2HU8A 1RUSA 4WBNF 4NU8X 5AE2A 3INRA 1IWPB 4GT1A 1CJKC 1YZNA 3R5JB 2I2SA 2YKOA 2BN4A 5J58A 4RGKA 2J0QD 2X86A 3FETA 3GYDA 1UAGA 2GZAA 4OLAA 1YIFA 1Y3DE 3TPFA 4P35A 1KK2A 5LCXA 3N2YA 3P71T 5TGDA 1LSUA 3UWSA 2CZGA 3VO1A 2A9RA 5K0JA 2KI5A 4Q9DA 4DV5F 4FFGA 3NP9A 4BPBA 4FYYB 3PFKA 3N0VA 1EDDA 3F7NA 3ENQA 3T1YB 1JLCB 1UBEA 1SLTA 5A5FA 1W46A 2NYRA 3CTPA 3WP0A 3LUKA 4YN3B 4BRUA 1EIWA 3DQPA 1NE7A 4LAFA 5JSQA 5BVHA 1NA5A 2PZFA 5JCZA 1SH2A 4DSTA 1IQTA 3LVBA 3MAAB 2CNNA 4QWMA 2A35A 3GB0A 3WJ7A 3RMYA 1ZHHA 4DR7J 1GX6A 3MLBA 1UDCA 1J97A 2UYGA 3LCRA 3K5OA 3HMJG 2MU1A 3Q40A 1Q11A 3TVTA 2GDJA 3K5WA 1C30A 2HQOA 2UYQA 1SD2A 1EQ2A 2GYVA 2FLKA 3B6MA 3CNNA 4BO8A 3L4EA 2XVGA 4UCXA 5KJ1A 2ZUUA 4RNCA 1QOOA 1JDBC 1ZFNA 1LWEB 4PYDA 1E3WA 1NR5A 3MCTA 1DKRA 3CDWA 3CZ9A 5BY5A 2QM0A 2VPXB 2YFHA 4N12A 1EP1B 2NSJA 1CUEA 4F97A 4BLWA 3JV7A 2CVZA 5BNWA 1Q86T 1LWNA 3VZDA 3VBHC 4DMIA 2VG6A 1E9FA 1B8PA 4CDXA 5BSKA 3ZTTA 1H7WA 3OPNA 1VZ2A 4EPWA 5MLCV 2E0IA 1PTJA 1UY3A 2WKPA 2CJXB 2ZJ0A 4YLEA 3D54D 2C29D 3ZJTA 1RVF3 1PLKA 3MLAA 2VTXA 4EZ6A 2DVMA 3E5NA 4TS4A 3CNQP 3H40A 1YS4A 4FWIB 4OQXA 5KDLA 3EQ6A 3DE3X 1W6MB 1TRKA 3HYTA 4KQXA 3KSMA 3L8YA 2VFSA 3LGHA 1H6BA 3FHCB 3ZHTA 1WU8A 1V6OA 4CM5A 1CU1A 1I1OA 2ASEA 2CXQA 4YAIA 3TQTA 3Q8VA 2WMNB 4Q3DA 1MABA 3U7HB 3RJZA 2O5RA 5JSRA 1JR3D 3ZHZA 2GHIA 4WBBA 5GMDA 2AN4A 2GMHA 2RRNA 2BMAA 1J1ZA 4CLTA 4IL5A 4Q82A 3H7YA 2GD2A 2CLIB 2O8NA 3WNBA 3ZU2A 1Y4UA 1L8AA 3BGOP 3PSHA 1SACA 3D8TA 1JLEB 5AI8A 2MZTA 5DM4A 3IOMA 3POIA 3QLTA 3C5EA 3ZFGC 3C4JA 3HDHA 4EMSA 4X4RA 2QTMA 4MULA 4YMUA 4FYXB 1W6NA 1OY1A 3HVTA 3KT8A 1YBHA 1WEZA 2YN4A 1Q5VA 3MFQA 2XONA 4JKKA 4F5DA 3H5RA 2GB4A 3LCMA 1C9MA 3QSGA 4QB1A 2LVBA 4X63A 5FK8A 3W5VA 3JSMB 2V4ZA 1M2NA 4KC0A 4BO9A 3RS6A 5C5TA 4Z4EA 3KLVA 4XJVA 1GPNA 2N46A 1FSZA 1U2EA 4NCAA 5GONF 5IYZA 4QTZA 4KX5A 1Q8KA 2Y3YA 1TCVA 4Z9YA 3O3NB 3ZV6A 4ETNA 3H99A 4Z2AA 3TRJA 4EN9B 4BQ5A 1VP3A 3AERB 4DS0A 4XTCS 5CBLA 2PQMA 4R2HA 5FMCA 5MHTA 5T6BA 5E3QA 1QE3A 4A8JA 2BP6A 3HCPA 2V59A 3HQRA 2PMWB 1E1RD 3QQCD 4ED6A 1TJNA 3UPFA 3VX4A 2FN3A 2FZWA 2PH5A 1RHMB 3QAEA 1UFOA 4YYEA 2R6HA 4BV3A 4NVPA 1V37A 5E2BA 3A2NA 2VRWA 5HGJA 1ATZA 1Z4KA 3SSAA 1C1FA 1L4LA 1ZGBA 3G7NA 2RS33 5DTEA 5J2TA 4F83A 1D1SA 3MM9A 1WWKA 2WMDA 1W39A 5E1RA 3VUEA 5IT5A 3AKRA 5H1SV 2GM5A 2WS93 5D4PA 2RB7A 1MN6A 1SH7A 4IV1B 4PG8A 1VE1A 1VBC3 5FXZA 3HJVA 1VBE1 4NE9C 1Y6ZA 2VQSA 4K4TA 3ILFA 2R7LA 1H1AA 2LKZA 2F6BA 3TVKA 2D62A 1HRV2 3UM9A 2BTOA 3MHPA 4OX6A 2WIIB 3GV5B 1MU2B 4KQHA 4DCNA 3A1TA 4KXNA 2ASDA 2W90A 1VQLS 1DKNA 2PSFA 2H5JB 1GYRA 4EBDA 3BOSA 4V39A 2VNOA 3P2MA 5IUNC 4MCJA 1WKKA 4TMZA 1UODA 2YJ6A 2KLBA 3BPZA 4NL5A 4NLTA 5JAMA 3KLIB 4QG3A 5EIOA 4ER6A 4MK8A 1DRVA 3UFBA 3ATGA 4L8VA 2XR1A 2HJSA 1ACMB 3VM6A 3SCGA 4NLDA 5D21A 5AE1A 4Q47A 4Y2TA 1LPOA 4JUCA 4TWJA 2XUPA 4YDXA 1K3IA 4OBEA 4LNUA 5C4IA 3LDRA 1U5BB 3D6HB 4HQ6A 1ZQ1A 4DC0A 2A6PA 3OWHA 4HYQA 3EJMA 3R8FA 4WF9Q 1C0TB 1WZIA 3ZHRA 4LOTA 5FUBA 4WFQA 3TNLA 4UNIA 1BXNA 5BPHA 2VR4A 5A5EA 4YGEA 2N0SA 2DBVO 3C24A 5FWAA 1ADYA 1Z18A 5KG4A 2WWJA 4XDCA 3HC7A 2IH5A 2OV3A 3ER6A 3SCKE 1SU7A 2R043 2BFEB 4MWZA 1Y33E 4Q4AB 3NTQA 1C3HA 1JODA 4NEGA 3UMFA 4E4RA 3AVWA 1B64A 1JJFA 4ZRMA 4EG1A 4FJ0A 4CL2A 4YLZA 1X19A 5EPAA 1IK6A 2ZE2B 4YMHA 1E2BA 1MC1A 1V1MA 5KAPA 1DQ6A 4ETMA 4GYKA 1BE4A 3V6DB 1QIIA 2ABWA 3O4FA 2HU5A 3AUYA 4H4CA 3OTOF 1P2UA 5F5XA 4ED3A 2PZEA 2WFF1 4XB2A 1V3VA 2YC0A 3T7IA 1A27A 1ZM3A 4O9GA 1P1HA 1H42A 2EICA 3UZUA 3O1SA 1SIWA 2RCYA 4P0TA 1IHMA 2VVDA 1EAH3 4X4OA 2VDOB 1T95A 2R87A 3MBOA 1TK3A 1H65A 1FJ7A 3NWKA 2Y92A 2KT3A 1PBAA 3PEEA 2ISQA 5IK7A 3ACLA 4PXAA 4ZP7A 2JFFA 5TV2A 2Q7DA 4PC3A 3MMCA 3DYIA 1NSQA 3LC7O 2WAOA 5EYXA 2CFRA 1GRVA 1E6EA 1T8TA 1JLBB 5KPJA 4JI1J 4FVTA 5HV4A 1YCDA 3E18A 3JVUA 4CEYC 2B7BA 2C5AA 4EW3A 2R2TA 3OFNA 4JLPA 1IQZA 4X64B 2XNKA 4EBEA 4F4WA 3KKZA 4KTTE 4URFA 1EEHA 1XOIA 1N2GA 4OJMX 3OQVA 3ZZTA 5JR7B 2IXLA 2WD7A 3P26A 4YXWD 1AJKA 2A0UA 1UPSA 1KR5A 1UZUA 2ZBFA 1UZDA 4L51A 2ROQA 2H4WB 1HLDA 5L1LA 4OULA 4FT8A 5EZYA 3ZO0B 1ICEB 4WFJA 2PX0A 1A9NB 4QCLA 4TPKA 2BFFB 5D87A 4YJHB 1NJ1A 2ZR0A 4RQPC 2FA9A 1HDZA 3CKKA 1LENA 1WPXA 2BHLA 1HR0B 5DN6A 3ETHA 4K0RA 5CA0B 4X4NA 2C22A 2ZKNA 2FDXA 1QG6A 2R30A 3KU1A 4MVJA 3A4TA 4U7FA 4DQKA 4EYIB 4MUMA 3KWLA 3W5AA 1RYBA 2MHNA 4ADSG 1WXXA 3PR3A 3F3YA 3W2WA 3U61B 4HN4B 3MT7A 3PFGA 1QFYA 3ZGZA 4A45A 1S9EB 4QDTA 4EF5A 3DVSX 4LBJA 4ZLJA 2I6GA 4B6SA 5JNRA 2AWNA 1AXZA 1WDMA 2RGXA 1RZRD 4R9BA 4LBMA 4MR7B 1BE1A 2IC3A 5H70A 2ZYWX 1YVFA 4I55B 1TTHA 2CF5A 1PG0A 3HCWA 4I8XA 1MQ9A 2Q6KA 3C5WP 2IU3A 5LZ6A 3BO4A 2P9FA 2B9YA 5HM8A 3CO5A 5M2RA 1FNYA 1KJNA 3UT5A 3NDIA 1CP2A 3CEPB 4LITA 4QFMA 3AJ2A 1WQ1R 3DZFA 3BGDA 2QTWA 1K8QA 2JIOA 3MEQA 3HQXA 1M6VA 2MKKA 4NEZA 3BK2A 1I2ZA 4Y5Z0 4BAGA 4ZD6A 1UU4A 5TNXA 3SR0A 4YB5A 4X8PA 5B1DA 2R65A 3KOOA 3VDAA 2AGPA 3TJ9A 3N2EA 1U81A 4TMYA 1GRCA 2PZJA 1W3XA 4LXGA 1GICA 2Y0CA 1F2TA 3VVUA 2V7WA 4WFKA 2HRYA 3KXDA 1PK6A 4XABA 1KQRA 3PX0A 2GUGA 5AI6A 1JI6A 2YFUA 3OW2R 4C5BA 4WM8C 1BMV1 3HJBA 4I7FA 4GMFA 4B09A 3VD3A 1AR92 1YCGA 4D92A 2Q79A 3CEWA 3LW5C 1XF1A 3K59A 4JVOA 4QR0A 3SK0A 4ZT7A 5KXDA 1OMIA 3UJQA 5KFYA 2FUNB 3ZXEA 2XLIA 3GMDA 1IZYA 1TO1E 2BGOA 2O1PA 1OFGA 3FUTA 3CZJA 5HE9A 3B00A 3ASYA 3EEOA 3NC0C 3V6MA 1NVGA 2VUJA 3J4UH 1X42A 1Z4LA 2HBQB 2AP6A 4KV9A 3VGUA 5D8HB 2WJHA 4HAWA 3GCDA 4KQMA 1P81A 4EVQA 3MRSA 1WF2A 3UQZA 5FA5A 1BYHA 1TE1B 3BGFA 3QM1A 4HXCA 1IKWB 1QZZA 4FDFA 4FNOA 4AYTA 4MK4A 4JBCA 2A94A 1R9JA 3H3FA 1GAOA 4Q4DA 2ICAA 2Y1XA 3PCXA 3FC9A 4RKWA 3NHRA 2AJTA 3FHAA 4KIWA 1W5SA 5GVRA 1TEIA 1W6QB 1Y8RA 3S8SA 2XUDA 1MQTA 2VQ3A 4F38A 1HRDA 4GR5A 1R27B 1QE5A 1I2MA 5AVOA 1VL0A 3TZBA 4E4DX 3C87A 1V25A 1SVDA 1X9MA 2VPQA 4LQCA 2MKHA 1GNHA 2LCQA 3FMPB 3ZDCA 1OPOA 4IDOA 1N8RT 4CV3A 3ZXWA 1C0PA 1JHJA 1JAXA 2QN6B 2C99A 5FA6A 3Q4GA 5CXUA 2R3SA 2E7AA 3KAPA 2EJBA 2VT2A 4U2CA 1N7HA 1PC5A 3KJFB 2D5IA 2KJWA 2F67A 1RWXA 4EJ0A 1XEFA 5ALNA 3PHHA 4D3GA 1SNYA 2WM9B 3VOBA 1EPZA 1PILA 3WKAA 5L7OB 1QNWA 621PA 3MWDB 5IT9U 1M3SA 4YQWA 4WOPA 3Q1KA 5ALKA 5DM7Q 4KP7A 5BRJA 1C5KA 4GKJJ 5CTAA 5HK8A 1A0OB 3AP6A 4EHHA 5DQGA 1H85A 1WD4A 1C80A 1JQ3A 4DBLC 1V1MB 4Q02A 3J7HA 1LXCA 4XD7D 3FYDA 1DHRA 2JFQA 5K0FA 3AUFA 3U48A 4V3CA 5GPBA 4P4TA 1C1BB 4DNFA 2CQCA 5A6ZA 3PJXA 1RT9A 4IIDA 3GLKA 3VOAA 4YJGA 2HCTA 2JC0A 1P8GA 4CM4A 5BSMA 1HB3A 1VA4A 1FRZA 3I3OA 3X1YA 2CFTA 3GQBB 4I56A 2XR4A 1PS8A 2VW2A 1X36A 2WUWE 4Q39A 3DGTA 3B9BA 1USUA 2I0FA 1YS7A 4RV9A 1QDUA 4GALA 1PZ9A 4LRXA 5TE9A 3SBXA 4GWKA 4TN5A 2QRZA 3P5BA 4QPGB 1N32B 4RMNA 1Z36A 1HLGA 1FKOA 1RP7A 2O05A 4JVSB 1OYDA 2OHXA 1N2BA 2VDQB 2ZTMA 4P3PA 3ZR5A 4J5OA 2X0NA 5SV5A 5BYSA 5A3NA 4M98A 3T1HF 2UV8A 2GVDC 2OFGX 2QBYB 2AJBA 3WICA 4TZTA 5ALPA 3CF4A 4N90A 1G4UR 4RUCA 3RBZA 4UHFA 4FBLA 2XJUA 3PL1A 3OZBA 2VICA 3JD2A 3THOA 3KV4A 4RPKA 5D78A 5KFSA 2F1HA 4YW5A 2EC5A 1ORHA 3HKDA 1R0CB 5H9RA 5BORA 5A5DA 2HRRA 3UHFA 4P74A 4CKBA 1MQSA 1SUAA 4OMDA 3DMJB 3IVAA 2H51A 4R4ZA 1IVNA 5FO8B 2AUMA 2P27A 2WB1D 5A6YA 1LU2A 2BMBA 3RSOA 4MKIA 2NTNA 1VG8A 2FCVA 3ZNPA 2P6CA 5CZXA 4J9PA 2X1FA 3W5BA 3AH8A 1B6GA 4B9AA 4B1LA 3FUOA 5BW4A 1GBGA 2WKRA 3BIWA 3CR3C 1RPAA 2JE9A 1AF9A 3WP4A 3N36A 2Q5FA 3NW4A 3FOAA 1JW9B 3IUEA 2KH9A 2NZCA 4RU9A 3HDSA 2ZTLA 2NVWA 4F2HA 1B8UA 3MEKA 3ZXYA 1ZA4A 1YOVB 1KC8T 1QM9A 1UQUA 3M3PA 3QX7A 1ZHFA 3WLNA 4WZQA 3OZTA 5KQSA 4ZLNA 1XTUA 3CPHA 1RI4A 3FXAA 1PG5B 1IBKF 2Q3DA 1QIMA 1M7GA 4XYEA 4B3HA 1J2UA 5LQJA 2E4ZA 1G6KA 1W6NB 4KQ7A 1NSPA 4MQBA 2ZJ3A 2EGUA 3MPDA 3I6MA 1KRXA 3HJTA 1US8A 3QJGA 4AZ3A 2GIFA 4WNAA 2VHUA 2J45A 1C4CA 1KBOA 1LFAA 721PA 5T5LA 4DDUA 4GVBB 4GMP3 4MR8A 4ZT2A 1D4M2 5B1HA 4KO1S 2WZR3 1C8KA 1LKZA 2GVZC 1U1LA 2W2TA 1Z4PX 3TAQA 4RIIA 1ZJZA 2E21A 3AHFA 4Z9XA 4V1CI 1E1DA 1H2LA 3ACGA 3AZPA 3R6WA 1NI3A 1C0UA 2BHNA 4IS2A 1QNFA 1RPJA 1XWFA 2B1QA 3ICWA 1ZD9A 4NCGA 2I5JA 3T7AA 3N7KA 3KCNA 3AHEA 4UOZA 5FJJA 3AUJB 1QTIA 3EC2A 3T6BA 3PHBE 4GW3A 1WLCA 3MM5A 1DJOA 2B0GA 4KYIB 1KTIA 1PMJX 5JATA 5LEJA 4M4RA 2ZI4A 1GKYA 5IF3A 3RUPA 3I4IA 4RKEA 1MO5A 1BKZA 3VPHA 1TLLA 2QL7A 8GPBA 3GX1A 1D7OA 3NATA 3SFUA 1B3BA 5AR1A 2P3LA 4E2SA 3O74A 2U2FA 1IONA 3KLPX 3L49A 3V4IA 5D3MB 1FMCA 2X3FA 4AD8A 3NOQA 5CG2A 4NHYA 1OI2A 2XZDB 4CFSA 4CG3A 3ODGA 3AG6A 1JMTA 3MGJA 3KPWA 4COVA 1OIVA 5D7BA 4JV4A 2B3TA 4CT8A 1CRWG 1U7HA 1WE2A 1WKCA 1X77A 3RUHA 1X0PA 3JVVA 3QI2A 1ZZFA 3QI7A 4GZ3A 1NBOA 3O2NA 5K1ZA 1E9EA 3M4YA 3NV3A 2CYYA 4HFNA 4A6EA 2ZGLA 2N3OA 2XDQB 3BM7A 5BYBA 3GARA 3BN6A 4Q26A 4TLGA 3EFHA 1PT7A 1V2HE 4Q5IA 2K5UA 2WE8A 2DSNA 4M5DA 2XD9A 1N32F 2QVCA 3OMXA 3T1VA 5FJIA 3ZEAA 1W6QA 1L4YA 2K7JA 1PDVA 1MB3A 4L6CA 2JFHA 5HFNA 4G1MB 3TDNA 3DC2A 1UF9A 3Q8MA 3QWPA 1ZW6A 2JLRA 4G65A 2CJYB 2AJQA 3LD9A 2U1AA 3EM1A 3NXSA 3CW9A 3FHQA 4N3AA 1KEEB 3HCCA 2NUAA 3W63A 5BSHA 4DXRA 2VDNB 3SV4A 1FFGA 4HT3B 3Q0AA 3TUPA 2XBO2 1C0EA 4X7MA 2AYEA 3MEDA 1JIVA 3ZWVA 2I9PA 1GANA 1RWMB 4U00A 3KJQB 3P3NA 2XLJA 4L27A 4PG6A 1HR0J 4JJ8A 4Y3CA 1FDVA 4ECTA 1UC4B 1H3DA 2ZUWA 3FROA 4ALIA 2VDMB 2Y93A 3VB9A 1TU3A 3DMPA 5HVFA 2A59A 2E4VA 4PIZA 1D0VA 1C8M3 4UMEA 1A76A 4QPXA 3N75A 3BERA 1BWQA 4JI2F 5DGTA 1V96A 3R0QA 3Q3GE 5AC93 1A5TA 2VTDA 5ETKA 4LSNB 3THVA 2DVAA 4LOAA 4FF3A 4BXOA 3ADOA 4YFWA 1QVAA 4BCDA 5GOTA 3IPXA 1JHMA 1W48A 1XE7A 3NL0A 1PJSA 3E81A 2OGUA 3GEMA 1QXSA 4LBWA 1A88A 1N25A 5ECDA 2V8VA 2YH2A 3E9CA 1ZM7A 3W2EA 2F3RA 2DNLA 1XSQA 5GALA 1W47A 3GBGA 2JHPA 2X2PA 4WKNA 4KL1A 4NMXA 4OY3A 2PHXA 4MMOA 5FZ8A 4NAHA 2Y0IA 2ZUDA 4ZLPA 2PGLA 4LPSA 5DBEX 3MUVP 4RGQA 5B3JA 1XPJA 3TTSA 1A8UA 4TVAB 3FNHA 1E0JA 4YT2A 3M2UB 4QQNA 4ECWA 1HQYE 2AJ0A 3O0XA 2WU8A 4OMCA 2QN2A 3DQQA 4X62F 4HVRA 4IO0A 4XOUA 5FCDA 4Z0NA 1FOD1 4BVLA 4MKFA 4TSRA 4W9NC 1AMNA 2YJZA 4MI6A 1HDGO 3VNRA 1MU2A 1S89A 3CUNA 2FY1A 4MIEA 3NUQA 4CDQB 4UT4A 3T52A 4HAYA 2C8LA 5CMLA 5JIAA 3HKDB 4NH0A 5D6GA 4PS1A 1SU6A 3R0ZA 1V11B 4UF4A 1NZ8A 2JFXA 2JI4A 4N40A 5KYNA 1I5EA 2VA9A 4Q0QA 1YB6A 5AW6A 4RH3A 1N5YB 3GH1A 4GKKJ 1PVC1 4FMCB 4Z0PA 2M9KA 3EGNA 4RWWA 3BMCB 2ZI3A 5HCHA 3IGFA 3NSTA 1F2HA 4F46A 2CVEA 1QH1B 4KGKA 1OIWA 2AUTA 2I7CA 2EL9A 5DWVA 1FFWA 2HHJA 3MXTA 3TXYA 2QLFB 4DV0J 5D5QA 5TMEA 5KO2A 2W8BA 3QBEA 3SYKA 2Y0EA 4G26A 3VJRA 4DM7A 2XA1A 2E7TA 2IKQA 3TEWA 1YVDA 4QYZJ 4G5QA 4I1TA 2ZEYA 3AUSA 1FKPB 4J6GA 2VOWA 2QL5A 2OSBA 2CV0A 5TMBA 1SLBA 1QDCA 4Y2HA 1VB3A 2BEUA 4AXXA 1YS9A 1AUYA 4XJXA 3DDWA 3T5HA 1VPEA 5K09A 3O0WA 4HVOA 1SC4A 3R7NB 1DPGA 2R1VA 1IVSA 5E1MA 2WN3A 4P3NA 1BXGA 4UZEA 1I3HA 1IIRA 4AN1A 5UKDA 1NLKL 1DEAA 5KTOA 2WFMA 2DTYA 1UWBB 3P5BP 3HT2A 3RRKA 4U7PB 1NUKA 2R62A 2DULA 3QFHA 5MFPA 5EMHA 4PE5B 3UVEA 4YZ2A 3DFKA 5BNPB 3AD9C 3QH7A 2H48B 3M4JA 4HZFA 3FMFA 3HO1A 3VR3A 3QXXA 5DDRC 1LQ2A 2AK3A 3PD0A 3H25A 3BWDD 2R2UA 1WEKA 3WYAA 4IDAA 4AULA 1TYZA 1KQNA 4YAJA 2G2ZA 3HNMA 1EFPA 4FDTA 3RS4A 3DYPA 5BV6A 5LXTA 3UMBA 2E33A 4NBRA 2G67A 3BL6A 5DG7A 2WS92 3IQGX 4MVYA 3WNMA 4Q43A 4RGYA 4X0EA 2F6RA 1RAFA 1NN3A 5ALFA 5SV8A 3AB4B 3C16C 2J3JA 3QIDA 3DT9A 5JTTA 4CNBA 3TA2A 4DRXB 1MKYA 2H57A 5DP2A 4ISQA 1WVGA 4LDJA 4O3FA 5LIPA 2YRFA 4CZSA 1AL23 3OLZA 2CXNA 3MM8B 2M2BA 2PYTA 3GRVA 5KJEA 4B8EA 1NT0A 3T0GA 3AL5A 2VRCA 4YMWA 2EEPA 2IXKA 3P3DA 3TLEA 1X3SA 1JVSA 1P7CA 2CWDA 5CH8A 4N6GA 2IYNA 2Z58B 1JOBA 2K06A 2CFCA 4I5DA 1P7VA 2NU7A 4JV0A 3MQFA 1Q6ZA 5HYVA 3IUSA 5KFUA 1F6TA 2OUKA 4J3JA 5D2CA 1J0AA 5B7PA 2CUNA 4YR9A 1PAUB 2BI7A 3O47A 5A9TA 2CAJA 3ZWWA 1V47A 4Y5SA 3LG2A 2A70A 1WCUA 2E3JA 3P3PA 5FTTC 4CUJA 4MRAA 2AN1A 2KA3A 3A0KA 4ZP6A 3TR0A 1NY6A 3DBOB 1T91A 2R1BA 3KLIA 2UYYA 3JZAA 3T5PA 5EMJA 2P3QA 1N8SA 4HL6A 3GT7A 3BCWA 4ASLA 4QVKA 3CONA 1WVIA 2I8EA 1QK3A 2FWMX 1KQFA 3HO6A 2CHGA 2JD0A 4FOOA 2C2XA 1WDTA 4LIVA 1NU8A 1MXHA 4DX7A 2H92A 3GEGA 4J8PA 5LYJF 1PUIA 1GZWA 3JQ9A 3O83A 4ML3A 2ZX2A 3O4VA 4PYMA 5T5JA 1ESZA 3FWYA 3PTRB 2W4QA 4DC9A 4J6EA 2KX7A 4GGMX 3T2QA 3WBBA 3WXPA 1QJU1 4YALA 3VD7A 1BD3A 3FNFA 5IULC 1HNZB 3F71A 2OFFA 4R5MA 2SICE 5K20A 2VLBA 3I5YA 2A3XA 3PI6A 4KO2S 1Q14A 2XQIA 2SCUB 3MMZA 2XMRA 4CMJA 1WBDA 2QLBB 4FBGA 1PU2A 1YDGA 2VNIA 4F6RA 1Z2EA 3AHJA 3LYAA 1S1AA 2YZ7A 3C1OA 1HNNA 3JZMA 3POJA 2NYHA 1L7EA 4D6YA 3ZQ6A 1NKVA 3LW7A 5L4LA 2YQZA 5K3FB 1B23P 4JC0A 1WW6A 3NWRA 5EJGA 5LXTF 1JDPA 2FW1A 3M9XA 4D0LB 5M2QA 1G9CA 1Q7EA 5EE1A 3WDKA 1CF4A 3QGMA 3HCXA 2Q4RA 3BXHA 2C5SA 2JD9A 2C42A 1TV6A 3V33A 2BTVC 2BPOA 1RZUA 3B60A 4OA8A 4J1SA 3TAXA 2WAMA 3ZKYA 1CT9A 3L6UA 3R6GA 5FTMA 2NZ4A 4KYZA 3TSAA 5IK2A 2O6HA 4FP2A 2BGIA 5C8WA 2ZAYA 1R5BA 3D5EA 1TJYA 1LTQA 4MICA 2P4SA 1E9SA 2BC9A 4ZFNA 5T8KC 3D02A 8OHMA 1YIPA 4CQMD 2ZRMA 5BR8J 4KJZA 4XCQA 2OBXA 1V11A 3DMJA 1M6WA 2BHSA 2ZGTA 3KR9A 2WDPA 1P4SA 1W99A 2MXYA 2QKDA 1CY2A 3A3YA 1FJXA 1P8AA 3GFQA 3D4JA 2Y05A 1HWLA 4OLLA 4G5SA 4J0CA 2Q1WA 2DHRA 1LHVA 1RU1A 2VAUA 2CHEA 4R2IA 3KUKA 5E9AA 3KXPA 4RUKA 3TIIA 1QYWA 1QLNA 5DAXA 1IS3A 1T5HX 4WCFA 2Q1FA 3L46A 4E5KA 4EHNA 2V96A 3CPSA 1W44A 3EPHA 4AJHA 4G1EB 3UPTA 2HVZA 1TCBA 4LJ9A 1Z38A 4E5MA 3VBSC 4MLOA 2D5HA 4G0YA 5F39A 3T95A 5I7UA 1JJ4A 4M3CA 2J0UA 3OCPA 4OGLA 1W4LA 1SY7A 3Q87B 5A8KA 5HJ5A 2VAWA 4YFVA 3RAGA 2HK7A 1DFGA 2QVGA 3LBYA 1VG1A 3TP2A 4AZ3B 2ZYAA 1L0BA 5G0TA 4EPVA 3PNMA 3T0IA 2DR0A 1SUBA 1RAHA 2EYUA 1GXSA 5CW2A 4HDAA 4NYIQ 1PNGA 2QTRA 4ZCQA 1XPOA 1EHWA 1ICIA 3M4XA 1QOTA 2FEKA 4Y00A 3W5JA 2JEYA 1U0HA 1ZK2A 1ZZEA 1TXGA 4PDWB 3DLPX 3FMWA 4RFSA 2CY6A 4XX0B 1GYPA 1MMLA 2POKA 2XUAA 4EO7A 4YT5A 1M6VB 5FNVB 2PAFA 4XFIA 2X1AA 3BJZA 3FN4A 3FKSD 1VKJA 3TRKA 1LX6A 1CR7A 4Y2CA 4O1IA 2YICA 2PKCA 5TSDA 5K3BA 5CVEA 3N4WA 1OD6A 5FY0A 1NVVQ 2BIFA 1D0HA 4BJ5A 2ASVA 5LXTB 3LDGA 4RADA 1T4BA 3B5IA 2EVZA 4KGGA 5ETRA 4DLVA 4FNHA 1QIHA 2ROEA 1JB0C 4LN1A 1TVRB 3OD1A 1UEIA 1KRHA 3W20A 3AF6A 4ABYA 2DUUA 3JSRA 2D3SA 1Y8AA 2EJWA 2I2YA 2W42A 5T5PA 3VR5H 4LY6A 3QRWA 3KFWX 5BSTA 4FQ7A 1YX2A 1UAWA 4HDMB 2YWFA 1TYCA 5KWEA 3H1PA 1PAEX 1E3QA 5CBKA 2H3EB 2GTPA 1P91A 1VBNA 3ZS9A 3MEEA 1CAVB 2IY7A 3T5BA 1PD1A 4QGAA 4N43B 1BDBA 4PQYA 4O4GA 3JATA 2F8LA 1IBCB 4KSYA 2KLHA 5C24B 2JAQA 4EYUA 1RAEB 3PDJA 1XVVA 3D0JA 3H16A 1X70A 1R0WA 1XCBA 3CMMA 4KMSA 3WWPA 2GVZA 1BLUA 3X1ZA 5KJ6A 4N6OA 1VBD1 3JQRA 3W2VA 3BODA 3GROA 3WXBA 3SXWA 4J25A 3KJVA 3SEFA 1ONAA 1Y9MA 3PR5B 2DFVA 3GLHA 3VN4A 1ULZA 1QK4A 1VRUB 1Z2ZA 3M34A 5K6TA 2JRLA 1V7QA 1R8SA 1KEEA 3HHLA 4KACA 3KUGA 1AX9A 4HYKA 5G1OA 3KPYA 1PP4A 4YMLA 2AI3A 3LE8A 3BKFA 4P2GA 4KI7A 3GBVA 2O8BB 1K5JA 3R9KA 2ZHBA 4PVDA 2FOIA 1WSWA 4UREA 1FX1A 4XF9A 1EK1A 3S6JA 2PJUA 3WGIA 1GCUA 1TME3 3NAHA 1E3DA 4YVWC 3C3BA 4HN9A 2HCJB 2QA5A 4I4NA 4TV8B 5DJ5A 4JBXA 3I96A 4EWTA 1Y1PA 3U5TA 4YJFB 4QRDA 4Q3KA 1U8SA 2IU4A 5CFRA 3S7ZA 3V7YA 4CCYB 5JSZB 2IZWA 2AYBA 1T8PA 3BXXA 1N1YA 5DZEA 3OEYA 4KV7A 2BQRA 3FR7A 2ZDHA 4D8UA 3N9OA 3DOKB 3FFIB 2VWQA 3PNSA 2ZZTA 3MM5B 5TS3A 1ZNYA 1H2YA 1RB8G 1S1WA 1VFNA 1XJQA 2QL9B 2FHSA 1K0FA 5JVVA 2O20A 1WTAA 4XWWA 3EVBA 3LGAA 3CH6A 4BQEA 1LW2B 5DYIA 2WEKA 3FYTA 1X1BA 1T9XA 3W9IA 1CUAA 2VB6A 2VV5A 4KWJA 2W6NA 2ZP1A 4NMXB 2PHZA 5JU6A 1NK4A 1OH5A 4DUZB 2B8TA 4RA9B 4AQDA 3H0KA 2DEIA 3UT0A 4LZOA 2HSJA 1SB6A 5K8SA 2MKSA 1OU0A 1GSLA 4HGNA 3DYBA 1JU3A 3AZVA 3UMRA 4BYGA 1RI1A 2CSUA 3W4JA 3TUIC 4C6AA 1J2RA 1RHQB 3RQSA 1UPPA 4IWNA 1MP0A 3ANLA 4A03A 3ZV3A 1K0UA 3PNPA 5FTJA 4YHHF 4CLOA 2EKBA 4F4HA 5A2QA 1EHIA 5E9WA 3D7LA 2GJSA 3I01A 5J40A 1NJYA 4YMTA 1VSBA 1KNQA 4G01B 5L1JA 3L93A 2KI2A 1W2HA 4PLPA 2OORA 3ZCUA 1FMJA 2NYIA 3RPQA 3VBRB 5CHCB 3OTIA 2PYZA 1MX3A 1CZVA 4CKCA 4FPGA 1W0KD 2MNGA 2I3ZA 4QELA 3ADCA 3ELNA 5KYWA 1E6VB 2PR2A 1GJRA 3R7WA 3P45A 2BFOA 1O2DA 4AZZA 1ZZNA 1V9U1 3CCLS 1A8MA 4NMIA 5B57C 3R9XB 1SLIA 4P2MA 3O4RA 1GQGA 3HFGA 4BNTA 1GTSA 1XD9A 5L9NA 1FFWB 5JR2A 4AMBA 5LBBA 3N3AC 5EIWA 2XJQA 1EFHA 2UU9J 2A6WA 1NMSA 4OQMA 3LA7A 4EGLA 4USTA 3OUHA 2HWKA 1MXFA 3E3NA 5JSFA 2AD1A 2DWCA 3GPBA 3C3EA 2WQ8A 1I94F 1T3ZA 1GPH1 2VJPA 4DV7J 3L84A 3M7IA 2X1MA 3R3WA 3V32A 1J2EA 3GJRB 3DS8A 3GFPA 4BAZA 3RIYA 1NA1A 5D15A 2GFFA 2WZBA 3WUDA 4L9WA 1OC4A 3ZWQA 4IOAQ 3TEYA 2IRWA 1YJ5A 3WDTA 1D2RA 2F64A 3W2FA 4QBFA 2DFBA 1FUIA 1G7SA