3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
molecule keywords Subtilisin-like serine protease
molecule tags Hydrolase
source organism Thermococcus kodakarensis
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
4KG7A 1SIOA 3VYVA 1SBHA 4JP8A 1S02A 1R64A 3DE0X 2TECE 5K7SA 1GNVA 3LPCA 2Z57B 2HPZA 4NE9C 1THMA 2ST1A 3VTAA 3EDYA 1SVNA 1PEKE 1Y3DE 1EGQA 1SCNE 3DE2X 3L1KA 3A3NA 2PMWB 2Z30A 1U5IA 2Z58A 3PTLA 1SUCA 3VHQA 2O8OA 1AU9A 1TMGE 2ZRQA 1UBNA 3TI9A 2G4VA 5SV5A 2X8JA 3EE6A 4DWWA 1Y3BE 3QTLA 3Q40A 1SBNE 4OV6A 1YJAA 3F49S 5CW1A 1S2NA 3TI7A 5AVJA 5JXHA 1JEAA 1NLUA 3DE6X 1R6VA 1TECE 3DVSX 4H6WA 2W2NP 2P4EA 2W2PP 2Z2ZA 4I3GA 2QFEA 3D9QX 5AQEA 1T1IA 4HVLA 3ZXXA 3WQBA 1YJCA 4CFYA 3DVQX 2Z2YA 3D43A 2PWBA 1C9MA 3VSBA 1T1EA 1ST3A 1KDZA 3A3NB 2Z30B 5JXJA 5ARBA 3DW3X 2W2PA 2Z58B 5FAXA 1SUDA 2X8JB 5I9SA 4FONA 3VV3A 4OV6B 1S01A 1KFXL 4NE9A 3DW1X 1SH7A 5FFNA 1GCIA 4MZDA 4DZTA 4RYDA 4AKTA 1Y48E 1AK9A 1EA7A 1ITPA 1GT91 3GCWA 3F7MA 1SCJB 2Z56B 1YU6A 5B1EA 4KPGA 2QTWA 3T41A 2Z2YB 3I37X 1KE1A 1SCDA 2DUJA 1GTL1 3P5BA 1SN7A 1GA4A 1Y34E 1AF4A 2SBTA 1GA6A 2ZWPA 4NE7A 2IXTA 2PQ2A 1ST2A 1MPTA 1SCBA 1BFUA 3A3OA 1KFUL 2XTJP 3QFHA 1TM1E 1V5IA 2XVGA 4HPKA 1OYOA 1NDUA 4AKSA 2SNIE 3GCXP 1SBCA 2E1PA 4C3UA 2QTWB 1SBTA 1V6CA 4K8RA 2W2OA 3JQWA 4WOBA 3Q5GA 2XTJA 1TM7E 3LPAA 1GA1A 4DXZA 1GTG1 5JXGA 4WOCA 2ZWOA 1AQNA 3WIUA 3DE4X 1C9JA 2XRMA 3GCXA 1Y3CE 1TK2A 1SUEA 2WV7A 3DE5X 3SICE 2W2QA 3AJ8A 1TM3E 3A3OB 5B1DA 1ZVKA 3DVRX 1Y4AE 2XVLA 3LXUX 5JMOA 3DE7X 4HPKB 3BOWA 1OYVA 4LVOA 5ARCA 3GCWP 1SELA 1IAVA 3GT3A 2WUVA 1SUPA 2HD4A 4K8RB 1C3LA 3F7OA 1AV7A 1VSBA 4GI3A 4G9SB 1BFKA 3AFGA 1Y9ZA 3P5BP 3DWEX 3EIFA 2LUWA 1A2QA 1MEEA 1WMEA 4NMXA 1Y1KE 2PRKA 3VV2A 4B5LA 1ZVJA 1SUAA 3DE1X 2IY9A 3JQXA 1Y3FE 2DQKA 3DDZX 2PYZA 3UNXA 5ARDA 3ZXYA 1LW6E 4C3VA 1T1GA 1SIUA 1P7VA 4YN3A 4BWGA 5SICE 4DY5A 2WWTA 1WSDA 3CNQP 3PRKE 4DJ5X 1CNMA 1YJBA 1SPBP 1Q5PA 4HX2A 2PWAA 2W2OP 1BH6A 4M1ZA 3SQOP 3HJRA 1CSEE 4OMDA 3OSZA 1DUIA 1SBIA 1DF0A 2ID4A 1QXPA 4J94A 3WHIA 4NMXB 1IC6A 1WVMA 3I30X 3VV2B 1TM5E 3A3PA 3CO0S 3LPDA 1PJ8A 2W2QP 4OMCA 1TO1E 2PKCA 1AH2A 3SQOA 3BGOP 1NQDA 4DZGA 1TO2E 3QMPA 3I2YX 4ZOQI 4YN3B 2GKOA 1Y33E 2W2MP 3DYBA 3DE3X 1PTKA 1OT5A 3H42A 1PFGA 1KE2A 3CNQS 1BJRE 4DY3A 1V5IB 1DBIA 1WMDA 1SCJA 1SIBE 2Z56A 2V8BA 2SECE 4Z2AA 1SPBS 1BE8A 4H6XA 2Z2XA 5AVKA 1C9NA 4ZARA 1AVTA 2XVKA 2W2MA 4CFZA 3BX1A 3DF0A 3A3PB 1KDYA 1BE6A 1NDQA 1SUBA 1GNSA 4CG0A 2W2NA 2ID8A 5FBZA 1Y4DE 2Z57A 3I34X 1TM4E 4H6VA 5JXIA 4LVNA 3BPSP 3CO0P 1GTJ1 1XF1A 3AJ9A 3WIVA 2DP4E 3BGOS 1R0RE 2B6NA 2PMWA 1P7WA 2WUWE 3H42B 3TECE 4I0WB 1WMFA 1SCAA 1NQJA 4KB5A 1HT3A 1KDVA 3BPSA 2SICE 3GT4A 5AMXA 1P8JA
chains in the Genus database with same CATH superfamily
4KG7A 3FK4A 4FYYB 5H1YA 1O54A 4QWCA 1RHQB 1RHI1 1RUC1 5A06A 1Y6JA 2UUAJ 1OB2A 3HCBA 4ZP1A 1XMOF 3DV0B 4GZ3A 2Q1TA 2HWXA 3E9EA 1RI7A 1DYOA 2IZ1A 2YJ4A 4JBLA 3VTZA 4PN3A 2N0SA 4XWWA 1LOCA 3E97A 1PJ5A 1ZRSA 2G5TA 3JTPA 3MGJA 4HXGA 1NR7A 5LUBA 4C0HA 3HT1A 1MKYA 2DTEA 1GYRA 3A9VA 5AKJA 3V0BA 4AURA 6REQB 2CFIA 2JLGA 3FHLA 3FFIA 3OJEA 6NULA 2MZJA 4UNNA 2OV2A 1LODA 4CDWA 1EH5A 1Y1RA 2JFDA 1J42A 1ST8A 2C95A 1E3WA 2JEGA 1HE8B 1NYQA 3WIBA 2GJKA 5FZEA 1M1YB 3DOEA 2VODA 1W8UA 1S0UA 4LNHA 1CJDA 3IT1A 4G6ZA 1LBIA 1KJJA 3Q4GA 2YBKA 1ZI6A 3GFBA 1GPUA 1UMZA 1JEDA 5LCXA 2WG2A 5JAIA 1Z6YA 3V2IA 4QQ8A 3AKPA 4A10A 2EHDA 2PMDA 3FCUB 2JX2A 1LI5A 4R31A 1DT5A 5HZHA 4EQZA 3IOCA 3PNAA 4ZO6A 4EFNA 2EL9A 1NPKA 1L7MA 4DG5A 3EZ9A 1ZM1A 3VU3A 3HT3A 3OM1A 5KNCH 3G9ZA 3WKDA 3Q9SA 4X7BA 4CQLB 2XNDD 1UUFA 1NLKL 1ZCZA 1ZS6A 4CCAA 1C1YA 5JSZB 3EXAA 1O96A 2HHSA 2AQ4A 4YTEA 2COEA 5BYSA 4P52A 4NCHA 2DCUA 4UOFA 1G2EA 4CFSA 5FUXA 4ZV9A 3COJA 1IKVB 1I5OB 3KU4A 3P3NA 3DMHA 2WN2A 3PENA 4I1PA 1G5QA 3HVUA 4OAOA 2RDIA 5KDOA 4XC9A 4E31A 5H82A 2DUOA 4DIOA 4E0BA 1S9FA 1U1KA 5IV4A 1KJIA 3VZHA 4OJ3A 5DYIA 1OTHA 4O44B 4QM9A 3AF6A 5TSWA 5NULA 2BBSA 4UF0A 3QPAA 1EUZA 4PZZA 4BVLA 3O8DA 4BWFB 2G9VA 3DE4X 1UQUA 2V7EA 2ZGVA 1OZHA 5GQSA 3F4BA 3EVOA 2ORVA 1ZPVA 2JA1A 3ABQB 3PR5B 4NMLA 5AW9A 1XCGB 3VBUC 2IPNA 3DHNA 1U7UA 3GUYA 4PXEA 2VQAA 4LFBB 4FSHA 4WNAA 4O4HF 3PW5A 1FB5A 3LHFA 1ZBDA 3SS8A 1MQAA 1JLFA 1LU2A 1KMHA 1MQ9A 2F4VF 1ZIDA 2JFYA 3L43A 1W2UA 5D0RA 1YBAA 2KI5A 3B52X 3KR1A 1X7WA 1NW9B 4Y6LA 1W0JD 1C3OA 4HEA6 4OQEA 1UU4A 2PZBA 3UR0A 4TLLB 5UKDA 1N3OA 1VECA 1WWHA 3G1WA 4RZ2A 3V4LA 2EKYA 3I3OA 4GP9A 1RBOB 4EHJA 3Q7EA 3BREA 2XMTA 3KDOA 4LJ5A 1RAAB 2CYFA 1CUBA 4B9LA 3ZGVA 1RPTA 1KDNA 2OA2A 5CNKA 5L4LA 1OYWA 2D3PA 1QJZA 1T6BY 2OO5C 4C0JA 4QX3A 1Z6XA 2QVYX 1NASA 3L05A 2AKEA 2G67A 1R5BA 4WA7A 3FUQA 2O2HA 4Q9KA 3HCRA 2AYEA 1YJRA 1KI2A 1SVWA 2X8LA 1EFAA 2WT9A 2WTAA 4PDWC 4QJ3A 1NSTA 2PJZA 5HVHA 5KSWB 4NECA 4QLOA 4US1R 1I2BA 5T5PA 5GINE 3IERA 4QXKA 1H2KA 5C8YF 4F86A 5JCPA 1KOGA 4G0UA 3MCAA 2HS0A 1WCSA 4NZMA 3P9CA 4PN7A 3SSRA 1NJFA 4F85A 1C7QA 1DIWA 1LULA 3DLEA 4HNSA 3N6MA 5ALVA 4YR2A 3VR0A 2H1WA 3FCXA 2N82B 2VBWA 3MUVP 2JIZA 1DBDA 1XD2B 5BWMA 4HFMA 4B3RB 3QJJA 3NU1A 5DWVA 1WCUA 4F7VA 2OORC 2PWPA 3L7AA 4YHHB 2VKRA 4QHSA 1E4EA 2QGFB 1SXIA 2QTMA 1NDLA 4E5SA 3UATA 5JLJA 3I59A 1HKAA 4WCEQ 5T4EA 4BLWA 1E6YB 4DLYA 1FDDA 4WP9A 3S40A 3ZY6A 3DL3A 3KT8A 4NKRA 4UU8A 3ENKA 2GAGC 2HS3A 4FGZA 3OLQA 4NLUA 5B4VA 1PHPA 3SBMA 3NG1A 5A1LA 1OU4A 4MVXA 2UXCF 1N7IA 2VHGA 1L3CA 4V1PA 1XDUA 3OX4A 5F0WA 3E2EA 1UDCA 2B7CB 4KXLA 1A8DA 1T24A 3DE0X 1LK0A 1L8XA 2QENA 5U9CA 2WWYA 2HWC3 1O7FA 2CNWD 1RLDA 1IUJA 2P8IA 3JD4A 2YS6A 5JZ9A 5KFQA 2CQ3A 5DTJA 4MUKA 1E92A 1FI4A 4W9RA 4JTOA 4GI5A 4C03A 3DFEA 4X8PA 3UGKA 1M5TA 1PG5A 3P49B 3LX5A 4AS3A 4RFLA 2ZZMA 1UBNA 2CBXA 1GZ3A 4MUVA 4RWZA 2YIDA 5CIQA 2OVUA 2C9ZA 3OJLA 3DRRA 1WHXA 3S1AA 3C6KA 2CJYA 2FDFA 2WVDA 2Z6VA 1NKEA 5I7UA 3B69A 1D09B 2AJ2A 4M99A 2G7ZA 5KXDA 2JFZA 4OSPA 4TV8A 4J16A 1KMNA 1P74A 4ZIRB 1M1KT 5AQEA 5FD8A 4NOTA 1VKNA 2XE7A 2PXXA 3AESA 3QLEA 1P6TA 3EIQA 3U07A 2EBWA 4JV5F 3IV6A 1PYTA 3LHSA 2DSTA 3GIIA 2W83A 1H2NA 1ZGZA 1RIIA 3EW9A 5M2PA 2Y1LA 4LO8A 4ROSA 1U2DA 1YZTA 3EXFB 1XXNA 3QLHA 2HWC2 3UB3A 4W4TA 3G86A 4FPHA 3MHPA 1AFIA 4LR4A 4JNKA 4QYIA 3T3MB 5DTIA 1NDKA 4C8LA 3K2EA 2J8ZA 5C1PA 4X4SA 2BFNA 3GJAA 2FGOA 2UDPA 3EN0A 3PIIA 2WO2A 1GCIA 1LHVA 3ILYA 5CA1F 5KJFA 4LYDA 4DQSA 1SB9A 4DY6A 3WQQA 4L08A 2V2QA 4TROA 2D1FA 1Q15A 1F9EA 2I29A 4IHJB 4NP6A 3SDEB 5BMVF 4L5CA 3X44A 2XTAA 5I4IA 4ARXA 3IIEA 1AJEA 1QUVA 5A3NA 1BMQB 4E2SA 1K8XB 2GFHA 2W9BA 2AWOA 2GRAA 3TW4A 4DUGD 1J0CA 2ZYAA 3TEGA 1F3LA 4KWCA 3W6UA 3F3KA 1Y8CA 3HJFA 1UPCA 5LA6A 2ILYA 4G9BA 3M3HA 5JNLA 3H6HA 3RS2A 4DFDA 1IE3A 4D0NA 5BVHB 4Z2WA 4P4GA 4B9MA 3A3OA 4UAGA 3DXXA 4H2AA 1JKMA 4CLPA 2B43A 1L1QA 1JKFA 5GOZA 4X3CA 1YRUA 4DSZA 5DS7A 4LHXA 2Y92A 1RAGB 3QEAZ 4G37A 2KXLA 4GQBA 4YFUA 2QD3A 3OF2A 5JW6A 3V4SA 4MS3A 1QKIA 3W5ZA 4A91A 4E4HA 1P19A 2VK4A 5FCCA 4KMMA 4XD7D 1T94A 1PVC2 2NZ2A 4RJVA 2Q1SA 4XM2A 2WKQA 2QDKA 3PC7A 2PT6A 1X9IA 2UUAB 1FFXB 4AYXA 2EBFX 5F37A 2H9ZA 4QT0A 1TM3E 2YBPA 3NS7B 3GR0A 2ZI5A 5AFBA 1VBA3 2ZM6F 3CT9A 2VHYA 4JCCA 5DN6D 4LVOA 1HZJA 2TS1A 3EGOA 5ELMA 3PX6A 1U8YA 2GBPA 1G9FA 4J9VA 1M8JA 2GXUA 2JAQA 4Y00A 1GZCA 1PLJA 5EWLB 1AQ6A 3WBFA 3RZGA 1R1A1 1U2ZA 1TF5A 5T4BA 5TQ0A 2XM3A 3BDIA 4GGPA 1SA0A 1EWKA 2WHPA 3BH7A 2OUJA 3BMOB 1W4ZA 1Y3FE 2VDKB 2VBZA 4DJBA 1UF9A 3NS5A 4CQMB 2B4PA 1XNRF 2O7SA 2ENWA 2R60A 2IIVA 4QPDA 3UMCA 1DWUA 3JU3A 2QIFA 4DJ5X 2BU9A 3IMQJ 3JQJA 4LK7A 4GH4C 2IF0A 2HYDA 4OIFA 13PKA 3KBBA 4ZO7A 5DM60 2WPNA 3HBLA 4M9CA 1SCIA 3UH1A 2YHBA 1XRRA 1VBA2 5JTTA 2IPXA 1WA6X 4XM1A 3ZD8A 1KBZA 4QPYA 1ZN8A 2M6RA 4O7XA 2QLFB 4J0CA 5DOZA 4C0QC 4ZXKA 2CJAA 4DL7A 2RUGA 2ZR8A 4KMRA 3MG9A 3MMPA 3IODA 4GLOA 2O1EA 3BGLA 5TVKA 3VQSA 4Q7EA 1X7YA 1Z06A 1PTJA 1NAHA 3HHPA 4D4JA 4BQ2A 4NCAA 2BVZA 4WM8B 3ZFFA 4PUOA 3EQEA 2LCIA 1GFWB 1KZ1A 1C4AA 3U62A 1G7SA 4RDXA 2O67A 3AM3A 2EGUA 1HLGA 4KW7A 3RAEC 2WF5A 1YB4A 2E5HA 5AOCA 3MBWA 3NKFA 5DGBA 3RTDA 4XAAA 2OBNA 2V4RA 3QPWA 1S8OA 2D3WA 4BQXA 2IDJA 4TQRA 4UUXA 3JALA 4I2QA 4AF8A 5K14B 4JVNA 2YNMA 4I6AA 4W8OA 1DFGA 4F46A 3UJAA 5FBZA 4DBQA 4BKOA 1EAH1 1G18A 1ZRNA 2AFHA 1GSOA 1OLME 1Y7PA 3JTEA 4NN0A 4YCCA 4HQ6A 2BE2A 5K8NA 2XCLA 4DG8A 4POAA 2Y33A 3IUEA 2A3YA 4YRDA 4TWAA 1POV0 3DT8A 1LDGA 3OTOF 3ZXAC 4KPUB 3B82A 4Y65A 3EXG2 3VKNA 1RA6A 2BACA 2R4UA 4HKTA 2QZJA 2PHZA 3IL2A 3HP4A 5A32A 4HYEA 1RL3A 4RK0A 4YK7A 3VBOC 1QG6A 4MUYA 3V81A 1JU3A 3DOJA 4KBIA 3JQBC 3WP6A 5FR3A 1OKKD 3D4NA 4YSFA 1W0CA 3HNRA 4DW8A 3CCTA 1PL8A 2FX2A 5JNRA 2VT3A 2AJLI 3D67A 2OZ6A 3VZJA 3Q8CA 4DFMA 1UPXA 3SOPA 2B3TB 4W50A 4FI3F 1UJ6A 4K4UA 2XA2A 3BGDA 3KP1A 1UYYA 5LXTB 4PCLA 2W1BA 3BMCB 5T14A 3WSOA 4JBHA 3VDMA 5ALEA 3HFSA 2Q28A 3MM7B 1KAOA 4N7BA 1YLLA 4KSBA 1S55A 5GKAC 2ARCA 4Z7QB 5CA0A 1QHHA 1UKYA 4XMIA 2HBRA 2EDCA 1LW2B 5C32A 5IF3A 5CB4A 3NV9A 5HLFB 3EM1A 1EFRA 3VBFB 3EHKA 2OSVA 1EZZA 2JLVA 3QUAA 1JYVA 2YV4A 5LMZA 2ZI9A 1PP4A 1KO4A 5LATA 4E33A 3TW6A 5K0FA 2ISQA 4ZC1A 3SVTA 4OQFA 1QYWA 5M2UA 1RWNB 1U3WA 2AJQA 2BHLA 1R4AA 4AO7A 2Q9UA 4JGGA 3H3ZA 4F04B 1ND3A 1MAUA 2X0KA 3MB8A 3SBXA 5KOJB 3OJUA 4DR1F 3AM2A 3NNAA 4RY0A 1S0EA 4PG7A 1JJBA 2CPEA 1KEZA 4LRYA 1K7SN 3G6ES 2CFOA 5F7JA 4KGKA 2LKZA 3DRPB 2HWB1 3IQGX 4LPSA 3FTQA 3RZLA 1EE1A 4CR7A 2AJ0A 2GASA 4WT7A 1O57A 1EMDA 3C3MA 1SLBA 3TANA 5IVIA 1SIZA 4YW3A 3LQRA 4YGCA 3RHZA 1CPZA 2GO8A 1B3BA 1AZWA 1L5KA 3BGSA 1YZ3A 1EUCB 2RI1A 1T1RA 5LT5A 2J8SA 1OH8A 5IKOA 4CUAA 3R5AA 1TKZA 5A6SB 2AUNA 3RSJA 3NBFA 4YDRA 3GRCA 1UMBB 2XNHA 3PFGA 4RPGA 2EX0A 2GK7A 1GSAA 3CW2A 2FEPA 2VAUA 4UNPA 2Q4EA 5MN6A 5FYBA 3RAFC 4YEDA 4DU7A 2C6SA 2ZJ3A 5LN1A 2PXCA 1UPMB 4F1JA 1LJUA 5LEKA 5IHRA 4ES3A 3U1NA 3ACGA 1RT2B 2RDMA 5IT9A 1QU0A 4IQ0A 1JAZA 4AI3A 1BW9A 1S1AA 2RH9B 1R3UA 4EIWA 2VDNB 1KDTA 1W6PA 1NA1A 1VLYA 4NJ4A 3QOWA 1DKLA 4QLBA 1OVPA 3K5WA 5KC5A 5IJXA 3G96A 3ZY3A 4SBVA 4G84A 3G02A 2C31A 4HSEA 3DMFA 2ZAAA 4HLCA 4KSCA 4LSNA 3PQEA 4L4XA 4C14A 2XR4A 4IL7A 3ZZNA 2JLSA 4P80A 3SISA 1E4YA 1GTZA 2C2NA 5ILGA 4BQ4A 1E8MA 4B33A 3MAAA 4E5YA 3C7TA 4E08A 5GZCA 4YMSA 1ONOA 3ZQKA 4F4FA 2VG6B 4GLLA 3TKAA 3DOKB 5C4GB 2N7CA 3DBRB 4J6GA 2XSZA 3VAJA 3QY0A 1BXRA 3FWPA 3UK2A 4WY8A 3LP5A 2Z5LA 4M5HA 4PLGA 2HRRA 4XWTA 3UAVA 5EIXA 1UP7A 2HNYA 4NMWA 3VC3A 1PFYA 1OZ0A 3NATA 1N9KA 1XC6A 3VDNB 5FTWA 5SICE 1OGYA 4QWAA 1G2PA 5HUQA 2ZPXA 3PRKE 3Q3HA 1SNYA 2HZAA 1KKHA 3SDBA 3BJZA 1X3SA 1DOZA 4Z4CA 3PQDA 4UFHA 3QU4A 5KYXA 4TVBA 5TQVA 3IBCA 4F26A 5HK9A 4AWDA 4X6LA 4K50A 4O0NA 2VBFA 3KOMA 2D13A 3STHA 1Z47A 3A9CA 2HNKA 3CO0S 3KZNA 1K98A 5KAMA 1Y7IA 4CWAA 1AJKA 4IERA 3EHDA 2C9AA 1AR72 3BGOP 2EDAA 2XMRA 3RFVA 3WMFA 4QBKA 2BFEB 2DVDA 4B3SJ 1W2WB 2JB8A 4JDMA 1HBUA 4PX5A 7GPBA 1QGZA 3AZYA 4KGQA 4MEJA 2CHUA 4OX9Y 3KSDO 2YUIA 2NM0A 4BC9A 1OYYA 3GEDA 3KRTA 4X95A 1C8LA 3M8RA 1DURA 3DO8A 5K2MA 4OQ8A 3AUYA 1MMDA 1QXJA 1ZL0A 1S1TB 1HRV2 2FWJA 3RW7A 4IV0A 4L0MA 1U48A 3GRKA 2ZYTX 5A8RB 2BFMA 1D2MA 3I92A 4DL6A 1ACMB 4JYCA 3A21A 3B5JA 4NHOA 2BJDA 1XC9A 1E7MA 3N8DA 2FSHA 1QM9A 3AJ9A 3T9ZA 1V0JA 2QOEA 3HVWA 4GMHA 2ZR0A 3A13A 4HSJA 1NGSA 3H5AA 4MRPA 1IBKF 2NQ8A 1N47A 2OQIA 2NS1B 5K0JA 2NXWA 2IELA 2YVLA 3AONB 3N01A 1H65A 1U11A 3W1YC 3O8CA 3UGGA 2JJ6A 3JS5A 2J1VA 3H4VA 4Q5OA 3LFIA 3J7NA 5BXXA 5HCFA 1FNSA 2G77B 1T5LA 2IYIA 4D7TA 4BFVA 4PTYA 3QLVA 1DTEA 1Q0RA 1WQ3A 4RF4A 2RS52 3Q8YA 1U04A 4XMAA 3DPUA 2A30A 3DEJA 1XERA 4RTNA 2FHSA 2D1RA 1XQ9A 5BNTA 4FMBB 1WEZA 2B9YA 1XSEA 1YA8A 2QDRA 1W75A 4K6KA 1EVYA 2OS2A 1MEJA 5K0NA 4TN7A 3NT5A 4AMUA 2EFCB 1GL7A 3I8SA 1NE7A 2LALA 5FD1A 4DREA 2O8DA 4JCOA 4RC9A 4BXOB 3LX8A 2ZS6B 4CUJA 2IS2A 4IF4A 4GWLA 3KQVA 4CI9A 3T52A 4BX2A 1DGWX 3GJ6A 3QVXA 2IHZA 2QYSA 5KWSA 2M3DA 3PS9A 2O1SA 5INTA 1PGNA 1Z0AA 3QKRA 5DLEA 2P67A 3KXPA 3T5CA 4XYEA 3ZCSA 4MS1A 2OMKA 2IC3A 3RTEA 4CNBA 1W85B 3IQIX 1WQ4A 4YECA 1N6OA 4DV5F 2C8JA 2Q1UA 1IRXA 3OCVA 4H0NA 2X19A 5FP8A 3A1CA 5DQHA 2EC5A 4P4SB 2C2GA 2KO1A 2LP4A 5EN1A 3NHZA 1OIWA 1NMEA 3MCNA 1K0UA 1QP7A 5JU6A 5T4FA 4I01A 1RUD3 2FPUA 3THPA 5H9EJ 4QQRA 1T0BA 2BMDA 4XIIA 1DC5A 4L5BA 2OCIA 3H1AA 3CGGA 5B1EA 3G4SS 1ZUNA 5CYMA 1XB2A 3P9PA 4PHHA 2YC2C 2I91A 2QTWA 4TLCA 4BWYA 4A8OA 4E2WA 3L4BA 4EB6A 1EFPA 3WP0A 4WM7A 3M8WA 3C5CA 3WYCA 4OV1A 2WSIA 5JC8A 4KO4S 3RWBA 3ZIUA 4XBQA 5BNNB 4I0BA 1UMCA 2HHHJ 2FFBA 4RDIA 2C4KA 3N86A 3DGPB 2HHAA 3MM5B 4LFCF 2E55A 3TPFA 1OQAA 1LQUA 1LBSA 3RZKA 3MQ4A 4A15A 1YJKA 2D54A 1QJY1 4OIMA 1QDCA 3QBVA 2IHJA 1XXHA 3QEBZ 1LWNA 4K8RA 2WYIA 1E5XA 4DQVA 3PW2A 3NNHA 2MYUA 4ZVSB 3ICCA 1RUD2 4YW7A 3RYIB 1H0HB 3UVJA 3T1OA 2AG8A 2P3JA 3AO0B 2DR3A 4EGAA 3PPXA 4DQXA 2PLV1 1RQGA 3OA2A 2YMZA 3RS9A 4P36A 3U26A 1G6Q1 1E2BA 6AT1A 3LV8A 1QHDA 4CLYA 3EFOB 1CQNA 3HB4X 4OL0A 2V7GA 1YB5A 1IQDC 1VMAA 3X43A 1I3MA 1LCLA 3EA4A 4P7KA 2GZRA 5ARCA 4GW3A 5DN9A 1JR2A 3VHNA 1OCEA 4HDMB 4YP6A 1YR7A 3GT3A 2VH2A 2ADBA 1QC5B 1KU6A 3CC8A 4LZZA 2D4AA 2H51B 3W65A 2XKAA 5HJ5A 2AIRB 4QIVA 3U1LA 4RE6A 2XOKA 4BZ4A 4WZAE 2QE5A 3QCWA 2OJ3A 3S2SA 3TYXA 1KWGA 3UJDA 1GTHA 5E4YA 2FX3A 5JBIA 3WNNA 1X1EA 1YWGO 2X1MA 2QZ9A 2SKCA 5LB2A 4M5NA 3CG0A 2E6VA 4DXAA 2ZOSA 4DMKA 1ZZNA 1ZMBA 4ZYZA 2VWPA 1O95D 3FKSA 1NMYA 1NH8A 2WOJA 3NH6A 1H2FA 4CMIA 2WU0A 3IDCB 3GT7A 4DPMA 2CXPA 4UE3S 2I4MA 4JI8F 9MHTA 1ZD4A 2PA3A 2BUBA 4ZXPA 2PSDA 1ZZBA 1PEDA 1QZTA 1K6XA 1RQLA 3W79A 4TTGA 1G2IA 2B45X 3RS4A 2XCRB 3R6WA 4Q3CA 1E66A 2HREA 5LASA 2H7YA 1D03A 1LA2A 1DV1A 3T4EA 4P38A 3H8SA 5DISB 3C8HA 4G1VA 2DHRA 4I8XA 4C7XA 1XYVA 3QVTA 3WK7A 5IBPA 3NNFA 4Q4W3 1BMDA 3W5NA 1SJQA 4DSEA 4KDEA 2RDDA 2GC1A 4TY8A 4EM6A 5JNSA 3T7IA 1Q50A 5EQFA 2HQSA 3K9NA 3K0KA 5AJ3F 1XQVA 3VL9A 1RAIA 5C8CA 4L6IA 3WNDA 3JAMU 4ZARA 3DLKA 3N05A 3OLZA 5HAOA 1TQ4A 4RV5A 3OXFA 5BV6A 1U5YA 1AXYA 3CTPA 4ISQA 3PFEA 2Y68A 2JECA 1AQJA 1C5KA 1CQIA 1YS1X 2DPXA 2X7IA 2YJ5A 2CJ9A 4IG0B 1L3JA 1R0RE 4UFJA 1GPMA 1B7FA 1W9TA 2ZHBA 4MW6A 1QGUB 5J36A 4AD6A 2YV3A 3URMA 4NWBA 1JLMA 4BLUA 5F73A 5IG2A 1X8KA 1M33A 1B8VA 3O9MA 2ZJ1A 2VHUA 2XULA 4DPXA 5AMXA 3PGXA 5KTTA 1F0NA 5CD4H 2A1TR 2QW8A 1FP2A 3EQ6A 4I3PA 3INYA 1NI5A 3GHMA 1WPRA 1JG7A 1YVEI 4IJKA 2VOPA 2IZWA 1VQ7S 1LNQA 2WA4A 4H7DA 2RE8A 3KTAA 4UW9A 1ZM9A 3LRTA 4A3XA 2QEQA 3O4IA 3VSAA 5EJEA 2QLXA 4MVJP 3GWGA 5CH3A 1FEZA 4U96A 1DG9A 2RCNA 2IWHA 2EKQA 1EP1B 4JAAA 4EYGA 1KKMA 5LIPA 5HRUA 1P8GA 4WFKA 3C7HA 2NZVG 3EBRA 4QASA 4WFZA 1AL21 5DDJ2 1LFPA 3EVZA 1NXPA 1NU4A 1TX4B 4URVR 2VMFA 3ILJA 1IJKA 5JAMA 4NZNA 4GC5A 5LP1A 1I4DD 1NUSA 4U00A 1HHTP 4JCKA 1T4GA 3LVFO 5AM0A 4TVSA 3F49S 3LPLA 4JN6B 3AWDA 4BNJA 1W6NB 1QH1B 4HS4A 3B2NA 4YW5A 1WXFA 4QCLA 2QE3A 1P0CA 2AFIA 1US3A 3J7TA 4B8WA 5U47A 1MFPA 4MLDA 2ZT6A 5AT1B 4A26A 2A5LA 3T30A 4JJKA 5CB6A 1J1UA 1TVGA 4EYQA 1ZGBA 4COKA 1V4VA 1FAYA 4EMTA 2AEZA 2XGOA 1D0GA 2F7SA 3O1RA 1XZMA 1G5IA 2F8LA 3KHRA 1U3UA 3EUFA 1YT5A 4EG6A 4EU0A 3F1LA 4BO1A 1QIFA 1J97A 3NTOA 4BWJA 5ALJA 1WZUA 5K3CA 1DEHA 5K0BA 1N88A 1UDAA 3TD9A 3LP8A 4K4YA 3JQ7A 3MTBA 3AB7A 1FX2A 3R77A 1S6PA 2OPPB 1G8GA 4UBJA 3WGVA 4FDUA 4JC8A 3FPGA 3QUCA 3ZWAA 2P34A 2EG9A 4B82A 2N47A 3SV3A 5EY5B 3KTDA 2DTYA 5F6LB 4G23A 3CURA 4B8EA 3HLUA 4WNYA 5GGYA 3QWPA 1GTL1 3L02A 3C6MA 4R5PB 3PFWO 1NCRA 5A33A 1A4XA 4O4IA 4URTA 1VL1A 4TT8A 2RHJA 5J4YA 3IAM9 3ZQ6A 1G7CA 1EDBA 4CEWA 2D97A 3NOVA 5LOVA 5AM3A 16PKA 5D6GA 5E5NA 3WY9A 3BWEA 3QFHA 2F4PA 5CVCA 4GAEA 4TL6A 3SFZA 3C6TA 5F7XA 3D0QA 4NYMQ 5E0KB 5LIRA 2IQIA 1KAHA 2C2BA 1YE3A 4XA8A 1QQ7A 1AGXA 4YCBA 3AI2A 4IEEA 2G4LA 1RXYA 3SMVA 4HB3A 3ZSMA 3JYHA 1WWKA 3B89A 4E2FA 4UVEA 5TPWB 3LKVA 4HMPA 4A8JB 1GZ9A 1A82A 3IMMA 4KREA 2RJNA 4IQ4A 1QAJA 1QR2A 2FWBA 3BGFA 4W90B 3MDPA 4Y9RA 2NZ8A 3JWGA 3K53A 1IAVA 3FLPA 2VMHA 1M3SA 4YJ2B 4Q0BB 1ZOLA 1OVMA 2AC7A 3Q2IA 1LWXA 3V4IA 2GEKA 4YVSA 2UP1A 1SOUA 4JJ4A 3BOSA 1VSBA 4K5SA 1CF2O 1RAFB 1XMVA 2HGSA 4TV9F 5SZKB 1Z6TA 2WLQA 3SBDA 3W3ZB 1UZ0A 2M6KA 3VZMA 3Q9NA 4DLUA 4B0PA 1D8TA 3WXMA 1EG7A 1U2QA 1Z6ZA 3V46A 5J48A 2FRVA 3H3XA 4LQCA 5KWIA 5FPTA 4HQNA 3VH1A 5DLQC 3IAEA 2RR11 1O94A 4C8OA 3ZXYA 4IMRA 1WXGA 1TC2A 2GBCA 1P4RA 3Q86A 3FZ3A 4B6OA 2GERA 1R6BX 5CFCA 4FUQA 2OP0A 5ER9A 2IQ5A 2A4KA 1E7RA 3BQ2A 3HUEA 5TMDA 1JLBB 3FBYA 2PUCA 5BQOA 3I9JA 3CEJA 3U4GA 2AGOA 4CHTA 3O75A 1P18A 4BVKA 2O8EA 4MOWA 1SBIA 1XQWA 2GMEA 2G70A 2LDXA 1SFPA 3FNFA 3D54A 4G8JA 4ZU6X 5HCUA 1A8SA 2H00A 4US0R 2X3GA 4ON9A 3ZYGA 4ETXA 5HM8A 5A7NA 4QBHA 3ZV4A 1NN1A 4L99A 4KXXA 5AVXA 2QWXA 3K09A 3SQOA 5T5QA 1T36B 5CGZA 1OY6A 4N7UA 3PDQA 1CJKA 3I01M 5DM1A 1ZDMA 3IDFA 4NI5A 5JMCA 3IR6B 2Q9BA 2XMWA 2X9LA 4EO7A 1K1QA 4GKJF 4LV8B 3THYB 3G82A 4LVUA 1Z0KA 1WUKS 1ZETA 2B4OA 2LFVA 2G80A 2ERXA 4RNFA 3FI0A 3AP3A 2G40A 3OXLA 5JS1A 1U0AA 5L73A 4JT4A 4YDQA 1U5XA 4AAYA 5CTAA 4K86A 2IL1A 3SEZA 1FUEA 5KQLA 3ZWCA 4R8UA 3FCSB 4AKHA 2H0VA 1IS6A 3NO8A 3I5XA 2PT9A 3AA8A 2QX9A 2ET7A 3ZXWA 2NO9A 2OWEA 3WOGA 1GL9B 1WBDA 1ZAWA 5REQA 1Q17A 2O0JA 3IHWA 3PHTA 2EW9A 1TVRB 4QRIA 2NG1A 1Z62A 3ZYIB 3KT1A 1E62A 1DC6A 5DCYA 4PZ0A 4JLBA 1KFKB 5AOAA 2PR2A 2OH2A 1LC0A 1Y5NB 4ZEXA 3HI6A 1GZDA 4GO7X 4L95C 4ZS6A 2VBCA 1W8ZA 4BIIA 3ISNC 1KJ9A 4IRCA 2JHCA 5ALIA 2GF9A 4WDRA 4L07A 2QTFA 1XLUA 4HZUA 5I93A 1ZJWA 1QHGA 5IKMA 3VHOA 1Y6ZA 1YVRA 5K45A 2ZGOA 4LXQA 4P83A 1XJAA 2R061 3OYWA 4CXXA 3Q12A 2WU3A 1HD0A 3NTXA 4EWEA 4JDPA 3QPVA 4LGYA 2ASJA 4ED2A 2O05A 1AM4D 1T2NA 2ZMKA 2RF2A 4AJ4A 3N1UA 2M0GB 4FMCF 1DO8A 3OJXA 5C8ZA 4YOEA 4DXHA 4RD2A 3KK0A 3QH4A 2DQ4A 1Q8PA 3QATA 2HA4A 3TRKA 5MFZA 2VMDA 3DLLQ 3NGTA 1D4AA 3HCFA 2P9ZA 2O2JA 5F3IA 3VRHA 1BKYA 1VRCA 3B94A 3VR6D 2G76A 2GGPB 5AC93 3CN7A 3RS0A 2QN6B 3M83A 3W8FA 2VPZB 4XTMA 4IVQA 2L42A 4CRJA 3J7ZT 2B7LA 2UZ1A 2XIQA 4XETA 4YUVA 1A7JA 4HMOA 1Y1SA 2PLAA 1I3NA 1SXJD 4YR0A 3VBHC 1CJSA 1TV6B 3OF1A 1GFIA 1OHHA 3KPVA 3HXLA 4UAUA 3HR9A 2QTBA 2GW8A 2C00A 1O4WA 1OZAA 2A9JA 1QIHA 4C08A 3F7MA 1U3FA 4DPWA 1DP0A 4X20B 3RLIA 2WSCC 4PXDA 1VBZA 1G1XA 2J46A 3MERA 3KCXA 2HFKA 2J1RA 2R7XA 3O1OA 2GEFA 2QU7A 1AKMA 5D3GA 1TKXA 3OEYA 2OZLA 4F36A 4LMBA 1W6OB 1VC5A 3CN9A 2LRPA 4LT5A 3ZYRA 3NNGA 5DQ0A 1ISIA 2A0KA 5JCZA 2AR9A 2WAAA 5BT8A 3OOWA 1NQXA 3IOMA 2NZ4A 4YB8A 2VDUE 3H97A 2ZE2B 2YQZA 3Q24A 5CFQA 1KEUA 1Z6QA 1GCGA 2JVJA 1VQSA 4PY2A 4C11A 4RYLA 1K73T 5BUCA 3NWRA 3V5NA 3IWNC 4MDEA 1LQTA 3UF0A 2ZUEA 5B7NA 2G1PA 1QSSA 1H4HA 3X1LB 2BUCA 2JAWA 4F21A 2Y77A 2XNJA 3R3SA 3LGAA 3OHPA 3LT1A 1M2VA 2K2WA 1FDUA 4DB5A 3W2TA 3ZKWA 2ZJ2A 2C29D 4MIYA 3KXKA 4YM3A 2WSBA 3SR4A 1SC9A 5E3RA 2YY3A 5A62A 5TC4A 3VR4A 1WKBA 3ILIA 5FJJA 5FR1A 2E9RX 1RKIA 2OAUA 1D6JA 3TVYA 3NO4A 3R5KA 4WLUA 3DDNA 2RC6A 4ESHA 3QEMB 3Q8VA 4TTIA 1PZ9A 3F0NA 2QQ0A 4DOUA 5CFRA 4NLRA 4M0PA 4X91A 2MR6A 1F9AA 3QQCD 5FV7A 3AFGA 1AV6A 2H1CA 4NL4H 1RIFA 4AY2A 2IA6A 3ZWMA 1VLNA 2FN3A 5KHGA 1O3RA 4TSKA 4PQFA 1USGA 3BYPA 1PZGA 4KO2S 1DTWB 1N8TA 5BNOC 1ZRCA 5JZBA 2YMPA 2VE1A 2H3EA 3G0GA 1WOOA 4LRSB 2VAVA 2AG1A 2VL7A 2QKYA 4BJ0A 5KTSA 2XUGA 1VA5A 4QPCA 4IXMA 1MB3A 4R2MA 4UMFA 1VQMS 3B6IA 4K6OA 5FUVA 1RP1A 1DIHA 2ZA9A 3GBSA 1PCXA 3LG2A 4RD1A 3RBDA 2JHEA 1SG3A 1CAWA 2PSHA 3UHPA 1WW3A 1XJ5A 4KHMA 2BL4A 5LC1A 3AEKA 1Q2XA 3RIHA 2F40A 1J1IA 2PS9A 4YYZA 4JI4J 1TZMA 1UBFA 3NC4A 3HC7A 1HT1E 2HQ3A 1FFBA 2CJWB 4DPKA 2Y64A 2A6OA 3K9BA 4AT1B 3L41A 5J63A 1EESA 3OY7A 4CUZA 1VQOS 2BMWA 2HIHA 1YQ2A 3WAJA 2ZJCA 1T3HA 1HQEA 2WBKA 1ZNWA 4GT1A 4Q0SA 4C3LA 4N8SA 2A59A 1BMTA 2OPWA 4NDZA 5K3FA 3J81j 1FZQA 2QRZA 2XCAA 2Z2XA 3G1TA 2WMYA 4C6SA 1S7IA 2H2DA 1DFQA 1GEGA 1RHQA 4W8HA 4J9RA 2XZDB 2GYWA 2WAXA 3DV0A 5AVSA 3TLMA 1T2FA 2O4UX 4E11A 5FKJA 3ON7A 2AJ8A 3KLOA 1RI1A 2CB0A 4AUEA 3P2EA 3X2EA 1QZ3A 2FWMX 4R2IA 3AVYA 8ADHA 4F4CA 1J24A 1LECA 1QYXA 2ZRHA 4I50B 1N5VA 3JQAB 3KUGA 4BQ1A 3DPRC 4LKDA 2C84A 4N01A 4I6YA 3NH9A 3HWRA 1EM6A 2OHIA 6REQA 4AJPA 4NNJA 1JYEA 2VH5R 5IRCD 1JHZA 2OQRA 4LUKA 5LDDC 3VLBB 3IAXA 3DG9A 3H04A 3PVZA 3VGVA 1TK8A 1E32A 4EYIB 4EH1A 5ES3A 3QMVA 3DMGA 4OX6A 3LKDA 2V0CA 4D8WA 4Y1VA 3H1BA 5LFAA 1Q2UA 2J6CA 3GJBA 4QUGA 1RKVA 1H6BA 2CHFA 3RR8A 3NWKA 1WBBA 1TVEA 3EA5A 2K0GA 2HN9A 2VJNA 1KJNA 4HKOA 1CC8A 2ECOA 2YXNA 2DCLA 1YJ9S 4IIJA 4EZ4A 4M0FA 4DCUA 3FOZA 3NV3A 2HHQA 1PBNA 3PFKA 4RZSA 2ENUA 4F8JA 1PM7A 2O7QA 3LX4A 3DA8A 3PRBA 3LALA 1U6IA 4Z5XA 1IK6A 2ZI4A 3EX7B 3W21A 1APBA 4N47A 1A34A 1I10A 2KM8C 3OPWA 4JGIA 3ON5A 2BJ3A 1HDXA 5EI5A 3H2IA 2HF2A 1DX4A 1J06A 1RABB 3U5ZB 2GRUA 4CQLA 3DN9A 1T4CA 4LXGA 4S1TA 4V2UA 3PVEA 3IWLA 4BJHB 1EV11 5JSZA 2ZAHA 4F2RA 1GQRA 2N4CA 1ZZFA 3OJSA 2JFHA 3A12A 4K4SA 3EH2A 5K0SA 2WD8A 1IKVA 1I5OA 5B7QA 3BL8A 3W3AD 2AREA 1NWHA 1PJ6A 5BPXA 4RQBA 1LPBB 1Z2AA 1RWMA 3GU3A 2VXCA 5AICA 3ZZMA 4G0PA 4I5EA 1G16A 2ZIEA 5EP3A 2M1XA 2ATXA 4PWWA 2GILA 4O44A 3K7EA 4ZYYA 1GBGA 3TZEA 1RBQA 1XAGA 1YFXA 1T2DA 1AC5A 2QN8A 1W35A 2HWTA 4X71A 1I7QB 1GUFA 2B8JA 5HOQA 2H7VA 2Z8XA 5M0TA 5AIBA 4Q4JB 4B6JA 4M22A 5JYBA 3FMPB 3T3HA 4QX2A 3LMKA 3WGUA 1VBB3 1UPFA 3DOFA 2WIFA 4R4JA 4JHTA 1FFGB 2Q49A 5CNJA 3KFWX 2FRXA 2X10A 2IDKA 4P2XA 2XDQB 2BSXA 1I13A 1Q8VA 4WZZA 4YRCA 4RW9B 4U7HA 3RHFA 4BQNA 1V9OA 4CCJA 2MQMA 4PCQA 4QD2A 3QWBA 4ZHRA 5FO7B 4J37A 3HJCA 1K6MA 4L22A 2DFVA 3EPGA 1G4UR 4BKUA 1AF7A 3IEXA 4L11A 2IS1A 1RAAA 2X09A 3PNYA 2G8NA 3G5UA 5D86A 3P9XA 2HNZB 5C6CA 1XQ6A 2YH0A 1E4OA 5LMNB 4DIQA 3QE9Y 3OUIA 3U4SA 4XB6B 5KTQA 2FSFA 3ZK9A 2ES3A 5T67A 1VBB2 2WYSA 4FN4A 4BZWA 4BZPA 4E2ZA 2R6CA 1ZHOA 5DG2A 3DP7A 1E2JA 3R3VA 3V1KA 3OD1A 4BE7B 4KFRA 4H4MB 3DAOA 3F5SA 3R5BA 1RXWA 5B53A 3EYPA 1A8MA 5ARDA 4K1XA 3PFHA 4HDNB 1UPIA 1T0PA 4YH1A 3TQQA 3GWCA 4RCVA 4OYZA 4M4SA 3OQOA 4QXCA 3CJ0A 3NANA 5BP7A 2ASVA 3NUGA 4ME6A 3MTQA 4NJOA 4EITA 4DF3A 1AQUA 4K4VA 3AH8A 3VZOA 2SHKA 2X1BA 4ZVHA 4XUGB 3HJRA 4V3CA 1AUXA 5B57C 2YPDA 3EH1A 5J1EB 4L6CA 4ES8A 1RADB 1P0QA 1S5PA 1XD2A 3F98A 5GJWC 4X64F 5E6UB 3C0KA 2K3KA 4F60A 2IV2X 2WKPA 3AVQA 5FDFA 1U8WA 3UD5A 2QGFA 3HHLA 4ATNA 2FF7A 1PU2A 3MM4A 3ZU4A 5M7EA 1NPYA 4OLBA 5FHRA 1SJRA 4X4QA 1MCZA 3ZYCA 2J6HA 3WGLA 2YWDA 3KQSA 1OFGA 4PVCA 4F3TA 5BNPC 2OUIA 5AKZA 1E9FA 3DLBA 5F9HA 4EI7A 2W4MA 3SMZA 1N8KA 1BJRE 1SKYB 5L3ZA 4BA6A 1LOEA 3VAFA 4BV9A 1C9NA 1N0VC 4RK6A 5BN3B 1Y6GA 1MGOA 2DR2A 5CT5A 2YWHA 1S2MA 3O12A 2ES4A 3H5OA 3AP1A 3UJBA 4DQRA 3JQ9C 1TPZA 1SZJG 1DAKA 4G41A 4AI9A 4EUFA 2QIOA 5B0FA 3ZWOA 5I4KA 4EHBA 1XF1A 1KMIY 4IUDS 5BN4B 4ZPBA 3U1TA 3OGJA 4NESA 3GAFA 3PR3A 1UBGA 3L0ZA 3ZFGB 3JPYA 3G8TA 3UY4A 3BALA 3T4HB 3BGRB 1A9SA 2HDOA 3GXOA 3LUKA 3PIPQ 5SYAA 3MAQA 4EEKA 1LGYA 4RBNA 1HORA 5FZAA 1FFSA 3SJCA 3I76A 4CPBA 2G5PA 1PE0A 3K9WA 3HI4A 4ZIRA 3T5HA 4I8IA 1HRI3 3F74A 2ACYA 3J80A 2EFJA 2AKAB 5IMSA 1OBHA 4TMWA 4GD4A 2XB2A 4XIKA 2OEMA 2P6MA 2EWMA 3HR7A 4LOSA 2JLRA 3H5VA 2H1LA 1SUCA 1DZTA 5TY0A 4ONEA 2QVLA 5BQPA 1QBGA 1H73A 3KV9A 2G71A 3FG9A 5FZLA 1NRWA 1AYM1 1NP3A 3RIEA 4JOSA 5F8PA 4LMFA 3GLFE 1S9DA 1N1TA 2FCVA 3W7VA 4GUAA 3ADCA 4IG4A 1RT6A 3U1MA 2FN4A 3RWKX 4U2FA 4CTNA 3SDEA 3D7MA 4G0WA 4HEA9 4NUBA 2QNBA 3LRXA 2R2UA 3C14A 3I2KA 3A1DA 4JQZA 2YXBA 3LPNA 5BQ5A 1UQTA 1R6XA 1V3QE 4B35A 4NLGA 2RHPA 1HRI2 1YZHA 4JI4B 4Q19A 2BVBA 1PJTA 5JSOA 1LHWA 2B4YA 4NBLA 4TRRA 2W6OA 2A70A 4RFSB 3IPVA 2HK6A 3LQYA 2DHAA 2PX6A 4DFSA 3JVIA 4UBMA 2ZBQA 3RDIA 2AFRA 1KOLA 1MQ8B 2Z2JA 4DJFC 3TUPA 1RAGA 2WU1A 5H3HA 2MSTA 4FUTA 3CVXA 2G9QA 4N0EA 1QIGA 4D6SA 2QRVB 1DRWA 3DXYA 2IAJB 4CKEB 4ASKA 4BO2A 2GJ9A 5EPEA 4BC0A 1GP2A 3H2YA 3TZBA 2IHBA 1FFXA 4C2BA 2DETA 1XP5A 1ZIPA 3NS7A 3WLOA 4M5MA 4EJFA 3PKMA 1U8FO 3VQTA 3ZIXA 3NNJA 1OD5A 4TXNA 4KWIA 3SYTA 2L9LA 2QN2A 2O8NA 1Z5GA 4JVMA 1QE0A 5CCEA 3L40A 3N76A 4URUR 1IN0A 5EWLA 2W2OA 3KSUA 4FXDA 1V7QA 3LW8A 2FY8A 4CMEA 1HXS3 4QYSA 1EBUA 3RV3A 4Y2CA 2RU3A 1GEHA 4CO2A 3R09A 2FWRA 5IW8A 3IRUA 3BMOA 3DFMA 3LT2A 4HJRA 1K7EB 4NRMA 4Y1UA 2C7GA 3VR2A 4LUMA 4TN2A 4M8LA 4NRQA 4CQMA 2BJ7A 2R68A 1OLQA 5KFAA 5DHUA 3CD5A 2VJLA 4QBFA 4IOCQ 5EX3A 3ZNPA 3FOAA 1TGVA 1GPJA 2XT9A 3SIXA 3UJ3X 2Q3HA 3U3MA 3OUZA 1NCLA 1EFHA 2F43B 4TLGA 4IDEA 1DJQA 2ZUBA 3LAWA 4IXTA 3VKLA 3EYZA 1K6JA 4DRZA 1M2JA 1OXMA 2AE1A 2A9FA 2H1OA 3PFOA 3NM6B 2QLFA 5ECWA 3SCJE 2BH2A 2H3HA 2PZLA 4DJJA 5KDDA 3TNJA 4J7XA 4QQBA 3DTVD 4X93A 3I54A 2R16A 4L4ZA 4IUBS 4IETA 1JQKA 4ZPTR 1GFWA 2WJ3A 3F2VA 4OQPA 3BICA 3WFIA 3EWGA 2C4WA 3GK3A 5LLTA 3DYPA 1AB5A 4ARUA 2A2CA 4TKUB 4NZ0A 3RT9A 2RGRA 2DYKA 3HSYA 4KH9A 1NVXQ 2AYHA 4TYWA 1HQWA 2IUWA 1ZM7A 3LYAA 3DCYA 2R11A 4COVA 1X7XB 1E64A 4S0MA 1Q84A 3MF6A 1T3OA 3DMJB 1O2DA 4GWIA 2RBKA 2J5QA 3ZS9A 2HA5A 1KDOA 5FP3A 2QD4A 5BSKA 1TKDA 4KPUA 1PTKA 3DBVO 1SZDA 4YNBA 3N2YA 1GNPA 1MVOA 2ZAMA 1EUUA 5AHXA 5FBWB 5L38A 3MUEA 3R3HA 5EYXA 1OJLA 2C5FA 5I3CA 4IEVA 5IDWA 4OKNA 2O06A 2B8MA 3UZUA 4MXDA 3N35A 2RK3A 4A73A 4EKEA 2PUHA 4IZHA 5AOVA 2RH8A 4BQOA 1NG9A 1G8HA 1RUJ1 4RA9B 2B3TA 1YOBA 5E88A 1KYQA 1X4CA 4D1YA 1V6NA 1GNQA 2KVQE 5LXTA 4H7JA 3BMCA 4JUAA 3HL0A 1D4M1 4K21A 1FYUA 4ZJPA 4P9LA 3MM7A 4KSYA 3U3JA 4L97A 2JSXA 2DNLA 3MEGB 3VVBA 4YPVA 3UGQA 3U56A 1YCHA 3CRQA 2WFF3 3DXBA 1LW2A 1Z2PX 3V2UA 5HLFA 1OVSA 3R5GA 3HHNB 2IUFA 4QBTA 1I6XA 3VBFA 4R01A 1V6KA 3MURP 3UWSA 3UK0A 4P93A 4MK9A 1LQ9A 3IUJA 1MEC3 1ZH4A 2C04A 2OUHA 1XK8A 4OIXA 3AC0A 4AGVA 2OIHA 2GM9A 1OGJA 4ZZIA 1MZ6A 1EXNA 2JAHA 4TS9A 2XOEA 1BBT1 1WSRA 2H6BA 1USIA 1ZVVA 3RPQA 2BA9A 3ZYPA 1RWNA 4QUHA 3CRRA 1S7HA 1R88A 1CQJB 3TUZC 3MOZA 1W2HA 1J09A 5IUJC 2XWBB 1MZ5A 2PLNA 1JJFA 4WV8A 3VUOA 4G5SA 5BWCA 1Q3KA 4Q2FA 5J1SB 4LBLA 5DXDA 2C2YA 3E23A 1ZNYA 1PSWA 3K8OE 3DRPA 1ESDA 3BEDA 4OHFA 2RK4A 5JD3A 5F3EA 1K88A 3D8UA 3BJEA 1HOTA 4MUAA 1UDXA 3ZUPA 1HN0A 3ILLA 2V9ZA 4B8ZA 2IF2A 2FNAA 4A27A 2RIJA 4OX7A 3SM3A 1QY7A 1S7CA 3CS3A 1O3YA 3L09A 2W2LA 1RRGA 4NC9A 1NN3A 3I09A 2VYCA 3OR2B 1ADGA 5HS4A 3FLEA 4CTMA 5F4BA 4GLJA 5CHEA 4LREA 3H5LA 5JT1A 5A6SA 1SKMA 3FI9A 1OD3A 4AO6A 3DKKA 1UMBA 3TTYA 2FMHA 3H84A 5J09A 5HQMA 4B2YA 5KMGB 3BTXA 4XDDA 2Z0GA 4MV8A 3UHAA 4XJ8A 4TXJA 4A1OA 4JUZA 1R5JA 5EJ9A 1KK0A 4Q4X1 4KZPA 4LWZA 1FXZA 5FL3A 1UWBB 5F51A 1ASJ1 3MUNA 4XJZA 5K8MA 1XCJA 4WP3A 5I4MA 2VZLA 3FZNA 4QB2A 3DC7A 4X6QB 5KFEA 3TL2A 2YHIB 2CDNA 3N5CA 4JI7J 5TNXA 4IMPA 5JO9A 3BZWA 5FZDA 2E32A 2RS2A 2UUCF 1RNLA 2ZC3A 1OSCA 1N75A 2BEFA 4ZOLA 4ZO8A 1GU3A 1KQRA 1DGRA 1XMIA 1OXTA 5F1PA 2QSFA 5DYWA 1WAMA 2FUCA 4UTPA 2VNSA 5LEJA 2CFXA 2YVUA 4KNWA 1F14A 3D4OA 3TW8B 3RE1A 5H9SA 4TUYB 3I4LA 1IZ3A 2P30A 3BR9A 5JPCA 1CZVA 3RAGA 1CUAA 2QG6A 4IQFA 2JLXA 2VG6A 3EASA 1Q22A 3DOKA 2P69A 3OTFA 3ZOIA 3KKZA 1BNCA 1MENA 2DPMA 4JBWA 5LNK6 3EBLA 4XZUG 2Y6LA 1GDTA 5AD1A 1STOA 4AJOA 3HBKA 2Q6BA 2O0OA 1DFHA 1HV0A 2CJBA 2PHLA 1JZ6A 2HJHA 1KSHA 1JFLA 2G88A 1S3GA 2FE1A 4AEMA 521PA 3JSYA 4M5IA 1CJVB 3SC4A 3AP4A 1VRTB 2HK9A 5TT0A 1ZISA 1N0WA 1S0VA 4BX3A 3Q22A 1D2GA 5TR9A 2D69A 2EXKA 2ZTLA 1G66A 2ZS8A 2YWRA 1FYVA 1FDSA 3SYMA 4M1KA 4YM0A 3KB8A 3A25A 1J58A 3PE6A 2BE7A 1GAQA 4FKZA 5AUNB 2WOOA 1LGNA 2W70A 2D9OA 4ASLA 3FDSA 1A6LA 1BCRB 2BFEA 1ES9A 1Z63A 3K8ZA 4JP5A 5DN2A 1LZKA 2WA3A 3SFTA 4QHYA 1YVPA 1RM5A 3B8EA 5EIBD 1E3IA 2J67A 1WEYA 2WFPA 2Y1KA 2JC1A 3JY6A 2OGZA 1K8AT 4UEKA 5E1RA 3C3VA 4ZAZA 4D99A 2QAIA 3VC1A 1XTZA 4RFVA 2XLJA 3D2LA 1S1TA 4QQOA 2C9CA 3IOBA 3K4PA 5A8RA 4UEOA 1F7VA 1ACMA 4LRFA 3ZVMA 2EFVA 3H7HB 3RASA 3AKCA 5ALXA 1VMJA 2PNJA 2FCAA 4AGRA 4WWHA 4DL5A 2J45A 2XNSA 1DXOA 2IPOB 4Y1ZA 4LPKA 4V2IA 4BVJA 3ODGA 2KJVA 4MRSA 2E89A 4QR2A 4DI6A 1VL8A 5CLHA 4OZNA 1NSPA 5LDHA 2JFVA 1OAAA 3KF3A 2QRUA 2WP8J 4WNCA 3R2DJ 3N7UA 1RWPB 2CWXA 4R6XA 2VK2A 3IURA 3FX3A 1XVTA 4L02A 2G28A 5FNZA 3RFFA 3GZTB 4FLEA 4R69A 5I7EA 1F0YA 4DN6A 4EATA 2F3UA 3POYA 4OUEA 4TTVA 3T3YA 2EALA 4DIMA 4CP1A 1YACA 4DMRA 3OEHA 5ES4B 4PCRA 4LJSA 1VLJA 1DZRA 4W5HA 3LZ6A 1IONA 1PGPA 2WM2A 3NTUA 4HFNA 2KJWA 3ZDRA 1FVSA 2N9UA 5EJZB 5CFDC 2FWPA 4FP9A 4A45A 1X3LA 2ZDQA 2JGEA 3CMES 3EMVA 1BY9A 1K0TA 4BXOA 2ZTVA 3BIWE 1OAKA 4NQZA 5HG0A 2BHNA 1MS9A 4V0ME 3PHLA 3QYYA 2LQ9A 1IPSA 2GQQA 4RESA 2RDNA 1OY8A 2G19A 5CKNA 5EXSA 1SY7A 1AMUA 3C8DA 4NV3A 4EW2A 4CF7A 2DFBA 4A0GA 3DWGA 5JROA 1MWQA 3CLHA 3KQMA 3QIPB 3NV7A 5EP4A 2BGMA 4NBTA 1W85A 1VQNS 1HRKA 2F4VJ 3O1VA 3A6JA 3QWHA 4B3JA 1DFDA 4KE5A 4LR9A 1T2XA 5AVQA 4B9NA 1U1IA 4P4SA 4Q7JB 5J2UF 4EO8A 2B2CA 1DV2A 5L4SA 5I51A 4JKLA 2WQ7A 4AMGA 3G49A 3GFZA 2F1RA 1FS5A 2DUQA 1JYTA 4TLDA 5GLZA 3IGVA 1YRWA 1JA1A 2FN8A 3S8SA 2CMDA 1BIFA 4NPAA 4UCQA 4CJXA 3DNCA 5AHKA 4ITVA 1YNOA 1W4CA 1C9MA 2JIJA 4MI1A 1QYRA 3OJ0A 3RSQA 1SZBA 2ZRPA 4G86A 1AGYA 5EZYA 5TRTA 2B9VA 3HKDB 4PQ9A 3C5VA 4AJNA 4Q00A 3OOHA 1GNKA 4YRMA 4ZVOB 5BNNA 3JVVA 4UOZA 1AKUA 3LK6A 2IX9A 2DFCA 1JG2A 1XZCA 3DGPA 1C4KA 4LOLA 2CWDA 3MM5A 1ZESA 3RU7A 3VBEA 4CMGA 1N5YA 4MZDA 1VXRA 3E8MA 2W3JA 2YNFB 4N7MA 2LDBA 1YC5A 2ZRFA 4AY4A 4XUOA 1FWLA 4G3YC 3E05A 4XJAA 4Q29A 3LVBA 4D98A 3ATGA 2JIZD 4JOCA 4WINA 4ZVSA 3LCRA 1BS9A 5I9BA 1WB4A 1H0HA 3CCZA 4ZOBA 1JECA 2CJQA 2OZVA 2ZTUA 1YJ5A 2M4MA 1ODMA 1OFHA 1UZUA 4EY6A 1NY5A 4P86A 3RTBA 2Z8YA 2C9YA 1B3TA 1NFFA 1XEFA 2DCTA 2HEIA 3EFOA 1DRUA 1VRH3 3RZJA 3N6RA 3LE0A 3ML1A 2PUGA 5CFPA 1CLUA 3M3IA 4ZKTB 2HLTA 3B3FA 3O9VA 4HDMA 1H30A 5HANA 5FV3A 3G2HA 2YNHB 2CKWA 5G1PA 7FD1A 5DQGA 1LDNA 5L3QB 5ADWA 1M1XB 4D4GA 2H51A 4Y20B 4XIYA 1LVUA 1AZLA 2AIRA 2ZWVA 5D3MB 2UXCJ 1A2KC 2VDOB 4UT4A 4UHDA 1F5JA 5ETSA 2XE6A 1JS9A 1F5AA 5FYMA 3B36A 1LFDB 1MV5A 4AHWA 3OKCA 2J5XA 4MV1A 1OH5A 4KU7A 4LQLA 5JHHB 3U11A 1JIJA 3VD3A 3POBA 5LQNA 1EA5A 3USUA 3KQPA 3VX3A 4LZNA 5CBPB 2GFQA 2GNMA 2BTQA 1Q8OA 1XZEA 3IPLA 3ZXDA 1NOIA 4MIWA 4M21A 1ZCAA 4R1UA 3C98A 2LM3A 2PY6A 3SJZA 3E5QA 1T43A 5CX1B 4FB4A 4RKEA 4BN4A 1P5ZB 1Q1QA 4PYRA 5F0UA 3AP7A 4JC5A 1VRH2 3V8PA 3T2PA 5BV0A 3KQUA 4WADA 2LUWA 5C7YA 4OYIA 3ZFEC 2D93A 1F9HA 2VR1A 4RX1A 4OM7A 3HUUA 4QJ5A 3RS3A 3HTXA 3ZEAA 1P2BA 3JR7A 3CX4A 4MULA 1ODSA 1X2BA 5A7PA 4CBVA 3KR2A 3ZVNA 4K9SA 1OBCA 3IESA 1XHEA 1SXLA 4JV5J 2P68A 2WJVA 3OZIA 3DTTA 1AKNA 1SPBP 4DPTA 3UXHA 2DLNA 4DDUA 1ZG3A 4DLEA 1C8VB 2I6UA 3ZMNA 5DDRC 2FPKA 4C90A 1X4DA 4OYPA 2QP4A 4M9QA 3VVTA 4CMBA 2DT9A 3VAMA 4KGGA 3COZA 4UJ5A 2ZH2A 1PMJX 5A80A 1U1OA 1XMSA 3A36A 3O9ZA 1CE8B 1M34B 1E3DA 3CPEA 4Q0PA 4FOWA 1WXQA 1UU5A 4F0KA 4IG0A 3WE7A 4Y2HA 2HLNA 4CCCA 2J6TA 4DMMA 2TMGA 4QDUA 1NY71 2RUSA 5LBTA 1P80A 2G3YA 1QGUA 2FWAA 1LSUA 2KBFA 2RARA 1OX6A 1G8SA 4JI7B 4QODA 1SCJA 4KVFA 1GZUA 3DZBA 2Q29A 2VASA 2WBRA 3HPNA 3WLKX 1E2GA 2ZBDA 1GGFA 1UCNA 3CCFA 1GOTA 3RNOA 3ZLBA 3X1DA 4JUFA 2OZJA 1DGRN 2YHJA 2MHFA 4EHNA 3DDUA 3CCES 5FJ4A 4KQ2A 4GOOD 1AQYA 3GEEA 4CCWA 2YWEA 1U6JA 4WPAA 2Y1WA 1DDLA 3OXGA 4NXNF 4BMOB 1HHSA 1P0FA 3RO7A 3T2OA 5LBBA 1PFUA 1CB0A 4B3HA 3R5FA 2JL9A 5C9ZA 4M8SA 1OTXA 4IEXA 1U7TA 2P79A 3C1AA 2AEJA 4Y2QA 3AV0B 5EIEA 4QTYA 5K6AA 1CAXA 3VVMA 1W6NA 1Y80A 4ICIA 1XMOB 2J76E 1O89A 3FL7A 4NENB 2ZM6J 1AR93 3MYRA 4ZITA 3RYHB 3FFBA 3PUQA 1K9VF 3NM4A 2AYMA 5AT1A 4MJ3A 4QYRA 3POEA 3G8SA 1LK5A 5M5BA 3IUSA 1WF6A 4P14A 3OIWA 1WXEA 2GBLA 5IC4B 2O3DA 4J3NA 4M0NA 4P22A 4HNTA 5DGCA 2PH1A 3CZQA 3PI7A 1A8UA 4BNGA 2ARBA 2BEVB 3ZXIA 1EX8A 1MRZA 4PQGA 2BDEA 2JG9C 4N7IA 3OIUA 3V6LA 1BC5A 3USSA 3Q8WA 4RLHA 1CJUC 2CW5A 2BYVE 4YONB 2OPPA 2V5VA 3B48A 2CE2X 2P6UA 1QLNA 3VTKA 2MQOA 2W0XA 4QJIA 5KOHB 4RMNA 3DAYA 4UPEA 1X7NA 5FY5A 1IS4A 2VKTA 4XB2A 3D6AA 3FBFA 4BO9A 2CUKA 3BBBA 3S2YA 4DRRA 2ZKTA 1P2DA 5EXOA 3SKJE 3Q3IA 3RFUA 1SULA 5D5PA 2A0YA 4R5PA 3Q8FA 3B54A 5KT3A 4NEHB 3GONA 4MIAA 2FEXA 3TBFA 4NSNA 1ILEA 2Y6UA 4YCAA 4DXSA 3TFOA 4ZIVA 3QMWA 2J09A 1D9ZA 5F3TA 1CBUA 1GT6A 1SOAA 4LXUA 4LRQA 4KUGA 2P2DA 2HQ1A 2FJPA 4NHMA 1C1BB 5JD6A 3PDNA 5JY1A 2VPPA 2NXCA 4JKKA 5JALA 3MRTA 4C07A 1L7XA 1ZICA 5DG1A 7AT1B 2HEVF 1BVUA 2EW2A 2I1VB 2ZAYA 3WMEA 4KAIA 1GPAA 1UBTS 2YNMD 5TPWA 1RZVA 4UZCA 4A8JA 2XUIA 4PANA 2C7VA 3D5EA 4ANEA 2AX1A 1ZCJA 4Q1AA 2WIAA 5K0UB 5DM70 5DRTA 4GYWA 4U67Q 3G0CA 2V45A 2BD0A 4Q0BA 4D9EA 4Y1RB 4U2GA 1IJBA 3D2BA 4WRRA 1JNYA 3OTOJ 4E4SA 4R1LA 3P0FA 2R8EA 2MQLA 1HX6A 3OQNA 2AI1A 1XN1A 3RZZA 2XUPA 2BJSA 5HYVA 5LSRA 4IFYB 1ZD1A 2FEOA 1HNVB 3KAQA 5D00A 3QYFA 1C9JA 1DLIA 2JRSA 2FQPA 1Z7GA 1O4YA 3OKPA 2P17A 1HNIA 4O4HB 3WL4A 4HH4A 4N54A 3Q5EA 2XSJB 1GG9A 2F4VB 1RCXB 3WO1A 3PMEA 3HO8A 1FA0A 4NDAA 3VI3B 3EZ7A 1JLBA 2DNNA 3I96A 2NSLA 2HMUA 4MICA 3W9BA 2D4HA 1BQXA 2VAMA 1XHFA 2VA8A 4U1RA 1EFRD 4Q1FA 4ERXA 2OM2A 2V1UA 1JZSA 5IATA 2V5YA 3LP1B 1PGOA 5LKRA 2R8IA 4I4CA 4FDFA 4ZOCA 2OT7A 2B39A 4YJGB 4ZU7A 1T36A 4G4JA 3JQDA 3G2XA 3TN7A 1TCCA 1YUNA 3KV5A 4YP9A 3IR6A 1M5RA 3UVEA 1AX9A 1GNRA 2ZUTA 1WSDA 4V0RA 4Q4W2 3J26N 2CXHA 4BRZA 4H1VA 5EVCA 2NM1A 4Q7LA 3BJRA 4PF5A 4L9AA 4R2HA 3POWA 5ITSA 2HB6A 4JP2A 4IPTA 3ZHBA 4FCVA 1OBFO 3KXIA 1C1DB 2J7PA 3C1TA 3WGJA 1APSA 4G63A 5H70A 1US8B 2GHWA 1WVMA 1YKGA 1WMSA 3DHVA 5BWBA 3A0UA 1QNFA 4E1VA 3NL0A 4XJTA 3M1VB 3EJKA 4FNAA 3JQPA 5C8YB 1HWUA 4XDGA 1UAIA 3QXGA 5L7WA 2VPXB 1TVRA 5IT9Y 4RZHA 2J6IA 3IDSA 3OTHA 1VJWA 2ODTX 5FPPA 1NHWA 1HA3A 2E51A 3HCNA 3QX9A 4EK2A 4DR4F 5H83A 4JENA 2OYSA 1Y5NA 2ZKLA 4GE3A 4YRKA 2B37A 3ESYA 3RPEA 3HCOA 4JEMA 1G3QA 2I8AA 5FP4A 3AHCA 4PX2A 2JCVA 4M6WB 1ULEA 1NDQA 1ZD2P 4M1TA 1RINA 1WU8A 2ZU6A 3R20A 2VF4X 3IBWA 2DURA 4L0QA 4M76B 3K9LA 1FMD1 1Z0FA 2X1HA 4GICA 4RSHA 3ZDZB 1P1KA 1ZA7A 4M8IA 1IXKA 3QLUC 2C1EB 2ZNYA 1TEHA 4I2OA 3FUOA 2UXCB 4ARIA 1D9AA 1VQ5S 5IN4A 4E7OA 3Q15C 3FUUA 5GVQA 2XI2A 5ECYA 4ES2A 2ZAIA 1SURA 3OZRA 3M3PA 2GFFA 1TK9A 2FETA 4FMDF 2ZSKA 3WP4A 1YBVA 1DPFA 4BVGA 2C78A 1MB0A 2VSNA 4FX2A 4A7KA 1X0FA 3R4CA 4F4DA 4Q4CA 1GRVA 1NULA 1LV5A 1JLAB 4M4RA 1B6TA 1K4MA 1Z5UA 2Y6KA 2CDBA 1BS1A 3UMVA 2V8PA 2QN6A 1E5HA 2VATA 4F93B 1PGW1 2Z5GA 3LNCA 4K81B 1ISPA 2D1CA 2I74A 5D4PA 1HDKA 4E1BA 2J7UA 1DQ0A 5ETKA 3QV2A 2XSZD 3MEQA 5J4KA 3RI8A 4ENPA 2VTFA 4R4ZA 1UZVA 4C05A 3IULA 5ACA1 4PAAA 9LDTA 3KMHA 1FBNA 3HVTA 1E2LA 3QOYA 3M70A 3AEUB 1TV6A 3B9CA 2VC9A 5FX2A 1W6MB 3X1KA 2EGHA 4D81A 5HFAA 2W1QA 4M36A 2HZCA 3T3GA 3ABRB 4WCFC 3IQXA 4JV5B 1JFTA 4KQGA 4NIHA 4XDZA 3KVVA 2GVZC 2I6QA 4X20A 1HSOA 3ELYA 2DY0A 3ETGA 2Z4SA 5JH7F 3GLGE 4OHOA 5KYYB 3D7SB 5ALTA 1UL3A 1N1VA 5KSZA 3AZVA 1Z4JA 1NPTO 4C21A 5L36A 1KJLA 2ZJZA 3EODA 2PUFA 2YYYA 2DKOB 1RTJB 3CD0A 1W6OA 2RGYA 4GPZA 2QD5A 4IXDA 4XB1A 2R7WA 5EQUA 1VBKA 1CY0A 5CA1B 3KVYA 3KLSA 1HV8A 5EUHA 1YSCA 1WHYA 3V33A 1JPUA 3SSMA 5CH8A 2OSRA 2I76A 3BXEA 1P73A 5BMVB 2NNLD 2MT9A 4N82A 5LL6d 1LH0A 2VA9A 4DA7A 3PJXA 3IPAA 4CO4A 5DW0A 3WIOA 4CV1A 3QYJA 2EVXA 3ABSB 2XZWA 4R2LA 2I4NA 3HD8B 1S4EA 1OASA 4XASA 4BNTA 4X1KA 1Z2CA 3DZIA 4BO3A 3U4AA 2ONCA 4LI3X 1Z4LA 4USHA 4L85A 4QNMA 1KK3A 3KTQA 2VJXA 2VJQA 4YP3A 2GFIA 4IKAA 2LXUA 4UHBA 1YB2A 5CMLA 3EOBI 3WS7A 5ITZB 4RJIA 1CQPA 2ZBGA 3P2KA 2GESA 2IOFK 4HTFB 3QEMA 2OUKA 4D9KA 2ZT7A 3LFUA 4KQJA 5FZIA 1RKJA 4XQ0A 3ZTYA 2G2ZA 4ZXEA 4EVQA 2QN7A 1NXD1 3BSAA 1IBKJ 2Y8YA 3R6DA 2RJKA 2V03A 2R8OA 4JITA 4DSIA 3HSZA 1CNFA 4PR3A 1Z6GA 4GEGA 3G5MA 3H2GA 1C7RA 1DTWA 2HGNA 5F52A 2ORED 2ZM6B 1WSAA 1HOXA 2ZB3A 1ZIXA 4KT0C 4I4TF 4TL9A 1X9PA 4EHDA 1YR9A 1UBUS 2CB9A 4Q93A 4QUBA 4JROA 3BWDD 3AHHA 4DWJA 3HEIA 2KB2A 4GWKA 4LNUA 3TSAA 3KIPA 1RS0A 1XSQA 3OX2A 4D74A 5AJUA 1A2QA 2G06A 1OFSA 2DBNA 4YYOA 3PUWA 2CJWA 5DSXA 4YP0A 4LUCA 3MWLA 1NOVA 2BJHA 5CNAA 1GN9A 4RVGA 1VBXA 3H0CA 1EXVA 4Z51A 2QN9A 2VW2A 4AT1A 5KNBA 3ZBPA 4K7QA 1FPN3 4PG6A 1HE3A 4YG6A 1N2GA 1CJTC 2FJXA 5A3MA 2G0TA 1GZ5A 4DV5J 3VZQA 3BGVA 4NAVA 4CLXA 1ZZ9A 1G7TA 5F77A 3QWUA 1TIBA 5TB5A 1FKPB 5KFYA 1XTQA 1B6SA 5DBGA 1GTEA 4DLGA 2XCUA 2XZDA 4HB4A 1KDMA 2PBRA 1VQ4S 1J22A 2W52A 1HBOB 5LMNJ 3C43A 3E18A 3L7DA 4MKGA 4HPJB 3H65A 1MO3A 4P5PA 3BVCA 4HVOA 4QAWA 3GJ5A 1I7PA 4P82A 4WAUA 2I2WA 1SVLA 2ZYUX 2PA7A 4U9IS 3GJSB 4F4IA 1UPSA 4I50A 4QPJC 3P26A 3JQAA 1LBTA 4RFRB 3RB3A 2YC4C 4K2XA 2VB6A 1JAIA 1O3TA 2OPRB 4J4TA 1HNXF 1IY8A 1NIPA 2ZPUA 3RYLA 2GLXA 3F6PA 1KPIA 1X80B 1V7CA 1KP3A 4WDQA 4YUZA 1SXQA 1KY2A 1R6UA 5KTPA 5LLDA 3INNA 4L8YA 1UR5A 5FORA 2LW8A 3U4DA 4YRIA 2GJIA 2PO5A 4NLSA 4J75A 3OTOB 3MEPA 2NR0A 3CONA 1V9CA 2PEHA 2Z9DA 3BGOS 4Y6PA 4CG1A 2JZOA 2WM8A 3V8VA 4UHKA 5FXXA 3C5WP 5KTRA 4R8KA 3ADDA 5C7PA 2XL9A 3IVMA 3P52A 3KK3B 4PLVA 3ESXA 2P7HA 1E2NA 1K3IA 1GNZA 4BGDA 4HBGA 1FF9A 2X1GA 1ONNA 1VFJA 2V67A 3D1HA 2OZEA 3FGOA 3H5YA 4P6QA 1U25A 2BFFA 1WKVA 4UTVA 3TEMA 1BROA 2XKKA 4NE9C 2RHRA 3WLJA 3VD4A 2YV1A 4D8VA 4MPJA 1OWMA 5AC92 1Z13A 5FZGA 1TTPB 2XOKD 4GZMA 4RS5C 2FOIA 5C8VA 2AC2A 2ZLBA 1PK7A 3QUTA 1AZTA 4WVZA 3GJ7A 4ZLPA 2J31A 3PXBA 2FFQA 1EVQA 1GEEA 3AMHA 1EVJA 3NUZA 4TTPA 2XMAA 3WK5A 3D81A 3AXTA 5IAKA 5JXHA 3LP0B 3B60A 1RK8A 2UYGA 3TKYA 4ZK7M 3FKSD 3JSAA 2BLNA 1XBWA 1J33A 3OIYA 2VBXA 1DJ0A 3T5DA 4PI0A 2GAOA 4OXYA 2YW2A 5L1LA 1V41E 4DR1B 3BYWA 1DQ8A 2A33A 4IXNA 1WA4A 2F64A 2ZDHA 1VIWB 1G19A 4G4GA 3CRZA 2VT7A 3ED5A 2MYTA 2ZPAA 3OP1A 4Q4JA 3CLKA 3BU7A 2ZWAA 2P6HA 2Q2VA 5DGDA 1TL7B 1CB7A 2OHJA 3NBXX 1S0GA 1FE8A 1CU1A 2VZ0A 4LDJA 1FFGA 3KR9A 1J8YF 4MR7B 2H63A 1E58A 1VHLA 3D1JA 1DUSA 2FN7A 1C1XA 1BXKA 3D2CA 3K73O 1T9GR 5DP2A 3N70A 1ADJA 2QXUA 2XDQA 4CPDA 5IXSA 1KI3A 2ZITA 4AG3A 4MO9A 4RW9A 1GA4A 2OAEA 1LEHA 4JBXA 2HRBA 2ZEYA 1I30A 3DDKA 4YV7A 5FUIA 1SH3A 1QV6A 2YQ1A 4PPGA 2QQEA 1JXNA 1ZD9A 3TRDA 4WVFA 4KBBA 2XZTA 2G0CA 3DLIA 2CQ1A 5KJ1A 2HCTA 1Z0IA 4L3KA 5F7ZA 5FZ8A 4RVNA 3MRXA 3LWBA 5KPJA 4IDHA 2BAGA 4JZKA 4ZCKA 5DMXA 3LDHA 2HWE3 1YKFA 2GD2A 4WOCA 5DT9A 2WYOA 2WJSA 3G1UA 3RW6A 1UDWA 2DLDA 2H1VA 3NWJA 1W06A 3NJYA 1G8YA 3U7HB 2L08A 5DW3A 4H4MA 1VZ3A 2ZMNA 1NJZA 4HDNA 1SG9A 4URZR 3DRYA 3D6EA 2R1TB 4XXAA 3OGVA 2GZ2A 1KWKA 2HRYA 3CIZA 4FYYA 2FEMA 2QNIA 3IKTA 3P8BB 3GVHA 1MDBA 1PEAA 1JH5A 3HI9A 2IJGX 2VF5X 3M0EA 1JR3A 3S2UA 4KH0B 5KC6A 4LF6F 5J1EA 3I83A 1RADA 2XMCA 3EIFA 1U0TA 4UOGA 5E6UA 3P2IA 2JJYA 4ONUA 1M2OB 4S0XA 1M2FA 4G26A 1BLUA 1KZ6A 1Z35A 3RC8A 2OD7A 5I0RA 2GTHA 1CUIA 2HMIB 3I0RB 2FK7A 421PA 1A96A 2HWE2 1K7FB 2HRDA 2AZ3A 1SIUA 3DV9A 1VKRA 1VLVA 3JRNA 4BS9A 2EZUA 5BOSB 1GR3A 5T52A 3I55S 1XD9A 3BH0A 2GNTA 2WNUC 5E16A 5I8SA 2C3OA 5KFSA 1NFRA 3DOMB 1TLTA 1M1YA 3TIGA 2YINC 3O90A 5BR1A 5D4LA 4O3RA 1U2TA 2YPJA 5BN3A 2Y6FA 1M67A 5F39A 1XKXA 1IK4A 1PGZA 2QUJA 2YX1A 1S1XB 1FRHA 4ARBA 3LEGA 1E18A 4C8DA 4E8DA 2WF8A 5TGZA 4RMJA 1S3FA 2HSJA 1U0SY 2WZR3 2ZAGA 2JAXA 2NT3A 2OBFA 1EVIA 3EJWA 3UAGA 2DX7A 1FOD1 1VE0A 3M3EA 2HJIA 5JMWA 2CL0X 2DGTA 4GECA 4Y2VA 1ISSA 1D6MA 1O0CA 3BGRA 1JQJC 1SVUA 4LVNP 5AKHA 4HLTA 4Y9UA 3LANA 4ZKDA 1JYIA 4RR3B 4A47A 3QE3A 3CH4B 2E63A 5T64A 3NIBA 4LBWA 4IJMA 5IMBA 2HYIC 2J0XA 1E2DA 3A8JA 3WNCA 1WQ1R 1BYIA 3CLRC 4B4VA 1WC5A 4BC1A 3SHVA 4W7SA 1YLXA 5DGAA 3ZGZA 1ECGA 3L4EA 2VHCA 3D6VA 3B3GA 2CWMA 3NV1A 1IBKB 2A6WA 2HQGA 2UYOA 4NCBA 2C4NA 3M81A 3CUEF 2RS31 1SCAA 3KAPA 5AXCA 1GTMA 3OVSA 3T5KA 1Y9JA 4FNMA 3USES 5HMWA 1VR3A 4NICA 2BMVA 3U49A 2VZPA 2JEMA 2LCFA 4PQAA 3ZJUA 5FOSA 4V2WA 1AF9A 2FDJA 5E3JA 5TLSA 5E6RB 5K99A 1C4OA 4PAQA 4P72A 4I1RA 2QO3A 2FKAA 2X4GA 3CDBA 5AVRA 1K5MB 5HQ3B 4A3SA 2FR1A 5E3CA 4HSGA 4EN6B 4D9NA 4D6QA 1J3PA 3V4ZA 3SF8B 1AUVA 2VYVA 2GZDA 1A3CA 3RVOA 3TZHA 1U98A 4ZZ8A 1U6FA 2ABYA 2AOUB 1LESA 3FW1A 4YIKA 1O94D 1UAYA 4XR9A 1ARZA 1GV0A 3JSMB 2EZTA 4TYQA 5JZVA 4RFSA 3VNSA 4WX2B 5AVUA 4L9SA 4I2VA 5C71A 4XOGA 1EIWA 4TL7A 4Z4GA 2VJUA 4DV5B 1M1UA 3BE8A 4ZI7F 2UYYA 3D0GE 1P2FA 1WPXA 3A14A 3OZEA 5K6TA 2QRVA 5K5EA 1E69A 3D54D 3KFVA 4A3ZA 2IAJA 4CKEA 1XDGA 1TNDA 3WAGA 2HOQA 2YC0A 5FMOS 4KYVA 1N3PA 3M9NB 1S8NA 5GLWA 2OUGA 4EG7A 2ZIZA 5JE8A 2OR3A 1L4GA 1EM8B 3IIMA 5L8VA 3M6LA 4DR3F 1I9CA 1J0XO 1WDDA 2VV5A 3WK8A 2NUHA 2VFSA 5A5VA 1VMDA 4F1KA 1Z7S3 2VEOA 2D6MA 1GT91 5BWNA 3MJVA 4GKJJ 1VI5A 2VOVA 4YRRA 1H2MA 3CDZB 2CY6A 3U7QB 3IN9A 3OA0A 3OM9A 4KR0B 3THRA 3CR8A 3LCUA 2HW8A 3E3LA 4I56A 2JDNA 3L82B 4PYMA 2FSUA 1WMXA 1QVGR 3DM5A 4LFCB 4R54A 4EPYA 2GN6A 3BCWA 2ROQA 3AJ1A 4L3NA 3CINA 2VSXA 4PC1A 3ITHB 2VC0A 4LRBA 4YI3A 3UTCA 4E4ZA 5MN4A 2I22A 4E5PA 4BEJA 3GV7B 5A7FA 4GWJA 4NRUA 2ZGMA 3BVPA 1OXKB 3SHTA 4PEOA 2DTWA 4DL2A 4DRYA 2DCYA 2OAP1 4ZYUA 1HNZF 3QXHA 1PQPA 2F43A 2ORXA 3E5NA 3GVCA 3B78A 2DXFA 1A71A 1GA1A 3CJRA 1R31A 5J3UA 2P9HA 2XGSA 4X8OA 2ANCA 4NAMA 1E6YA 1Z7S2 4QU1A 1JLQB 1R6YA 3DBLB 3PI6A 3UT6A 3NY0A 4ZVPB 5J9FA 1TZCA 5FP9A 4FEEA 2E5FA 3GP5A 4LMAA 4QRHA 1G1AA 5JUWA 1BN6A 3T0DA 5BNZA 1U0OC 3H8UA 1KJZA 4HQ0A 1G20E 4LBQB 2ZBPA 2P8JA 4IM7A 3RARA 5EIYB 4ZRDA 3VKUA 1QIMA 2VPTA 4NNPA 4R3WA 3EO6A 4J9SA 2L19A 4MH0R 4USIA 2EW1A 2D6PA 5DK4A 2Q2QA 1BE0A 3CMGA 2B7CA 1K92A 3DQQA 5DNDA 1JHRA 3HDSA 1V8FA 1M1GA 1KY4A 4Y6RA 1II0A 4UVDA 4TKUA 4M38A 2GK4A 3FNRA 3SI8A 2XTMA 3E3NA 5D87A 3D7RA 4O25A 3FJ1A 3R1IA 3PEJA 1KNZA 4JWTA 4BMEA 2HH9A 2VSOA 4D25A 3D1QA 5DNCA 3N7AA 2LQBA 2Q0HA 3HZRA 2WLPA 5E6HA 5IVVA 5AVWA 1X7XA 2QN1A 3JV7A 2W48A 3OZSA 3PWKA 3DMJA 3MA0A 2AC4A 1H93A 5LLSA 5JVHQ 1FMFA 1HURA 2QZ8A 3U1VA 2BMEA 2EARA 3A58B 4EEXA 1CR2A 4P3YA 1D09A 4KO0B 5F8HA 3CBQA 4OGKA 4JI8B 2W5FA 1L8QA 1LPAB 4YACA 2L41A 5A3UA 3FUXA 1OHHD 3WHIA 4P7FA 3UCEA 4BQIA 1X8EA 4GOND 1JOPA 3EXFA 4IVNA 4RPIA 3BWVA 2FTRA 3GPBA 5FPZA 1EFTA 1DI0A 4RA9A 2RHBA 4RHFA 5ISMA 3BTZA 2XMGA 4MI9A 4DS4A 1P2VA 3NALA 2RHDA 2B5HA 2B4KA 2GA9A 1IOWA 4PG5A 2O52A 2F63A 1KP9A 4I3HA 1QJU3