3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Subtilisin-like serine protease
publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
2Z2ZA 2W2QP 1WMFA 1MEEA 4I0WB 4WOCA 3BOWA 1GNVA 2WUWE 1TM1E 5JMOA 1SUPA 1SBTA 1BFKA 2XTJA 1NLUA 1XF1A 2Z58A 1AF4A 3DE4X 2W2NP 1TM3E 1C9JA 1SBHA 4AKSA 3DE7X 3DF0A 3BPSP 2PKCA 4NMXA 3D43A 4H6XA 1SIUA 1KE1A 3GT3A 3AJ9A 1DF0A 2Z2XA 4K8RA 1A2QA 4OV6A 1QXPA 4DY5A 3PRKE 2ST1A 5AQEA 3GCWP 5JXJA 3ZXYA 1WSDA 2ID4A 1S01A 4I3GA 3P5BP 2W2MP 1KFUL 4YN3A 2DUJA 3BGOS 3DE2X 4G9SB 3JQXA 4FONA 3QFHA 1SBCA 4ZARA 4K8RB 2O8OA 4AKTA 3QTLA 1EA7A 4LVOA 4MZDA 2QTWA 3A3NB 1OT5A 1OYOA 3H42A 5AVJA 3L1KA 1Y3CE 2SBTA 1GA4A 4LVNA 5SV5A 4NE9A 3VSBA 3Q40A 4KB5A 1SIOA 1Y48E 1NQDA 3VHQA 3Q5GA 1ST3A 1SCAA 3GT4A 1TO2E 3EE6A 5SICE 5K7SA 2W2OP 1T1EA 4Z2AA 2TECE 3DE3X 1YU6A 3SQOP 2W2PA 1C9MA 1Y3FE 2Z56B 2HD4A 1Y4AE 1SCJB 1WVMA 5FBZA 1ITPA 2PMWA 2ZWPA 1GNSA 2X8JA 2PWAA 1AQNA 4RYDA 4C3VA 1SVNA 1YJCA 3AFGA 2DP4E 1R64A 1Y4DE 5CW1A 4DZGA 1SPBS 2DQKA 1GTJ1 1NQJA 3DWEX 2SECE 1Q5PA 2IY9A 1ST2A 4HX2A 2Z30A 3F7OA 1V5IA 2W2QA 1WMEA 1PEKE 1Y34E 3VV2A 1GCIA 1SCDA 2PWBA 3DW3X 3EIFA 4HVLA 3UNXA 1GTG1 1DUIA 3OSZA 3TI7A 3AJ8A 2WWTA 2XVLA 3GCXA 2W2NA 3HJRA 3WHIA 3CNQP 4CFZA 2SNIE 2Z58B 1SBNE 2ZWOA 3TECE 2Z2YA 3ZXXA 5B1EA 4DXZA 1DBIA 3VV2B 4KG7A 3TI9A 1T1IA 2PYZA 2XVKA 4NMXB 1TMGE 1NDUA 1SUCA 4CFYA 2QFEA 1P7VA 2HPZA 1PJ8A 4OV6B 1VSBA 3F7MA 3GCWA 1R0RE 3P5BA 3A3PA 2XRMA 3CO0P 1OYVA 3A3OA 1SIBE 3I37X 5AVKA 2ID8A 2P4EA 1GT91 4YN3B 5JXHA 1TECE 4HPKA 4KPGA 3I2YX 5FAXA 1SUBA 1KDZA 2Z57A 2PRKA 5AMXA 1SH7A 1BE6A 1KDYA 1SUDA 3DE1X 2QTWB 1T1GA 1Y3BE 4GI3A 3I34X 2W2PP 3H42B 4B5LA 4H6VA 1TM5E 3T41A 3BX1A 3WQBA 2W2OA 3SQOA 4J94A 1EGQA 1MPTA 2IXTA 3DE6X 1BFUA 1U5IA 2XTJP 1PFGA 1AU9A 1GA6A 1HT3A 1GA1A 5B1DA 1PTKA 2PMWB 4OMCA 1KFXL 2X8JB 1SELA 4H6WA 4NE7A 4OMDA 1C3LA 3DVSX 1TO1E 3LPDA 1KE2A 4M1ZA 3GCXP 1JEAA 3BGOP 3D9QX 1TM4E 1CSEE 4DZTA 1UBNA 3VV3A 3EDYA 3WIUA 3DVQX 2Z30B 1V5IB 3BPSA 2G4VA 1YJBA 1S2NA 1AH2A 4CG0A 1AK9A 3DDZX 5JXGA 2WV7A 1CNMA 1AVTA 3DW1X 3LPCA 1TM7E 1P8JA 1SCNE 2B6NA 1BJRE 3A3NA 2WUVA 1Y1KE 1YJAA 3DE0X 1IC6A 5ARBA 3SICE 1WMDA 2V8BA 3PTLA 1Y3DE 1BE8A 1TK2A 2W2MA 2Z2YB 4WOBA 1SCBA 3CNQS 3LPAA 1R6VA 3DE5X 1P7WA 1C9NA 3WIVA 1ZVKA 4C3UA 4DJ5X 1BH6A 1NDQA 3LXUX 1V6CA 2Z56A 3DYBA 1SUAA 1SN7A 1SCJA 3VYVA 2GKOA 1Y9ZA 1SPBP 1ZVJA 3DVRX 4BWGA 4DWWA 3A3PB 1LW6E 1AV7A 4DY3A 3A3OB 3I30X 5JXIA 1SUEA 4JP8A 1S02A 4NE9C 2PQ2A 1Y33E 2SICE 3VTAA 4HPKB 2XVGA 3CO0S 2E1PA 5FFNA 2Z57B 1SBIA 5ARCA 1IAVA 4ZOQI 3QMPA 3F49S 3JQWA 5ARDA 5I9SA 1THMA 2LUWA 2ZRQA 1GTL1 1KDVA
chains in the Genus database with same CATH superfamily
3NV1A 2BE9A 5FYBA 3RGGA 1WXGA 4AKHA 4C1XA 1ZVFA 1JNYA 2CFSA 4JGIA 4LREA 3QEMB 1IPFA 3GH1A 1YWXA 3LC0A 1TQLA 1QHEA 3VBUB 1HT2E 1TNDA 2ROGA 5JNRA 3VRHA 3VNUA 5IAAA 1X7YA 2ZS6B 4IICA 1Q8PA 4KIAA 1UX6A 5J2QA 1Q2XA 3TGWA 1UZWA 3RW9A 4KO2S 4C9BA 2WJYA 3WQHA 3FMWA 2YJTD 3N07A 4ZAGA 3CTRA 3URFA 2C9BA 4DZ6A 3ROQA 3DTVD 3GF6A 1W87A 3EBPA 4AEDC 3ICOA 2QKYA 1CETA 1ULUA 2WS93 3FCYA 2W2MP 5BN3B 1WBFA 1U3VA 3I9LA 2FPGB 1MJGM 3Q8AA 1XG5A 1YMUA 3RYFA 3ETNA 2UV8A 1GNKA 1XF9A 1AX1A 3BRWD 3P5SA 2HJVA 1OOEA 2P6OA 2MEV2 1XEFA 4B3MJ 3OX2A 3R2CJ 3L07A 1K12A 5ICCA 4C0WA 3N6RA 1W4LA 1C1LA 2FX3A 3MOGA 3MLLA 3KYCB 3DMJB 5FYIA 1GPNA 5JRJA 3UANA 4DR1J 3ZD7A 3EGXB 1WLWA 2EAUA 2JWNA 3G9CA 4MJ7A 5K0UB 5K14B 5E2IA 2AXQA 1X7XA 1EHIA 2ALYB 3WT3A 1WUJS 4KXMA 1JEYB 4D8MA 4H7LA 1BHO1 3TNJA 3OR2A 2YNMD 3EXUA 1S77D 5FUXA 2F43A 3H0EA 2RS32 5BXXA 1KO4A 4RWEA 2P40A 4YJFA 2WSEC 2XRFA 4D96A 4C6HA 4QXRA 5AHRA 4DSTA 2IXHA 1U9ZA 5FQ0B 2XG3A 4EFNA 3A06A 2IPOB 3IEUA 3LM8A 1U2TA 4MV7A 5A7OA 4MW9A 1H2NA 3ROPA 1MN9A 1ONOA 4UHEA 3IM8A 4B9NA 3T1YB 3C7OA 4UW5A 4LTMA 2LVWA 2WONA 4XX0B 2PRIA 4D7SA 5JATA 3AEXA 1HE4A 3CF2A 2WA2A 4J7CA 4B76A 4B4PA 2UP1A 2YVUA 3EYWA 1D2AA 2BOAA 4JP3A 4DV4J 2CNAA 1D6SA 1Q21A 4WOKA 4IXTA 1L3IA 1K3TA 1NLZA 2GPWA 4JXJA 2WG0A 1UCNA 4WZBA 4RVOA 1IG0A 1FUUA 4U3JB 4XIGS 3JBG3 3PI7A 4BGDA 5KJCA 3I5MA 2V8PA 2PYIA 3A9WA 5FZOB 1DSSG 2IXLA 2C61A 2ON6A 3FFIB 1ECCA 3US5A 2YQ4A 3VBCA 3ICWA 4G4IA 1E2IA 4O1MA 3ORYA 1FLAA 3G4SS 3DNPA 5CDUA 5D5HA 3ZUGA 1GZCA 4MV3A 1Q79A 1DG3A 3AETB 3EZFA 1SLBA 1TQ2A 4QB2A 5KNBA 3HA2A 1P7ZA 5FL7D 2GKSA 2XTMA 2WVDA 4XIKA 1HYEA 3T5BA 3GRAA 3FPHA 5T3UA 2VT7A 1DFGA 1WMAA 1MO3A 1P4SA 4LPSA 3CRW1 1K5JA 4L97A 3GEMA 3CLSD 1X7HA 5I4MA 2P2NA 3U3XA 5A2QA 1CZOA 1WULS 4DDWA 3AP5A 4HR2A 2JE7A 4JHTA 4NRPA 2JF0A 3I1IA 2JSXA 4WM8C 1NSKL 4DPMA 1W36C 1JVSA 1T4CB 2FZEA 1LHWA 2HOQA 5JY6A 4KO1S 3WAKA 4F83A 1Z8FA 2BVZA 2DNNA 4K3VA 3BSFA 4D46A 4J0DA 3UPUA 1LDNA 4FJ1A 1V11B 2HCTA 3VD5A 1ZNYA 1DAPA 1OC2A 2F8LA 1UBLS 2D6KA 3DO6A 2MQMA 5C7YA 4EQZA 4MV6A 3FFBA 3I5UA 4DHVA 4K21A 4COWA 1RVV1 3KL4A 4G8CA 2HGLA 4QT4A 4IDQA 4RXMA 5IFKA 3ZV7A 5KHKA 2J9RA 4P75A 1FEHA 1Q1BA 3GLGB 2Y6JA 4ASUD 1T5BA 4P9GA 3QWPA 3KBOA 2J9DE 4I6GA 2GFFA 2PUWA 2DCUB 3E35A 2EZUA 3IT2A 2WUDA 2KYZA 3RT1A 3FSGA 3TOJA 1M5RA 2COUA 3AI2A 1A9TA 1SCBA 3HY4A 4D26A 3GDBA 3E3OA 3T1YF 2DULA 2AZ4A 2F3PA 4Y1XA 1YH3A 5ELMA 4JYCA 1ADCA 4HLUC 2DUUA 2YRFA 4E1AA 4P71A 3NHPA 2BOIA 1J9ZA 1M2OA 2OHOA 1AO0A 3IKJA 3E5NA 1HURA 3HPOA 1G20A 3B3JA 4A82A 3GV0A 5B2EA 1LHUA 4PAAA 2FUKA 1R091 1HOTA 3AZOA 1PNOA 1I51B 2IELA 4REQB 1S0BA 3KTAA 3GXOA 1VS3A 1Q77A 4L6CA 1WIWA 1ONNA 3JQWA 3JQMA 2XBPA 5A06A 5FF9A 3K9BA 2F3JA 4FYIA 1JEQB 4BPZA 2JGDA 1PLLA 1RE0A 1KFEB 1E0JA 1PK6C 1GLNA 3LQRA 4W8OA 5HM8A 4Q7LA 1F8VA 2KSQA 4YJ3A 3TW6A 4WFJA 2K5UA 2VHVA 3ZCPA 4JDNA 3V8EA 2IYNA 4ZDNA 1AK2A 5JUVA 4IESA 1ODFA 5HILA 1DAOA 2Z5GA 4K6HA 4WUTA 1PNGA 1M1NA 1AKNA 2F3UA 3TSWA 2VBDA 1WW3A 3GJ5A 4D80A 3EFOA 1LHVA 3K9WA 4KDFA 5IULC 3TD2A 1K8AT 3WGMA 2ZB8A 3K4ZA 1BSVA 3V7WA 5EFUA 4CO0A 4HMOA 1OI6A 1FP1D 3LW8A 3TJZA 5JAQA 4Q0BB 2K1RA 3DFMA 5I7EA 5A7PA 2RDJA 2J0QD 1JNXX 3L18A 5AJ3J 3R7SB 3ESZA 1JLCB 5DIZA 1I36A 4IE0A 2I2CA 3F90A 4I1VA 2PX6A 3W4IA 2HU5A 2NG1A 4II3A 3PIPQ 2B35A 3AJAA 4PLWA 1A8DA 2RS52 3RVRA 4E31A 2W98A 4JNCA 3CEAA 1FS5A 2VYVD 1Y42X 1DT3A 2O52A 4DINB 4DV7J 3DAGA 4V3BA 1PUXA 4ZJPA 1E3IA 3CUWA 1QJCA 3Q5GA 3TQIA 1I6XA 3E9YA 2J1SA 5I3UB 2CV6A 2HBRB 3RJ5A 3LT2A 2OO5A 4B73A 1T1EA 3OC6A 3OUZA 3CX3A 5T50A 1GSOA 1IWBB 4V0QA 4P86A 1ZYUA 3MT8A 4FTWA 1QDOA 5BYBA 1W7AA 1MXFA 3HT0A 4Q1PA 3GAZA 2UUCB 4PLOA 3AFGA 2F1OA 4HHHA 4IR1A 1CULC 8ATCB 3BTAA 2QP9X 4MB2A 4ED4A 3LKBA 5AI4A 3V8MA 4W1RA 3C3CA 1P72A 4UUXA 1UBOS 2ZXUA 4DIUA 3VQSA 1EVEA 1HRV2 1FRMA 4Q4HB 1KDKA 1EK2A 2RC6A 2RMU3 1EHYA 4G84A 2XNDD 1DFDA 3G7NA 2VFRA 3L93A 1VRUB 4G6VB 3MC1A 4ALIA 2I1QA 2P4HX 2ADOA 2P7HA 3CVYA 1PRYA 5GADl 5AW2A 2PEZA 4Q4Y1 3BPDA 2IF0A 4G67A 4GG1A 1L5LA 1RNLA 1BDJA 3FBBA 4YCNA 1B41A 2G40A 4PPZA 4OVEA 3HJCA 2VR1A 3B94A 4EITA 1RYSA 1QRDA 3HSSA 4I9FA 4CUBA 5ALUA 4I9UA 1BQMA 4CDXA 1SCKA 3C6ZA 3OO1A 2HXSA 4FPYA 4ODIA 3DTVB 3EVWA 2ACEA 4LRXA 3UDLA 5LZ6A 4FFOA 3ZDXB 4S24A 2YWCA 1IHUA 5A62A 1H9AA 5EX0A 5DUXA 5G0VA 5KTRA 2E5GA 5JDIA 3OOJA 4ZEWA 3LGHA 5FFMA 3KK2B 1C2TA 3NDJA 1V6LA 1ZGBA 2XKKA 4TN2A 1MCZA 5KU1A 2H5JA 1IOLA 1OXXK 2YKAA 3N3AC 1AR71 4R2MA 3ZIWA 2Z0MA 1U8EA 3DA8A 2DISA 1OZFA 4FYXB 1RTIB 3UKDA 4D0GA 3GGSA 5DG2A 1X4HA 1GKLA 2XSFA 5JEEA 3EGNA 2QU7A 4BQ2A 5JWHA 5I9LA 2JLUA 2GJKA 1DX6A 2BGMA 1FZTA 1EPUA 5LLDA 4AQ7A 2VJVA 4BBYA 1B2RA 4KQFA 4YXWD 4EH1A 3E3XA 1WU7A 2JBWA 5FYYA 2AI1A 4JLDA 1RIRA 2GTHA 5JSKA 4KQGA 2FHJD 1RTHB 5A1LA 1UETA 1Z39A 2P11A 1IQDC 4KIWA 3K4DA 1YHFA 3GPAA 4F0KA 4M1EA 3ENQA 2HF2A 2BJDA 1JAIA 4M60A 1CJKA 2FE4A 1E1CB 2OAUA 2UUCF 2WU0A 4A8QA 2ONKA 5DMYA 1M1KT 1YR9A 2L2QA 2NXWA 3S01A 2VKRA 1SHTX 1N1DA 4PE5B 2BBSA 4IVRA 4IIJA 3IKTA 1MZ5A 4TMYA 4MMOA 2L3MA 4J91A 5FLHA 1P31A 2DHQA 1VBA1 3FUXA 1ZNZA 3UOAB 1EINA 2QWXA 2OB2A 1QH1B 5JVGQ 4CBVA 2XBUA 3I3DA 5JANA 2LA6A 5COAA 3LPAA 1MVOA 4CYMA 4EGAA 2O1PA 1A96A 2ZFUA 3NBYC 4FMBB 3O3OB 4I6EA 3WRYC 4QKDA 4HI1A 1WAMA 2YIMA 5ALNA 4GRSA 3Q2KA 2IP1A 4NFHA 1SC3A 4P4TA 4L3VA 4PNZA 2A4KA 5CB4A 2G1KA 4Q4V2 4UQPA 4PI0A 4RDCA 3EULA 3MM7A 1K2WA 2DNZA 2XY5A 3RC1A 1V8FA 3WMXA 5FFNA 2R44A 5H5JA 3O1IC 2ILVA 4O33A 5T6MA 5G3ZA 5EPEA 4PVDA 1EWVA 2HC9A 4KRXA 5L1KA 1EZZA 2D5BA 3N8KA 1RP5A 1V6HA 3QOXA 2WFPA 3J81j 1BBT1 1NBEB 3I05A 2C20A 2JD0A 1M1YB 3LUKA 4P4SA 1HMPA 1I4WA 1Q16A 1XZKA 4WFKA 3U4QB 2WJSA 4BQFA 4IQXA 3UHFA 4AWDA 2FYTA 4QD2A 4LDJA 3ZIAA 3TZWA 1ULGA 1NZDA 3GILA 5LXTA 3SVZA 1BWSA 1JI6A 1NHVA 4FDTA 1QVAA 2OZLA 3TB0A 1UZYA 3ADOA 4BE9A 2KVIA 1S3SA 4N53A 1HHQA 1G5HA 3QPUA 1N2BA 3GLFA 2YQ0A 2VSXA 4D81A 5HZMA 4K5RA 2JKZA 1Y8RB 4N43A 5GAGU 4FEEA 2ZH7A 1AR91 4B3CA 4M9SA 2Q6VA 4YFZA 4R3UC 2ZJBA 2ZRDA 3QITA 3ROUA 2HUNA 3UKTA 5LMNB 2P90A 2X0FA 3A2MA 5EG5A 3OCCA 3LQKA 2HDNB 1G60A 3HYRA 2C1ZA 1YDMA 3NT5A 5IJ0A 3SC7X 4F7WA 5HGXA 4P72A 3CIOA 3U10A 1O4WA 4SLIA 4DC1A 3BTOA 2HRUA 3SJZA 1RI3A 2YFUA 4TKTA 4I8DA 4XFGA 4GQIA 3S6JA 5B0AA 3EBLA 1RHI2 2ZYIA 4JQCA 4MKVA 5BPHA 5JAHA 2CJYB 4J1TC 1AE1A 1C0PA 2C5LA 2GXQA 2JKYA 1AZWA 3FWPA 4TSKA 1MEJA 4G89A 1NF9A 2N7CA 2Y6UA 2GIRA 1YIFA 2GFQA 5KHAA 1KTIA 2MT9A 4Q2FA 3GVIA 3C4VA 1JI0A 1KYXA 3PLAE 5LIRA 3NPAA 1LD3A 1PR3A 3N2YA 1URPA 4S2EA 4ZZ3A 1R081 5DWDA 2PWBA 3VC7A 1MC4A 4RA6A 2X58A 2WYFA 3WLEA 4OLJA 2QW0X 1TPZA 3C3VA 3I97A 1VQLS 1V26A 3BERA 4RQPB 2DBRA 1LWNA 1PN3A 2ZAMA 3F67A 4ZAXA 3O93A 1DDOA 2QTRA 1PGNA 4PQFA 3TEHB 2XXBA 5BQXA 2O8CB 2D3O1 1QJEA 2JFPA 3BWXA 4MV1A 1WQ4A 4PWDA 2ZSDA 2OT3B 2HRYA 4XJUA 4LGVA 4AU1A 4OQPA 4YS6A 5JLVA 3D81A 3AHDA 1M75A 1LGYA 4CDRA 3P9QA 3UBTA 2X29A 3H8RA 1OPRA 4DY6A 9MHTA 3R3WA 3A04A 2I38A 1DQRA 4UTXA 1OUMA 2I45A 2ZIEA 2AX4A 4WLVA 3DI6B 3I37X 1HUQA 2OXTA 3RE1A 3Q8QB 2R49A 5EIHA 3GOQA 1RR6A 5CYPA 4B8WA 2KPOA 3HM2A 4NHYA 1SCSA 3FTEA 3UENA 3N0VA 1ZFNA 2HSWA 1P19A 1UC9A 2JG8C 3CVVA 4OTZA 2A8YA 3KJVA 3DGTA 5C24A 4PLNA 5DQHA 3FNNA 3GGOA 1YR7A 2D2XA 3TLYA 4OHVA 1F2TB 1M34B 2D5FA 2DXDA 4LUMA 2C5GA 1NJZA 4ZD6A 1HKAA 3ECAA 4Q4JA 1NF3A 4F3KA 3AD9C 5HSPA 5LMNF 4HJRA 3AKPA 3VDQA 1IY9A 1QKIA 3C70A 2A3YA 1N1EA 5KOWA 4E27A 3PNAA 1UZVA 1NLQA 1A78A 5AJZA 2VNGA 4TLLB 2BFCB 2HWF2 4WKPA 4DG9A 4P4LA 2VHCA 1SFPA 1S1UB 1N6QB 4LKRA 5FTLA 5J47A 1VIWB 5AW6A 4QFCA 3P6YC 4FQ4A 421PA 2VXOA 4RBNA 4HGPA 2EK6A 3V2HA 1XFAA 5FNVB 3QLHB 3QOWA 4DG5A 2JCBA 4O4LA 1JHPA 3DDZX 2X86A 3IR5A 4CEWA 1FF9A 1G6Q1 4JDPA 3IR6B 2HEIA 2Q1YA 2B6NA 3C7AA 1DHMA 1XN4A 3OT9A 2A78A 3DE0X 3H1YA 2OOKA 1GBGA 3S5QA 5BMVA 4TQ9A 1AL22 1AZTA 2YBVA 2YXNA 3UAGA 4WFNQ 2Q4SA 1K45A 2V72A 2G9UA 3LF2A 4BNLA 2ZGUA 1X8LA 2VNVA 1L3CA 4YAJA 2DQSA 4YRLA 2MR6A 5KYUB 3H4IA 5HKBA 4G0YA 4PN3A 1KJZA 3ULKA 4RBUA 3R9XA 1U6KA 5IBRA 4EYQA 1RYFA 1MLDA 2CL2A 3EM1A 4LJRA 3EHKA 4LBOA 2FAXA 1RPTA 3AXTA 3D6NB 4IDPA 2Y6VA 4LG1A 3NRUA 5E16A 1T2NA 1A6LA 1RXWA 1JZ4A 3THXB 4JLSA 4ED7A 2G4LA 1D7AA 2JECA 1I0LA 4WK0B 2CXEA 2D1SA 1M06G 4OBEA 5FOUA 5FBVB 1NA5A 3GN1A 1TC2A 1NX9A 1I5OA 3WLHA 1Q2UA 2ENRA 5JPMB 4LYDA 4H7JA 3IP5A 4YCLA 1JJCB 1PV4A 3D6VA 2IM2A 5FCCA 1DUSA 1RVF2 3M3DA 1RUOA 3ZBTA 5TMDA 1RWQA 3GZNA 4G6ZA 1REDA 1PZNA 2CDQA 4P6QA 5EIWA 5FBJA 3Q2SC 1IVNA 2HBQA 1EB9A 4HXEB 3AZXA 1XF1A 2W8BB 2BABA 2I2YA 1DKLA 1KVJA 4CP0A 1QV7A 1RHUB 2O0JA 3TA0A 1PWEA 3B2QA 4F93B 1SG9A 4O44A 1A72A 1ZVMA 2JVIA 1WKVA 5HV0A 1S4CA 3ILVA 4F86A 2G8NA 3GRVA 3PJQA 4CMBA 2L0XA 4HTIA 4JBHA 1OFGA 5IHRA 1LNSA 1GUZA 2J07A 2RB4A 2BMWA 2NTJA 3U0VA 2PFDA 2WK4A 1E60A 3OV7A 2PN1A 4IDNA 4QXMA 1PGZA 4M1MA 3ORHA 5I42A 4LISA 2I7VA 2XW6A 3NATA 4Q0MA 1EUDA 4J9UE 3ZJVA 3NHFA 4V19J 2YJNA 3JYQA 5H9FJ 2I74A 4MVXA 1T1RA 4RHV1 2X9NA 3AMPA 4NJEB 5IEBA 4V0SA 5FNVF 3VJMA 4BO7A 4PC2A 5LEJA 2QTZA 2XS2A 1RHJA 4N47A 1RS0A 5HP4A 3QPCA 2W7AA 1C8LA 3NNHA 5IAOA 2ZE5A 4XQDA 2QQWA 4Y6GB 2XL9A 4LR4A 2V4RA 3Q1LA 4QTUB 4Z3DA 2WV9A 1MR3F 1GFF2 4K1XA 1WHVA 3GGDA 2NM1A 4BNIA 3VD7A 1G6NA 1FRLA 4D3XA 4Y2JA 2PA8D 3QVKA 4B1MA 2PLAA 1TLFA 2POCA 1RQ2A 1U7TA 3ZXKA 3H7IA 4UFIA 4GP7A 4YV2A 3LL4A 1TV6B 2PWAA 3KELA 5DO9A 3CRMA 2WU8A 5A7FA 1RKJA 5FYQA 4CT8A 3PURA 1NJWA 4KBBA 2B9EA 5AKJA 2AGSA 4YHHB 1U7LA 4MXWA 2MHNA 1GCIA 5FJKA 3F46A 1VIMA 2IXEA 1RJGA 1ZA1B 4GVXA 3TM4A 2OBXA 1LGCA 1AXRA 4BFTA 1JHUA 1D0HA 4IVPA 5E9QA 4PWZA 1W8OA 4QC2A 3IYLW 1RE1A 4NENB 3T1HB 5IXUA 3R3TA 1SXIA 2VOOA 5AM5A 3I1JA 4RR3A 1IN7A 2GF2A 2J33A 2RAPA 2FLOA 3EPIA 2P8JA 1K8RA 3Q3EA 5CHYA 4BZQA 4IUFA 2NADA 4CV0A 2G4BA 2C3UA 3IO1A 3VH4A 2ZH9A 3T3NA 3D7NA 4J6GA 5DCYA 1ZBQA 3HZOA 1M4WA 2OHHA 2W4IA 3MTGA 3WZ2A 4CQMD 3BJEA 1UW8A 5HNKA 4NCKA 3UXEA 5CYOA 4Q0UA 1I4OA 1F2DA 4A2WA 2VASA 1E1RA 4ZVFA 3HA3A 2PWPA 1EFVA 2A1IA 1EE9A 1GZUA 5M29A 4XWKA 5K0BA 4IUDS 4RHYA 1H72C 5T67A 2DGXA 1V2HE 5EIOA 1N6KA 1E20A 2VNRA 1I94B 3FRJA 1YL5A 3HSYA 5T4HA 2Z95A 4AO7A 2OK8A 2YINC 3L6CA 1HDYA 1S6PB 1V3SA 3R4UA 2BTVC 4PZLA 3VKGA 1VCTA 4QYZK 2P9JA 3QX8A 3L04A 1KDTA 4EL0A 3A12A 3E9CA 1IBMJ 1PO22 5AI6A 4B79A 4CLHA 1F06A 5CB8A 5GOZA 2WD7A 2LDBA 1TEIA 4PBSA 3IDZA 4EA7A 1KQOA 4Q2LA 1EX1A 2G67A 2HLTA 1FRFS 1JUHA 3RTVA 5J37A 5F5LA 1PTKA 3FG9A 1VLNA 2RRAA 3OJFA 1Q91A 4MDFA 1UVMA 2RS12 1I4EB 3SFVA 3F2ZA 3V6MA 2PMBA 3KUDA 5A8WA 2YS6A 1BD4A 2DYKA 2KXFA 4LEIA 1BGVA 1FLDA 2Z30B 1IDN1 1YIAA 2Q21A 1RWNA 3H5IA 3KLMX 2PJRA 2G5CA 3PB3A 2V54A 3UK6A 5A6VA 1OIVA 3V8BA 4Q26A 4YHHF 1R74A 3U4GA 2VRCA 2K2QB 2DO4A 3OQJA 2I6WA 4D8WA 5TGTA 2FZWA 1ZH8A 3BMNA 5KFMA 3F5SA 1QGZA 2BVBA 3QVMA 3K4PA 2UYGA 3PVOA 1JQGA 4I0AA 3V4MA 3RRJA 2WUFA 2O7SA 3ZE2B 3ZK9A 2X1GA 4TT3D 4YAGA 1VIXA 1U4NA 4EW2A 5EUCA 1YA4A 3T1HF 4B4VA 3WQPA 1HQWA 3W5DA 3NAZA 4LDPA 2DPMA 4ZS6A 3DZ8A 5GJVC 2E66A 2ERRA 2O8EB 2VP4A 4Q48A 1M8JA 4LF8B 3PC2A 1SUEA 3FVRA 1NJ8A 2J5QA 3OA0A 5DBEX 2GN0A 2W6MA 4BV8A 3KT8A 2PQ2A 4KSEB 4V38A 2QVZX 2VDRB 1R8AA 1V6MA 1CVJA 3L0PA 5FP4A 2X22A 5ETOA 2Y1OA 1PK8A 2VAUA 1GPH1 3EDCA 1CRWG 5A9TA 1W1IA 2DHAA 1XO1A 2YKMA 4QNNA 1U8ZA 5ALWA 2R6JA 2HHAA 4EF4A 2CJBA 4XW3A 2OKXA 3D0KA 4L76A 1JZSA 4MLCA 3DBHB 1L7QA 1W6OB 4I2OA 2JIOA 2CRLA 3IJRA 1I94F 2M8HA 1TKRA 4QJIA 2ZBQA 4DQSA 1ULZA 4Y2TA 3NGXA 1KYIA 3NR2A 3OLBA 1FUIA 4F71A 2WDPA 4L22A 2C9DA 4AXJA 4X64J 4DFPA 4YJHB 4MWSA 4M4RA 3NBMA 5FXMA 4KYZA 2D1FA 3RF6A 3EXFB 4J2HA 4Q8FA 5LLTA 1K97A 1NG0A 2CC2A 1XQYA 3AU9A 3L7CA 1KSGA 4X3CA 2JK1A 1U6JA 5E1BA 1JR3A 3TFQA 2BCJQ 3WNNA 3QIPB 3NEJA 4Q18A 1ZD5A 2MYUA 3SIPA 3WYCA 4M0UA 4QJ3A 2MSTA 1ZBTA 2WAOA 4PRYA 2FFQA 1N34B 5CLGA 1YL6A 2SKEA 1RYZA 1SJ3P 2XSZD 1NUAA 3F4KA 4YCSA 2AJ2A 3BEOA 1HPZB 3KETA 1JG2A 2GFHA 3I6PA 4BP3A 4V0RA 3VZJA 1H2VZ 1F4HA 1Z7EA 3WK4A 1AQYA 2Q6TA 4LUBA 4ZVSA 1K6IA 1D2CA 1VMFA 5IKPA 2AK3A 2QVLA 1A27A 4DSJA 5LA6A 4PQUA 1CUSA 5KZMB 4C0BA 1Y3FE 2P41A 3SDEB 2Y0BB 4AT1A 1GP4A 4LK2A 2V50A 1YYNA 2XH6A 2P9FA 2R2GA 3T8YA 4YO8A 1WBJB 1VL1A 3WUCA 4EKIA 1NW7A 1NATA 1RW4A 4KSCA 4D3DA 4W98A 4E2XA 1TKDA 2QA1A 1U7PA 1GL9B 2ARXA 4B29A 4XX1A 4J9PA 1IR0A 4FS1A 2NMOA 1VQ8S 2D97A 3UD4P 2XNJA 2NMVA 4LF8F 1W4ZA 4QR1A 2XJUA 4P81A 2GM4A 4KH0A 2VDQB 2BQRA 4URGA 4UBHA 5CBPA 4EJ2A 4QOIA 2I6FA 1MTZA 1QBGA 2HY7A 3AJ8A 3W05A 1NW5A 3A22A 4M0CA 3CCJS 5IXSA 4LBMA 1CIWA 1U99A 2QIOA 1GUBA 2VTBA 1DIWA 1CUDA 2QCSB 3ZC3A 1IN1A 2X5IB 3RFXA 4Q8EA 1KK0A 2QVXX 3Q88A 2ZUVA 4RJLA 4FYMA 1Z0IA 4WKRA 2V0GA 3R5AA 3U07A 2RKOA 4BOWA 1D2RA 6REQB 1EFLA 1AYN3 2OVUA 2QJOA 3RTAA 5ECWA 2HVZA 1D4M2 1XOIA 4X2BA 2IPAB 2HW8A 1IN8A 1ZGJA 5KX5A 3MHPA 1E5HA 1TKAA 3B3QE 2HRDA 2R2SA 2PM8A 1KO7A 1BXRB 5SZIA 3MEDB 3A9RA 4QYTA 3WLOA 4BWOA 2OHGA 1AUVA 3FZEA 4ALNA 4U36A 3ZH2A 4B85A 4QDQA 3PGMA 3QYJA 4BFCA 3TPCA 3V7UA 3BIJA 3GB0A 1R3NA 5SUHA 4WBNF 1HK7A 4CLXA 1TIKA 1UFWA 4S1OA 3OKAA 3UQYS 4GKKJ 3T41A 2V7QD 3ST7A 2PL3A 4EHDA 3PL0A 2VNHA 4QQ8A 3Q8CA 1N34F 2RK3A 2VF7A 4QKBA 5KAPA 4E21A 1UM9B 5FYCA 1PAUA 4Q9JA 1KEEA 1QY7A 2GTPA 4ZITA 5DM4A 1XWLA 1JDBB 3POJA 4OOFA 3TNYA 5F33A 5FBKA 1DINA 3IIJA 2ZHNA 2PSDA 3RTEA 2NP6A 3Q89A 2GW8A 2VJMA 4PSVA 1U2RA 4M3CA 2QN8A 2DTYA 3VDMA 3RIHA 1VECA 3C1TA 3IAS6 4XDPA 2GMJA 4B3XA 1WQ3A 2X2PA 1EJ0A 1NHWA 1JEEA 5HJEA 2GUWA 1BKZA 1NRJB 4KFUA 2XUHA 3R7NB 5B09A 3F6CA 3A27A 4IFBA 4P3YA 1WF0A 2FSGA 5LBCA 3BHNA 5EWLA 3MRSA 2VL4A 4NYZA 1AZLA 4BDVB 1MROA 3SCKE 3CCVS 2V09A 3KB1A 2X14A 4Y18A 1X9SA 4ZT2A 4DG1A 2D3TA 1W2OA 4QOJA 2Y64A 1GRNA 4RCZA 1PJQA 2XMMA 5HBGA 2MHCA 2DURA 2MKHA 4TS4A 1EXNA 4PDWA 3AFMA 4HN9A 3WLMA 3KUHA 3G8BA 3QD6A 4R9SA 3W3AH 2A0YA 1SJ9A 3VU3A 1YK1A 3D3WA 3HNMA 1JXEA 4R1NA 3SS9X 4ZO4A 4ND5A 2ZRJA 4L95C 1GTEA 1D3WA 4AW9A 3DYBA 2UZ0A 5CIRA 5LKAA 3PJDA 1X92A 4CQMB 4IV1C 3R7BB 1YRHA 3CULA 3H1PA 2Q79A 5HROB 1NQTA 1Z6PA 3LZCA 2EK1A 1ZISA 1MG7A 4RS4A 3HT1A 1HDCA 1TAGA 4A8MP 3O1MA 2AF3C 3SNHA 4BO0A 1YBFA 2EJBA 2FFJA 1YT5A 4O2AA 4UFHA 1QU3A 1QP4A 2ZZNA 5IVBA 1F2UA 1RT6B 4XZ3A 1H9BA 3TN7A 4XE5A 3ZD8A 3JTOA 1MWYA 1E5LA 4GE3A 3H1MA 3G8QA 4LMPA 4X91A 1POQA 2VUJA 4RQAA 1W8NA 3HHLC 2BI7A 5B4TA 1N1VA 4M5LA 3OLYA 4V1CI 1NBOA 2V9ZA 1PJ3A 3HB5X 1H23A 2PVCA 4Q34A 3P6BA 4Y65A 4QUGA 5LYJB 3GA7A 1WV1A 3K9CA 4E5MA 4B6EA 3KLNA 1L4BA 4IF6A 3AONB 5JR3A 2WMOB 1ARZA 2R65A 3T9CA 1CJBA 4LF5B 2BPA2 1PJ7A 2Q3CA 1XDUA 1Y98A 1PF7E 3LNTA 1IM5A 1T2VA 2A1XA 1J6UA 5I01A 2DHHA 1Q0NA 1R31A 3G8DA 4IHQA 5BUZA 3D6HB 4UBLA 2J5RA 3UESA 4RF2A 1TM2A 1GPWB 2O8VA 5LRSA 4WBFA 5JH7B 1QCZA 4PLFA 1DMRA 1JP7A 2UZ3A 2H6EA 2GVZA 4BNNA 3ME2A 4DMRA 3DMDA 3NHJA 3RG6A 1CQIB 5J1SB 3OVMA 3IMCA 5I3ZA 3IUJA 4FQ7A 3HCFA 3VHQA 1V43A 1XKLA 2HS3A 1G2EA 5J63A 4QIHA 2H1WA 2X0KA 1AMNA 4WM7A 3K73O 1HRI2 2XWJB 4PCRA 1DMSA 2VD7A 3ABIA 4OB8A 3CISA 5BN4B 2UUAJ 1Y1LA 4OFXA 1VGQA 2GD2A 1SKSA 4DMFA 3OYWB 4HSGA 4AX8A 2E32A 4CDGA 2BSQA 1HN1A 5L9AA 1PWZA 3AG5A 1C0IA 4DLNA 1OR8A 1OKQA 2NU7B 3I0RB 4FFIA 1COWD 1V5IA 1VDMA 1GO2A 1OHHD 3BCSA 3RROA 1GKBA 1VYTA 5DGBA 2IU3A 2N75A 1ZKMA 4WLEA 2E4WA 2B46X 1WOMA 4YGXB 4DGQA 4BK5A 5M3BA 3EAFA 4ZI7B 3G8SA 3H9EO 1ZL2A 2QMUB 4A46A 4L3WA 3CNQP 4CG3A 1YSJA 1MOZA 2R7KA 3C0KA 7FD1A 2HG4A 4IDCA 1QAOA 5C8DA 3D67A 1Z13A 1RL3A 4EY3A 1W06A 5L3SA 1N5SA 3AF6A 2FOLA 4DL5A 4DHWA 2EGUA 4CUAA 1YBHA 1PL8A 2JFXA 5EXXA 2A1TS 1I01A 2I2XB 3PYGA 4OYWA 4C7QA 2E33A 2CF5A 5EXTA 4E08A 1UBJS 5JIUA 4G5XA 3SC2A 4JIGA 4P7JA 3RS3A 1Q8IA 5LYJF 3CLHA 4AFAA 4RD0A 2B3TB 1MZPA 4DJTA 4D3ZA 3Q9LA 3T95A 1XXLA 1PW7A 4LX8A 4LF5F 4KPGA 4YMVA 2B8EA 5D4NA 4RORA 3E7FA 1UCFA 4QPIC 4TN5A 4P84A 1Y8CA 3SJ7A 4HZIA 1T1SA 4KIGA 4LY6A 5HJ7A 1UP6A 3GLKA 2F65A 4MUHA 3ONQA 3HYNA 4Y2UA 3HBZA 1B0ZA 3R44A 4B84A 5JH7F 4Z49A 4D9NA 1GAJA 3EIHA 3F5FA 4L4SA 4WEQA 3RZKA 4YB6A 2VA2A 1XJ0A 2RHSB 4ESEA 1ZTTA 2VK8A 3SLIA 3AK0A 5KMGB 1D5WA 3HU5A 4RY2A 4NIDA 4DYDA 3EIEA 5DFAA 3U4AA 4V1PA 3T7IA 3NTRA 1ESCA 1VBFA 1RMTA 3ZGOA 4F6RB 1TO1E 3LPDA 4IM7A 4F1WA 1HI9A 4EENA 5BORA 3AF0A 3EXIA 2AZ5A 3EODA 1PCXA 1O87A 1JMKC 2V55B 2QJVA 3HI6A 2GSWA 4F3JA 4HKLA 2R043 2X19A 1MC5A 3AB3A 3TLBA 1TP7A 2EW9A 1WMXA 3N05A 3VVTA 5CA6A 2NSCA 2V8HA 1G8PA 4OUMA 5DW0A 4ZVPB 1AT1B 2Z8YM 1AFJA 2W90A 2WTMA 2W5FA 1VKOA 4RTPA 4DL0C 4ZI7F 4LMAA 1ODMA 2VVFA 4Y5Z0 1F8XA 3R2DJ 1QZXA 1ZZ6A 4LF4J 3FYUB 4EK2A 3W2VB 3CF0A 1NSYA 3KDPA 4H7DA 4NFLA 3L9JT 2VTKA 3I2KA 4BWGA 3MLJA 2RU3A 2NZWA 1BMQA 2FQ1A 1GANA 5ITSA 3BRSA 2DVAA 3TNDA 1CAXB 4D4HA 1Y1TA 4DG8A 5UKDA 4AAXA 2D7CA 1TTQB 3SLGA 3M3OA 4OXQA 1M2GA 4XUOA 1OQ1A 1Y7HA 3DFIA 3OQNA 1WG4A 1ND2A 3CU7A 3LLUA 3G5TA 3AHHA 1D4AA 2ERFA 2DVMA 3QNUA 3NT2A 3QKIA 4P3NA 2BFNA 4H27A 2Q3DA 4ENTA 3J8F2 1B7FA 4GEKA 1X2EA 5ICMA 4RA9B 3A0UA 3CU5A 2FHSA 2CFCA 1NLUA 4IEXA 1SL2A 3I0MA 2PMDA 2J48A 3MM4A 4MADA 3UGGA 5K0SA 3BFVA 3RWKX 2VBPA 3AV3A 2V03A 2FCVA 5KOHB 2D2IA 2D9OA 1FMD3 4I5FA 2DCKA 2OEJA 5JI2E 4CGYA 3Q5EA 1R0LA 5BQPA 4GC5A 2AD1A 1GFZA 3N9MA 1UIMA 3LDFA 1NPPA 4IDDA 4B7UA 4CUZA 2HMIA 2XDAA 2IXFA 3H3ZA 4QHTA 1KFDA 3PT9A 2XUKA 2NO9A 3I3OA 4ZMBA 2OO7A 1FMFA 1JT9A 3CSUA 3D7MA 1S89A 1BLUA 4IFTA 4DKXA 3O2NA 2EG5A 2COEA 1PV1A 2V6BA 3M8PB 4TOIA 1J4AA 4X8OA 2LQBA 3ITHB 1JJBA 4KXFB 2B5VA 1DB3A 2RHOA 3TLGA 1CAVA 3ROMA 2IDEA 2IC3B 1VJ1A 4RLQA 5LUBA 4WKOA 2PS9A 5D3KA 3CJ8A 4UOQA 3UHJA 3AKEA 5T14A 2GNPA 1PFKA 2X13A 4YGYA 3U7JA 1O95D 4JJ4A 1QG6A 4M9RA 1CXZA 2QJRA 4C29A 4UPVA 4CI0B 2FQQA 5AHWA 3WY6A 4C0SA 5HQTA 3DNCA 1G6KA 4YBZA 1FFYA 2WNSA 4YJGB 5FUWA 3P3NA 1J2JA 3KLSA 2HNYB 2J87A 1N1TA 2WYUA 3PLNA 4I36A 3D9BA 4ZVHA 1S8AA 4AL9A 3VR0A 2ZMLA 2ZC4A 2HHUA 2CYAA 5E9WA 2RONA 1SBFA 1RHKB 4OQXA 3J7YI 2NTYC 2IBKA 1NBMD 3E01B 2WMDA 2CJWA 1S0EA 2JI6A 4YQWA 3TLKA 2HMTA 2RGDA 3OZRA 3SYRA 4RE5A 2G25A 3TAXA 3V0AB 1D9FA 1W6MB 3MIFA 2YKNB 5FY5A 1W6NA 3MGKA 3SE0A 3CJKA 4Y9UA 3WWYA 3MJ4A 1XRMA 2X0IA 2IZOA 2MKKA 4ALMA 4OUDB 1EIYB 2VH1A 4TLCA 5HMLA 3MTQA 3CEPB 2ZJ3A 3JQ7B 2QGFB 1HBNA 5AJXA 1PWHA 3C5HA 1MMNA 1Z5VA 1T5TA 2ET7A 3ESQA 2AJ8A 3ABSB 4MLOA 1YQXA 3GRFA 4XDZA 3RFFA 1XNAA 3ZSKA 5J2TA 1LWFA 1MRZA 1VAVA 3R8YA 2JX9A 4Y4RA 1RXOB 2APOA 3PSHA 4XM2A 2GLUA 3M2PA 2P7IA 3I2YX 4LMRA 1HV8A 2CVOA 5L9RA 1DCMA 3SEZA 4Q3DA 2V1UA 5FY1A 5B4VA 1RABB 2CJXA 2QAJA 2IYZA 1GV1A 1V37A 1O0BA 4RACA 3LFHA 1P0PA 5THXA 3VR3D 2O48X 4J3NA 5AO9A 3W64A 2UAGA 3PF8A 1TNFA 1NVTA 1KD7A 4LOTA 4KRFA 3LBAA 1WUYA 2BGTA 1YFKA 4JGZB 3QNWA 4B4WA 3F96A 1OLSA 4QREA 2HI0A 3I3QA 2HF9A 3BGWA 3RJMB 2ZJRQ 3K2OA 2VG6A 2OYCA 2LM3A 1T36B 4NEQA 2PT6A 1Z35A 3QOPA 4GB31 4C4SA 3RRYA 1YJ9S 1HNWB 4HRXA 1CUHA 1W5TA 1I2MA 4W7HA 1QLJA 2Y60A 1PJTA 5BOSA 2H2GA 1Q3KA 1NQWA 4UMEA 3OC0A 3I1YA 3LHDA 3FBTA 5DX8A 2WN3A 1H73A 4UUOA 3B6BA 1EB8A 4AWBA 1VFNA 3AUXA 2HFNA 2XAUA 4WNAA 3CPSA 3GFZA 2GJAA 4RZRA 4FDMA 3GJ7A 3H9UA 3T7CA 3UDCA 3N5KA 3DVAB 1I9RA 2XMRA 2ILZA 2WV7A 1X3SA 4DL3A 1ULFA 4BBAA 1M6YA 2DPGA 3TD9A 2QTCA 1HYBA 5K6AC 4OQLA 4B9VA 2A33A 1L5KA 1WW5A 5KYNA 1PO12 2AWOA 1RFGE 4YMGA 3CO5A 5FZ6A 3T7SA 4UD2A 1GWKA 4PGHA 3LH5A 1SUQB 3U7HB 1MZ6A 2RGCA 3IJ5A 1Y82A 4N8EA 1J5OA 1GICA 1XBFA 1Y1SA 1HF3A 4AGRA 4K9OA 4RTSA 3QO9A 1Y4ZA 1JTEA 2C54A 3WIVA 1FX0A 1NULA 4WQMA 1ISSA 3O31A 3AQIA 2QZPA 3QUAA 3SMHA 1B8VA 4PIPA 1TE2A 1E8NA 4Q1FA 4MCIA 4B9LA 2PSHA 4J9RA 1NQOA 4GH4A 4PR3A 3PACA 3FIJA 4UUBA 4QYIB 1GG2A 1T6YA 2YWJA 4XMAA 4HLQB 1U0HB 1IU9A 3DBVO 3GR0A 1Z7GA 4F91B 2I6SA 4ZDJA 1ZBE1 1KVRA 5CU7A 3AJZA 1OKKD 2CHQA 4F8YA 3VQTA 1IZ3A 1R8BA 2CZCA 1TL3A 2A0WA 4IEZA 2RBEA 1PJBA 4FEAA 4D9EA 1ZGGA 4OX9B 3WDLA 1NSPA 5TT0A 1L7AA 3PV0A 1NVGA 1R0WA 3D7KA 3JSRA 2PH7A 3B36A 4F2SA 3IJPA 1WY5A 2BZ0A 3W8EA 1WCUA 1A8MA 1OI7A 1LZKA 1SHJA 5IVPA 3A10A 4RXUA 1R43A 3K9QO 4AVBA 5EHXA 4NZ7A 4DM7A 3DLHA 1F8UA 2IJNA 5JS7A 4P2FA 4FGUA 5KDDA 3D3CJ 3TH5A 2QMOA 2MKIA 2JG9B 4OK5A 2H4JA 3BIWA 2X9LA 2A0FA 2AENA 1JLEA 3HFJA 4MW0A 4GKYA 4QD3A 5AXMA 4J4HA 2EZ4A 1R18A 2QQPA 2NS1B 1JAHA 3RBXA 2Z69A 3PEHA 4DA8A 4L72B 1Y8QA 4RTRA 4A2CA 2OR3A 5LK7B 1G291 1HNWF 3NH9A 4RW8B 2C00A 1I5ZA 3M4XA 4LTAA 2WIBA 4PQEA 5F98A 1PVC2 1V8DA 4YVSB 4TL7A 4UT5A 1GFSA 1PE0A 4X8NA 5EVJA 2CXNA 3AIMA 4RLHA 4YG6A 5GGXA 3UN2A 1O0PA 3EF0A 3ZV4A 1A5ZA 3SK0A 4DA6A 2B34A 4RD6A 1CERA 5FO1A 4CWAA 5JWOA 4YACA 1HWKA 2EC2A 2TECE 3BULA 5SY9A 4G5RA 1FV3A 4AB1A 4I46A 1SBRA 4AKIA 4CM0A 3BDPA 2FVXA 2AQKA 2E48A 5JR7B 4LOIA 5ALVA 2X8JA 2JEZA 2ZUWA 1XMQB 4O8CA 3DXSX 1QC5B 4B09A 4ED8A 2OUIA 4V2IA 1MHTA 4QIVA 1H2HA 3C7HA 2VNSA 3OZTA 4N8SA 4ZT6A 2AJ4A 4D5GA 4KYVA 5C1PA 2DNHA 3RK1A 3LKDA 4D4IA 1NVDA 5FYSA 3B7MA 4MLPA 1FVQA 4LQLA 3WGHA 2MPFA 3GVXA 6YASA 2R4FA 1E3EA 3PRDA 1W0PA 4RUBA 4MKAA 1VPWA 3T15A 1FJXA 5L7OB 4YFYA 1RITA 4HFMA 2QRVB 3GZ7A 3P49B 2RARA 4OX9F 1XCBA 5K0ZA 1HX6A 5EYXA 4Y2XA 2QYTA 4MVJG 1UIKA 1MB4A 3K3OA 2ZOGA 1JR4A 3EJKA 1V4BA 3GVPA 3TIFA 1QVFR 3WLKX 4ANFA 2VLIA 1P7VA 5FR1A 4UI9L 5A7GA 1VYAA 2DH6A 1JXMA 3M6AA 3FZYA 3QRQA 1KS9A 2BQUA 4MS3A 3ZE1B 1I0IA 1HD0A 2ATCA 3QHQA 1W48A 2ORZA 1HKUA 3H2IA 4QM8A 5FAXA 4C0LA 4HNAA 4DN9A 1N9GB 1UFVA 4BC0A 1N48A 2PA3A 2PELA 4IS2A 2O2XA 4E1VA 2QZ2A 4DPWA 2O7NA 3U3ZA 3KWMA 4X4SA 1VBD1 3CJRA 2VRNA 2GLXA 4TMXA 1UH5A 4FTSA 2QR2A 3Q98A 1D9AA 2P62A 4WV8A 4TQSA 1X86B 4PRZA 2VOEA 2DXEA 4UU7A 2GK4A 2PHRA 2C7BA 4IGQA 3PJEA 4DCUA 4M0KA 1CD3G 1KO1A 5EMNA 1A8IA 5AXKA 4CEYB 2PYDA 2QN6B 4NC9A 4MPJA 1Q1AA 5EJ5A 3OY7A 5JSPA 1PGSA 3T0FA 4ZPWR 2WSYB 2GNTA 2IYXA 1NRIA 4OB6A 5ABJB 4CCLA 3IKVA 2PXXA 2YNHA 4G9GA 3ZG6A 1HLDA 3ROTA 3CF4A 4DCSA 4UVHA 4ZPIA 4B83A 3SEPA 4AJIA 1VZ2A 4IFIA 2CUTA 1T2UA 3NDPA 2XS5A 4WRRA 1TK0A 3PUXA 3DOEA 3MRXA 4GYKA 5JS8A 1XMQF 3O4IA 3TUPA 1QTIA 2JLBA 2JD4A 1KTQA 2VCAA 3D2WA 5ER6A 4HS4A 4OUKX 4RABA 3JASB 3ZNQA 5FMOL 4AYXA 4WLUA 5CA1B 1T15A 4XB2A 3TEGA 1IWOA 4F02A 1F1JA 3N9LA 3HCNA 2BDEA 1WCKA 4I99A 2YW9A 2CBZA 5EWJA 2B5JB 4M36A 1YRUA 4R9VA 3KOAA 4DBLC 5FLEX 1C0TA 1AKQA 2CL7X 4ZMMA 3OF2A 2ENWA 2CNKA 1OA0A 5KKCA 4Y7CA 2HBZB 5CCEA 2WABA 1A4IA 1XPJA 4IIHA 3KZNA 4IG4A 1G1MA 2YXPX 1BXGA 2RKBA 4XVRA 1H0BA 3UC9A 1JFVA 2QX6A 4RNFA 3JU9A 2K9ZA 5FPQA 1VC5A 5B08A 4LGCA 1NPTO 3RVDA 3SZUA 1Z2DA 2RH3A 4L6AA 3TQEA 2D62A 4XDQA 2JJ2D 1N7JA 4Y20A 2XMJA 5AXAA 5CVTA 3HP7A 2R62A 2PKYX 4OJTA 3ND5A 2YHUA 5KYGA 5KDLA 4ENWA 4HPWA 4ZQFA 3TUJC 5T8KC 2B7BB 1T3TA 3QH4A 3LY9A 1ONSA 1FJGJ 4ZKDA 1M0WA 5EJAA 1KC8T 1KAEA 3NYQA 1CPMA 2B6AA 4WW0A 3T09A 3MFYA 2G2OA 1KK3A 1M66A 3RS9A 2ZUUA 4IV5A 1PMIA 2RBKA 4A2PA 3H8JA 3VZKA 5IEJA 4S1WA 1YJLA 4QWAA 1PJ4A 2GHIA 1USVA 3HHPA 3HRKA 4LR8A 1KOOA 1ND3C 2RJKA 1GOGA 2GBGA 1Y3IA 1GV0A 1OJ4A 2HT6A 5KQLA 1Q0HA 2J0SD 1NM5A 4AXIA 3SZ3A 3MRVA 1G19A 4OI6A 4C0JA 3K1AB 4XJTA 4LF2A 1BX3A 1WZCA 1DLCA 2XWJI 3H0OA 1D09A 2NQTA 3RYHB 2ZEXA 2FP3A 4X61A 4WF9Q 3PC7A 3GFTA 2I9SA 4BO2A 2O8OA 2H0VA 1EGVB 3EGXA 2YY7A 3V8NA 1K4YA 5THWA 4XDCA 5EE3A 3K09A 3PIRA 1BOFA 2DH7A 2BBEA 2IM1A 5J4VA 2WU1A 4Q0VA 4OV1A 2Q2WA 4N3GA 2JI4A 5IJZA 4MRVA 1T3ZA 1CYDA 3KYBA 4NMWA 3EGOA 4XOIA 2XUAA 5G0SA 1EQ2A 5EHDA 3T3YA 1NW6A 3SJAA 3I58A 1JEYA 5IWFA 2QPOA 3KJFB 4JJGA 1AGPA 3I04M 4DB5A 3IBFA 2XS7A 1LVUA 4AY2A 5CA1F 4MW5A 2QZZA 1UPPA 2DRIA 3MMCA 1Z4PX 1TVKA 3IH5A 1VA4A 2IGBA 3AOEC 2BZ1A 3EZ7A 1RJ7A 4ZEVA 1H2UX 2C24A 5EJ6A 1WB6A 2HNBA 3D6UA 1XKTA 2YPDA 1YQDA 1VZ3A 3DBRB 4G5FA 3M9XA 1KI6B 2B1JA 3VZNA 1KAMA 4DCPA 4YPOA 3ZFFA 2I80A 1E9CA 2JBHA 4MUGA 2YASA 2WBKA 1QJY2 2OG1A 4CW7A 1FPMA 5CFDC 4KY3A 4FNOA 2J9EA 1FRXA 3GFYA 4X00A 5EWSA 4BP1A 4C21A 4DWJA 3N8NA 3K2IA 3FLTA 1EDOA 4LZJA 4U3JA 2JLQA 3NFRA 3AL3A 4QOEA 1YS9A 3AEZA 5DRTA 5BP7A 2JS7A 3NBQA 3AHGA 4D45A 4AI6A 3Q0TA 4V03A 5CVEA 3JAMA 4UAPA 2ZB4A 1K0FA 4P0QB 3E7DA 3WYBA 4ZOCA 2GAGC 3VBEA 1NM2A 1GPKA 1N5LA 2A6WA 1V3TA 1ZPDA 1VBB1 4GMP0 3DFEA 4EWEA 1JSRA 2EWWA 4B6FA 2L41A 2DBBA 4M22A 1GL7A 2HLPA 1M2JA 3UT6A 1Z5PA 3RWMB 5FMBA 4YN3B 4BNVA 3R8FA 1NHUA 1FW8A 3SCHA 4AIRA 3G2XA 2F8HA 4CMEC 2NNLD 5FLXA 4RL6A 4KWKA 2PGOA 3CX7A 4NBRA 2CTVA 3KVYA 3EJWA 3MPWA 2IBSA 3D31A 5FO0A 1CNEA 1WNTA 2RCYA 4TLEA 3CWQA 3F44A 4U7FA 4ZCKA 2BNMA 4LRFA 1YFJA 3W6ZA 3F95A 3VZQA 2B82A 1C4WA 5GP1A 3TBHA 4DV1B 3KHTA 3C6UA 1UC5B 4U7UK 3W66A 3S29A 2CUNA 1J56A 1XVLA 4H7IA 3VOTA 1FS4A 2FDXA 4NI2B 3U7QB 5GJBA 3MECB 3EZ2A 1SH2A 3FLPA 3LHSA 3PHIA 4UATA 4AFBA 3MAQA 1UO9A 3VZBA 2FW7A 4PR0A 3GLGA 1HQEB 1H4VB 1TVRA 1JZ6A 1TQ5A 2J5BA 1EAH2 3IUBA 2HFKA 3KOYA 1CSEE 2E53A 2YYOA 4NXNB 3SHOA 3NBXX 3UIEA 2R6HA 3JYNA 5EL0A 1G5QA 2ZGTA 1WC4A 3LPCA 3AJ2A 1F1BA 4YIHA 5T4BA 4DCTA 1RPZA 4B47A 2CYFA 3NGKA 3KHGA 1Z7BA 5CFCC 1Y3DE 1GLGA 4B4OA 3OKCA 3KHUA 2BM0A 3IHKA 2XE6A 2YFQA 4ISRA 2QZ9A 4J1QA 4V1CB 2DVIA 1XU7A 5HPOA 2FMYA 4MA0A 1XQ9A 3GBFA 4REQA 3RMYA 3PV8A 4QARA 3OUHA 3ZLBA 2CADA 2K2WA 2Z56A 4HDCA 4GWGA 2JC3A 2FCUA 1KDPA 1BMDA 1SV5B 4P10A 4N77A 1TQDA 4NV0A 4ERXA 1Z2PX 2HURA 1LPSA 2IA5A 1W9YA 3FRZA 4HQNA 4JI4B 4ECEA 4YRJA 1IJEB 2HFUA 1BNCA 3QLQA 3TPFA 5FWJA 1SOMA 2WP8J 2RC5A 2Z3ZA 3U2QA 4OP3A 4XQEA 2W7PA 3WUDA 3B82A 3FYDA 2AFIB 5K1ZA 4IG3A 1OB5A 2BBAA 3T7AA 1CJMA 2A67A 4JEMA 1R8SA 1WG5A 2E4XA 3C3YA 3GG9A 4ZP1A 3PIJA 5GAHI 5D78A 3TIXB 1ULSA 1EHCA 5C6CA 2I3GA 3FCVA 5I3PA 4LRWA 2H3EB 1CDOA 1FU4A 2MKCA 4MIEA 2WZ8A 4I4IA 2QSZA 4BPRA 1VIDA 4ILRA 4HB4A 4GZMA 5HQMA 1WD6A 2GN1A 3R5GA 4PNPA 1IBRA 4JI5J 1LKNA 2REQB 1P9LA 5D3GA 1GQOA 5FO9B 2JEGA 3HS3A 5JIAA 2Z2XA 3LT5A 1TMF1 3KXKA 2A57A 4E2FB 3DFZA 1SBDA 4DV1F 4M5GA 2PCJA 5IM4F 4MJ3A 4S2FA 2VDNB 3D7LA 3OFJA 1Z45A 5CLQA 3W3AA 3MLKA 4CLZA 3GFSA 3EDRA 1S2BA 5LWHA 3UAXA 4EO4A 4OQ4A 2VMEA 3TX2A 3PQ2A 4RZ2A 4W82A 1Z08A 4ZQCB 3SNMA 3CN7A 5I3UA 4JLWA 3EUNA 2HA0A 1CR6A 2JI9A 1V48A 2IBOA 4N3NA 3KLIA 4NXNF 1SA0B 1Z6XA 1VM6A 4NHMA 2BRTA 4L4UA 4CG2A 1A88A 3NGSA 1WLSA 3O4HA 5BNZA 2F1RA 2FC9A 1YZYA 5LZ9A 2NYYA 4X84A 3KSDO 4G2TA 1CX4A 2Y77A 1JR6A 2WAMA 4I3FA 1HLGA 1FKOA 2PO5A 4DNQA 5H02A 1MA3A 1A8QA 4Q05A 3ZTQA 4C7OB 3UMSA 3VPGA 1KLMB 5E9AA 1AB8A 1XIQA 4A8JC 2FWMX 4XB1A 1OE0A 5DW3A 3RRGA 3U02A 3BWBA 2UYHA 2X09A 3ZYZA 4F0HA 5K7PA 4LRDA 2I03A 4DZGA 4QYRA 3NI2A 1UP1A 1E79D 2ZJCA 4ZVGA 2HYIB 1VG1A 1GARA 2DGVA 3F7OA 3SFTA 1IONA 1XDGA 2CKWA 2HIMA 1XXHE 4YVWA 1LX6A 4NLLA 3EFEA 4LFBB 1JZ5A 3J7MA 4JI4F 3KHCA 4GLBA 3BWMA 4Y5TA 1G16A 5SY6A 2R7SA 4UNQA 4XCQA 5D8AA 2CQCA 4FDAA 1ENRA 1ENZA 3BWEA 1TAHA 2ALJA 2ZREA 1O3TA 2IP2A 1T8YA 2GAHC 5C25A 3ILXA 3DT9A 5FUBA 3DTVA 1TKTB 3I59B 3VZRA 3FRIA 1M2FA 3C3AA 4JGBA 5CEFA 3IERA 3JQ8A 2W9XA 4ED6A 4LRSB 3KFVA 3A2LA 1RKVA 3CUSA 5D3ZA 2RS8A 3GMSA 3HU2A 2PUCA 4P6VF 2RAQA 4L0DA 4GOXA 1NX6A 1PHRA 3KWFA 3UCEA 3BRWA 3KK2A 3MJDA 2XDQB 2CNLB 4RKYA 4EJSA 1ORTA 1O54A 1CDZA 1CUGA 2ZJAA 1GP5A 5FPBA 1IY1A 3EUWA 4DV5J 4ZJYA 3VBRA 3J7Z5 3VWSA 1SUBA 1RTIA 3K7EA 4LXXA 4M21A 1QQP1 4NCXA 5J1TB 3E7PA 5G4LA 1JYSA 4XCBA 1NF2A 1OFHA 3PUAA 4O3NA 2B8QA 3HPQA 4B5LA 1FPN3 3RSSA 2J0UB 3HCRA 3GROA 2VDKB 2YZKA 4XFAA 1BDBA 1KMCA 4U7CA 2ZGMA 1OPZA 4FMDB 3KOZA 3AB0A 1X5TA 2YNMA 1S2IA 3Q3JB 5F2EA 4HVTA 4IAOA 3I5AA 1GLVA 2FZCA 1QBKC 1D1TA 1UP7A 1UJ2A 3I9V9 4GYJA 1JZ8A 2N47A 3M9MB 2O1SA 5KQMA 3V4OA 3GYDA 4NV3A 4O6VA 4BO4A 1E2DA 4NHKA 3RO7A 5A0YB 2W2KB 1E1CA 2VC0A 1BDHA 2MZTA 5BXYA 3AVRA 1P81A 3U0BA 1T91A 2PRYA 4OU5A 2AV6A 3KKOA 4RMJA 4Y3CA 4DAEA 4MMZB 4PYDA 3MMZA 4WCFB 3HEIA 4RXTA 6PFKA 1OBVA 4J07A 2ZHOA 2WNIA 2H1IA 1OVSA 2OCDA 5FTTC 4Z3KA 4F0JA 2ZTLA 5FTWA 5KTYA 3NL1A 3JYTA 4QHYA 2IK8A 4KHPB 4YLEA 2NT3A 4C7MA 5HVGA 2O6LA 2MEV1 3TG8A 4LCEA 5FIXA 3VB9A 1XR7A 4HI0E 2X0RA 4Y9SA 4R9NA 4LFBF 3AYXB 5CURA 2OK7A 2QTMA 2RSQA 3CNQS 3VKVA 1PJRA 2PD1A 1OVGA 4Z5XA 3HNBM 3IP8A 2XL7A 3VUFA 2B9WA 4EA6A 3I01A 4DLTA 4XTRA 3ZHUA 1V70A 2R60A 3DOHA 1HW9A 3DCNA 1JECA 2B98A 1JTZX 2V96A 5AUNB 3FNGA 4BCDA 1E5RA 4ARAA 1GKKA 1Y1RA 2A92A 4G65A 4P83A 4NOKA 4K03A 2R4UA 4L5JA 5L6MB 5FL7A 2PBFA 4NRQA 2BEFA 5CXTA 2DHCA 2B9YA 1H0RA 1XT6A 3JYHA 3H1FA 3V6JA 1NQVA 5FUMA 4JDMA 2RS31 4QRHA 4XBQA 3EB7A 3NGUA 5EE0A 4IUGA 2Q5IA 4Q5OA 5DLGA 3OD0A 1WKYA 4LGMA 1MEEA 1TCCA 5DEIA 3TKYA 3ZIDA 4J3JA 1QDUB 4LF9J 1T0HB 3TZLA 1JU3A 3MDPA 1UKEA 3VNRA 1TM1E 5KG7A 2H08A 5BYNA 5ADHA 2H65A 4H3VA 1S0DA 1JL3A 5G0UA 3QLVC 1DWUA 3R4SA 4R8VA 2XMUA 1B64A 3KT7A 3QYFA 1VK3A 4PR6A 4M86A 4WVMA 3ED5A 2WHRA 1Y8RA 4X7RA 5F3GA 2YXDA 5H3HA 4OGGA 4CM9A 1BEV2 4P31A 1V1MB 3ADCA 1L3BA 1AXGA 4FN5A 5B4XA 2YC4A 2J08A 3HJAA 2ZDQA 4TN1A 3LP2A 4COUA 4PFJA 2QM3A 3OZUA 1SIZA 3K8WA 4FMDF 4L08A 2B8NA 4HRVA 5C3SA 1TKBA 3G89A 1OV4A 4C8YA 2ATXA 4QULA 3UFBA 4MGKE 4ASUA 1GFIA 3AESB 2ZSFA 3SEAA 4ROTA 3FNFA 2R7QA 4KGVB 5IT0A 3K4QA 1LA2A 3ZXIA 4EQ6B 3ZGNA 2F00A 4Q3KA 1SK8A 1GGKA 4PANA 4LK3A 2Y99A 1Z36A 1M6NA 2YY3A 1TL1B 3CLKA 5NULA 4JLBA 1T9YA 4MPTA 2XQGA 3ZSEA 1GEHA 1HN0A 3RHFA 4NYOA 2PAMA 1HY3A 2DVFA 2CLOB 1OB2A 3OTBA 5HAOA 2IFWA 3M8WA 1Z6AA 2VCEA 1GPAA 4KHPF 3UV9A 4L4RA 2IM0A 4RJKA 4G4GA 2MMGA 2NZ4A 4I55B 2BIFA 2DY9A 3R4CA 3H0PA 1L3UA 2ZIUB 3IAEA 3M81A 2V3WA 1ONBA 4KH1B 1Z3IX 2NVUA 4C6TB 4RYDA 2FZGA 5GTDA 3M6UA 1QHXA 4RQPA 3QK7A 3N8GA 3G5LA 2VPWB 4TQGA 2Q8NA 1LDYA 2DUQA 1NUUA 4S1VA 2B0JA 4KKOA 3CKMA 4CT5A 4UEWA 2CD7A 4ND8B 4USMA 5B53A 3W8PA 3NC4A 2O8CA 3VJLA 5CG2A 2WBRA 4B7EA 3DPIA 1IN0A 2XZDA 2AHRA 4J2TA 2FPPA 1H69A 4OYRA 4C6SA 2QN2A 2G7ZA 4EQVA 1G1XA 2BVNA 4AL5A 2BTQB 1EU1A 4ENPA 4V1Ak 3WDSA 3U60B 1SXJE 4EEYA 1W49A 5DNDA 5EZ6B 2CLEB 4Y33A 1NKBA 3FB1A 4CVNA 4ZVLA 4FSDA 2WK1A 4LMZA 1EQAA 4QPGB 4ZT5A 4RW9A 4N7TA 3GUZA 1VQ4S 4FI3F 4DQXA 4F4YA 4BO8A 2G82A 1J07A 2B1RA 4DJEC 4KPCA 3PIDA 3OZWA 4MROA 1VBC3 2XSJB 4TSFD 2VBYA 4UVDA 1FTQA 4BJ3A 5JNUA 2ZU6A 5IT9Y 1NA1A 3Q8FA 5HKLA 5CKNA 1LECA 1NB2A 3DNMA 1E9EA 3PFCA 2AUMA 4FPGA 4N90A 4DX8H 5EIXA 1NCQB 2WTBA 3LDRA 3MF9A 4UQOA 3K77A 2IU6A 1DARA 1W2WB 2DHRA 3JQAD 1E1YA 1UKRA 4LRQA 4HQRA 3QE9Y 3D3AA 2GJFA 2EFJA 4JHXA 3LQ4A 4C5AA 3PT5A 2J3QA 3EZXA 4G2NA 3IQHX 2C2RA 2I6GA 4I50F 5DN2A 1Y9GA 2MWMA 5IG2A 2WT2A 1JIUA 2OCKA 4Y6IA 4QGNA 2HK3A 5G0RB 1HE3A 3LT0A 4RKFA 1GQPA 1XD9A 4GLFA 5ALHA 2YUTA 3AINA 2PN5A 3DU6A 4CU9A 4BMOB 2CXOA 2H2DA 5I4BA 4NVRA 3DJYA 1E1LA 3DYVA 3RHZA 2DTEA 3MTAA 3IEKA 4B3GA 3MPOA 5EV7A 3ZJ5A 4E7PA 3K9HA 2QE5A 4BNKA 4C03A 2QQNA 3PC3A 4LNUB 4I55F 1T8UA 4YVFA 2GMEA 2XNDA 3EA4A 3AW8A 4RPFA 4LC0A 3W3SA 1JIIA 2C2BA 2DY0A 2AJFE 4MIBA 4R9RA 5DAWA 3IA0A 4RJJA 4RZXA 1PZ8A 3DPRA 5CK4A 3KUGA 2HO4A 4QG7A 5AVOA 3B89A 2XZLA 5ETLA 1EH5A 2OPQA 5KYUA 2Y1XA 1FLVA 1UODA 2RS51 2ZVDA 4BLTA 4WBNB 1MABA 1G8YA 3I0ZA 3U0ZA 2Q4TA 4BMNA 4C4YA 2ATEA 1U7DA 2WIDA 3B69A 2QYOA 1WF1A 2JZOA 3BMQA 4DPOA 5GKAC 1O9GA 1WVIA 5GIOE 4D9HA 2OXEA 3X1YA 3SPXA 4BLSA 4MYUA 2VIHA 3PHEA 5CCBA 4OK6A 2GBFA 3WVNA 3J81U 1F5NA 1GD1O 1G66A 3MZHA 1H38A 2DUWA 3KR2A 3V0BA 1EFRD 3KT6A 4AVCA 4OHPA 2DU0A 4R0MA 3FDIA 1S02A 2JFOA 3UG6A 3D1JA 3KM5A 5HKOA 1N6NA 1G42A 2BGIA 2IIQA 2ZW9A 1KORA 4P08A 3ZHCA 8AT1B 3AP7A 1WW6A 1E6WA 3ASYA 1ZI6A 3SBEA 4EFKA 4H60A 3AYZB 4IIDA 2NU9B 4A26A 3KT1A 4YM0A 2W9BB 1KFBB 2W2QP 4HNVA 4FHEA 3YASA 4KZKA 5FZ4A 2X3FA 4KXWA 2WJWA 1DIHA 5M2PA 4BN0A 4YXWA 1MOSA 5IAGA 4ZDWA 4DF8A 3IUQA 3MW2A 2FHJA 2QNBA 5E1MA 3VOAA 5KWRA 2XCPA 2ZG6A 4ZGWA 3BSWA 3L4KA 2ZITA 1VMAA 3HDSA 3HR9A 4LYYA 1DYKA 4YAFA 3AZVA 3CMCO 5A33B 2IFTA 4WADA 1A7JA 4KSYA 4LOJA 2A7QA 2XGSA 3HVKA 4NJEA 1UU6A 2AZ1A 1H2LA 3OOXA 4ALKA 1MOPA 3MI7X 5LZ5A 3RM3A 5MFPA 1FX5A 3UETA 5F9NA 2PUDA 1UL3A 1MN6A 3WJ1A 3BRQA 3OMXA 3NG1A 2XYHA 4RIEA 3T1NA 4HQLA 4X6RB 2C29D 2C4VA 1RRGA 2HO5A 3KOOA 4AJHA 2FDRA 1PZMA 1FNNA 2FF7A 1RUH3 4JLUA 2A70A 1UZUA 1N2HA 3VJRA 1RFLA 4UOEA 4Q3LA 3PE3A 2EKLA 4IYRA 1V47A 5D6GA 2PX8A 3VBSB 1YQ6A 4G1UC 1LR5A 1NR1A 2M4MA 2BJSA 4NECA 3G0CA 3BO2A 3VDRA 4F5ZA 4FGJA 1NYQA 3W60A 4RFSB 1QJU3 2C7OA 2GETA 1NUHA 3H2KA 5F3DA 5FXWA 1NLYA 5EOVA 2VW0A 1ZA1A 3UOGA 4Z9YA 5BR8J 2DP4E 2C9OA 5B3JC 2QLMA 3TYTA 1QJX3 1WY7A 4ZIRB 1IJFB 4KAFA 4FFNA 3KQRA 3LE8A 4H9GA 3GPBA 5FUIA 2F59A 5KOIA 2JL1A 5JVDA 4F2HA 4BXOB 1K9VF 2R7LA 4CLWA 5GJ6A 1R6YA 4I9NA 4CLEA 2I9PA 1T13A 1ETHA 4AE2A 4ETNA 2G70A 1T3HA 2J09A 1IKWB 4K9QA 3LD8A 1N5YB 3CW2A 1YGPA 1KJJA 1AXEA 1N1GA 3HKCB 4X4TA 3AVXA 2Q07A 3WNOA 3CJIC 3I9OA 2VR4A 1GDTA 1OA4A 2WQZC 4U9RA 1WPXA 3AERB 1RUG3 5H0IA 4BNFA 4HX5A 3G2LA 3AL0C 3FFTA 1HYGA 4I81A 3CB2A 2M1XA 4Q82A 3F4LA 1MIHA 3C8UA 4ZVKA 1AGRA 2MSNA 4Q4V1 2ONZA 2IYRA 1CJSA 4X7MA 3DUIA 2VF4X 4Y2CA 1ZI8A 3Q1KA 5DI3B 1JAZA 1U0BB 1CW2B 1M33A 4AWAA 1OLMA 1QUVA 4G24A 1WBLA 5D21A 3UAOA 4WXRA 3KSZO 3ML1A 4FOQA 4KQIA 4PF1A 1DEOA 2IYFA 1XZJA 1DKQA 3ZU5A 5I45A 2RJOA 4HY3A 4W6WA 3FEXB 2X6RA 4KQEA 4PYNA 3EDQA 3BUSA 1X4DA 4A36A 3ESBA 3UOWA 5ADUS 3BTSA 1UJCA 5DHQA 2H0QA 1JMVA 1QLWA 4DDUA 3CUNA 4HS9A 2VYND 3NV4A 4YI3A 4GZ3A 4IEIA 4BQEA 3BQ0A 1VBYA 4HDMB 1XDWA 3Q8VA 1HBOB 2QIFA 1KFXL 1R27A 1T6ZA 4F7VA 4IYQA 3TR0A 2E1CA 3MM8B 1L4NA 4IH6A 2RS2A 4ZTBA 2HHJA 4ECUA 1ZAYA 1LS1A 4EX6A 2DBNA 5HIIA 2TUNA 1TUBB 1Z34A 4PQ9A 4JYAJ 2X3UA 4I09A 5CPBA 4BP9A 3TAMB 1VJ5A 1YS2X 3LCPA 2VG5A 2NQ8A 4IJMA 3UJHA 1NR7A 1QOOA 1KU6A 1E3QA 3VD3A 3UAWA 1CR2A 4X65B 4UT4A 1FFGA 1Y1KE 3EPPA 3LGMA 4HEJA 4AS3A 1U8YA 1VR3A 4XIFA 4PX2A 4RK7A 4CWBA 4F25A 1BE8A 3DKVA 1XERA 4JX9A 3OQIB 3A4YA 3OURA 3OGRA 1RHMB 1T9GS 2R86A 3OOEA 3PUYA 3ZNOA 3A9UA 5BNPA 3FSJX 3CLUC 3THOA 4DZZA 1RHI1 2G6BA 4M9XA 1LC0A 5BSKA 2V1XA 3BCRA 5AM3A 4ZRNA 4LY9A 4PO1A 4HAVA 1SPBP 1XU9A 2E63A 2L82A 1Q0RA 5JD6A 1L5MA 1PWXA 1VI5A 5ALZA 3DBHA 4CLLA 2BEWA 4DIDA 1W6OA 1CCWA 3FDJA 2LGJA 3THWA 3R3UA 3JQAB 5L3QA 1HDGO 4HOYA 2A6PA 5F73A 4OZNA 3TA1A 3X1WA 1IUOA 3AH8A 5CFRA 1FFAA 1YQQA 1TME3 5JALA 2HEKA 4DPKA 3VKWA 1DAHA 4BUJA 4I0WB 3LPFA 4F8RA 2M9MA 3QGIA 5AOBA 5FULA 4IRCA 5IOLA 4OCZA 1UDXA 2AXEA 1GOTA 3TOVA 2GVNA 1FXUA 5M7EA 4OHFA 4RMGA 1U0SY 4O2LA 2D5HA 5KBYA 5IT5A 2CPDA 3LAKA 4D9KA 4W4TA 1VRH2 4C0XA 5JNWA 1IK4A 2PZGA 1MBZA 1TEXA 2BVVA 1RC6A 1MW7A 1PC5A 3KSRA 9LDBA 2QQGA 5LBFA 3D8NA 4MK7A 3TM5A 4Z4EA 4PYJA 4DT1B 2R062 4G1BA 1I2AA 1RTTA 4NLVA 3CEJA 2VBWA 1XV5A 3WGVA 1A9XB 3WDMA 5FAKA 4KAIA 3PICA 3ZGYA 2A6MA 4CCYB 3SR0A 2C97A 3AKTA 4AJLA 3RVHA 4MPPA 2P9EA 3VKHA 1N2SA 2AYBA 1C4RA 3DFKA 1R6AA 2Q2OA 5FZIA 4ZVQB 1TZBA 5KPDA 3MCVA 5K3AA 1ZD8A 3GYBA 3QTLA 1MWZA 1H8ED 2RHBA 3HM9A 3TR6A 1VCIA 1CAUB 4P98A 4Z4QA 1P73A 1YDGA 4OQYA 3T3HA 2ZRLA 5EYYA 2Y0BA 4C8DA 4KJIA 4RD4A 2CUKA 4C3OB 3TOCA 3V6DB 1AYM3 5E8AA 4HK8A 1FTGA 1FDBA 4MEJA 2UXCJ 2RHWA 1E2PA 1Z2AA 1PSZA 3USES 4X65F 2WJZB 1TCVA 2RI1A 2H0BA 2KM2A 2AIRB 4A3ZA 4X4NA 1W9HA 1Z6ZA 2W6JD 2ZRGA 3CT6A 4O7XA 1XCPA 5DWVA 4HB3A 1F12A 5E7MA 4V24A 2BFEB 1OSGA 2HWF1 2ZR9A 1XRPA 1FOEB 5JBNA 1RAFB 4DMGA 2X5XA 2QC3A 1DO2A 3BD9A 5C9AC 3C15A 5LP6A 1DXYA 4RS5C 2TS1A 3HN1A 4B75A 2O0HA 3DLGA 4C43A 5CD9A 5JZVA 4UHKA 3FHQA 1RB0A 1JA1A 5KYWA 4Z54A 2X5IA 3SSAA 5LU9A 1SKUB 4HWKA 1N33J 2CL6X 3ZXGA 2GI4A 3V46A 2E4ZA 4DB2A 4BFSA 1YRTA 1UJMA 3HADA 2HQSA 3EAQA 2XH8A 2XVLA 1R0CB 4OZ1A 4JV0A 2Q4DA 3PHLA 2CE7A 3RQIA 4ID8A 2MSKA 1AL21 4ZLPA 5FEUA 3MR7A 1XK6A 2GO9A 4NMIA 3B4MA 4RHCA 3BL8A 3VO9A 1B3RA 4NMXB 3ZLUA 1GKUB 4F56A 3WX0A 1KSPA 1M7HA 4BECA 3MNFA 2SKDA 4R8HA 2HHWA 2WWHA 1PIWA 2QTAA 4CMGA 4MK9A 2EIGA 1RXVA 2F1KA 2C57A 3RIXA 2C2NA 3H9AA 3SQXA 5L3VA 5CZKA 2HT1A 2ZHKA 5BT9A 2V74B 4YW5A 3LW5C 3PLRA 4LO6B 1RUC3 2SKCA 1OBFO 2J3MA 1JEOA 1L0BA 1XEZA 1XA4A 1NQ5A 4ISQA 3ZE8A 5AW7A 2FMUA 2XT6A 3SIWA 2Z09A 3ES1A 1EWTA 1YR1A 3E4CA 1BYIA 2R30A 3HUEA 3U4MA 4TV8F 2RIPA 4X6UA 1SHLA 2XMBA 2A58A 4F85A 3C6TA 3VXKA 1RVF1 4AS2A 3BG5A 4PICA 3CMAS 4I6AA 5HCHA 2H31A 1C30B 5HMMA 1ZESA 3V4LA 4BVLA 3I0SB 4OYAA 1XLWA 4Z7JA 5K2MA 1N32B 2JAXA 1NKCA 1HA3A 3B1WA 5K9YA 4WV3A 1K66A 4XVQA 1W8WA 4AEJA 4NWIA 4TZDA 4YYZA 3GJYA 3KD4A 1KFSA 5H9FK 3RBDA 2NO4A 1PK9A 2Y1GA 5L7WA 3PU3A 1X8EA 5J1EA 4QX2A 5A76A 2OEPA 5JUWA 2W42A 2I76A 3BFJA 1SQ4A 4HDSB 2MB0B 3HA7A 5AKKA 1JT2A 1T6XA 3QUBA 3GLHA 4GVBB 2EXHA 5G1PA 2U2FA 3ZZ0A 2C5BA 2W00A 5FZ3A 5FV4A 2VLBA 1YO6A 3B20A 5KJ1A 2W0MA 4B35A 4IHAA 3X29B 4CN8A 1O4YA 3TX8A 3PTLA 3IBCA 2FW9A 2POKA 3W78A 1E6CA 5EE5B 1VJRA 2FW6A 5GJWC 2DM6A 3WOVA 4L92A 4BVEA 1RBAA 2GZDA 3N0WA 4M0NA 5KQPA 1OSCA 2XEXA 1VHWA 1MC1A 4TVBA 5B7PA 5KFAA 2BE7A 2EIXA 1YAJA 1RT6A 5B7WA 1CJTB 5HMWA 5IFTA 1KHVA 3NNJA 4C8NA 3K2BA 1PJ5A 3C5CA 3RYRA 3SBMA 4XIUA 5B0FA 2GHWA 1YJWS 3B93A 2WKQA 1RI5A 2ZE7A 2J3LA 3W6UA 1FE4A 3U3DA 3WW4A 3Q6NA 1L1EA 2IHYA 3ISVA 5ALLA 4PQQA 3LDAA 4I9GA 5D8DA 4AO8A 2FJ0A 2RAUA 2BELA 4MGZE 4OZ0A 2EC0A 2A88A 5FO8B 4F11A 2WKRA 1QIFA 5I4KA 2C2ZA 4PCLA 4FE4A 3BEGB 3DEMA 2I5PO 1FYUA 1CS4B 1QM5A 3HMQA 3KD2A 2WJAA 4IO9Q 4IDBA 2BAGA 3TDMA 1UXKA 1E2KA 2ZCUA 2QYCA 2I0XA 4KN5A 3AUUA 1XTJA 1N2GA 2J6HA 2OIIA 5C8YA 3H9JA 1SHUX 1TIBA 3A6ZA 1NMEB 1N9KA 3ZWBA 1FP4A 4YW2A 2DF7A 5CADA 3NAPB 2KG0A 1V8BA 3A58B 1BHQ1 4AUMA 3MAAA 4BWFB 5DZFA 1VE3A 1N32F 4U1RA 2GJ2A 2WOMB 2OBMA 1UWLA 3ZN4A 1Y7PA 2J7PA 5G2OA 2C9ZA 1CQIA 4LOKA 3LFIA 5DUWA 4RMNA 2OO3A 1IRIA 4GKJB 4BQNA 2I55A 2IU0A 2LTNA 3NRCA 1HORA 3DRSB 2FQYA 2A9RA 1DRZA 5ICSA 3PFIA 2C4TA 1NK9A 4TT3A 3OX3A 4DMCA 3POYA 3IG1A 1AQLA 1FWPA 1RT4B 3D4PA 2OT7A 1XCOA 3HEBA 2FTKE 5FIUA 4HVRA 3EZNA 3K6JA 2GA9A 1ZIPA 3LUCA 5LK5A 5BSHA 4Y1RA 1D3AA 1TDJA 1ZXLA 3OYWA 1NQAO 4JYPA 1PO21 1CWUA 4NU8X 2Y1RI 3RW6A 6LDHA 2CYCA 5H81A 3P9NA 2WNUA 2IHTA 3MWEB 1G38A 4WFBQ 4M0HA 1Q1EA 2QR3A 3WISA 1T5IA 2AQHA 2A6VA 1OSNA 5HCBA 3OBIA 1AQNA 2WZR3 3LU1A 2B7CB 5IT4A 3KV3O 1JQKA 4OEHA 4Z1OA 4XJZA 1NC1A 5AK3A 1Q5PA 2QV7A 3Q9OA 1LTQA 2W2QA 2FY1A 3AFIA 5IVIA 1EFHA 2VFTA 4NAUA 4QKQA 4M99A 2JGLA 4EPYA 3DW3X 6AT1A 5IQQA 3FMPB 5BYKA 3EPGA 5BR1A 3PYLA 5C51B 1WA6X 3ZI4A 5KFHA 3VBFB 1T2DA 2H8GA 1RCUA 1XMXA 3MWBA 4X1KA 1A8HA 3HUTA 3D1VA 3SG0A 1FI2A 2C8VA 4FOPA 2XVYA 4MYHA 4CLRA 1KNQA 5K0GA 3BXGA 3LD9A 4NBSA 4BN4A 1GFWA 1HTBA 2WAXA 4EFMA 3NBPA 3UWTA 2YWGA 1NK0A 2JAHA 1CEQA 2FUEA 4H7PA 1VR6A 5BNOB 3RFCA 1NXD1 2ZSUA 4MV8A 1UWKA 2PLWA 2HRTA 5CPFA 2ZYRA 2AMYA 4HACA 1MO5A 2LV8A 2IW3A 3RYKA 4A10A 2YHAA 3VDBA 1QAYA 2XSZA 3LX5A 4R5MA 3WFZA 2JGRA 3VAYA 3M89A 1GZSA 4XF1A 1C1BB 4OVKA 4DDVA 2RH5A 4X4UA 3GVHA 3GCGA 4XFHA 2VZLA 4ZPBA 4L85A 2OEKA 3N7UA 4FD2A 4GWNA 1KDYA 3QQCD 1P2GA 5FOTA 5HQJA 4D9CA 1OFNA 1RQ7A 5KTQA 4QWBA 4C1WA 3H42B 5ETTA 16PKA 3JQBC 1JLFA 3HKDB 4GKJF 2HAFA 5H9VA 3RU0A 3JXEA 5FI1B 4TXLA 3GDHA 2VTXA 1LQ2A 5E2AA 4ES2A 1JHZA 1U7UA 1WC6A 1ZMRA 4JSYA 5KNDD 1EFPB 4GRIA 1QE3A 2HR1A 4UULA 3ZQKA 1FK9B 4CIYA 3MINA 4RK5A 1J2UA 3WP4A 1ZUWA 1JOJA 1KQRA 1JHDA 2WOJA 1N1MA 5HMZA