3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Subtilisin-like serine protease
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
1SCJA 1YJAA 3AFGA 1NQJA 1U5IA 2ID8A 2DP4E 1Y3DE 1EGQA 3OSZA 4LVOA 3I2YX 1TO2E 1YU6A 1SUAA 2QTWB 2Z2XA 2X8JA 1SCDA 1NQDA 1ITPA 5FAXA 4CG0A 4Z2AA 3DDZX 3AJ9A 3GCXP 3P5BP 2QFEA 2PRKA 2W2NA 1WMDA 2PWAA 2PYZA 5JXJA 1SBTA 3QMPA 1TM4E 4K8RA 1MEEA 2Z57B 5AMXA 2W2PA 2Z56A 1NDUA 1ZVJA 1MPTA 2W2MP 4RYDA 4DZTA 2Z2YA 3A3NA 3BPSA 3EIFA 1GCIA 2DUJA 3PRKE 2Z2ZA 3GCXA 3P5BA 4C3VA 4WOCA 1PTKA 3VYVA 3VTAA 3EDYA 5I9SA 2G4VA 3D43A 4ZARA 1WSDA 3D9QX 1SCJB 1PJ8A 3DVQX 1AU9A 3WIUA 1GT91 1DBIA 1WVMA 3GT4A 1SBHA 1GTL1 2E1PA 2ZWOA 3QTLA 4JP8A 1KFXL 4ZOQI 3DE2X 2XTJP 4YN3B 3SQOP 1P8JA 1SUEA 4G9SB 2X8JB 2Z58A 2HPZA 2XVGA 1IC6A 2DQKA 1Y4DE 1PFGA 3VHQA 2WV7A 2W2PP 3A3OA 2W2OP 3Q5GA 1AK9A 3I34X 2W2OA 2SICE 4KG7A 2WUWE 1SIBE 1P7WA 3BGOS 3BPSP 5JXHA 1T1EA 3DE0X 1GNVA 1Y3FE 2Z58B 1THMA 3TECE 1JEAA 4J94A 4HX2A 3A3OB 1R0RE 1KDYA 3SICE 5AVJA 3DF0A 1R64A 4DXZA 4C3UA 1SBCA 3GT3A 4HPKB 4OV6A 1SH7A 4NMXB 1R6VA 2PKCA 2Z30B 1DF0A 1V5IA 4OMDA 2P4EA 4M1ZA 1Y4AE 4HPKA 1KE1A 1TMGE 3LXUX 2B6NA 3GCWP 1SUDA 1KDZA 1Q5PA 5AQEA 1KFUL 3QFHA 3DE6X 2LUWA 3EE6A 3LPDA 1Y34E 2SNIE 4OMCA 1AV7A 1IAVA 5SICE 1Y3BE 4NE7A 4DZGA 1Y48E 2XTJA 3DE3X 5ARDA 1GTJ1 1QXPA 4H6VA 1TM7E 5B1EA 1ZVKA 1OT5A 1OYOA 4AKTA 1ST2A 2V8BA 1BJRE 1NLUA 1SBIA 4H6WA 2XRMA 5CW1A 5ARCA 3BOWA 2Z57A 1SCNE 2Z56B 2XVLA 1SUCA 2SBTA 1SPBP 1AVTA 2PMWB 3A3NB 1SELA 2W2MA 2QTWA 2ZWPA 4I0WB 4DJ5X 1VSBA 1V6CA 3A3PA 1A2QA 3JQXA 3DW3X 4OV6B 3H42A 2IY9A 1WMEA 4K8RB 4H6XA 3TI9A 2SECE 1T1IA 3PTLA 1BFUA 1TO1E 3A3PB 1GA4A 1SBNE 2W2NP 3I30X 3DE4X 3WIVA 1SCAA 1CSEE 3F7MA 3ZXYA 3DE1X 4NE9A 4HVLA 3HJRA 1SPBS 1SIUA 2WUVA 1AF4A 1YJCA 4DY5A 5FFNA 1NDQA 1ST3A 4KPGA 2ZRQA 2HD4A 1GTG1 1SN7A 2W2QP 3CO0P 3ZXXA 2W2QA 2O8OA 2GKOA 2ST1A 1C9NA 1CNMA 3DWEX 4MZDA 5K7SA 3DE7X 2PWBA 3DYBA 1KE2A 4NMXA 1BE8A 4NE9C 3VV2A 4DWWA 2PQ2A 3CO0S 3VV3A 1BFKA 3F7OA 1C3LA 3CNQS 1LW6E 1S2NA 3BX1A 3WHIA 2Z2YB 3TI7A 1HT3A 5SV5A 5ARBA 1SIOA 1TECE 1S02A 1TM3E 2TECE 4KB5A 2IXTA 3SQOA 1Y9ZA 3VSBA 4LVNA 1OYVA 1TK2A 3Q40A 4AKSA 3CNQP 3DW1X 5JXIA 1BE6A 1YJBA 5FBZA 1XF1A 3I37X 1GA6A 1DUIA 1WMFA 1AQNA 1V5IB 5JMOA 3JQWA 5B1DA 1EA7A 1C9JA 1Y1KE 1Y33E 4YN3A 1T1GA 4BWGA 1SUBA 3F49S 1TM5E 4I3GA 3LPCA 1P7VA 4FONA 1C9MA 3DE5X 3GCWA 1SVNA 1PEKE 2Z30A 4WOBA 1GA1A 4B5LA 3DVRX 1UBNA 2WWTA 3LPAA 1GNSA 3UNXA 2PMWA 4CFYA 4DY3A 3WQBA 1S01A 3H42B 3AJ8A 1Y3CE 5AVKA 3VV2B 3DVSX 4CFZA 1TM1E 1AH2A 2ID4A 1KDVA 1BH6A 3BGOP 1SUPA 4GI3A 3T41A 3L1KA 5JXGA 2XVKA 1SCBA
chains in the Genus database with same CATH superfamily
2O7SA 4FDLA 2WT9A 3FM9A 1NIPA 1ZOIA 3PDNA 2P4SA 1G1XA 3DMNA 2WSMA 4ILMA 5AKJA 5ADWA 2BJ1A 3UHJA 3IIJA 3VBRB 2YWDA 1NYLA 3U9LA 2WTNA 521PA 1RINA 4Q7LA 4MFBB 3IV9A 3QGGA 2EFEB 6Q21A 2VHEA 4DN9A 4ESOA 1GRQA 1R9GA 1RXCA 3A3YA 3IKJA 4DQVA 3KLHB 1J00A 4WTYA 3W7VA 4QWDA 4I30A 3SBEA 2UYQA 5AM1A 4LE2A 4JDMA 2OR3A 2RKOA 3PA6A 1VE3A 2IVFB 4KNYA 4YB8A 3X0DA 3C6ZA 2P6HA 3O6QA 4WCVA 1WD4A 4OHFA 4GD3Q 4J7CA 1A98A 5BNTA 2B9XA 3CZCA 4EO8A 4MUJA 1CUGA 2O8VA 3KE9A 4ZT4A 4YW1A 1FXWF 4Q66C 1RXVA 3J9SA 3L9XA 4XUCA 5C8CA 2GC8A 4WERA 4TXSA 1UPSA 2RHHA 4IIDA 2HCFA 5B0FA 5LJIA 2JG8C 3DHNA 2Q29A 2C42A 2JXAA 1TYCA 2BZGA 2FGOA 3A70A 5A5GA 1M9NA 5K09A 3RREA 1E63A 3IAHA 3I05A 5LY1A 5FKJA 1RMYA 2Q7DA 1YA8A 4LF9F 2CCKA 4HWSA 2XVGA 2ZGTA 1RWOA 2V74B 4BTVA 1FRQA 1J24A 3QRQA 1T9ZA 1N3PA 2ORIA 2ZWAA 4F2RA 1YUNA 5H4GA 4LZZA 3QOFA 5G0VA 1IKVB 1HBUA 2Q8NA 3PFEA 2Y1FA 4GM1A 1KPGA 4ZA2A 3VDXA 4RD0A 4YV1A 1YZ3A 4EB0A 5FEUA 3DF0A 1S2LA 1HE2A 5I5GA 4IE6A 1Y9AA 1F5JA 3CC7S 1B26A 2V8VA 4RNFA 3TYTA 1R9NA 3KP1A 1RTHB 1Z6AA 4Z7QB 3MTAA 2VDPB 1JHOA 1B99A 1S3GA 4AP5A 2PGLA 1YQ2A 2WFAA 4RXMA 1AUYA 4EJSB 3V0BA 4ARBA 3K89A 2CXTA 2ZJRQ 4S3MA 3N7TA 4J90A 2FHPA 4G1PA 1L5SA 3GEIA 2NQPA 3MCWA 1YO8A 5E1OA 4OXRA 2WNHA 4MHSA 3RVHA 4EHKA 3O38A 5FIXA 5GMOA 3RAXA 1SGWA 3L9WA 1BUXA 4NPOA 2YJ3A 2ZYWX 4Q3DA 4M5LA 2YW2A 5C8ZA 4DA0A 4P58A 3NR2A 1R8JA 4DDHA 3MF6A 1WV1A 4M0DA 2JBWA 3EY4A 1R27B 2I9KA 4UMEA 3AD7C 4KWCA 3PR4A 3BYRA 2JIOA 2PGXA 3RQSA 3O3CA 3RLFA 1XMOB 5B4TA 4JL6A 4KJIA 4XDGA 1OXUA 2DGOA 1ZAKA 5DGBA 4QBFA 1PIV2 4OX6A 4JLMA 3I0SB 5L3ZA 1CZOA 3UAVA 2VUUA 2VTXA 1EZZA 1JJBA 1B7GO 2PJDA 4EN6B 1VSBA 1HBMA 3BALA 3MMBA 5CX1A 1D4ZA 1G1MA 1GCGA 1D0HA 3PD1A 1NU6A 4QBUA 3H42A 2WYWA 2VHYA 2L19A 3PI6A 3ANTA 3HTXA 2H1SA 2QN1A 1WDWB 5CD4H 1PGPA 4FAHA 2VSFA 2G0JA 4K0RA 2RKWA 3V65A 3HFKA 1KSHA 4HB4A 4HNSA 3QU4A 3U3OA 4NECA 4G24A 2PT7A 3GT7A 1NSYA 4AFFA 1X94A 2EP8A 1LRJA 2IXFA 3E03A 1NJ2A 1WMSA 2J4FA 4WRRA 2N9UA 3WLOA 2ZH6A 3GEHA 4DJAA 3S2UA 3HCOA 1K3TA 3I6ZA 1RTJA 4BE9A 4P2SA 2YZKA 1CY0A 4ZO7A 1CNMA 4OYPA 3ZLVA 3RRBA 4BVBA 1UKAA 4CDGA 4MRSA 4L16A 1PAEX 4BX2A 2AR9A 4LF8B 3W2IA 2H8GA 1RBOB 2EC5A 1JL3A 3KHBA 4UT5A 1XO1A 3IMMA 3WY6A 3T1HF 3NNGA 3PX2A 3DKVA 3A0KA 3BXZA 1NK5A 4ZAYA 2FZ1A 1N0HA 3NGMA 3TB0A 4AI2A 4MRMB 3T9AA 1QZTA 1S9EB 2B4OA 2YN0A 5DI3B 4EYQA 4II2A 1WCKA 2BSAA 4IQ4A 3H90A 2GNOA 2CPFA 3NHZA 1PYGA 4MCAA 1YZFA 4M3CE 2R7OA 4Y5SA 2J0QA 4HPWA 2NZ4A 2NGRA 2E63A 5J1XA 4PAOA 4QYZK 3I61A 1T1GA 5JS7A 1R0WA 2EOAA 4DA6A 1TM5E 2KBEA 1GFWA 4KPCA 4LYEA 5AT1B 1Z29A 4PKDB 1HHTP 4G0WA 1CQJA 3AMVA 3JQ8A 4L5BA 2DFCA 1PZ8A 2PBZA 4Q7KA 3NANA 5ERGB 3GU0A 5I7AA 2ZYAA 1XLVA 4BU2A 1E94E 5JSPA 4IRXA 1GG8A 2PV7A 1TT5B 1QRUA 2HO5A 5AXLA 3DD1A 4WJZA 1AMUA 2GEJA 3U4CA 2GVDB 1KRPA 2ZHAA 1HA3A 1UFOA 1QH8A 4BWMA 1GRVA 1KDMA 5BORA 4FFRA 3ED1A 1RUE1 4LZLA 3DCAA 4AL4A 1B6TA 5C1DA 4KO3S 2R5NA 1DCKA 2KG1A 2H6BA 4RVGA 1P80A 3FTQA 2ZHNA 4YPVA 1JHQA 1W1WA 3CURA 1T0TV 3ZBQA 2IYSA 1OLUA 2Y1KA 1W5EA 1P2SA 2NUHA 3QFTA 5DYWA 3ENWA 2JHCA 3X1DA 1RAAB 1Q92A 4NXMJ 3EDRA 5BNOB 1JALA 5KHOC 2RJ3A 3T7EA 3CLTD 1IKWA 1GGFA 4KTTE 2RMU3 4GKJJ 3EEOA 4EY5A 2EICA 5DSZA 2HMTA 4YVSB 4AT1B 1WDTA 2DNQA 3KJEA 1HD1A 4RA6B 3FFIB 2JCXA 2TMGA 4DLWA 3RJ5A 3H5XA 3UMRA 3VJKA 5FLHA 4HLNA 2ZB7A 1ULSA 2BMBA 1GANA 4CKXA 1GCIA 2C5SA 3QLQA 2IBTA 2AG1A 5ABJB 3E01B 5DCWA 5LZ5A 3AHEA 2HZBA 3HQUA 5DLDA 4DJTA 1MJHA 4NATA 5IFKA 3CJTA 4W5TA 4J2HA 2PHWA 5DBEX 1UBOS 5IH3A 3VR3A 3FNEA 4FDTA 3VD3A 1Z34A 3P1IA 4BO4A 4XUNA 4XX0A 3M1LA 3PQ8A 2CLMB 1QORA 3AUAA 3SOZA 3FPAA 3MPUA 5HKBA 2HHHJ 1NRIA 3C5VA 3ZFGC 4YNIA 1NK7A 1NYQA 2QQKA 1FRXA 3LH5A 3L7MA 4RGYA 1X1CA 3M32B 3ZTRA 2VYVD 4RR5A 4PYJA 3AF3A 1RPTA 1E6MA 4PZCA 5JADA 5EIHA 4RKQA 1RR6A 2FUG1 3KLFA 1B0AA 2P5SA 2ZKIA 5IK4A 5IXUA 1B14A 1CS4A 1SC4B 3O2IA 2ZQ5A 2OP1A 1XTBA 4DB5A 1J0XO 4FILA 3VI4B 4AO8A 4EY4A 2J1EA 2AN1A 2B4PA 5G53C 1O4YA 3TS1A 3WRYA 1UVMA 3AEUA 3WICA 1WW3A 4D79A 2PWYA 3N2EA 5BN1A 2FOXA 4RLEA 1NW3A 5E7JA 3VZMA 3TRKA 1KR2A 3B38A 3HSKA 2D1RA 2W4MA 4NX2A 5LZ2A 1X6VA 2B6NA 4GU5A 4UM9B 2JEMA 2HJVA 2COLA 3NZEA 2LDYA 4FF3A 3LP6A 4EPWA 3EE6A 4W5OA 2ASLA 1L1RA 5F0UA 3MG9A 3P5SA 3E7FA 3ZYIB 3KHLA 1KH1A 2PXXA 3D6JA 4MINA 2VQ3A 3DYMA 3UOWA 1UXIA 3L6DA 5FXZA 3JD2A 2MSNA 4BQIA 1IRXA 1DJMA 1VQ7S 2YMLA 2R7WA 2FEOA 3NAGA 4Q0VA 1P9QC 5EJ4A 1X92A 1RWMB 1R6DA 2J7MA 2RE9A 4FR5A 4DFDA 4H4DA 2MSLA 2G80A 1GTRA 3ZU3A 1LOFA 3KK3A 1JTFA 3ETOA 1ECBA 4AJHA 1I80A 5A2QY 1MT0A 1G0NA 3QD6A 4CUCA 3RSOA 1EWRA 3ZCTA 4M5NA 1T0UA 4D3FA 2J6CA 2ZS6B 3F3MA 1MS1A 3O1SA 4P6VF 3SVZA 1T8YA 1U7XA 2PN6A 3MTGA 4CTOA 3FPHA 4Y33A 4L9WA 2UXCB 1QQ6A 4UY85 5JTUA 1TVKB 1A5TA 2NO7A 1A4UA 2XD9A 2W2NP 5IATA 3G8SA 4A0QA 2VJUA 1I3OA 2P3SA 2GP3A 5CABA 5KTMA 2KHDA 4YBZA 4BNLA 3H0OA 1P1FA 1QNFA 4NE9A 3TVYA 1S8FA 4IEQA 4DPXA 1L3TA 4DSUA 2SCUB 4WASA 3DCYA 3UQZA 5ECDA 4KI7A 4QGAA 1ZH8A 1Y89A 3KSUA 5KG2A 3W2WA 4RM3A 3FB4A 1X4HA 4EKIA 4HLUC 3WGOA 3WDKA 2HXGA 1U3TA 3HNRA 4NMXA 4LE4A 4WLUA 5FAKA 4M6WA 4D0RA 1E1RA 2Z0GA 3PX3A 1IAQA 3O93A 3T0FA 4F1KA 1PZEA 4TLAA 3GFRA 1BFKA 1DAMA 1YI0A 2ILZA 4D4LA 3C7OA 2OKQA 1V6OA 3QRWA 2L08A 4B7KA 1W47A 2QRPA 3I6BA 2ZC3A 2GI4A 3R3TA 1KI6A 3WDUA 4LJ5A 1PK6C 3QWIA 4FUTA 1U6ZA 1MJNA 3B9IA 4QG3A 3K5NA 2W39A 1MEOA 1QH6A 1WQ4A 4GPD1 3J7Z5 3DRPB 3V1YA 3IESA 3OC6A 1CQNA 1NRJB 3OAAD 2BHLA 2CUKA 2OGTA 3DMFA 5ALGA 4K4WA 2BF7A 3IMGA 1ZK2A 4AZTA 2B99A 4ZQBA 1GADO 4YP7A 4B33A 5BN4A 1L3VA 4EP1A 5KFTA 2N7GA 3JALA 4NYJQ 5HGJA 2E3JA 4JBGA 4DSTA 1SKBA 2GBPA 5T5LA 3MS7A 2V0NA 4NZ0A 4E22A 2PZEA 4XFKA 3O31A 2X7XA 1W29A 4LWQA 1HBNB 2ZJ7A 5JH7B 3KELA 4NLYA 4JAAA 3WDSA 5GZFA 2CFIA 4QBKA 5AVAA 1FQKA 2IM1A 3Q8WA 4ED3A 2G5GX 2IP1A 2WIGA 1C1LA 4K6HA 1BMDA 4GFDA 3IJPA 3N2GA 2CQCA 1S48A 5LIPA 4TKVB 3IS9A 2JCBA 4JITA 4JV0A 2IELA 3TI0A 4QAWA 4E08A 3UHOA 1W9TA 2ZRBA 3IURA 2YQ4A 3EEFA 1H9CA 1H2NA 2LVBA 3EQ8A 1NBMA 2RGNC 1QHHA 2X5IB 1XNHA 1FX2A 4MH0R 4YZ5A 3TLKA 1BJTA 4R6WA 2OBBA 2QLMA 1G9DA 1HZZA 3AHFA 2ENRA 2PYIA 4N8OA 4Q0SA 2WSBA 1Y5IB 1PJ6A 1XVLA 5ESXA 2XWJB 5E6UA 5FMDA 1SXJA 1NDCA 4MQEA 4RYDA 4NZPA 3M8WA 1RWXA 3FNQA 1CJKB 4HH0A 3VH1A 4UFIA 4C2MA 5LMUF 3G1UA 4XF0A 1N0VC 3LUBA 3OLCX 4AIIA 4JYAF 3LEIA 4C6HA 2OMLA 1LK0A 2GC2A 3GFVA 2ORXA 1VKZA 4DF8A 2WNEA 3TLAA 5TVKA 1KO4A 2X0IA 4RK7A 3VNBA 2AC2A 1X1BA 1COWA 2QFJA 4Q9KA 4BP1A 4Q0PA 4QNMA 3NT4A 2R073 1GLNA 4D9NA 2V8HA 2P9QA 5E38A 4OYIA 3Q7QA 3PFOA 1YZYA 4Y22A 4N0QA 4B8WA 4FQZA 5F8LA 5EJIA 4YN3B 2A78A 3R1IA 4CLZA 4NP6A 1LWEB 4XB6B 1IN5A 5HL7Q 4MX8A 2DR6A 3SV4A 4ADSG 3I34X 3MUFA 4XYBA 2WZ8A 3T3FA 3DCQA 3PNBA 2JGDB 4QELA 5EQUA 1WLCA 2OX0A 3MPYA 4JA2A 4DLZA 3NUQA 1HRI3 3BG5A 2X42A 2VNKA 1Z4QA 5IAOA 4V03A 1EFVB 4W7HA 4XGKA 4EL5A 2P2SA 2EWHA 2R8ZA 4OV6A 3OZ7A 3CJKA 2W4QA 1WLTA 1MNAA 2D97A 5EJ7A 5FZIA 4RPFA 4GBMA 2R8YA 2EWWA 1FKPA 3P7MA 1CQ9A 4FU0A 1ZI6A 2D9OA 3SLIA 2B9WA 2CB0A 5FYYA 1MNQA 1SMKA 3DF9A 3KQUA 4LJ9A 3OJLA 2ZIWB 4FR2A 1Y5LB 1K88A 2GZSA 2JASA 2KTQA 4E27A 1Q3EA 2H1WA 3O9VA 2CYAA 2D98A 1CE8B 1RJ9A 3PC7A 2IX3A 5HJXA 4FFLA 4J6EA 1FDBA 2WS93 2V5DA 3THPA 3E9NA 3RYPA 3KLGB 2YH2A 3UM9A 4HX5A 2BGGA 2XBPA 1V9LA 5CTAA 3MIBA 1M6YA 1CC8A 1OVMA 3AP7A 2X7HA 1JJHA 1D9FA 4D3YA 5H1YA 2Y67A 3JASB 4UAGA 4GMP0 3UKNA 1MTOA 2C1FA 3MMJA 2E44A 1KAHA 3CEAA 1N0WA 2Z4RA 4UFLA 2QI9C 4JI6B 1GCOA 4RHYA 1ZVQA 3QXJA 1A5SB 4ELUA 3W34A 1WW6A 4HVQA 3PKYA 2B7LA 3EOZA 3LLSA 5A4DA 4CXMA 1CQIA 3JCZA 4R4XA 4UW2A 4YGEA 3WEZA 1SQEA 1ZGAA 4RAQA 3HCWA 2DU8A 4IZ6A 2KXFA 3DLGA 2RC5A 3NS5A 1LZLA 5F98A 1KO8A 4RA6A 3X1YA 1DAEA 2V7VA 1ZKMA 4DDWA 1O0BA 2C2BA 1L7DA 2RF2B 4BN0A 1W88A 5A6PA 2VXCA 3LPMA 4YX9A 3I87A 1RAHB 4R0JA 2L18A 5JSQA 2A7AA 5A4KA 4NS4A 4HAZA 1RA7A 4NZZA 4AWDA 3P20A 2ZS9A 3AZYA 4N7BA 1Z83A 4NRPA 2BMEA 2MOKA 1RT2B 3J7LA 4LE0A 2Y64A 3KKEA 3Q7PA 4ELTA 4MFBA 1YV9A 1N5KA 3OP4A 2JKYA 2GJAA 3P6BA 2C9ZA 1G9AA 2WHRA 1CRPA 2FFBA 3KLHA 1MROA 4B3SF 2VDMB 3G9TA 1M5KC 2UYGA 1C3LA 2CJKA 3IKWA 1UAGA 2ZYGA 2D06A 4USKA 5KFGA 4CTKA 4X6XA 4FFWA 5TMPA 1UMBA 3RPEA 1TM3E 2P30A 4G8BA 1E1CB 3SXUA 1V6AA 5ECWA 2B5VA 4AVCA 5DM6Q 1DCMA 2Y60A 4UQOA 3BL8A 4YG6A 4P84A 5KNCD 3IIMA 5B58C 5CA0A 4HR2A 2H5EA 2P3JA 4P2GA 1HBMB 1REVA 4JJ6A 3P2JA 5FLIA 5H3LA 4H3SA 1VHWA 4ED9A 3GCWA 1V35A 2QZ8A 1BVYF 1Y3HA 1XVAA 1WBJB 1ICEB 2ZDOA 3GUZA 3AVOA 3TLCA 1ZBQA 5IZCC 1PNOA 4BJ5A 3L4BA 2W7TA 3TAHA 3PF9A 5CB6A 4UTRA 3E97A 1GCUA 1GMWA 1RYDA 4V0QA 1MMFB 3GJ8A 2GC3A 4HMOA 1TJNA 3SEAA 4HDSA 1JTEA 1HX7A 2ZIGA 3WDXA 1IGOA 1ADFA 2G07A 4AVBA 5HROA 1O57A 1OY1A 3S5JA 2P9EA 2VH1A 4JC1A 2HFJA 4RWXA 2BGLA 1Q0UA 2X8JA 1V0JA 2CNDA 3DOHA 4DU7A 1FYVA 1B0UA 3QFWA 3PHJA 1XZ8A 3WMRA 4L51A 3THTA 2IHR1 1VHTA 4JI2F 1NG1A 4JHXA 4TTGA 2XKJE 5JG7A 3KXDA 1PV2A 1EETA 1VQ9S 3U61B 2FUNB 3ZQJA 4WVVA 3LOBA 1O0SA 3N5FA 3NNSA 5M2RA 3CJ4A 3M9LA 5IVKA 1NJGA 4BLIA 3GJQA 3SSRA 2AOTA 4M5JA 2CXQA 4J7AA 3PDQA 4PQFA 5JQGB 4P9NA 2GVDA 4OQDA 5DYNA 1WE2A 1CPMA 1CNFA 5K14A 3MLEA 4PX5A 2I6XA 5DTRA 1VBNA 3KF5A 4CMEC 4XDPA 2CNWD 2P2YA 5I9TA 4ISBA 4MEAA 4O4LA 2YYSA 3LY5A 3RJ9A 2YKNB 4Q4AB 1RAJA 2YZ2A 1LPMA 3LQRA 1DBIA 3W8RA 3DGEC 1GYQA 2YJ6A 3MEDA 3HHLB 4TN7A 1SIWB 2W70A 3VGPA 2D1TA 4DV2F 4D9MA 2V7QA 1V5VA 1E5IA 2UYOA 3MLKA 3DJYA 3KETA 2ZT7A 4G4FA 5CB4A 1OKKA 4LBOA 4YGDA 4CCYA 2ZI7A 1KP3A 3ENVA 3JATA 1Y9EA 2FJAB 3GIIA 4YHBA 4C4OA 5D87A 5IMBA 1ACCA 1AHNA 1BVUA 3EC2A 4NV1A 1SEVA 2QBYB 1MG7A 4TZ6A 3FHLA 2ETEA 1SVWA 1L5WA 2BUCA 2JA2A 1K8AT 2P9ZA 3ICEA 3ZUGA 2XB8A 3OUZA 1XDDA 1NJYA 4ZIRB 5FPPA 1IS5A 4LVNP 5ALHA 1OV4A 2BW8A 2YXSA 4WP9A 4K6KA 5A8RB 4WVMB 4MI9A 3QMQA 4F91B 4WEOA 3WX4A 1CX4A 4KKOB 3G82C 1QTNB 2QVCA 5KT6A 2A2DA 2ZPXA 2PLAA 1DELA 1HARA 2YN4A 1F5AA 3L7DA 2EI5A 1HBNA 1T02A 2GAHC 1CEYA 4XHBA 1RZRD 4QBHA 3CF5Q 2O5DA 2GEVA 3HKBB 5AK4A 4H9GA 3L0SA 3G6WA 4HYTA 2DURA 3N53A 4Y2GA 1FE4A 2PNFA 4Q8LA 4GSLA 1GO2A 1OXXK 3CPSA 4FTSA 3BM7A 5EWMA 1HZJA 1L4GA 4WIAA 4G5QA 2JL9A 3DKDA 1UNBA 4M2LA 3W90A 4KHPB 2PGDA 4WVZA 5FYIA 1CQJB 5KNBH 4FYVB 1UODA 1JXMA 2HRBA 4K0KB 2H51B 2OV1A 3GFTA 4PZUA 5K4AA 4LO8A 5HKOA 1BBT2 4WFJA 1H2TZ 3I96A 1OI3A 3VWSA 3E1GA 3IGFA 1BMQB 3NMAA 1RZRA 4CL3A 4LEJA 1CB0A 4URFA 1QS0A 3KHUA 1HTWA 5KTTA 3EPJA 4FYYB 3ISND 4CVNA 4B02A 4PI2A 3NAIA 3M7AA 1CSEE 1T0PA 1LK7A 2FUKA 3K2EA 2OO4A 3HCPA 3KCNA 4CCLA 2JLBA 3ZI4A 3CD0A 1T13A 3TX2A 2FB9A 2V59A 4BYYA 3SZLA 2MHEA 3OLBA 3N01A 3VUOA 4OSPA 3RUCA 1O9GA 2XJRA 4M86A 2XMDA 3U81A 3U9TA 3PLRA 5KT2A 3B1ZA 4ITVA 4NYPA 2JIMA 3ABZA 2YDYA 3B5LB 3AFIA 1M1YB 3ZNUA 1HXHA 3MBKA 2RU3A 1UL9A 1PR0A 2C2YA 3I2IA 3T09A 3NIBA 1LPOA 2G4LA 3OBAA 3H8RA 3EXCX 3H2KA 3N07A 1X7NA 2GM4A 2XUKA 1U94A 2X05A 1N1MA 3BAZA 3NVKI 2AR7A 2H48A 4MS1B 3CEJA 2XMTA 1P1RA 5KB3A 1JR3D 1FLAA 1COZA 2C4UA 4XFFA 1W4ZA 3G0BA 1D3WA 4URAA 5FPVA 3US5A 3NDBB 2RONA 4IDPA 3LA7A 3D1OA 1VMDA 4ES2A 1H5QA 5K9YA 1KAQA 3BXPA 3CJKB 4UUXA 4QECA 2Y1LB 1S1CA 4COUA 4OHKA 4Q48A 3WMFA 1NB7A 3F4LA 4UTPA 1UEJA 3D6AA 2VZ0A 3Q2IA 1VOTA 3K6SB 2HQ3A 2G5CA 1QTRA 3QKWA 3IMFA 3NRBA 3ZDVA 1RWVA 2FQQA 3T7KA 2BR3A 2XA9A 2G6TA 2X6QA 5E4JA 5DP1A 2DNNA 3SMQA 3ZXKA 1A8MA 2O7RA 1P33A 1LS1A 3OCPA 4LQRA 4X1IB 3T1HJ 1PJAA 3K6RA 3Q86A 1SC4A 1BH6A 2NPIA 4LDRA 2PL1A 3R3UA 1V41E 2J7KA 2J9XB 4EJFA 4JBCA 2ZRFA 5ESDA 3E6AA 3S0MA 2O0MA 5AC91 1FJGB 2DQYA 3IKTA 4RJVA 1Y3DE 2CFTA 3CF4G 4EO7A 1UOEA 4BKRA 2C4XA 1JDBB 5CDTA 3MR3A 1MA3A 4LSLB 3IAQA 1L2TA 3D4IA 4YDHB 1AJKA 1FA0A 2Z8YM 5G0RA 3RJTA 1JJCB 2B1RA 1EJBA 1QPZA 4DV3B 4CDRA 4AZWA 3MYXA 1SXJB 4QKDA 2AGVA 1JX4A 4NX9A 3FPFA 2VJMA 2UUAB 4F4KA 1E1LA 3MIDA 2D6NA 3AD9C 5HMXA 1U8EA 1KRWA 2WHYA 3MUMP 1DRWA 1N5LA 1XU1A 4AXBA 4FPGA 1TL1A 3F71A 4QPGC 4PRLA 2C7BA 3HNMA 2ACKA 2FI1A 3ND6A 3U75A 4X20A 1G59A 3CH5A 2Q5IA 1XNAA 2GAJA 2XODA 4DVJA 4QGBA 4C3VA 4LK7A 5A5DA 3R6TA 2FMKA 2DHQA 2W6PA 1FV3A 4DEVA 4QU6A 1CDZA 5DNVA 3D68A 1DG3A 3CD7A 1LUAA 2FDKA 4XJXA 1P39A 1ZICA 2GLXA 2GYWA 3KYDA 1R1DA 4CO1A 5GMKa 3FBTA 4LSMA 3OTOJ 3RGGA 5KYYA 2PLNA 4MADA 5CVEA 4K3UA 2W11A 3D0GE 1DC6A 2LROA 5GVQA 4MW2A 2HA3A 4YWAA 1D7AA 2OVUA 4P81A 1BD6A 4E30A 2HZVA 4Q3BA 1AJEA 1P4RA 1VRH1 4O2BB 2WF5A 4ZCPA 2HGSA 3RYFA 3TB4A 1FDIA 2HBQA 4CN9A 5DHFA 1OWXA 1MEC3 3DMTA 3KQYA 3PXGA 3RI3A 2WTFA 5C81A 1QH8B 4TGLA 3A7EA 3TN92 2DFNA 3A3OB 3LGMA 2E32A 3B1KA 3PJGA 1C28A 1UMIA 4INDA 3TJMA 2PQMA 3NVCA 3UJNA 1E98A 1EUCA 1KVSA 2ZTVA 2AENA 1A9RA 2ZC4A 2NU6A 4D43A 5DISB 1ADCA 3IPCA 2XLJA 2PMKA 2L9DA 1GXSA 2OBFA 4K6MA 1EHCA 2M98A 3AMHA 1SKUB 1O6CA 5DASA 5L7WA 1W9MA 5AQEA 1XOIA 1BN7A 4IKOA 1M5SA 4JEIA 1OC4A 3IRXA 4Q45A 2ODAA 4H7HA 2QUZA 2C5FA 5B3LA 2P34A 2Z6VA 1GGHA 1ST2A 3A11A 1T4GA 1HN1A 4QPPA 2IRXA 4LHLA 3M9MB 4FPLA 5LP6B 4R31A 3HB1A 4DT1A 4G2NA 4EK9A 4E2FA 5B0DA 4ZONA 5IJWA 2GF0A 1LNZA 3VZPA 3V64A 4GLBA 3JWGA 3ZXLA 5F9TA 1BXGA 1C9YA 3KOZA 4RK5A 1SUFA 2AQ8A 3CF6E 2H48B 3MMSA 1JVNA 2Y76A 1FYUA 2ICAA 1ZNQO 1CUIA 1GMMA 3NHMA 3O7WA 3DN9A 3A3PB 1ZH4A 2I5JB 4YECA 4K40A 3TLZA 3GLHE 3O75A 1ZVVA 2MZQA 3JB9k 4F4FA 1ULZA 3CJIB 5I3UB 1F4AA 3ACDA 4J3FA 4Z1MA 3FMGA 4C78A 1EFPB 3MT0A 1PL7A 1I36A 1BEEA 5K6TA 4F4CA 3KLEB 4BNUA 4MHUA 2QRVA 3TBHA 1RAEA 4DSOA 1SBDA 4QT6A 3IUJA 1JN2P 4K1LA 2MEV2 1G7CA 1YJNS 3UK2A 2KM8C 3FAKA 3GPIA 1SKYE 2DNPA 3OD1A 1RP7A 1ZN8A 4DUGA 2DXEA 1NQXA 3VTIA 4PF5A 1BGWA 2J5KA 2JRCA 1MDFA 3ROKA 5JAXA 4BFSA 4KNWA 2VTXJ 5CIQA 3N3BC 1HV1A 1WZNA 3WGVA 4JASB 3EG5A 4ALJA 4HQ6A 4Q4Y1 4ILEA 4J9NA 3S2IA 1ZOTA 3LANA 2NG1A 3R5JB 3SJZA 2EBFX 4BO7A 4FZ5A 3UYKA 2QV0A 2C1EB 4LPLA 3FMPB 4F5YA 1HI1A 1QSLA 1QHXA 2DRBA 1SUBA 3JYPA 2AJCA 5K6RA 1QQ7A 1XSQA 2X53S 2NVOA 2GGPB 4Y22B 5FDLA 2O8BA 3TBFA 4MSUA 4LOHA 4I01A 3G68A 1XNRB 2GC0A 1JEDA 2VJMB 4E4RA 4XD7D 1EJ0A 2NZXA 3MIIA 2DB3A 2LFVA 3KB6A 2R65A 3KOXA 2FMTA 2W47A 1XKXA 3V55A 4KVGA 4L2NA 2FZ2A 2MGZA 2W24A 3GNLA 4A26A 3CKHA 1DQ2A 4A9AA 4DA8A 2BFCB 1EDEA 4ZLNA 3KTDA 3KQHA 3VV2B 3OHAA 1JKXA 4NL4H 1HWJA 3TAMA 4MRAA 3OF2A 4RGVA 3NORA 4XWTA 5HQTA 4NZ6A 1X7WA 1W4AA 4MEJA 1NR5A 1DBQA 4MWZA 1PZMA 1UYZA 2C4TA 3J80U 3SZUA 1QO0D 2JZNA 1T2DA 1TEXA 2OFWA 4JNCA 3MM7A 2WPDA 5EIOA 2NREA 4BNKA 3DLHA 2BJ3A 2WBLC 1JKHA 1E5VA 1GWLA 1XDSA 4PQAA 3PJYA 4IUBS 4YUZA 3SEOA 2VI5A 2HTEA 1E6KA 5C18A 2GFHA 1SCDA 4COKA 3PWTA 2DLDA 2OHJA 1RMU2 2V6GA 5LOQA 3HDQA 3LZCA 4WGFA 3UCFA 4ESEA 2WS92 1PI3A 2YG0A 4U2BA 1IJEB 3HB7A 3SIWA 2RH3A 2HMVA 3AODA 1RJGA 2VG8A 4M54A 4A7KA 5K03A 2BUBA 2M4MA 1C3OB 2XQCA 3DUIA 3C3EA 3HB5X 4LA3A 4CU8A 5E7QA 4RGKA 4FQ8A 2WD9A 3PTYA 3BJZA 1DTQA 2IZ1A 1R8CA 3OM8A 1HDXA 4POOA 3I28A 4IR9A 4G0QA 3ILNA 3D3AA 4BCAA 1JOPA 4FYHA 1OLMA 3AIIA 4M53A 3OUYA 1NJSA 3I83A 1Y8AA 3ZYBA 4JI6J 2HHHF 1ICEA 3QKSA 4OI1A 2UUAF 2FH5B 1XDBA 1NQOA 1P75A 1ZWLA 2QNIA 3T94A 3OOHA 3PJXA 5JOYA 2GAIA 4D5GA 4E5YA 3GB9A 3IV6A 1VKJA 2P3LA 3KRTA 4C7KA 4OCTA 2X8JB 3EG9B 4IPTA 4YWHA 3MECB 1IQAA 4OQFA 3WE7A 3OE1A 2V2ZA 4JVOA 4XQ0A 4LF7F 4A4AA 1AS0A 1BA3A 3Q9SA 4DILA 4KR9A 1KEEB 1XTSA 3DDOA 2CNNA 2K1RA 2QYGA 2H1YA 1LQTA 4REMA 5LY2A 2ZKTA 3ADDA 4WK4B 4R40A 3CU7A 3B3AA 3WJ7A 3KV4A 3MV01 4MV8A 3K1AA 3GRYA 2G9VA 4ZVSA 5A3RA 2QAJA 1KETA 4J49A 3I3MA 3KG4A 2B61A 1XTKA 5A4IS 2PVSA 5C7OO 3D2CA 4IICA 4LHWA 1UP6A 3QIAA 1YLLA 1U47A 3CCFA 1CP2A 2WF8A 1IM8A 1Q5PA 3T38A 3OG9A 1RRMA 3CB2A 1A9ZA 1SDWA 4BMEA 1V8DA 2JLCA 2VDQB 3A6LA 4HSJA 2WJWA 5CFMA 4DNOA 1W1UA 2AH5A 5F7JA 2XS5A 3FPSA 4QUDA 2D7FA 1K98A 1XHFA 4YMVA 1LKNA 5FOBB 3WDTA 2HXYA 3VAGA 3EVBA 3BOWA 2Q62A 3DLJA 1MDBA 1ENOA 4KLRA 4BKOA 3R4DB 3FKJA 3VZIA 1T2FA 5A3MA 3VAFA 2RARA 4L75A 2PSDA 1EQAA 2SBTA 1XPJA 1VRQC 3NNFA 1G7SA 2W2MA 4RELA 4ZI3A 1YHQS 5AESA 3IFEA 1RWPA 1SU8A 1HT0A 2DHEA 3WV4A 3K51A 2QFIA 1A8IA 2QLBB 2J87A 2KI2A 2CQIA 5AUQA 1GBGA 4CDUA 4NNPA 4ZV4A 9ABPA 1R4NB 1IEXA 2CCGA 2HO4A 4FPOB 4QOFA 1CGPA 3LKDA 1E5LA 3Q83A 1K5JA 2ZB2A 3S2SA 4IEEA 3PC8C 2YC0A 1E0AA 4AM8A 3OJSA 4TRMA 2YMZA 4OHXA 3HBMA 2WKSA 2UXBF 4MXWA 4P34A 2AFIB 2Q1YA 3TQRA 3MICA 4YJ3A 3SMHA 4KO8A 1RU2A 3WRWA 3I52A 1ZBE3 2GAOA 2VDVE 4GA9A 4HDQB 3G6YA 4MKXA 2VK8A 3NKVA 2FSIA 1GOFA 4IRKA 2H1RA 1SOMA 4AQYF 1EM6A 2C7GA 1SQGA 1Q7TA 1D1QA 3KWFA 1IMOA 3G5TA 1FDRA 1H6XA 1USGA 1JIHA 3QVUA 4QU9A 3IL2A 1QUPA 3OX3A 1MMLA 3D8RA 4GUDA 5DK4A 1AXYA 3BMQA 1S02A 4KVFA 1DY3A 2GPSA 2VR4A 5GV7A 3IR6A 4RABA 2IU0A 1CKEA 2ES3A 2RU9A 2GMEA 5TQJA 2CSGA 2AZ5A 1VE0A 5I51A 3UMMA 4B3XA 4Z3KA 3MPUB 4QXAA 4CV2A 2BABA 1KR5A 3NG8A 4EZ9A 1A82A 4R2IA 1VB2A 4AMYA 2P8IA 3ZNOA 5EZSA 2VK4A 3DE5X 2H4XA 4O4JA 3SI8A 2QENA 2HKXA 3AESB 4DUPA 4XVUA 1KAGA 2XMPA 4DPUA 2AD1A 2R60A 4AROA 3PJWA 4YJ2F 5JZVA 3JATB 1CNEA 7YASA 4L7VA 4PXBA 4W9NC 4X4UA 3I5XA 1NU4A 4HRYA 1T91A 2J42A 2AVDA 3I1JA 1GG2A 4JYAJ 3G6KA 4UD2A 3T5AA 3ZTOA 4IXDA 1BDJA 1HF3A 3R9IA 3T7RA 1SUPA 4MW7A 3AR4A 2IZZA 1E9VA 3KEMA 5D15A 4JJ8A 1WY5A 1AL22 5GALA 3JYOA 1V1JA 5LBIA 3P9CA 5BN5B 2OZJA 3BL6A 1MBZA 3EVCA 2JI7A 1ONBA 3Q3IA 3GD5A 5D3MA 2EX0A 1UF9A 3KB2A 4V0SA 1RUC2 1XTRA 4PRFA 4J1XA 1ECCA 3ZGOA 4ZMSA 4WLVA 2C78A 5I7EA 4B8YA 4AE2A 2X5KO 3R7BB 5CMLA 1NT2A 1ZM3A 1IHPA 1AUPA 3E9DA 4OP1A 1SBTA 4BQ5A 4DX5A 3HKDA 3SR4A 5A5EA 6ADHA 2ZE2B 1RTHA 2W90A 4MR7B 3UGJA 1NE7A 3NAPC 3KKKA 5HBGA 3TZQA 1JBKA 3PNVA 2ZJ5A 3GJ7A 4HFSA 4B46A 2B5JB 4RUAA 4A6EA 5B58T 2R86A 2QN8A 3I2KA 1P74A 1AZWA 3QOXA 3NHYA 3NYIA 4D4KA 4OSOA 2IVZA 4KWJA 3PWZA 4JAVC 1LHWA 3DXYA 4GL4A 4M1OA 2ZJPQ 3INTA 4LF9J 4HK4A 2VAMA 1GNYA 3JQPA 4XGQA 2NT4A 3M3CA 3L77A 5TDHA 1NDKA 1Y5MA 5LXRA 1ESEA 3GJZA 3N6NA 4J0GA 1X0PA 1ZUIA 3G89A 3M8ZA 3G5LA 3HB0A 3TLBA 2BRUC 2G28A 1OGIA 1OH8A 5JIUA 1A6CA 3M89A 1Y4DE 1A2OA 3JSRA 2KHZA 1P2VA 1R9MA 2XC9A 1GFZA 4AB1A 1OH5A 2J1TA 4ZOEA 5BNNC 4KFUA 1W0JD 2A7XA 4HLUA 1TP7A 1Z1ZA 4OUMA 2V8OA 2VPYA 2X15A 5AP9A 4TWTA 4FMPA 3R5JA 3NHKA 3Q7SA 3RC3A 3MFAA 4PYRA 1IPJA 1RHQB 1JIVA 5LOVA 5LQRA 2CKDA 5H9RA 1V1RA 3H7HB 3MWLA 4GOMD 2WK1A 3IAS9 5HX7A 3KVBA 3EF0A 3W4IA 2R7KA 4NYMR 1AXZA 4Z2YA 5LUAA 4WBBA 3ZFEC 4X4RA 2NYIA 3KS9A 1NW8A 2C5GA 4DL4A 1NM2A 3Q2OA 3N7UA 5LXTB 1KKHA 3UC5A 2NQTA 3ELNA 1X15A 5K9ZA 3PFFA 4K8FA 3Q0TA 4FKZA 2CLHB 2V4JB 5C8YF 3FLPA 1XYNA 4POAA 1TRKA 1O8BA 3EIOA 1ZX1A 4MYRA 3QQ5A 2ODNA 3WFJA 1AB6A 5KYXB 3FOFC 1OXSC 1X4CA 3VO2A 5BWMA 3CCQS 1OROA 2O1EA 3SC2A 2IJNA 3FW1A 2JCVA 3DFMA 1EETB 4K6BA 3WR5A 1ZS9A 3NTLA 2Q66A 2D7CA 1YZHA 2MYNA 3LP0B 4XIJA 3VU0A 2ACYA 5KWEA 2MYFA 1MO3A 2KS6A 1F9AA 4A8FA 4WLEA 1KU6A 4KIAA 2XDYA 4NARA 3T6BA 3SEZA 4O4IF 2QL9A 4RD6A 1VC6A 4GHWA 3UH1A 3TQTA 4J0QA 2RRAA 4ER3A 3GUVA 4JGGA 1SJ3P 3NDIA 2WAOA 5JNWA 3VNAA 2ZSBA 4CKBB 1Q7RA 4BUZA 4PT6A 3N6XA 3W2WB 3S68A 4FMCF 1HY3A 1SJ9A 4RUCA 4Q2FA 3RYIA 4JZYA 1Z0DA 4EBCA 1H1LB 1YJVA 4CKZA 3ENNA 4OCZA 1OY8A 3RC9A 1MU2B 1FQWA 5D84A 1Y9QA 3ZN6B 2B34A 3UVJA 3UWMA 2QN2A 5IDWA 1BQEA 4MWBA 4QU0A 2A3XA 1GNQA 3MPBA 4DL5A 3K92A 5AXMA 2OLJA 1R18A 4JXKA 2F9FA 1NA5A 5LJ3Y 2XI3A 4EBFA 1KKMA 2HHQA 2VZQA 1PEYA 1UD1A 2B7YA 2PH5A 2O8NA 4EE2A 3AU8A 1Y9MA 3CD6S 2WR8A 2GT1A 2AG8A 2DHDA 1M7BA 1KC8T 1JW9B 3CIOA 4HOYA 4WVMA 2P1BA 4PDWA 1V5EA 1PIWA 1Y1QA 2R6ZA 3DDSA 3W8FA 1QZZA 2Y4OA 2GF2A 3K4PA 2WTEA 5GGYA 4HGRA 1VOMA 3KG0A 4MGHA 4O0IA 4QOHA 5JD4A 5A9SB 1KS2A 2OI2A 5TT1A 2H3EB 1WUVA 3EWAA 2VFRA 4RF5A 3BKZA 4F6RA 3LPAA 2OXFA 4Q0BA 2GBIA 2XNRA 1P1LA 4KE7A 1LVGA 1WELA 2DTXA 5KFNA 4J9UE 1KYVA 2JB9A 1P2BA 5TQ2B 3GEBA 5C8VA 4DG1B 3Q6MA 2PTGA 1JR4A 4AQ2A 1HJGA 1Y3CE 3ZK7A 1TM1E 1JRLA 1Q50A 1S9HA 1FMD3 2FHJA 1BD3A 1D03A 3U10A 5IBQA 5FYCA 1JQAA 2P40A 2JDIA 1UXKA 1WSRA 1N2SA 4CDXB 2GN2A 2VC1A 1OF3A 1CZNA 5KJCA 3DXSX 2IYRA 3HCEA 1TW2A 5DT9A 5DOZA 3M32A 2HZ7A 1DG6A 1NY5A 3PC3A 4DZDA 1QXSA 3D3NA 1NQDA 2VPZB 1RUE2 2Q2VA 2WTMA 1O4TA 2W71A 4X24A 4CCSA 2R2RA 4KLAA 4RANA 4XWYA 4M01A 4DPWA 3RF6A 4AQTA 1DQZA 3SQMA 2PL3A 2OORC 2NO1A 1E2KA 2O3UA 1KJNA 3OCCA 2ZYHA 4GO7X 1PK7A 4B4DA 3H5RA 3LO5A 3KUHA 2DCZA 4IGEA 1NDUA 1TEIA 1ZRRA 2H4YA 5FWDA 1Z8NA 1CIJA 2PTHA 3NJ4A 4I1UA 1DAFA 1KZ6A 3MEPA 2BJSA 3ROFA 4FYIA 2B4YA 1NSPA 1G8SA 1UY4A 4E0DA 3ECQA 2WB4A 4FPXA 3LGSA 3A05A 3LWBA 3WL5A 2EFQA 2FWBA 4H7PA 3AYDA 3P45B 1PZ9A 4FZ3A 3PIIA 1TKXA 1A9TA 3U4DA 2WVJA 1TZKA 2QYOA 1WF6A 5EJAA 2HVHA 2Q4EA 1WW8A 2B0CA 4JI8F 3BEGB 3D7MA 2X5IA 1KYZA 1WI8A 4YTEA 2E4ZA 3BTYA 4MWDA 1PYOB 1MZEA 3TKYA 3Q5GA 2Y0PA 4AI0A 2JJQA 4RS5C 4K87A 1ZGHA 2VPQA 3BGOS 2ZT8A 3P5TL 2IXHA 2VF5X 3OFJA 4CO0A 5EVCA 2YKMA 2CDQA 4MA0A 5KVAA 3CVOA 5E4YA 2OCXA 3MNFA 2R8JA 1C3EA 2BLLA 2LECA 3IEXA 4M7WA 3B6IA 1LI7A 1YOBA 2AR0A 1OQ3A 3DO6A 1HRV1 1IOLA 2FHRA 3PNIA 2IIPA 3OZDA 1S1AA 3NP5A 2EX4A 1CUEA 1YS2X 3AQIA 4UVGA 2YS6A 2H7YA 2C3PA 1ZMRA 5DYYA 1AGPA 1M1NB 2WBRA 3UEOA 4JI6F 1AL21 3CA8A 3I8OA 5KFVA 3HACA 4TSFA 4KWHA 4CMIB 4IV3A 1ZRFA 4YYOA 4D4GA 3S7TA 4LCJA 3AUYA 1G9CA 3SBXA 2J3MA 5LBTA 4AG3A 4W92B 3VR6H 5CAAA 2WU3A 4OYBA 2LCIA 1U24A 5T64A 5AXAA 2HFKA 3BFKA 2R2SA 1KKUA 4KWKA 4NN0A 3HCAA 5LBCA 2X41A 4XRGA 5CLIA 4JYAB 1NHWA 3PIJA 2H1FA 3WQQA 4NI5A 3DAYA 1M2FA 3AJEA 4OUDA 2N4DA 1FPN2 1H2MA 4B29A 2H17A 3CHYA 3IAEA 2RRBA 5DZ7A 3JY6A 4LFBJ 3DFIA 5FYHA 1WC5A 4RZQA 3G6XA 1EFLA 1NK0A 3MJCA 3P45A 2DY1A 4NA1A 3OVSA 3ZR5A 3ZK8A 4O3RA 3DT9A 3QBVA 4RGAA 3T3NA 1Y9OA 3OEED 3W1EA 4R8LA 4A1FA 1FXLA 5JCZA 1T3OA 2X0FA 1U28A 3WP4A 2XZWA 1WD7A 3JYQA 4PAQA 1J0DA 3OGJA 3RBXA 4KBBA 3PIGA 2ZH7A 3BSNA 2HSWA 3E53A 3BIJA 4NCIA 3OT5A 1QAYA 5L36A 2IBSA 3HDGA 1GARA 3CIHA 2YC4C 4QG7A 4RIHA 4DLUA 4IUYA 3Q9NA 1RRVA 4DV7F 4CMHA 1XBFA 1AG9A 4N56A 3GFZA 4UOGA 1Y0HA 1DIBA 4GVXA 3DV8A 1FD8A 1I3LA 5D4OA 1O95D 3EVEA 2NYRA 4NEGA 2QU8A 3I6IA 3SEPA 3JQ7B 5E6HA 1NKEA 3CRNA 4FXKB 3V8VA 1RLDA 1N6NA 4LDPA 2JB4A 4HQ0A 3WBJA 2V50A 2Z2MA 4IJVA 2JLGA 1E9FA 4EUEA 5EJ5A 1P27B 3AC0A 2Y8YA 1W0KA 2YJ4A 3K53A 4TT3A 1C29B 2YVSA 3PC8A 3T1TA 1AHPA 1ZBA2 4LC0A 3HAGA 2GHRA 2O3QA 4IV3B 3O1VA 5AWFC 5FH9A 4HR7A 2QOEA 3W5XA 2MCFA 2CPEA 4CIOA 1JB1A 3H2GA 2GWRA 2PUVA 1S2DA 5D3ZA 3OD0A 1XEXB 3SKXA 2C97A 4R8MA 5CH5A 2F4VJ 1H2YA 3B9PA 4NU6A 2F3JA 2VZ3A 1CLFA 5BNPA 3IYLW 1LGCA 1NPYA 1GN9A 2YFHA 3C8HA 4GQBA 3HVDA 3TQCA 1FIUA 2OM2A 3Q41A 1A69A 4A8WA 1UADA 3ZCRA 1TLTA 1FJXA 1X4BA 2PU7A 3CN7A 4E2QA 1RUE3 1CVJA 4B71A 3W21A 5H9VA 4JJIA 1TYDE 4FF4A 3RSJA 3CJIC 4W5NA 1JPJA 4P38A 1F5FA 1M5RA 3ZU4A 3O4HA 1Z16A 4R3UC 4GLFA 4I2PA 4TTIA 2PMDA 1KJQA 2X4GA 4LO4B 3P4UB 1QJU1 3QSYB 1P9LA 4OBWA 1S01A 4XI9A 5KHAA 1QHEA 4LHNA 3RROA 4Z0TA 1ZFNA 5F37A 2Y8EA 3I9NA 5JQWA 3SVLA 3EYPA 4LFAF 1P77A 3DNFA 2N4CA 4FYDA 2J0EA 1IN4A 1KMIY 3ZH9B 5AVXA 3DL7A 3AFMA 2RD2A 1AYM1 4LE3A 1W49A 2VPXA 4Y26A 4UF0A 1KDKA 4RJ2A 3B2QA 4LBZA 5A3NA 2I4LA 5H4HA 2DNMA 2QX6A 3IO3A 4UBMA 3SQDA 3IR6B 2BKOA 2HWC3 1C2YA 1JDPA 1U0HC 3LI2A 1H9BA 3OFND 1DQ8A 4OQNA 3RZZA 2EJBA 3WWCA 2GPNA 3PEWA 1T9VA 2RKIB 1QSGA 3RHTA 3WP0A 3FUVA 4KVAA 5CEFA 5HPOA 3IT2A 3KQMA 3ACGA 4KN9S 4QWMA 1PO12 1G42A 1RQGA 5E4FA 3ILLA 5L38A 2MMGA 4GM4A 4LF7J 1FDAA 1E5HA 5LZ7A 3PYXA 1LWFA 1XMQJ 4R9UC 3N3AC 1H3NA 3AERB 3CKYA 1WB5A 2I7CA 1HFEL 4QT0A 1UT5A 3M6XA 4LSWA 4BV2A 3ZE2B 1USKA 3O7OA 2ZGLA 1NA1B 3L4BC 4ZGGA 2APOA 3K1JA 4BNWA 1ZJ6A 2XW6A 3RYIB 1MN6A 3WHKA 4DXRA 4LGMA 5BVGA 4LREA 3R6GB 2AU0A 5CQGA 4ZCQA 1UWBB 4FDMA 1WUTA 1PJ8A 1L4FA 1I6XA 3R7LA 4M5MA 4DV5J 5E1BA 1QIFA 1RUC3 4Y7CA 5EXEA 1YB2A 1F2TB 2O6HA 1Y3TA 2MZTA 1Y8ZA 3NP9A 4L6IA 4BKQA 4J9MA 3EEYA 5IFTA 5GLUA 4RDXA 5FO1A 1DFQA 4RR3A 1NBMD 1Z4KA 3AFHA 4WVLA 2C5BA 4R05A 4NYMQ 1SZPA 5DE3A 4PC6A 2BJDA 3BPSP 1ZBDA 3AXKA 5LW9A 4DCGA 3IAS1 4X54A 3CLRC 1RJEA 1JZ5A 3GHHA 1U0NA 3RODA 3T54A 4KYUA 3ELYA 3S8MA 5TT0A 5J23A 1VRH3 2ZM5A 3EBRA 3DKRA 3C19A 1XMOJ 2X19A 4NI2B 5A02A 3G71S 5E7IA 4XB2A 2XMKA 3HEBA 4KJZA 3LDKA 1Z56C 4N12A 2ZJQQ 3NL0A 4JHZA 2VNVA 4LZAA 4F46A 3V2HA 3QW4B 1DQNA 3G0IA 3HD1A 3PJQA 4EHJA 3OV7A 2D44A 3OI7A 2NLRA 5M2UA 4KQGA 4IDBA 3PUAA 1EUUA 2AIRB 1LHUA 1OYOA 3DUFB 3WLEA 1YBTA 1NUKA 5EE5B 5DJBA 2R8KA 3B52X 4ED6A 2ZDPA 2C5EA 4U2GA 4C2BA 4JJKA 3OQIB 3EH1A 3NBAA 3AR2A 5IKEA 3TZBA 2JI8A 1S4CA 4IHJB 4XM1A 2INGX 5DOVA 4DC1A 3QEOA 2VP2A 4FNAA 5J3JA 1K5MB 5HIAA 5I7WA 2QTWA 2PY6A 4P2XA 4FPKA 2XG8A 2BC9A 3RW9A 3VISA 1QJ4A 2FFJA 1UJNA 4ID5A 2ATFA 4LBQD 2IDJA 2ZHLA 2HN9A 4DAOA 3S55A 2ZBCA 5CT8A 1HI0P 4EN8B 3C41J 4JXJA 3I3EA 3FCAA 1VKOA 4JYZA 1U63A 5F21A 4AHYA 2HTFA 1EP2B 3AO0B 2QJFA 5J36A 3RKRA 2WDPA 3D3CJ 3V6LA 5F9FA 3LKVA 3SFTA 4B9EA 4ER6A 3OP1A 5A8KB 2PLV1 2Q2WA 1HW5A 4ZVRA 2ZABA 5JNSA 5JVDB 3RW7A 2P79A 1YQDA 4ENPA 1NUEA 5FP4A 2HK2A 1Y6ZA 1QONA 2QM8A 4NAHA 4AFNA 4R9DA 4A0GA 2R1TA 3O8CA 1WB6A 3PR5B 4E2ZA 3A06A 3PTAA 5F9LA 3HPOA 2GA9A 3L6CA 4S1TA 3M5PA 1JS1X 2MLYA 3VHRA 5A3UA 2ZJFA 3W06A 4RFRB 4TKUA 3EUAA 3TRGA 4X91A 3BD8A 4BXOA 4CN8A 1MC5A 1RWQA 4QR2A 5HROB 3TSYA 3LGAA 3WK9A 2ODEA 4YSFA 4KN6A 4QPGA 3D3KA 1N1TA 4JB2A 1HYQA 2K87A 3R05A 2OH2A 1T6XA 3N0WA 2J5AA 1A77A 4QMAA 3AHJA 5LASA 1SACA 4UDYX 2MSSA 4MKRA 1DTWB 2X4LA 1BDIA 2RKIA 4JUZA 3WI7A 3NH9A 4R68A 4KE5A 3EHEA 3QVVA 5ES3A 1HFJA 2MJLA 3A1EA 3IUBA 2FCAA 1QHYA 5DX1A 4CU7A 3GJ3A 2JE8A 3RVKA 4OYUA 1V1MB 2H6CA 3EXIA 1DWUA 2X8BA 1P5HA 3OJCA 2C6SA 5COBA 5BOVA 5LA6B 5JFTA 4FWTA 2JGLA 2AW0A 1OSDA 3KLFB 4G3XA 5LBEA 4XQWA 1Q77A 4E1VA 1V6KA 1VRUB 3BH0A 2Q3PA 2DGTA 1QK3A 3LH2S 3FWYA 2IPLA 5B3AA 4XF9A 5JI7A 5H59A 4QM9A 1NB2A 5TS3A 3CLHA 3W59A 1ABEA 4YFZA 1N5SA 1Z3CA 3PIPQ 4WXPA 1N7GA 5JLAA 3IAFA 1LRKA 1JAYA 2HF9A 3LUPA 1KGSA 2CGOA 4M8NE 3U1VA 3MGKA 5K0UA 5DH9A 4LV5B 1HNIB 4H35A 1J2UA 4MWSA 3VSDA 1NE4A 1CQWA 1M4WA 2IAJB 2FN8A 2O1WA 2B1IA 3GJTA 1GOHA 2ZBEA 4B9TA 3OQBA 4PYQA 2L9LA 5LWQA 1SJRA 1M2OA 3RJMB 3S7IA 4D44A 2LPMA 1MABA 1GMVA 3VO9A 3RHZA 3ZD7A 4EH1A 2QTHA 4V0MA 1FU8A 1D2CA 3E3LA 5J37A 1CJCA 3WGLA 3VBEA 1HTBA 3OQOA 5IHXA 5TF0A 4Z5XA 1E57A 4IJUA 1WXQA 1RSZA 3FEYB 4DJFC 3OOJA 1FQOA 5KG5A 1O2DA 1CYEA 5TR9A 1MS9A 2QXUA 4OEHA 3HD2A 3P0JA 5HEKA 2OPSA 2CMHA 1IZ8A 3H1PA 4MRPA 3QXHA 2C5DA 3RAMA 1K92A 3P5BA 3NJYA 2JFKA 5DN9A 4JT4A 3ZTYA 5DPNA 4E03A 3BDPA 3V6HA 1PCXA 1UA1A 2HWC2 4U4AA 4QEKA 3O2NA 5GLZA 4LFBF 1U0TA 3K5MA 3UMJA 3GG2A 3DKPA 3I9OA 1VPVA 1J8YF 5BOSA 4NRMA 3RABA 4NHLA 2TNFA 2OZPA 3T52A 4QGSA 1HDOA 1A3KA 4Y6OA 2FKNA 5BXYA 1NMQA 1HKUA 3CDZB 1PKXA 1M5PC 3A3OA 1YS1X 1WF1A 1H0HA 4YRKA 1LW2A 2Q2NA 3V6JA 2ECPA 4AN0A 3ZXSA 4B45A 5DM0A 1KOJA 3MLAA 2O2CA 4L8FA 1GZWA 2GEFA 1SQ6A 5DTQA 3BRWD 1POWA 3RFTA 1N75A 4HX2A 2IVIB 4OFBA 3QWUA 2B7BB 4WCEQ 4LJ8A 5HIJA 4PSUA 2A0YA 3PYEA 2MWMA 2X3DA 1YMQA 4RIGA 4NMXB 5KFHA 3RRFA 4CM4A 2ZATA 4H7DA 2FE4A 3OX2A 1T9TA 3BJYA 4ECVA 1G21A 2GPAA 2WRAA 3KTOA 3SX4A 2PJZA 3J80A 1XRJA 3ANLA 4L57A 3AP6A 5LL6P 4LF5B 3JRWA 4LDZA 2MLXA 2SBAA 4FHDA 4MUFA 2A0XA 1IN0A 4OZ5A 4C3ZA 2NT3A 4LITA 4F9TA 1UU4A 3W9AA 4AWAA 1DO8A 2HA0A 1RI4A 3THXB 4KGVB 3NPAA 5JU6A 1HYSA 2CMKA 1H9PA 3ILFA 3C15A 3TIVA 4CCHA 3F46A 5J2PA 3IQXA 2O2HA 2WZPP 1TM7E 5MAOA 2VTBB 2G7ZA 3CUNA 3QO9B 1GQQA 2XOKD 4I0BA 4TTSA 1UX6A 1W6PB 1JNZB 4GWLA 5I3PA 4XR9A 2F4VF 2HWD2 3WKCA 1KEUA 3LP8A 4BVFA 3OW2R 4W99A 2Z56B 1L5FA 4OFZA 2TUNA 3LY9A 1ZCJA 1POV0 2VBFA 2J07A 4GC6A 3RS9A 4R8KA 1S4QA 1YMUA 2ZKNA 1ZA4A 1H2HA 1T5LA 1G9TA 1FNXH 3LECA 5FFFA 2RGYA 3E9RA 4JI7J 1QZUA 2XHCA 2XZDA 2X1AA 4DR1J 2QV6A 3OR2B 3ST7A 5AVZA 1F9FA 4YM2A 1V96A 4CKWB 3SLRA 3WOGA 1G8YA 1UU5A 4ZYTA 4LF7B 1CESA 2QL7B 4DBQA 3LPEA 2IEGA 1VJQA 4ICLA 4KBZA 5E6UB 4IX1A 4ZVLA 4IDGA 1AA9A 3E4DA 3H7YA 2C2XA 3FF4A 4HMQA 3G2QA 4BOYA 1FUEA 1SPBS 3SN6A 3DLPX 3GPBA 4FOWA 3ONFA 1OXBB 1V37A 3DAOA 2CL6X 4G3IA 3IBFA 3UAZA 3FJSA 4GXTA 3FGPA 1LQUA 1VP3A 2W2QA 2W25A 1XOYA 3CKMA 2DOKA 4MVJD 1LY1A 4JP1A 3IHKA 3GLRA 5L3SB 1ILEA 2Q50A 5TJHA 1VCOA 1Z4IA 4RV9A 1P81A 5DHRA 2JLAA 3FH0A 2DHHA 3OCZA 3HFJA 1J7JA 4OQ8A 1NYRA 3VYUB 4TWRA 2VF3A 4FC7A 1Y5RA 2J3QA 4TMZA 3S6EA 1B8OA 4LLFA 4RQPA 1DEAA 3BD7A 4EMUA 3K3NA 1RUI1 3KHSA 1QVRA 2YKPA 1YU9A 1THZA 2HQDA 2YOHA 4GVBA 3L8ZA 4LSLA 3OU7A 4KB5A 2G7MC 1XI2A 3JPWA 2EVZA 5AE3A 4XMIA 4I81A 4I9GA 2JFUA 3MK31 2FPKA 1GL6A 2WO2A 2QA5A 3R23A 1Y6JA 3FSRA 4L5CA 2XQGA 4L3OA 3RUAA 4BLOA 1Y7BA 1AQNA 3MRTA 2Y8WA 1H5NA 1Y33E 1G16A 1G8HA 1IZ7A 4PONA 3ZIAD 1SUIA 5CU1A 5EFOA 4GP7A 3TR6A 1LC3A 3WVJA 2ZZNA 1JXAA 1NQUA 4PZVA 2O05A 4J4TA 5KVCA 2PI5A 1MO2A 4XIYA 1ODIA 1X1DA 3FBYA 5E6SB 1V48A 2OPSB 2Z2KA 2FSPA 2QROA 1JLLA 3VX4A 4QAJA 3UNPA 3AV0B 1I4OA 3K8VA 2Y3YA 3DBHA 1GWKA 4MVJG 4PPNA 1XE0A 1UEIA 5DM4A 4ZQFA 2ZYVX 1SOVA 3LHIA 2UXBJ 5IZCA 1Y5LA 3EY9A 2GESA 4RTMA 1U8CB 1YS9A 2AJ4A 2RH5A 3QWPA 4XEZA 4DPNA 1OFHA 4ZEMA 3AETA 2BVNA 4R8VA 3UUGA 2HHAA 3Q8PB 3A25A 4AKEA 4EUNA 5DDJ2 4LW8A 4LRCA 3KK1B 1UCFA 5DI9A 2BFDB 2ID7A 3E82A 2W2NA 1OLXA 3N36A 4J9KA 3I23A 4YJFA 4YLYA 3G86A 4ECYA 1MMDA 2E1AA 3D1QA 5DM7Q 4FOYA 3TUIC 1H85A 1RCXB 3MM9B 2DH7A 4YRIA 2VIIA 3GLVA 1PMJX 4N90A 4NROA 2ZR7A 1EP1B 5EIBC 2HOQA 2O4UX 4B6QA 3BV8A 4DWIA 4F12A 1ZZ8A 4V24A 3FGNA 3JR3A 2EG1A 3KXKA 5DUWA 2OYCA 4KPYA 2JAHA 3PRHA 3T1AA 4CKCA 5IUKC 3WA7A 5CKQA 4RQTA 4QJVA 5A1AA 5FNVF 2AR6A 3D9QX 1TEVA 2X5JO 3ZNNA 1KP6A 3O3MB 2X13A 3RU7A 3H9EO 2I4TA 2QTFA 2W93A 3ZKWA 3RMYA 1KJRA 2ZZKA 5IS2A 4OI4A 1GNLA 4BNHA 5ETMA 3IDCB 3S30A 2V4VA 1Z0FA 3ACCA 1NN0A 3DB1A 1QK4A 1PWZA 1NZCA 2VP0A 4YPOA 4D6RA 2KN4A 4NLXA 4QPGB 1AHIA 4OX9B 1LOGA 4EI9A 2AT1B 5FZ1A 2HSEB 3QA3E 1VALA 3QNMA 1OTYA 1PEDA 4Q44A 4TZTA 2CL2A 1GU7A 3A1YG 4YZ4A 4IY1A 2X2PA 1NA1A 2I65A 4FP9A 1QSSA 1I4LD 2B20A 2P9GA 1JUIA 4F25A 1XK8A 4PLMA 1OX6A 2FXVA 4ND8A 1Q8OA 3IN9A 2CJWA 2ZUFA 5CZKA 2E5LF 4CR8A 1Z2AA 3EGXA 3QZUA 5KOHB 3UJOA 4U5XA 4BO0A 3QX3A 1U0SY 2EPIA 1NKBA 4GO1A 3FUOA 2OGSA 4PICA 4KKXB 4MLOA 1H0BA 3UOGA 1H05A 2QDRA 1SY7A 1IR0A 5K5EA 3B7PA 5DDRC 3OZCA 2ZVIA 4KQ6A 5EEGA 3NKLA 4FFFA 3V2UC 2BE2A 2VYNA 3K7EA 5KSPA 1K73T 2CWXA 4LNUB 2IMOA 5ILOA 3VJLA 2HYIC 2VQ6A 2IPMA 3GIMA 4Y34A 2W68A 1RB8G 1WVIA 2ZH2A 5JMTA 2R063 3NGTA 2QZ2A 2QQGA 5DV9A 1UW4A 1RXWA 2XQFA 4XDOA 1NM5C 2H65B 1E0JA 1RT3A 3N0XA 3ZDYB 1W6PA 2EFHB 1PJSA 3CB4A 4LT6A 2X0EA 2Q3HA 1J5OA 5FP3A 3V4SA 4F3KA 3D7KA 3ZXWA 1XZIA 4FTBA 4OZ1A 4BN5A 4NLVA 1O54A 1T9DA 2JGAA 4V2UA 1NV9A 3RB4A 2N75A 3PK0A 1FE0A 1F7UA 3O73A 3FSGA 2G1UA 4INJA 5EJ8A 5LD2B 1PC4A 5KG3A 1T36B 4N03A 5AKHA 4USVA 1RFLA 3O8DA 1H8VA 4ETNA 5IHPA 5D3MB 2HSJA 4QYIA 2EALA 2UVPA 1T5IA 5T4EA 1P1TA 2JHPA 1P7CA 2ZOMA 3FHCB 4C7BA 2GBLA 1FP4A 3K16A 3FOEC 4D98A 1Q7BA 2F9DA 4DLGA 3TQSA 1URNA 2DO4A 3P27A 4IWNA 1UZAA 1S6UA 1IR2A 1B3RA 2HJSA 2UUTA 4EA8A 3TNFA 1X0VA 4WKCA 4OMFG 4KR0B 3VBOA 4OQQA 2XSJB 4O3PA 1GGJA 2J8ZA 2ZB8A 4RR3C 2FLOA 4L0MA 4QBGB 1UFKA 4Q7EA 1K2WA 1ODNA 2GV1A 3G87A 4GKVA 4KK3A 1OO0B 4OXKA 5FYBA 3K0AB 1U9CA 4LBIA 4ZI5A 2JD9A 5CLJA 4B3MJ 1W4CA 3F6BX 3RAGA 2PRZA 5FL7D 3SCZA 1P17A 2QMXA 1F15A 2IPXA 4O4GA 2XR1A 3IUQA 4CDUB 3HP7A 1YF3A 4L0QA 3LQYA 2TEPA 3QKUA 3QT8A 2CYBA 2RI6A 4G09A 3DLIA 4LOAA 5CNAA 2MTLA 4HWRA 4IRDA 3B1FA 3E5MA 4Q5IA 3G1WA 4CNBA 3WYCA 2VCEA 1ASJ1 1XCMA 2BMWA 5CA5A 3HJGA 4CM0A 4Q2LA 1OFSA 2NMVA 4ARZA 2DWCA 3K8OE 2W52A 3TA2A 2GK6A 2JANA 3BA6A 3JQGA 4FVMA 2PS1A 4ZCLA 4X5OA 2QBYA 4NLUA 2A2CA 1TCBA 2NUAA 2ISCA 4X66J 2AS0A 4DSEA 3PHMA 2XPJA 5EDWA 2ZP1A 4F6RB 1AXRA 3BJRA 3PRYA 3SJAA 2QV7A 2OESA 2RD5C 4KH0B 3GFSA 3M7IA 4GI3A 3V4FA 1KVIA 2B8MA 3SPXA 4DNFA 5JBNA 2G77B 3O83A 3RZMA 4C91A 4ER5A 3RQ0A 1WXDA 1TXGA 8ADHA 4BMXA 2BE7A 1DKMA 4UTZA 2IWRA 3RWNA 4RY8A 4XF3A 4IH7A 4DFSA 1A7UA 3PXUA 4LJ6A 1WAMA 4F2SA 1UCXA 5B0CA 1QRSA 3KQQA 1W6UA 2R7VA 1N6OA 1NP7A 4YT8A 3NASA 4RTKA 3IRVA 2PWAA 2JLYA 4NLPA 3DMDA 2DVDA 2WAMA 5ALQA 5EUBA 4C4PA 2VJDA 5BP7A 3RRHA 4PZAA 4P4UA 3CJIA 1R6TA 2AZMA 5TGTA 2RBGA 5FUIA 5KHGA 5AW2A 1LXJA 1F0KA 4OQYA 4WTOB 4KQMA 3DPRA 3NTVA 1L4HA 1QIHA 2CPHA 4COWA 4PLTA 1PG5A 2D6LX 4QXOA 3SDEB 1HEYA 2EG2A 4KO0A 1CF9A 4B6RA 1YSJA 2WHEA 3QLHA 4RQPC 3BBFA 2DWOA 3DI6A 2E29A 2QJRA 5K51A 4K4TA 4MWOA 5AQ1A 3OY2A 3KLGA 2WSCC 2OEMA 1Z18A 3UHPA 2RJLA 1F4LA 2Q30A 1A34A 2ENWA 4GKJB 5DDJ1 1Z5ZA 1WEHA 5H5JA 2DKOB 3ZCUA 1IC6A 4O4RA 1FLDA 2BGWA 4ARCA 3B5EA 3VVBA 5ALDA 4EN9B 2V03A 5IF3A 1CIYA 4KSCA 1RM3A 5AKLA 2NUAB 4DABA 4YT5A 2HSDA 3KSRA 2QVLA 1FOD1 1J9ZA 3TIXB 2F4LA 3HHPA 5TPZA 4BE3A 2CQ2A 3VDAA 2J6HA 2J67A 1S55A 1XDGA 4QXKA 4PRZA 2Y6HA 4A5OA 3ENRA 3TN7A 4XBQA 3TAQA 4PC7A 3MEEB 2C58A 3RPQA 1SLCA 1OZFA 2GK3A 5FTKA 3I5MA 4IMJB 1CUVA 1HRI1 1JEQA 3PNQA 2CT8A 3HLKA 4MR7A 3P0RA 4X4OA 5FPQA 4P9YA 4JI5B 2VG7B 1J1IA 1R1ZA 3K20A 1G4HA 2F3UA 1REQB 2IYYA 3N8IA 3MBOA 4YW2A 3BGFA 1KORA 4UPEA 1KEWA 4A8MP 1KDOA 5BSWA 4CCNA 4FB5A 2ZVSA 1HV8A 2P37A 4FYWB 5D3KA 4NL5A 5IVJA 4LR4A 1CYDA 3IQGX 2FSVC 2GJ8A 2BTEA 3DP9A 4DDFA 2J0WA 4NV0A 2I1RA 1NEEA 1UPBA 2UUBF 3AL0C 2RK6A 1G3QA 4X6LA 2QQMA 2QVXX 3ZWQA 3GONA 3FLMA 1RUI2 1NCRA 3SZRA 4FN4A 2DXIA 2JFNA 4CDUC 3COVA 3R4CA 2DNOA 3RRZA 5B1IA 2HF2A 4JI0J 4NXNB 3LG2A 4JYCA 1OR8A 4FW8A 3ZHSA 4E2YA 4CWBA 4NWWA 4AFDA 1HO3A 1TV6B 3IERA 4AJIA 3CC8A 4QDOA 4C0SA 2YASA 4UVHA 4JB8A 4YMLA 4QX3A 3CPEA 2ETVA 4HWKA 3LFHA 1VIYA 4CLWA 1V8ZA 2GX6A 4CT9A 4HNQA 4A27A 1H2VZ 5F1YA 2FGJA 3BB5A 4KAAA 4UOQA 3P52A 4KFSA 2UVWA 2YOFA 5E6RB 3I7DA 2EFGA 2A9OA 3OY8B 1J59A 2R7TA 4RWWA 4A44A 2H07A 1E3TA 4JJGA 4IOCQ 4TTJA 4ZCSA 3PFGA 3NVDA 4ECWA 1Q0QA 3BUSA 4M5HA 1HQUA 3N86A 4XBLA 5IC4A 5IT9A 3QU9A 2ZD1A 4B4OA 4WMLA 1BVVA 4RW8A 1YRXA 2XKAA 2FDJA 1N4AA 1NVVQ 2QRQA 3BPZA 1B8UA 1FFWA 4BK5A 1HBOA 2PX6A 1U49A 2UXCJ 3E5NA 5FR3A 4CE8A 2ERFA 2XYRA 1SLBA 2PQ0A 3V7UA 5KYWA 5JCXA 1EX8A 2EXKA 1JWLA 4OJ3A 5LQMA 4YJKA 1QY4A 1G5PA 3R3XA 4UF0B 4DUXA 3MINB 2I8LA 2LCFA 4AKSA 3CR8A 2QGFA 2PFGA 4OJKA 4JV1A 4DA9A 1SA0B 1U5YA 3O7MA 1FFAA 1XF1A 4OX9J 2QKYA 3AP9A 3ZE6A 1ACMA 4PQUA 3G79A 4HNGA 1FPQA 4HXYA 3PYDA 1ZITA 3PDCA 3KFWX 1MC1A 5JSYA 4P71A 3IIAA 4GKAA 2A6YA 1J2YA 3BZQA 2CPJA 3TF5A 4BWYA 1DKLA 5DRYA 2OIHA 2XNJA 1VPEA 4W8OA 4L4XA 3D7SB 1U28C 3FNIA 2I1VB 2H54A 4XUPA 4F3YA 1YL7A 1ZBA3 3FKSA 3BIWA 3HB9A 3O8WA 1SNYA 4P3PA 2C5HA 3T9ZA 1UC8A 1VBD1 5C8WA 1T05B 5CXUA 4NQRA 5K14B 1T1JA 4RTRA 3T7SA 3MM6A 2P4QA 3QEKA 2DJIA 3I5YA 4UZBA 3ANXA 1KITA 3HN2A 1B8NA 1PM4A 2UUBJ 4ZJOA 3P8BB 2MKJA 2QD5A 2VH5R 3SJUA 4RZXA 3FVVA 1FJEB 3CW8X 4DCTA 2OB1A 4M0MA 1QTIA 3MCUA 3TM5A 1NVXQ 1AZDA 1QJX2 3H05A 4DA7A 4ABYA 4Z4FA 4Q12A 4GJZA 1FNYA 2QRKA 4ASKA 2HK7A 3C2PA 5BPXA 2FUG6 3VR6A 4A10A 3SC7X 4X7MA 2BTOA 2RHBA 3I8SA 2GBLC 4I1PA 4NBUA 4L4SA 1IOVA 4IUCS 2LXFA 1DKRA 3QHPA 4UEKA 1H2EA 2VUCA 5EGYA 1F2HA 2JOQA 4IV8A 5IM0A 4NPMA 4ZVUB 4JLNA 1TVRB 4I64A 3MAAC 1YYNA 2O3JA 3JVUA 3I4LA 4MVJF 3QIDA 2PBFA 4XTMA 2IU4A 3B2NA 4ZZ3A 2Z57B 4RIFA 3KXLA 2DUMA 2B45X 3LVQE 1SJFA 3MURP 2VV5A 2FZ4A 5IYZB 4I68A 3W7BA 2WU8A 1A97A 1E2LA 1O3RA 2UVPB 2CWWA 3PFWO 1RZUA 2HIYA 5YASA 3W3AD 2IJFA 1EIYB 1HHQA 2R7LA 4IS3A 3K3PA 1TYAE 1AT1B 5CDUA 2CADA 3O8QA 4ROSA 2Y0IA 3IAXA 4ZU7A 3T5PA 3LOIA 4DSNA 4ITSA 3CRQA 5JVGQ 1L4EA 3I8XA 1K06A 1F9KA 2EU8A 2GAAA 2Z2LA 2QMHA 1YQ6A 4A8OA 2PIIA 4INOA 4Y2QA 4J9RA 4RPJA 1L5VA 5GADU 3UJQA 4NFYA 5EJFA 2VE1A 2IKQA 1W9YA 1RYYA 3OB8A 3KG2A 3O03A 4B3MB 2WIFA 2BPA2 4REQA 2QRVB 3WLNA 3NKTA 2HQFA 2LDXA 4I8DA 2QTRA 1REVB 2CLDX 1Q95G 1CUSA 2C2DA 3K9BA 1P6TA 1C5HA 5GPBA 2WYFA 3OJFA 4LQ3A 3WD5A 4P22A 1QB8A 2AEYA 3G2XA 3R5TA 2G63A 4PCRA 1BHGA 3PEUA 1SFPA 3AY6A 4OYMA 2HM7A 1BBT1 1NW6A 3V6DB 3X3HA 3DMRA 3IBSA 5GAJA 2W8BA 4WCFC 2G9ZA 1M1HA 3SR0A 1LTEA 1RUSA 2DPLA 3DA8A 2W5UA 1KFUL 3NOVA 1O7FA 5KFQA 1IBRA 3QYAA 1RADB 3R76A 3U40A 3JRXA 4NV3A 3WGYA 1IVZA 4XIUA 1IHMA 2Q2QA 4C0AC 1P7YA 4PANA 1R4ZA 1GEEA 5I8WA 1U5AA 2P78A 1S77D 2ZGQA 4X20B 1SXQA 4TYNA 3CJ8A 4W6ZA 3EC1A 1POQA 4P9IA 2DSTA 1PJBA 1AR83 3PX6A 4YYZA 3N8GA 4ECUA 2EC0A 4QYSA 5HATA 1JIKA 2ZTLA 3EA0A 5AW4A 3D2BA 1JR3A 3UVEA 1QFJA 3NIWA 1NW7A 1SBFA 3H11A 4PG5A 2CVOA 2WV9A 2AV5A 1FPMA 1HLWA 1R1A1 3ZXUB 2M70A 1KJYA 2BN4A 4QIWD 2EGUA 4FDVA 1YFKA 3KWMA 1K08A 1N3OA 2E9RX 1O97C 3GBPA 3VHNA 3O8BA 3CCCA 1NJ6A 1NVFA 4IR7A 4YACA 3REFA 4BFTA 1CIWA 3U44B 3SCKE 4LVOP 1VMFA 1X8EA 1HE3A 2QG9A 4HTJA 3OJOA 3AU9A 1ZAWA 1EB0A 3TMKA 1KK0A 2CA9A 3FFXA 4REQB 2O0HA 1H1IA 4MS4B 1F1JA 2RUGA 1CAWB 4X3PA 4URGA 2E4XA 2ZHKA 1VHJA 4Q5VA 5T7BA 5TIIA 2CV6A 4CMGA 3G8DA 1GKLA 2DFBA 3VD4A 4JI5F 1JQDA 2IC5A 1RT5A 5AHRA 4X6QB 2V65A 3A6FA 4I36A 1SXGA 4IRMA 1NSQA 4YR0A 2XUQA 4X1IA 1QK5A 5JW6A 4NG4A 1ZR4A 4B1MA 2UUBB 4BY9E 4NZ7A 2XNDA 3W6PA 5I4KA 4HWGA 3L7OA 3W63A 3C7FA 1PCAA 2EF6A 1JDNA 4AJJA 1ZW1A 2P6SA 3QACA 3RZAA 1HE1C 1S10A 1FESA 3R20A 2VZTA 3WHIA 3PYFA 1VGRA 3W9YA 5KNLA 3L02A 1I33A 3GJXC 5ARBA 3FZEA 3DEAA 2BBVA 5MFZA 4DGSA 5FREA 3VBCA 1H4QA 4RVCA 2HCBA 1VC5A 1Z28A 2D2VA 1VLJA 4N7MA 5JAOA 4BPRA 3RGIA 4TKLA 2BJEA 3MPPG 2VZSA 4F3MA 5J40A 1U90A 2FLLA 3LQ1A 3K05A 3KU4A 1JSXA 4EPVA 3JAWA 3FZBA 1HXS3 1RLJA 3WJ2A 3E27A 2OAP1 1F3VA 1SVDA 1T5OA 3BH6A 1UY2A 3Q8RB 3NNCA 2NUPB 3HT3A 1UBNA 1JEQB 3ZHTA 2DULA 2G3YA 3M4XA 4LJHA 3MQFA 3KSCA 5FJHA 4HETA 3ACFA 3O1MA 2VQDA 5C7PA 2PKQO 2JFGA 4NHOA 1RM5A 5DF1A 1WC1A 3MBIA 4KMOA 2ZH8A 1U2FA 1RWWB 4CCEA 1EI9A 2AG6A 3V5NA 3U26A 3L8EA 1NVDA 4GDMA 1DKNA 5IUQA 3L1KA 1CY6A 4O6VA 1W76A 4R2HA 2KX7A 4LHYA 2HGMA 2AUYA 4V1PA 1U1DA 1W44A 3JQ7A 4YP1A 1DBSA 1FK8A 3GHMA 2GW8A 3A6KA 4TWIA 1OZHA 4K50A 3L7BA 4ND3A 4ZV9A 5FYDA 3FCEA 5FKBA 1IQDC 2Q9UA 1VE5A 4G5YA 4FD2A 2GZOA 5EHNA 4BGUA 1ZIXA 1FB5A 1JP7A 1RGVA 4U7HA 5FY1A 1M2HA 4USJC 3CRMA 1N6PA 4NULA 1S6QA 3PHGA 3EDCA 1MABB 3HA3A 3K4HA 4EMDA 2I6SA 4RNHA 3DP7A 4M3CA 1JZ7A 4R25A 2J3HA 1JZ2A 3JQFC 1LBIA 5E9JA 1OPOA 2GETA 2X22A 4H0FA 5C25B 1ML3A 1YZGA 4QDKA 4UVEA 2XHNA 3OYWB 5LMNF 3G2IA 2YRFA 2I6FA 4IEXA 2IM2A 1ZRIA 1Z6PA 3JTNA 2YQ5A 2NYHA 4PGGA 4MGEA 1EARA 4RZHA 4ZPWR 1HBOB 2HBTA 4MS1A 5KFWA 1FFWB 1GUFA 3I42A 2PRIA 4P54A 2CQBA 4Z4GA 3JZMA 2W46A 7AT1B 5CADA 1UPIA 1CPZA 5IF9A 4ND1A 3WGNA 4XPIA 1JLBB 1AKNA 4CGZA 3I62A 4NPLA 5AJHA 4P72A 1SIBE 4TS3A 3DZ8A 5C7GA 2AYYA 1RUH1 2WVDA 2WSYB 3BMQB 3H1FA 3SICE 5AOBA 1QX4A 2P6UA 2MSCB 1ENRA 2GVZA 5HQLA 4D92A 4W6XA 1SH7A 4EVSA 3RT7A 4XUDA 5D4PA 4QNNA 1DTWA 4IQMA 1SG3A 3Q8LA 3DOMB 2ADMA 2EK1A 1U4OA 2JG9A 3G9UA 1ZEJA 1T2EA 1O6BA 4EATA 3V6KA 2CDRB 3Q8VA 4UY8T 2Y1JA 3O0XA 3LA0A 1RSCA 3BICA 1ZETA 4ZJZA 3HM9A 1WTFA 1ADGA 3C97A 4D0NA 4TT8A 5JECA 5THKA 4G1EB 2RSLA 2UXCF 3NIDB 1S0FA 3N2KA 3YASA 4Z4CA 1HX6A 3MWDA 1TTTA 1ESNA 2QT7A 4ZQGA 4Q82A 2YXBA 1NF2A 4YRJA 4USHA 1DLIA 4PLZA 2XUGA 4DX8H 1CAWA 3UZUA 1U1PA 2LIPA 1Q22A 3HBZA 3X29B 2VQFF 4KAFA 2B6HA 4RY9A 3BDIA 1YQUA 4LIVA 3TYJA 3I92A 3F6EX