3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
b'KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Subtilisin-like serine protease
publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
2X8JB 1GNVA 3GCWA 5FBZA 3BPSP 1Y33E 1NDUA 1SIBE 2WUVA 1BH6A 3A3OB 4DXZA 4NE9A 2PKCA 4I0WB 1WMFA 2W2NP 2HPZA 1SCJB 4G9SB 2Z56A 2X8JA 4WOBA 1SH7A 3BPSA 4NE9C 3PTLA 3I37X 5JXHA 3TECE 1SUDA 3H42B 1R64A 3A3OA 3BGOS 5B1DA 1BFUA 2E1PA 1ZVKA 2W2QP 2W2NA 2W2PP 2IXTA 1SCJA 1SUAA 1KE2A 1BE8A 1S2NA 1C9MA 4GI3A 2V8BA 1PFGA 2Z2YB 3ZXXA 3ZXYA 2XRMA 3AFGA 5CW1A 4H6VA 3SICE 2TECE 2W2QA 1GA6A 3BX1A 1WVMA 1Y48E 2W2PA 3EE6A 1SCAA 1IC6A 1SUBA 1TM5E 4OMCA 1XF1A 1SCBA 2Z2ZA 3VYVA 2P4EA 1SPBP 1V6CA 4BWGA 1TO1E 5AMXA 3AJ8A 2XVLA 1C9NA 1Y3DE 3DE3X 1CSEE 5SICE 1UBNA 2W2MP 1KDZA 2ZWOA 2G4VA 3DWEX 2ID8A 1LW6E 1MEEA 3DVQX 3WIVA 1YU6A 4B5LA 1Q5PA 4YN3A 3DVSX 2XVGA 2PWAA 1AU9A 1SUCA 1GTL1 1YJAA 2W2MA 2PMWA 1SN7A 3DW3X 3VHQA 4DY3A 3CO0P 3DE4X 1TM3E 2Z58A 1P7VA 3AJ9A 4ZOQI 1ZVJA 1TM1E 3A3PB 1EA7A 3LPAA 2WV7A 1ST3A 1OT5A 2XTJA 3DYBA 2Z30A 1SCDA 1BFKA 1JEAA 1OYVA 1TM4E 1S01A 3A3PA 1AV7A 3I30X 3LXUX 4C3VA 3QMPA 4H6WA 1NQJA 1MPTA 1Y3BE 1SELA 1SBTA 2QTWB 3TI9A 2DQKA 2W2OP 3GT4A 1IAVA 5AVKA 3I34X 1DBIA 5AVJA 5JXGA 4Z2AA 1GTJ1 2XVKA 3P5BP 3CNQP 4C3UA 1TO2E 3VSBA 1AK9A 2PYZA 3PRKE 3DDZX 2QTWA 1NLUA 2Z57A 2W2OA 5JXIA 2SECE 4DWWA 3WHIA 1CNMA 3A3NA 3P5BA 1SPBS 2WWTA 2DP4E 3VV3A 1TMGE 3Q5GA 3HJRA 1GCIA 4I3GA 1R6VA 3OSZA 3LPCA 5FFNA 2SICE 3WIUA 1SUPA 1NDQA 1SIUA 4YN3B 5K7SA 1ST2A 4K8RB 4HX2A 2SBTA 1DUIA 1T1EA 4M1ZA 2O8OA 3LPDA 2PMWB 3GT3A 2Z58B 2SNIE 4K8RA 4HVLA 1SBHA 3F7MA 2Z2XA 3EDYA 3DW1X 1Y4DE 1Y3CE 5SV5A 1T1GA 1P8JA 4H6XA 4NMXA 1HT3A 1NQDA 2XTJP 2Z30B 3Q40A 1A2QA 3GCXA 4DY5A 1ITPA 2PRKA 3JQXA 4WOCA 5JMOA 4CG0A 1U5IA 4HPKA 1KE1A 3F7OA 1C9JA 1C3LA 4OMDA 3QTLA 1DF0A 3EIFA 4JP8A 4NE7A 1Y3FE 1AVTA 1SCNE 1Y9ZA 1OYOA 2ZRQA 3JQWA 4DZTA 1BJRE 1PTKA 3BOWA 1P7WA 3DE1X 3WQBA 1GTG1 2Z57B 1KDVA 4OV6B 1R0RE 1THMA 4DJ5X 4FONA 1V5IB 3A3NB 1SBCA 2B6NA 4CFYA 4MZDA 2PWBA 3QFHA 1SUEA 2DUJA 5ARBA 4OV6A 1GNSA 3DE2X 1V5IA 1YJCA 1TECE 2HD4A 1PEKE 1TM7E 2QFEA 5B1EA 3DF0A 3VTAA 2ZWPA 3DE6X 2IY9A 1SBNE 2LUWA 3BGOP 3H42A 3SQOP 1BE6A 1WMEA 3VV2B 3DE7X 1T1IA 1S02A 1TK2A 3D9QX 4KG7A 2ID4A 5AQEA 4LVOA 5FAXA 4NMXB 2Z2YA 3D43A 3CO0S 3SQOA 3GCXP 5ARCA 3F49S 3VV2A 1GA4A 1QXPA 1AF4A 3DE0X 3UNXA 4HPKB 1AH2A 1WMDA 1SBIA 1YJBA 4KPGA 3DE5X 5ARDA 1SIOA 2ST1A 5JXJA 3I2YX 2WUWE 1Y4AE 4AKTA 4J94A 1PJ8A 3TI7A 3L1KA 1GT91 2GKOA 1KDYA 1EGQA 4KB5A 4CFZA 4RYDA 1GA1A 4AKSA 3GCWP 1KFUL 3T41A 1KFXL 2PQ2A 1WSDA 1Y1KE 1VSBA 1AQNA 1Y34E 4DZGA 3DVRX 3CNQS 4LVNA 5I9SA 2Z56B 4ZARA 1SVNA
chains in the Genus database with same CATH superfamily
1KIFA 1G1XA 2ZJ1A 2HTEA 5KNLA 5NLLA 2YV3A 2R68A 2HHXA 3K6JA 1YXMA 3A3OB 2A67A 2PUGA 5JJLA 4IINA 2XBUA 3H4BA 2BLLA 1XIQA 5FV3A 4QFMA 1ZN8A 5AW0A 4FX2A 5KWEA 3IYLW 2I99A 1BCSA 1SKBA 4YRLA 5T5PA 5CYFA 1BE8A 1VDHA 4DLPA 1FFGB 4TKTA 1J27A 1Z2DA 3PRJA 1TK0A 3FDXA 4WINA 4YRPA 5AESA 2JDHA 2O2XA 5EE0A 2RAFA 2FCVA 5CFQA 5A9RA 3FZ3A 2RDDA 1VMFA 3WL7A 2WNIA 1XNQJ 4BOYA 4JI0B 4EG5A 3U4SA 4EY7A 4O4LA 1VMKA 2DE0X 2OPPB 1W8FA 4KHPJ 1J2JA 5FXXA 2CUYA 1ADYA 4S1WA 1G7CB 3UJOA 4GC6A 5A4MS 4GP9A 1DQNA 1VKRA 4REOA 3QWHA 1MTZA 3EQEA 3DRYA 2RS11 3GQBA 2R7XA 5D0HA 1JZ5A 3FSJX 4DQ0A 2LLZA 2AE1A 2EXUA 3OQIA 5CCDA 1HQEA 3HVDA 3L7AA 3TVKA 4L4YA 4PQ9A 3ZFEA 1U9JA 4DQVA 3TTSA 1T35A 1E6VB 2WV7A 1IAQA 4P54A 1ISSA 4K6KA 5B6IA 3HM2A 5KVQA 4OI0A 1MW7A 1U7PA 1RW4A 3ZVKA 1UBJS 2V8PA 3F0NA 3BMCA 3EIHA 1YI0A 4JUDX 2V45A 1HT0A 2Q7DA 5G04L 4RH0A 2VATA 5LYJF 4D1YA 4FMDB 1QB8A 3NOCA 1HOTA 1Y3BE 1R4MA 3H2SA 5F1PA 3OSNA 4Q0PA 1ASJ2 4AWAA 4IGPA 4FNIA 4K5SA 3S0MA 2EKLA 3I34X 1XPUA 1U7DA 3E3MA 2DXDA 3IM9A 3O1TA 3SJAA 4XJSA 1QYVA 1XYNA 4I50A 1PTJC 3WP1B 4N54A 1FSGA 4DS4A 3QY0A 4H4OB 3OTFA 5AK3A 4QPNA 4EY6A 1K3UB 2HWF2 1BQNB 4KC0A 3GMSA 5JO0A 1FFSA 1QZZA 2YY5A 3NAGA 5FULA 4X94A 1AMOA 3Q8MA 3QUTA 5F35A 3KQMA 2RJZA 1XR5A 3JARA 4XF0A 4KQZA 5J3UA 2GAFA 4A3SA 5KXCA 1RRPA 1GL3A 2R1UA 4E5YA 5HOEA 2RR13 2YH2A 3W9YA 1WD3A 1QV9A 1RZRA 3IQXA 4OKIA 4B74A 4E21A 5KT7A 2BM1A 1F2VA 3VBOA 1NOIA 2FZVA 2B8MA 4POAA 3AKTA 4K20A 1QM5A 1N92A 1SK9A 1DXYA 3HJFA 4BO9A 4XR4A 2CLSA 3X1MA 3NH9A 3VX3A 4FYWB 2FJDB 4LIPD 3O92A 4XI9A 2VK1A 1TKXA 1UBCA 4NL4H 1ACMB 3KKOA 1O0SA 1I7DA 4FOOA 4BQWA 2H4XA 5KQMA 2HFKA 1LPBB 2V63A 1N3LA 5FTTC 1LJLA 3KYCA 3U11A 3M81A 3QPUA 4KGMA 2OLEA 4RMIA 2J0WA 2CPDA 5IXUA 1SL2A 1JEQA 3T8YA 2YHIB 2QM8A 2ADOA 2CNKA 3U4DA 1CQIB 5L46A 5COQA 4G1UC 5IVDA 2PO4A 2G5CA 4EFKA 1SHKA 4GKJF 3HNYM 4UM7A 5K14B 1TAQA 1B0VA 2QZJA 2WS92 4WOJA 4BNMA 2OEMA 3FEYB 3FLBA 4GMGA 4D0GA 5EHIA 1YC61 2BFBA 4LF5B 3H5RA 3QTBA 5FFFA 1NJ8A 1CY1A 3SZ2A 3UA4A 4X6YA 3TGLA 1E0AA 4EGAA 3GAMA 2ZRPA 5AXCA 1JAXA 3N3BC 2WUFA 1WPXA 1RHJA 4NLWA 4RS4A 5BQ5A 3AODA 1TQ6A 2OO4A 4O2RA 2B69A 1QVRA 4CDNA 1LPMA 4HK4A 3LBYA 1RYDA 3KLEB 4FPKA 3AW8A 3R75A 4PLZA 2PUDA 4NEGA 3R8YA 4LDZA 3SU8A 1H72C 3O6QA 4J9OA 1N2SA 1HXS2 3BH6B 2IDMA 1RUE2 4BQ4A 1KPHA 2C2RA 2FZKB 3WSWA 5LLTA 1W9TA 4QKFA 3PDHA 5LQNA 4OCTA 3H86A 5K3BA 2VYNA 4FS3A 3RUBL 1SKSA 4QQ2A 1V7ZA 4E22A 4WFIA 4K1ZA 5CHCB 2VJOA 4EYSA 2YQ4A 2ZXQA 5BNQA 2O8CA 3GRAA 2HLEA 1Q1BA 1XRJA 8AT1A 3KELA 3OF3A 1NBEB 3JQAA 3T9EA 1CZKA 1JQAA 3KK1B 3LT1A 5DH9A 5EQJB 1VJ5A 4WXYB 1LH0A 4IJVA 1SKYB 1QJU2 2IRXA 3K51A 2I6SA 1FNCA 2ZBPA 3Q6MA 1HRV2 3PKJA 4YCDA 4I3HA 4R54A 2GO9A 4YH1A 1XA3A 5B3LA 2BEWA 3OLAA 1KOLA 1R6AA 1NBOA 3OQPA 4JD5A 3ZY6A 2VZOA 3FPCA 1QSGA 1OFIA 3CLTD 1REQA 3LVFO 4BGVA 2B51A 4W6XA 1T15A 2JLVA 1WV1A 3NAPA 2N9UA 1JZ8A 1P0QA 4BX3A 2JH3A 2YXLA 2AJCA 2CVOA 3U0ZA 2KRRA 2ZPAA 4EO7A 4H7EA 3VC1A 5J2TA 2Y6LA 1G86A 4B3SJ 1GL7A 1T1JA 2RS2A 2WZQA 2DNNA 1O89A 3TJAA 3EGOA 4DC1A 3LKDA 3TE6A 4UD2A 6Q21A 3WL8A 3D68A 4O3RA 2M6KA 2AGSA 1Y48E 5DLDA 2PT9A 1TKZB 2VAVA 4WZAA 4A2CA 5JYEA 4IGQA 3TQHA 3ND9A 1QNFA 4KO2S 2VQFJ 1O97C 4ETNA 4EW3A 3RG6A 1QHIA 1DGLA 3ZBUA 3LLUA 3O1OA 1FPMA 1A5BB 1X9GA 4ALZA 1V6CA 2VPXA 3CF4G 1ECFA 2ETXA 2KHZA 1LWCB 2L9DA 1Y6GA 4QDOA 1FK8A 3FK4A 1UL3A 2G4VA 1G0NA 3UESA 3QGGA 3KMHA 3MBWA 1W581 3EODA 2H00A 3FDZA 4MKHA 1J1UA 3ICCA 2DNMA 3FLPA 3T3EA 1JI0A 1P9YA 2B4PA 5ACA3 4OIFA 4N0DA 2M3DA 3PTWA 1IH8A 3IAUA 2D2IA 3ZD9A 1WCDJ 5CK4A 1K08A 3I3SR 3AJRA 4FD2A 1GVNB 3VBFA 4F3JA 1KYQA 5F76A 4KVZA 5TF0A 2HPAA 1GHTA 1I3NA 1IWAA 4QPIB 3FFBA 1UW4A 4U95A 3UXYA 1J5XA 5F7ZA 3TK1A 5KYXB 1RM4A 4RULA 1HX7A 2KWIA 3L09A 2OAGA 3DI6A 1IONA 2WDPA 3V5RA 3P8ZA 2B4VA 3PJYA 1UDRA 5KWRA 4MUVA 3RZZA 4EHAA 4QXRA 2W6JA 1W9SA 1W7WA 2ERFA 1EGMB 1FA9A 1AR82 1ZBA1 1V37A 1V6NA 3VHLB 3EVAA 3ANSA 2QE3A 4C4XA 1OZAA 1AFJA 4CCSA 1YJ5A 4YXWA 2BMVA 5JBIA 4PLFA 5IYZB 2BN4A 2M6LA 3ESDA 3BRQA 2P2YA 2BGJA 1D7OA 1CERA 1ULSA 4WD3A 1TGYA 4RVUA 1C7QA 1OX4B 3VKGA 1S97A 1RBAA 4QO7A 1ONPA 4HX2A 1VXRA 3W05A 4GB32 2IW3A 5C37A 1V3SA 4KIFA 2CA9A 2ZJFA 4XF1A 4AXIA 2QWXA 2FX2A 4BLOA 2VM9A 1JH8A 4I8DA 5CYQB 2BKUA 2KLBA 3L46A 5EJ6A 1Q44A 1MRZA 5CNKA 4H1WA 5F2WA 2VF2A 5F5AA 2FZCB 3ZTRA 3C8XA 4DL7A 3DW1X 1QXSA 1KZ9A 3TRFA 3RB4A 1T1GA 4PTZA 3U1VA 4NMXA 3I6MA 1VMIA 1C3EA 3UN2A 3GBPA 5KWJA 1O96B 1G7TA 3MFYA 4JI2B 3TZBA 2Y1KA 1MP0A 5C8CC 5I7FA 4EA8A 2RGYA 2Q4EA 3K53A 3PEYA 2TEPA 1YWKA 2VDLB 3JCZA 3E7PA 1ZRCA 4JP8A 2P6SA 5E3CA 5EJ9A 2IEBA 4IGIA 6NULA 3IP6A 2WZR1 3SLRA 2OGSA 4L99A 1KMNA 3DZFA 1JWBB 3I0MA 4DMGA 2OP1A 4I64A 3AETA 2OGZA 4DL2A 2JGIA 2BHNA 4JBGA 4Q29A 2CV6A 3HMJG 4DRRA 1I1EA 4KU7A 3HKZD 3ANNA 1TJYA 3CMAS 3R5KA 5G3YA 1CAXB 4ZZ5A 1GQOA 1RZRD 1YASA 2QNBA 2VZUA 1CS4B 5THWA 3QPDA 3QK7A 1Z18A 2GJAA 4ECRA 2UP1A 3OM1A 3S40A 3HULA 4YQZA 6CHYA 2HFZA 3EAFA 4L4ZA 1O0BA 1X7VA 5DTIA 3HFKA 1OI2A 4NDZA 4NP6A 2DHXA 4MH0R 4BKMA 1D3AA 3BT7A 1X2EA 3UICA 4I2VA 3RVJA 4ZPVR 2FPUA 1XZGA 3BYRA 1R4NA 3POIA 2VQ0A 1JNXX 2FX3A 1ZYBA 4ZK7M 4Y2JA 1FBNA 2F1JA 1OQ6A 1OLME 1R0SA 4NQRA 4EL5A 5FWXA 3KB2A 2JI8A 1M5OC 5BXYA 1V9U2 4MGTA 4KFBB 1YJBA 1KDMA 1H5UA 1Y1TA 2V5UA 1JHOA 1Z7BA 3CMES 3A70A 3EUNA 2O19A 4RNFA 2V7VA 4USMA 2BGMA 1Z73A 2JGJA 4ZU6X 4I2QB 3W8PA 2CXHA 2QQNA 3F5DA 4KIAA 4IDFA 1PS0A 5FZOA 4Q4X3 2VTEA 2NZWA 4QJ4A 1U0AA 4AQSA 4FU0A 2RE1A 2C26A 1WZ2A 2C4XA 1RXEA 1HJGA 2BRTA 2XVAA 3B9QA 2PRYA 1HYSA 3DTTA 5LDGA 1GWKA 4LF8J 1NVAA 1UY4A 1ZIPA 1PK6A 2C84A 4ANFA 5KNDA 4O4LF 3Q85A 4MRVA 4MW1A 2ZSUA 2HWC2 5HEKA 4YUWA 1OBVA 2A1TR 3J81A 3JB9k 3RI8A 4ZN6A 1T34A 3TIVA 4Q4DA 3H2GA 5IJ9A 3DEYX 1VQ5S 3ZDBA 4ASMB 2EP8A 1SH7A 1Q3KA 1JXNA 5JS6A 3N0TA 5FBHA 5ED4A 1O3RA 2AYXA 5AFSA 2I07B 1FDIA 3DR5A 4MOWA 3QGIA 1EB9A 4TMXA 3GG0A 1PAEX 2O1QA 1DEXA 2J07A 3CUKA 3JQGA 3PACA 2WILA 1Z0KA 2D00A 2E5FA 3C7TA 3MWJA 1RJDA 4U7GA 5FPLA 2VYND 2GHWA 3QEBZ 3GDBA 1T13A 3KQ4B 1PGW2 4CKWA 4MKBA 1ZETA 3JYNA 1ODJA 2DURA 1I5RA 2WM9B 3ZZ1A 4OYHA 2QQ5A 1MB3A 4Y9RA 3MPBA 3ESXA 4YPFA 2SCUB 1W44A 4WGGA 2QJTA 4I1UA 4Y7CA 4IXTA 2HHHJ 4ZAGA 4I50F 3LGRA 4ASUA 2HNYB 2A9VA 4JJ7A 2FHMA 1I2BA 1M6HA 3LDFA 2GNTA 5KAMA 1DDOA 1W03A 2DR3A 5IT9U 3O91A 2A88A 2O4CA 2ZR9A 4F8YA 2G08A 2BYCA 3PR1A 3AR6A 3MLKA 1O6XA 3K58A 2BV3A 1AB5A 1E9VA 3SEPA 3LCPA 1XZLA 1VCIA 4HSJA 3HMKA 3VDBA 5L3SB 4NLUA 3PCXA 1D9FA 3AZOA 2R2SA 4OZ2A 1GIAA 3AHIA 5L51A 3KZXA 4COVA 4F02A 4LF4F 2FR0A 3TJ9A 3HMYA 3BMOA 1HNIA 4RY0A 4EI9A 3CUSA 3SBXA 4RMHA 2KFNA 5EKDA 4IG3B 1ZSNA 4BWYA 1GL9B 1AXKA 1H9PA 4DPOA 4X8OA 2E55A 1RWNA 2AA3A 1LQ9A 4ZVOB 3DH0A 3V4VB 5FJIA 3HCXA 2CFOA 2XNCA 1QYCA 2YZNA 3WQRA 1L7LA 2YYAA 3IDSA 1DKRA 5GAGI 1XNGA 2V1XA 3QFCA 1R4AA 1H8HA 3HJCA 3H1FA 2ZMKA 3HFZB 4JJFA 3QRWA 4JI3F 1NJFA 3H97A 3DJFA 3GT7A 2BZSA 3HDQA 1B1CA 5KT6A 5JAZA 2Q07A 3R5XA 4LSNB 5IFTA 1FF9A 5EHNA 1HEYA 2GVZC 3WVJA 1AN0A 4QX3A 1M73E 2E32A 2WJWA 1RCTE 4QPDA 2FQYA 5I8TA 3AKCA 1HRI2 3RJZA 4YV0A 4PN7A 4B4KA 4WKBA 2HRQA 1QTMA 2DJ5A 5A3OA 2R5WA 2FETA 1ZINA 2R8RA 2FMFA 3JBG2 3FFTA 5AKZA 4YUYA 4LE0A 2PGAA 3Q1LA 2O5CA 5B64A 3DLKA 3I3BA 5D3GA 1JDJA 2P7HA 4JYBA 4WZBA 4WTYA 1N54B 2D3O1 4Q1RA 1ZA1A 2QRZA 3T1VA 4JWKA 4D46A 1C1HA 1Y1PA 3EDYA 3WKCA 3T4UA 1XDBA 2RGBA 5JPDA 1L7MA 1ENPA 3ZIAA 3HKCA 2JFHA 4Q4AA 3BSSA 1UJCA 2G9VA 4ZJPA 1V00A 1O77A 3T1HJ 4B81A 4XARA 3I5UA 2QV6A 3GPAA 2GDJA 2D97A 4D9MA 4NARA 2W46A 1UXXX 1OYOA 2W6JD 4I3FA 2O2YA 4ASKA 4Q5IA 3K8VA 4N6GA 4EEZA 1SACA 2FW7A 2H51A 4WKYA 1Q7TA 2OHOA 2MMGA 2NG1A 1I13A 4X44A 4YXWD 4DNXA 4B3OA 1UZDA 1OOPB 4K9SA 1OTXA 4E5VA 3HCAA 5EC8A 3ENKA 4MMXB 2XECA 3SY8A 5CB4B 3RHFA 4PZYA 3OLCX 2LIVA 3DMYA 2K7FA 4DR2B 4D9EA 3Q8PB 2WBMA 1OMSA 5L7WA 4QHOA 5B55A 2IC5A 3EAGA 1RI2A 1SU6A 3I1JA 5AM0A 4DXAA 1AYM2 2GO1A 4PWWA 3C45A 1X33A 2NUPA 3KSMA 3MFHA 3CCFA 1C5KA 1JSXA 2J7MA 2ZBRA 2PZ8A 5EWJA 2ZYSA 5SY9A 1Y8QA 1I3MA 1BUXA 2X9VA 4XXAA 4JI5F 3CJTA 1B41A 3MEGA 1XE8A 1MV5A 3VUFA 1IM8A 2X05A 3H5XA 2GSDA 3HFJA 4KLZA 3PR5B 1WB9A 4P73A 4QM7A 1E18A 1QRRA 1RXUA 1ZZBA 2L9LA 3POGA 5CB6A 2FH5B 1S0VA 2Q4TA 4OOEA 1SQFA 1XKQA 4LBHA 2Y77A 4IXWA 5J2TF 4KQKA 4FYIA 1PFKA 5E6SA 1VB4A 2J3LA 5AICA 1JXEA 2D3TA 2YWEA 5A7GA 3LG2A 4FT8A 3ZNJ1 4JK3A 1AKQA 4AG4A 3BL5A 2ACWA 2ZULA 5K05A 4ZI7A 4KMSA 1XDDA 1LNSA 2GI4A 3OT1A 3WWZA 5A3TA 2J0EA 3B6EA 5AUOB 3QVGA 2FY8A 2A8YA 5DTMA 2WIIB 4EJ2A 4PAOA 3HFRA 4WF9Q 2FUG1 3DV0A 1JKJA 1NE6A 1Q4RA 2N3LA 3LBIA 3GIDA 4PI0A 1CE8A 3JAKB 2O8FA 4W8HA 4AFNA 2BDUA 3RADC 2FN7A 3BB6A 1MORA 2BV4A 1R43A 1SCJB 4GLOA 2F8TA 4QQNA 2BBWA 1W8WA 1ZZ6A 3DYPA 2YC0A 1QHDA 2MKJA 2AFIA 4PANA 4EVIA 5BR8B 1WHTA 1VRH3 2CWKA 1MVEA 1CB7A 4MZUA 2A4MA 3HWWA 5AXKA 3ME5A 3WC2A 1E92A 3CW2A 1VIYA 1U6IA 1OXVA 3ZXXA 4Z37A 1Q8KA 4WZQA 2PYTA 2KB0A 3LYUA 3LOBA 3B3AA 1UJMA 1YBTA 3WDKA 4HO1X 4LR8A 1YFLA 2OB2A 2W90A 4UT4A 1US3A 2IUEA 4MVJA 5KVAA 1WTCA 2PDAA 4XUEA 3M4JA 4NCKA 1JKFA 1MSWD 3WP0A 2VXOA 2CLIB 1GEHA 3N07A 3ROKA 3QWAA 5SYMA 3AQ4A 2Q99A 1QHFA 3RC3A 3EG5A 3UGFA 4A8SA 3ILVA 3HFVA 2NYAA 3W78A 3FRYA 4OX9F 2ZJYA 4EFNA 2OM6A 5C81A 2A6MA 5CNIA 2PHXA 1E5TA 2R8JA 4BNTA 1BDIA 4C8ZA 1QO0A 1CULA 1T8WA 4BL5A 2GALA 4TM7A 1NVBA 2ETEA 4FFNA 1YS2X 1AR73 1TL5A 3G8QA 2PPVA 1HA3A 1OFVA 1N36J 1G20E 4D3GA 3T9DA 1EX9A 1FTNA 4FKYA 1JEAA 2GMJA 3HB7A 1X1DA 1RPZA 1AR91 3OP1A 2ZKIA 2Y8WA 2NYVA 3D28A 4PWDB 1UBFA 3N01A 2NP0A 1HQUA 1SZDA 4BX0A 2L17A 3Q22A 2OZPA 5GY7A 3CB2A 5D7BA 3BTYA 4MTPA 1UVNA 3GJZA 2WC1A 2MCFA 1FXRA 2P9HA 4Z9YA 2B7LA 3MIGA 1PO11 1LW2A 2JBAB 5KG0A 4X1KB 3HY6A 1KVSA 1FVOA 4J0IA 1UT5A 2RAUA 3QF4A 2VZPA 4FZRA 3O26A 5M2QA 1RLMA 1AO0A 2WJZB 1B26A 3H4MA 5LZ6A 4ASUD 1XL0A 4IR9A 5IT4A 3WQPA 4CLRB 3QWFA 2ZX2A 4NZOA 4K9QA 2G4IA 4QU6A 3Q8QB 3H05A 2QO3A 1XFAA 4NLTA 4ZVSB 2P5BA 3OSDA 4WCVA 2EGHA 2DVIA 5T55A 4M1WA 4O1MA 2Z58B 4RWZA 1RWVB 5TR9A 2VFVA 2EXXA 2WG0A 2XMTA 1U7XA 4QBTA 5EQDA 1TZCA 2BL4A 4F25A 3NC4A 4L15A 1I7QB 2XJUA 5FYDA 3F7NA 3NNDA 4JI6B 2J3HA 4AUMA 1Z37A 1Q1ZA 3H0OA 1NP7A 4S2DA 3QIDA 2MZQA 1V9SA 3GHYA 2W87A 1RLIA 3DYVA 1J5EJ 4UHCA 3NBXX 4BQNA 1VJQA 4R1SA 4L92A 1ACJA 2EDAA 5E5NA 3PJQA 4ES1A 3R1HA 1L3KA 2E1AA 3GONA 3IMNA 2FRDC 1H8HD 3IO3A 1GU1A 2XBO2 1R9NA 5T54A 3WX5A 3EGZA 3PHHA 2XG3A 4AHXA 1NKBA 3MIBA 1SVLA 1X8MA 4DCPB 1T95A 3NGTA 1UMDB 1J97A 3GZNB 1X4CA 3ANMA 3EQZA 3MOSA 3M6IA 1JLAB 2LXFA 1KU0A 1DX6A 4BUCA 4RSUA 2X1VA 3CEWA 4RW9B 1FXWA 2D74B 4K4SA 1O95A 4CEYA 3MF5A 3WZMA 1CU1A 3EZ5A 4UQGA 1LVHA 4I0WA 4QDJA 3ZFGA 3RZKA 2ZVSA 1B4SA 1ZLYA 2EQAA 5GM1A 4K28A 2ZHMA 1ZWKA 3ZCXA 4W9RA 4K6CA 1AR63 3ZIAD 5CKQA 2C83A 1J7JA 2WJGA 2F3SA 3AB7A 1TF7A 1FS6A 2H5LA 4BK4A 3ILRA 4H1HA 3UUFA 3KPVA 3ADPA 1KJZA 4NENB 4XK8C 3S5UA 3L1HA 5LYYA 2QUBA 4GVPA 2ENUA 3JRWA 5DM1A 3GMDA 2JE7A 3UNXA 4AT1B 1YU9A 1S1CA 4WHMA 5I7SA 4EUVA 3G6JB 5ABPA 2D6NA 1R8CA 4KGKA 4WASA 3LGSA 1AG9A 5CM8B 2PSHA 4NQZA 3OL7A 1PWZA 3A4TA 4XH9B 3H1YA 1C1LA 2PBFA 4RSRA 1PJRA 4GVLA 1N0IA 2ZE7A 5C3OA 3GCWP 4IVQA 1ZICA 3KOAA 3UHPA 2UUAJ 5IDYA 2VS1A 4ZEOA 4B8WA 4DZGA 1HWYA 2R2TA 2VMEA 3A4NA 5L95A 5HLFB 5TDHA 3P4YA 3VBUC 2ZJ7A 2B37A 3O8QB 4OJTA 4PGAA 3TCNA 5JWRA 2XSFA 3LOUA 4K0KB 2J6CA 2VNAA 2XOXA 3I9OA 4TXSA 3UXEA 5FZAA 1D1QA 4U6SA 5EZSA 1S2KA 4PNEA 2ZYWX 4USIA 2PVPA 5C4WC 3MSCA 3KZ1E 5FWNA 3BB4A 3UPDA 3I9MA 4XVQA 2AK3A 5LMNJ 1TU0A 1ZNZA 3A12A 5I4CA 4DLGA 1GFIA 5ALZA 4RIGA 4Z7OB 4CZSA 4D26A 2I5JA 4J7UA 2Z1NA 3T7JA 4FBTA 2AOTA 1T5BA 2WO2A 4CF5A 4Q3BA 4QJBA 2Q2QA 3UHOA 1WCQA 1VE3A 2OI2A 2DQSA 4FBGA 3AP5A 1R0XA 4RNOA 3WL4A 5C9AB 3VH3A 2RQKA 1SJ4P 3EK2A 3GEDA 1RYRA 1X7YB 1GZ9A 2QORA 1A34A 4RAOA 3AHGA 3RWBA 2WU4A 3JQMA 1P74A 2IA5A 1ZK1A 3BYZA 1EP1B 2XB4A 4CLZA 4GMP3 5JOZA 2GBLA 2IYGA 2WFAA 1UY1A 5CAZA 2W83A 2B5JA 5CLJA 4GM1A 3R7NB 1S7HA 1NATA 1RWBA 1Q7EA 3MA0A 2PLFA 1SV5B 4D6YA 2H31A 3PHGA 3KXKA 1CJBA 5BSRA 3C15A 4X92A 1J39A 1SJ1A 1RU2A 4O4GA 1OZGA 4RVCA 3PENA 2LA6A 4D9HA 3BSYA 3OU6A 4I6WA 2VXYA 3OQ1A 3B6KA 1UU4A 3MR3A 2JFOA 3MQ4A 3FOZA 4A2PA 1NKSA 3ZEAA 3D3WA 2F65A 5J3JA 4H4KA 2ODWA 3EDRA 4CMAA 2WKQA 4USUA 1U4SA 2KO1A 4YONB 2QGZA 5CYMB 2QP9X 5A32A 2IL1A 1CPMA 4KL1A 2N3OA 1T9DA 3VI3B 3CNQP 4MVJD 3UDEA 3PEFA 2E7VA 3VZBA 1F5JA 1AL21 2W1UA 3OCXA 3E8OA 4DCOB 3W5UA 3LSYA 3PEJA 1HPZB 1E5RA 4LHXA 1FRVA 3UD4P 3OD0A 4G0PA 4QE3A 1CLUA 3SOPA 1YIJS 2VBGA 3GUUA 3WQ1A 5AVOA 5AW6A 1HDGO 3T9BA 2VHVA 1GAQA 3L7KA 4ITVA 4DCJA 4I0BA 2R8EA 3OEHA 3H9UA 2XS7A 4M98A 1QO0D 1ESMA 3X2FA 3Q5EA 1ND2C 3QHPA 3IP8A 3RKSA 4NCJA 1H0BA 3DTVB 3TRKA 1KTVA 3SR0A 1H1LA 4FIZA 4UCWA 4OYZA 5JZSA 1P8AA 4DIUA 3MDPA 2VGDA 2AENA 3EDCA 3BFPA 4ZXKA 1SUSA 3LQ2A 1U0OC 1EUCA 4H3HB 3K6SA 1K1SA 3HB1A 4GT1A 4P4SA 5HRUA 3OOWA 2YKNB 2E53A 1T2XA 1SBRA 3SDEB 5AK6A 5FUXA 1JB1A 4UTGA 3I97A 1PR9A 4EATA 4J1SA 1U3CA 2VBCA 1E3QA 4JGGA 1DQ0A 4EDFA 5E0OA 1K7XB 1CWUA 4JI7B 1NONA 3SIPB 3SV3A 3LPMA 2DY0A 2PHWA 3G71S 1N33J 1Z12A 1QQTA 3CJRA 3D66A 4TLQA 1MEJA 3KOOA 4H0FA 3KR1A 4Y0AA 4CEHB 4Y26A 4A8JC 2WQ7A 2RUSA 5LCWL 1IBLJ 2V2ZA 4WKRA 4J91A 2ZOFA 1A6LA 2YXBA 2E33A 1YL5A 1XXHA 1LX6A 3MFAA 3AW9A 4HGNA 1VJGA 4FP3A 3MZHA 4IQ4A 3HXLA 4IEXA 4M6WA 3ZTPA 2FJPA 2L9NA 4DQRA 4EGSA 3UN3A 4CP9B 4KREA 4G24A 3FJYA 1P0CA 2VKTA 2P41A 1JVBA 4BU0A 5ULLA 1M6VB 2HW8A 4CMIB 3H9AA 4LF7F 1A78A 2EEYA 5ICEA 2C7VA 4QEDA 4M49A 1J90A 4KK3A 4ZI7F 2WQ6A 3MSXA 4C2AA 1RACA 4OX7A 2H92A 2VRNA 3NATA 2XUQA 5HROA 3GFFA 1KEPA 3MOJB 4G5GA 1WOSA 3O8BA 2A3WA 4I08A 5ISMA 4H77A 1L4NA 3GPDG 5JZBA 3B6IA 4IRMA 4ED1A 1BDHA 3UCXA 5FA5A 3MJTA 3E5XA 4WYLA 3PGXA 4GVXA 5CDGA 3C1TA 4PQEA 3KLPX 1NZJA 2BFNA 2IQ5A 2OWDA 3F47A 3AX4A 4CM6A 1RMU1 1IYZA 3OAAA 1N0WA 3WLUA 4W5JA 5EP2A 5FUIA 1VBXA 4QBGB 3QKRB 4MHTA 4E6PA 4LBWA 1BCRA 3GUZA 1E98A 3GMGA 3NM5A 1B09A 2A73B 1JVNA 2QVZX 5BWBA 5EXSA 1TC2A 2W11A 3L3CA 1KZ7B 1NG0A 5EHHA 1J2TA 4RIHA 3NOOA 2G1DA 1QH9A 1YJTA 3HJGA 3KSCA 1N9GB 3TH5A 3V42A 3RREA 3ZV4A 3EX7B 1UXIA 5BP7A 2B9UA 4AJPA 1O95D 2VG7A 5HANA 2WYIA 2QMYA 4IV3A 4TWTA 3IJ5A 2CCKA 3OQNA 4NJEA 4NH0A 3E9RA 3M9OB 4MVJF 2YBSA 3VMFA 1P5ZB 4A41A 2X8JB 5H3HA 2N4CA 1NSTA 4FXKB 1PGOA 3I58A 3NPMA 4CLEA 1RUJ3 4UF4A 4QOIA 3B51X 4MQFB 4I4BA 1WMAA 1MQTA 3VAYA 3VNSA 1SUDA 3M2RA 2XH6A 2C4WA 5DNVA 4RD1A 2XNHA 2HA7A 1ZVKA 5JSKA 1XLVA 5GLVA 3PO5A 3ZYZA 2WNUA 4B4PA 1PYTA 1DLIA 3FDIA 1IBKJ 4OULA 2K7ZA 2QF7A 4RJVA 3D4KA 5B4XA 3LFMA 1ORIA 1OAOC 2GP3A 4Q19A 1SCAA 3CCJS 4R1TA 4XFKA 4Y30A 5CVVA 3S99A 5M0TA 3ZGYA 2DNZA 4OI4A 3EPIA 3O90A 3SCZA 1LY1A 1AXRA 2GCOB 3CBGA 5C7YA 1PDVA 4HGOA 3N58A 1A9QA 3AL2A 3DXXA 1L0BA 1F3FA 3VOTA 1KP6A 4DSAA 3D0GE 4JI4F 1OC2A 1ZJJA 4MUYA 2CXOA 3VYSB 3HBFA 1VKJA 1I3CA 3IR5A 4BZZA 1XP5A 2VG8A 4BGUA 4ME6A 2RQ4A 5HRCA 1YLLA 1ZM3A 1IZ3A 4PNHA 2RE9A 3KOMA 3RAJA 4TWZA 1OMIA 5GLWA 1OHHA 4QW9A 3HUDA 2P3SA 3THYA 3BSNA 1W0NA 1C9YA 3MAQA 1CUBA 3R6LA 1FKOA 1TOAA 2J32A 5JWPA 2ZBVA 1IUOA 2D3SA 3PXEA 3CVJA 2P8JA 2ZAYA 4YM2A 1SG6A 1OYEA 3IIEA 4O6VA 4M4PA 5LBCA 5C5UA 2V73A 1HF3A 4F8EA 1TL1A 2OV1A 5I9TA 4CH0S 3ESAA 2AU0A 4XXHA 1O6UA 5IULC 5KG4A 1VG8A 1JDBC 4L8YA 3DLTA 6ABPA 3MJCA 2K4MA 1RJGA 3O75A 2HWHA 1QJX3 4AZWA 3LMKA 4DV2B 4XHXA 1JQ3A 1GGKA 1LSSA 3NZEA 5LOVF 4WTOA 1DNPA 5A3QA 3BIEA 4KQEA 1NSFA 5E1DA 1RWOA 4JL8A 4MDYA 4H17A 4YJ2B 4YR0A 2BC9A 1UEIA 3IIJA 3ADBA 1TKTB 4WDQA 3OX4A 3WHIA 2A9QA 1XNJA 3W06A 1AUOA 4QFBA 2P1RA 3C16A 1HW5A 3QLHA 1UK9A 4S1PA 4BVKA 2ZFHA 2BNMA 2I4MA 1JG7A 3R7LA 4HNGA 3N8IA 3NFRA 4YEAA 1KQFB 3MMBA 1AZDA 5A4DA 2B78A 5A4FS 4EHNA 2QJWA 1IJKA 2D0IA 2QSUA 5EHXA 1VLHA 3TAMB 4FWTA 1NUSA 1QAIA 2CJXA 3O12A 3TAPA 3UTCA 3ECAA 4DDMA 4C11B 3NDJA 5DGAA 4JP2A 1NDPA 1C1FA 4RHV1 1BQ3A 4ENVA 5LMCA 3D1HA 3C8DA 4RJ2A 3KWFA 2WQ4A 4HADA 2OPQB 2EZTA 1F9FA 1M2GA 5ALLA 4UTXA 3OR1B 4QU1A 3E22A 4CL3A 3ASVA 3W1YC 1KY3A 2P6NA 4B73A 2IS2A 5G0WA 5HPOA 1U7HA 3REQA 1J21A 1T0HB 4EYUA 4Y34A 2I4OA 1NCQA 4HN9A 2VOXA 1YRQA 3POTA 5AVZA 1Y9EA 4GH4B 2R071 2J9RA 2W6NA 5JDCA 1KBZA 4P4NA 1S79A 3ZW9A 4BQIA 1XEXA 4B5KA 1Q2UA 2BFOA 1PVOA 2QAGC 4NFYA 3E3NA 3NS7A 2IBTA 4G1MB 2QOEA 4HXCA 2POKA 1UVLA 1EWQA 3OEHD 1NHVA 4DTIA 3VVUA 5FTWA 4LUCA 3ZW7A 4KW7A 1KI4A 2OOKA 3ZQ4A 3N75A 2P67A 2J3JA 3V0BB 1SQEA 1HB4A 1GNSA 4B7KA 4RPGA 4RZ3A 1KYTA 1V5GA 2ZH7A 2R96A 4G0YA 1KO8A 4Q7KA 5T7LB 1SULA 5APAA 1CBKA 1UOFA 2QTBA 3RH0A 1M5RA 3EZFA 2A6VA 1WF0A 4XB1A 1JZ3A 1GGJA 4AKEA 3DEMA 2VNSA 4UMEA 1O8SA 2P77A 2UZ0A 5CDFA 1ZS9A 5ESRA 1LU2A 4UBKA 2BZGA 4D79A 5K20B 2J45A 2NT3A 3NHYA 3SXUA 4YJ3A 3AMMA 3IPVB 1DDIA 2OXEA 1NUPA 2JCXA 2XG8A 1K7SN 3R1IA 3PTAA 2C98A 1BKZA 5IWAF 4FYPA 3TAUA 2VH1A 1VGRA 3D6HA 1KNXA 1Q43A 1Y5NB 1SHZA 1KHTA 1EUZA 1HNXJ 2FSGA 2Q4RA 1NK6A 1BBT3 4YY3B 2D2FA 4KIWA 5THQA 1JIVA 3AUSA 4AI6A 3R7BB 1VJ2A 4BNDB 1CUWA 4CFSA 1BKDR 5JXSA 2J5AA 2N4DA 2C07A 2GFHA 1IB0A 4WA8A 3DVRX 2IH5A 3JQ6A 1RYBA 2WNEA 2X29A 3GK3A 4PO1A 1P1HA 3CLHA 2QQFA 2H9ZA 3UKNA 1YBFA 4L5IA 1BH6A 1XHLA 2W6PA 2EEPA 1Z68A 3JQ8B 1U8YA 4P4LA 1WC6A 4Y00A 1LWEB 4GX1A 2POCA 2WBLC 3Q8FA 4UCFA 2HQRA 1P29A 4G41A 1QWRA 3LHKA 3C7AA 4UFHA 2MIIA 5K6AA 4IDKA 1IQRA 4DR6B 2NP6A 2UYCA 2C1XA 4UUPA 1RYSA 1J9EA 1B00A 3HO8A 4YGBA 4OHXA 2IXEA 3IUJA 2OQ7A 3KXDA 4Q7AA 2HWE1 1S0OA 3DOLB 3OAAD 1VOMA 2EF1A 1S9EA 1Z7S2 1CAWA 2F62A 2XKAA 2F90A 1VC5A 1HR0B 1DLOA 1N56A 1L5MA 1AYN3 1EP3B 3O0XA 4RC9A 3OZFA 1J9GA 3J7HA 2QL5A 1HBUB 3D8TA 4BWGA 4LHVA 4FJ2A 3WC4A 1R8JA 5B6JA 3DC7A 3TBFA 5HPYB 1HRKA 3BEGB 4OD0A 3Q8WA 2QX6A 4O4JA 3K4QA 3SXJA 2JFQA 2IUYA 2IFTA 4J0KA 1BAPA 3K4PA 1SJRA 1V7QA 1B73A 4WZZA 3MJ4A 1EEXB 1QEXA 1X7NA 1WHSB 2IRWA 3QFTA 1YRLA 1EY2A 3OJBA 3VZPA 4JKMA 4YHHF 4YCAA 1K42A 3QVUA 4INPA 3C6ZA 3AEZA 5D2CA 1YZ3A 3TX0A 1EVJA 3U3XA 4R2MA 3D3BJ 2KH9A 2WTFA 2WFLB 4FWBA 3A3PA 4I68A 1QIFA 1NBHA 3FR8A 1I2ZA 2HC9A 5LY1A 4D4IA 2HK3A 3LC0A 3ATGA 3RRKA 2QV0A 5JSQA 2B30A 1GZ6A 3E9EA 3KDOA 4O63O 4QLAA 4WE3A 3TLAA 2G5TA 2YQ5A 4W6ZA 1SMKA 2CFSA 1EUYA 3T2PA 1YQTA 4W5OA 3IUSA 5IFLA 3SHVA 2V5HG 4BFZA 5NULA 3CGWA 4D0SA 3ND8A 2EERA 5TQ0B 6ADHA 1CF2O 5B1SA 1TLLA 2I87A 2QLMA 3BIWA 5HQ3A 4B6FA 1YQ5A 3U27A 1HT2E 2FDNA 4KIJA 1R9MA 2H17A 5IHPA 1LUAA 5JNSA 2F40A 5H3CA 2QG9B 3DA8A 4YECA 6YASA 3UFCX 2A6OA 4GBJA 1IQZA 4AI3A 3T3NA 2Z5WA 3ZGZA 1GAWA 1UWVA 2P6MA 4MGIE 3D5EA 1U1KA 4BMPB 1RBZA 1QHHB 1NZAA 4DE5A 1YDEA 3PR4A 4DM3A 3RSCA 4F45A 3PIPQ 1WPRA 3MAHA 1OXCA 4P9YA 1CR4A 3QTLA 4RW4B 1Y00A 1USGA 3LZDA 4AZTA 2CQGA 4ZT3A 1S55A 1MFZA 1KAHA 2HRCA 4MSUA 3GRRA 4GUAA 4OBBA 3DGVA 2LNDA 4AJ9A 2IC3B 5KC5A 1DRJA 4EA6A 4WFKA 4X0EA 3JQ7B 2Z57B 3IA2A 2FCUA 4FWIB 3UYLA 1ODKA 1ATIA 4ESVA 5LMUJ 1D2GA 2DCUB 4Y2AA 3PQ4A 2CNBA 3MINA 1TIBA 1TKBA 4CDXC 3TNLA 1RT7B 3A9VA 1QX4A 4TN2A 3DE2X 1TL7A 3P9ZA 2WMOB 1ZUIA 2KX7A 4HD8A 3MM5A 3C6TB 4TYPA 4UW3A 4L28A 4IEUA 2OD2A 4NU5A 1KTQA 3OTCA 3GBVA 3LIPA 4G0MA 1BEUB 3T0GA 3N3AC 3NP9A 4JC8A 3EISA 3GNEA 2BKNA 3CXRA 1DC4A 4LSZA 2VXCA 3A1YG 3WV6A 1MMNA 1N3QA 4B8ZA 4KQMA 3GOQA 4AZSA 4HL6A 4EBEA 2ZPXA 1URXA 1YOBA 2V3CC 1YVFA 4RA9A 3DF7A 3P52A 4WFQA 1NNDA 3PGA1 1GA4A 2DY9A 2NVBA 4KE5A 4OK6A 4NYIR 3E15A 2NU8B 5KFOA 3WB0A 1E3WA 2EKQA 1N5RA 2WVHA 3DULA 1U3GA 4LR4A 2CJ9A 1NSQA 3F6SA 3S8SA 1OIXA 1YBVA 2RDJA 3CBQA 4M0CA 4EZBA 3TI7A 3GUVA 3WIDA 1VC2A 3OGJA 3R3WA 2VMIA 2YIVX 2C88A 4XIKA 2AW0A 3HGMA 3PCOB 3BDAA 4N40A 4BJ0A 4DV1J 4WUTA 4UOQA 2VY0A 1JZ6A 3W60A 1RPTA 4DR5B 1JWLA 2P9CA 1YWXA 4BXFA 5CURA 1CR7A 1MN6A 2A9RA 3CNQS 1ZRSA 2Y1DA 1VJ1A 3W2TA 1PSWA 3F2IA 3HU1A 1E3TA 4YRAA 5BQPA 4QQRA 1GUYA 3QJ5A 2EKBA 4YB8A 3OIYA 4AQDA 1V8FA 4S1TA 1FYUA 4E2FB 4Q37A 3SK0A 1YZVA 5EHQA 4RW7A 3DHNA 3ETHA 4UXIA 3IHTA 2RH4A 5DLQC 1DXQA 4WBXC 2V4RA 1D0SA 1DYOA 2PUFA 4KLNA 1Y1QA 1JQDA 4CDQA 2ALYB 1S2LA 2YMZA 4WVFA 2HTFA 3OTOF 4L02A 4GYJA 4R2WA 3GLGE 2ILZA 4FFWA 3ES1A 2G1AA 3ZWWA 4DMZA 5DHFA 1J3QA 1E4EA 1QVWA 2P3IA 1J0AA 2JRLA 3SICE 4RY8A 3MM6B 2QMOA 4DV7J 2VJBA 4QQBA 2MQQA 1MJGA 2XBMA 2GSYA 1L7OA 5T5OA 4OMCA 2QLJA 1N4DA 2GPTA 1AX0A 2FFRA 2VNOA 2FW0A 1IK4A 1L3JA 1JZSA 3G8BA 3LQCA 2AN4A 2ZJ0A 4JGZA 2A0WA 5JSRA 3HCRA 4WIAA 2I45A 4DWJA 3SYKA 1EPWA 4B3RJ 3KZMA 4EW6A 2JEFA 3TW6A 4V2UA 2YFZA 3ESYA 4HNAA 4HUQB 2G9OA 3K9HA 2C42A 1F5SA 5CM9C 2WA2A 1PNRA 2QA4G 1GKUB 3HO6A 1KVKA 4DILA 3U6KA 1GH8A 2RMU1 4M0HA 4XVRA 5ERXA 1UFKA 1NR1A 1LB2A 2EIXA 3GPBA 3SJ7A 2BWJA 1F4VA 2GFIA 3VAFA 5BOSB 4YDRA 5EYXA 5ENZA 1JHQA 4JRLA 4LZAA 1KP2A 3A8IA 1X4DA 4MKZA 1RUNA 3PK0A 3KWMA 2ZZTA 1KSPA 2WF6A 1P17A 3U26A 4QRHA 4B46A 1TW2A 1C9DB 2MQOA 4CKXA 1HSZA 5CH5A 1OD3A 5LBIA 5L36A 1OKKA 3HB5X 4FYVA 5JCOA 5KTRA 2E44A 2C28A 5FQNA 2GOYA 3BQNB 3SBMA 4W1PA 5AKYA 1APBA 4E4SA 4WXHA 1NE4A 3BF7A 1KS9A 4OQLA 2JLYA 3U7HB 3C98A 2GS8A 4G5QA 3SH4A 3MECB 1F5FA 1Z2LA 1J42A 3TE7A 5AC93 1Z7GA 3LY5A 2CQPA 4BJHB 3M8YA 3A04A 1RT1A 1IS5A 5KYWB 1T1EA 3KKMA 5DHPA 1KDKA 3PU3A 4KT0C 1YJ8A 3K8QA 1IQPA 5C2CA 4W8GA 4J0HA 3PIDA 5HBAA 3BJZA 3OC6A 4BNWA 2ZDPA 2H85A 2NUUG 4H31A 2EK6A 1CT9A 3GZEA 2WINI 4R05A 2XCLA 3PA6A 3KU4A 4UMFA 1I51A 4E5DA 1D1SA 3OHSX 4MK4A 1C8M1 5JSHA 1M54A 1ZAYA 1SU8A 4RPIA 4IQ0A 4CCJA 1XZMA 5K99A 4MMZB 2XQIA 1AX1A 2GM4A 1SFNA 2E1RA 3V97A 1REDA 5DW0A 4OZ0A 2RF2A 2XUDA 4M37A 3N0RA 2HK6A 1T6BX 2GJFA 3UGKA 2GC0A 4S2FA 4YJ3F 3ZNNA 1NVGA 2FE4A 3JYTA 1VBB2 2ZRDA 2HK9A 3DU5A 1YIDA 4B9MA 3UUGA 4AS1A 5GZ6A 2ZANA 1ATZA 5DM0A 3EQ9A 4YCBA 1GQRA 3F8TA 4O29A 3IESA 1PILA 1J09A 5BWNA 4HT3B 1L5LA 2JDKA 1DFDA 2XLBA 3TW8A 4L4SA 2EZ8A 4Q24A 4ZCIA 4EP1A 2Q5OA 3LUFA 1FYEA 5HJEA 2BBAA 1W6PB 5C46F 3M1AA 3SCLE 1TVKA 3WNZA 3K5HA 1JE0A 1B0PA 4XJAA 2YH0A 5ALGA 3OXLA 3QA3E 4XQWA 1GZSA 4GH5A 3ITHA 4OFBA 1TK2A 1S9GA 4LVOA 4ZO4A 1OFUX 3JQFC 4ZLLA 4KRWA 4S0XA 2K2WA 1DQ1A 3RE1A 4BISA 3OZIA 3ZBTA 1SQ5A 2E4VA 3EQ6A 3AVYA 1NLRA 4P98A 5H4HA 1NU4A 4OUSA 4ZRMA 4MWCA 3W5SA 4BVEA 2R063 3FJSA 3ZBPA 3PLQA 1TL4A 1GSHA 1XQ6A 4CCOA 4XUCA 2DR8A 1O3SA 3QKIA 4OKSA 3OJLA 2C78A 4U2AA 5D21A 4QGGA 4LSGA 4ZMMA 2GF0A 1KZ6A 4BLTA 2BIFA 3QLTA 3K2OA 1DURA 2JCVA 2VULA 4C21A 4YZ4A 4B79A 2J46A 1ZU5A 4OQ4A 1N0HA 4OK5A 5C32A 2Q5CA 2IYLD 3KEMA 1UEUA 4BIOA 1UOJA 2BQPA 3R1LA 4J5OA 4F84A 4IE4A 1F60A 4IIEA 4O4JF 1KO4A 1Y9DA 5H9FK 5HQTA 1KWKA 5D86A 4RA6B 2HWWA 2VPIA 2IOFK 2HZCA 4BVJA 3MZ0A 2K8GA 2OY0A 1B43A 1H2FA 2OZLB 1URNA 1I94J 4NASA 3LT0A 4MXWB 2HSWA 4J9KA 1MLDA 1XAJA 4BWJA 2E9TA 4XSGA 5AVSA 1UJBA 4G1EB 3BBBA 1J3RA 3FPJA 4OL8A 4NPOA 4JJIA 5AM2A 3BMXA 4LF6B 4KR0B 2KFZA 4J9QA 3BX1A 4CEJA 4JVAA 1AZSA 4MUGA 1QU3A 4C89A 4OQDA 3TF5A 5LA6F 5A6WA 4FHEA 4QBHA 4AKHA 1E6YB 1Y3JA 4Y2MA 4E4DX 2EKNA 1NPYA 4KNYA 2F9LA 4USHA 4F67A 3KYIB 2I0FA 1XWLA 1YRTA 1FNNA 3VR6A 3PLAE 3MBOA 2F1HA 3PKIA 2WVBA 1DKMA 3IO5A 2OMLA 3O14A 1NW5A 2QN2A 1R6DA 2QY6A 3CIFA 2ZGLA 1RXYA 5E16A 4X45A 4B6PA 1PBTA 1L8LA 2BFCA 4PIXA 5I9MA 3POFA 1TE2A 1JMTA 4TSRA 4HUJA 3MR6A 1S2IA 3P2MA 5FMOL 1GGMA 1MOPA 1PGJA 2ZVDA 1J5OB 2ZCJA 3ICQB 3BDEA 2Y0IA 5ABJA 2NREA 4C07A 4P9NA 3MEQA 5AP9A 3GJTA 5LB6A 1ZXBA 1TV6B 1U0RA 3F6PA 2D1TA 3DEKA 3BKWA 1XERA 2UYBA 4YJFB 5AJ3F 2XNKA 1YWGO 4II2A 3N5KA 1H2HA 4GUDA 1NQJA 4NRUA 3QT7A 2M9KA 1CP3A 4H15A 2ZP1A 4DUYB 2HSDA 2QTWB 1ULUA 3HK2A 4JLAA 2OBLA 4JNCA 5K0ZA 3BH7B 1W6RA 3TQRA 1QKIA 4N8DA 4PGHA 1ZXXA 5EWFA 4U4AA 3LKJA 5D6OA 4LXGA 1WLCA 1GLVA 3EXFB 2PI4A 1NA1B 1GUDA 1UBEA 2VJDA 2VWHA 1K8QA 1QRTA 2GKSA 3RNOA 3LEGA 2X2FA 5EIHA 3RU0A 5T6MA 5H9PA 4KGQA 2UVQA 3W2GA 1XQYA 3RK0A 1ZITA 4KMQA 4KPUA 1BGWA 1E7WA 2X1HA 5DGXA 1NJSA 3RDIA 4W90B 3MWLA 2OT3B 5TSDA 5D4OA 4M7RA 2ZIXA 3TB0A 3HA2A 1LQUA 1UKZA 3H65A 4A7KA 4PAMA 1X8DA 3BM5A 2OBNA 4ZO7A 1KQ3A 3TQFA 2I6QA 4Q01A 3D6MB 2AX4A 1S7CA 1ID1A 2XZLA 1JBQA 1AB8A 5F4ZA 3DVLA 2QTZA 4HG6B 1NVXQ 4GWJA 1RAJA 2O1XA 4UPEA 1W85B 4M9RA 4KRGA 4DL4A 5JHHB 4UQOA 1TLFA 1SL0A 4TMTA 3DGTA 3IDEA 2PA3A 4XWYA 2WJ3A 3MAJA 3QNUA 3WSOA 3CURA 1OKKD 3V32A 1DZIA 3G82C 3MRSA 5K0UC 5J4YA 1VECA 2D1QA 4JV2A 4X4RA 5B0GA 3ZVNA 1VIMA 4PZPA 3GN1A 3RVRA 4AD8A 2H4FA 2AXEA 1GU0A 4D3YA 3RU2A 1VKNA 4L78A 1RXGA 2XTNA 2BY4A 4UBOA 2D13A 2XXBA 2BFFA 1M83A 4L8QA 4MG2A 3EYWA 3AT1B 2BBEA 3CDAA 3A8JA 5BSHA 4XPVA 3RARA 2OKGA 5I7UA 2Q1FA 2HSGA 3SBOA 1RTDA 3THTA 4AVBA 3GA5A 1W34A 2XNRA 1A9OA 4YAWA 3P0HA 5DGCA 3PRVA 3W9IA 1WMEA 3QCWA 1TFUA 2GK3A 4RU9A 3NTUA 4COUA 2Q50A 4PVDA 2H4YB 1NI4B 4WCEQ 4BQ5A 2LD4A 4O0IA 3ET6B 1FTWA 1GYRA 3G2JA 3B01A 3ANTA 3ED5A 1P60A 2FMXA 3JQAD 4P92A 4FKXA 2BMWA 2JFVA 3PDIB 1DCMA 2HA0A 2IYNA 1S0UA 2R7OA 5HVHA 1LLQA 3ITKA 4ENQA 4DHWA 4IL5A 3DHEA 1IOLA 4I5EA 3FMBA 3RVSA 3AUFA 1U6JA 3KVOA 3PDWA 1A4RA 2EXJA 4AFFA 1LEHA 1L3BA 1Y0BA 4ZJUA 3JU9A 4ID5A 5FUYA 2LCFA 4B0OA 3MCTA 2ZUVA 5ER9A 4EUKA 1U0SY 2Z2SB 1SG0A 5D78A 5HFNA 3QFRA 1UODA 1FP4A 1Y43B 1DMSA 3F2VA 3HHDA 2RRBA 4RJKA 5L4SA 2IJNA 3WBKA 1MEC3 3AF2A 3B8EA 3NO4A 1BJKA 4J7CA 3V1YA 4UOFA 1UOPA 4OUKX 1NDUA 1UMHA 3AZYA 4NU6A 4ITSA 3D0IE 5FZ4A 5DNEA 4GOXA 3EXHB 5CAAA 4NA2A 2YFHA 5FYSA 4LOHA 1ZEMA 2VPYA 2BR3A 2W2KB 1E20A 4TWIA 3T54A 1EDZA 2IDKA 3NEAA 4AQYB 5CVCA 3EVFA 3G6ES 4U7JA 3KD3A 5IQ6A 4H0CA 3OGSA 5H7XA 1EKXA 3N2EA 2DWQA 2HPUA 1WC1A 3PHIA 4IIXA 3H5IA 1ECCA 1E2IA 1NW6A 5ITWA 3KPYA 3OIGA 1CK4A 4GI5A 1HD1A 4KE8A 2EJTA 5ADWA 1VBE1 4LVUA 5A7QA 1T5IA 3TN92 721PA 2YUTA 1W9HA 5TX7A 3PX6A 3Q72A 2P35A 1US8B 3KEFA 3ZHBA 1TL3A 3KG2A 1ULEA 5KXDA 2J3KA 3D6JA 3VZMA 1WA5A 3H04A 4Y18A 4K6FA 1F1JA 4D3FA 4U2FA 2GQQA 4OJKA 4PRZA 1OF4A 1EB8A 4IRCA 1OPXA 3ZZ0A 3L6CA 4IDQA 3CR3C 1U8XX 1XU9A 1N9KA 5B58T 1UWAA 4Y2RA 4IEYA 5CVDA 1TTQB 1SH0A 4NVPA 5EEHA 4RS3A 1XSQA 3U1BA 4ZVNA 2MKCA 1RAEA 3MTDA 3ZXEA 3QU2A 3NS5A 5JNLA 1VPTA 5DQGA 4M3NA 1Z26A 3NFYA 5T52A 4QW8A 1XQ9A 2ZRNA 1OA0A 2FEKA 3I9KA 4HAXA 2XMJA 1Z6XA 3ZWVA 1KPGA 3WYAA 3KJFA 2PT5A 4WW0A 4EB0A 3CUTA 4BMEA 4CQJA 1E77A 2VT7A 2BJVA 3IDZA 2JFBA 1DRZA 2Y0BA 1BWEA 2VC9A 5DHAA 5HKOA 3O7OA 1RHQB 2XA9A 4EUHA 5FPKA 3EXAA 3K35A 3NGMA 4KBYA 3MTEA 3SNHA 1SUFA 1FP6A 3G6YA 3IAEA 2B8EA 1U81A 1N57A 4AVCA 1TJ5A 2LE0A 5FUPA 1WCIA 3CRNA 5IABA 5D1NA 3HUFA 1ZS6A 3K1ZA 4EUFA 1GUIA 2L42A 1AXYA 3MICA 1K9VF 2QQMA 4B4VA 1MQAA 2H8KA 5HS6A 3WZ2A 3RFRA 1FX5A 1POV3 3PVZA 1VIDA 4A92A 5F9TA 3VR6D 1M9NA 3LGAA 2J4DA 2AMLA 3I92A 2VCHA 1W0OA 2HPHA 3STWA 5I48A 1VISA 2KDOA 3W9SA 3OB8A 2FKAA 1E1KA 3ZEIA 4MB2A 3UNYA 1UZHA 1FI2A 2X76A 3QOPA 3BIXA 3RRGA 4ZJYA 2QA4S 1U80A 1ULDA 1VMDA 1X8LA 4TS3A 3G7SA 1V6IA 3MRTA 2AQKA 3NIDB 4LJ4A 2XQGA 4MV0A 1CLEA 1H3NA 1JMVA 1OYDA 2O8OA 3TO8A 16PKA 3H25A 1J9ZA 4M88A 3CC7S 3FDFA 3GCZA 3X1XA 1WOYA 5AVPA 3NO8A 1XN1A 4YV2A 1RA6A 4U7TB 1KQKA 4M9ZA 3J8F3 4NXMB 1U1PA 5C8CA 2GSWA 4KWTA 2EKPA 4UBLA 3N9MA 4UU8A 2PGCA 1HJFA 2QXUA 4HMPA 4YPVA 2LXUA 2JEMA 1A7GE 4GPAA 3GGOA 3L3BA 2NU6B 2YWJA 1O8CA 3ELNA 2I54A 4LR9A 1OI3A 4UU1A 3U3DA 5K0TA 5T3UA 3QXSA 4PM4A 5F0WA 3EA0A 3HNOA 3U9TA 3MOIA 2OG1A 3BK7A 2PPLA 4ETWA 5CCMA 4I4TA 2MEV2 2QMEA 4DZRA 2MZSA 2ZMLA 2QQUA 1BMV1 2WFF3 5JE8A 1KOHA 1LQTA 4HKOA 4JC1A 1FXDA 1M1YA 2RARA 2FEAA 2UUCB 4HFNA 1MN9A 4S1NA 4M5NA 5BYSA 4L0DA 1X1RA 4N53B 3I6ZA 3OA2A 1P61B 4IRXA 4OV6A 1PNQA 3ROGA 3BJEA 2AC1A 1MS4A 3HU5A 1H1DA 1KVIA 4MITA 5KFCA 2OZ6A 1V3UA 4ZCPA 5L3VA 2RS53 5H9SA 3MGAA 3QPBA 2ZEWA 3UJNA 2IKSA 5EWEA 4BGEA 3QEMA 4DV6B 2Y1XA 2ROQA 1NVVQ 3KUHA 2RT3A 5LXTB 3BCSA 4PQFA 4YGDA 4D7SA 2H54A 4SBVA 3BH0A 4ZZIA 1SR8A 2ZTSA 1U2ZA 4K6BA 3NMUF 1RITA 2JDAA 2YC2C 4YG6A 4YRZA 1BMDA 2KM1A 4LLFA 3MRVA 3BGFA 2AZDA 1UINA 1WI6A 1NC1A 2YRWA 3WA6A 2A9JA 1P9OA 2E4AA 3IDQA 4DS3A 2V4ZA 4CPDA 3HNRA 4UJ5A 3E0XA 3R3HA 5KNDD 1XNDA 1RHKB 4UNPA 2IHKA 4CMEC 1M5VC 3CH4B 2B0CA 2IF0A 4IGFA 4E5NA 2VO5A 1LRKA 5KYNA 5K4GA 5IT6A 3NJRA 2WPDA 2I2BA 3DAYA 4HNSA 1PR0A 1UA0A 2CGPA 5ALOA 2UVRA 3WB2A 2M88A 1PQYA 3F41A 2ONKA 5ES3A 3NIGB 3N2GB 4U2DA 3PNIA 4FF1A 5C52B 2PZEA 4RD2A 1JJ4A 2CVHA 4K21A 3PBKA 1XC7A 4Q4JB 4RHYA 4OP2A 1J00A 1E8MA 3GGJA 1G2QA 3UMMA 1K3TA 2AJ0A 1DBRA 3ZXGA 1SVNA 2YKGA 2DNOA 4JHZA 3MELA 2JCGA 2J0UB 3UATA 1M1HA 1YX2A 5CDTA 1VYHA 4FMCF 5EXPA 3VI4B 1Y6ZA 3QKWA 4CU8A 1R6XA 4CLSA 1QDCA 1V8OA 3AVPA 4BYGA 5HMZA 4A8FA 4BUZA 1W2OA 2J9GA 1US2A 3NJVA 4ZIRA 1BQXA 3OPWA 5BVHB 1GR3A 2PUWA 5EIOA 1DB3A 1UK7A 3D3AA 4YW7A 4A6SA 2H16A 2UXDF 3AI2A 2GCNA 2O0OA 3KTQA 1VJDA 3DU6A 3A58B 4OJ3A 2AKEA 4RVHA 3HCOA 2G25A 1TCVA 4ICLB 2GAUA 1YIFA 4FYYA 4XPIA 2ABYA 1QJY1 2PI5A 3E84A 3HN6A 1E8DA 1E5VA 1Q8VA 3JV7A 2MTBA 5FUQA 2ONZA 3I87A 4P52A 3ZD6A 1SVSA 3RVNA 5KHIA 1K1EA 3FIJA 1RVF2 1QYDA 5U4QA 1V6SA 3RK1A 2GYVA 1JLQB 3COVA 4Z6KA 2XXAB 1GGFA 4JLUA 5JFTA 1MOQA 3VA7A 2J7KA 2C4NA 3H5WA 2BQUA 4P5PA 2CF5A 1BHQ1 1RRKA 5E9AA 4P1ZA 1RUI3 3V4RA 2Y0SD 2PWAA 2R8BA 2FPKA 1Q1AA 2EBGA 2KHDA 3BIOA 3KLNA 1R8BA 5AW5A 2DHEA 2YWXA 5LOVA 1VAVA 1GAEO 3UT5B 5E0KB 1DQZA 3VO8A 2IZOA 3L41A 1KGYA 2UURA 1FMCA 4FSHA 4F9EA 2QTMA 1FJGJ 3WAKA 4TVSA 1XJCA 1SBZA 3HLUA 1S2EA 4LKSA 1WY7A 4Y2YA 2G40A 3WY9A 3UFBA 1KYYA 2AGPA 4X4TA 5L19A 2QEXS 2AQ8A 2VT6A 3ZU6A 3KSAC 2IXGA 4OHBA 1LHVA 2HRDA 1QV6A 3DEAA 3KLFB 5J5CA 1VRUA 4E4YA 5JZMA 1GZCA 1VHJA 1X77A 1BVHA 4L8FA 4L07A 2FPIA 1PMJX 4NOTA 2FEMA 2JFNA 2FZGB 1FBTA 3BWMA 5DUWA 1C4CA 4WADA 2JGMA 4DLTA 5LXYA 2VUCA 3AU8A 2QPOA 2YVAA 1QD1A 1ZGAA 2GEJA 4R8RA 1PJ7A 4CLOB 1RYMA 1VHDA 3UMJA 4ZQIA 1UBHS 1KMHA 4D3HA 4AO8A 3INYA 1HSOA 2GZMA 4LQLA 2AX1A 1XEFA 4YLZA 2Y76A 2AL7A 4RQUA 1L3VA 4PZ9A 1CAVB 1W36C 2PQ0A 2GVZA 4OOFA 4QU0A 4MRNA 1R27B 3I32A 5F9FA 4TYNA 3GEIA 4NOKA 4Q66C 2I7TA 4CEWB 1ISMA 3HU2A 2COKA 2VQEB 3DUFB 3ZIWA 3RBEA 4Y22A 4BCAA 1A4UA 4BN4A 4G3YC 3WKEA 4M1ZA 2M70A 4AM8A 3DEJA 4M0DA 1C14A 1MXHA 3GT3A 5IDWA 4IXLA 2BMBA 1NGSA 1UKGA 1T3TA 2D0DA 4DB4A 2JIDA 3BR9A 1Y6QA 3LWBA 4CDUB 3VU9A 1CBUA 3I62A 2HQCA 4HDAA 5ADHA 3P3NA 3ZDCA 4WV8A 1TUBA 4FGKA 2VBWA 4NNPA 2AW3A 4UM9D 4RTOA 2OXFA 2XDAA 5DT9A 2RS32 5A7PA 7AT1B 1S2GA 3ZZTA 5L1IA 1S3FA 3MTGA 3BGRA 1PS8A 5E6RB 3MIDA 2Q2OA 1GQFA 4M1SA 1A9XB 4X20B 2FPPB 2YWBA 2XADA 3V6MA 1DAHA 2WIDA 2GPSA 3BB5A 2UU9J 1HKHA 4DDVA 4DIOA 3CRW1 1NZ8A 2QX4A 3AL3A 5F32A 1QF9A 4EENA 2PWPA 2QG4A 3HI4A 1W25A 4MUAA 2ZUTA 3AB8A 4L76A 4IJUA 1RTIA 4XCBA 4NRPA 2BUAA 4MZDA 5LVAA 3VAZA 2NU7B 2R30A 1VBA2 3CD5A 2RVAA 3HM9A 1GQYA 3PRDA 4Q12A 1TECE 3HDJA 3D7RA 4EPVA 1BVP1 1KRPA 2X8AA 4ZVTA 2DT8A 2TNFA 1NMXA 1EAH1 4UW6A 2QNKA 2A75A 5A3SA 2X5XA 3R05A 3NMBA 1U1LA 2Z0MA 4EPRA 2BJWA 5IM4A 5I0SA 5DSXA 3W7VA 1AUQA 5JOXA 3TTTA 1XRLA 4TY8B 4TQSA 1FFYA 4MDFA 3PNYA 1ENRA 4YO8A 1AT1B 1W1WA 2XMGA 2LUOA 1CF4A 3BKFA 2Z2YA 3D43A 4LHLA 3GUYA 1Q8OA 2I6UA 4I6JA 4W1SA 3K1AB 2V34A 5EQFA 4KO3S 2FKNA 2HAFA 2FDRA 3L49A 1F9EA 5K8IA 3ZPOA 3IILA 5F51A 5BXQC 2VW0A 3AC0A 4Y20B 3WIBA 1MS0A 3MIZA 3UYJA 2XCUA 5AXMA 2J9YB 3O4HA 3C97A 5J63A 1CSJA 2MLXA 1T3GA 1DRUA 2LPMA 4PLTA 1EAMA 1RRGA 4M9CA 5IZ4A 3HRHA 3UV3A 1TYEB 1KK1A 2PD4A 3ENNA 1XLTC 1K63A 1FX0A 3OESA 1S7GA 3TD9A 1NW3A 2FN3A 4AP6A 1U1DA 3JAWA 2Y92A 5CXQA 2AW5A 3ZYIB 1ZM2A 1OHFA 2P2SA 3DBLB 3VRHA 2VO1A 4KAAA 1RC0A 1T5TA 4FR5A 2GMWA 4WEOA 3T3HA 2KTQA 4AHYA 4QB1A 4F2DA 4TM8A 1NYTA 3CC2S 3G6XA 1YVUA 1G2EA 1I4EB 2RGCA 1PHPA 3C3YA 1LPSA 1G9CA 1U5BB 3AUTA 1RTJB 2R7MA 2W2PP 1E61A 2G9QA 4Q7EA 4PZAA 4ECVA 5E8JA 2V94A 4IXMA 1P80A 2FJAB 1YOVB 1XR3A 1B35C 2BKXA 2XQKA 4NRMA 3A6LA 4D4HA 4NYMR 1HKDA 3RAQA 4OGGA 3BQ0A 2X0NA 3F96A 4JQRA 3P0JA 1AGPA 3Q4GA 5CTAA 2WW4A 1M06G 1NLMA 3A1EA 2B7BA 4AB1A 2FLVA 1F2GA 5J2UA 1A4XA 5HIJA 3SMHA 1T9BA 2WPDD 2PS3A 4ZLNA 1HKUA 4KAIA 2FJBB 4TKUA 5FIXA 3WJ1A 3OZDA 3PGLA 5BNZA 3P9QA 3W3ZB 5K51A 1USWA 4G3XA 1V11A 1PI3A 1VE0A 2C7BA 1P9LA 3G9TA 1JJFA 1GDDA 1VB2A 1WW2A 1CUZA 5MGBA 4RKYA 2WWRA 3LPFA 3BSCA 1Y89A 1SFRA 1LA2A 4EFMA 1FUEA 3VHQA 5LR6A 1DAKA 3DE4X 5DM7Q 3FF4A 5HRAA 2IP1A 5EFUA 4Q27A 2WU3A 4RIEA 421PA 3PXCX 3VR5A 1KMMA 3VPHA 4N8EA 1M2VA 4E7OA 2QA5A 4YUXA 1JX6A 5L38A 4C2BA 1GSLA 2H63A 2CPIA 1DQRA 1EFPB 2CHUA 4KX3A 2JIBA 3PC6A 2M2BA 2OVUA 1KMIY 4BLIA 2IOHA 4CU2A 4NYJQ 1LPOA 3A14A 3AUAA 1S0MA 4DDHA 3DPRB 3K5NA 2OUKA 3K92A 5HMXA 4URYR 4TMWA 3TLJA 3S1AB 1R0LA 4P5EA 3W8RA 3FM9A 4QDXA 1V43A 4LDAA 3TQEA 1E0JA 1A8QA 2B9EA 2OPWA 2Y1WA 2VG6A 3U40A 3ZQ6A 1GGNA 5C18A 3ZWDA 5IFPA 4QDKA 3T9FA 5FNVA 2XJQA 5BSKA 5HBRA 3H6HA 5A6QA 1S99A 4DV4F 4G0QA 3DMNA 3T4VA 2NQYA 4Q1BA 5E1OA 3VV3A 2RR12 2CNDA 4I4NA 3AFIA 5C24B 3M4YA 1CJUC 1MO6A 3L2HA 1YK9A 3KZKA 4I4TF 3DPSA 3H1AA 3C8YA 1RJ7A 2GWRA 5J1EB 1PL6A 5KJFA 2A0FA 4DUGA 4HMOA 2ASVA 3LPDA 5C5EA 3KFVA 1Q77A 3KEQA 4XGNA 3DPIA 3ETNA 3CF6E 4LMBA 2QLTA 4OFGA 3O1PA 5TPWB 2KJVA 4I0AA 1VYVA 3SS8A 5K1ZA 4HOOA 5FLKA 1GZTA 2J8AA 2VHCA 3HBZA 2A1IA 3OVBA 3AP6A 5ENVA 3QQPA 3IPAA 1U0GA 3SE7A 4G4JA 3GT0A 2FRDA 1QMPA 2FLOA 2SHKA 4ES6A 1WA6X 1F9HA 3X1KA 4EBBA 1JB9A 3HHPA 4H59A 4KWIA 3C43A 3LQFA 4A8TA 5AHXA 1HW9A 5CYJA 1O87A 3A37A 2WT0A 2HU8A 2ZCUA 5K8CA 2YWGA 3D0JA 4FBFA 4IO0A 1DBQA 3IDCB 4J4TA 3LHDA 4UZEA 1JIXA 5FWYB 1EFVB 1XVLA 1XKXA 5B12A 1Q0ZA 1WF6A 3MLBA 1SUEA 5E9JA 1NXSA 3WHKA 5KVCA 1S3IA 5AC92 2Q45A 3IEIA 4R2IA 1UXHA 3D4LA 2BEVA 2O1SA 3PTYA 3JZVA 1VBC3 4DR4J 5IVVA 4CL0A 5FHQA 3KG1A 2NYIA 3QW4B 1GDTA 5J96B 4WY2A 1P31A 2BFEB 5AOVA 5LYJB 3LTOA 1IXZA 5C5CA 1MO2A 4Z51A 3BSFA 1A77A 1N5YA 4IGKA 3IP1A 1Q86T 2O7NA 5DABA 2FWNA 4I9NA 1D2HA 1LAJA 3WRVA 3CUUA 5FWDA 1ZAWA 2QLLA 2PUAA 4UYBA 4WU3A 5AXLA 2R073 1G8FA 5KTQA 3SQOA 3UGQA 1U28C 4R9CA 4KO8A 1NKCA 2PZAA 2GEFA 3KJVA 3ECSA 4YP1A 4QULA 1FUUA 4CL8A 5BNOA 3QIAA 4J0DA 3TMKA 3H8VA 1RJ8A 4ZQHA 1CHNA 3RR8A 4U6QA 5GZCA 1QJZA 1YRUA 2H9YA 1ETHA 2VZRA 2R8IA 1GTVA 1O3QA 1SVWA 5CT5A 1FJHA 4P80A 3RJRA 3L9WA 4A6XA 1YR3A 1E7QA 1VLZA 1VTKA 1CJCA 1FQWA 2JAQA 3NHWA 4ZO8A 4BZ4A 2OYSA 4YROA 3VBUA 2DO4A 4ARAA 1WZXA 4D92A 4OM8A 3GDFA 4L0MA 1FERA 3TZCA 3Q9UA 1ULOA 4WFJA 4JC4A 1ZKDA 2G6BA 4Q34A 3E6BA 4U9RA 4XJTA 4F6RB 2H1FA 2ZH6A 4I2NA 3N7UA 1IVZA 3KK2B 2ZXUA 5C4WA 2DIUA 4PLVA 1NV8A 1PVC1 3OLYA 3IXMA 2JDMA 5REQB 1H4VB 5IVFA 2E21A 4FPFA 3NWEA 1RAIA 4X64B 1M66A 1VMBA 2BCEA 3B1WA 4H1TA 4ZAYA 3STXA 4YJKA 4XJUA 1C8KA 5I91A 1PFGA 3SIXA 3ZLIA 3GFYA 4ZVPA 3KS9A 3T4XA 3R4CA 2IPOA 3IAS9 5BQOA 3RQ0A 3CKKA 4UY8T 4WJLA 4NIIA 4RCYA 3Q0EA 5ICCA 2A0KA 3KHUA 2WU1A 3PXGA 3T4PA 1VAKA 3WYGA 5E1RA 4I9FA 4X1YA 5ACA2 3WFIA 4I55A 3ILIA 4PJYA 4CO3A 3U1TA 3S7IA 1KZGB 1ESNA 1OC4A 4WBNA 2IXHA 5GAEI 4YARA 2BJ8A 2NNLD 1S1AA 2OGTA 4JI1F 3C6KA 2VTDA 2X1FA 5BQ3A 1SLAA 2VOTA 4IZIA 5A4IS 3PFBA 1R66A 2JE8A 3SC3A 3ORRA 4Q4W3 3PFKA 2CN1A 2GN8A 4N5NA 1DKUA 3V0AB 3BS4A 2UV8A 4LQ9A 4AI9A 1JYFA 4LKRA 3I0SB 1MUUA 2RDSA 3AG6A 3QLQA 5HP4A 3O47A 4JX0A 3VNRA 4IDAA 4RW8A 1Q3HA 3MG9A 4BE4A 1PJBA 4IG9A 4F3CA 4X63A 3SKJE 1CZRA 5C9ZA 5DBOA 2HKIA 3OJXA 5BPFA 4RA0A 1UDWA 5AUQA 4LJSA 1DI0A 5DAXA 2HEIA 1XZCA 3DECA 2OFOA 2IHZA 2ZAAA 5D0GA 2QT1A 4UCQA 1UFLA 4EY3A 2PKXA 1C0PA 3JD2A 1ONNA 5FZKA 1N2ZA 3MR7A 1XVIA 1OY9A 2QR3A 3FCVA 1S0FA 2WJYA 3SF8A 4F5ZA 3OE7A 4R3NA 1ZUD1 1OIAA 1JNZB 3HR9A 4O3QA 2WLTA 5B0BA 2EI5A 2C57A 1W52X 2JJQA 4MKAA 1Z74A 1YRAA 2XULA 3AZZA 2HRYA 1C50A 3VH1A 1ND2A 5AW9A 5KTMA 3I9FA 4LYDA 1J33A 1YR8A 2JDNA 4G8JA 1AFIA 3PPWA 1J2YA 2DUWA 4CTNA 1MJFA 3MLAA 5FR3A 3MCSA 4K88A 1EEHA 2QIFA 3AHJA 1YRBA 1XYYA 3IAM6 4UEWA 1GR1A 1Y37A 4P72A 3VR5D 1GYPA 3LSEA 1RUOA 2C61A 4Q18A 2MHNA 2WWWA 4WXPA 9LDBA 4M8LA 3ZK9A 3IT2A 2Q62A 2CAJA 3BMNB 3KX2A 3NORA 3KJIA 2Q0XA 2UXBB 2YG0A 2QM3A 4U36A 5SV5A 2YKAA 1QE0A 2M4MA 4WWSA 1ZH4A 3D3KA 2CG4A 1DV2A 2NTJA 4AVAA 4QVIA 2AC4A 1RR6A 3IVRA 4XE9A 3ADAC 1FFXB 3JATB 3HCPA 5IM4F 4A8JA 2YS7A 3ZLJA 4RLSA 2L0XA 4OMDA 4LF9B 4JR1A 3TWIA 4NX9A 3NJ4A 3WRYC 4J0EA 4YGEA 3BWDD 2XB6A 4Y1ZA 1ML3A 5IK2A 4AO6A 2P6UA 3DAFA 1S1XA 1JBEA 2JFYA 3CJKA 2PY6A 5IUNC 5AHWA 3CW8X 1L4FA 3Q3JB 1K06A 2WVEA 3NXSA 5BRJA 1U1EA 1KEEA 1GPJA 1T36A 2JS7A 2Z8YM 4MW5A 3AMQA 4M9QA 4N5DA 3QJLA 5C4MA 3R9XA 4F4UA 3HLYA 4BB5A 4DUGD 1XEWY 1W9WA 3T7DA 1PE0A 3DFZA 4BQEA 3CXCR 3GTYX 3K4ZA 1AE1A 3IOYA 5HYVA 1JK9B 5TF4A 3AVVA 3J7YI 3WYCA 2OHIA 3QKTA 1NNUA 2LUWA 2BJHA 2EBHX 2MTLA 1W4RA 3PGJA 1UJ5A 3FMIA 1LSUA 4OI1A 1OJ7A 3BODA 1S7IA 1W88B 2XVMA 4YUZA 3A2MA 1IBMF 5LSOA 1B6RA 4IZ6A 1E5QA 4B3GA 2ZIEA 3G8YA 1PFVA 1OS5A 2EFHB 4P58A 4GRIA 4BNFA 1IHYA 1I5EA 1VQ1A 4ZD6A 2E5LJ 4ZU5A 2OCXA 3E4CA 1Q7RA 1S4EA 3CTRA 5T4EA 4HQFA 3BC1A 1WKBA 4LIVA 4NYPA 2O4UX 3AP4A 5AJHA 3NG1A 4CU6A 1ZP6A 2ZM6F 4MAAA 1H9CA 5JCZA 5FPHA 4ACBA 4KPGA 1XB2A 4H0NA 2QBYA 3KUUA 4Q4X2 1G8PA 4IGAA 2NSBA 4YAKA 1K5MC 3VBSA 1X42A 2XUJA 4ER5A 1C30A 3R0QA 1SLIA 2GPNA 4K1LA 2CHHA 2PX6A 4CQ1A 3H5YA 4UD6A 1NRJB 3T35A 3EEYA 3WGIA 4F5YA 3KRTA 1EQ0A 4GF5A 3P9IA 2D2VA 2QYTA 3ONQA 1VKZA 4N7RA 4M3CA 1UKEA 1YI9A 3FLTA 4B1LA 3ZSMA 4FP9A 1TMYA 4FGSA 3HE3A 3N59A 5JAPA 5J2UF 2VUJA 4KY3A 1DYPA 3DWGA 3DDUA 2RE8A 3NXZA 1BE4A 2V8OA 2RCNA 3DDNA 3R5TA 5FLJA 5CT4A 4DMUB 4B3MF 3MMXA 2H5IA 5LA6A 4R1PA 2VTBB 3DKDA 1ZJ6A 3ETLA 1SIZA 5J47A 1NP6A 2N7CA 2BUCA 2J6TA 4EDHA 3JW8A 1VCMA 1IPEA 4PFQA 1QS0B 1TMJA 5CB0A 3I4LA 4G8BA 1JHAA 1DDLA 3CL1A 4TX1A 3DKIA 1A88A 1KRXA 4YCLA 2OORC 4ECZA 3NBFA 3T5BA 1OAOA 1PDWA 1IZYA 1UZWA 4MYEA 5AW2A 1PX2A 1I7PA 3VKWA 4HH3C 2IUSA 3R7SA 1EQ2A 2RS13 1RXVA 3R4VA 3U5TA 2NTYC 5TS3A 1WUYA 3CEJA 4GO1A 1IJFB 4LFBJ 1OHHD 4GRAA 5IUJC 5K0GA 3SGLA 3W63A 4WESB 4NAHA 4JIGA 2U2FA 1NULA 5BV8A 3U1NA 5FZHA 3R6GA 4CIOA 4WE1A 4B76A 3OOHA 3BN6A 1TYBE 4EKDA 1YKWA 2ZETA 2KW5A 1X92A 2I6FA 5D3MA 3LV8A 1UMZA 2ZVJA 1PNVA 4KI7A 4XKJA 1I5OB 4YN3A 3ER9A 5AVVA 1Y81A 2I80A 4NU0A 5FNVF 3UGTA 1OUSA 3P45B 3QGHA 2QLBA 2IVMA 2V54A 4XYBA 4LXUA 2HJGA 2HLTA 4ZYUA 2E7AA 4E03A 3D2WA 2BHRA 3AIOA 3NDBB 5HI7A 3V1LA 3V9PA 1LC3A 1X8JA 3Q9OA 2Z8QA 2HQOA 3P9NA 4J03A 5FKJA 5HIAA 4RH1A 2WVDA 2JC1A 4F9GA 3MERA 3EA4A 1BCSB 2ZI9A 4IL7A 4LKOA 3PFOA 2WG1A 3LZCA 3QXJA 5E9QA 2C24A 3LRTA 3OEYA 4FFIA 1OAKA 2O8NA 4EG1A 1RAGB 2PA0A 4LMAA 2SXLA 3RS3A 4LRXA 4MHSA 4XF4A 4PLOA 3ELUA 1ZA4A 4O2AA 5CZVA 1JW6A 3W4IA 1C4WA 1HEUA 5AM1A 1SLLA 3SX2A 4NV1A 3CSSA 5G0VA 1OH4A 4XIOA 2MR5A 3CN9A 2FYXA 3VJLA 3CRQA 4QXBA 3HHLA 4G4FA 1CPYA 4ITCA 2I4NA 4NFSA 4LTMA 4BDVB 1OBNA 4N3NA 3QEKA 2FC9A 2QYHA 3AF5A 1KIMA 3TOVA 4RM2A 3P9YA 4L8VA 3GQBB 3ACHA 4PLCA 4QVKA 4UXHA 221PA 3DMDA 4FE4A 3OQIB 4DV5J 4W7SA 5F2NA 1T0TV 2O8DA 1HQEB 2Q30A 5FZDA 2Q5FA 1S2BA 5FTLA 4DBLE 1PUJA 2YVUA 5I3UB 3ZXUB 4FKBA 5C7GA 2PIIA 3BFXA 3S2YA 2XWSA 2BQRA 4W4ZA 1KMCA 5IDQA 3LDRA 1H05A 3ECCA 3OPKA 3BMCB 1PIEA 1L5ZA 1BMTA 3DBVO 1W0KA 2P9QA 1U26A 2GYWA 1AJOA 1R4MB 4ZIVA 4ZAFA 1SEPA 3AJYA 5CNMA