3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Subtilisin-like serine protease
publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
1GNVA 1SPBP 1BE6A 3CNQP 1R0RE 1S02A 4DZTA 3WIUA 2X8JB 2X8JA 5AVKA 3PTLA 1SCNE 3DE6X 3TI7A 1Y3FE 1SVNA 2PMWA 2PMWB 1C3LA 3I34X 4NMXA 4NMXB 1VSBA 3DVRX 1PJ8A 2ST1A 1SCJB 1AK9A 1SCJA 1TO1E 5B1DA 2XTJP 1SUAA 1SUDA 2SICE 5ARBA 3GCXA 1Y1KE 3BGOS 4DXZA 3F7MA 5CW1A 2Z2ZA 1TM1E 4OMDA 3I2YX 4I3GA 1Y4AE 1GT91 1CSEE 2PRKA 1Y48E 2HD4A 3DE1X 1ST3A 3DE7X 1SIOA 2PKCA 2LUWA 4KPGA 4NE7A 4OMCA 2ZWOA 4DY5A 4DWWA 4LVNA 1U5IA 3QTLA 1Y3BE 3DE0X 3WQBA 3GCXP 2SECE 1MPTA 2Z57B 1XF1A 1GTJ1 1NQDA 2Z57A 1NDUA 3LPAA 1SCDA 1KE1A 1GNSA 1NQJA 5FAXA 4GI3A 3BOWA 4CFZA 1BH6A 4CG0A 1P7VA 1LW6E 1HT3A 1T1EA 1EA7A 4MZDA 5JMOA 1TMGE 3GT4A 1AF4A 2W2PA 3L1KA 5I9SA 4HVLA 1Y3DE 1A2QA 3VTAA 2GKOA 3DDZX 2XRMA 3OSZA 2Z58B 2Z58A 1TECE 4WOBA 2G4VA 3DE5X 1OYVA 4FONA 3VHQA 1SCBA 4YN3B 4YN3A 1PEKE 1R64A 2Z56B 2Z56A 1WMEA 5ARCA 1ZVJA 1Y4DE 3DF0A 1GA6A 2W2PP 4BWGA 1KFXL 2PWBA 4G9SB 2WV7A 3DE4X 3VYVA 3SQOA 1WMDA 3A3OB 3A3OA 5ARDA 4DJ5X 3DVSX 3QFHA 1AV7A 2Z2XA 5FFNA 1AH2A 2PQ2A 1YJAA 2DP4E 1SUEA 4OV6A 3DWEX 4OV6B 5JXHA 3DYBA 1TM4E 4CFYA 1SUCA 2ZWPA 1C9NA 2P4EA 3DVQX 3SQOP 1WVMA 1TM7E 1S2NA 3BPSA 3JQWA 3VV3A 1SBTA 2ID8A 4NE9C 3BGOP 5AQEA 1KE2A 3D9QX 5FBZA 1NDQA 3Q5GA 3DE3X 1DBIA 1TO2E 3QMPA 2XVLA 1BJRE 1OYOA 3TI9A 2PYZA 4DZGA 1TK2A 3CO0S 5AVJA 3A3NB 1WSDA 3A3NA 3D43A 2WUVA 3PRKE 1S01A 3DW1X 1KDYA 2Z30B 2Z30A 2W2QA 4B5LA 1GA4A 1ITPA 1KFUL 3BPSP 3BX1A 1YJBA 2XVGA 3GT3A 1V5IB 1V5IA 2IXTA 2WWTA 1KDZA 4K8RA 4K8RB 4I0WB 3P5BA 5SICE 3DE2X 5AMXA 1QXPA 4JP8A 2B6NA 3EE6A 5JXGA 3ZXXA 1JEAA 1YJCA 1Y3CE 2E1PA 1BFKA 1SCAA 1MEEA 1TM3E 1V6CA 3SICE 2W2QP 1DF0A 1SPBS 3AJ9A 3CNQS 3TECE 2W2OA 3Q40A 4HPKA 4HPKB 4HX2A 1C9JA 3H42A 3H42B 3WHIA 3GCWA 1WMFA 3P5BP 1KDVA 1GCIA 4J94A 4WOCA 5B1EA 1P8JA 1AQNA 1R6VA 1BE8A 1GA1A 2QFEA 5K7SA 4ZOQI 1SBCA 2WUWE 2IY9A 3LPDA 4AKSA 2W2OP 4H6XA 1SBHA 1SUPA 1THMA 1PTKA 4H6WA 1UBNA 3GCWP 4M1ZA 1CNMA 1IC6A 1GTL1 3T41A 1OT5A 4ZARA 3JQXA 4C3UA 3VV2B 1Y9ZA 3VV2A 1C9MA 1SBNE 1P7WA 3A3PB 3A3PA 3F49S 1SUBA 2W2MA 3EDYA 2V8BA 2DUJA 4KB5A 2TECE 1IAVA 4RYDA 1T1GA 3LPCA 2W2NA 2Z2YB 2Z2YA 1Y33E 2QTWA 2QTWB 2HPZA 1YU6A 5JXIA 5SV5A 1DUIA 1ST2A 4LVOA 1SH7A 2XVKA 3LXUX 3ZXYA 3CO0P 1EGQA 1AVTA 3F7OA 3VSBA 1AU9A 2W2MP 1SIUA 3I37X 3DW3X 4AKTA 1PFGA 1T1IA 1TM5E 2ID4A 1SELA 1SBIA 2PWAA 2SBTA 3AJ8A 1ZVKA 2W2NP 4Z2AA 3AFGA 1BFUA 1SIBE 4KG7A 3I30X 2DQKA 4H6VA 1SN7A 1GTG1 4DY3A 4C3VA 4NE9A 2O8OA 5JXJA 1NLUA 2SNIE 3HJRA 3UNXA 1Y34E 3WIVA 2XTJA 1Q5PA 2ZRQA 3EIFA
chains in the Genus database with same CATH superfamily
4FOQA 1FMJA 4H4EA 1Q2UA 4LMZA 4YMVA 1Z45A 3A06A 4FEEA 2GUWA 3T5DA 1RUD3 3T4VA 3N9MA 1I7PA 4JEHA 1QYVA 3RFRA 5FOBB 4NXNF 3L09A 4BBZA 1GGNA 2WJ4A 4AX8A 1C8M2 2O1EA 3R3SA 5FP3A 5G1PA 2D3PA 1UA1A 1O91A 3H90A 1P31A 4DR6F 1VG9B 3NV7A 4UHDA 1Z8DA 2BEVA 2OHOA 1UKUA 1ZRDA 4OQPA 4YM0A 5IC4B 1U2RA 3AYAA 3DUFB 3BERA 4P52A 4HGOA 1W06A 1HI0P 2F1RA 2B82A 1KEPA 2VNKA 5KSYA 3KSCA 2P9ZA 2GAUA 4W1SA 3CJSA 4A47A 3WMGA 3CMQA 2ZI3A 4II3A 3CEHA 2EGHA 3C2QA 5MGBA 3EAQA 2DUMA 1B70B 1J56A 4L3NA 5F35A 3BT7A 1P6QA 2NZXA 3G8CA 1PJSA 4YJ3A 2AD9A 3GFTA 4CR7A 3QF7A 4X6UA 3PHEA 1QS0B 2LU2A 1GNSA 4C3KA 4LDQA 1QGOA 1N32B 3GN1A 5IK5A 2O8QA 4QEDA 1DXOA 5AE2A 3VGPA 3M2VB 1U63A 1VBE2 2FMFA 3OLVA 4QPIA 3ODGA 4NI5A 4AAPA 1NVEA 1AKUA 4BQPA 3KZ4C 2ZJ1A 4UPEA 1VBYA 2H1LA 2YVAA 1TK0A 1YZVA 2XJPA 2VZLA 1QMPA 3WYNA 2HLUA 2PWZA 1HB1A 4CW7A 4HETA 1U7PA 4FNIA 2GXSA 3VTIA 4HCJA 3DNPA 4LR8A 4F6CA 1VGQA 3ND9A 5CG2A 1U98A 1KVUA 3BH7B 2HPUA 2HH9A 4I56A 2RI0A 5LLSA 4UUXA 4BLQA 3L01A 5J2PB 3DKIA 4GO7X 1TFUA 3VKUA 3SQOA 2AOVA 3NJ4A 3I6PA 3JWEA 4DYDA 2GARA 1I36A 4DMMA 1NNLA 1NDKA 2F8EX 4PX3A 5F3IA 1CX9B 4BFCA 5C9AA 3H5VA 4GBMA 2IHR1 5DZEA 3QMVA 4CL2A 5IW0A 5DZ7A 1QVGR 1G21A 1CR2A 3PD0A 3QT8A 3F7TA 4RVGA 3N86A 4YQEA 3RRFA 5A33B 1BXHA 1RTJB 1HNXJ 2C7OA 3J81Y 2VT6A 4UHBA 1T91A 3MR7A 3QPCA 1IHDA 1NW9B 1MT0A 3RAQA 2VUSA 1F8UA 4N3BA 3PX6A 5D87A 2NTEA 1B6SA 3WGJA 2PPLA 2PVSA 5KTSA 3RS6A 3K6SB 2YXNA 4E5PA 1E5XA 1G9TA 2L3MA 3GELA 3FL7A 1BN6A 4WTOB 4EO7A 3O1SA 5HS6A 2VP6A 3UJ7A 1K7FB 4I2QB 3FTCA 1AN0A 3CLKA 2J5XA 4FSHA 1BQNB 2E4UA 3M8WA 3EVMA 2WVCA 4WJZA 3A12A 1CP2A 2FEWB 4K4VA 1G59A 4LKEA 5M34A 3KVVA 2AR7A 4W9RA 1VDHA 3ILLA 4CRWB 1IM2A 3OE1A 3K4ZA 2BFCA 4BQ1A 3PRYA 1MWYA 1Q44A 4AZ3B 3GLFE 5FUWA 3BFPA 2Q3CA 1AUYA 2C4UA 3CUVA 1TEZA 4LOAA 1CS4A 4XQEA 2LMIA 4RK7A 2WJYA 3FKBA 2HVIA 2GHQA 1HXHA 3PQDA 1FUIA 5CQGA 1GAJA 5J4KA 3RK1A 4R7ZA 1NMQA 3QI7A 3UHOA 2E37A 4LOIA 4N43A 3FNIA 4RNHA 4MVYA 4MS3B 3UD5A 2BNOA 1JNRB 1OB5A 3LDKA 1P4JA 3PFCA 3GJ8A 5DBGA 4D3XA 1FFYA 4N8SA 2O48X 1COZA 2JLXA 4UEQA 3ZNOA 2BUAA 4LTAA 4MEBA 3GDGA 4J9NA 5K0LA 3IUBA 4QJIA 1RXGA 1I3KA 2A4MA 2ZREA 3J8F2 4P84A 1JHDA 4RH3A 1C9MA 1GNQA 2RS11 1E79D 4HWKA 1VJ2A 4IH1A 1NLMA 4BYYA 4EVSA 1VRVA 2QTVA 4MRRA 4ZZ1A 4FR2A 2NTJA 2FLWA 3MD3A 2YTZA 4F0JA 3ZFGB 3VUEA 4Z8XA 3GG9A 3GDHA 2ZT8A 2WU4A 4OYHA 4FXVA 3IEIA 1RJ9B 3F5FA 2FJDB 3TVDA 3RDPA 3MXHP 1KMHA 3SCIE 2F3UA 4C4WA 2XCIA 3AVXA 2LW8A 5DX0A 4QB1A 4G6ZA 4EL5A 4WP8A 1PKXA 1S1VA 3ZTRA 2GCEA 1VYAA 4RLEA 4ON9A 1PGSA 1REEA 1FFEA 2AFIE 2O7SA 2FWBA 3VKGA 4DR5B 3QT5A 1W5EA 1SJ4P 4W8JA 3ZV5A 1TF5A 2DK2A 1J8FA 3ZHYA 2FVRA 2X7XA 4HVRA 4EW6A 1PL0A 3BIOA 4CR8A 1XZIA 2YWRA 2V7UA 3QWFA 4C0KA 1P4HA 3LQVA 4HKLA 3PIJA 1UC8A 5DO9A 4ILMA 2WSLA 2DBRA 2FJ0A 1T94A 2G13A 2PV7A 1U11A 4UT4A 1H8HD 2OCDA 2OB1A 2C2NA 1AK9A 4G84A 2C9ZA 4Q4X1 1G41A 2OV6A 3UKTA 3HG7A 1AX9A 1HV8A 3A6HA 2I29A 4I0AA 1WXGA 4JI6B 4MW9A 4A92A 1KD1T 4ENRA 2XB4A 2YICA 1MBZA 4RVUA 3IESA 1O94D 4OJYA 3DBLB 3PNQA 3D4JA 4KMRA 3EWIA 1U8WA 2FMXA 1F2VA 1ZN7A 1JYWA 3GIMA 3L7LA 1APSA 3COYA 2OYRA 3U07A 1ZD3A 3HB9A 1R8JA 4C2UA 1JLCA 3N6VA 2J7PA 2ZTVA 3E1GA 4CLOA 3D0QA 3KEGA 5CNIA 2OP5A 1GJRA 2FHRA 1XR6A 1OQ3A 2IYSA 4YXFA 2CQ2A 1SZBA 2EC5A 3P2YA 4U7JA 1DQ9A 4HAZA 5HMXA 5KSPA 2VP9A 4ESOA 4O4GA 4GP7A 1EA7A 4XIFA 1S2KA 2JLYA 1TJ4A 4JJ4A 4QFCA 2MYPA 1GWNA 1AURA 4K05A 3HZEA 4BY9E 1QVWA 2XNJA 3K96A 3VMFA 4IH5A 3MEDB 4AI1A 3DHXA 1F9AA 1WDKA 3POTA 2Z3WA 3AVWA 1JL3A 2R11A 3A4MA 4LSMA 1YQ5A 4XVRA 5EYPB 1BBT3 3E7XA 3B52X 3HI6A 4MI3A 2I9PA 3POJA 5KTMA 1M6YA 3PQ8A 3OZ7A 3CNHA 3TB0A 4PE5B 3F1KA 4Z7JA 3WVJA 2GZWA 1E9CA 5H9EK 4KBIA 5FKCA 5A6YA 2WT2A 1O57A 1NMZA 2VH5R 2PUEA 3NHAA 5HF5A 3OXLA 4DL5A 5H9VA 3Q8MA 3X1YA 4FP9A 2OQVA 1QU0A 4YP6A 4WXYB 1W52X 2LIPA 3HJUA 2F3RA 2VE1A 1E2IA 4DLAA 4NIDA 2RHTA 5H9EJ 2AWOA 3PCXA 2W1WA 2OXBA 4LY3A 3NCRA 1TAQA 1T25A 2QSUA 1MXHA 3HRHA 4Y2UA 1RBYA 3NIDB 3EC2A 3T9BA 3LA8A 4Q34A 1PJ7A 2QQIA 4D02A 1WM1A 1YHZA 2GLUA 1ZHFA 3MCOA 3N1UA 3V1KA 2EYUA 2A9PA 5ICSA 4E0DA 5GZGA 2ZDGA 3AC0A 3B1KA 1QFYA 1BU5A 4ZV9A 4JVMA 1XEWX 3KXKA 4NLTA 1AZSB 5FNVB 3INGA 3CLUD 3HKCA 4LY0A 5AI5A 4ZIRB 3HVDA 4NBSA 3FZYA 5DW0A 4AULA 1IWOA 4FPGA 7REQB 4DQQA 3TXYA 1RWUA 2Z6UA 4NBTA 2ES3A 1JEYA 4J25A 1X19A 3O14A 2IPOB 4DF4A 4C3LA 3A31A 1FP4A 5CFMA 1YJUA 2CFIA 3H9BA 5BSRA 2UVVA 5J2UA 5I3UA 4DNOA 4YVSA 3W62A 3VH2A 2FKAA 2NOAA 2JLRA 3N75A 1EFVB 4CDQA 2XZPA 3HDVA 2BZSA 1IOWA 4BCUA 4EMTA 5JLJA 2NAFA 5IN5A 1KQNA 3AA8A 2H57A 9RUBA 5DISB 2YNMD 2AMVA 1BA2A 1VKRA 2C77A 4ITCA 2AT1B 3E9MA 4RACA 4JBLA 5LQMA 3OPTA 4P02B 3DXBA 4FUQA 2HMIA 2QZ9A 1EI9A 3USUA 3TLGA 3H7JA 1CJSA 1WD3A 3HBLA 4KUEA 2C5DA 2Q1TA 2P6OA 4ZJZA 3Q8VA 3JRNA 4FOLA 2QIFA 3UF0A 2MQLA 2Q6VA 2ZKNA 2FUNB 3W7VA 3I2KA 1K5DA 5EJ6A 3X2FA 5CB4B 1QZXA 1L5YA 5EJAA 3A2LA 1FNYA 3NOCA 4BRUA 1CQXA 2Y77A 1S0CA 3X3HA 3AT1B 3ZXFA 1JU3A 5SZTA 1XC7A 4QR1A 3L1JA 2CYCA 2IYIA 3RYIB 4QYWA 2HK3A 4GX2A 4AGRA 3FLMA 4BQWA 1KYIA 2YW9A 3RWMB 5A1FA 2Q6OA 5HPOA 3PNSA 1UWBB 4G0MA 2QUKA 2QMUB 3OOXA 3ID6C 5HLFB 4Q1BA 2C99A 1JU9A 5CPBA 5JFTA 1FUYB 3TAMA 4OREX 4KYZA 3ERCA 4XBNA 5CT4A 1BEV1 4G1PA 4REQA 4UOJA 1DUIA 3A9WA 2HXYA 1H2HA 2IYYA 1OT3A 5BWOA 1UZMA 3CO0P 5JSPA 1AL22 4I6YA 4Z07A 1GQYA 2WNVA 3V2IA 2PZBA 5C2JB 3B6EA 2VSNA 1QUVA 4IE5A 5F8JA 1H1IA 4MV7A 2O8FB 3IUYA 3V6MA 3RZMA 3ZHCA 1YIOA 3S30A 4K4YA 1Z9BA 3H5LA 1Y8QA 3HEBA 1CJVB 3NASA 4YARA 4K21A 2GM5A 2ZPTX 4JB8A 3CF0A 1UEUA 4KG7A 4ZXFA 2HWKA 1U7OA 4IRDA 3H8WA 2EPIA 5KNCD 4C3VA 4ESEA 1AGXA 2HBUA 3TXAA 3G8AA 5BQ3A 1P1LA 2ODAA 1P2FA 4P3PA 4KGMA 4ZI7B 1TVEA 3M6WA 1PUIA 5JI2E 1SPBP 2I2SA 1R0RE 4XX0B 3TRHA 4MRNA 4KWJA 4ZDNA 4QOFA 2P5TB 4XFAA 4BAZA 4R8RA 4M9CA 4MR7B 5IFLA 4REOA 3BIFA 4MYUA 2ZULA 1O87A 2R6ZA 3QVJA 5HF9A 4DCNA 1DT3A 4XLLA 3C1TA 2ZJOA 4NMXA 1WWKA 4AJPA 1LWEB 3ZU2A 3QFSA 3B02A 5FUXA 2EJVA 3PEEA 4J1NA 1OPIA 1B2LA 1Q95A 1WUIS 3S1SA 4OAPA 1RZ3A 4HWTA 3UB3A 1SUDA 4MR8A 3WFIA 1OX6A 3S29A 1TZMA 1I51B 1VQYA 3C8ZA 2PXJA 5TC4A 1DAKA 3LL7A 1PE0A 3IXQA 5I0RA 4NPMA 4GPD1 2DKFA 3MGJA 2QDRA 3IT1A 1ASJ1 3I76A 1QGYA 3G86A 1KFDA 2RB4A 2RHDA 1DWUA 1FS4A 3DV0B 2YYOA 3C3KA 5K0UA 4RVHA 4AT1A 5CEFA 5F5LA 1SHTX 2QRMA 1N6PA 1NKSA 1M2EA 2UY8A 2X5KO 5GZEA 1WC1A 3OFND 4NOJA 4IGPA 4XVUA 5FXWA 1R4NA 1T8PA 3CT4A 3VPXA 4A4DA 3LP2B 3WMXA 3KJGA 4CMEA 4XCQA 3AXEA 4DPWA 2J42A 2IYOA 3DZGA 4YH1A 1LJ8A 3KYIB 1UKGA 3ZHZA 2HWWA 3JRWA 1AF4A 1IRXA 1QAIA 1FBNA 3W9UA 4QPCA 4TQSA 1EXNA 2X2OA 1TME3 5A6QA 3I5UA 4EQZA 1Y3DE 2YXDA 3NS6A 2H4ZA 2OPSA 2KXLA 4BX0A 3B3GA 3QEBZ 5C35A 1W6MA 4MADA 2TYSB 2XRFA 2Z5FA 3FYCA 5L7OB 4RMIA 2Z5VA 2TMDA 1EM8A 3N2EA 2ZIAA 1XFAA 2OBMA 5LL6d 4PRKA 2DUPA 4LVUA 3H9AA 1DZQA 4BWGA 2FR8C 3BTVA 1K3TA 1ZX1A 3NIBA 3KQVA 3MTAA 4FO9A 2VJQA 1TMJA 2VB6A 3QP9A 4O1IA 4JV0A 1M5KC 2BFDA 4C1WA 3JXSA 4JEMA 4NMLA 2UURA 1YE3A 3AZWA 1ZA1A 3SSRA 2Q1LA 2CV2A 1C3OA 5I9LA 2FW1A 3S2EA 4B46A 2ADCA 1SG9A 5IP5A 5HCFA 1HD1A 4CV2A 1P60A 4YQFA 2C9CA 4FQZA 1IJEB 5A4AA 5FO8B 3MF4A 4XSHA 3IBCA 4XIJA 3BQ0A 1J5OB 3MWDA 4BU2A 4AWBA 5CK5A 3VJLA 5L3VA 1N5IA 4OQEA 5TQJA 3KDNA 1FQKA 1UKRA 2BKVA 1JZ3A 1RB8G 1T8UA 2G7MC 1GUIA 4KRXA 5C5JA 4L97A 4LX0A 1NY71 2WIFA 1IXSB 4UASA 2IXDA 2GSYA 3R41A 4XQ9A 2BI7A 4GP6A 3ESQA 4KH1B 5T52A 3REQB 4DDVA 2C6SA 4FSJA 1B74A 1ZW6A 5ETPA 3IILA 3GT3A 4LC9A 2FDIA 4MMYB 4YTEA 3VZOA 1JQJC 1G9XA 1ZMOA 3WGZA 3QW4B 2NWQA 3R44A 4AD8A 3LA7A 4NG5A 4UTXA 1IN5A 3PJYA 3GZ7A 1K63A 5LFAA 3PUIA 3DFKA 3V9PA 4MUJA 4C97A 4PQEA 1Y7LA 1SA0B 1G5PA 4MV9A 2HJGA 4N01A 3LWMA 1SR8A 2YH0A 5DH9A 3ONWA 1ODJA 3VH4A 3FXAA 1XL0A 3SIXA 4XJUA 4ZHNA 1C9JA 1FVHA 1LDGA 1AGNA 2E5GA 1TKXB 1G86A 1MAAA 3V5NA 3CPWR 4KGGA 3VUOA 1BX1A 1WDMA 4XACA 1QAOA 4D0NA 3GUVA 4Z9XA 2HU5A 4GLLA 2J0VA 1HG0A 3BN7A 3MMAB 3KO8A 2F8HA 3I5AA 1NE2A 1QJX1 1HQWA 3FHAA 3DO5A 1F12A 3K0CC 2BCGY 4GOMD 2YWWA 4AKSA 2OWDA 1GILA 5KG3A 3GOQA 2UYYA 2HBQB 2X77A 1RYSA 1UAWA 3V1MA 2CNNB 2O0HA 3OURA 1UXKA 3V80A 3UAZA 3LAGA 1MZFA 2JBAA 4RUCA 1J5EF 2OESA 1CIPA 3ZGZA 4YJFB 3L4JA 2H85A 3IHTA 1UYZA 2BCJQ 2O8CB 2V94A 2F3JA 4HLCA 1RTHA 1K5JA 4QU1A 1TCVA 5C42A 1WSRA 5K05A 3RRJA 1OFHA 2R4TA 3ETLA 1GRNA 3AZQA 2X6RA 4L07A 5A5EA 4CUKA 1QE1B 5DYWA 1UC9A 4A73A 4CEIB 2VNRA 2W70A 1N7IA 1Y7IA 3F6BX 3ILSA 3SZ3A 1DBRA 2HUPA 4FOWA 3K9HA 8ADHA 2IHTA 2KD7A 2Y8EA 4BJ0A 2GFHA 5C80A 2ZAMA 2ROPA 5JECA 4ZPAA 3FTDA 3RVLA 2P9EA 2JFHA 2MJLA 1LHUA 2W9XA 3BN4A 2VJMB 3CD0A 2BBTA 4JYAF 2CJQA 2Y05A 4H6VA 3B82A 1DI0A 2IJFA 3X3UA 2H4YB 2W58A 4DLXA 2XL9A 3N9OA 4LO4B 2POCA 3R9KA 4HFRA 4PCUA 4TV8A 2RC6A 3CLRD 2YQ0A 2C9YA 1ZK4A 3BB3A 3DLKB 4ARSA 3JSYA 1IE3A 2H9IA 3KMQA 1HBMB 1NVKA 4B2YA 3TG2A 1AR83 1ENQA 3ABQB 2FPOA 4N76A 4LCBA 2M3DA 4Q19A 4XM0A 5DWVA 5E8RA 4LZOA 5F73A 5IDYA 4LC0A 5K8TA 1D6JA 3OD0A 2NX2A 3R8XA 7ABPA 4MK9A 4KQMA 1ZY2A 4P9JA 3BWVA 1OFNA 1QFXA 2Z2ZA 3WZ0A 5CG1A 4JDNA 4AJ4A 2FCUA 3BHIA 4FUTA 4PC6A 3MYRA 4YDDB 5JJLA 4RHV2 1FXSA 3GJRB 4PQFA 4L95C 3LO5A 5FJKA 2MEWA 1MABA 2O1QA 1SC3B 5BUZA 2XO6A 1K7EB 2QLJA 4X8PA 3G0IA 3IPVA 2R7EB 4DJFC 3R6GA 4AHZA 2D98A 4C4OA 5H4HA 2YVQA 1LBTA 4EY8A 3V4VB 5FWAA 4CCYA 4G86A 2HLNA 4LJAA 1BDJA 1ODIA 4BYGA 1OS5A 3WG4A 3PU8A 1P9YA 1ZXBA 5CA0A 1G9DA 3IA0A 1PW5A 5AXCA 1L9XA 4AI0A 4KYUA 1Q5VA 2X0JA 1EFPB 1BS9A 2GIFA 4WVWA 2IPMA 4U5QA 4LY9A 3NUGA 1S4QA 2GRAA 1MAVA 5JJCA 3AJ1A 4P74A 1FTWA 3ZV4A 4G9BA 4JC8A 1WXIA 2OHGA 4YYEA 2K2WA 1LJUA 5M0TA 4OU4A 3LP8A 4CDNA 1ISIA 2CVHA 5F39A 3LDAA 3V7UA 4KQ7A 3UHAA 5A8RA 3GJ0A 2BFWA 3M1VA 5G0VA 1UBHS 1D9XA 2G9OA 2IYLD 3DOOA 3QOFA 5KXCA 1VIWB 2WWRA 2FG5A 4FNHA 4XFDA 2FG7C 1QVRA 4TYYA 3M3IA 3WT3A 3E9DA 4DV2J 3A1NA 2XWBB 1QFMA 2FPWA 2PX3A 2YNHB 3ZO0B 2FLNA 1VBD2 3EYAA 4IQMA 4C5BA 2ZX1A 1FB5A 5EE9A 1MVOA 1GKLA 3WQ1A 2MKKA 4HVQA 1CX4A 4PXEA 1FKAF 4IILA 2Q99A 2WZQA 2BN4A 4FK8A 1NBHA 4MMXB 4F4AA 1LBIA 3UL2A 3DE3X 2HA2A 1H0HA 3U7JA 3AR7A 3OVAA 3ASIA 2GN4A 4HDOB 4DR3J 1AR62 1MS1A 2QQLA 3NBPA 3NWPA 4PC7A 1DKNA 2OCYC 2ZS6B 3OT1A 1Z5PA 3JATA 1GR0A 1JMKC 1TMYA 4Z4CA 4NLDA 4V0ME 3GV5B 1FMTA 2AMLA 4QU6A 3A11A 1KSHA 1WKCA 2G3YA 2R7AA 5KBYA 2G9QA 4AG5A 4HN0A 4IZIA 2G9NA 1IBCA 4IHJF 1VPEA 5D15A 2I9KA 4ETIA 4H0CA 4LFAB 3B78A 4B6EA 4QOJA 4ENSA 3KKFA 1XRRA 4JBWA 2Q6TA 4IF6A 1Z73A 1MO6A 1Y43B 3HJNA 2MQ8A 2WW4A 1SU4A 3EBPA 1AUDA 5DUXA 4DL9A 1W9YA 1CUDA 1VIXA 4OUMA 2NYHA 2PSJA 1U2GC 2VJYA 4MR9B 1RLDA 1GG9A 3WRXC 1GM5A 2QRUA 4KQFA 4NOHA 3EFHA 3RZLA 2HPVA 4AN1A 1U45A 1LPAB 4C8NA 4WESA 4AG3A 1A3KA 4UEJA 4S24A 2QD4A 3CNBA 1OX4A 1N8RT 2PFKA 5KQLA 2F43A 1NJXA 3IQIX 5EIFA 1U6KA 2QTCA 5DKFA 1EAYA 5C8VA 5JASA 2ETVA 4LJYA 5KTQA 3GLFA 1AK1A 1Z38A 4ZQEA 1RBAA 2B8MA 5F0UA 3IMQJ 2EW2A 3ZH2A 3PD1A 3ZSJA 3HBMA 1PZ8A 1ZICA 1BRTA 1DKLA 7AT1A 1ZGGA 2W6MA 1WXXA 2CK3D 3T41A 1T1RA 4N5MA 2LQJA 1IUPA 1GAXA 3WGGA 3KHKA 3K0AA 4CF6A 2FHKA 2PUAA 1B7GO 2K8GA 3OBIA 1NR5A 4KR0A 5F8HA 4KNWA 4B7UA 2UUTA 5B0BA 5CLHA 4WLOA 3KQRA 1EXMA 4PZYA 1A7UA 1CF4A 1LKNA 3HP7A 2BJSA 4OFXA 3O8RA 1Y63A 4JI5F 2J3DA 3WP1B 2HPZA 4BVLA 3FIUA 1ONSA 2V7VA 3KJIA 5C25A 4JKYA 1MQ9A 2O2JA 4KQXA 2ZSAA 4BKUA 5FXZA 1OVMA 4XIUA 1FWLA 2V9WA 5KNBD 3UAOA 2JLEA 4IKOA 4OU5A 1LGNA 3OQMA 3IKMB 3TVKA 3BXXA 4UU0A 3GPIA 3SP1A 4QOGA 2TBVA 5FLXA 3DF7A 4AR2A 3VNRA 5HVGA 1MR3F 3K0KA 4L0CA 4OYXA 3BEDA 4GPAA 4QDOA 1QSLA 2FZVA 3H1MA 3VUFA 5IJXA 4FE4A 2WZ1A 4QOSA 3NAQA 3K30A 4Q3OA 3ZV7A 3LLUA 1FMFA 4LQ3A 2VT2A 5JSHA 4DPUA 3FLAA 1ZSVA 3KKZA 1N5YB 2R6DA 2MR5A 2GESA 1G8JA 1O5TA 1OKQA 3WQSB 1MSWD 5JAHA 4YGCA 1VBMA 4DRYA 1E1CB 3BJMA 1R083 1N9KA 1YA8A 4WXHA 2YNGA 1K42A 2QZ4A 3VDDB 1RIIA 2AFIA 5NLLA 3DV2A 1JN2P 1J22A 3VR0A 1AROP 2WBKA 2R7NA 1RWPA 3WQ0A 1UXXX 2DHCA 4MB2A 1FQJA 1OILA 3PX2A 5IBPA 2VG6B 3CBQA 5SV8A 5H59A 3CSUA 1S59A 1JJAA 2C2XA 3HN3A 1AZTA 4HLDA 2OSVA 5I93A 3T7RA 2H16A 2F4FA 4KLRA 4DXHA 1CVRA 1K45A 2Q4DA 4R2WA 2CXQA 1S1XB 3F6CA 2JLVA 2BIFA 2B43A 5HI7A 1TAHA 4E03A 3VAFA 5C5DA 2BOPA 2EF1A 4XGKA 4G24A 4JJKA 3W3AD 1E5IA 2HQDA 2RGGA 2WYOA 4BAUA 5A3MA 1H9AA 3E0QA 3JAMU 1CY6A 1P2GA 4OJ1A 3S2UA 5SY9A 3VPSA 1FX1A 3C3WA 4CEWB 3V48A 4UFPA 4LJHA 4AXBA 4J9SA 1CJTC 1IN8A 2GEUA 2EZTA 1IY9A 1Z4MA 5AHOA 3PGVA 2GS8A 4G4SP 3WKAA 2QX7A 1G38A 1S1UB 2Z58A 1E5RA 4DY4A 1JF8A 2QMOA 3VHRA 2BBOA 3H59A 3AFOA 1T9HA 2PI4A 2DJ5A 4PFQA 5TE9A 3R4UA 4TU8A 3EAGA 4QT4A 4AVAA 1CYDA 3M2PA 5LZ7A 4CMKA 1JE0A 3DGPB 4X64J 2VYFA 3J81U 1PZMA 4F4WA 2NVBA 1P6XA 2K9ZA 1AB5A 3V1LA 2ANBA 1RXUA 1ZPVA 4I2OA 3HFRA 3KJQA 1EVZA 3I9MA 1TVRA 4HRYA 4C9DA 3ACHA 4YLYA 1KYXA 2YU2A 3PS9A 4FB5A 1IDN1 1HE2A 4NBKA 3AD7C 3V8BA 4WWSA 4NYOA 5REQB 3KNAA 3G2OA 3IWLA 2ZJAA 4V03A 2VDVE 3TQQA 5BQXA 2LEBA 3G1WA 3CH6A 1QLWA 1I30A 1JHAA 4DV7J 4KQ6A 3UXYA 4E7PA 3I4FA 1VMEA 2ZHMA 4Y1XA 3HL0A 1H23A 4I6GA 4JU9A 4CZCA 2QV7A 2ENRA 3C45A 3AFNA 1H5QA 3PPXA 3IQZA 2R5WA 5E0KB 1XMJA 4CLHA 4ARAA 4W8GA 1D3WA 4Z4HA 1SZJG 4ZJQA 1G9CA 1KD7A 5H8WA 2XTZA 3NAPB 1Y4SA 1VCIA 2VKTA 4C01A 1EH5A 1PW7A 3IIIA 4Y2YA 4D3WA 3H4BA 3KFVA 1SMVA 3LPMA 1DGQA 4NESA 2V5HG 3LZCA 2H1CA 4H1WA 4MYHA 4OJHA 2P8JA 2OJ3A 2OCIA 2QJOA 3ZU5A 2MJNA 3B70A 1EWTA 2CQPA 2QBYB 1Q12A 2QRRA 4D2IA 2QVCA 2HWIA 1KH2A 5TGDA 4DUXA 3AVSA 2Q0QA 5C24B 1OLOA 1CN1A 2W2QP 2RE9A 1L8AA 3COVA 1MP0A 1BVVA 2AOUA 5ALYA 3UO0A 3GUHA 1OZHA 1S4CA 1MHPA 4MLDA 1R0BG 1T9XA 4WZ6A 1KXJA 4N5SA 2ID9A 2WYIA 1ZNQO 3TE6A 5BXQC 5D4PA 2VUDA 2PZ8A 4JFRA 4B7XA 1CJUA 2A5JA 4ASUA 1OIAA 3QUTA 3JSMA 5FULA 5D21A 3JZDA 5JHHB 4P5YA 1UKZA 1KTQA 4I50A 5EOVA 1QV7A 2UVDA 3LUBA 3DC2A 3C3CA 3DLAA 1WF3A 4ALKA 2NV2B 2JDUA 4JRLA 3L6RA 1NSKL 1Z6ZA 4PAWA 4XYBA 2LRHA 5CLQA 3OD2A 4QW8A 1AO3A 4B47A 4LPLA 4CMCA 3LGSA 1T3LA 3OBZA 1PQPA 2AVNA 4GVBB 1NMEB 4L4UA 2ZGQA 4W5WA 5KTOA 4A7YA 4B29A 1Y11A 4BMPB 4AEMA 4F3JA 3O21A 2Q6KA 3DCAA 4CO4A 5A62A 2QQFA 2RDRA 5FJHA 1AHHA 4JNCA 3MMCB 4KX5A 1SKYB 2WTNA 1X77A 2B3DA 3HCFA 5B6IA 3CVUA 2M6KA 1GNRA 2BSAA 4F4HA 3ZKAA 5KFGA 3BB1A 2CV0A 4LZLA 3ZZRA 1WXFA 1ZS9A 3L6DA 4J91A 1EGQA 1LFDB 3C74A 5AKYA 4FFLA 3MPYA 2V96A 3SF8B 3VBUC 1KMMA 1ZONA 4R83A 2OGWA 3AX4A 1QE3A 2CMKA 1LAJA 1N2CE 1HPZB 4O4JB 2WR9A 1XNQB 1ACLA 1CVLA 1PV2A 4R05A 4Q3EA 8ATCA 5B36A 4C6TB 4NU8X 1YJKA 4TLFA 2ALYB 2BFEA 4AMUA 3HJVA 2AOTB 1EIWA 4HHJA 4D9BA 3WIDA 5LYJF 4TPKA 1U0SA 1BE6A 4X3PA 3M8LA 4V0SA 5C3PA 3NWOA 3EZLA 1HKUA 4IX1A 1HRI1 1E2PA 2YFHA 3B6ZA 3MEQA 4PHHA 4CLXA 1WC3A 3G2IA 2J9RA 5B1DA 3U7GA 4CWBA 5DM1A 1Z1ZA 2MEV2 5IATA 2ORWA 2OX0A 2VICA 4OXYA 2QO3A 1H6DA 3FFBA 3QGPA 4DUYF 3E2EA 1UKCA 3RARA 2H1YA 5FHRA 1MZEA 4ALJA 3RGGA 4OK5A 3FETA 2CMDA 4YPOA 3PT9A 3WHLA 4IWNA 1NBEA 3OESA 4LXXA 2FFAA 2K5UA 3DZHA 2ZRDA 2WRMA 4DIOA 2GR9A 1R37A 4LRWA 2QJVA 1MZVA 3LF1A 5EAIA 1QRDA 3S27A 2GQ0A 3NS5A 4E4YA 1XEAA 1AKVA 4KPFC 3VKVA 1UQUA 1NW8A 5M5BA 2B2NA 1TCBA 3RRYA 1H4QA 4YG6A 3TTTA 2NCKL 1LC0A 1YVRA 1YK1A 4FP2A 4N7MA 3QEMA 4GUDA 3UMCA 1HW9A 2GZDA 4DKJA 1F5CA 2C94A 3B51X 1LXNA 1J2VA 4RWWA 2EBGA 3ILHA 4EY3A 1JYNA 3HY3A 2XCTB 3G0CA 3JD4A 2QA1A 2Z56B 4D7YA 2D74B 4Q9AA 4UJ3A 1JXQA 2R9VA 5BUVA 4DG1A 3C4VA 4RHEA 1GCAA 4E0BA 2GUGA 4LJ6A 3Q9OA 2VP2A 3CZCA 1SI9A 4LCEA 1MMFB 1I4OA 5KG1A 3E5RA 3P3NA 5G0UA 4KG0A 3NSTA 4JHLA 1XK6A 5CU7A 3DVSX 3X29B 1Q1GA 3TPFA 3VZIA 3BF4A 5C8YA 2XADA 2VULA 3MGUA 1FRNA 3ZFEC 3BSAA 5JD4A 4GQBA 5E6UB 5IFTA 4A8TA 3H9QA 5FJJA 2CGPA 4B71A 1C9NA 1R4MB 2W6ZA 2IMOA 5AD1A 1TM7E 1LDMA 3S2GA 4BNTA 4LKDA 2VNHA 2A6VA 4CPBD 4M9ZA 2B1QA 2X5XA 2O5DA 3CVYA 3DXXA 4XJXA 2HHJA 5DAPA 4IUDS 1E77A 3UI3A 4EVRA 4F11A 3T1YF 2GC2A 2IIBA 4I64A 4ZK2A 4F0MA 1PJZA 2OBFA 4M86A 2ZX2A 3DZIA 1GL3A 3MTIA 4X6YA 1ZOIA 3A25A 5CAEB 3R5KA 4WF9Q 5HQ3A 5JNLA 1ULHA 2FCVA 2PXAA 3OYWA 1Y3TA 3EICA 2HMAA 4ZMMA 3EXCX 1HXS1 1V6IA 2NVOA 2A3WA 2XQGA 8MHTA 4IUGA 4ES8A 4JL6A 3AEQA 3WLQA 3MCSA 3T3MB 2WA3A 4RKQA 3ECQA 2D3UA 2PMHA 1YITS 3WKCA 3GAAA 5I7EA 5CA1A 1K73T 1ECBA 1A8MA 1VKNA 1A9YA 3VSEA 5LEKA 4DCUA 2PAMA 721PA 3EXHB 4XDYA 5T5JA 5JZGB 4FAHA 3H3FA 4Y3UA 4XWAA 1FYUA 5HRAA 3L0ZA 2OAUA 2J9CA 2XNDD 2REBA 5JCOC 3DCIA 5HPYB 5D4LA 1VL1A 3E97A 3RU0A 2WIDA 1EFDN 3RU3A 5LEJA 2CVQA 1L7LA 4ZOQI 1T2DA 2HWE2 2QMHA 1KTVA 4P5PA 1NF2A 2WUWE 4LF4F 3M8YA 1RQ0A 1RC6A 3VR3A 1UVNA 1EWYA 3VNSA 5I8PA 4TKVB 3PDHA 3TAQA 4LLOA 1U7ZA 3KM5A 5M04A 3X1KA 1IQZA 1GGMA 4M53A 3R5JA 4M55A 2C2EA 2ZDHA 3AYZB 1RJWA 1ZBE3 3WNKA 1CDEA 5C46F 1HWIA 4TS4A 3V4IB 2FLKA 2A58A 3RSFA 4CODB 3QLHA 2Q7DA 4DA4A 5JAIA 4N6OA 2W42A 4MQBA 1OQAA 1JEOA 1PX2A 4GE3A 4Y1UA 4GEKA 2Q8OA 1XCBA 1LRKA 2YUIA 2AHOB 1U94A 2N1BA 2O4UX 4XJ9A 2CNDA 2D7SA 1ZP6A 3FQKA 2DTXA 1BC5A 4NL4H 4D9JA 1RE1A 1VKOA 1YC2A 3TAUA 1A71A 4R8LA 2X76A 4NEGA 3SMVA 2RQ4A 1GANA 5LQAA 1VIVA 4N5NA 2IRYA 2FGCA 4LOKA 1LWNA 2IK8A 4GXRA 2OMKA 1RRGA 3RM3A 3NG8A 5AI9A 1A9PA 4B2LA 3UXEA 3AHCA 4I3FA 5EEHA 2XGOA 1OLXA 3EFOB 3F8SA 3F3YA 2WM9B 1PR5A 3MNFA 1ULDA 3HACA 4GX5A 4TV9B 2SBAA 1UUFA 4TTTS 3GFQA 4FKZA 1IK6A 1V6MA 4MKRA 4FBMA 1Z34A 1T8WA 1U2QA 2UUWA 1PZ9A 2R8IA 3B9PA 4PT6A 4RL4A 1SBYA 2V3WA 4QVIA 5FOXA 3HCAA 2OQRA 1FE0A 5ETQA 3PTLA 3DLEA 2PMWA 4R31A 2XLIA 4QR0A 3KEMA 5LMZA 2CQHA 5ECYA 2YW2A 5AESA 1FE8A 3NVAA 3RS9A 1I1GA 3D3AA 2WT9A 4DPXA 4UBKA 3G2QA 4OYRA 5FFFA 2X15A 3X2SA 1XDUA 1Y1KE 2J1AA 2YJNA 4ZOAA 4C7VA 1CZNA 1N34B 4NRTA 5D01A 3Q3HA 2XOEA 4IEZA 3CRRA 4LF7J 5SYMA 2E49A 2ID7A 2QAJA 5J40A 3RUHA 2ZR7A 2ROEA 2BERA 2FXIA 2I55A 5ENVA 1L4GA 2YKMB 4GSLA 4HWSA 4YREA 4KH0A 3KTQA 2ZM5A 2OSRA 3IALA 3FHQA 3HXQA 3D81A 1XZHA 5AC91 1T6BX 3E7WA 1U6JA 1NQXA 1NQJA 5JVDF 4MXDA 4XJAA 3OOHA 1T05B 4XDDA 2WNEA 2KX7A 2VECA 1WC6A 2OMLA 3EMDA 3GRFA 1KFCB 5BT9A 2TMGA 2UYHA 1WI8A 4SLIA 1CY7A 3WL8A 1XA4A 3L5OA 3UPDA 2VF8A 1YZ3A 1NX9A 3MDPA 4O2AF 4U36A 1BCRA 3ZIAA 4CDRA 3WHUA 1CB0A 3LNTA 3ETCA 4IGIA 4YFYA 4JX8A 3C6TB 4DLKA 3OSZA 3R7BA 2FNAA 1FRQA 3VDCA 2ZRLA 1GIAA 4IX9A 4Q1FA 5DX1A 1GUAA 1FSZA 2PA8D 1LW2B 2YWJA 3QBEA 4EQVA 4ND6A 4DBZA 1EFCA 3ZX4A 3GUYA 5ETSA 1BO6A 3QUAA 4RGQA 2JVKA 2LXIA 3R0JA 1BW9A 1QCCA 4YWJA 2OHHA 2ZSKA 4CDWC 2O3RA 3LWLA 4GM1A 2XF8A 1QR2A 2VOKA 5A7SA 2ZWVA 2FX2A 3VSCA 4KR6A 2CD9A 1PNTA 3SFGA 4CTOA 4A5OA 1XPJA 3PYEA 3AVTA 5TPWB 1RKUA 3E18A 3AONB 1H2BA 1Q1EA 5FA5A 1SHUX 3CF6E 3LE8A 5D3KA 2R071 4JBXA 1UL3A 4FVCA 2EQAA 1YDLA 4X84A 4LBQA 1IQAA 3T1HB 4HANA 3TX6A 1XJWA 3ZSEA 2DD8S 5T57A 4Q4JA 1IY8A 3A6FA 2VUTA 1OLRA 3ZZYA 3OEWA 4RDCA 2GCOB 3ITNA 2C7PA 4P3YA 3CUUA 5L1JA 4KKOB 1DQYA 4OIXA 1EVKA 1EVYA 3SAJA 4MNTA 2F4VB 3FPEA 3THPA 2HPAA 3VD9A 4K1ZA 4R7GA 3FFWA 3MAAC 3MLLA 4RS3A 4ZJPA 3PC7A 3PYLA 4OHCA 2OKXA 3KKNA 4ZGBA 3LANA 1OH8A 4LREA 1MS8A 4OX9J 1X60A 2ZT6A 4Q43A 3ZDVA 2DCJA 2C9KA 1CUEA 2A9KA 1UDBA 1SC9A 4DEVA 3DL4A 3W7BA 5D3QA 1DHKB 3CW9A 3PNKA 3EEOA 2XECA 1YJCA 4BMOB 1IPFA 3ITHB 2IUSA 2P1RA 1S3SA 1R092 1F3LA 3EGIA 2ATIA 4V0MA 2OV2A 3CZJA 3D6NB 5A3QA 1NULA 4IESA 5GAGI 2GHVC 4Y7DA 1WPRA 4G5RA 4UUMA 2A6ZA 4BFWA 1OI4A 3KL4A 4IGAA 3VPAA 2P5UA 1IZYA 5KCZA 3O8LA 1QPBA 4KLAA 1TA0A 1YRZA 4KC5A 4LMRA 3J80Y 3T99A 2BRTA 1T9GR 4YHHB 3H2LA 2PN5A 1EKSA 3D5TA 4OFBA 3ORYA 2HYDA 3DKQA 1VK8A 3U1NA 3L7KA 4V38A 2F90A 2DHRA 2UVPB 1LJLA 1YHNA 2IZ5A 2GBPA 4OZJA 3LC0A 3CIHA 3VR6A 2Z2KA 4LUBA 2FDKA 1UZWA 2DLDA 2NU6B 4MS1A 2W24A 1SVUA 1JYIA 1W7WA 1D0EA 1CJPA 4RTJA 2FRXA 2UVRA 1S8NA 4JBNA 5AW4A 3O90A 2BBEA 1TKDA 3OE5A 1KO5A 3E48A 1DEKA 3IKLA 4W5HA 3EZXA 3BWBA 4RZXA 2VBBA 3RVOA 3B53X 2A33A 1X7WA 3RZKA 3DEHA 5G4LA 1P1RA 2FMKA 1IKXB 5C4GB 4A0HA 4BNKA 4W1RA 2NUTB 2XS7A 4URHA 2CJXA 1Q53A 4IIUA 1QUPA 3EPKA 1QP0A 5LJ5Y 4B3SB 4TYAA 1N92A 2BC9A 3QU4A 5H9WA 3CPSA 4MVJH 4UCWA 2W2NP 2O0OA 2DVMA 3HT1A 2RBGA 3KK3A 1A7JA 2YDEA 1RTKA 4DDTA 5SV2A 3FBGA 2XLKA 1A5AB 5FZCA 2X10A 3RD5A 4M3CB 1Q22A 4ZTBA 1LRHA 4URSA 5K1ZA 2X4GA 3SFVA 3H5TA 3JU9A 3R8YA 2VR4A 3MAHA 4RBUA 1VHQA 3DPSA 2Q79A 1GSIA 3G59A 4PGAA 1EAMA 2C5AA 3H4TA 5GVQA 3TBDA 3GJAA 3R09A 2BOJA 3C6ZA 4JI8J 3J8F1 3FNGA 2VUHB 2Y6KA 1B0UA 1KERA 1K97A 2QXUA 3V1NA 3KKMA 1VKZA 2GRJA 4PTYA 1Y9AA 1X7HA 4IVNA 2VPYA 4IKPA 2WWVD 2GO1A 4Y2MA 3HEMA 2QLFA 4Z8YA 4DMZA 1GT91 3D4BA 3OTGA 2VJVA 4NHMA 3V2GA 2RG1A 2ZUGA 2NYVA 4CR6A 1JR3D 4IDKB 5C7PA 1Y4ZB 2CJFA 3PU6A 2UKDA 3WNOA 2FR8A 1B00A 5EHIA 4KR7A 2ACKA 4BUJA 2PL3A 4KDFA 3H1BA 4TL9A 1DPGA 1G2EA 1HNIB 1L5KA 4O4HB 4N7JA 5FL3A 1H2MA 4PGFA 3LC2O 2P0YA 1HOTA 3BOWA 3NHRA 3BFXA 3UCEA 2QUBA 1MO5A 2O19A 4B3RB 1G8YA 4IDPA 4G56A 4JJGA 2VBIA 1YS1X 1J2RA 4AYWA 1FKPA 2IITA 4MGYR 4X8NA 3AP4A 3L1KA 2IWRA 1WUUA 2RQKA 1SEVA 2RILA 2EC0A 1IGOA 2KB0A 1N2OA 2P90A 3D0JA 1FDIA 4MT1A 3QWPA 1Z2AA 1AQYA 4ISQA 1XKLA 3WZMA 2FCRA 4HDNA 2AVDA 3WLNA 2Z5GA 2R30A 1NXSA 2BJ3A 1V3ZA 2R32A 3N79A 3SHQA 3ZWVA 2KYZA 2QE6A 5JE8A 2GZAA 3EXEA 3OXGA 4XUEA 2G71A 4QFMA 2BQUA 3LUFA 4OG2A 3PACA 5FZ7A 3FCWA 3POFA 1ZW1A 2WLTA 1OOPC 1FXZA 1XUOA 3W5BA 1H93A 2OXIA 3U31A 5IHPA 1WCDJ 2RS33 4I1OA 2IYVA 4B4KA 4FOYA 2ZIEA 1XNBA 3MAQA 2WNSA 3DXSX 1L3UA 1CJKB 4N9HA 1IJFA 2UUBB 4QPGB 1RT7B 1OYOA 4E1VA 4JUAA 1WSDA 4Y6IA 5IVFA 3K0CA 2V63A 1Q3HA 4W9NA 4GZMA 3ZYCA 1HE4A 2B3TB 4JI2J 3QGGA 2GM9A 3O84A 1W48A 2NXNA 1F0KA 1ULBA 3CD5A 2VZ9A 1MF7A 2BBSA 3I0SA 2I7DA 2VZPA 2HI0A 3OGJA 3DMFA 1NJSA 1ETUA 2YNIB 2IPNA 3WL6A 3Q8KA 2R8KA 4UBIA 1LCIA 2P62A 4G1QA 3I6YA 4NWWA 3BGFA 3EE6A 2PUWA 2JHCA 3KQNA 1RZUA 3OMXA 1CF2O 5CDYA 3K2YA 1NKTA 2OENG 3GP8A 1JNZB 1FVXA 4DV0J 1CE8B 1FRIA 4ENWA 1UFWA 2LM3A 2WSYB 2JJ4D 4J0HA 3SR0A 2X2FA 1GTVA 1UQXA 2R8EA 1L7PA 4LRFA 3FBCA 2UXBJ 2ZUTA 3BILA 1X1TA 1RZRA 2QJRA 2B99A 4YBRA 4L2NA 2W01A 1SUFA 1GCIA 2PSZA 2YFUA 3RGWS 4AI8A 3E4CA 3GLJA 2KMLA 1H73A 4NQZA 2W6PA 4CYMA 2VOXA 4GKKJ 3M32B 3D54A 5IT0A 2MSNA 2X2PA 5JY1A 3AMQA 1KXGA 4DC1A 3VKLA 2VP5A 4C8KA 5BV0A 3LW7A 2P9GA 5AJHA 2NSJA 1I33A 5KJCA 3DD1A 3WP6A 2NU8A 3WL3A 2XCAA 5DCWA 2ALZA 3CN7A 3UICA 2O2GA 3MECB 1DGRN 2R043 2OI2A 3E3OA 2YC4A 1WUTA 2Q6BA 5KDLA 1TTTA 3U81A 2RAVA 1QSYA 1W0NA 2I4OA 5SY4A 1QSSA 2DH7A 2C54A 3ITEA 4KVGA 2B8EA 5ABJC 3FYUB 5E8JA 1TUBB 4GP9A 4L72B 2ZQZA 3CUSA 1QXRA 3LY5A 3KKPA 3UFBA 4JCOA 4A03A 2Q1ZB 2KZZA 2QV6A 3WINE 3LMKA 4WVMB 2ZIZA 2QPOA 4LJ7A 4O5OA 3OD5A 4TLMB 1V3SA 5E0OA 4Z0PA 1SH7A 4Z2WA 2WWGA 3FUWA 5CGZA 1ZJJA 3UBMA 2C2ZA 3QUSA 1PCAA 4XC9A 1E96A 3GLUA 1HL3A 5CFDC 1GXUA 3R74A 2PEZA 3BKTA 4GH4C 4OQZA 3D7NA 3AD8C 4WK1A 4JLPA 2XVXA 1UY1A 3B6KA 1G5QA 1O3QA 3MTBA 4YRLA 4AQSA 3COSA 1SC4B 5KFKA 3VAAA 4UF4A 2DU1A 1W6OB 3V81A 1AOXA 3IT3A 4A8MP 4IKEA 3EIXA 2F6RA 4RGGA 2IV2X 2VA3A 4C14A 4HX9A 4DHEA 1FRVA 3L02A 5KXBA 4A48A 4YGXB 3W77A 2Y4OA 3KYDA 4G0PA 3PUWA 1UAAA 1XMQF 5IXUA 3W9YA 2JIQA 5COBA 3GUCA 1G8AA 4NDNE 5FD1A 2N7YA 4D97A 1V43A 3PD7A 1N2CA 4D3FA 1BD4A 3HZRA 4DFPA 3P9IA 3A13A 1RMU3 1AR73 5D6GA 3PC8C 1MW7A 2FHPA 4BXOA 2DUWA 2CXXA 2K3KA 1VE5A 3NHYA 3TX2A 2Q8NA 1W44A 1V6NA 3A6KA 2XYGA 3QWIA 4B32A 2ZG6A 4RXTA 3AL6A 5CIRA 1SK8A 3TJRA 3I2YX 3JXEA 4P4SB 1B3RA 4XD7A 1T9WA 3JY6A 3KGLA 1JXNA 1WLCA 5BXYA 3THVA 3NHFA 4O0NA 2LEAA 4OAOA 1P2VA 2D2FA 2ROQA 1FSFA 1WEKA 3F71A 4JLUA 1Q7RA 5EJ9A 4EA8A 4INAA 1STOA 2JJ2A 4JR2A 3Q3IA 3AP1A 1RWVA 5CNKA 1Z26A 2V6JA 1USIA 1KDNA 4ID5B 1XMOF 4XMIA 1AA1B 3D59A 2OLKA 1NW4A 3BI3A 1XF9A 4TU7A 4K0RA 2B9UA 5AVZA 5L9AA 2FJEB 2VNOA 1YIDA 2GERA 4OXRA 2J5RA 2KLHA 1XN1A 3ECAA 3E5MA 1PK8A 2AZTA 2DGWA 3WP5A 1X7YB 1RFGE 4XIYA 5E7QA 4ZI3A 3C8UA 2D7FA 2VG7A 4M95A 5F2KA 5B55A 4BMSA 1JAYA 2WRZA 1D9AA 1HYBA 1H2ZA 3WMFA 2ET6A 5DDJ3 1NXMA 2JFFA 4ER3A 4UUWA 2XHZA 4NYIQ 5ARCA 3IQEA 3RGIA 1BROA 1N2HA 1BBT2 4JU8A 4TLBA 2AMCB 2IAJA 3PLRA 3DOUA 3ZWWA 2Y0IA 1VJ5A 1MORA 1D2NA 1T9ZA 1KI1A 2JZ5A 5DB4A 5FBJA 4MP6A 2HWB3 2HVZA 4CMJA 2OMOA 4HEA6 3PTRB 2P40A 2VP4A 1OC2A 4UUBA 5KMGA 3B4MA 4OYZA 4YGYA 5IPFA 4UPDA 5TF0A 3V1UA 2NYUA 5K20A 4FOOA 5T6MA 5EEGA 1U2GA 1DQSA 4GMKA 3VD4A 4DFSA 2GXQA 3RK0A 2BP7B 4BNLA 5TNXA 5DRTA 4EKGA 4GPBA 1JLQB 4XO0A 2ZH5A 4PY2A 2C5BA 1B6RA 1REQA 3WBFA 3O3LA 2JHGA 4I9HA 3T0GA 1FZTA 2CY6A 3CEWA 3DNCA 4E6EA 5C70A 4XABA 4I6JA 5CD1A 1BDIA 4KV8B 4B9NA 4OKSA 4CU6A 1ZBQA 1B35B 4RW9B 3SX4A 1G8MA 2DGDA 4X92A 5HR5A 3C85A 2V9KA 2VZ0A 4ZA2A 5EHNA 2KH9A 4LY6A 2VXOA 4DUTA 4BYMA 5EC8A 3DDHA 3WI7A 5E6HA 2YIDA 2ZOGA 1BCXA 4J6GA 5C3OA 4NENA 4DCJB 1POQA 1TU0A 1GMVA 4RL1A 5L3QB 1QKKA 2DAPA 1V8PA 4JEIA 1GQQA 3I5XA 2C4HA 4PRYA 1SCAA 1V6CA 3D4IA 4M8IA 3Q8EA 5ED4A 1YFXA 3ND6A 4C87A 1DURA 2X1MA 4EITA 1RYBA 3ZN2A 2J0QD 3U1MA 2B5JA 4L3VA 4HG2A 3D3NA 1N36B 1LSJA 4B43A 4CZ2A 5GAGU 4MUYA 3B85A 5DUUA 2QL9B 1Q1KA 5IZCC 1C5IA 3HHEA 4MRSA 3BAZA 3NHSA 3KZNA 2WZPP 3JYHA 1W29A 4QWEA 1N33F 1I5EA 2PSSA 4MCIA 3GYBA 4J9RA 2E55A 1KEXA 3W8PA 1PT7A 3H4DA 1N88A 1UPTA 1AQIA 1YSJA 3WGMA 1RGVA 3ONNA 5IHXA 3LVFO 2ABWA 2AXNA 4JXZA 2LKDA 1BDBA 3WKBA 5GZ6A 1XNDA 2WSSD 4ND8A 2WSBA 3DI6B 4CJXA 2F1JA 1TGYA 5L3SB 5FNVF 3LEIA 2PHUA 1HQYE 3N36A 3HWWA 3I2IA 2H3HA 3ZNPA 1TA4A 1KI8A 2FV8A 2N7GA 2EFVA 1DDGA 5BUQA 1BQPA 1KLNA 4IZHA 2GHTA 5LD2C 1Z6AA 3BZUA 3CF2A 1P91A 3A3KA 1SVOA 2XCRB 3GFGA 2VBGA 1C7QA 4FBTA 4EWEA 2X3DA 2HNYB 1FSGA 2I5JB 3DYIA 3H8YA 2JZOA 4DIEA 4AZ0B 4Y2CA 4J7XA 4GPTA 4KI7A 4OX9Y 2ZX4A 1SH0A 1E0KA 4DCOA 2M4MA 2W25A 2JE8A 1Q82T 1H1LA 3SWWA 3DL3A 3EDMA 2IZ7A 2R7QA 4QWNA 1C1XA 5IG2A 1VE0A 4O4IF 5MAOA 1J0AA 1GZ7A 2VF2A 1B4DA 4UTRA 4WEQA 2YUTA 3NEKA 3TZZA 3ZUGA 3RJMB 2O7NA 5JWOA 2ECOA 4RFT0 4RJTA 4ILRA 2YZ7A 4RQPC 3Q8UA 5THXA 2V6GA 1M5SA 1K75A 5EUBA 1RD4A 4H1UA 4OGWA 4C21A 5C37A 2ZC3A 4LOTA 4ER7A 2M2BA 1JQBA 4EY4A 4TQAA 1G98A 3W90A 3KPVA 4QU2A 3FMGA 2H92A 3WB2A 4B31A 4MULA 1CJTA 4IV3B 3S5AA 3GEBA 5LK7B 3DVAB 1SD1A 2CPHA 4ZJLA 3NOOA 5JPNB 1D7AA 1ODKA 4Q93A 5ALQA 5A7PA 4NG4A 4L8YA 4O3SA 4WFXA 3S7RA 3M1IA 2XT9A 4M4RA 3OAAA 1CD3G 3D1JA 3PY8A 1T2EA 1KZ4A 4FGKA 2H5LA 1XXHE 3EZFA 2XUMA 2ZFHA 1FEZA 5CFRA 2RM23 5DMXA 2ZUUA 2MKJA 3ZV6A 5J7MA 4FPIA 3FPGA 4MW6A 2XAAA 3D64A 4C7OA 2IC3A 2C29D 3VYSB 2QAGB 1UVLA 4HAXA 4YDQA 2IJGX 4C8ZA 4F3TA 3K70B 1EFRD 1DFDA 1NVVR 5HJXA 1G2PA 3MIIA 2X6QA 1J1IA 1ZBTA 3N6LA 1OA4A 4NA2A 3HO6A 3RS0A 2REQB 2YFZA 4UI9L 5JNWA 4Y2VA 2M7SA 5FPSA 2HAFA 2A59A 4QO8A 1Z0IA 2EFJA 1N2SA 3F3SA 5HK9A 1TK5A 1LGYA 1G1MA 3IHKA 5IVJA 1CZSA 3BTYA 1C8BA 4Y2PA 1BWSA 4YAJA 3NKFA 4BDTA 4ITUA 3N7MA 4WP9A 1RWKA 3MB8A 5DTQA 2ARXA 3HQXA 3ABIA 1TME2 3PPIA 4X7PA 2O1WA 3CRQA 5HAOA 3D6HA 4LZZA 2DR9A 1EV13 2CFTA 4NYPA 2BKPA 1T4CB 3ENRA 1MX9A 4CM9A 2MOKA 3KDPA 3AM1A 2YYAA 5D00A 3GSDA 4YCMA 4YV7A 5FA6A 1NTRA 3P9PA 1TRHA 4AYTA 2QLTA 1G2QA 1LY1A 3W5AA 4PC1A 3FMPB 3F3MA 4F86A 1KFSA 1CZHA 2C2BA 2VYNA 3AWIA 3B69A 3IEUA 2C8KA 2VG5A 1X3LA 4S1PA 4RHV1 3NORA 1N1SA 1FYXA 4S04A 5A2QA 3F4KA 3PFGA 2HHPA 2A0WA 1V16A 2H5IB 2EWWA 4AL7A 1IKPA 2ID8A 5FBZA 4C7QA 3TIFA 3ZOKA 4UOEA 1KFKB 1CVNA 5KZMB 1O0SA 4YG3A 3UDEA 3K9NA 1Q0NA 4WZBB 3CHYA 2VH7A 1GDDA 3JYPA 3SBOA 5JQGB 4L9WA 1AHPA 4OHBA 5H9QA 2C1EB 4QUIA 3ZJUA 3MD1A 3F0TA 3FK4A 3M3QA 4JUCA 4C8DA 1G5TA 1UXGA 1RUH3 3BSWA 4XFKA 3MF6A 1MFPA 3MCAA 2WJWA 1B64A 3PA6A 2YFKA 3WNMA 2FMIA 4JP8A 1P74A 3QKWA 5EUMA 3TWZA 1T36A 4DA8A 1VBC1 2I6WA 3TMYA 4ADSG 4QNNA 4XB1A 3RF7A 2XVMA 3IULA 1KK2A 4R3WA 2C4NA 1JFLA 1C2YA 4RY0A 2HJWA 4ND7A 2GN7A 1V4NA 2BE7A 1NCRA 4PYQA 1LX6A 3CNEA 4L27A 4OI1A 1NDCA 1DTWA 1ZCJA 3GV7B 2GH2A 3VBUA 2MQQA 3GZNA 1VBD1 1OYDA 1NKBA 3UJ9A 4F2RA 2KG0A 5CB6A 4CCDA 4B9SA 2ZOSA 3QHPA 2WZCA 3AW8A 2NMVA 4M5HA 4DLSA 1GV0A 4YGDA 2YMMA 3LKDA 2R4FA 3UGHA 4KJZA 4MPJA 3NNNA 2XB2D 2OECA 1TQ5A 2KDOA 4TWBA 5A9SA 5LU8A 1TMF1 4ESHA 1KRIA 1RWWB 1VR3A 1AR61 4Q9KA 3HX9A 3MWFA 3UDCA 1PHMA 2SCUA 4Q4V1 2C2DA 4IIJB 1TYDE 4PZAA 5JJKA 4OQNA 4BNNA 4YRGA 1PSWA 4OQXA 2XD4A 4DA7A 3MWYW 2FZ4A 1FJXA 4BVAA 3BD9A 2DCZA 1IXYA 2NM1A 3DAYA 5CNMA 1DRWA 3M6LA 3KHTA 3HJHA 2QTWB 4JKMA 3IR7A 1Q0QA 3LQ1A 2B30A 4YW5A 3HVUA 4ICIA 3DOCA 2QSYA 2AG1A 1U3GA 1DLOB 5C71A 2P69A 2GJAA 2XVYA 5JISA 3QKSA 3EA4A 3M1HA 3QGIA 1IDOA 3EOZA 2PH7A 3F46A 1VBA3 3DRRA 2O8NA 4Q3AA 5EGSA 2YNFA 4NICA 2OSQA 2RSQA 5F8PA 4XWKA 4I14A 1J0XO 2AC7A 3OZTA 3WLRA 3K1ZA 3CSDA 4FVVA 5JWPA 4FB4A 3WXPA 4P33A 1ZK0A 4AVBA 1DV1A 4KAIA 4TKUB 4DL2A 5E3CA 1R5BA 2CADA 1G4AE 3OKAA 4L15A 3WB9A 5D5QA 1OI2A 2WOMA 1CQJB 4M98A 2TMYA 1XQ9A 1DZ5A 3W5CA 4ZP1A 1CR4A 1JLAB 2ZKIA 3OTOF 1B0AA 1R8QA 2XWJI 1AR82 1ZVFA 4P82A 5JRZA 1JTFA 4QPYA 3E01A 2XUFA 3T5LA 2HJRA 4DLNA 3LCRA 1EB0A 4AFAA 4B7KA 1QZZA 4ZALA 1E3JA 3P9CA 3T35A 1S89A 3ZCQA 1F5FA 4UBNA 4F7VA 3QU2A 1GO2A 1SQ5A 4X4PA 1ZVQA 1U9ZA 2I1WA 3ONEA 1KU0A 1TL1A 4MVWA 4QIEA 3M4JA 3TJMA 1CVJA 1HNZJ 3T34A 1J0BA 4ZCPA 1RCFA 4ZGWA 1DDOA 2ZOMA 2QTFA 2A0XA 2J33A 4K6GA 2NACA 3GP3A 4QJ4A 1BMFD 4DARA 2Z2MA 2EIDA 2H2GA 4CL0A 1THZA 4B2IA 2CEAA 3AUJB 1WUHS 1ULCA 4LEJA 1IJKA 3D67A 1X14A 5F5XA 4ZCRA 3BN6A 4DZ6A 3LFTA 3LSDA 1OTHA 1D2QA 4X62F 3KYCB 4W5RA 1KU6A 3N2GA 3E2PA 4QLBA 1UP6A 1W581 4FF3A 1E1YA 5GVSA 1WCV1 4LWZA 4KAXA 1EJ6A 1FDBA 4Q01A 3RUEA 5T4BA 2WAOA 2ZJ0A 3GONA 4JBHA 3KLSA 1ZN2A 3JVIA 1JSLA 1EETB 3IQWA 3VR4D 2HA3A 2WJ3A 3EC1A 1N0UA 3V97A 2R8JA 1PGW2 4KSEB 5F8MA 2NW6A 4E2WA 3EG9A 4U7TB 4MHRA 5AW9A 1ACJA 3GEEA 4ISRA 4BNFA 2CDRB 4I55A 4BMDA 3VR2D 2BWCA 5BNNC 2QX4A 4OV6B 2YH1A 3TBHA 3H3ZA 3DHWC 1Y9DA 3KLMX 4O3NA 2R6GA 1J59A 5FBHA 1EUZA 1X86B 3A4VA 2P9QA 1YTLA 1LQ2A 4BNJA 3KQPA 4E21A 2RQMA 3G85A 2D7CA 5T7BA 4HNRA 3V4MA 1FK9B 2CHHA 5JCOA 4DC9A 4DMHA 1VCOA 3UW1A 5BWNA 1HBUB 1I14A 4FHEA 5BNPB 5CBPB 4KAAA 1CQMA 3QTTA 5J37A 3E3LA 1TZBA 5LT5A 4G5YA 1PL7A 3QSGA 1OV4A 1RAFA 3HFVA 3N70A 1EUCA 1KS9A 2Q6IA 1C0UB 1KETA 2XQVA 4I1YA 5IVVA 2RSLA 4IG9A 2MSCB 1ND6A 3VVBA 1ITPA 1Z2OX 3DAGA 2UUAF 1Z22A 1ND3C 2OAQ1 5C6CA 4ZLLA 4UBGA 3J80U 3HFGA 1VS3A 3ZXIA 4ZZ5A 1SXJB 5LCXA 4INOA 2QMXA 5C52B 4D41A 4KAFA 1WZXA 4YNBA 1RPTA 3CE9A 1IS5A 4COVA 3AJAA 3VJRA 4PHCA 1TL7C 2Y1IA 1RXWA 5A1JA 4B7CA 3N3HA 1A0OB 4IJ6A 4WJKB 2YKPA 2J1SA 4P9IA 2AC1A 3TQTA 1UYXA 3IX7A 1DQZA 2YWFA 1HYHA 2WBRA 3W3ZB 3ESCA 2VC9A 3WLAA 1RXSA 1G20E 3IWNC 1BE4A 2A57A 3FE2A 3I2DA 3EDRB 1DG9A 4ERDA 4YVWB 3OJWA 1TKBA 2CDNA 2OUGA 3ER8A 2J59A 4M21A 1U0OC 1W2HA 2XWBF 2EWMA 1GZ3A 4IXWA 1D1PA 4QDXA 4XEZA 1LXJA 1EDEA 1EJ7L 1LFAA 2OCAA 1AG9A 4BTLA 3C7AA 4ZVOA 3CVOA 3OZUA 2J7UA 3PGMA 5CJ2A 2UZ0A 3VU3A 3ZD9A 5I4CA 3GNTA 2ZUBA 3OF1A 2WA1A 1OU4A 1I0IA 4GYYA 9ATCA 1MU2B 1DAFA 4YJHA 4UM5A 1KYTA 4KDEA 1P2TA 1HI1A 3K72B 5G3ZA 1YK9A 1Y6QA 4FPLA 2OPQB 5JO9A 3DWGA 4F4DA 1UYYA 2XMAA 3KKKA 2FVXA 2WG1A 1W87A 2GO8A 4MRVA 4YS6A 4LFAF 2GCIA 4JRAA 3LCMA 2H48A 4KPUB 3CLSD 1KQFA 3BQ1A 3FBEA 5KFFA 3F7OA 4G4GA 4EJFA 5E88A 3BSFA 4IFVA 1U8AA 2GCFA 4PHZA 2P27A 3AXDA 1D6MA 4URGA 4FHZA 3GRVA 2CCKA 4QQNA 3D0IE 5J2MA 4AXIA 2J6HA 3L06A 2BE2A 3UWMA 4K0KJ 2PUVA 3I5YA 1I2AA 3I04A 2WFAA 4BRWA 4W6ZA 1CIVA 2PAEA 1MJHA 4F72A 4QMAA 3TYXA 4CYDA 5JSOA 1SMKA 3MWJA 1M1NA 4RXUA 2CGNA 3TN93 4FI3C 3MBIA 3AP7A 3O3OB 4V0NA 3TOCA 2PKWA 3BUSA 2IJRA 3JASB 3MXOA 2ZSHA 4D3DA 1FFDA 3DUIA 2ATFA 3H9EO 3HDQA 1J6UA 2YS7A 1R082 3PFWO 1LW0A 1DIAA 5H7XA 2C96A 2QVGA 1T4MA 3K4PA 3KMSA 3MOZA 3QLQA 3LUCA 3ACDA 4UVEA 1QO0D 3OCCA 1GXSA 3I2GA 2V5AA 3HB0A 1EXDA 2HRUA 1XNRF 5K6TA 1QG4A 4EG8A 1DIBA 3J7LA 2HNAA 4EYUA 1JH8A 3EWSA 4YA6A 2PK3A 3SQWA 3P0IA 1U8UA 1X80B 1TL4A 4EBEA 1SBRA 2YXPX 1X7VA 3UJDA 2ZB3A 3QTLA 2QLBB 2SECE 2GPTA 1IPEA 1QC5A 1IOLA 4B83A 3M30A 5A32B 1WBFA 1AL0G 2ZXQA 421PA 4EI2A 2QLXA 4INPA 2C2WA 2V98A 5EHHA 2FW8A 1T1EA 4I9UA 4LF7B 3TEWA 3KAJA 4HI0E 3OUYA 3PDWA 2W2LA 5AXLA 2HJHA 1H8VA 1DEOA 2IQIA 2E4WA 2A14A 1VCHA 3KB5A 1VKJA 4EI8A 2XXAB 2PTGA 3ESZA 3GEHA 1D6NA 3HQUA 4YB5A 3UN1A 4OJGA 1KGSA 2PRIA 2EBFX 1QLHA 2QM3A 4H4DA 4EMBA 2OB2A 5L4LA 2O3SA 1MS5A 4MUHA 4AQYJ 4WN3A 2JEMA 3G0BA 1VYVA 3R3WA 1QV6A 1SKQA 3CGIA 1II0A 4UM7A 1QFJA 3O8OA 4U7UK 4UEKA 3DYAB 2PJRA 3T9ZA 2A6WA 3K05A 2MEV1 2FN4A 2VQFJ 3LRPA 5ARDA 4H17A 5FT9A 1QJCA 4OI3A 2OZ6A 4F2DA 3AERB 2RGBA 4FDTA 1C1DB 4GAZA 3ZZMA 5HF8A 4KLZA 2OZLA 1S0EA 4AO8A 5LY1A 4NP6A 5IK7A 4FDUA 4X65J 4P0TA 2Y67A 4NLRA 5ETLA 4DUZB 4GC7A 1VHJA 2ZDOA 1WBDA 3CC8A 2C3OA 3ZH9B 3IV7A 1JLEA 1SD2A 2WJZB 1HDZA 2W6JD 1PG0A 3OO1A 1KE2A 1P9QC 5L7WA 3K51A 4BNWA 3EQ7A 4UF0B 5EMNA 2NXUA 5C8CC 1EQUA 5I7HA 5K4HA 4D44A 4DQVA 1S4MA 3GFPA 2GDFA 1RTDA 3Q8AA 1K9MT 3TSWA 3K92A 5LC1A 2GBGA 2ZYWX 1I24A 2Z30B 1MJ5A 2J67A 5AVQA 2EHDA 2GHWA 2F6BA 3OG2A 5EIBD 2FEOA 2G4BA 4FQ7A 1RGSA 3CF5Q 5EG5A 1ITZA 3OY7A 1JEDA 3SX0A 4AI9A 1HQEA 2GFIA 1XTSA 2VCCA 2QMQA 4FPYA 3QWBA 1Q8OA 1UKAA 2QG9B 1NT0A 2HU8A 2OD2A 1RP1A 5KTTA 1RT5B 4YO8A 2R1DA 3ZTSA 2BYCA 2HDHA 4OATA 2RKIB 2IODA 3ETQA 4K7JA 1U9YA 4BBJA 3G1UA 4R68A 4Y4YA 3SBXA 2OYSA 2M1ZA 4WZMA 3D4OA 3A05A 2FEKA 3HU5A 3I0NA 1EJBA 1X4FA 4BLUA 5E41A 2PA0A 5JS7A 3PCTA 3LUGA 1L4FA 2FQ1A 1G5IA 1ZOPA 4DFJA 1OFSA 3AIIA 4R2LA 1DEXA 3GC6A 2PL9A 3FHJA 3K1AB 4A8JC 2J87A 4RQUA 5KYXB 4BV9A 3JD71 2KTQA 3A4IA 3B1XA 3MM7A 1QYCA 4NLWA 2EJWA 3CT9A 1C1LA 2BFBA 1A2BA 2Q3MA 2ZU6A 4YW3A 4R8UB 5DIFA 3T3PB 4W5JA 1WTFA 2PL1A 2WVGA 3BGUA 2B6AB 2H5EA 2C1ZA 4ZZ3A 1A9NB 1NRWA 3P94A 2DE0X 1W88A 4TXNA 3VZHA 1XALA 3IJEB 4GW3A 3MJFA 1M74A 4B73A 2EJCA 1FU8A 4DANA 4Q26A 4WD3A 1LOUA 3OKFA 2GM3A 3SC2A 5C7OO 3VZKA 3ACGA 1WG8A 2EF0A 2V4JA 3M05A 3TBFA 3PX7A 3WWEA 3HHLB 2WQ4A 2N0SA 4BUCA 1M5HA 4XMAA 4HZIA 1EUDB 3R6TA 5DSXA 4WY8A 3G2PA 5IWFA 3W64A 1Q56A 1AHSA 1FTCA 1HMYA 4LA4A 2R68A 2JI6A 4G3IA 3N8KA 4FPCA 5C4WB 2ZRQA 5IC6B 5AE3A 3QW2A 4QUEA 4FNGA 5KO2A 3CF4A 1V8ZA 3ITDA 1IB0A 1QTIA 2DNQA 2QTZA 1ID8A 2D7JA 1G8HA 2QX0A 5KKNB 4RETA 5TV2A 5IM5A 1DRJA 3CUWA 4KKVA 3M9LA 3IBMA 4DDWA 4ISCA 2OEJA 1H2NA 5AHXA 5LZ6A 4P9YA 4JR0A 2SICE 1Z74A 5B12A 2GAOA 1UF2C 2V45A 1T2XA 3SDSA 3GGPA 3C41J 5PNTA 4N77A 1IZZA 2KRBA 4PBSA 1H69A 2XNKA 1GXLA 2CB9A 2IP2A 2FMHA 2GC3A 2IRUA 1Y4AE 4AF6A 3MCWA 4P32A 3RK4A 5B4VA 1ZHHA 3ZDAA 4B9UA 4KPGA 3CCVS 3NGXA 3DPRC 3I12A 3PFNA 2X05A 3TNYA 4KXQA 1W05A 4Z7CA 4DY5A 4KDCA 5AXDA 3HXMA 1SQ6A 4PI0A 1AHNA 2VDMB 3PFKA 4TVSA 4B3BA 3IN9A 2D1TA 1PUJA 1SM4A 5AHRA 1RUI3 2FMYA 3PRHA 4ZS2A 5ETRA 3BYRA 1N78A 3ZHOA 1YFZA 1XXHA 3MEEB 3IP5A 2ZH3A 1B41A 2QV0A 1O94C 4KU7A 2QRGA 1QU2A 5HA5A 2AUYA 1KP9A 2XLCA 1OOPA 1EUTA 5FOTA 4LMBA 2QLMA 1SJ9A 4JGZB 3PZBA 5DWQA 2YHJA 4G0ZA 2J6SA 1HNXB 1JOBA 2R8YA 4Q1CA 5TQ2B 4UHFA 2VZOA 4AN4A 3W9IA 3FPCA 2G67A 4YECA 5AKXA 2X1FA 4EB6A 2CJKA 2WN2A 1LWFB 2FXVA 5BNIA 2CHGA 3MJVA 4YN3A 1NM2A 2JDZA 3WGHA 1Q7YT 1F9KA 1EP4B 2ZKLA 2BFOA 1L5OA 5D2AA 4WE1A 1TRKA 3ZQJA 1WHWA 3A1UA 2ATXA 2GD2A 4URZR 4JJFA 1RA6A 5CB7A 2HK9A 1UEVA 1UINA 3J7YI 4M00A 3GR0A 3Q3CA 4EEZA 4LYDA 1T3SA 3V8MA 5FZ9A 2VWPA 2LCQA 3WDUA 4JYPA 1VLLA 1VISA 4GC9A 5DGTA 1JLRA 3THYB 3D66A 1QDLB 4DREA 4DTCA 1R5JA 1F60B 5KFVA 3A70A 3GLQA 3FGVA 1QQ7A 1BSVA 2FSIA 3WGLA 5HMLA 2D3ZA 2ZWPA 3MD0A 4HBGA 1KR5A 4G07A 4LE1A 1G8PA 2VTVA 2G1HA 4Q0VA 1RUG1 5F2SA 2VA9A 5IULC 5CZVA 2BFNA 1YRAA 4J1WA 3CONA 4PF5A 2A9QA 3MF5A 1F3VA 1NWHA 4POOA 5JVHQ 4DSKA 5EP4A 3F6EX 5M2QA 1CZTA 5H70A 4L02A 3Q3VA 1YS9A 2OQ2A 4L7QA 5CAZA 2BABA 1NJ6A 1ONPA 5TSDA 2EBHX 4AW7A 4M0CA 1FOD2 1ETHA 4DPOA 3VBHC 2MLYA 1ZDMA 1Q43A 1C1CA 2MB0B 2J3HA 1AUQA 1R5NA 4I5FA 1T5OA 1HZJA 3FHTA 2JKVA 3KCCA 1J0EA 2OM2A 2QVXX 4L78A 1ZRFA 1JS1X 1QRAA 4I0WB 5KWEA 1WMSA 1TG7A 3LA0A 5ES4B 1MRZA 4RSUA 2DWRA 1QHSA 3IPLA 3ZXXA 4EG5A 3OY8A 3TKYA 4RF4A 4DN0A 5ABJA 3CLUC 2G80A 4ZRMA 2JD4A 2BGKA 3DJYA 3UDVA 3GJ3A 4IYQA 3NLLA 3KZOA 4FYYA 4HVTA 2BTOA 2PH3A 4LNUA 1Q8VA 3U3KA 2FFQA 3E2MA 2FPGB 3RT1A 3O7OA 4NOTA 1WG1A 3FOZA 4OSPA 1UCNA 2OHJA 5I4BA 5EYYA 2X7JA 4I5EA 1W6PA 1DAOA 3L46A 3UPFA 1GA1A 2CQCA 5LOQA 5ISMA 4ZYLA 1YJLA 3EX7C 1PSDA 1HFJA 1LFWA 4LG1A 4GH4A 5F7XA 2JJ1D 5DEOA 3D2WA 1BTOA 2HJ9A 4JTNA 1K0VA 1BMQA 4F04B 3LKVA 5AW8A 4LFCJ 2QUOA 5D3ZA 4CI0B 4B4PA 1K1EA 2YROA 4HTFA 1JX4A 1HQCA 1OTYA 1CUHA 2YNMC 4F9TA 4RKWA 4JJ7A 5FY9A 2YBEA 5LMCA 3DMHA 3GRRA 3RVRA 5EXDA 2ZWMA 4AS1A 3AEKA 3L7UA 1JDSA 2HBZA 4MEJA 1ZBE2 2DNKA 3Q83A 1W28A 3ND5A 2VYVA 2CJ9A 3TQOA 1MQSA 1VHTA 3ZPOA 5GZCA 4KHRA 2Q5HA 3QEAZ 4KV7A 3GPLA 2HMUA 5F1PA 1Q1AA 2HCBA 2O8DA 3AK0A 4P2XA 2A3XA 2Q1XA 3PC8A 4BVKA 3ULKA 4ED1A 4WCDA 3SZLA 2VRCA 2H0QA 1WVGA 3VVLA 2UZ3A 5KNLA 2HHAA 4XUOA 4QPXA 1ZD1A 2QT1A 2YKGA 4DQRA 2C24A 4PLTA 5H16A 1G6Q1 4ITRC 1ISPA 5DF1A 1B99A 1R091 3LB9A 4A6SA 3KD3A 3EZ6A 2OAP1 4LF6J 1PFWA 3E35A 4CWAA 3WG1A 2ZC4A 4CXWA 2CD7A 1NBIA 4JJEA 1GGHA 4LGCA 2Z09A 1N2XA 1GOTA 1AMUA 1U9CA 5KYUB 4KGDA 1A8PA 4E5VA 4CO3A 3KQSA 4Y28C 4J7UA 1O8SA 2E9QA 4MKGA 5UKDA 2RHLA 2YBDA 3D7SB 4GWGA 4E88A 2XMDA 3KLPX 3GPCA 4B8YA 5A7HA 1RKBA 5AKLA 2BKAA 3EVWA 1JZ5A 5CMLA 3MQ2A 1C8M1 4QVGA 1VRH2 5IK2A 3DTVB 2VUGA 1Q8LA 2DHQA 1UK6A 3CJ0A 1XCPA 4XF3A 2GAIA 4ZVSA 3MJ4A 1RI2A 1M67A 3WDXA 5JYBA 4XAAA 3VRHA 1WEYA 3IG1B 3G7DA 5B30A 1E5TA 3WQPA 1QGZA 4A46A 2N3OA 1YOVA 1X0FA 2LP4A 2PHXA 3ORSA 2Y1RI 2DEUA 5F3WB 4WLVA 4BFZA 1W3VA 5EQFA 3ZY4A 4MI1A 1MKYA 1RJDA 1DFIA 3J4UH 1AJOA 1JHQA 2O8BB 2VHYA 3Q4GA 3LP1B 4EEYA 2XZLA 3GO4A 1WLSA 2VYCA 5TX7A 4N03A 4BB0A 1PT6A 5HANA 1NPTO 2BQRA 4HVCA 3K35A 5EPEA 1JLBA 4I5IA 1KE1A 4KSCA 1D2AA 1VBE1 4JITA 1D4VB 2UZ1B 1AQUA 4DIKA 2BGOA 2VDWB 2ZS9A 4ZPTR 4EUNA 2QNIA 4RW7B 4RSMA 1RAAB 3W66A 2W2PA 4IUBS 2ZYHA 3NWEA 3M9NB 3UQZA 1YKWA 1ZI8A 4TV9F 3PZRA 2ZRHA 4EUEA 4AOCA 2WF6A 4E8UA 3ISTA 4F1KA 3ETDA 2IBTA 1O6XA 5KFNA 1JKJB 4YRMA 4LBMA 1J27A 3V8EA 3PIRA 2O7QA 3HY4A 1RAJA 1IFXA 1NQAO 3PJ9A 1NA5A 4CUZA 1TW2A 4R2XA 2NIPA 1E2KA 1LW7A 3ZXUB 4O9EA 4H7MA 1A9ZA 1MDBA 1G1AA 3IDQA 2XI3A 2MJUA 3AGPA 5DXFA 3SZRA 1N34F 1RLJA 3H84A 5AE1A 3RBXA 3MRTA 1PG5B 4JXJA 2D6FA 2PEYA 1U1DA 4BN0A 4Y2JA 3TD6A 4OH7A 2KO1A 3FPHA 2PE8A 4M8SA 2GQCA 3ZVKA 3WWPA 1JPVA 4RTKA 4O2BB 3AM4A 3BMQA 3BTUA 3STXA 1D4OA 5JD3A 1K6IA 1VE3A 2PAKA 4F8JA 3FFAA 4PFJA 1E18A 3ZK7A 2QKDA 2W71A 5HJ7A 4Y1RA 5JALA 3FI9A 1ZWLA 2C9OA 2WUGA 1AXQA 1X7ZA 5JMPA 5T7LA 1QBGA 5HROB 3VWSA 2AUMA 1SC1A 2HJSA 4ZYUA 3FDZB 3D0GE 4K5QA 2R00C 2VHVA 3L9XA 5GOTA 2VBDA 4NWVA 2WBLC 2CPFA 1VQPS 2JHFA 2PZMA 2NGRA 3LHDA 3ND7A 4JKLA 4HXEB 5THQA 3QEOA 4TTAA 1C4RA 3AL3A 1XR3A 3OIFA 1Z16A 4KE8A 2HBRA 1JXEA 4FVMA 3R0IA 4PWWA 3KJNA 2E1PA 4EYIB 1MO2A 3V1TC 4ARBA 1V70A 1DBSA 4Q7LA 1Z2EA 3GZUC 3AOGA 4AZVA 2ERCA 1XYNA 4R8VA 3ZCTA 1E9AA 1XLVA 2GHRA 2F9JA 3LO3A 2QENA 3FM9A 2FSHA 4Y26A 4L3KA 3EY4A 1NXIA 1N9ZA 5TLSA 2H4HA 2O6HA 4RK6A 4Y0FA 1E1QA 4HQOA 3QQ5A 5G4DA 1S6YA 3QLVC 2CPDA 1JLLA 2ZT7A 4AMYA 2DM6A 2LDXA 1RUD2 1UQTA 3ISND 3SPXA 3LPDA 4X7RA 3ZJVA 3GDFA 3ZHRA 3GSIA 3TMKA 5HN0A 5A5GA 3CD6S 1X9PA