3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Subtilisin-like serine protease
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
3SQOP 2XTJP 1PTKA 2W2PP 3VV3A 5JXIA 1CNMA 1IC6A 2Z2YA 1KDZA 4BWGA 3JQWA 4AKSA 3DE3X 3DWEX 2Z57B 1IAVA 4YN3A 1SCAA 4H6WA 4K8RB 2QTWA 1T1GA 3DE0X 4ZARA 4OMCA 4OV6A 3GCWA 4KPGA 5ARBA 5FFNA 5ARDA 1BFKA 1SUEA 3DW1X 2XVGA 1KFXL 5B1EA 3DVQX 1PEKE 3WQBA 3BGOS 5JMOA 3QMPA 3H42A 1KDVA 1P7WA 2XTJA 3VTAA 5FBZA 1ST2A 1SUCA 2W2OA 1SN7A 1P8JA 5JXJA 1ITPA 1Y3BE 5JXGA 1S02A 3D9QX 4HX2A 1SUAA 1TO1E 1BFUA 1HT3A 4I0WB 3AFGA 1SPBS 3VSBA 1DF0A 1PJ8A 4G9SB 1MPTA 4CFYA 3I30X 1GTL1 5ARCA 1NDUA 1TMGE 2PWBA 1YJBA 3HJRA 1SBHA 4NMXB 3A3NA 4DZTA 2SNIE 3DE2X 1NQDA 1OT5A 2PMWA 1BJRE 1GCIA 4KB5A 1KE1A 3A3PB 1SUBA 1S2NA 1VSBA 3L1KA 1SIOA 3GT4A 2Z2XA 3QFHA 1V5IA 4DY3A 1Y48E 3BOWA 2GKOA 1DUIA 5JXHA 3ZXXA 1P7VA 2ID8A 3SQOA 4Z2AA 4C3VA 1YU6A 1SIUA 2P4EA 1GTJ1 2ZWOA 4OMDA 1WVMA 4DXZA 1PFGA 1ZVJA 3VHQA 1SBCA 5CW1A 3EE6A 1OYOA 3Q40A 1Y3DE 4DZGA 1SCJB 3H42B 3LPCA 5AMXA 4FONA 3VV2A 1Y34E 2Z2YB 1ST3A 2V8BA 4NE9A 1S01A 4GI3A 1SUDA 2IXTA 5I9SA 4JP8A 4DWWA 2DP4E 2WUWE 3F7OA 2W2NP 3CO0S 1TM7E 1Y4DE 2W2PA 4WOBA 3BPSA 4MZDA 4HPKB 1SELA 4LVNA 1GA4A 1ZVKA 2Z56A 2X8JA 3Q5GA 1SH7A 3JQXA 1R64A 1XF1A 2ID4A 3AJ9A 1Q5PA 2SBTA 1NDQA 2PRKA 2ST1A 2DQKA 2PMWB 2X8JB 1SBNE 2O8OA 5AVJA 1Y4AE 2XVLA 2Z58A 3DF0A 1KDYA 1A2QA 1V5IB 2G4VA 3F7MA 4CG0A 1TK2A 1BE8A 3AJ8A 1NLUA 3CNQP 1TO2E 3GCXP 4B5LA 3CNQS 1AVTA 1GTG1 2LUWA 5SV5A 3DYBA 3LPDA 2PWAA 1Y33E 1SCDA 5AQEA 3WHIA 3WIUA 4DY5A 3VV2B 3F49S 1C9JA 3DE1X 2W2QP 1NQJA 1C3LA 2QFEA 1MEEA 3P5BA 1BH6A 1EA7A 4NE7A 3PRKE 2Z30A 1JEAA 2DUJA 2WV7A 3GCXA 1WMDA 3P5BP 1GNVA 2XRMA 3EIFA 1Y9ZA 4DJ5X 3OSZA 3A3OB 5K7SA 4HPKA 1AH2A 3TI9A 4J94A 1GT91 4ZOQI 1SBIA 1T1EA 4CFZA 1SPBP 2E1PA 1SIBE 1Y3CE 1GA6A 4H6XA 1U5IA 2ZRQA 4M1ZA 1WMEA 1QXPA 1AQNA 3I2YX 3LXUX 5AVKA 2Z56B 3DW3X 4C3UA 2SICE 2HD4A 1TECE 2W2NA 1TM4E 1CSEE 1EGQA 3D43A 1KFUL 3BGOP 4KG7A 5SICE 1R0RE 4NE9C 4WOCA 2Z30B 3QTLA 3GT3A 1UBNA 5B1DA 1LW6E 2W2MA 3CO0P 3LPAA 2HPZA 4AKTA 1WSDA 1TM3E 1WMFA 3DVSX 1C9NA 1SVNA 1C9MA 1Y3FE 1V6CA 4K8RA 3SICE 4YN3B 2Z57A 4H6VA 1SCNE 1TM1E 2XVKA 1AF4A 3WIVA 1THMA 1SBTA 1AK9A 4OV6B 1AU9A 2ZWPA 3DVRX 2Z2ZA 3ZXYA 1TM5E 3I34X 3TI7A 4HVLA 1SUPA 1AV7A 1OYVA 3A3OA 3A3NB 1SCJA 2PYZA 1YJCA 1Y1KE 1R6VA 2PKCA 1GNSA 2WWTA 3DE4X 1GA1A 1KE2A 2SECE 1DBIA 1BE6A 2W2MP 3TECE 3T41A 2B6NA 3GCWP 5FAXA 1T1IA 2WUVA 3I37X 3BX1A 4LVOA 2IY9A 2TECE 3UNXA 2W2OP 3DE5X 4RYDA 3PTLA 3A3PA 3BPSP 2PQ2A 1YJAA 3DDZX 3EDYA 2Z58B 1SCBA 4I3GA 2W2QA 2QTWB 3DE7X 4NMXA 3DE6X 3VYVA
chains in the Genus database with same CATH superfamily
3TTWA 3EQ6A 5BVHB 1XEXA 3RYIA 1JI0A 1HB4A 1VISA 3G0OA 1MC4A 2CDPA 4JDNA 3VR3A 3KYDB 4LSLA 4YR0A 4LRSB 4I50F 2RMLA 3DC2A 3HSGA 3H13A 1ECCA 1HA1A 1HH4A 4MPJA 4UUBA 4DPYA 1FRQA 4L8FA 4KE6A 4IV8A 4OI1A 4R0MA 1Y3IA 1UETA 3CSDA 1G20B 4ZCLA 4UHCA 2A9OA 2EFPA 4ZIRB 2C9YA 3S0JA 1R0WA 3GRVA 1NXWA 4MLCA 4XD7D 3AHHA 2E85A 2HNAA 4DJDC 1T9UA 2RJLA 2PKQP 2CLOB 4PX2A 1VKRA 3VDCA 5TT0A 4D6QA 2A3RA 3DT8A 4EITA 2QZPA 1UBTS 5L1IA 1PQYA 5A9SA 3LBAA 2AF6A 4KJIA 3WAKA 5KCMA 4FFMA 1YZYA 3ZE7A 2BEUB 2YWXA 3FRIA 2C2XA 2QMUA 3OTQA 3A1NA 3O4VA 1QGLA 4OTZA 5T6MA 2C1ZA 1JFTA 3ETCA 4YJGA 3EW9A 4DR5B 1T4BA 4EIWA 3ZJTA 2KR2A 1KI4A 1ORTA 1N6LA 2AX3A 1MOSA 3O1SA 1XF9A 4TYBA 2GHVC 2PO5A 1S2NA 2ZXUA 5BPXA 3MINB 4II3A 2ZHAA 4YRJA 3W3AA 4E4SA 1DUVG 3PT9A 4FLEA 2J5RA 3GLJA 1W8IA 3G79A 3FXAA 5H9RA 1WAMA 3HPNA 3N2IA 4L6IA 4B48A 2V8PA 2Y93A 1VBD1 4MXVA 4JKYA 5DJ5A 2OGWA 2A4KA 4BWFB 4EEXA 2PHRA 5DPNA 1MS4A 4RVSA 5DLYA 3GDBA 3MEDB 4JITA 4GPEA 3NKVA 1CSJA 3T1AA 1J4AA 4KHZA 2J9FA 1B3BA 2O5EA 4F04A 1SCQA 2XDQA 4RTQA 1YK9A 1T5HX 1F6WA 1I3LA 2B6AA 4D6YA 3C98A 3VC1A 2PM8A 3AM5A 1QNWA 3RJ2X 1XMJA 4XIYA 4QCLA 2OV4A 1ANKA 3RUCA 4FKXA 2FG5A 2MTBA 3GIKA 4MRMB 2XJSA 2WN2A 3DYOA 4V1PA 1RUNA 3LP8A 4RLHA 1AXEA 1N6KA 1PO23 3IHKA 2W2PA 4NOHA 2YJNA 4ED0A 2QAGC 2QMXA 4WPAA 3PXEA 1UK7A 1NQTA 2BCEA 4UUXA 3IR7A 4YXFA 2JJYA 3GBSA 5FDFA 5FZ1A 1V3UA 4XLLA 2VKZG 3WINE 3SC6A 1V4VA 3PTWA 3HBFA 2C95A 3PNOA 4TT8A 2OMEA 3VDBA 2EX0A 2MMCA 5GVQA 2UYHA 4WCFC 3OGRA 1DQ0A 1W6OB 3DF0A 3DLCA 2Z0MA 2AFHE 2XM3A 2EC0A 3IULA 3U6KA 1AFJA 3W9BA 1UXXX 1IK4A 5DO9A 5ESWA 2V5VA 5LMUJ 1XZGA 2ZMKA 4EABA 1ZN9A 1JNRB 2E21A 4KO1S 2AYBA 1V43A 4Z6KA 1ZZBA 3PCRB 3N9QA 2LALA 3OGGA 2WRZA 3S2GA 1JLLB 5J1NA 4K5QA 1VI7A 1G2QA 4Q3KA 5IEBA 1UOOA 1YQEA 2KYRA 3IT1A 1PR5A 1KVKA 5H9SA 3B53X 3VAAA 3ZDFA 1V8BA 4WINA 4WW0A 1GCAA 3K09C 2NZ9A 3DHVA 1DQ4A 3BGAA 4OREX 3D3KA 4J5OA 3WGKA 4EG8A 3ELYA 3KQUA 2NOAA 5KHOC 3VDDC 1X4GA 4JXKA 2RD5C 3PFWO 2L3MA 3CH5A 2QGZA 3GV7B 1V8FA 4QNMA 4I7FA 1WE2A 5EZSA 4JX0A 1EWQA 1MSWD 5AXAA 5FH9A 3B9QA 4MWEA 3KVOA 1LRJA 4IDFA 4B73A 4FPJA 4ET7A 3NBPA 5TRTA 2EJTA 4QXMA 1UBCA 2BVBA 3IALA 2IDKA 4YB1P 4LBQD 4RNFA 3PO5A 3TW8B 5U9CA 3C2QA 5TMPA 1CSEE 4LSWA 1PNVA 3TBDA 2BJVA 4NIHA 2F1KA 4PFKA 3WV6A 3OZRA 4L97A 2R041 5DLGA 1CAXB 3N7AA 3WL5A 3QTLA 4C6RA 1FZTA 3PUIA 1JXQA 4LNVA 2HU8A 2DYAA 5KMGA 2D0IA 3H8UA 1Y5MA 4MGZE 1N2EA 4NOTA 3QEJA 4BLRA 1W4CA 2R00A 1XJWA 2HQBA 4G4GA 3BWCA 2R2TA 5MFZA 4DUYB 4DPLA 2HS0A 1JG7A 3EUFA 1A6LA 4UVGA 2DVIA 2IYPA 4IUCS 1WP9A 3CWJA 5KJEA 4YRPA 1VGYA 5ETMA 3I6BA 1CU1A 5F8HA 2ZRFA 5AJHA 2MR5A 3OWHA 2P6MA 1HR0B 3K5OA 4E03A 1XU9A 3PB3A 3D54D 4D7YA 1KJYA 1C0PA 5DM1A 4R2HA 3UMGA 2WN3A 4CCMA 2PS9A 1M7GA 5NULA 1BU8A 2QVGA 4CTNA 2GC1A 2PMFA 2O66A 4I2PA 4A23A 1P3JA 4XGKA 1U3WA 5J5VA 1DL5A 2CEAA 1M0WA 3M32A 3DQPA 3ZOKA 1DS6A 1ZA4A 2I6UA 1LW7A 2HXGA 3U80A 5I01A 1C80A 2H9ZA 1ZETA 3J81k 3MD3A 1VLVA 2RVJA 1ORIA 1IMJA 4NMMA 2AJCA 2WFF2 1EP0A 1G9DA 3RQ0A 1RWMA 3TDKA 2XQIA 2YHBA 3AOGA 3S2EA 1L6RA 1YBMA 3MA0A 2R32A 1CR4A 5JVDF 5DNAA 4PUOB 3JWIA 3UJNA 4HD8A 5T54A 5KFBA 5HTKA 4C0BA 1RISA 1M1NA 2ZGPA 2XQCA 3OWXA 1SAYA 2B4UA 2HO5A 4TS4A 2WC2A 1TQ8A 4CMIA 3H87A 4R1UA 3WSVA 4R3NA 4N82A 1IOLA 1KYWA 4HONA 5HJYA 5LW9A 2DGWA 3VC7A 4F26A 4Y1RA 1OF1A 2WT1A 1ENSA 4IOBA 3ATGA 1EZ1A 1ZS6A 2W2TA 4IJWA 2PHXA 2GLXA 5AXMA 1PFQA 1JIQA 2WOOA 1A8PA 3RDPA 4M8KA 4PPZA 1GQHA 2RHHA 4GBJA 2VD3A 1HE5A 5B0GA 4G9GA 1VJQA 1DG3A 4F7ZA 5LDHA 3SJUA 1GLHA 4EI2A 2OXIA 3SXWA 3G85A 5EJ6A 1Z0SA 2C2WA 3G2MA 2Z8XA 3ZEAA 3B78A 3KLNA 2KT3A 1GXLA 4FHGA 2E4ZA 4MUEA 3A13A 3GFVA 3AKSA 4OMFG 3J80U 3WMXA 4BRZA 1LSSA 4LOHA 3SMVA 3GJRA 3QFHA 4RL1A 5EE1A 3OHPA 2ODEA 3BA6A 3FIUA 5DYWA 3BE8A 1N33B 2W4DA 3OFKA 1GNRA 4HYYA 5A6WA 5EQUA 1RWWA 1S7CA 6LDHA 2JFWA 4OL9A 1KNZA 1U1IA 1SK9A 4I4NA 3FKSD 2IELA 4RKFA 3RCBA 1MQTB 4FYKA 1H3DA 2CNNB 1J1IA 1TD9A 4U6NA 4E2SA 1XD8A 3B3QE 3M6IA 3O9ZA 3E7PA 2WSEC 3EPIA 1PJQA 3TZLA 1A9ZA 4XJXA 1W5FA 2V8BA 4HAXA 5I9LA 1NGSA 3ZW7A 3OQBA 2KPOA 1GOTA 3BFXA 3MWDA 2QLJB 1I3OA 4U2FA 4RPCA 4HI1A 3HE3A 2R8GA 3D6FB 1I1EA 4CLYA 3W9JA 1K8ZB 1FFWB 2I78A 3KOZA 2H5JB 3ZBUA 1XLTC 5JEDA 3P3DA 2RJNA 3AI3A 5KQRA 1IMOA 3PQCA 2HFKA 3R2JA 3ZI0A 3TJRA 3AU8A 1FRLA 4YDQA 1V4NA 3PVZA 2OCBA 3AJ9A 1O5LA 4ZN1A 3SYZA 1N9ZA 1NLZA 2Z4RA 4HTJA 4UJ5A 3AYEA 1TVGA 3M9XA 1Y4AE 3E5NA 3FBGA 4DX8H 1CG2A 1YCIA 3H5XA 5FJHA 5EE0A 4IQ4A 2R072 4P0QB 3ND7A 2Q6LA 2A78A 1UWAA 2J41A 3BORA 2C4XA 1WXDA 2I67A 3U61B 4WK3A 1L3CA 1RABA 2XW6A 3IBFA 5DG9A 1X0XA 2MSTA 1SVWA 2IY5B 1GTMA 2B35A 4B43A 1ZN7A 3GJAA 4ZO6A 4E12A 5IXYA 4Y30A 2GHPA 4QHTA 3ZKWB 2QFEA 3R8XA 4OB6A 4FYVA 3RVNA 4BC1A 3LSEA 3CDWA 2R6CA 4OYYA 3RAQA 4P6VF 5K8UA 3BKZA 5EKTA 2KX7A 4N0DA 3TKLA 1QLHA 1TC2A 1RJ7A 3J81j 4HQFA 2D1YA 1W73A 2VP0A 4J94A 2SHKA 4Y1YA 1DQ5A 3RU9A 4B4PA 5C5EA 4ZU4A 4WWHA 2YNMC 5KYVA 4QB1A 4QJ3A 3T0FA 2IS4A 4QPJC 1AQNA 1QM9A 4MLDA 3T7JA 4A41A 3BGRA 4WLVA 2CQPA 4LDQA 4DV1F 1NJZA 2C83A 2Z43A 5EEHA 3O0VA 2IY7A 1L7QA 5CXTA 2A35A 1BS1A 1ZHHA 1ZUNA 4XYLA 4KNCA 1IEVA 1KH1A 1RKXA 3W4KA 3VH1A 4LE3A 3V4OA 1S5ZA 4X4NA 3RFFA 4BQFA 1TM3E 4D4KA 4HL9A 4BZ4A 2UZAA 2GMEA 1Z8DA 2G0NA 5FZAA 4FYYB 2G9VA 2WPNA 4C6TA 1K12A 1SKWA 1GNZA 4XVCA 3LA2A 1RUOA 1FESA 2JB4A 1HXHA 3VBSB 1Y7TA 3G13A 2XMJA 1G2EA 2OESA 2YGLA 1DC4A 4IIXA 1RGVA 5J2TF 3TI7A 2EYQA 1SXJE 2VUUA 1QHHA 1HE2A 4PRKA 5DGHA 3WBKA 5FP4A 2HGZA 3HN2A 1ZBE1 4O4HF 5HLFA 4ILLA 1V16B 4BPBA 2QUAA 4RKYA 4C20A 2R7NA 1TIBA 2QNIA 2GWRA 2ZAAA 2CHHA 4F50A 1NUQA 4E5UA 1V8OA 1XLVA 4D9GA 2YXNA 4ZYWA 1R27B 1LV5A 2XLCA 2BKNA 2BBEA 3KAPA 4F2WA 2C8JA 1Y4WA 2VMIA 4ZVVA 5AUPB 4B6EA 4B17A 2HMIB 1YASA 1WUIS 2OHVA 4TVSA 2VVTA 2EYUA 1PKXA 1NAHA 1UIMA 2ECPA 3Q8VA 1VLZA 2JLAA 1RZVA 2VOKA 3KLFB 3NCRA 1F60B 5BORA 4BXOB 3OF2A 1IIRA 4U9IS 3AYCA 2DFPA 4DUVA 2JD9A 4D2IA 3RV4A 1RAOA 4Y1ZA 1HFWA 4M76B 4QDRA 1MBZA 2QQNA 3TSZA 6ADHA 2C2MA 4S1NA 3UOAB 2IKSA 3EZOA 2ZGUA 4QW9A 3I54A 2BRLA 3GCWA 4NWVA 3DR5A 2K9ZA 1UBOS 3ENAA 1OU0A 4IGEA 1V1RB 1T3OA 2AQ8A 4P36A 1T3SA 3DNFA 2BOIA 3ABZA 3PQ7A 3GLKA 2QQWA 4Z8BA 1D9DA 1CS4A 2G19A 1OO0B 3I0MA 1NBEB 5IKXA 2JEMA 3ZOZA 4KPFC 2GVDC 1ODJA 4MLOA 4JGBA 2A9RA 1GU3A 5B0AA 3CLSD 4ZVGA 3VVMA 2QD2A 1WSAA 3VZRA 1JDUA 3BH6A 4C43A 2IK8A 4IXTA 1NVGA 4MB0A 4URVR 1SVDA 3DLGA 2D3WA 4DQKA 3EFOB 1DO0A 3SC4A 4ZVPB 5PGMA 1CR6A 1XMOB 1CQZA 1IUNA 5B2ZA 4BRWA 4TMVA 1W3VA 4NEGA 3H0KA 3FNBA 2AWNA 2J22A 2AGPA 3R5GA 1XZKA 1E4OA 5THWA 4RYLA 1O2DA 3O82A 5L9VA 5IAJA 2W8BB 1IRIA 3V80A 1T2AA 1W94A 3QSYA 2QU8A 3AUKA 2I2CA 4WFNQ 2C04A 4ML3A 1CN1A 1ZD5A 3PGXA 2UUBJ 4XJSA 3DMGA 2PHDA 2XOEA 2YV8A 1WRBA 1ZI9A 3O21A 3WL6A 1SC1A 2XMPA 5EMNA 4C7MA 1KQKA 3CT4A 5TGDA 4PCRA 2XMWA 3AZPA 1CUFA 2ERCA 3GLFB 3Q5DA 1KQFB 5B53A 5FPKA 3O3LA 4DZGA 5L4SA 1J5OB 3ITHB 5EJ7A 4TVAB 2AH2A 4IIJB 3D5QA 4JI8B 5EMHA 1YIJS 2EFJA 3K53A 1QG2A 4CIYA 2D4HA 4QGNA 1XQ9A 4AFAA 1BXHA 2WA1A 2C84A 2H57A 3K1AB 4CI9A 1O6ZA 3V9AA 4M55A 5EVJA 1MGOA 1LLDA 2DVFA 1O54A 1KFBB 2NUBA 2BSQA 5KU1A 1VDHA 5E7OB 1A78A 3EQ2A 2INGX 4C4SA 4P00B 4O3MA 1JLGB 3W6NA 1KBOA 4RX6A 2O14A 4EU0A 4C4WA 5A4JA 3OZGA 1P6TA 2OCGA 4LVNP 2OD7A 1RR6A 1E5IA 1U8XX 2C2ZA 1W28A 2XECA 1UMCB 3PQDA 4YT4A 4G1CA 3VAYA 4Q4HA 3WA7A 2CNAA 2FVQA 5CA1B 2KLBA 3AB2B 2VZRA 5I5EA 2WHXA 3EEOA 3RVKA 2BZ0A 3OBAA 1MHTA 3CDZB 4P32A 4F36A 1BE8A 3PR2B 3CCVS 3LOPA 2QE7D 4PQQA 1AVTA 5E3QA 1UVNA 1N1EA 3AEXA 3OPYB 1KEEB 1WKKA 2RDSA 2B94A 3F49S 5GADI 2AYZA 3ADCA 1DBPA 3ZC4A 4LREA 3AY6A 4IDNA 2YZMA 1TL3A 5THXA 4PZDA 2ORVA 1M5RA 3OM8A 4GVXA 2BDEA 4MH0R 1V4BA 4TXNA 4LJ7A 4IKEA 4EN0A 5K0SA 2HRQA 5IK2D 1B6RA 3GRUA 2EQAA 1WKJA 1XC6A 2V94A 4LZLA 5L9RA 2MLYA 3S6JA 3MC1A 4NWBA 4F6RA 3AR5A 5FA5A 3MWDB 4Z0HO 4MPDA 3FSRA 3NM6B 1GYKA 3E9YA 1SVIA 1Q1AA 2IGBA 3H2KA 1K8YB 4QIFA 3KMHA 1U2RA 1QDOA 1R43A 4BQEA 3O1UA 4IV3A 5HATA 4D9BA 4KYZA 3FYUC 2OCYC 2R1TB 3LIIA 4ZZ1A 4GKKB 1RVF3 3TW4A 4KWJA 4LK3A 1XHFA 1FNOA 1KEVA 4TYYA 3LHKA 2J67A 1YQDA 1II8A 3O1VA 2CLMB 5LB4A 2VCMA 2ZSBA 2EAAA 3A21A 5FXMA 4EI8A 3C70A 2HADA 3IO1A 4LZOA 1T8PA 4W5QA 4J3FA 3UC5A 4LHKA 4GR5A 2PU7A 3C3XA 3ISZA 3L6DA 3MV01 1OTHA 4DLKA 1CD5A 2FXVA 4O3FA 5HFNA 2OCIA 2PFDA 5F7OA 4GZLA 3OIGA 1WGPA 1G3OA 5DYIA 3MR5A 3RI3A 2JEJA 2OM6A 3O95A 2FHMA 1VJTA 4IEUA 3E9MA 3ZLJA 2DGTA 1MO6A 4F7VA 3OA0A 1QPBA 3ES9A 1D7AA 3AG6A 2IYZA 2QEXS 1WLDA 3PXGa 3ZTRA 3MJSA 3MPOA 1U9CA 1DTWA 4KAXA 4DQPA 3KS7A 2NREA 3ZWVA 1IQZA 1H1IA 1BE6A 1ST8A 4F8EA 3DYMA 3TN91 2HHHJ 2UVDA 1U0HC 1CLFA 4ZJLA 2ZYIA 4YFWA 3KIPA 4Y20B 3DVAA 3KB5A 4EGQA 5BXQC 1G19A 2IFWA 1RYNA 4LF9B 1V3VA 1ISJA 1ZMOA 2C2YA 1ZXBA 1QV9A 5KTKA 2V7XA 4YREA 4R9AA 2X1GA 3OLBA 1AG9A 2V8GA 1VRTA 4UW6A 3AJEA 3R5FA 4SLIA 2DU0A 5F2SA 1GPYA 1I1NA 4EELA 1ZGAA 3NWBA 2DAPA 4KO4S 4HR7A 3HKDB 5FY5A 2P9EA 2AR0A 5B09A 2OORC 4C2AA 4PWDB 2YTZA 2J5AA 5A9TA 5DVZA 1TZMA 3EYWA 5FPVA 3D7KA 5FQNA 3PCXA 1MP0A 1KP9A 2BR3A 1FYWA 4B75A 1PEAA 5EJGA 4YRAA 2HEGA 2W6JA 4D3HA 3N6LA 1SG6A 4H18A 5CR9A 1LA2A 1K63A 2REXB 4OLOA 1ENXA 1VCMA 5LBUA 5B36A 4EBEA 5J5CA 2G9UA 4JCOA 5GV8A 3M5DA 1H8ED 2ARKA 1BWQA 4NZ0A 4U2AA 3LQCA 2BHSA 4ZCRA 1PO12 4NCKA 7GPBA 2L0XA 3BIEA 4KIFA 1PR3A 4OQQA 1PCAA 2H2HA 1KMIY 1Z18A 5FZIA 2DUMA 2DHHA 2ES3A 4YXWA 3P2KA 1B64A 2N9UA 3IJRA 1H1AA 4ZVFA 3Q8LA 1J2JA 1Z47A 2GIQA 1HEYA 4QULA 4JAAA 4ZK6A 4BM8A 2P3KA 2QDNA 3E3XA 5AJYA 4TYMA 1G59A 2DWCA 3RYFB 2BJ3A 5FYCA 4FC7A 4K28A 4DOUA 3LVBA 1A0OB 4BK4A 3EGZA 4OX9Y 2IM3A 1XSRA 4IKPA 2GKSA 2X5JO 1N2HA 4J1XA 3P1JA 4COUA 1PK7A 1PC4A 5FADA 1MF7A 3ZEIA 4HXCA 2AZ1A 4FXDA 3PD1A 4CEJB 3MMJA 4BC9A 2BJ8A 1KSGA 2JVJA 3MYYA 1NKGA 2WABA 2FWJA 3EWIA 3BI3A 5BNOB 2QYTA 3K9BA 3RVMA 2OD9A 2XA2A 3HLTA 3N5CA 2QTTA 2ZS7A 1PZ8A 3X1KA 2N47A 1UMKA 1OV6A 4IIBA 3S7RA 2ZRNA 2PC6A 4LCJA 4D41A 1D9ZA 5BV7A 2IXIA 2F64A 3PNQA 3LGNA 2IE0A 4IXNA 4FOQA 3T7DA 3OFFA 2IWHA 4ES8A 4GO1A 3A9SA 1RS0A 2VQEJ 4C2MA 3AR8A 3PW5A 2YY3A 1BGVA 5J96B 3MCWA 1TLLA 1UWVA 1X33A 2C4TA 3W05A 5LP6C 5JFTA 3AVYA 2POQX 2XE8A 1IDN1 4DSNA 2Q3DA 1WU8A 1FUEA 4DNYA 3TSYA 4ECVA 2HQGA 2ZAHA 4ARYA 3JD0A 2CJXB 4LZPA 3W5HA 1M8JA 1Z4IA 1VMKA 4B32A 2CLSA 3DP9A 1PQWA 3QX8A 3OZ7A 5HWSA 2W95A 3OJOA 1XNJA 1Z5UA 3LH2S 3NGLA 2IPOA 2O3TA 3R4VA 5D3QA 4RFT0 1E92A 1RADA 2UXCF 3NYQA 2BANB 3KUEA 2JB8A 3IOMA 3EJKA 1FOEB 3ORYA 4NE2A 2ZOFA 1RA7A 1W25A 2V45A 4QE3A 4NI2A 2WJ6A 1D03A 1DLOB 3C6ZA 3JQ9C 4IERA 3G2XA 3ENWA 3BGUA 3V8MA 1XWFA 2PIIA 2FC9A 3D5MA 2ZE8A 3PQFA 3VDQA 2OBXA 4H1TA 5E9AA 2XQJA 4A1OA 4BOYA 3A6PC 2PS1A 5JARA 2HMWA 3VR5A 4JT9A 1ZUIA 1E7QA 4GR4A 5EMJA 2YDXA 4CQLA 1HNVB 4ZK7M 1H9WA 4RW4B 3ZIWA 4BKPA 5I8PA 5A3VA 1C8LA 2ZTUA 1L5HA 5TR9A 2KE5A 2OGZA 3ZHXA 2EV9A 2A73B 2RUGA 1RCFA 4JV2A 1BRMA 2P6UA 1K0FA 1SV5B 1R0LA 2HA2A 3DCAA 1X8JA 1JNZB 4U7FA 3TKAA 1ZM7A 2WR8A 2VBPA 1IN8A 1Z15A 2ACVA 1HETA 4LJRA 1QNYA 4X62F 3FYDA 1UJ4A 2QI9F 4DARA 5HJ7A 1VTKA 3F4LA 4PAQA 1OHFA 3OFGA 3GNSA 1PZXA 1VHJA 2GK6A 4PBRA 1K47A 3Q9OA 3SIWA 3E84A 2DNMA 5AK3A 4YCNA 2IEZA 3RSJA 2CJWB 3O0DA 4JQSA 1VZ2A 4Y1GA 4RVHA 4FDLA 4X45A 4R8HA 1MOZA 3FHAA 3ZV7A 2LA4A 5TMDA 4IDPA 2IEDA 1X15A 2ES4A 1CQNA 4MKZA 5DLEA 3ABQB 1RDFA 3IHWA 1J56A 1GUYA 2ZUSA 1Y4ZB 3EDYA 2CYYA 2FSPA 3USCS 4Q5IA 1XMOJ 4ED1A 4HH4A 4FMPA 3PRVA 4H2DA 2XTJP 1L5RA 4FSJA 2P75A 4A36A 4K6MA 3UWPA 2XCIA 3QNMA 2OBBA 1AC5A 2DX7A 4TXHA 2C4UA 2NO5A 2OT3B 3I8OA 1E0KA 2FZCB 1T0UA 2J3IA 4WZAA 1CC7A 2HQFA 5CT9A 1G9XA 1KF0A 1QQ5A 4J7CA 1ZG3A 2O20A 2XS2A 1QGAA 2I2YA 4FUQA 3V8BA 2Z98A 3JAKB 3QAEA 3PX2A 1JHXA 3CLUC 4IWYA 1HWIA 3OHBA 1WXIA 2XRYA 3VGJA 4LO8A 1VYAA 2JLSA 4PWWA 3OPVA 5FMCA 4XIUA 1CZNA 1V9CA 2QPTA 2Y77A 4RD4A 3ZCPA 2DOKA 2ZG6A 3QWIA 4TPKA 2N4DA 1GPBA 3D6FA 3V7NA 2M7SA 2J31A 1NPDA 4X94A 3J7YI 1NAQA 1S2DA 1F8UA 4G0PA 5FO7B 1G5IA 3I42A 1VMJA 1PHPA 1HMYA 4LWPA 4FPFA 3GEMA 1XZFA 1T0JB 3PDWA 3IEPA 3ZNNA 3DE2X 3BTYA 3IDFA 2P9HA 2IUFA 1GMVA 3FFZA 1JZQA 3SCGA 3WD5A 2XE7A 3MWYW 5T50A 1WULS 4A4JA 2L17A 3Q8BA 3MIBA 1GQQA 2BTQB 1C1XA 3ZYJB 5F77A 1ACMA 2YHIA 1DC3A 3WLKX 5K8VA 4ES2A 2DPGA 5BNNB 1YU6A 1HBNA 1YIFA 3ELNA 4UQOA 1JA1A 1YSCA 4EFMA 3PUVA 3CX6A 1AT1B 1SHLA 2VRWA 2GBLA 4JY7A 4L8QA 5DHSA 1YGYA 4YDSA 1QO7A 1V5VA 1Q7EA 4KWIA 4DY6A 4B3IA 3B02A 1VL1A 1E9SA 1Z45A 4K0RA 4RLQA 3CCLS 5HDQA 3ULHA 2MKJA 2DURA 4EKEA 2R2GA 3VR3D 2H16A 2W4CA 3MLJA 4DSFA 5F73A 2VOJA 1TM7E 5IWAB 1RA6A 5HL7Q 4BNGA 4F3RA 3UKOA 2AD9A 1ZRIA 5K0UC 3JQBC 4A8XA 4XUDA 1MXFA 3TTSA 1VQ6S 4ZT6A 2AR7A 1A5SB 3KU4A 4NR0A 2V6FA 4CXYA 4QC2A 4C5AA 2VHXA 5DIFA 1EM8A 3QFTA 2EW1A 1QJU2 4E31A 1F1JA 2A0FB 3ZYBA 4NBLA 2WICA 1HN1A 2X1BA 1M5KC 1PNRA 1K1EA 4Q4X3 5JZOA 4BN5A 3R7WA 4MFBA 2D2VA 3HZZA 1KU6A 3RAEC 4Y2AA 2CJFA 4Q4AB 1MT0A 2G09A 3WW4A 5B0CA 5CD9A 2FWPA 4KQEA 4CQ1A 3LS2A 2FVXA 3VGVA 3HHEA 1NY5A 4JI7B 2Z8YM 4AICA 3HADA 1WCKA 2RJ2A 1YZUA 1NTRA 3FB4A 2ZVSA 3ZY4A 3UUFA 3FMVA 3GXOA 1S0MA 1JDJA 1XG5A 3HJTA 4ZVOA 3P5BA 1T5OA 1QLWA 2QL7B 4QKBA 1S48A 1VPDA 3T7KA 5REQA 3Q85A 4XC9A 1RP5A 2GPYA 1W4RA 4KH1A 3V00A 4LTAA 1F20A 1GUFA 1J0BA 1QH6A 3HQXA 4LF8B 2XG3A 3OJBA 4CZ2A 4GWJA 4LIRA 3OG2A 3RSZA 3NW4A 3WQ7A 3I5BA 3E22A 4U7WA 5EJAA 4TLFA 1U6ZA 5BSVA 1J5EF 3U39A 1GLGA 5JO9A 4KGKA 5BPHA 3MAGA 4BMDA 1JHZA 2Z2IA 1QV7A 3RU0A 1VJGA 1QRSA 1M6EX 1V5WA 4KODA 9ABPA 4Q27A 3R0VA 3KAJA 3JSRA 4YMLA 4AK3A 2YWGA 5DEOA 5FO8B 2DHEA 2Q43A 3ZKYA 1AUQA 1SVNA 1XBTA 3QVSA 1B6SA 1D2SA 5KHIA 2YU1A 1X7WB 4RH3A 4R8UB 3DZFA 2ZGQA 4L50A 1U81A 1IQUA 2BN4A 5D86A 4FBMA 4AR2A 1Y9AA 2AYYA 3J7HA 1BTOA 2D7FA 3HUEA 2IIPA 5CCDA 4WKGA 3TJAA 2LROA 3QIPB 5KTQA 4B3SF 1UEIA 2YR0A 1OA4A 2UYGA 5K9ZA 1ZDMA 1VBNA 9ATCB 2ZX0A 4DR2F 1RM5A 4JGZA 3MRSA 1UJCA 1F31A 2P6TA 5GADl 1B0ZA 5H02A 2ZIGA 2PLRA 1GR1A 5GLVA 3I0RB 1IB0A 3LSDA 4U2KA 1TJPB 5CRIA 4NASA 3BWVA 4IHKA 4LJKA 4BO8A 4HUTA 3ZCUA 2ZC3A 3WGJA 3QLHB 4OX6A 3A3PA 4JJ6A 3KZNA 2Y6LA 1Q1NA 1RHI2 1OVSA 1DAHA 5LLDA 2XCPA 2NT4A 1VRUA 1T8WA 3KVVA 4ZPAA 1DC8A 1ZOPA 4IPTA 2P0EA 5K4HA 1XYNA 2VPVA 5CEEA 1M2OA 3NG1A 3ZFGA 1D0EA 4HJRA 1M2VB 4Y6OA 1TFYA 4RU9A 2I80A 3I59A 4HEA6 1N77A 3N35A 2O2YA 4URQU 2ZQZA 4FSDA 3D68A 3EGWB 3L1HA 4BRSA 3DKIA 4OMCA 1U7UA 2FPIB 3NHJA 1LU1A 2WSBA 4X1YA 1V9U3 3CN7A 1GVNB 4NCNA 2XCUA 2QTBA 4GKBA 3N2GA 2FIUA 4TVKA 3WOVA 2JDKA 3OJWA 3PRJA 1DQ2A 4NAMA 1KRIA 3TAYA 4MUBA 1TQ6A 4BV8A 2FRVA 4F97A 1BQ4A 2FETA 3TRKA 1T7PA 2B1IA 3HB4X 1ZK0A 2RHSB 2AIRA 2W52A 1ZP6A 2LXNA 1SIWB 5CISA 1IFXA 1KYZA 2CNLB 5HNKA 5IFLA 5ARCA 3F6PA 5BV6A 4KBFA 3MT0A 4UC0A 3LUPA 3UWOA 3VUEA 1NONA 3DB2A 1ND2B 3A3PB 4D8UA 1Y9OA 2FK8A 5DMXA 4AFNA 4YJ2F 4EN8B 4B3RJ 3ZVKA 1I14A 3JB9k 3FBCA 1SIOA 2GVNA 5I48A 3ETEA 3QVGB 2ZOSA 2JIJA 4NXNB 3K1ZA 3QE4A 1NXD1 3ZJ4A 4OQYA 2A70A 5LYYA 2Z04A 4K9RA 4Q1CA 3O8WA 1M5HA 1TPYA 4W5OA 4HHEA 3VNAA 2Z09A 3PO4A 3JVEA 5FTNA 3R5CA 3LIHA 1CAWB 5L7OA 1J99A 1OWNA 3I4PA 1UMDA 2B6HA 2PKRA 1SBDA 4XTPA 1TYDE 2V7BA 2P65A 1BKYA 1AM4D 1TJ4A 1BVRA 1PMJX 3IVAA 1IZ9A 2EKNA 2KI5A 4JJAA 3W9UA 3ZC3A 2VZLA 1QK3A 3EASA 3RSGA 5JTTA 1UMIA 1FDTA 3PHIA 1WB6A 2ZUEA 3BV8A 1H5UA 4YT5A 1ARZA 4MINA 1Q20A 1AZLA 1S0OA 1TE2A 4DV0F 4KQ6A 2QG9B 1TZOA 3DDWA 1JZ4A 5C3OA 2OV3A 2YKMB 3OPQA 2XLBA 1X3LA 3P26A 4DDTA 5KFDA 3LQYA 4UOJA 4KR9A 1H93A 3W2HA 1MRSA 2WZCA 3IX7A 4OYHA 2V0CA 1PV1A 2DXDA 3IQFA 1G6OA 2PMWB 1ESZA 2IU4A 3OY8A 3BCWA 1DJNA 1CQMA 2WZBA 4B0OA 2C20A 1U7OA 1WVGA 3ECAA 3GZEA 2C5AA 2PT0A 4ZPIA 3TVKA 2VJBA 4ECZA 1Z0KA 3VZDA 5EQJB 3DEJA 1T3TA 5EJFA 4LBLA 3WF1A 1JYSA 3RC8A 1W30A 3RW9A 4DLBA 1QQP1 3BH0A 5L8RC 1XXHE 2G70A 3OXGA 4L72B 1TKXA 1QHNA 1CC8A 3OHMA 1KKLA 3V1KA 1LLCA 4YB6A 2B21A 3E23A 2HMAA 3WP3A 3GE9A 2DHCA 2PS3A 5AHRA 3JAMY 1NG1A 4N0EA 3ZY3A 5A3UA 3RSOA 4MVJM 1SMVA 3M6FA 3P5BP 2WIJA 1H3NA 3AP9A 2Z42A 4LY9A 1ZCZA 1DMRA 2OZVA 3A3OB 3L8MA 2PEYA 3MTKA 4OYRA 4DF4A 1WCDJ 2VPYA 5HHTA 1PTJA 4ECEA 2ORIA 4M1KA 2VQTA 2XHCA 2R7EB 5A8RB 2JGAA 2XH6A 4XO0A 3ET6A 2H00A 1RU2A 4L6AA 1HDEA 3J81Y 2H52A 2XJPA 1JYCA 3QH6A 3NIWA 4YA6A 4OF4A 3KOUA 4N8OA 1JIHA 4J07A 5AT1B 3BSOA 1BCSB 1QAQA 5EZWA 5HIJA 3KG2A 3DM9B 3T6KA 4XB6B 4OQDA 4N9IA 1MZFA 1APSA 2WFLB 5B1HA 4C9DA 3UFCX 4AS3A 1ZK3A 4YRZA 1GZ7A 2VZOA 5LYJB 2W2MA 3OKPA 3ZCVA 3L4SO 1A9XA 4H3WA 1Z74A 1JLSA 3G2PA 3E2PA 2Y0SD 4H4CA 2XNQA 4I4IA 4OUEA 1BMDA 4K9LA 4EDHA 1BS2A 4FFGA 3W60A 2FAXA 3ZW8A 4RTMA 1AXQA 1CUZA 2Q1MA 4BZXA 2C1EB 5LZ2A 1W2TA 4MJLA 5D3KA 1N8NA 1GEHA 5JH7A 3MWLA 3UH1A 1CQXA 2OXBA 1KETA 4YPFA 4P5YA 1YRWA 4AP5A 3GLHB 2D6PA 4DCMA 2GGSA 3POSA 4F46A 1XA0A 1Y1KE 4OPMA 2A6YA 3I6ZA 4HOYA 2XZWA 5COAA 4LFBJ 1N3YA 4D3YA 3MFYA 1KERA 5HSGA 4C7QA 3N8KA 1IEWA 2VH9A 1OGIA 3QKSA 4R84A 5HK4A 1AR61 3HXQA 1ULBA 2UU9B 2RHCA 1PKEA 4HATA 5H80A 2CG4A 4GNKA 1E8DA 4WVZA 5JYDA 4ZLJA 1FA9A 1XYYA 2ZABA 2AN3A 4RGKA 5B7GA 4C4RA 1NOJA 4AK9A 1YUDA 2YIDA 1PT9A 5H9PA 3VPSA 4LUKA 4H7LA 5BUQA 3WR0A 4QU2A 1OQ6A 4KYTA 1Y6QA 2JWNA 1GFZA 2GC0A 3RKUA 5A05A 2XQGA 1RAHA 4RL4A 3CWCA 4YR3A 1XA3A 1H2WA 3TXAA 2LQ8A 4ELUA 1FKOB 3ON7A 4CLOA 3LQRA 1ZW1A 4AQ7A 4KMSA 1QTRA 3HR4A 2R071 3KK2B 4JV1A 1RAEB 4PI2A 2ZIWB 2KS6A 1ORDA 4EL5A 2AGVA 5GOTA 2HYIC 4B9TA 3QLVC 4B87A 4GOJA 3WLIA 5LMNB 5JALA 3C87A 3E2EA 2JLEA 4WUTA 2Y34A 2MEV1 2VEDA 3K2BA 1RXUA 2D3O1 2X1AA 3NBAA 1Q7LB 1VFPA 4E70A 4XFDA 5K3SA 5JSFA 3BTSA 4CV3A 1VE9A 3LCMA 4RQBA 3SHRA 5KNCH 1FDSA 1I4OA 1RCTE 1NP6A 2AMFA 3FFTA 4MRAA 3B3GA 3O26A 2QBXA 3S57A 4Q0BB 2V2KA 1XELA 4A48A 4KBGA 5T14A 4RVDA 3UR0A 1H9AA 2ZQYA 5A03A 3UUEA 4IDQA 5A7SA 2JFVA 1P8GA 1IHOA 1VBA2 1TADA 2Y6FA 2VMGA 2JG9C 5DHRA 5J3JA 3WNVA 1LWOA 3KSRA 3V2GA 3JV7A 2CNWD 3HMJG 5FJIA 2W68A 3N39C 1QO0D 4C3OB 4ETXA 2Z4SA 4TKTA 2VJYA 4LW8A 3RI8A 2LLZA 4OYUA 4KHMA 2VP9A 3TOVA 1R3DA 2Q1WA 4YJKA 2Q41A 4EB8A 5EIWA 2RHTA 2C29D 3MWKA 4CDXA 3VKFA 2AV5A 1Q79A 2FLPA 2YBSA 4P4UA 3BDPA 2VPXB 5TLSA 2CHFA 3V6MA 5JSYA 4P3XA 1PT6A 1XMQF 1I13A 2NX2A 1B3RA 1F51E 1CUDA 1EPZA 3PURA 1UBRS 3WRYA 3QQPA 3KT4A 4G84A 2QG6A 2CMFA 2J9CA 3V0BB 3ZFEA 2HDOA 4N7IA 1U2SA 1AN9A 3WDKA 1NLSA 1JZ7A 1OYEA 3T19A 2G07A 1Y3JA 1I3OB 3KQOA 5DZEA 4FMDF 2P6OA 3R5JA 1NV8A 2GH8A 3A0RB 1RIFA 4XQ4A 1JJVA 3AW9A 4INJA 2K2SA 2AVDA 3VNVA 4S1VA 3RT9A 1QFSA 5LKRA 3K09A 5DTRA 1XIVA 3DS8A 3IEVA 2MLXA 4A46A 1J3RA 2X22A 3TMYA 5KOJA 1LJUA 1W9WA 5SZJA 4ZIWA 3H2LA 4DV2B 2YZNA 3RS2A 3ZU2A 1TO2E 3ZSLA 3HDTA 4MQEA 3GCXP 2HWC2 1RT5A 3PUYA 2I4MA 3KPYA 4ARVA 3ZDBA 2IA0A 3ZZ0A 1NBOA 1NJGA 4G0OA 3FZNA 3OE5A 2Y9PB 1T8TA 4HF7A 1IKVA 1UZZA 1AYN3 2KJVA 3DBHA 2O2CA 3GRRA 3JQQA 2NXJA 2R1DA 3HOBA 2QP4A 3O5SA 4MQMA 2OKCA 3FF1A 4TL9A 1AKUA 1CY0A 5GAGI 1BN6A 1FATA 4U2DA 1OLXA 3ZO7A 1U28C 4B9EA 2RS32 4EHDA 4XEUA 5FYTA 4NCXA 3FTEA 4UW2A 3RODA 3NC4A 3PNVA 2RQKA 1SCIA 4I6JA 3G7NA 2I8CA 5LR6A 1E2BA 3BIXA 3RS5A 5DT9A 3GZJA 5F3WB 3WZ0A 1HRV1 1BW9A 4DLGA 3RZHA 2PZFA 2FJAB 2E5IA 1YSJA 4MS4A 1AGYA 1UZAA 4YUWA 2AC2A 1NUSA 1JYTA 3GGPA 1N5LA 2PEBA 1BCSA 2BUAA 3WRVA 4JBIA 4FT2A 1Q82T 3D4IA 2FJWA 2JSXA 2KT2A 2V72A 1PEDA 3UKTA 3HSKA 4U3JA 3DL3A 2QT0A 3CD6S 2B42B 4GKXA 1EAYC 5MGNA 1HFKA 4F1WA 1PG5A 2BFEB 1HYHA 3W2VB 3NV7A 2GX6A 2JHFA 4NHKA 5A6XA 1VE5A 2MHNA 1DHTA 1YZLA 1JPJA 1TX4B 4DI6A 1R5NA 4HXYA 3VPHA 1CEXA 4GPD1 2YDEA 1QTIA 5A5GA 4GWLA 1GL3A 1M5TA 1DGLA 4X4PA 4PPNA 2AOXA 1V6NA 4BV3A 4K1XA 2AU0A 4F5EA 2Z9BA 5GLTA 4J9QA 2ROQA 2FX3A 3OY2A 3N2KB 3RE1A 1N32F 1XROA 3K72B 2V7UA 4EHFA 5JT1A 1KE2A 1WSVA 2W7OA 2QTLA 3WGOA 3GCWP 4ZAFA 2C0CA 4IEIA 1YVEI 4MYUA 4YI5A 5IZ4A 1GQGA 3S01A 1GFIA 3DR3A 4BNIA 4BMOB 4HWTA 4E1VA 5FY8A 5C1DA 2JL1A 1FA0A 4DINB 1CIJA 1EXNA 3TM5A 1D4M3 4EHIA 5EXOA 3LW8A 3DEZA 4KHPB 4F3JA 3PDIB 2QPLA 1ZBA3 2O2JA 4WP9A 4ZHQB 3UJHA 4AL9A 3I23A 3DLIA 4EVRA 3NBYC 5AM2A 4J9RA 1U9IC 4CKWA 3B6JA 4A82A 4NXNJ 1POQA 3TKYA 3A70A 4URYR 2OLJA 5DXJA 1GN8A 3DWEX 1STOA 3IKJA 5IC6A 1GZWA 5KFEA 2DHDA 2EXKA 5EINA 1Z06A 3NV2A 4EG0A 3HULA 4H35A 3M30A 1USKA 1WLTA 3AF3A 4ZPXA 1HTTA 1JLAB 3DFKA 1VC0A 3KLOA 3BIFA 5D7NA 1K5PA 4K20A 2UWCA 1EAH2 4IWNA 1SR8A 3H3FA 1YAHA 1DQPA 1HNZF 3ESBA 4DJEC 4KNYA 1MJHA 5ABJA 2JAQA 5HMXA 2HRZA 2VUAA 2P79A 5TQVA 5KOHA 4RMHA 1G8GA 4DR1J 1REVA 3E82A 1OLMA 2ZBUA 3PW4A 1R0BG 3G0CA 2QTGA 4ILMA 3OPTA 4E2GA 1BROA 4UTXA 3TW6A 3GJ7A 1Y3AA 4IXLA 3POTA 2ZDGA 1VRTB 3OYWA 1USVA 1EX7A 4QELA 4PBPA 3WFJA 1EVYA 2UZ0A 1E6MA 4R5PB 4U63A 1LJLA 1OT5A 4PAOA 5GINE 2YWEA 2EEZA 4DUPA 4P14A 3PJDA 3W2WA 1BJKA 1SUBA 4KXQA 3OQJA 3UWTA 2JLBA 2PT7A 1P8AA 5E4FA 4LHXA 4Z2YA 2XLJA 1HBJA 4WLNA 3RSLA 3TW0A 4NCGB 5FLYA 2WT8A 1NLQA 2WM2A 3FBMA 3HJNA 4MYCA 4N5LA 1L4EA 2GETA 2XA9A 3E9RA 3IUSA 2HHVA 1ZUD1 3OPWA 1NMEA 1RP1A 3QPAA 1AL21 4AEDA 1JLEA 3IM8A 4BLJA 2C00A 2FMIA 5EWGA 4GD3Q 4FW9A 2E26A 2K5UA 1RLDA 4DUXA 1Z2PX 3TOSA 2FKAA 4DLPA 5EX3A 4CO1A 3I28A 1OFHA 3PITA 4EW6A 4AVCA 2VSFA 2CBZA 2G28A 2DGOA 1K73T 4FILA 2V73A 5AKKA 4AGVA 3PDNA 5LU8A 2DSNA 3D31A 5DCWA 3W5UA 1NNLA 2W08A 3OJSA 4RNMA 3U40A 5T7BA 4JA0A 1QIFA 3AB0A 4BX8A 1U7TA 4XJ9A 4N7UA 1B00A 3ZQ4A 5AUOB 4AQ6A 3HM9A 3W5XA 1UD1A 1M2OB 2OBLA 4R5MA 2MZTA 1I6JA 5KQSA 3ZHOA 2OZLA 4DMMA 3QLQA 1WELA 5K45A 4GE3A 3M5WA 1E6VB 2P77A 4B8ZA 3F2ZA 1Z6YA 2L41A 2AUTA 3RHTA 3R8FA 1KSPA 1U2QA 1LV8A 4X1OA 3BULA 2Z6UA 4WKOA 4FAHA 5K9YA 3RC1A 3JD1A 2GT1A 1SCUB 2J9FB 2BDUA 3EM1A 4XEZA 3IUNA 3NHMA 3EXIA 3ZIDA 3OT1A 1UJ6A 4UOFA 2G82A 1O3SA 2HKIA 3FIJA 4EBDA 3MAAB 1IVNA 3N28A 1ZD4A 4YK7A 4J9LA 4F4FA 3HA3A 3FFIA 5JOXA 1NQ5A 1Q7YT 3SFUA 4F9FA 4N90A 3KSMA 4ZGBA 3CC2S 1RINA 2XJRA 4L0DA 3GDHA 3IUJA 2Z2MA 4BUCA 4PG8A 4YAJA 1KBQA 4CM4A 1EHIA 4YJFA 1M0TA 1JR3A 5I7HA 4WAUA 1C8BA 1E1DA 1FEHA 5CDFA 1N1SA 2OPRB 3IQIX 5AW2A 2CLFB 5DOVA 1PS8A 3N3AC 4P2FA 4RFSA 4YJDA 2R16A 4P84A 4GM4A 2EIEA 2WHQA 3CRZA 5JWHA 4IOJA 2HK9A 1V5FA 5HM6A 2O1SA 1K6IA 1KIAA 2DFBA 1VOTA 5AK5A 4WE1A 4ZVRB 2A0WA 3KR0A 2JDPA 1DCKA 2VQFJ 1RI4A 4N8MA 3HYLA 3AETA 4HDMA 2BJHA 1LQUA 1U0TA 3ROZA 3IR5A 2VCCA 2ZRCA 2YFUA 4LBKA 3PL5A 3E48A 1UPPA 4N7JA 3IUPA 1XT6A 2ZTMA 3N7JA 3V33A 5F1RA 3IAS6 2NQ2C 1CQIA 5T64A 3BG5A 2WVDA 4IIJA 1DKQA 2CXXA 2D0OB 1JHUA 4PC3A 1OUXA 1ORRA 4NRUA 1FY2A 1KO5A 3OKCA 3OURA 1UOGA 2QLBA 1I3HA 2BDPA 3LBYA 4RZRA 7MDHA 4IMPA 3O83A 2R7LA 5KG6A 3ILSA 1IBMF 4B2LA 3KK3B 2K2PA 4GC6A 3LZ6A 1X7VA 3WLQA 3F7TA 2AYGA 3W8PA 1URXA 3AEUB 5LZ6A 3E3OA 3LB9A 2SECE 4K03A 1L4LA 3HACA 1ZL0A 1QDEA 2X8LA 4E3ZA 3LBNA 1RAAA 3PYEA 4MROA 2COUA 1XZBA 5G53C 5H82A 3ASIA 1FFCA 2MKHA 2PX3A 3SYLA 1RGSA 4MQUA 3WI7A 3DKVA 3E53A 1XTQA 1FPMA 2BFCB 3DLGB 3IV6A 3ILFA 2R2AA 4WK6A 1Q3KA 1W88A 1SJ3P 1E3JA 1CS4C 1U0HB 3IQEA 5BUCA 3AI1A 3IB3A 4ED2A 1JKIA 5IJAA 5KNDA 1W35A 3IGFA 1Y80A 1F2UA 1CRWG 2ZUFA 5HVGA 3DZCA 3TZ6A 5JBNA 1YR7A 3HCNA 3B38A 3ZZMA 1IG0A 1QMJA 2QD1A 4LTDA 4M6WB 2UWAA 2QSZA 3MCZA 4X4RA 1EDZA 1K86A 4TUYA 4ARCA 3IPCA 5KI6A 2HMUA 3HFSA 1SCSA 2ROGA 3HY4A 5DFAA 2XY4A 5IJWA 5ES3A 1QYCA 3ZFFA 1HHTP 3C41J 3R40A 4BNUA 4DYHA 2GVZA 1TKDA 1XN4A 5JIUA 3X1XA 3CJ3A 5TDHA 3ZXJA 3KL4A 1Z7WA 2VCYA 4CV1A 2O19A 4PCUA 3I76A 2W2OA 3SS7X 1S02A 2F4PA 4ID8A 3AKQA 2P90A 2IRYA 1IHYA 1AJKA 4OHVA 1PWYE 1XU4A 3WC4A 3LYHA 3AF0A 4G9SB 3DPIA 1JHDA 3ETDA 4IBOA 4FE3A 1FMLA 3HXMA 1MO5A 1S49A 4IJMA 3BCSA 1VBB3 1OBVA 1UPIA 4DLZA 3ZX5A 1WNTA 2HEVF 1ENQA 2Y9HA 3C3KA 2UXDF 4KFRA 3GUYA 2RGUA 4TMWA 2C7BA 2YFZA 3C3VA 3GIDA 1ULGA 1IBRA 2AFVA 2AENA 3JYTB 2JLUA 4RZ3A 3K05A 5KC5A 3DKWA 4DANA 1MU2A 3O3MB 4AY5A 4MTCA 4EB3A 1ND6A 2UXCJ 4YVSA 1WCIB 1CY4A 1AYN2 3ZNUA 2X77A 5ALVA 4QBUA 3LLVA 1Z0UA 3OICA 4YRRA 5AOAA 1NU8A 5L46A 1ZD2P 3F2IA 3KLEB 4J6GA 4LZJA 1EJ2A 1SKUA 1JWAB 3NKYA 4REMA 5FB3A 4ATEA 3IS3A 5MN5A 3NRJA 4LF1A 4DPOA 3ANMA 3VYWA 3I58A 4JLKA 2HAIA 3A6JA 1O8PA 3QX9A 3D1QA 3E05A 4BBJA 3MIIA 1YS2X 4FFFA 2YFKA 4IG9A 3BO2A 5MHTA 1RUE3 3I4LA 3NOVA 2TMKA 4B6GA 5K3AA 5JWRA 2HBUA 5E6SA 2FSUA 2ZNYA 1GDTA 4YMIA 3I8SA 3PQ4A 3CIHA 4K7JA 1TGYA 3TG8A 2W01A 4PLHA 2I2DA 4I5EA 2B20A 3CCFA 4O4LA 1A8QA 1IVSA 1T02A 5CYMA 4GSKA 1YQ2A 1VJWA 2PXXA 3L7OA 1T8RA 1DQRA 3RC2A 4O44B 4BLTA 3MIDA 1XEFA 5IDXA 3B1XA 4MKRA 4KGVB 2FQPA 1N9GB 1IKYA 1SB9A 2ZETA 3L6OO 4AZ3A 2WK4A 5C3RA 5E3JA 4BBAA 2J7WA 3W8NA 3AA8A 1C2TA 1QHFA 3UMMA 5EJ5A 3INYA 1P19A 4DV2F 5I3PA 1AR63 3UVEA 3V3KA 1S9EA 2R85A 1U5BA 4U6SA 2CG8A 1ATIA 5FRDA 5A0FA 4WHMA 4LXHA 4ZZ8A 4IEQA 2LVBA 2VG7A 2Q1YA 4GH5A 3NAMA 5FORA 3FHIB 3G2JA 4TWIA 1M5OC 5FWDA 3T0AA 5C7PA 3I5UA 3A36A 2WAQD 2D06A 5DHTA 3KHBA 3KZXA 5FY9A 3O1OA 3DV0B 3R2DJ 4HNSA 4AJIA 2IIHA 1CJTC 5ETJA 4DLEA 3NGRA 4NENB 1NA1A 3E03A 2JFPA 4TL8A 3NJ8A 3K5NA 1BOOA 1DRUA 4IDKA 3I3SR 5LCWL 2R65A 2XBMA 4BA6A 1WB9A 2KZZA 2FD8A 1LFWA 1TAUA 4MVTA 1NI4A 4E27A 1HDKA 3KMSA 4ODIA 3GT3A 3G1WA 2QMWA 3LPAA 3PFCA 3D7NA 4HNGA 5AVYA 1RJFA 2MQQA 4AY2A 1CUUA 5IBPA 3MJTA 3I73A 3ZXLA 2OEMA 3OTBA 1W88B 4AIRA 1KJLA 1T8UA 3T1YF 4FFIA 4XJ8A 2DVAA 1QGUA 1QHDA 1B7YB 4WVLA 3VH4A 3HD8B 1E99A 4XFIA 3ROPA 1OLSA 3M7IA 3UYJA 2XADA 2OQ2A 2VVDA 2HRDA 2IPLA 4AI9A 1JYVA 3VNUA 3TK1A 1RADB 1T8EA 1DINA 2ZAYA 1O58A 1HE3A 4WY5A 5IXJA 3GSDA 3LA3A 4XF1A 1ZFNA 2JGIA 1A9TA 4Q3LA 2XKPA 2Y0CA 1DBIA 3G2IA 4BO3A 2XCSB 3HBZA 3GJSB 3H1MA 3OUIA 3I3QA 2VRCA 2YKPA 3C7OA 2H17A 2CJXA 2XT9A 4ZEVA 1AUOA 1I94B 2XIJA 4ZP9A 5AW6A 5H16A 1M6WA 5ITZB 1E3WB 5FUQA 3K6SA 4FPHA 1DARA 1E1CB 2IP2A 3PJYA 2NAPA 1PTKA 4K3UA 4BDPA 2X2PA 1L5ZA 1DHKB 4LC1A 3PCOB 2O1XA 3LYUA 3CLKA 3KHTA 3TXXA 4AKSA 6Q21A 4S2HA 4NV0A 3RVSA 4KFUA 4OK6A 2ZBIA 5C8CB 1U5CA 4QYZK 4KDFA 3TVTA 3ACIA 1KSJA 2GSDA 2VHTA 5HP1B 4OJ3A 4LFAJ 5FZ8A 2AEJA 2GA7A 1VHLA 2F4LA 4ES3A 4I66A 4YUVA 2Z2LA 1ZH8A 1R6AA 2FUG9 4W8OA 3B9IA 3LF2A 4CF3A 1A5ZA 2QTFA 2EEPA 5FUIA 1TMJA 4PUOA 3M4ZA 1YZ7A 1YR1A 1Q95G 1LECA 1Q81T 3M1VB 4NYMR 1Q53A 5B0EA 4J90A 1ZJWA 4X20A 5IAGA 2X0DA 5L53A 4XCXA 4ESOA 4Y0NA 3NEKA 1NDUA 4WVWA 1M0SA 3QSGA 1O96A 4CKZA 5BYBA 5B6JA 3EVTA 2E5GA 3HWRA 3EZYA 2ZUVA 3M5CA 5KQGA 1G8FA 4ZPVR 1Z13A 4FDTA 1YR8A 4KRYA 4Z0TA 1ZOTA 1WKBA 3H1GA 2YHUA 1F5SA 3CJTA 5TE9A 2P7IA 1WBBA 2XI4A 1GCOA 2ZE2A 3H97A 4ND5A 1QBKC 4UZEA 3I0NA 2HLDD 4WIQA 3WWPA 2HA4A 3MTBA 5I9TA 3U3KA 4MI6A 1NUHA 1EEXB 4JC8A 2VZSA 4DMFA 3ILLA 1C28A 1BBT3 1B8NA 3GGCA 1RCOB 3M4YA 1AF7A 1RYEA 5DULA 1SBCA 2OTCA 3CEDA 1TUBA 1QF7A 4HSLA 5EL0A 4GIQA 5C46F 5KG4A 1E1YA 2RHOA 4CUGA 1OXUA 1EETA 4X61A 1JYNA 4NVRA 2OV2A 4A8YA 4DA4A 3RJ9A 2AL7A 2HA5A 1EVIA 1T95A 3H4DA 1PBTA 5I9SA 3HABA 3HH8A 1QP4A 1FYEA 4FFWA 1DQYA 3WGHA 1XQNA 4DNOA 1TAGA 3V1LA 1HQKA 3W6ZA 4QW8A 1WOYA 1N0WA 1YR6A 3L92A 4GMXA 2BGLA 5CCXA 2BGMA 1C1BA 2WSIA 3CA8A 3JALB 2VEOA 2OXRA 4RC9A 4TWJA 1GXSA 1L3TA 5CFCB 1WOMA 1U25A 5HCUA 2DVGA 1XF1A 3K70D 5IAVA 2RU9A 3G6ES 5BT9A 3NWJA 4Y6PA 4DL5A 1WD5A 4KPUA 4R7GA 2XXJA 2X4DA 2COEA 3KUCA 3SCZA 3X44A 4JYAJ 1BKZA 3QJPA 1CWPA 4ACBA 2YJ4A 1WW2A 4X54A 1W6QA 1TM2A 2XNJA 3QRPA 1ISGA 4YPOA 1IB6A 5FZFA 2XCAA 4TMFA 1DOHA 2KDOA 1DG9A 3UMJA 1N6NA 1K66A 1LTQA 2D5IA 5F0UA 1WM1A 3OD2A 2WWYA 4F3QA 4I55B 3K4QA 4YV7A 5A3RA 4Q0UA 3FCSB 2UVQA 3VF0B 3TRDA 5C25A 1FFXA 1ZU5A 2AYXA 5GMDA 5E2BA 1IXZA 3QELA 1KWGA 1TUEA 3OCPA 1LS6A 4HPKA 1RWPA 4G8CA 3ZHYA 1WQ4A 5TARA 2VG9A 2YNIA 4ZVHA 4X64F 3VOAA 3WGQA 3PX3A 1Q1EA 3DCNA 4QBGB 5ITHA 4PIZA 3UV9A 1BXKA 1F7UA 1LK5A 3ZSEA 3EXEA 1OH4A 1PCXA 2QROA 2F9MA 1FXWF 5I7VA 2B5VA 2NUAA 1HORA 1VL8A 1LXJA 2UXDJ 4L3NA 1KD1T 3BR9A 5AKHA 4CLRB 5BRJA 2ZIZA 1ZIXA 2E55A 2FWMX 5RUBA 2UV8G 3V1UA 3ACBA 4DV3J 1T94A 1SLTA 1U7LA 5EWJA 4URZR 2OAP1 2JRSA 3KT0A 4FSXA 2OKXA 2D40A 4OK3A 4E4HA 3AMQA 2GC2A 4IKAA 4F3KA 2ZMLA 2O7NA 2BR5A 2YWDA 4E51A 3SK0A 1REGX 3GVIA 1EX1A 2C2BA 2Q9UA 1RRMA 2MSCB 5F5AA 3VBRA 4JUFA 3L0PA 4TROA 1NYLA 3TE7A 5IYYA 1CJKC 4OV6B 3SYTA 3ZVRA 3DSRA 1D1SA 3FETA 3J9SA 4CIVA 4Q44A 1NWCA 3C1TA 1ASJ3 4QYTA 1MNEA 5HE8A 3ZYRA 3VTIA 5FL3A 1TZBA 5GONA 2JCVA 4N3NA 4KG8A 4P83A 1QPZA 2WWGA 1XFAA 4FGWA 1PDOA 3O0TA 2Q7OE 4CQMB 4KGQA 3P9IA 4W9NC 1OASA 4NXMB 3DZIA 4LOIA 4NPRA 3QFRA 4TMTA 3KPWA 4JB2A 3MQ4A 3HYCA 4OA5A 3KWVA 3CX7A 1SOWA 5A3PA 4DS5A 5K0ZA 4NCIA 5FMOL 4Y00A 3QE3A 5ETKA 3RC3A 1ZMBA 3PL0A 3ANSA 4PZEA 1OI4A 4IE4A 4HQLA 1JT9A 2Z58B 1NVWQ 4DF8A 3PW0A 1RUH2 3ECSA 3T5BA 4Y2HA 3QYYA 4PANA 1HQUB 2GO1A 1C1FA 3A1VA 3AXTA 3E35A 2WYVA 1AJOA 4LRDA 3HCCA 3CBQA 1KVUA 4GSLA 3S7TA 4IYRA 1R8YA 2QB5A 5BUZA 3K0AA 3W5BA 2VHEA 1Y1QA 1V95A 1M2JA 3KLIA 2GRAA 4CLEA 4J9VA 2RDJA 3UAZA 5D1HA 5IHPA 4DJFC 1BD3A 2YYOA 1ACJA 2VOVA 3PENA 3U3ZA 2W7PA 1W8OA 4X97A 4BNYA 2UXCB 1YFZA 3EB9A 3TGLA 1DQ8A 4ZVUB 2WAMA 3A9WA 4CLDA 3ESCA 2D3OR 4X4VA 1BW9B 4XBNA 1UAYA 2NU8B 2JFYA 1EU1A 2AMVA 3LX5A 1MORA 1LULA 2M88A 1V3SA 4UCXA 2EQBA 3WKEA 1KPHA 4DOZA 1VFNA 1FDDA 4CLFA 2VHWA 1GZDA 1Z4LA 4HTFA 3HVKA 5C4MA 1W8WA 2C0QA 4QX1A 1P1HA 5C6CA 1X9MA 3SLGA 1JA0A 3Q22A 2JIZD 5JLVA 1XEXB 1KI2A 3A9VA 4R7ZA 1A9NB 1AN0A 5CG9A 2VATA 1AUVA 2H2DA 1KYXA 2W0XA 1N92A 2ZSAA 4M54A 2REOA 3T99A 2RB4A 4RV9A 2YCLA 1ESMA 4I69A 4AFCA 1NMSA 3F7NA 5G0UA 3F97A 3VKLA 4RHYA 4J0JA 1RT5B 2FVYA 3VYSB 2WIIB 5FXVA 4RIFA 2FEXA 1WW4A 3WMWA 3H8YA 2W00A 4PN7A 2OZPA 5CA0A 2JH8A 3W5AA 1ZRDA 4R4XA 1KRXA 3CRVA 4MX8A 3K0SA 2BM9A 1YZFA 3B69A 4CLPA 4W82A 4W8JA 4G5YA 4B6JA 1A8SA 3VKNA 1PJLA 4CJXA 4W1SA 3IV9A 4RNDB 3STHA 3HWWA 3FOAA 3MFAA 3FQKA 5F9LA 4XPIA 3IV7A 1O08A 5E2IA 4G65A 4M36A 1FJHA 1JU4A 2WNUA 2HL6A 1RWXA 4DPUA 3I0SA 4Y0VA 4WNIA 2RS11 2DR7A 2W4QA 4XGNA 2OW4A 1Q7TA 1CDZA 2P9BA 4X3PA 1GL6A 3WDYA 3Q4GA 2OKGA 1A9YA 3DV0A 1YJVA 1YUMA 3OQVA 3WE7A 3BC1A 4DEVA 3EEFA 3T4HB 3BPSA 3POGA 2FP4B 3TGWA 1NSFA 5JJ5A 2I2FA 3V6JA 1Y10A 3AJYA 3ZDAA 2P1RA 4QPZA 4DIDA 4CDWB 2ZH1A 2XX3A 3HNBM 4X6QB 2YVLA 3JQXA 2ID4A 1MS3A 2VECA 2DV9A 5BNPA 2M5YA 1X2EA 4KI7A 4M0LA 1BK0A 2O5CA 4MR8B 1NRKA 4GKYA 4H16A 2A75A 3GARA 2HMIA 3V42A 3L2HA 2F67A 3A1CA 3KQYA 4JP5A 4ZKTB 3W62A 8ADHA 2GK4A 3MLLA 4H3SA 3QBTA 3ZGLA 2AUNA 2NYHA 4TM8A 3TFWA 2WV9A 5JS6A 5WRFA 1LGNA 1RT4A 5JV5A 1VQKS 3V9PA 1NMZA 1JVBA 3W8FA 1MN6A 1O94C 2DT9A 2ZB3A 1ZJ6A 4Y2YA 1YZQA 3C3LA 2BM8A 1JQAA 2JDAA 1DRWA 1M76A 5EGYA 1S8FA 2GCOA 4HSEA 3F56A 1M5UA 4IEFB 1H4SA 3IVXA 5EESA 4JL5A 4KAJA 1I5OB 3WVJA 1VQ8S 3ICEA 4DCTA 2CFTA 3G6WA 2PZAA 4B4RA 3BK1A 4LGVA 2K2WA 4JRLA 1ZBE2 1B35C 2RARA 4B29A 2ZRQA 1WMEA 3K32A 1MAVA 2CVEA 4JSRA 5CHEA 1WB4A 2WNHA 3KK1A 1BVVA 1AQYA 1KC1A 5K5MA 3AK4A 1QIQA 4CLOB 4AY4A 2UAGA 3DAYA 4Q1BA 1JEQB 3A6KA 4QT0A 1IPFA 3S8SA 2GCOB 3GEIA 3VHXB 2XE6A 5GGYA 4OZ0A 1SC9A 2Y27A 1I0ZA 3WGIA 3GALA 1C9NA 1GZTA 1LODA 1NJYA 3PHGA 2H0BA 3WYAA 1L4UA 2RQMA 4GE0A 1X9PA 1R9NA 4AMVA 5A2QA 3WIVA 1PAEX 4FHCA 1UAWA 3M2PA 3G2QA 4KOAA 2PR2A 3GIIA 2NSLA 4N1AA 2CZCA 4QGBA 1UM9B 4XXHA 4CEHA 3HA7A 1OLOA 1W8DA 5JASA 2KG1A 2XCRB 4DG8A 1QQ6A 5IVIA 4JCCA 4R8MA 4HDRB 3K4DA 4DEZA 3BREA 5AHXA 3COSA 4M5GA 2QTHA 3EUWA 3HEMA 1UVKA 1JV2B 4JH0A 3W3SA 3G6KA 4D69A 1PEYA 4BTLA 4YG0A 4AWXA 3CNOA 1F0XA 3D0IE 4BIFA 4NMXA 3IB6A 1EP9A 3KVBA 1AXYA 1S9DA 3FFQA 1HE8B 4WCFA 3IP0A 4DSIA 2DBVO 3LDRA 1U7XA 3P5SA 2GILA 1SUWA 4Q39A 4M1MA 2JFFA 3AP4A 2J6SA 3WHUA 1U31A 1XK8A 3DF9A 5FZ6A 2ZZMA 5DM70 4IIHA 3K3NA 3KFWX 5KXBA 5KXEA 1V6IA 4RE6A 3UA4A 2BR4A 4V1CB 5IT0A 2WHYA 3KJVA 2NMOA 3ND8A 4OHRA 3UR3C 2NWQA 2AKYA 1VBE1 5F41A 3I3EA 1K5HA 4PC2A 1ZSVA 1FTWA 1YUNA 3E7XA 5CM8B 2VVEA 3VBEA 2HCTA 4AHWA 4PSAA 2WMNB 3WLAA 1Z78A 4RSMA 4RBUA 2IYXA 3MTJA 1M8GA 5KAMA 1K5GA 1ITPA 1AKMA 4EUEA 4B3GA 3N86A 3PXCX 4OX7A 1JALA 3HFJA 4WADA 2WZQA 3TOJA 4LF8F 4L5CA 2VL7A 2OYRA 3AOEC 1GDHA 1THZA 4HQ6A 2JC0A 2HLTA 2GCFA 2A67A 4MGHA 3TQFA 2UUBF 4KQHA 3HVAA 1X7HA 2OILA 4IOLA 3OL6A 2Z1MA 3GSIA 3SCHA 1VBFA 3UKDA 4Y0FA 3W1WA 1ZRFA 1MX9A 1MMNA 2IXHA 2KQUA 3L1VA 3H4BA 3NHUA 3OD5A 1LS1A 4NBUA 5E2QA 4ZRDA 3OVAA 1XNTA 2WQ8A 2ZKUA 3FC0A 4FYHA 3GD7A 4U9HS 1P2TA 3RQSA 3WHTA 1TFRA 1JBQA 4TWAA 3CT9A 3R44A 1P7VA 3W9SA 4UFPA 3CW2C 2A0UA 1AUYA 4MCAA 1HYBA 2XXZA 2HC9A 3BBFA 1B1AA 1V6SA 1BQ3A 3EYAA 3M70A 4KRXA 2VP5A 3QBJA 4U7CA 2IPMA 4DV6B 2PUBA 2BFFB 4V2IA 5G0WA 4PO8A 4IDOA 4EVQA 2M4MA 2XT6A 3HD1A 4QQHA 1ADFA 2YNFB 2C88A 4I6EA 4AYUA 4JGGA 5KAKA 1L4HA 4COOA 2WWSA 4ARXA 1O5TA 2AC4A 1W0KA 2R6R1 1YJRA 4GDMA 4AGGA 4WM8B 3SQLA 3LUHA 1RJWA 3T8YA 5IXSA 2GJKA 1CAWA 3SM9A 4JI0F 2J8AA 4REOA 2XULA 1HNXJ 4NFHA 4PDWC 1ZYQA 2ZSJA 5J1PA 1C7FA 1G21B 1FQWA 3DFIA 4D3XA 4FGSA 4GH4A 1H6AA 1ZWKA 4XDGA 4EZHA 3DPRC 4A1FA 1V6JA 2O8OA 3DEIA 4BU1A 2B5JA 1UMBB 4QTZA 2Q29A 3T3YA 5L19A 4NIDA 1SQ5A 4JBYA 2G6TA 1PQUA 3TTYA 3QVGA 2CDNA 2IXKA 4COWA 3E4CA 5KXCA 2DM6A 1W9FA 4KV9A 5BN3B 1UK9A 3HKBB 4AUEA 4B84A 1FMD3 3PF8A 1KAOA 1GAWA 2ZD1B 1UFLA 3RVJA 5DZSA 3RK0A 2AD5A 1NJ2A 4GG1A 3KHCA 1GTZA 2A2DA 3D6EA 1PYTA 4W5RA 1OUSA 1HRI1 3SQNA 3IP8A 5KVAA 2F9JA 4XF4A 4E5DA 4V2UA 1YQWA 2KFYA 2XD9A 4UT5A 2IDMA 2H11A 3LK6A 2LQJA 2QE6A 4PLGA 2DUQA 4DCVA 4MVJI 4INOA 3HZRA 5LA6A 2CZVC 1K2WA 1CPYA 4C87A 1KEPA 4G5XA 5KMGB 2WPDA 2VF7A 3GT0A 2FK7A 5D78A 5FRAA 3UNYA 4JI0J 4DWIA 1R0ZA 1IUOA 1CF4A 1M1ZA 4AJJA 2IS6A 3LEIA 5ITVA 3UUGA 2GF2A 3ZZRA 1WY5A 2WG0A 4LT6A 1PO13 2OQIA 3SJ7A 2Q2OA 1UQXA 3HBLA 1KS2A 1FFXB 3H8SA 2XMLA 1PBNA 1K4MA 4XWAA 5TNXA 3U3OA 4D7AA 3O2JA 3J8F2 2SCUB 4M1TA 2VXOA 2CVIA 5C80A 4BL5A 5JBQA 2J3HA 4EY4A 1D8AA 3W2IA 3B1JA 1YU9A 3FL7A 3FVQA 1LWCA 3ZBTA 1KLNA 4TZDA 3N2EA 1GM5A 1ZD1A 4ALMA 3V2IA 4AULA 3KS9A 4E22A 5KX5B 3GFTA 2DUUA 5HRAA 3Q86A 4ZVNA 1N7GA 4UOCA 3HNMA 2NXNA 3R3UA 5AXDA 4NYPA 2XKOA 1A8DA 3UL2A 5IJ0A 3NAHA 4R5PA 3SQMA 4CG1A 3ESAA 4R0EA 3SXUB 4PRFA 2PKCA 5KHJA 4RTKA 1BDJA 2QZJA 5B64A 3M82A 2V9ZA 1XHLA 3GRPA 2BKAA 2YASA 1ULUA 3GJTB 1CR1A 2Q07A 1RWVB 5IKOA 5I45A 4BFYA 3JQKA 4BB5A 2VJMA 5TJHA 3DDZX 1I3KA 3VJKA 4G2NA 2NSBA 2E5LJ 4CETA 5FZBA 1O0BA 3LQVA 2IU0A 4TVBA 2HHLA 4OLFA 4XJTA 4UFLA 4V3BA 4B40A 3OQNA 5AW1A 2Q6CA 1IJFA 3ON5A 2J3DA 3VTKA 3RIMA 5CXUA 1F4PA 1BXGA 1GZWB 2KH9A 3R0JA 2QMOA 1Z5ZA 4RR3C 1OC1A 1FNBA 4N47A 1T6YA 1CUVA 3HWSA 4UT4A 4RD1A 3L9WA 3O5AA 1Z5OA 4MVJE 2JGEA 5AO9A 3FEXB 4WZFA 4KGXB 1JMTA 1WHSB 4E4ZA 2IODA 4HDOB 5IW0A 2C9DA 3FWPA 4UBGA 3R6SA 5A6VA 2JG9A 5J2PB 4USIA 2HCFA 3VI3B 1USWA 2XTJA 2K8GA 1AB6A 1E5RA 1CX9B 3TDNA 1SUCA 1OC2A 1JIKA 4R1TA 2PPVA 3RS7A 4BFSA 3M4JA 2FW9A 3FYSA 3DZJA 1Y8AA 5DM7Q 2XCQA 3E18A 1V25A 2EX1A 4TV9B 4MAFA 5EJZB 2ZP1A 2NGRA 3PT5A 4ECRA 3T1HF 4XWGA 2VNHA 3HJRA 3AC0A 1K1SA 1YWXA 2QLLA 1IQAA 1S96A 4FOTA 1M8PA 2PH1A 1NN0A 3S2IA 1NY6A 3LIPA 2Y1OA 1G21A 3UCUP 4H4OA 3TI0A 2R7UA 2PL3A 4ZC8A 4QVGA 2TBVA 1X42A 3DXXA 4KV7A 5LDDC 3NV1A 4Q19A 3AFMA 2CW5A 1S1MA 4QQPA 2ROEA 4ZP6A 4ED4A 4GOXA 2QMUB 5FNZA 4KO0A 5DP2A 3JD4A 1WUHS 2VLIA 1L8OA 4KG0A 3ER8A 3BRWD 1TTQB 4N8EA 2QX9A 1OX4B 1OH8A 4Q16A 4YP3A 3CR3C 1YUBA 3LOQA 3X1DA 1J23A 4E9KA 3MM6B 1FEZA 4DB4A 3FI0A 2EJUA 4FC6A 4J1NA 1OBHA 2ZJZA 1A7UA 3DL4A 3C3DA 5FA8A 2DLCX 1BWSA 3MB8A 4ED3A 2VOOA 5KFSA 5KFIA 4IQGA 1ZA1B 1P6QA 4WOBA 1NZ8A 2IVJA 4LXQA 1XDZA 1Z4NA 3W3AH 1O7FA 3JQMA 1JTVA 4G0WA 5J1EB 4GOMD 1JLQA 1NUPA 4DDHA 1OWOA 4BQ1A 3RAXA 3L2OB 2FPUA 1YZNA 4WNAB 4C06A 5AFBA 4MB6A 1WCSA 1E7YA 5LB6A 2AFIB 5H4GA 4BNVA 1YBFA 4RACA 1XEWX 1BHQ1 2PUGA 1N25A 5J59A 3ZWNA 1JW6A 3GFHA 1LBIA 3F9CA 2D9PA 2N7GA 5BYNA 3UJOA 3R5XA 1YRAA 3RFUA 4JHLA 2E4YA 3SEQA 4IILA 5E9JA 5KOJB 4NMHA 4DM7A 2KU7A 4QUJA 3LQFA 1CVLA 2R4UA 5ESXA 3KQKA 5B0DA 5DYTA 3K2IA 5EHQA 4L4YA 1W44A 1L5FA 2XB6C 3B2EA 4QYMA 1O3YA 4PQGA 2LP4Y 1VJDA 2PGCA 1PNQA 2ZB4A 4MR9A 3GLHE 4NBNA 1RAFA 2O8VA 3WQHA 3F2VA 1ZOOA 3WDXA 3TAHA 4MIKA 4YW7A 2DFNA 2PGOA 3PY8A 3B3AA 2LCFA 3OECA 3KYCB 3LJKA 1AH2A 4JLNA 3RVDA 1EGAA 1TQ4A 3ROXA 1RE1B 5KYKA 3HL4A 2YZGA 2JBHA 1G6KA 3IKLA 5DUWA 4FS1A 2GMLA 2GO7A 1LEOA 4PHFA 1PGL2 3VYRB 2P1ZA 3FZ3A 2R79A 3ND9A 3TZXA 3EEYA 3MLKA 1FRKA 3EVZA 4LCEA 3C3PA 3CU5A 4M9ZA 3L7LA 3N7TA 1SU6A 2EW8A 4GA9A 3DL2A 4IYJA 4BV9A 1UKBA 3EGDA 2WBRA 1CJUA 2QNBA 2D00A 3MUZ1 1IUKA 5LB2A 3EZLA 4KMRA 5CZKA 4XQWA 2V4JA 4ROSA 2RKOA 3KDSE 5AJ3F 4DUWA 4B3OA 4DREA 5LFAA 4LC9A 3VTZA 2EZTA 3TQTA 1TVCA 3BQNB 4RXTA 1N2IA 4A91A 3HR9A 1AF4A 4HHJA 2E63A 4EB6B 1Z0DA 2IQ5A 4CLZA 1TT5B 1H2TZ 4YVWA 3U5TA 3VDXA 4DSJA 2J9DE 3KZMA 1UH5A 4HVTA 2PAFA 1KN6A 4M8SA 1TME2 5BSWA 4MTPA 1NJ6A 3KKEA 4N03A 3Q3JB 2OHJA 3U17A 3RJZA 5FDBA 3GJ0A 3LL4A 1XAJA 3OF5A 3QPIA 2NVOA 1IY2A 2P69A 3SFVA 1RT6A 1NBIA 2ZJ2A 2JEGA 3MWJA 1NPTO 2D54A 2AI2A 4YJ2A 1OIXA 2NXWA 2DLNA 2IYRA 2OYSA 5DWDA 3JAMU 5DQHA 1QGOA 1V71A 2XBO3 4A45A 1LESA 5LXRA 2D13A 3FMBA 1RQGA 4UU8A 3MIFA 1OH7A 1CJDA 1KMHB 1K89A 3PUWA 1Y81A 5ED0A 1JDPA 1IR2A 4H31A 4KE9A 2R4FA 1GQYA 4LR4A 1S2KA 3KB8A 3T4EA 1PE0A 1ZRSA 5D0RA 1NAEA 5J2UA 1MQSA 2NZUG 2VTVA 1K68A 4UF4A 3KLEA 1FKOA 3DOMB 4H60A 2H06A 3SD7A 3GZ7A 1SHTX 5DIZA 3VAHA 3O4IA 3NHRA 4LBVA 4NEZA 4YSFA 1C57A 1TW3A 3GV0A 4D25A 4QPIB 4FX5A 2O1PA 5D77A 4HH3C 4GMP0 4KQZA 3COPA 4WDRA 3JWHA 2JIQA 1JPUA 3WUCA 3PEJA 4YM2A 1R1DA 1O8SA 3HM2A 3F5FA 4D8VA 2Z9CA 4UFJA 1WG1A 4MA4A 1N5QA 1VPHA 3H75A 3TEZA 1RP7A 3O7MA 3MGBA 1KJJA 2A3NA 1WHVA 3B00A 4ZDJA 2OT7A 4MMOA 4A16A 2WJSA 1UWWA 2ILYA 4FS3A 2JVOA 4LMZA 4W6ZA 1R0XA 1P7ZA 4WA8A 1RKIA 4MW2A 4CDWA 4RPFA 3QGGA 2IITA 4XM2A 3WY9A 1S6YA 1SG9A 2YH1A 3BRSA 4XURA 1FUYB 2XYPB 4WVVA 5JD6A 4JDPA 3QAUA 2ADDA 1YX2A 1LNZA 2O0MA 5FIXA 1XZPA 3JS5A 2BQPA 1E7MA 2XVYA 5F9TA 1E9CA 4A92A 4QX2A 3L1JA 4ETWA 2IBMA 2A30A 4LLFA 3A4UA 4EP1A 2HH9A 2C58A 3S7EA 4FNIA 3NYIA 2IP4A 3K4ZA 1F2NA 3FHLA 2ZJOA 4DXZA 1YMVA 4IV1A 4HCJA 4JIGA 4BFZA 4CA9A 2WILA 4XF0A 4ZXPA 1RWXB 1IXYA 1I1GA 5FK7A 2WNUB 1EK6A 4DWOA 2R4TA 1RC1A 1Z62A 3V4PB 4IOCQ 3FVWA 4BWMA 5K8NA 4OUKX 3Q88A 1TA0A 3WICA 3RK1A 3TEGA 2IMWP 3EC1A 1MC5A 1CAVA 5HF5A 4LBJA 4E5MA 3IVRA 2CGOA 2Y0PA 1DIBA 2BE7D 1NW5A 4A8FA 1GZVA 4LVNA 5CLLA 2OXTA 2Q0SA 1HBMB 1U8UA 4FYJA 3LUFA 3OD0A 2O8DA 4E5PA 3HA5A 3BPDA 1Z2EA 2AB0A 4JI0B 3DLKB 5KWRA 1W36D 2FUNB 3A12A 1NVAA 1C4XA 4NQZA 2O1QA 1ZHFA 4YWHA 1TK0A 2XZTA 3QEAZ 2B7BA 4G0UA 1I6LA 1SBRA 5EWEA 3T5TA 5FUVA 4LBPA 1EWTA 3FFWA 2AFIE 4D5GA 4Y1VA 4JZRA 2JDHA 3UVJA 4R25A 1QO9A 3QVOA 3M2UB 2F9DA 2ZK7A 3TX0A 4GPBA 3NPMA 3NZEA 2J9XB 1NVVQ 3OPNA 2JRLA 2DXEA 3IDAA 2BOVA 5DZFA 2FMKA 2HR1A 4MW9A 2BEVB 4EJSC 5APAA 1VIMA 4AF9A 3RYPA 4KX5A 1CQIB 2W2KA 1B09A 3OY8B 3I96A 3UPFA 3RWMB 3O31A 5IQQA 2VH5R 2GD1O 2NU8A 3OUZA 3RWKX 3W06A 2O8CA 1EA7A 3KHGA 3H2YA 1FV3A 5CH5A 2YKMA 1ZVQA 2XRMA 2P9ZA 1YQQA 1E9EA 1DCFA 2E53A 2X86A 1LFAA 4EEZA 2O54A 4KMQA 4OX9F 2QRPA 1MABA 3FA2A 1QF6A 5K0EA 3IG1B 4YDDB 1T1SA 2VYQA 4GKKJ 5BSTA 1OSCA 1ZH4A 3QOXA 1J27A 2EZ4A 5E6RB