3AFGA

Crystal structure of pron-tk-sp from thermococcus kodakaraensis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
519
structure length
505
Chain Sequence
KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Subtilisin-like serine protease
total genus 165
structure length 505
sequence length 519
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
A PF18237 Tk-SP_N-pro Tk-SP N-propeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3afgA03
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3afgA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3afgA02
1JEAA 2ID4A 4B5LA 4BWGA 1C9JA 1ZVKA 4LVNA 1CNMA 3D43A 3DE2X 3VV2A 3DDZX 3EIFA 1TM1E 1EGQA 3DVSX 4YN3B 3GT3A 1NQJA 2X8JB 1SBIA 2WUWE 1C3LA 3I2YX 3P5BA 5AVKA 4AKSA 2E1PA 2Z2YB 1SBNE 1SBHA 1V5IA 3BPSP 4J94A 5CW1A 1V6CA 3EE6A 4JP8A 4WOCA 3A3NA 1SUBA 3A3PB 2W2QA 3GCWA 1VSBA 2ST1A 1T1EA 1AU9A 4DWWA 2QTWA 4K8RB 1Y3CE 2W2OA 2PMWA 2O8OA 1MEEA 4OV6A 3WIVA 3QFHA 1DBIA 2DUJA 3PRKE 2GKOA 3TI7A 1A2QA 5I9SA 4M1ZA 3PTLA 4H6VA 5B1DA 2SNIE 2LUWA 3DWEX 4NE9C 4OMCA 1ZVJA 1SPBP 1C9NA 1Y34E 1AVTA 1SUPA 1IC6A 2HD4A 1GTJ1 3WQBA 3SQOA 1KDYA 4CG0A 1SVNA 3DVQX 1BH6A 1KDZA 1WMEA 1THMA 1AQNA 1SUEA 2IY9A 1AF4A 2XTJA 1U5IA 3DE7X 1NDQA 2B6NA 4G9SB 5FAXA 4K8RA 2QTWB 1TM7E 3DE1X 1KE1A 3Q40A 4MZDA 4DXZA 2XVGA 2W2PA 3F7OA 1WSDA 4OV6B 4HPKA 3BOWA 2HPZA 1TM3E 3CNQS 1R6VA 2SBTA 1Y4AE 3GT4A 3CO0S 3GCXP 3F49S 1S2NA 1YJCA 4C3VA 1OYVA 5JXIA 2ID8A 4YN3A 5SV5A 2ZRQA 1TO1E 1QXPA 4FONA 1SUCA 1Q5PA 1Y48E 1YJBA 3DF0A 4AKTA 5JMOA 1NLUA 1CSEE 2PQ2A 3DE6X 1EA7A 2PWBA 1SIBE 1Y3DE 3I37X 4DY5A 1AV7A 2DQKA 3F7MA 1TK2A 1KFXL 1P7WA 2W2MP 4HPKB 2X8JA 1R0RE 5JXGA 4GI3A 3VHQA 2Z58B 1GA1A 3ZXYA 4DY3A 4RYDA 1BJRE 3A3NB 5SICE 1R64A 3EDYA 4LVOA 3VTAA 3ZXXA 2P4EA 4NMXA 2Z56A 1WMFA 4H6XA 1TO2E 1UBNA 1PTKA 5FFNA 3HJRA 1Y1KE 1Y3BE 5AQEA 1KE2A 1P8JA 3DW1X 3CO0P 4DJ5X 1AH2A 1WMDA 1AK9A 2PWAA 4NE7A 3SQOP 3BPSA 1MPTA 1TMGE 3LPDA 4HX2A 1TM5E 1KDVA 3I34X 4ZARA 3AJ9A 1V5IB 1NQDA 3JQWA 2PYZA 2ZWPA 2Z57B 5FBZA 3VYVA 2Z30A 3BX1A 3DE5X 3QTLA 4HVLA 3DW3X 4CFZA 1S02A 1Y3FE 4Z2AA 3GCWP 3LPCA 1LW6E 1T1IA 4KPGA 2Z56B 2V8BA 1HT3A 1BE6A 4DZTA 3DE0X 4I3GA 3AFGA 4H6WA 1Y9ZA 1SIOA 2Z2ZA 1SN7A 3BGOP 3WIUA 1GA6A 2XTJP 3A3PA 3A3OB 2WV7A 2WUVA 1OT5A 1WVMA 1KFUL 3DYBA 3A3OA 1SUAA 3T41A 2G4VA 1PJ8A 2XRMA 3DVRX 1BFKA 4DZGA 5K7SA 4KG7A 1GNSA 1ST2A 1SELA 2PRKA 1SIUA 2XVKA 1S01A 4CFYA 3I30X 2W2NP 3VV3A 3L1KA 1SH7A 1TECE 1SCAA 1IAVA 3CNQP 4WOBA 5ARDA 2DP4E 3VSBA 3UNXA 5ARBA 2ZWOA 1BFUA 1Y4DE 1SCBA 5JXHA 2W2MA 3QMPA 3GCXA 1OYOA 5ARCA 2XVLA 1SPBS 1SBTA 1GA4A 2PKCA 2QFEA 2W2QP 4NE9A 1GNVA 2Z2XA 1YJAA 3H42A 4ZOQI 3JQXA 2W2NA 2SICE 3VV2B 3D9QX 1Y33E 1SUDA 1GT91 4I0WB 3TI9A 2W2PP 1T1GA 2Z57A 3P5BP 1SBCA 4C3UA 1SCNE 1PEKE 1SCJB 3AJ8A 1GTL1 1YU6A 2Z2YA 1GCIA 1DF0A 1P7VA 1NDUA 2IXTA 1DUIA 4KB5A 5JXJA 2Z30B 1SCJA 3DE3X 1C9MA 3TECE 1ST3A 3DE4X 1XF1A 3LXUX 1GTG1 2SECE 4NMXB 3H42B 3SICE 1ITPA 2TECE 2W2OP 2PMWB 3WHIA 3OSZA 1PFGA 2Z58A 3LPAA 5B1EA 2WWTA 3BGOS 3Q5GA 1SCDA 5AMXA 1BE8A 5AVJA 1TM4E 4OMDA
chains in the Genus database with same CATH superfamily
1LY1A 2F00A 4HYEA 4QBUA 3KXLA 5EZWA 4Z4HA 4HAYA 4AVTA 4ZREA 5C3UA 5C7OO 2WTEA 4ZYUA 1BBT2 3QJYA 5DM1A 2D1YA 3KHKA 2FRVA 3IOMA 4M53A 3OJSA 4FMPA 2GBLA 4UU8A 1RYEA 2O14A 1K1SA 1RWUA 4TXWA 4Q9AA 1IQZA 3RR2A 4EMUA 5HBGA 3OF2A 1WD5A 4WOCA 5LMNF 3ZR4B 2VNJA 4NZNA 2LGJA 9ATCB 1T95A 2Q5EA 3IS9B 2P9CA 2CVPA 3M1HA 4WINA 4EYIB 4LDAA 2CLLB 3O3CA 1NA1A 2AOWA 4D57A 2R751 3IBMA 4RIGA 2FPPA 3TRIA 4IEIA 4M5NA 4KDRA 3HBJA 5HVFA 3AKDA 2P6SA 2BV4A 4LFAB 3NOOA 3UVJA 1AQJA 1A76A 1T0UA 5CAEB 3ZFEB 2LWIA 5J23A 1DCSA 3HHKA 4G97A 2O4CA 3V8NA 2WB4A 2IHTA 4R1OA 4P5DA 3WL8A 2ZBQA 4DV0J 4GC5A 5AXAA 1HHSA 4ER3A 4GC9A 4Z0TA 3KZCA 1C3OA 2Q5CA 1CQNA 3PIJA 2OCAA 3IAS6 2B4VA 1RT1B 4PWDA 3RB4A 1Q92A 2HVHA 4RVCA 2QM8A 1RPAA 3S7ZA 4JDUA 2Z3VA 4KXXA 1CB7A 1WSRA 4IGEA 1JZ7A 2QGNA 1SBRA 4Q0BA 4ME6A 4OZ3A 5A7FA 3V3KA 4RTPA 1MV8A 1DVRA 3L0CA 3F2VA 4GWMA 2RHPA 5EHIA 1EX8A 1N1GA 2DF8A 1NVKA 4DV0F 3HVWA 4CDGA 4UEJA 5FI5A 1RIRA 1M5VC 3BOPA 2M4MA 5C4IA 4X65J 2CVQA 2BFOA 3R9KA 2O3JA 2QRKA 4O0MA 1U7XA 1KQGB 3MDFA 3PXGA 5BYNA 4HEJA 4CPBA 1DQ6A 3V6KA 3VR6H 1M72A 4JVMA 2FE1A 3V8BA 3C14C 4DRRA 1HA3A 1YI2S 1GILA 2YPZA 1KVTA 1H30A 1Q77A 1NX9A 4I0WA 4NEHB 4Q4X2 3EICA 4H6PA 2FFBA 4W4ZA 3O14A 3PX3A 4EWDA 4GWIA 5KJCA 4DV7F 1B42A 3U0ZA 1HL3A 1XMQB 5KNBA 2YTCA 2DFPA 2RJNA 2GXQA 4P32A 2BQPA 2IDLA 4B9NA 4Y1FA 2W1UA 4JI0F 1YXMA 4W8OA 1ORRA 4P31A 1EAH1 3PURA 2EW1A 3MGJA 4N8SA 3SVLA 2NZ2A 4G5XA 3RB0A 1ZA1A 2YVQA 2H8KA 2GDJA 1WHTB 1PNOA 3EXEA 2FY8A 3TQ1A 2VJCA 5KFIA 1FUKA 5JNTA 4OJKA 3Q7SA 4XBQA 4EK2A 4TTSA 1SDDB 1DYKA 1WLDA 4KGZB 4MUHA 1HM5A 1HYGA 3NS5A 1DG6A 2PQSA 2OBXA 2SCUB 4Q9DA 3WKEA 3GNSA 3KSZO 4KQWA 4DFDA 1MDBA 4JL8A 2G9NA 5ALDA 2GVDC 1YCFA 3PGMA 1HKAA 1KFKB 1EAYA 5FPHA 2KLHA 1V5VA 4V2UA 4MW7A 5IT9U 4R2KA 1X77A 4HGNA 1SELA 1E7YA 2VJDA 3ETDA 4YI5A 1JRLA 5E2IA 2NV2B 1S96A 3CM0A 2JCGA 4K8OA 1NCRA 1EV13 2JFQA 5DMYA 4OZ5A 1ZREA 3AP2A 2ZIVB 4FYPA 2R4QA 5A5EA 1Y4DE 3TDKA 3D3BJ 1Z2EA 5IAGA 1TCAA 3DAFA 3HM2A 3HWRA 4XARA 1F0YA 1ZJ4A 3L3BA 5DM4A 4IE5A 4ZYYA 3OL7A 4HDRA 1NZIA 4URQU 4GIBA 3I1FA 2J3HA 4LRBA 2YMLA 2QBYA 1K06A 2VQEJ 3M2PA 4N5SA 2HIGA 3HXQA 1GNVA 2LKCA 1AZSC 4ZZ5A 2E44A 3W20A 1J0BA 4TLDA 3PTWA 1ULGA 4AL7A 1ZI6A 3CKYA 4B9MA 3TQOA 2BKPA 3EQ2A 3U4HA 1UXIA 2Z43A 2PGOA 3BKUA 2C4MA 4FR5A 4N43B 1DV2A 2QL6A 4XUQA 5CA6A 1V6IA 1ZMOA 1PZ8A 2PO5A 4GO5X 3JQQA 4YV2A 2YCLA 4R0NA 3IHLA 1L5KA 1SH3A 2M88A 1L8OA 4DJBA 3ER6A 1K7YA 3COSA 1PSZA 4C98A 2L9WA 3KTDA 1JYXA 2HNZA 2WYIA 2GK6A 2PZ8A 2E7ZA 4WIQA 3SJUA 1CUCA 2XO7A 5B6JA 3UFCX 3LW5C 1P77A 3P5SA 4K5QA 4FXOA 4H1UA 1WABA 3DL3A 4KGMA 3S1TA 4CLWA 1QJCA 4D3WA 1GPMA 4USTA 3BR9A 1FTRA 2EFJA 1MROB 5IT9A 2XTAA 5KHIA 2FEOA 2VHTA 2O2EA 3VZRA 2CQIA 3EGDA 3WDTA 4Q27A 4HRXA 5F3TA 2ODTX 1XEFA 4I30A 1JMUB 1J8YF 1BCRB 4QREA 4LECA 1MMLA 3MUNA 2RH3A 2IS4A 4Y28C 3CJIA 3NGRA 3KJXA 3POTB 1XZLA 3ZE2B 3NASA 4C2TA 2DXDA 4ED1A 1RYDA 1S1XA 1VSBA 2EAUA 2VTKA 3HGMA 3UMYA 5IRCD 1UPBA 1IZ3A 1IN7A 3F8WA 4KV8A 5CA1B 2BFCA 3AIMA 4HGZA 2CCKA 1EG7A 1BQ4A 5JHGB 3K53A 4AAPA 4WZCA 2CQBA 3QFHA 4I9FA 4UNIA 2GK3A 1OYEA 2P34A 5C1IA 5LZ5A 1T91A 3RU2A 1L5YA 2C2KB 1FX2A 4YZ1A 1U1MA 4LXLA 2PHFA 3QLHB 3C8MA 2WS92 5LSOA 1QO7A 1W5BA 3BALA 5BMOA 6AT1B 1N34F 2MLXA 3ND9A 1JQ3A 3TM4A 2JXAA 3FPKA 3JSMB 2CKMA 3TE6A 3F1KA 4AF7A 1Z4IA 1MZ5A 5JVDB 3JZFA 1GNZA 3Q83A 3KQLA 3UGFA 4LW8A 1JU4A 1RTDB 4KGQA 4ISCA 3N3BC 3ZI0A 3OECA 4AFCA 1AD2A 2XPJA 1H6YA 4LF2A 2YNHA 1CQZA 3PQDA 1EUYA 4K2HA 3UKNA 5DCWA 5I0DA 1JZ5A 1DHKB 2L17A 2GO8A 2XVGA 3OTWA 2GFIA 4DZZA 2PG3A 2GCFA 3N8DA 3N6NA 1RXYA 3ROZA 3WFIA 1ZAKA 5BR4A 4XXAA 1TEIA 4L28A 1PG0A 3HQUA 3BIFA 4Y6OA 2G70A 2R5FA 5FORA 5IBPA 1P4HA 1VYVA 3E7XA 3FKQA 3RW9A 4ZOLB 3C0KA 1AHNA 2WWUA 2OK8A 1SUCA 2EARA 1PGJA 1NG9A 4TZ0A 2D9PA 4NLDA 5CG9A 4DHVA 1H3DA 3D9BA 4KHRA 2WJIA 1HDCA 4KWEA 2L2QA 4V0KA 3W77A 3K5LA 1UJ2A 5BRNA 1K88A 4XDOA 1MB3A 4NBWA 3CDAA 5CDSA 3HRHA 2RUSA 3BF4A 3FFZA 1WB4A 1Q7EA 3I5BA 2D41A 1HFEL 4GI3A 1Z3CA 4AE5A 4RH1A 2UXCB 2VATA 1JDJA 4E09A 1JS9A 1VDHA 1BYIA 1A8DA 5DG9A 5EJ5A 4IEEA 4YWJA 3KLMX 5DABA 3EIUA 3J7LA 4C2UA 2HQ3A 5CT9A 2WQ8A 2JGIA 1ABFA 2R44A 4RW7A 1KK2A 3DOJA 4AO6A 5LD2B 3I0ZA 2CYBA 4WP8A 1UVLA 3P4YA 4I4NA 3NZEA 3RUBL 1NUUA 3MW2A 1VQMS 1BN6A 3ZVXA 2JOQA 3W1VA 5LU9A 2VJKA 5EIAA 3W5VA 1VRUA 3E2MA 2CV2A 4E8CA 3UV3A 4KDFA 4RL6A 1UWCA 2KW5A 5C1BA 4HFMA 1T5IA 5DCLA 3OF1A 3SPXA 1GRRA 5EQDA 1O6CA 1B0UA 1J5OA 1FKOB 3QCWA 1P7ZA 1M54A 1KSPA 4FYXB 2EFPA 1PJ2A 2GZ3A 4EY8A 3QD6A 3TQIA 4RNHA 5ETSA 2XMCA 4TXSA 4F1JA 4RTLA 2CG8A 1MXFA 1WLWA 4TYBA 3TTSA 1GSHA 4M6WB 3KVBA 4JX8A 1PK8A 5K14A 4IEUA 1JQBA 2Y71A 3ROQA 1OMOA 2VKRA 3OSPA 2ZACA 4OBXA 4QGLA 1DRKA 4LTDA 4A0HA 3PTRB 1ZW6A 1C0UB 4KQ6A 3DCYA 1SIUA 2HIQA 3RUPA 1ZOSA 3FFIB 1WG5A 1OLUB 3T1OA 4I9UA 4PIXA 2ZRAA 3QLJA 3UIEA 4CEYA 5TPZA 4BOYA 2XL9A 1W9YA 1C1BA 1D2GA 3T3EA 1ORHA 5K0JA 1FMLA 4LE4A 5GADU 1Y5MA 4JVOA 4JOBA 2WTMA 1N34J 1GA4A 4GMGA 1R8XA 1QJX1 5F3CA 4XRGA 1T7PA 2QYHA 4U8GA 1I7SB 4MS3B 4PPQA 4OU5A 4NRMA 5JD6A 2YYAA 3PVNA 1A8IA 1M2JA 3A23A 3GLJA 5IFLA 2AGSA 5ALKA 2NM0A 1OKQA 3UAVA 4F93B 2FOIA 3VO1A 2QLBB 1EP4B 1TD9A 4JUAA 4BLOA 2FD8A 2XUKA 3NNMA 5FV4A 4F56A 2W1SA 2LFVA 1MIOB 3DKPA 2GM4A 4FZVA 4EY7A 2FDXA 3N9UC 2MTLA 4QYZK 4JOQA 3B52X 2DNZA 3WIOA 1TB4A 3OU7A 1PR1A 1WCIA 2M70A 3IVMA 2G9QA 3OG9A 5F5AA 4AI6A 3LXUX 4KN6A 5CD1A 3DGFC 4FYVA 1QDOA 4Q5VA 3CCSS 1NVFA 3DO8A 3UK2A 3Q3IA 1JP7A 3HN3A 1ULCA 1HURA 3MVEA 1UAWA 2CQDA 1WW5A 2B9EA 1A2OA 1U2TA 2PLAA 2R68A 4CF7A 4ZVTB 3VBUC 1IKWB 4BNWA 3ACHA 5DDQC 1ZYUA 1PL8A 3J8F1 3IT3A 4CGZA 4OMDA 1YOVA 2M8HA 3GI1A 3B5LB 1MC1A 1Y3HA 4Q16A 3AV0B 2A5JA 1DRJA 2JJ2D 2K1RB 2FLOA 1LW2B 3JZIA 5JMCA 4DLKA 5FBLB 1QQBA 2UVDA 1NN5A 3RSFA 4JGGA 2ZT8A 1NDLA 3ADOA 4DMCA 3WL4A 4E94A 1QAXA 2YXBA 4EHBA 1KQPA 4E2FA 5KNCD 1UYXA 1RAEB 1TVCA 4AYBD 1YMVA 4J0IA 2AMCB 4B73A 3WNKA 3AEQB 2R1TA 4IS3A 1PHMA 4MK8A 3IP3A 1F3FA 1IOWA 2Y9PB 4GB31 4ZV7A 3CTRA 3N7MA 4CLUA 3PHCA 2RU3A 5B4NA 2RH4A 3A4IA 5I6DA 3OQJA 4LE3A 3IAS1 3PRKE 5AHRA 4BVEA 1YSCA 3TRGA 2C4VA 1M66A 4M1ZA 2OD2A 1BQMB 1BC5A 3ZCXA 3GG2A 1OT3A 4CKCB 1AR91 4D4JA 1T6YA 2TMGA 2XUZA 1SUPA 1Z34A 2BEWA 4COWA 4L16A 2GNMA 1WUVA 4ORFA 3ESXA 4NBUA 2C2YA 4Q4JB 1RUE2 1ECLA 3C4JA 1IGOA 5AVZA 1UDWA 2H3HA 2YXPX 2PUTA 4R9CA 4KXFB 3KDNA 3L1JA 2H1YA 1RMU3 1TK0A 1P0IA 5IT4A 3OCYA 1QMPA 4FBMA 3FPCA 4IJQA 3JAKA 3RV3A 1UPPA 2WSMA 9RUBA 3R7BB 2GBCA 4RD6A 1EFPB 4V2WA 4NXMJ 1CP3A 3GUUA 2D93A 3KDOA 1X7YB 4AMGA 4JI1B 3T5JA 1BE4A 3SCZA 1CJMA 3QKUA 4KWJA 3POGA 2KG0A 1FXSA 4Q2MA 3C6UA 1QEXA 3AVUA 1N92A 1IQ0A 4MUKA 3TVDA 3CVKA 2ISCA 2H4WA 5JPNB 5I91A 1PGPA 4QR2A 4XM1A 4TTPA 1QM9A 5B0EA 1IRXA 1Z78A 1DC6A 2PQ2A 3O9VA 4FGJA 2C2GA 4LKOA 4UOJA 3HJCA 4L75A 5DXDA 4UHKA 4WW0A 4DR7B 5C4WC 3ZNPA 3KF3A 2JL9A 1F4VA 4CU6A 4EN8B 3EPKA 1XMOB 3N74A 1S2KA 2YX4A 2PA7A 2UUCJ 4JFAA 5FTMA 4TTRA 3MCVA 2X53S 2Z8ZA 2AEJA 1BYHA 4LGCA 5E6UB 1UXOA 2IA5A 4DC0A 2QTAA 1Y9DA 3AB2B 3NCRA 2HT6A 1OWPA 1FXWF 3RE1A 4CMIB 4OZXA 1HQWA 4MIOA 3P6YC 2F3PA 2ECOA 1SCKA 1AKVA 2UUAJ 2YBDA 3B9CA 2ACKA 2PAAA 4S1OA 5IAXA 1IJFB 3T4VA 3OWXA 2ZWPA 3IC5A 2I1RA 3V4PB 2QFJA 2CPIA 1XRRA 2I2YA 3AONB 2WBMA 4DQIA 4MGZR 1DAPA 2OOSA 1X5OA 2BNNA 3LP6A 1ROFA 3JZVA 3RZGA 4UAGA 1XMOF 3WV6A 5CYOA 1JJVA 1JGTA 4ETWA 3U44A 2WYWA 1F4HA 4X66F 3UMGA 1SRRA 4KGDA 2W2VA 2V9KA 3HB7A 5D4OA 1HYHA 3DF7A 3IUPA 1MNEA 5KFRA 2FIUA 2WVFA 4P9YA 2MQQA 1Y5RA 4FGUA 3DYBA 1MCZA 3U3RA 1POXA 2BTQA 3LSYA 2AGVA 3CVWA 3ELYA 2CNNA 4CODB 2C8KA 4WXPA 4UBIA 5EJ1B 3LPMA 1ST2A 2X9NA 1SJ9A 3EZGA 3H20A 5AJTA 3UQYS 4BQ2A 3HI6A 4PY2A 3UDEA 4HYKA 3BEOA 3KUXA 3WGOA 3KLHB 3H4DA 2PUCA 1QANA 1MNAA 4QBIA 4F9GA 1HETA 4J1QA 3RSLA 4C89A 4LJMA 2G1UA 2GC1A 4AO8A 2CDCA 1JG1A 5C7IO 1FESA 2DOKA 2PPLA 1RDRA 1A9XA 3PHBE 3UPUA 3RG2A 1O6XA 3FD8A 1IHXA 4F4ZA 4D7YA 1UBJS 4IJMA 4R98A 2IH2A 1VBC2 2RGWA 2H11A 2YQ3A 2WNUC 2FJXA 4C43A 3J7HA 3JD4A 4K28A 2XJTA 1I51A 3UPTA 1Y9AA 4LKSA 1Z5WA 3IX7A 4V1Ak 3DLEA 3NWGA 4RW9A 4K7QA 1W04A 1KS2A 2AYYA 4KDEA 4UDOA 1EVEA 4Y2JA 2UU9B 4P4LA 5BQOA 2TECE 3KFXA 2BFAA 4LFBJ 3OSZA 1CONA 1QJU3 1VMFA 1EAMA 5HG0A 2AFVA 5FL7D 1N3BA 1PNFA 4I1SA 4QEDA 2XT9A 4N39A 3IE2A 3VNQA 4JI4J 3WK5A 5EE3A 4ZO4A 5FOWA 1GNPA 4MJXA 5ETKA 1FUEA 4L8LA 4JGZB 5D00A 4K86A 4CEIA 2KX7A 3EZLA 2D3O1 2X8JB 1C3LA 5J4LA 2IX3A 2BPOA 1Z88A 1PJ5A 1RT6A 2PHDA 4PEOA 4XTMA 1CJVB 1MABB 2JBAA 4HHUA 3A3KA 3GU0A 2RS13 2CFRA 2BJ8A 2VSXA 4ZZ0A 1L4YA 4ZP1A 2HU2A 4XYBA 2IYLD 2X0DA 1XZBA 1X1BA 1Z6AA 1Q8BA 5JH7F 1VKHA 3SHRA 3MWLA 4M0HA 4P7VA 3KIPA 1HBNA 1W5FA 1E20A 5IXSA 2QQFA 4HB0A 1KFEB 5GMEA 1ZSYA 5M34A 4NPLA 5IX8A 4FYKA 5B55A 3DM2B 4I36A 3D7SB 3QO9A 3K58A 4DJJA 5DU2A 3PD1A 3L4JA 2VASA 1W99A 1DHTA 3JD1A 3FC9A 3O3LA 1XLUA 3QJGA 3DU6A 5FZ9A 1K0FA 5HRAA 3SSSA 3UV9A 1M2FA 3OIGA 4B6GA 3M1LA 2CZ4A 4KO0A 1ZONA 1KK0A 4C90A 3G1UA 4ITVA 1II9A 5KOHB 5DAQA 4XHBA 3MM4A 4UNRA 3ILIA 3L7JA 2FMKA 3LPYA 3UVEA 1PQYA 1KMHB 3BMQB 5D3MA 3ZV4A 2PIAA 1NQAO 4PYNA 1L9KA 2FR1A 3ESCA 4PGAA 5C1PA 4QTTB 4NWVA 2RDMA 1NKVA 3UWPA 5ACA1 2ZXFA 1NBWB 1F8FA 3TF5A 5CA0F 2ZHAA 3AZPA 3KU1A 4Y2SA 4R83A 5CEEA 3MEKA 1IZ8A 5DGXA 1KZ1A 3AZWA 4HLCA 2CHEA 1TCBA 1LA2A 3V0BA 4IG0A 5FO0A 1ZRSA 3DI6B 3EG9A 1Y0BA 3AEKA 2A1TR 5B7NA 3A2KA 2X3FA 4KQMA 5FTKA 3LUPA 5IYZF 1H9WA 3VBFC 4RF4A 5K0LA 1G3RA 3MLJA 3CE9A 4HVRA 1A04A 4MRPA 2VCHA 3GRFA 2O1PA 3GX1A 3DCQA 3B9PA 3BU0A 3JAKB 1TCVA 4A8PA 4RD2A 3BMOB 4M5DB 3GTYX 1UBHS 5A0YA 3W9BA 4DLBA 5DDJ2 4X4TA 4ENOA 5HUJA 3D0SA 3SM9A 2OGZA 1LUAA 3B54A 4JI2B 1O95D 1Y5LB 3HBFA 4JEMA 4WCFB 1GGVA 4C3KA 2A0YA 2W7OA 1Y10A 1RWWA 1U4BA 2X86A 4P4TA 4BZXA 4IZHA 4P2BA 4C2BA 4NPOA 2D0IA 5COAA 2CDPA 3IS3A 2QGFA 4ZPTR 4DUYB 5KI6A 2HEWF 2WHRA 2VDLB 1ALYA 1E3TA 3E1F1 1FVFA 5FPQA 4XPZA 2QSWA 3EE3A 1XFDA 3H9UA 1VGVA 3P0IA 4IEWA 1R3DA 4QMAA 2ZCVA 3IAFA 4IW3A 1ZBE1 2D54A 1EETB 3DE5X 2GJ4A 4XWGA 3CMAS 1JNZB 1O89A 4AEDA 2AU0A 4TSKA 4QW8A 3EIXA 1TLFA 1NXIA 2OMLA 2RHOA 2PTHA 3PNIA 4IOBA 3QWBA 3BJYA 1QFJA 4ZRNA 4UY85 4LDNA 5A1JA 1DGWA 3BSCA 4FF3A 1Q1QA 2FI1A 1JHYA 3N75A 2HLDA 1O0SA 3I87A 1OX4B 1FLAA 4EDHA 2YVLA 2D3UA 4KXWA 4HQRA 2JDMA 2X4DA 3O4FA 3C1TA 4HPWA 3B13B 4ID9A 4B6PA 3QY9A 5E8AA 1P1RA 4LNUB 3LL4A 4LLFA 4P86A 4QU6A 1SUAA 2A6WA 4NRDA 2QPTA 5ALHA 4PBSA 3N0WA 1EJ6A 2M9KA 5B36A 4JJ8A 4GQBA 3DOUA 3KEMA 4XZPA 3GJZA 3PUSA 3ZWNA 2XZOA 4USMA 1FNMA 5AVVA 3R2DJ 1C29B 1QG4A 3WRXA 1FYEA 1X5PA 4B7ZA 5CKQA 4C4AA 4XR4A 3G13A 3VKLA 1CUWA 2PYTA 3ROGA 1Z16A 1Q17A 3GLHE 4XAEA 2FQQA 5IWAF 1H05A 3SXUB 3ZW8A 4J5OA 2QORA 1V2GA 1ANKA 4USJC 4UM8B 5EE0A 3WS7A 1UZ0A 1M5OC 4LOAA 1EQMA 5EP3A 2RHBA 2YU1A 4TZTA 5LA0A 5D8HB 1ZZEA 4CMGA 4AULA 2UYHA 5FKJA 1JEEA 4PLWA 4AF6A 3U3ZA 4R54A 1SB6A 2A70A 4B43A 4PSDA 3SBOA 1RUD2 2YUTA 1Y6FA 1D2CA 4CTEA 1RC6A 3KVYA 4TTJA 1MC5A 3DMGA 3MBIA 4CBVA 4LOJA 5ES3A 4I56A 2NUPA 2QE3A 4CUCA 4PCVA 1N33B 2DX7A 1V3UA 4CLFA 1XNHA 3RI9A 2XGXA 3CLTC 4RXMA 3OEBA 4H1VA 2OD4A 3R5XA 4MQFB 4Z1MA 4XIIA 4I4TB 1ZH2A 5HJ2A 4YWAA 3QHQA 4BKRA 1JUDA 5KAPA 2XEXA 4AI8A 1C9EA 2ODBA 1IZYA 5AW9A 2MYNA 4KW7A 4P9NA 5HSPA 1W3XA 4BNVA 1JOPA 3NBPB 3WUDA 1RJ8A 2HRZA 3EGEA 3DEIA 4ZIRA 3TA1A 4Q5IA 1JFFA 4JBXA 2VZ9A 3GZJA 2OFPA 2RAVA 2ZJPQ 5BUSA 4I9HA 1ULZA 4M4RA 3HY3A 5B2GB 3IAXA 5JU6A 3NHUA 2AD1A 3N2EA 2IOQA 1VI6A 1CESA 3R1HA 3KCYA 3KBOA 4D5EA 3RG6A 3G2MA 5LQUA 4DV2B 2WD8A 1RWOB 3C3PA 1LHNA 2PUJA 1C3OB 5EGNA 2OVUA 1Q8KA 1U6IA 1QE5A 4OHCA 6PFKA 4CLPA 2X1LA 3WOHA 4XUOA 1N5IA 3AF0A 2N47A 5D0HA 1JI0A 3J80A 4Q3DA 3A7DA 4HGPA 5L4LA 2BGKA 2H6EA 2ZJ2A 3IILA 1QU2A 2F3TA 2VQAA 1YOBA 5JJIA 4AGGA 4BA6A 5GJVC 4MX3A 4JCOA 2GD2A 2UZ1A 4FJ2A 5ETVA 3GLHB 3E22B 2FWPA 5FTLA 1S9FA 5CIWA 1NUAA 4ZT7A 3AF5A 1U31A 5T4FA 4D6QA 4ZQBA 3AILA 1RIIA 5ILOA 2XMPA 3EPHA 2HF8A 4BLPA 3WDSA 2VWQA 5FAXA 3ZJTA 3KTOA 5JAXA 4IHJA 1IOZA 2CLSA 1CC7A 4N5NA 1QP8A 1KQGA 4O4RA 2XULA 5CH7B 1IBKJ 1HLDA 1POV1 1MO2A 2BMEA 2FK8A 5H3LA 3MCOA 4GECA 5D2CA 2IIBA 5IVVA 5M2UA 3HO1A 1DKOA 2DGUA 3R5AA 2KXLA 1D1PA 4CVUA 1DZ5A 1PD0A 3N5CA 4CM8B 2BEKA 4L3OA 2Q5HA 1WWKA 3ZXIA 4N9WA 5AYVA 3FCWA 3N58A 1E9DA 8ATCB 2NW6A 2HWE3 4FEEA 1XE7A 1BS1A 1KTQA 3K9LA 4G07A 5D4PA 5EI5A 1SIBE 1W6OB 4HKTA 1Q74A 1W9HA 2IVZA 3D54A 3LDUA 4KXVA 3IM8A 3ZG6A 4AJJA 1DKRA 4HB4A 3EN0A 5G0UA 3VAFA 4KXNA 4RADA 3P71T 1W9FA 3MIDA 4EA6A 4W98A 1WW3A 2PSDA 5FOVA 2H18A 2X09A 1IUNA 2FZKA 4A1OA 3TOQA 3UMCA 4CUZA 1B09A 2QJVA 2DLDA 5TARA 3B7PA 5D15A 4QA9A 2A0UA 3EVGA 2YN4A 2EXKA 4BOWA 4GIQA 4AN1A 3KJNB 4Y6SA 2P2CA 2Q4BA 1RITA 2AIRB 1FLDA 4FJ1A 3SCHA 2PWYA 1YE5A 4DV7B 2O5VA 5F73A 2GCIA 5B0AA 3JS5A 2AW5A 4FSXA 4J49A 3N53A 1CAWB 3FVWA 1BCXA 2CFOA 5EJ4A 2E63A 1EIZA 4KZKA 4JI6J 4LBKA 1QVFR 2BUAA 3KZ4C 2Z56B 3KSBC 1KSFX 3IKWA 1TUGB 1KO5A 5FWAA 3ZTSA 3H17A 2I03A 1GHTA 4QYMA 4HI0E 2H1OA 1PM7A 3CD6S 2WL1A 4RZ2A 5ALEA 3LMKA 4LVOP 3Q8LA 2ZDPA 1SN7A 2G8NA 1N2EA 1W8HA 2CXHA 3BQ9A 3V00A 5JUVA 3PSHA 3CCWA 2WZCA 4Q9JA 2P2NA 3DKIA 4MGZE 4I8DA 3CDWA 3WR0A 4PO1A 1N32B 4MWGA 1HB3A 5CHYA 4L85A 1P6XA 2XJSA 2C0CA 5MN6A 4NPMA 3BJZA 4Q7JB 4NCGA 3TB0A 3I30X 3ZCUA 4F8EA 4MGTA 3GOHA 4C4ZA 3FCHA 1SWWA 2BONA 1ZRRA 4ONEA 3F9IA 4PAAA 1R6DA 5TY0A 2X3DA 1HHTP 1KZYC 4KGZA 1DYOA 3FMFA 3SMQA 5C7YA 3CLVA 3PVXA 3M8PB 2B9VA 4HQ0A 4ECYA 1U2PA 3HVIA 1SVMA 4A6SA 3L6EA 2VMGA 4OQFA 1QF6A 3PGXA 1JE0A 1S9HA 2C28A 2VW2A 1OGIA 4M3NA 4XDPA 3ZWQA 5C9AA 1GFZA 1VK3A 1X7GA 3PPWA 2HCRA 4JU8A 4ELVA 2Y1LA 1VE1A 4AAXA 2VMHA 3NGXA 4QYIB 3HSDA 1YJ9S 1KEWA 4D6XA 4R3WA 5CAZA 2JI4A 2Y1FA 1RB8G 1HKHA 2FJWA 5G2OA 3ELBA 2JVRA 2DRBA 3LYLA 4XJVA 4H31A 2OAUA 4TSFD 5L4SA 3IODA 4NLXA 5KDLA 4RA0A 3FAKA 2F63A 3R3HA 1U0SA 2VFRA 4PYRA 3GFPA 5JYCA 3E5QA 3HA2A 4N5IX 4JT9A 1S0UA 2HNAA 4RWEA 4HNHA 1Z28A 4OL9A 2RFLA 3N6VA 4LWOA 3TOVA 3NC0C 4EITA 1KU6A 3LRXA 3C8ZA 3BGOS 4QPTA 2ABWA 2EBEA 5AXNA 5K2OA 1NM2A 5HM8A 4LOTA 3ZE8A 5F5NA 4PG6A 3E97A 5KINB 1MFZA 3OC6A 4V24A 2J6IA 3DEFA 3LY8A 1E1YA 5BNNB 2XPCA 1IFXA 1IKYB 2Y76A 2B8NA 2MY7A 2A6VA 4CUGA 4LORA 4J9VA 2Y99A 3DTNA 2HWYA 3A7EA 2XMSA 3LQFA 4NVRA 5G3YA 3OKFA 2PEBA 1TQ2A 3K4QA 4OGLA 2YYYA 2R6ZA 2FDRA 4NK4A 2G0NA 1MFPA 3BAZA 2ZWIA 3X43A 4CIDA 4Z92B 4UQTA 2MGZB 2IPOA 4Q12A 2XBO1 2W8LA 4B6QA 5EZYB 2CU5A 4XPIB 3DWIA 3EMDA 5A2QY 2WI8A 4FCVA 3CONA 2J9FA 4YFZA 3T3PB 3V1NA 1EIWA 4K9MA 3QBDA 1P6QA 3EDQA 4R8UB 2FWRA 2RSLA 4ECEA 1MGPA 1V6AA 3IMQJ 1H8HA 1THMA 1AQNA 1GYQA 1V9OA 1ODLA 2NZCA 4RS4A 1W0KD 4M4PA 5DSTA 4IV3B 2ZYVX 3ZPYA 5AW2A 1JJIA 3EXHB 1GPNA 4GKJF 3AOGA 4BQ5A 3B5JA 3OPQA 3ACIA 5BSRA 2Y4NA 4DV1B 1RGVA 1QJ4A 4JEIA 4ER6A 3PG5A 4KR3A 2OCYC 2A3YA 1XAIA 3ADPA 2XMWA 1KH2A 5C46F 2W43A 1LV5A 5E4YA 3IWZA 1WU8A 2WZR3 4FC7A 1NVEA 3UEOA 2VWPA 5DHRA 1GPWB 2X4GA 2BJEA 2QTMA 2Y8YA 2CMDA 3L79A 4LCBA 2GD0A 4HKLA 1FDOA 2AN3A 4WBNB 4CH1A 4Q4V1 1GL3A 3DF0A 1CSEE 4H1HA 4DPMA 4AVSA 3ESZA 3I05A 4ZGGA 4F4UA 2ZM6J 3NBQA 2YZKA 4AYXA 3OZUA 2IGTA 5C3RA 3QKWA 3HXKA 3K92A 2F65A 5HBAA 4Q39A 3LI2A 3MCSA 1W19A 2N3OA 4YREA 4NHLA 1CULB 1SXPA 1NE2A 4B1FA 3TJ8A 2HLNA 1QSLA 1HF3A 4I1OA 4LOLA 4GC7A 3K0JA 3GFTA 5BVHB 1B4DA 3HVJA 4G5YA 3GSIA 1H74A 3F97A 1CLEA 2RGRA 4X4RA 1J56A 2PS1A 4IVPA 1WMDA 5KFXA 3OSNA 2AN1A 4WLUA 2R60A 1C1CB 3EFOB 4J8PA 1GQSA 1P1FA 3KJIA 4USVA 1W6OA 4ZGBA 1SC1B 3OCJA 5KYWB 5BUZA 1ENSA 3FPHA 5HWSA 4FT2A 3W2EA 2HI0A 3GJ8A 1NF3A 4ZT3A 2NP0A 3AG6A 3R7NB 4DR4F 4EBFA 1UKCA 4ZS3A 1I6JA 4YEAA 3W61A 3MUOA 5DLYA 1VB5A 3GFSA 2EF1A 3VX4A 1W52X 3LP8A 5IVEA 2PQQA 1I9RA 2KJVA 1UWAA 3HP6A 3UJBA 3BSFA 4WE1B 4GQ7A 4CP0A 4E2FB 2ZR0A 3RVPA 1T05B 4QB6A 5AM4A 4XDZA 3U1NA 4ZPAA 3K30A 1TT5A 2H3EB 4NMLA 2JC0A 4BO5A 2PJDA 1U28C 5JLJA 4ISBA 1HPZA 1OU4A 1AF7A 1P72A 3HJTA 4B44A 2XDQA 2FKNA 3JQAA 5KHLB 3CINA 3UJOA 4AVBA 1W6RA 4O0LA 3ILJA 2CSXA 1QO0A 4LUMA 1NR5A 3BCSA 3D6TB 4OA8A 4WZFA 1CPMA 3K0BA 5ICFA 1OYDA 4Q1BA 1EP3B 4L0DA 2EFQA 2WFMA 1K3UB 5HN0A 4Z0HO 2R79A 2YNGA 1PFWA 5HP1B 3T7AA 4ZMRA 2QA2A 3U9TA 4DV4F 5BPFA 3UNXA 4E9KA 5IM0A 1BOOA 1DIOB 1FRLA 4G25A 4RVFA 1K3TA 1SPBS 2EK1A 3ZK9A 3S8EA 3B8EA 4PQFA 1OOPC 4B47A 4JUIA 1D9XA 3GPLA 4HVCA 1NFRA 3WD5A 4L5JA 1RUF3 5CQGA 2Q1TA 3Q8KA 1DOHA 2H2GA 5FREA 1W88A 3IB3A 4PXSA 1X9TA 1CVRA 3H5XA 5J4HA 1UY4A 3TIVA 4QX1A 5G4KA 1N6KA 3OVMA 1N7JA 1H72C 1PO13 2GWHA 2YUEA 3NO8A 1J59A 1Z33A 4D82A 2ZC3A 2B1JA 4L7VA 1MWYA 4OAQA 4UFMA 4C06A 4CKZA 5EWLA 2DHRA 5EXEA 4YAUA 2IUUA 2GK4A 4FP2A 5JOWA 4QB2A 4F3MA 3LZZA 4UAPA 5KFFA 5LZ4A 1ND5A 4QFCA 1WDTA 5BRJA 2X7HA 4QJ5A 2V2VA 1I8TA 3NUZA 3TLMA 1DTSA 2CNWA 4KE5A 4IEXA 3H19A 3DEZA 1ICEA 4NXMB 2I4LA 1LGYA 4P73A 1V5GA 3TLEA 4BE7B 2IU3A 3RSZA 1E5SA 3UYKA 3GPCA 3NC1C 2P5BA 1HRI2 2FP4B 4XX0A 3OIFA 5D6GA 5BJRA 4AY4A 1NVTA 3WMEA 1NCRB 3H2HA 1NTOA 4K1XA 5CB6A 1YEWA 5EIBC 4KRFA 3O3MB 1SHTX 2YXEA 2D13A 4OO3A 2GAUA 3VAMA 1BU8A 2XM3A 4HG6B 3HBMA 1G5FA 4RHV3 4OVKA 4R5PA 3ACFA 1W87A 4PJYA 2YWXA 1V9LA 5DLQC 4ET7A 1Q8VA 2NWQA 2VUGA 1HZZA 1K63A 2VLIA 4Y3UA 5HJYA 5F8GA 4NPRA 4XUDA 4JBCA 4Q4W3 5A6YA 3QX9A 4M0UA 3GYGA 1IONA 3FOFC 1GG2A 1LLDA 5FWNA 1WLYA 2R48A 1ZHOA 4BBZA 2XG3A 1CUEA 3BB6A 5ULLA 4BFZA 2QYOA 4KK4A 4R0MA 4NCNA 4DX8H 3OPYA 1JECA 2V03A 1JSLA 3UOGA 4BQRA 2WO2A 2HHLA 2VXBA 1MKYA 4BN4A 5JPDA 1XALA 3T61A 1CG2A 1O4TA 5HQLA 4GP6A 2XY6A 1ZRIA 2DM6A 3L2HA 4RJKA 3PYEA 1MTZA 4K8RA 4O61A 1H1MA 3K2BA 1K73T 2B6AA 2KU7A 2KM8C 2LS6A 3ET6A 5LLTA 4ZIVA 1VECA 1OI3A 1TEHA 1YIDA 4FSHA 3IAM6 1RBQA 4L76A 5ALZA 4YUWA 4YNIA 4HVOA 2EICA 5L73A 3VDNB 3PT5A 2QA1A 3DBVO 3WJ2A 3IMNA 5FWYA 1GGKA 4PAQA 5FPYA 4TNOA 3PUHA 3WDMA 3T0IA 5E33A 2OP0A 1T5DX 3I0NA 3KYJB 3NS7B 4R25A 3EM1A 1GQYA 3INGA 1K5MC 2YZNA 5HLFA 4C1XA 4AKTA 3NRBA 3EASA 5JR2A 5F76A 1NZ8A 1POV3 2AB0A 1Y3DE 4OIFA 4IMJB 4D8VA 4EJ0A 2ZHBA 5AVWA 4BDSA 4Q37A 3QI2A 3KQNA 2AR9A 4XCQA 1DQAA 1F9EA 2HXSA 4CYUA 2XUOA 3NTLA 1WNEA 4HDMB 2P0EA 5ETQA 3PGVA 3ILRA 1DBPA 1JKJA 4L92A 4N03A 4PXAA 2ZKNA 1YO8A 4PN7A 3LX5A 2HLPA 3LT0A 1X36A 2CJKA 4JA2A 1NVGA 3OZVA 2Q8OA 5TMDA 2CYFA 1G9AA 1E2HA 4X1YB 4YASA 1GZSA 3DUWA 4Q4AA 4I2QB 2E18A 4DUTA 1OFUX 1NJ8A 1U0EA 2BMAA 1UIJA 2H5EA 1HRI3 3A9VA 1BMV2 2VHZA 3PFNA 1I4OA 1T26A 2CF6A 3QXCA 1BEV1 4QTZA 1DLCA 4EA7A 2BTOA 3H11A 4GMFA 4ZO8A 5BWCA 4H4KC 3GLTA 1XYPA 4JI1J 1GSIA 4O2AF 5EJIA 1OQ3A 2XQJA 3T34A 3F96A 5F8IA 3AVXA 1OQDA 3T30A 3LGMA 2ZJ0A 2R4FA 1QYWA 4UFJA 3NMAA 5T41A 2H5IB 5I7EA 3T2PA 4KNYA 5I9IA 3R0IA 4M8LA 3SDEA 2G7MC 4G3XA 3BGOP 3WIUA 4JVLA 3A3PA 4KSCA 1G0NA 1XP5A 2PEZA 1RPJA 4LBLA 3ISZA 3HY4A 1SHZA 1QQP1 1U3WA 3G49A 2W7PA 4N3CA 4XJXA 1KWGA 3WP3A 5DUXA 2IXDA 4DL6A 2XSZD 3A9UA 4Y0NA 2GN2A 4DV5B 1YFJA 2UUCB 5CB8A 4YRTA 1REEA 4X4PA 1JS1X 2O8QA 3HWSA 1K7SN 2WJGA 4D56A 2HQSA 5LQCA 2DU8A 4E12A 2B61A 2FPHX 1NKEA 2D2FA 1RQLA 1I5PA 5IYZB 2BBEA 2RGNA 2BDTA 2IZZA 4X91A 4YJHB 2YG0A 1V8ZA 1U9JA 4UW3A 4EV0A 4WV8A 2B5HA 4KI5M 4ZN6A 5KQLA 4CCMA 5K0NA 3S1AA 1GQPA 2K2WA 3WEZA 4EPVA 2YWHA 5JDBA 2Z2XA 1W2OA 1W39A 3VVLA 4I7FB 2PKQP 4OLJA 1QPGA 1ENPA 2K7FA 1GITA 3QW4B 1EZZB 2CVOA 3Q2SC 2P6RA 1R0AA 3DV0A 1YQXA 2ZRBA 3KZVA 3KZMA 4OYLA 3SHFA 1MA3A 2AX0A 3DECA 5BSTA 4LA4A 3FCUB 5L6MB 2R7QA 1LTEA 3GM8A 1H23A 1SCNE 5HIAA 5IQQA 4OI6A 2NPIA 4OQXA 2EJBA 4HT7A 3JU9A 1WWHA 2EJCA 4H2AA 1G9DA 1DUIA 1N5TA 5FLYA 4WM8B 3VPXA 2GPWA 1JG3A 1JWLA 3BGAA 3OLYA 3VU8A 2FW1A 2PR7A 4GA9A 1CJCA 4EKEA 4ZP8A 1T9UA 3ZXJA 3PJEA 4WXHA 1NWCA 2QB5A 3RHSA 4V0SA 2PMWB 2V5DA 2EXJA 5KC5A 5F77A 1IJBA 3LB9A 3JY6A 1N6HA 2QAGC 2GBPA 3QT8A 2PFDA 1VRH3 1YZ6A 1O3SA 5LSAA 3WADA 3ZWXA 5K8UA 3F95A 3EXAA 4D3HA 4ZJZA 1L3SA 4E88A 2XMQA 1YTLA 4KQ7A 4N65A 3OLXA 4RABA 5CDFE 1TM1E 2OV8A 2WVJA 2FX5A 4DYDA 1QGUB 2J7UA 2UU9F 2XHEA 4WGGA 1X3SA 1SOUA 3RYRA 2ZRFA 2WT4A 1RYYA 5IK5A 2WEKA 5KSWB 3DN9A 3LZ6A 4BXOA 5FNZA 3Q8AA 1RABA 3QACA 1U7PA 3PDNA 4MT1A 4ED3A 4I6YA 2OBBA 3NIWA 1KD1T 2HCBA 3KLNA 4XPEA 2P79A 3GGCA 3IL2A 3O8WA 4LK2A 4ERDA 3R3TA 1TVKA 5DHAA 3ISTA 1UQTA 3HP7A 3CJXA 4ZKTB 5RUBA 3LBYA 1LBQA 1LNSA 2G2OA 3NNGA 3P9KA 5C8YB 2OD7A 1VIOA 2SNIE 4IPTA 2E53A 3GCZA 5I7RA 3FFWA 4P9SA 4PHCA 2X5KO 1N47A 1RTDA 3C7FA 3O8QB 3I5XA 1C50A 4IHJF 3WLOA 2JG8B 2OIIA 1I3OA 3P2KA 4NV0A 4CRJA 3THWA 4X7RA 1XVIA 1I94J 4XSGA 2IYRA 3IBGA 3GEBA 2HYKA 2R9VA 4PX5A 1GTRA 1RW4A 2DZDA 1XXLA 2JAOA 1OB5A 4ZRMA 1BY9A 4D5GA 4RHV2 4TVSA 3I3QA 3EW7A 1V2HE 3MAAB 1YJCA 2XBLA 1WOPA 4ARIA 3SLIA 4I8IA 3VU1A 3RIHA 1T9YA 4PLTA 4X60A 2YHIA 3BGFA 3O4HA 1I2MA 1Q5PA 5JPIA 2LVBA 1U8TA 5EJAA 4R1TA 5TQ2B 2KYXA 5IJ9B 2MEV1 3PQCA 2PV0A 3TNDA 2X22A 3DH0A 3QFFA 1WD7A 1H9BA 4X4UA 2Y1RI 1Z15A 3HD2A 5CCBA 2R8KA 1AXQA 3BL8A 1GGEA 3ETLA 3O1SA 5FOBB 1WL8A 3EBRA 1N1MA 2W6NA 2ZDQA 1ZTWA 2R4UA 5SICE 3BGLA 3ZXWA 5GZFA 4KR6A 1LBIA 5K0BA 3OZGA 4F5EA 3NKTA 4DRXA 4ARCA 1UT5A 3LKVA 1OH6A 1KL7A 2V96A 3MFIA 2BABA 4EO4A 4D96A 1SCIA 4JODA 3DWGA 2X9VA 2CKDA 3R5FA 2JFHA 3O8NA 4O1IA 4QKFA 4B29A 5CGQB 4ILLA 2KI5A 2YYOA 4URFA 4I4LA 1DGWX 5CJ2A 3C2UA 4CLXA 4B2LA 3JWPA 2RK6A 3LPCA 3T95A 1X9HA 1QJY2 4EF5A 1GEGA 3M82A 4BQSA 3ZHQA 3EWAA 1TKZA 2P6CA 2BANB 3CNHA 1ULFA 5B7PA 3K6SA 4M8SA 2GZ1A 1CETA 2IA6A 1Q1EA 4XEHA 4OGGA 2L42A 1UCXA 1NMEB 1DGRA 3TW8A 4I50B 1RYNA 1OAOA 1U0RA 2WJ3A 3TJAA 5AKEA 4IO0A 1NB2A 1UMBA 3RRDA 3E1GA 1S5ZA 1SZJG 4X1YA 2BV3A 1BVP1 3K48A 1CWUA 4DINB 2IYTA 2AKAB 3HZGA 4OYHA 2DVBA 1JEJA 2RS11 3KUUA 1KFUL 2R6R1 2CE2X 2XYVA 3GD7A 1IM8A 1XAJA 1Q8LA 2XIJA 3FYUB 4C08A 1ZBE3 5C0OE 1OGYA 5FAKA 1UKBA 1P1BA 2C5HA 4Q7KA 3VTIA 5J9FA 4F83A 3SNMA 5G53C 1Q20A 2DP4E 4Z4IA 3G0GA 2P78A 3H05A 2ZULA 2VQFB 2A57A 5FBVB 4K6OA 2Z95A 2UP1A 3LEKA 3SDEB 4BKQA 4A03A 1XI2A 3X3HA 4G6VB 4QXMA 4RPHA 2WT1A 4U7FA 1ZD1A 2D3PA 5FR1A 3O7MA 5DHTA 2QE7D 7MHTA 1D4M3 3CUEF 2W1BA 1EWTA 2KPOA 3THXB 2HK2A 4R8RA 3AXTA 4GG1A 2LPMA 3AMVA 5GMOA 5BYKA 3AP1A 4H18A 3A1SA 5DXAA 5HMMA 2L9DA 4N8DA 2FJ0A 3PHIA 1XWFA 1LOAA 1U6BA 3ZSEA 4YS2A 2ZJFA 1Y98A 4KQIA 1Z5VA 3O83A 3AL3A 2KYRA 4FE4A 2VYCA 4CKEB 3P8BB 3BN3A 4YVSC 3J81Y 4H4KA 3I1JA 5F98A 5FOSA 2OT7A 4DPXA 1QTRA 2DFTA 1ZKMA 4YVWB 4X4NA 2K46A 2CXOA 3HFGA 1JIJA 2ZYWX 1AA9A 1SKUB 1DL5A 2XRYA 1W26A 5CBPA 3EDCA 4GWKA 2NUAB 3V2GA 3JQ8A 3Q8QB 5B3JC 2EVZA 3T0GA 1ZVKA 3R7WA 4FPYA 1CPNA 2O3TA 3BIWA 5KAKA 2RDQA 2QX6A 2Y26A 1P73A 4YPFA 2J3EA 2WFF2 1LQ9A 3W5SA 1KRWA 5CA0A 4YRMA 4QSMA 4F1WA 1SH0A 2H4WB 3V42A 3UESA 4QFDA 4X62J 3BF8A 2OQ2A 2BTQB 2AJDA 3MLAA 3HU5A 3T38A 1SBNE 2QRGA 1FV2A 3UK7A 2AJQA 4W4MA 3KHGA 4HLBA 1M0SA 1HG1A 1WTBA 4U2FA 1U8CB 1NCRC 4K6CA 2FPOA 3DKWA 4Q00A 5CLHA 2O2ZA 1CZNA 2XCTB 2IHVA 5CUQA 4DQLA 1POQA 3QVMA 2FW8A 4NXMF 5J40A 1IM2A 4IWNA 3ZWCA 1W8OA 3M3QA 3UT6A 4ZS6A 5DM2A 2OPWA 4Y1UA 1SJFA 2MY8A 1LJ8A 4QJBA 1FW6A 3NWKA 1V4BA 5SYMA 2F9DA 4CMIA 1NOKA 3QPBA 4KFBA 3AF6A 2HNKA 4J3FA 2X8BA 2PO4A 2CGNA 2M3DA 2AFIA 3BWEA 1IYZA 3BUSA 5CZXA 5KDOA 5I4BA 1OVGA 1FWPA 4W9RA 1RUH1 3UH1A 1RABB 5CLJA 3T4HB 1ZL0A 5DP2A 2ZRNA 1ZRFA 3DFKA 4MMXB 2GKSA 2JENA 2W2PA 5BWLA 1FUIA 1FSPA 1J97A 4D3DA 4GEKA 4GL2A 4Q4X3 2HPZA 5JDCA 1HE2A 3Q8SB 2IW3A 4N90A 2JCBA 4LF9B 1VQOS 2IM1A 1Y9EA 4O5OA 4ZMBA 4W1QA 4DV2J 1QVRA 4CU5A 3MECB 1FNOA 4X64J 3D31A 4J9RA 4UFIA 2DGSA 1I2CA 1SPXA 1XZPA 5BW5A 1E0SA 3QYFA 3WLRA 4JSRA 2ODEA 3GJXC 1JR3A 3RAEC 4UJ5A 2P2ZA 2XHKA 3CNOA 4PIPA 4S1NA 1BXNA 1R9GA 5B2EA 2FZEA 3T9BA 3NU1A 2WJPA 3CUKA 5EX0A 3SSQA 2VG6B 4YCBA 2ACMA 1OF3A 4QWEA 5FV3A 1TL7C 2Z6UA 4S2HA 3VHQA 2QY6A 4UOQA 5HGJA 1KY4A 3W65A 4JT8A 4CM8A 3H8VA 2YDEA 1XLVA 5HQJA 1EFVB 4JCCA 4PFJA 4MQBA 1JW9B 1CUDA 2O5CA 1H8HD 1HMVB 3ACBA 3K5WA 3K8WA 1ZQ1A 4L5BA 4H60A 3GAMA 2BFUL 4META 2X5JO 1JEDA 2VF5X 4BJ1A 4QGGA 5KX5B 3HCRA 3I34X 3OJCA 1ZHHA 3EXUA 2FA9A 4L15A 1OILA 3VYRB 4WHMA 1YWXA 5L3QB 5IKMA 3N5FA 1H6CA 4XTPA 4U7WA 1O2DA 3U2QA 3JXSA 2XMKA 2QR5A 4DR2F 2VQTA 1K47A 3CT9A 5CNIA 2CSGA 2YW9A 3J26N 5T6BA 3PX7A 2AXPA 4Q4Y2 4HDNA 1T2CA 3ELWA 3PG9A 3VPCA 2G1DA 4EFKA 2BMFA 5T3UA 2Q99A 1SIOA 1H93A 2GPAA 4NPCA 1LBHA 1UAIA 1R0YA 2C78A 1MJ5A 2ERFA 2ZQZA 1WVIA 3V0BB 1XVTA 4ESVA 2YMPA 1KEVA 1HDXA 1JHJA 1RSZA 1LGBA 2XZWA 3KLEA 1BMFD 2YC4C 2DNOA 3PJFA 1PW7A 2PUBA 1Z26A 3HFJA 1FXDA 1IXRC 4NLVA 1GCAA 3TNFA 4RD3A 2CNLB 3BGSA 1WLTA 3CCCA 1V35A 3UJHA 1HIXA 4NI2A 2CQ0A 1HWYA 2XNHA 3U09A 5AUQA 2A5ZA 5LXTB 1U1KA 1IAVA 4CNBA 3H3LA 3NGUA 2EFOA 4NLGA 3PYMA 3QOFA 4W9NA 1JEYA 1A7GE 2PJRA 2NO7A 3FTDA 4LHLA 3PIOQ 1VKZA 2RKOA 2XH8A 1SBZA 1N78A 3IIAA 3OLBA 2JFWA 2XODA 4Q9LA 4N01A 4MV6A 2PKCA 4DNPA 3QX3A 1D0HA 2F6RA 3MPPG 1R8YA 2ZRKA 4BJ0A 2K7KA 2IY7A 2HHWA 1GNKA 3JQDA 1EESA 4LDPA 4YW4A 5BP7A 2LP4A 1SUDA 1Q0SA 2A5GA 4R2WA 1W76A 2JC3A 4DV1F 3SSNA 2G1AA 2N1MA 3R5CA 3IRVA 2AD5A 1FTQA 2EX0A 3FFQA 1QPBA 2A3XA 2RGDA 1JN2P 3BDEA 1W2IA 2PZEA 4XB6B 2P2LA 2YQZA 1VHWA 5T52A 4OGFA 1V43A 4M9QA 3OFGA 1YASA 3IS9A 1U9CA 2ZWMA 5AI4A 4ARUA 2RC6A 3RU3A 2WTNA 4KQZA 3C8DA 5CB7A 1TL1B 2ADDA 2LCQA 2V65A 4JNCA 2VKQA 3HUEA 2QE7A 1FVXA 3TNJA 2PAEA 1RJ9B 1JLCA 3LXRA 2RR13 3D6HA 3VU9B 4RX1A 3IRXA 2CQ1A 3UDVA 1L3CA 3GOQA 3PGJA 2Q4RA 3I2JA 1G9XA 5FCDA 4BWGA 1ZN9A 1GXTA 5K3EA 3OZBA 4WADA 2HF9A 1DP4A 3NAIA 3NT4A 4RFVA 2ZNZA 3ZIDA 4O9GA 3L7YA 2FDKA 2NZWA 2D5AA 4N8EA 1HDEA 3STWA 4DSTA 4C8NA 3P5BA 3RUCA 2ICAA 4WNIA 2GN4A 3THVA 3H2LA 4NOMA 2JZOA 3POSA 2MQMA 1YS9A 1PGW1 3GELA 5CU7A 1NPKA 1DCTA 1SHKA 3CF2A 1OIXA 1Z18A 2DBQA 1S1TB 1RI7A 4HFSA 2IXGA 3Q9NA 2V6AA 4YR3A 1CN1A 3PLNA 5EERA 1L4FA 1ZK1A 4U8YA 3OOHA 5HQ8A 1Y3TA 1EUCB 2JK0A 1W8WA 4BV2A 4TT3A 1WC6A 1A6LA 4S04A 2QR2A 1DEXA 4HNUA 5FI3A 1E99A 2FCRA 4YUZA 4EUSA 3QE0A 2VR4A 2CL6X 2CFCA 4HJXA 1XA0A 4MW0A 1GU1A 3WB0A 3WHLA 3KX2A 2YZGA 1RBLA 2GC8A 2F8LA 5COBA 5BXIA 3SXJA 4DA9A 4LX0A 3OPZA 3ZWMA 3N05A 2ZRDA 4CM4B 4JH0A 4DLSA 3EIWA 2GC2A 1R8JA 1KC8T 5BNWA 1UOGA 3F5SA 3E2IA 2NM1A 1QY4A 5AW0A 5BW6B 2XI4A 1WCWA 1KARA 3D4KA 1RLJA 2II6A 3QYAA 4YFYA 5FWJA 2IHR1 2Q5LA 2QJTA 4XJZA 2I8EA 3FPJA 4MG2A 5KHJA 1J1TA 5H02A 4Y0FA 2QSYA 4OIMA 1A4IA 2RHGB 2PZKA 4CUBA 4EFLA 3QVWA 3OUTA 5JASA 3WLAA 2IYXA 3ZHRA 1LSOA 4F96A 5A8WA 5M7EA 1JQLB 4IGOA 1ISFA 3BILA 4HPKA 1OQ1A 3OTOJ 3QMQA 4MI6A 2P68A 3DZGA 4B4RA 3DI6A 2W11A 2BW8A 2A9RA 1NOIA 2KM1A 3E8SA 3FOZA 1NDKA 4DXRA 4RTOA 5B6PA 4X7MA 1ISRA 3I1IA 1X8DA 3Q12A 4V1CB 3CRVA 3ZXAC 1CEXA 4YMUA 3PDJA 1JNXX 1O97C 2AK3A 4KTVE 3TEMA 4YROA 3D0HE 2W25A 2DGXA 4CETA 5FOXA 2C42A 4WFZA 2HZ7A 3M6FA 1RT5B 4IOLA 4P74A 2IYAA 4F8JA 1PWYE 2XBPA 4Z51A 3N2IA 4S35A 2WNSA 5CD4H 4LE1A 4K20A 2AX1A 4AY3A 4BEJA 5JHHB 4AX4A 2ZIGA 3PF9A 3KD3A 2QEQA 5BV1A 3CF4A 4JP2A 2YFHA 3E8XA 4JLBA 5AM2A 3CEHA 2PKXA 1XK7A 1S3FA 2MOKA 4D8UA 4WVWA 2ZETA 3P3DA 4XAAA 1SUSA 2R8YA 1IN1A 3E0XA 1P0FA 3OBAA 4GKKJ 1KDVA 3OJFA 2X1VA 2HS0A 2HWE2 3CULA 1SXQA 2D2IA 3ZLIA 4C07A 5LW9A 1KI7A 2O48X 3FX2A 4RKYA 1O8PA 2RDJA 4HGQA 4AY5A 3AB7A 5FYTA 2JHGA 1N5JA 3TNYA 2FLPA 2J5RA 1HV0A 1FAYA 5WRFA 2Q3BA 4X45A 2W6QA 4HDRB 4KH1A 4BTLA 2H2HA 4QFMA 3JD3A 4J9LA 3OLZA 1RI2A 4YQYA 3JTMA 4B7UA 1O94A 3AXSA 4D3ZA 3ZYHA 2I7XA 4PBOA 3OPNA 3BZBA 1A9RA 2ZH4A 4KIFA 1RWPB 4OYUA 2W58A 5JZ9A 2ZGVA 1FTNA 3ZEAA 3WQ0A 4NLLA 3VM6A 1EFUA 4DR4J 2HLDD 3MOIA 4TKTA 4OAOA 4C7OB 1W36C 3SI8A 1F6TA 5IJZA 2DERA 5CYQB 3TAUA 4QQHA 3D8HA 4ES3A 1GPBA 5HCHA 2ZUVA 4K0KB 5LASA 2I9KA 2BKEA 4KE9A 2BFBB 3DTVB 4KG8A 4GKJJ 4EF4A 1DQ8A 3WQQA 4UULA 4CR6A 2R061 1WP4A 4MA4A 1P4GA 1WC4A 4GH5A 1CT9A 1RTIB 1LRKA 1TT5B 3B6KA 1SHJA 3I01M 3IEUA 1VIXA 1U7LA 4G8BA 4LLOA 1OXTA 3GRVA 2JGNA 4Z4EA 3HGQA 4MUFA 5ARCA 3ZXDA 2OYRA 1U7OA 3C3YA 4WOKA 1C7JA 2FP3A 1YS2X 5BY2A 5K0EA 1O5IA 2FN9A 4Q9NA 2RARA 1R66A 4GF5A 4QGFA 2HHQA 5DBOA 4PG7A 1X70A 4RAQA 2UY9A 2JL1A 2DCKA 1KLMA 4W7IA 5FWYB 3P94A 2AVDA 3IN5A 1JMVA 2X2OA 4TWZA 1KFDA 2W9BA 1N0UA 3NEYA 4HI2A 4UHFA 2I3GA 1YQTA 1VLHA 4OL8A 2J45A 1X9WA 3WHTA 4MA5A 1YRXA 2IEAA 4JASB 4WOJA 3V2IA 4UOHA 3V1LA 2A7XA 4AVVA 3LZCA 3RK4A 1HQUB 4TMWA 1AR73 2XITA 1MEC1 4QQKA 1KGDA 1VC5A 4XB2A 3G23A 1Z25A 3LPLA 1ZOTA 3GCDA 1Z47A 4AQ7A 4LYEA 1QXSA 2A59A 3Q1LA 2FUEA 4C0BA 1QDUB 3UANA 3ASUA 5GM0A 1LQUA 3DMDA 2BGRA 2ZH8A 2Q79A 1J5PA 4P2GA 4ES1A 2RGNC 1JYCA 3B48A 3LVQE 3R77A 3KNAA 5FZKA 1CX4A 5FY4A 3SOZA 2ZT5A 4LF6J 3TZWA 1Q7YT 1I7QB 2VH5R 2IYSA 5D1NA 2OHJA 1KR4A 1C3VA 3F6EX 4M7RA 4JI3J 4YHHJ 3PHTA 3OR1A 3CLUD 1JR3E 2PO7A 1VFJA 3K9HA 2Q1MA 1YXWA 3BFKA 4MS4A 1X1TA 1QP7A 1FSGA 3EJ6A 4W5RA 2GPJA 3QTTA 2V97A 5CX1B 5DK4A 4LV6A 4YHHF 2AMJA 5BNPB 4ZMMA 3F47A 1L6IA 1JLCB 2QG9A 4YR7A 4D4IA 3JQ6A 2YV1A 4W9NC 1OFGA 2ADMA 3FSYA 2P5YA 2SLIA 4E1VA 5HEKA 4Q4LA 1PG5B 3C7CB 5GZ1A 2DUJA 5SV2A 5AESA 1Q1KA 3T2OA 1EHCA 4IV5A 1IBMF 2ABYA 2XCOA 1THTA 5DYYA 2CJ9A 2O5RA 2IM0A 3K8YA 4NS4A 1S6QA 3SZGA 1HDYA 1OXVA 1F6BA 3VL8A 2IPAB 2VHCA 3CUUA 5EZSA 3SQOA 3JPYA 3ZNUA 3JYTB 5DQIA 3DOMB 1ZMTA 1AR81 3RJMB 1ISPA 1C9YA 4G0QA 1SEVA 4B4DA 5H7XA 2WKWA 1XQIA 4B3XA 2GHVC 5CG2A 5DDIP 3OICA 5KXCA 1GM5A 1JG2A 4WZQA 1B6GA 4J3JA 2A2CA 2B92A 4HDMA 3D6EA 4N8MA 4Y1ZA 3E82A 3IVRA 3HMYA 4HEA6 4QUAA 1IHOA 1Y3JA 3B2QA 3S70A 1J90A 2JLSA 1I4DD 1VQLS 4RQPB 3BHNA 1GN8A 2LA6A 4UY8T 2QI9F 5I8WA 1VQYA 1QXPA 4PZYA 3UWTA 3QRPA 4F11A 4AHXA 3I8XA 1JA9A 4H4OA 2V5YA 1L8QA 2HQRA 1FP6A 2RAPA 1D0EA 3C7TA 2EC5A 1VE3A 4RTMA 4I2NA 4EYQA 3N36A 5ESXA 1FFHA 4C29A 1VE7A 3FLMA 4IIBA 2FZKB 5BNNA 5IUQA 4ZVPB 2BYCA 2WJJA 1IBKB 5THQA 1G5IA 3A3NB 3MXHP 2V8GA 1UP4A 1NLYA 3SMHA 2XVMA 2XJRA 4HETA 3UCGA 3WJ1A 4UUXA 5CYGA 4Z3OA 1PVC1 3K0FA 2BDPA 4BH9A 1KR5A 2FPUA 3WTBA 4QPJC 4BFUA 4NHKA 3EDQB 2O3RA 4XACA 3WG4A 2HHPA 3KQQA 4WBXC 2ZJBA 5K8CA 4P71A 4CCSA 2FZ4A 1X4EA 3QENA 1JKHB 3K35A 5H8WA 1YBHA 2B0CA 4EDFA 2XHWA 1E6CA 4P10A 4W50A 2WNVC 4YTEA 1RWNA 3EAGA 3HJAA 1SUWA 2VOTA 2NUHA 2AYXA 4Y20A 4LBQB 4O8ZA 3JQCA 2JIDA 2WRMA 5IYZA 2J08A 3VR4H 3T0DA 1TKCA 2WUGA 1HQ2A 3F6SA 2APOA 1AR72 4YR0A 3FMGA 3I6BA 1CGPA 1RXSA 2W00A 4DQKA 3W6ZA 1YQUA 3IA7A 4EO7A 3VR4A 2VU9A 2XGQA 1NVXQ 5A6SA 1LWEB 4RHEA 3G6ES 4URYR 3JARB 1PJ7A 4NHYA 2IAJB 2OXCA 3EZ6A 1YDGA 5B7QA 1DTEA 1IZ0A 1GSAA 2G4VA 3K96A 3B02A 3PMSA 4IH7A 4FWIB 4TS9A 3AETA 1MRSA 3GFOA 3LGAA 1HDGO 4WV3A 1IKXB 3H5SA 3LSEA 4LXQA 3C5EA 4N5MA 2W2NP 2GNDA 4B6SA 5IVFA 4Y3CA 3R7LA 4FPFA 2KB0A 1Q7LB 4LO6B 4F4DA 2QZZA 4OJQA 1T5SA 1IVNA 4YDXA 1FXLA 4GKKB 4YY3B 4NWWA 2OAQ1 3TUPA 2WLQA 3E05A 3LQRA 2FMUA 3WNVA 4XQCA 4MGIR 4YDRA 5E4JA 2D7DA 1H73A 4YUDA 3PA8A 4C3OB 1ORIA 4JJ7A 3PKZA 4RWZA 2VDIA 4GGOA 4W8JA 2V4JA 4M98A 2VD3A 2ZGTA 1D2QA 1LQTA 5KG7A 3AB4B 1OAOC 4B02A 2PFKA 4CLZA 1WPRA 2VT6A 4QAJA 1U0AA 5FK8A 3AWIA 4QBTA 2I55A 4UTXA 5TV2A 4CLOA 4R8UA 1OLRA 1EQUA 2FFHA 5LDGA 1U1FA 4MXVA 4P54A 1K08A 2J6BA 3QVUA 1C9MA 2Y64A 3GFQA 1UAYA 3GUYA 4OH7A 3W58A 3AXDA 4BVJA 3RSGA 3MD0A 1WZUA 3HA7A 2FVRA 4CZ2A 3FGOA 1I30A 5FPAA 1HPZB 2PTGA 3UDCA 3W5AA 5FMOS 2RKIB 3MTKA 1QFXA 1UZWA 1PO21 3H25A 1M83A 1XWLA 4KYZA 3IO3A 3IDEA 1PR9A 3T9EA 1NSTA 4URAA 4LO8A 1ADBA 4C6SA 1MB9A 1S2EA 5JH7B 3BYWA 3QE9Y 3PWTA 2HLEA 2Y6HA 2L41A 2C88A 3L5OA 4R81A 4B3GA 2W9CA 3CX3A 3ZHVA 1PR3A 2VD7A 4RIHA 2HJIA 2E1PA 1OUXA 2EDCA 1N34B 1QS0A 3T7SA 3K9BA 1Z2AA 3GIWA 3VBRC 1RQGA 2QM3A 2ZI4A 3DL7A 3TLCA 1ZIYA 4RSHA 4ATFA 1V0AA 3EGCA 2YX7A 3KJFA 2HFJA 4Z9YA 1R43A 1C3EA 4P5EA 2IYWA 4KXUA 3C45A 5HP1A 3THDA 4E8DA 3W6NA 4YRPA 2YBSA 2XKPA 1OV4A 2Q2WA 1TCCA 3DAPA 3DYVA 1S1CA 2NN8A 5GLZA 1M1NA 4GM4A 5AXMA 4OFBA 2LQ5A 3WF0A 2Q8PA 2VNVA 3EMTA 3A1CA 1Z7YA 3H98A 2OFFA 1APSA 3UN2A 3V4RA 2EFDB 2E1AA 1FFXA 2HCJB 3DP7A 3K8QA 1H4HA 1SZBA 3HCPA 4R3UC 4FS1A 5LKAA 2OG2A 2EKNA 2V1XA 4EZ6A 3TR5A 2C7VA 1YQHA 5FWXA 5KYWA 4B3RJ 1GZ4A 2H4YA 2VG5B 3RS5A 1AS0A 1LV8A 1L9XA 1R0SA 4D74A 1N3OA 1TM7E 2J76E 3W9UA 2O66A 1M2VB 4O4HB 2FN8A 5FWEA 3HY6A 3BKXA 4QO7A 1AYN2 4W8HA 3O1TA 1SOMA 1XRPA 2RHRA 4XC9A 3F7OA 1F2TB 2QQGA 2OAEA 2V9CA 5IAKA 1T6NA 5CYMB 5JAPA 5J47A 3GT4A 5HOEA 5CAAA 4MROA 1CJTB 1UFKA 3RKSA 2UXCJ 2HTFA 1USIA 3HR9A 3ETNA 2W01A 4RZSA 1PUXA 1W6QB 4RKEA 4KU7A 3MR3A 2PHLA 3Q2OA 4IFIA 3NMBA 3EDRB 4IHQA 3T1YB 1DBVO 5H9WA 2B35A 2ILYA 4X1OA 5CVTA 3VR4D 1UF2C 1NXXA 2QN8A 1OSDA 1V9U2 2I2AA 4ZRDA 3ZWVA 1E4OA 2VCCA 1G291 4U02A 4QQPA 2LZ0A 5JC1A 4H4EA 4C05A 2W6ID 4Q93A 5F4ZA 1GQEA 3WXMA 2DPJA 5IDXA 1ZJZA 4Q7AA 1E5LA 2ZJCA 2PJZA 1QG6A 3OTFA 5LBBA 3SKJE 1W1WA 5DN9A 2GN3A 3P2JA 3O8CA 1QE1B 1QFYA 4NNOA 2QJWA 5LBIA 3DPRC 3CWQA 4ZPDA 1V6MA 3W2FA 4EUKA 1B3BA 2B46X 4YGEA 4M8IA 2A2DA 2G76A 4BN5A 1UJ5A 4O3QA 5JWPA 3O5TB 1DZQA 4YB1P 1K86A 5DB4A 4ZVLA 3P3PA 4JJIA 4AZSA 4ACAA 1HLGA 2BFDA 2DPIA 3ZS8A 3V4ZA 1ONBA 1HWKA 1DO0A 1Y1LA 2GZHA 2IXAA 2ORXA 2OPRB 4R51A 3ZLJA 2VGDA 3H8SA 3KYCA 4AYTA 1DS6A 5F2WA 1N57A 1A7UA 5D5HA 5IOLA 2HNZB 1K9MT 2J7PA 3FIUA 4UUNA 1U80A 2C57A 3HJNA 2C5FA 2VDNB 4YONB 4DI6A 5CFZA 1VIWB 3E35A 3KVNA 2DU0A 3UPFA 5CLFA 1KOOA 1L5FA 3E7FA 3MRSA 5JE8A 3HX9A 1DEAA 2QRZA 1UFVA 3DBHB 4PRYA 1RAGA 2C7OA 1AFJA 1DO2A 4QPCA 2NZJA 5H9VA 4KWLA 3DLKB 1C80A 1CHNA 3LKZA 2IBMA 3BXXA 3B3FA 3UV7A 3V9AA 3ZFGB 3MJTA 3I39X 3R7SB 2HSEA 4B3CA 5ISMA 1GP5A 4XUEA 4D41A 2CLEB 2O1EA 2IYFA 3FE2A 2HSGA 4ED7A 1IBLJ 4ASKA 1GUIA 1YNAA 4GRIA 1SLCA 2ZT7A 2NXNA 2EL7A 2P65A 2QTVB 3WYAA 2VSQA 2QMUB 1QKIA 1KHVA 3CJ2A 5C7GA 1RYMA 1Z2PX 2CCJA 3HCAA 5AI8A 2BM0A 2XCPA 1VQ4S 1O6UA 2E4VA 3I92A 5FO8B 4HAXA 4EY4A 3V4OA 1JMYA 4QYTA 1OXSC 3TRHA 1UWWA 1VHFA 3N6LA 1CUAA 1ZD9A 4KKXB 3L8YA 5B1IA 2KJQA 2VWGA 5DXJA 3AJ8A 1TU3A 4ZDWA 2HWF3 3L7NA 5CA0B 4OUDB 4OLHA 3VGVA 1FYFA 2DR0A 4DNFA 1QORA 4BNUA 4IDGA 2CPYA 1QHXA 1E0JA 2YY3A 3O2NA 2Z6VA 5JIUA 2V6IA 4MH0R 4OLPA 2RG7A 1JHPA 1O5UA 5L7YA 1P60A 2FVYA 3WGLA 1YNOA 2PFGA 1DWPA 4AOCA 5M2PA 1X82A 2HAIA 1W9TA 5AKLA 2FMYA 1A82A 4N18A 3NH9A 1JOBA 3VU3A 5L39A 1U3CA 2DISA 1TFRA 3W2WB 1EPUA 1K6JA 3EGDB 1AUOA 3ZFFA 2QMWA 3R6LB 4GX2A 3C2PA 3F2IA 1Z63A 1SURA 3K89A 3KB6A 1BXRA 2VJBA 3K5IA 3KQTA 1S6PA 1ENYA 3T0BA 1K44A 4FXGB 4MV7A 1JKXA 4LZOA 2GTHA 4UW5A 4YJGA 1UMCB 3M8RA 3K59A 1JHRA 1SBHA 2RJZA 4QDSA 2BNOA 1I5RA 1HV8A 2HKIA 4DN9A 4DANA 1JZ2A 2Z83A 1U5YA 5FO7B 3GCWA 3QBEA 1AN0A 2NADA 1KZ4A 1D1TA 3C3AA 1YACA 2AGQA 4JQSA 3FBMA 1LZKA 1YRUA 2CXRA 2R6DA 2J30A 4XMIA 2W6PA 3E7DA 1GKUB 2VRWA 2PYIA 2WT2A 2QTBA 4OB7A 5LT5A 4E3ZA 3TAPA 4H1TA 1RA6A 4G84A 4HBNA 5C9AC 1HYBA 3D1OA 1N5YB 2HC9A 4EHJA 1OFNA 3SJZA 4PGMA 2WS93 3GLFB 4US1R 4MW1A 1G55A 3VDDA 4Q1RA 4HWGA 2CMKA 4F2PA 1BEEA 2O5EA 1UZHA 5ILQA 3VR5A 4PTZA 3IC1A 1ZDMA 1E89A 6REQA 5FP0A 3HHLB 2HZAA 1W6MA 3ZWDA 5CHCB 4BQYA 4WM8A 3RR7A 3CZ5A 2F8TA 1C1XB 2ZC4A 4XB1A 5DCYA 2ZH7A 2WHEA 2NUTA 2I4TA 3ZYFA 2VPXB 4UOZA 1PJ6A 1KBOA 3WYBA 1WQ1R 4UC0A 4AJEA 5FFMA 4TMZA 3ZDDA 1ZNYA 1VBC3 3A1NA 4WZBA 1XRLA 2OHVA 1WG8A 2HA3A 4P1ZA 1TNDA 2KI2A 1NVMB 3ATGA 3QG1A 4ASUD 4X66J 3FUWA 2DF7A 2J85A 1H1TA 4WACA 5D0EA 5DGHA 4LJ4A 2WIDA 3GPAA 2OI2A 5T7LA 3QVKA 1AYM3 1JIUA 5ALPA 2H51A 4R5HA 4PDWA 2HYIC 1KH1A 2BI8A 5E9WA 3O3OB 4EW6A 3LF0A 4TRMA 4AW7A 1VZ2A 3KLIB 3BMCA 2EI5A 1OBNA 3US5A 1UFQA 1VL6A 2JJ1A 4GM0A 2ZJOA 4HB2A 3INNA 4BP9A 4ZI7A 5HSGA 3PNPA 5FFNA 4ZAYA 2PLWA 3SSOA 1EWVA 5EMJA 4UCQA 1FWLA 3PPYA 1N2ZA 1TE2A 3D6HB 4OP3A 3A1FA 3DAHA 4YJFA 3M9WA 3O93A 2I4RA 3R5DA 4KVFA 1MIOA 4ANCA 1NH8A 2IZOA 4NOKA 3QOWA 1ZM7A 5FY5A 3LALA 2Z30A 3DDKA 4DOZA 5HVHA 4LV5B 1C2PA 3TLGA 2BTVC 2Z1DA 5SY9A 2C9DA 1AZSB 3NDIA 5LXTA 2JASA 1PNVA 2E5GA 2HCFA 1KERA 3B00A 4H2DA 1TF5A 4LHSA 1KBQA 5I9LA 3GYBA 1S3SA 1XDDA 1RI4A 3K1AA 1PR4A 2P67A 5FI0B 4OI1A 2JLBA 2B8TA 2EDAA 4BNYA 3F4KA 1OWXA 1AR61 1XC7A 2XYRA 3QPWA 2R84A 1L1RA 3PXAA 5EEHA 3W8GA 4EELA 1GMVA 3EZXA 1FVHA 4JLJA 4ZKEA 3F3MA 1I1QB 1MJGM 3MERA 4OSPA 3JAMU 5CCLA 4OJ1A 5I47A 4FYIA 1HDKA 5BR8J 3GPDG 5A3WA 2OC4A 2PLFA 3SHVA 4HDNB 4AFMA 4UZSA 2YL2A 3HSZA 2FHMA 2VAWA 2P6HA 4M0MA 3MM7B 5KFBA 2GC0A 2WJ4A 1T6GC 2QN1A 1R091 4JJ4A 4OYWA 3KT4A 4UFHA 4RK1A 2DBIA 3ZXFA 3B20A 2P9BA 4BQXA 3T7KA 3U4GA 2IIHA 5JT1A 5FPBA 3L46A 3FRYA 4D8XA 3BCRA 4AEKA 5FYDA 3TINA 5L19A 5JNLA 4CJXA 1YQ5A 1DBNA 1EINA 3UL2A 4HDAA 1XNTA 1IM5A 4PG4A 3ZNOA 4RNFA 3OU2A 2Z57A 1U04A 3RYCA 2BI7A 1M1YB 4ZXKA 4H3WA 2MHCA 5ALUA 2OEJA 1UM9A 2EERA 2XNKA 3TE7A 2HSEB 1NDUA 1GLNA 1TF2A 4KB5A 1GOTA 4J7AA 1UBSB 2CPFA 2AEYA 1QAOA 2C97A 1JPUA 2HWKA 4HQFA 4BV8A 3ZU4A 4LUCA 4PUOA 3DZHA 1NAQA 3H42B 2J6SA 4ZVTA 4XFAA 2VP9A 4U2AA 1GWMA 3T5LA 4YV0A 4CCYB 5KOWA 1NVAA 1L8AA 4GWNA 4OX6A 3HJVA 2QW0X 3ER8A 1NDPA 2FG5A 1YHNA 4MB0A 4MVCA 2V8VA 2CL7X 3SMZA 3V65A 1CFJA 3V4MA 2Y1JA 4E5MA 1DCMA 3JQBC 2K1RA 2Q6VA 4AN0A 3ER9A 2HTEA 4LSZB 5AKKA 4ND4A 1NXOA 3E5NA 3PFOA 4ECQA 3ZMNA 2FB0A 4KEAA 4OHVA 5AVKA 4E32A 2ET7A 2OPKA 1TL1A 1YONA 4OHZA 2Z69A 4AXIA 3CUNA 3NM6B 1EFCA 3AEQA 2GA8A 4MWZA 2V8DA 4EJSA 2C6SA 2UU8A 4J2HA 1W0JA 1Y3AA 1KWKA 1R15A 5JMTA 3BIEA 3NOCA 3BRQA 3ENKA 4A7ZA 2HIAA 2NMNA 3M6MD 2BACA 4GMXA 1JL3A 3VD3A 1J20A 2FSUA 1ZK4A 4KIAA 1RP5A 5FQ0A 1DSSG 1COV3 4PBPA 4G24A 3QV2A 1VKOA 5JC8A 3AY6A 4MULA 1PN3A 2PH5A 3OBBA 4CHTA 3IEMA 2W4PA 4A8QA 2HX1A 3FNHA 3F5MA 4WK1A 3NW9A 2ZE7A 3RREA 4G2TA 5DVZA 2BGOA 3E2EA 4LYHA 3R5HA 2BOVA 5THWA 3UHJA 1AKTA 4MUNA 3RT7A 5EA2A 1VQSA 3UAWA 1S0FA 4C6RA 1D5CA 4A73A 1WV1A 4NLWA 3R3ZA 3IT0A 2GH2A 3VUFA 1M8KA 3PNBA 2ZRGA 5IDQA 3THYA 1J58A 4TX1A 1Z8HA 3DMTA 4HWKA 3ANNA 1G21B 1QIFA 2A73B 1RZRD 1TFUA 4EBBA 2WFF1 3TA0A 2EA7A 3R40A 2QY9A 4BMBA 4BKOA 3VX3A 5TQVA 5L7OB 3HQ4O 4EHIA 1HGXA 4L72A 1Q21A 3U6KA 1O3YA 3OWHA 3AD7C 2BZ1A 3PS9A 2CV0A 5JWOA 3IPYA 5D3ZA 1L6RA 2VJMB 4DA8A 1HNVB 1QLJA 4YS6A 3BUCA 1Y9MA 1SVKA 5EP1A 1GOGA 2RCYA 5AT1A 4ARXA 4BQ4A 2WHQA 3VDDB 2FD2A 2G7ZA 3QKSA 3ETPA 1Z5NA 3R7WB 1S7CA 2VOKA 3KS9A 3BH7A 2AWNA 4TMTA 1CAVB 2P90A 2QROA 3OLCX 3ZY2A 5IVBA 2X8JA 4HPKB 2LTNA 4ZU4A 3G89A 1Y0HA 1VQPS 4G1PA 3JR7A 2DKOB 2AFHA 1LI5A 3K1ZA 2CAUA 4MW9A 1ZBA2 4UBKA 3CMES 4EEXA 4NL5A 2MKKA 4UUQA 1F9KA 3EVBA 3OGVA 1PLJA 1M2OA 2G0AA 3CUSA 2PUWA 2VMFA 2W46A 3UGKA 4DCTA 4JI8J 4D44A 5FYMA 2ZZNA 4Q4X1 1AX0A 5G05L 1I24A 1LXJA 2CDRA 1XRNA 5CVJA 4IEQA 1ZD5A 3KYDB 1U5XA 1NXD1 5EP9A 2OPBA 3BF7A 1NI4A 3LCPA 1QTNA 4BUJA 4MUYA 2DCMA 1QO9A 1XNAA 3I23A 1PAUB 3W34A 4QQFA 2CJAA 4HVAA 4JI2F 1QHSA 5IFKA 5LYJF 4GOMD 4JI0B 2CWWA 1LOUA 4C7KA 4M1KA 1VMEA 5J4VA 2HRYA 4RW8A 3T1NA 4WK2B 4GH4C 2FDCA 2JZNA 1LI7A 3I6ZA 2XSFA 2XZLA 3O1PA 2CLFB 2GEVA 3HZEA 1G5PA 4P7TA 2C9BA 2AQHA 3PRJA 4YFVA 1IS6A 3FVYA 3UB3A 4B32A 1AY0A 3D4PA 4CTAB 5C4GB 1DRUA 3RRGA 1ZZ8A 4PPFA 2D3ZA 2UVPB 1J8FA 5JAIA 4CIYA 4BM8A 1SHUX 2R8OA 1W4ZA 5H9SA 2IBOA 3KDPA 1MOSA 1QHFA 4QGNA 3GJTB 1YJWS 3QRRA 2V9PA 4MUBA 1RUC3