The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
165
|
sequence length |
519
|
structure length |
505
|
Chain Sequence |
b'KPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGNAQLSGVQFIQEDYVVKVAQVMATNMWNLGYDGSGITIGIIDTGIDASHPDLQGKVIGWVDFVNGKTTPYDDNGHGTHVASIAAGTGAASNGKYKGMAPGAKLVGIKVLNGQGSGSISDIINGVDWAVQNKDKYGIKVINLSLGSSQSSDGTDSLSQAVNNAWDAGLVVVVAAGNSGPNKYTVGSPAAASKVITVGAVDKYDVITDFSSRGPTADNRLKPEVVAPGNWIIAARASGTSMGQPINDYYTAAPGTAMATPHVAGIAALLLQAHPSWTPDKVKTALIETADIVKPDEIADIAYGAGRVNAYKAAYYDNYAKLTFTGYVSNKGSQSHQFTISGAGFVTATLYWDNSGSDLDLYLYDPNGNQVDYSYTAYYGFEKVGYYNPTAGTWTIKVVSYSGSANYQVDVVSDGSLGQP'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of a subtilisin homologue, Tk-SP, from Thermococcus kodakaraensis: requirement of a C-terminal beta-jelly roll domain for hyperstability.
pubmed doi rcsb |
molecule keywords |
Subtilisin-like serine protease
|
source organism |
Thermococcus kodakarensis
|
molecule tags |
Hydrolase
|
total genus |
165
|
structure length |
505
|
sequence length |
519
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.4.21.62: Subtilisin. |
pdb deposition date | 2010-03-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00082 | Peptidase_S8 | Subtilase family |
A | PF04151 | PPC | Bacterial pre-peptidase C-terminal domain |
A | PF18237 | Tk-SP_N-pro | Tk-SP N-propeptide domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Peptidase S8 propeptide/proteinase inhibitor I9 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Peptidase S8/S53 domain |