3AG3E

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag3E00
2EIKE 1OCOE 3AG1E 3ABME 3AG4E 1OCCE 2Y69E 3AG2E 5IY5E 1V54E 3ABKE 1V55E 3ABLE 2ZXWE 2EINE 2EILE 3ASNE 5B1BE 2EIJE 5B3SE 5B1AE 1OCZE 2DYSE 3AG3E 3ASOE 3X2QE 2OCCE 3WG7E 1OCRE 2DYRE 2EIME
chains in the Genus database with same CATH superfamily
3ZVVA 1E8XA 2LAIA 4YDEA 3TWRA 3CR3A 3G2TA 2L6JA 4PS3A 3UI2A 3TWQA 4YDYA 3DSWA 2WXQA 2NSZA 4C0EA 3SQVA 2MHKA 3FUHA 1NP7A 3BEEA 4G1TA 3B13A 4LEUA 3S7BA 3W9GA 3D9KA 4P29A 1SZAA 4FJYA 3F6QA 3EDTB 4CDRA 1N11A 4FC8A 5CECB 3D9NA 5AQ9A 1JCQA 3HHMA 5JJ7A 3BQOA 4N5QA 3ENEA 1JCRA 1SA5A 4HOSA 2FBNA 3MGBA 3EHNA 4EQFA 3FTUA 2Y4UA 1X5BA 1G3NB 3Q47B 2ZU6B 1U2VG 5ENRD 5HS0A 3D3MA 4UQZA 3D9OA 4AOFA 3S7JA 5JMND 1X81A 3X2QE 4UWLA 1HU3A 2XS1A 3MYVA 4GMLA 3K9IA 1NL4A 3UTMA 2PQNA 2JLBA 5ENPD 1H6KA 3IHYA 5T8IA 2FULA 5IY5E 4K0RA 4JL0A 1N9AA 2WMOA 3CHOA 3CIAA 2LSUA 5E75A 3HXCA 5CMYA 1WAO1 3AG1E 3CHRA 3G2WA 4CGVA 1EYHA 3D9LA 1N94A 2R59A 3ABLE 4LERA 2UY1A 2CHZA 5AQBA 2DWZA 2X6KA 5CRUA 4GTSA 2LXMA 2XENA 2X38A 4I17A 1TN6A 3TJPA 4DX7D 4MS6A 4F1PA 1O1RA 3T5XA 3EIJA 1DNPA 2AVPA 3EJNA 3UKUG 1TN8A 4U8VD 4ATGA 1Y6IA 4GU5A 2F8YA 4FADA 1FT1A 1H2TC 3FY4A 3KEZA 3UUXA 4M3OA 2Y0BG 3L17A 2L0TB 3CVYA 4U07A 4PS7A 1Z5SC 3PE3A 3WG7E 3APDA 5AJLA 3R9AB 2H6FA 2DZOA 3QNKA 2IONA 4A1SA 1H2VC 5EX0A 2KBXA 1KPSB 3U64A 2XPIA 2WQ6A 5AYWD 4J8SA 3VTYA 3P2BA 1Q2ZA 3QB2A 3UM3A 2DVWA 2VSYA 4ILHB 1UJJA 1SW6A 3NF1A 5CHEE 2F37A 3QKYA 2LO6A 3B95A 3APFA 1D8DA 5G05J 5A7DB 4JW1A 2VSOE 3SF4A 4N2SA 3UPVA 1MQSA 4BTBA 4B8AA 3FTWA 4LRZA 4BESA 3HDXA 5EIBE 3DPYA 5EDSA 4N3CA 2V5FA 4U7EB 4HLLA 3LJ3A 3S2AA 2GRRB 3ZXSA 2VGYA 1MYOA 4LNGA 4O1PA 4NURA 4UI9C 3FTVA 5BT1A 3CVVA 2WVIA 2OVFA 3IEGA 4KT6B 4GYYA 4U0UA 5G2NA 3TXNA 3DXKG 4NRHB 5B1AE 3R7RA 2WXIA 3TG4A 4TXPA 1OCOE 4AXHA 1YA0A 3QAQA 1OWPA 3TGOA 4IYPA 4Y6WA 5E76A 4G25A 3V31A 4JC8A 2J4DA 1ELRA 2GROB 5M72A 1UG3A 2X6HA 4BWRA 2IQCA 1L5JA 4O6FA 3ASOE 4K5CA 4I1AA 3RAUA 1P5QA 2P9LG 2EIKE 5AAOA 3Q73A 2J9QA 5CBNA 2QYJA 2DCPA 3UX4A 3SFZA 2WXNA 3CVLA 3FUDA 4BERA 2CG3A 5CRVA 4F3VA 1QBQA 4KZCA 3QDNA 4U8YD 2XGOA 4KVMA 4OVUA 3V2OA 3KSQA 4Q69A 5AN8A 3IBEA 4MRUA 2CFZA 1ZU2A 1H6PA 1YYHA 1TNOA 1XNFA 3AJIA 3PNTB 2L9BA 4I6GA 3MZLB 2ONDA 3FUKA 3FH8A 1MX6A 4UUCA 1EPUA 2R05A 4A3TA 5EYLA 2Y4TA 3CK9A 4H7XA 3L08A 4BX8A 5FQ4A 2FI7A 4BSXA 2FO7A 4UWFA 3V30A 3SHFA 2R17C 2B0OE 2QC9A 1JPLA 3PRZA 3ZEFA 5BUZA 1LD8A 4GYOA 1HG2A 4ME2A 5ENSD 1OWOA 1SZ9A 2KM4A 3URZA 3HRAA 4GZ3A 4RG9A 4ANVA 4I2ZA 4NIKA 2MOWA 3RRMB 3CKCA 4FLHA 1IXVA 3D9HA 1JWFA 4EPZA 2CHWA 4KBQA 3UMVA 3ZNGA 1FCHA 2IO2C 2IF4A 1N95A 2DYRE 4RLYA 4LG6A 2DBAA 4UWHA 1ELWA 3CSTA 1TJCA 1YMPA 3LVQE 2Y69E 2BTDA 4KXKB 5JA4D 1SQMA 4LCTA 3LKUA 2EINE 4U95D 1KT0A 2V5QC 4HXIA 3APCA 5CEDB 4GTMA 3CEQA 3SZ7A 3QJZA 1QQEA 3LJNA 4FULA 2KZTA 1H19A 4OAUC 4WWNA 1Y8MA 5EKQD 3TAXA 3AS8A 1AWCB 4WWPA 4U0SA 3OXLA 5J90A 4TUMA 2EIJE 2PNNA 4AVXA 1S0PA 2J4BA 2P9IG 4GTTA 5KCMA 5D0QD 1OWMA 3L82A 3CQGB 3CLJA 4FU3A 4K5AB 2WXRA 3UIOC 4IULA 5C1DA 3HYMB 1PAQA 1IHGA 2LXLA 2XHEA 4GZ6A 4MLPA 2PM6A 2EIME 4HOUA 1NA0A 4ACKA 4G24A 2WXGA 2P2CP 4A1GA 5CMWA 1HG5A 3FULA 2GW1A 2XRYA 4E85A 3C72A 4OYSA 4OVVA 1NI1A 4HNAD 2CFUA 4GCNA 4DX1A 3TG5A 3FUNA 5ENOD 1U3DA 4G26A 2C0LA 3ZKJA 4X8QA 2C0MA 4BT9A 2LAHA 1QZ2A 2J49A 5G55A 2HO1A 4R7LA 2XGSA 2XEVA 5A23A 3C3OA 3TWVA 4LUNU 5ANLA 5FQ6A 1E96B 1QYMA 2QY7A 1TJFA 3DPDA 3D9MA 3G2SA 3CVQA 3ULYA 3ASNE 2BKGA 4F7AA 4WNDA 2P9PG 3FEYA 4YDOA 4HORA 5FJYA 2DIWA 5HKPA 2L6BA 1WDYA 5EX3A 3UINC 2RFAA 5T3RA 4AIFA 3TWWA 4TXRA 4HI9A 3RU0A 2XRZA 4EHMA 3NAWA 4HFGA 3E32A 3R9MA 3R7QA 4ACLA 3ZGQA 3ZYQA 2WXKA 3E33A 2KCVA 3IKOB 4HRMB 4XZ4A 3ZIMA 1IQUA 3SNXA 4EZJA 5LX8A 3BU8A 5KWDA 4DLQA 2P9SG 3HXDA 4LNUD 2GGFA 4L1BA 2WXHA 3CVNA 4UWGA 3PUJA 1UJKA 2BUGA 1N54A 3B7UX 4XKBA 1IKND 3ML9A 3LYAA 3C3RA 2OOEA 4C0MA 4GPMA 3ULQA 3ASFA 4UQYA 1TN7A 3ZW3A 3J5PA 3D9PA 2J8SD 2CHXA 5CEAA 1NZNA 2ZIRA 4FHKA 2V0PA 4W9RA 4J7WA 2Q7FA 3BG1B 2PQRA 3FDHA 4I43A 4JA7A 2I2OA 2R02A 2ETBA 5FQ8A 2XGMA 4PDXA 1BI8B 2GRMA 3AS4A 3ZFWA 4HOQA 1FVFA 3TXMA 4CZ2D 3L16A 4TV3A 1N4QA 4ATZD 3DSVA 4L9PA 3JYSA 5HRYA 3UT7A 2WMNA 4C9BB 2WB2A 3CQCB 2A4ZA 4RVBA 3QARA 2PL2A 2V8SE 5LOZA 3RK6A 3B7TA 2I1KA 1HH8A 4ABNA 4N3AA 4BETA 2MYOA 4DPRA 4DRXE 3NOCD 3UXGA 4DX2A 3OTNA 5C2YA 3PH0C 1N52A 3JXIA 5BV0A 4UWKA 3NZUA 5BXOA 3EU9A 4J8DA 4E6HA 2JEKA 1MHQA 3MJWA 3FU5A 3JUIA 3AG4E 4GTRA 2CG2A 4GPKA 3GZ2A 3TWSA 1V55E 3GYZA 3RO3A 3SBSA 2X6IA 1HX8A 1KLXA 3EUVA 3VLFA 4I1MA 2WXOA 1K8KG 2P58C 3GZ1A 4I9CA 2WXLA 2F8XK 5AARA 3FU3A 3FUJA 4LSZE 2LUHA 2VGXA 2XCCA 3KD7A 4N39A 3CHSA 1JUQA 4APOA 2L0IA 4DUIA 1HFAA 3FTZA 4GA2A 3CHPA 3LCAA 5KJLA 2KXPC 1MZCA 4JA9A 3JQ1A 5ENQD 2XCBA 3RO2A 2NC9A 3CHMA 5B3SE 2DZNA 3UIPC 4L7TA 1S70B 5JJ6A 5AJDA 3PZDA 1KT1A 4JPSA 2BEDA 3RSEG 4ZFHA 4U0ZA 2OVBA 5BPPA 4FA6A 4JD2G 4CYMD 5LCWJ 1E7VA 4G23A 4DX6D 1O1TA 2VJ8A 2VYIA 3E34A 3ZXPA 3GZSA 4I1OB 4GAAA 4CCAA 3SGHA 3FUIA 4HOTA 2BKKB 2F0YA 2ETAA 4U8HA 4I2WA 2GRLA 3Q79A 4WNEA 1A5EA 4KZ0A 4AM9A 2AXVA 1E8YA 4AJWA 1DVPA 3FP3A 2FO1E 1DCQA 3ESLA 3AU4A 4BX9A 4UI9K 3QWVA 1KZPA 2X6JA 3O48A 2XEEA 3ZHEA 1ZBPA 1OUVA 1B89A 3W9FA 3FUFA 3Q5MA 3CVWA 3NZSA 5LFAA 4LNBA 3I5PA 1PC2A 5EYPF 4DJAA 5AQ7A 2V4LA 5LP0A 4GB9A 3DSUA 3PDNA 2Y1LE 2PZIA 1ZB1A 2EQXA 2KC7A 1N0QA 1LD7A 3Q7FA 3ML8A 4BFRA 2AJAA 2ETCA 4HBDA 2ZXWE 3IHVA 4PS8A 4XX5A 5LCWC 3SFXA 3FTYA 3HG0D 4N3BA 2XS8A 4MBGA 2IO3C 2PM7A 1N4SA 1OCRE 3LXUX 3E37A 3PREA 3CVXA 5ARGA 3D9IA 1HF8A 2BF0X 4DI3A 4MKTA 2RFMA 1MJ0A 2KZTB 2H6HA 3PVLA 4PH4B 2HE0A 1WY6A 2WXPA 5D0OD 3ONLA 4RG6A 2YQ8A 4F6RD 2V4HC 3ONKA 2IU1A 4PUCA 3ZPJA 4XI9A 2OEWA 4ILGA 2VSXE 1TNUA 2WQHA 3PZ4A 1EF1C 5CBOA 3LY8A 1S63A 3Q78A 1IQRA 4KYOB 3PUKA 3HXBA 1E8ZA 2I6HA 3C3QA 2Y3AA 4HRNA 4N5CA 2I1JA 3NBNB 3OAWA 4HVBA 1OY3D 3IV0A 3JCKC 3S7FA 2RKKA 3Q9UC 4GTQA 5HQ8A 2KCLA 3C5RA 3ZYLA 2RD0A 3FUEA 3U3WA 4XI0A 3VLEA 1BD8A 2QZAA 4D10C 5JHBA 4DX5D 3AS5A 1N4PA 2A5EA 3FTXA 3TWTA 3SI5A 4CT0A 2MRIA 1HE8A 2WXJA 3QC1A 4N2QA 1MX4A 4UI9J 1BLXB 4GTVA 2UWJG 1TNYA 3DBSA 5T4YA 2HYZA 4J0UA 3CVPA 1D9SA 5HI7A 3EHRA 1DC2A 4CRWA 4GZ5A 2OEVA 4BSZB 3ZUVB 3BUAA 2VTBA 4AY6A 1NA3A 3IXEA 1JCSA 3UM0A 1FT2A 4JXTA 4GZCA 4GMJA 3VLDA 3I4GA 4GMRA 4G11A 4FHJA 4BT8A 4HI8A 3CV0A 5KJMA 2J07A 4XIFA 2FEZA 3AU5A 3UT8A 3ASHA 1S64A 3U4TA 1YCSB 5G04J 1KZOA 2GRPB 5BV1A 3KS2A 1O1SA 1OWLA 4HS2A 2NXPA 3QOUA 1WG0A 3B7BA 3Q4AB 2OV8A 5CCMA 3FEXA 4QQIA 2R2LA 4RQIA 3ZN3A 1E8WA 4GYWA 4U96D 4JZYA 2XPZA 4CT4A 3Q7AA 3HXEA 3U9WA 2IJGX 5FZRA 2R03A 3MCXA 1LTXA 2DYSE 1H2UA 3ABME 3O4ZA 1K1AA 2H6IA 1U3CA 3DWLG 3PEVB 5D66A 2IOSA 1BU9A 3TWXA 3DEPA 3QK0A 5B1BE 2XQ0A 4IN3B 3CK7A 3PZ1A 5AIJA 2NYJA 4L2LA 1HZ4A 3V2XA 2B6CA 4JHKA 4NQ0A 3L9TA 4ANUA 3CVUA 3N71A 2P9NG 3BG0B 5KJNA 5BNWA 2YINA 1HXIA 2C2LA 2XZDG 3EU5A 4DLOA 4JHRA 4FP7A 5CERB 3DSSA 3TWUA 3ASDA 4XKCA 4U04A 5ARFA 4I9EA 4NACA 2IOLA 4K5BA 3L13A 3VTXA 3HIZA 4A63B 3DXMG 1N0RA 1E7UA 2WXFA 5JHAA 1Z6TA 3MEKA 3UM1A 2IEJA 3C98A 4GA0A 5FWQA 5J08A 3KEAA 3Q49B 3LVRE 3ABKE 3L22A 3KAEA 3MKQA 1K3ZD 2GRNB 2VQ2A 4BEPA 1DCEA 5KNGA 4G2VA 4EZKA 3JUEA 3D9JA 4B0ZA 4J8EA 5DBKA 4YVOA 4FJZA 5CCLA 5DIZA 5H7PA 4Q94A 1OT8A 3DEOA 1H6OA 1RW2A 3PE4A 1OWNA 4DI4A 3PZ3A 4HRLA 4JB8P 2R5SA 4QFVA 2HM8A 3HVEB 5KNHD 4B8CB 1SA4A 3T9KA 3CSFA 2GRQB 2WM9A 2WPVA 3LEWA 1BPOA 2KATA 4BTAA 3FH7A 1FPPA 4CDMA 3RKVA 3QWPA 4AP2A 4Y6CA 1BI7B 1IYGA 2AWIA 3P1UA 1LF8A 2ILRA 3JXJA 3MKQB 3I4RB 4O60A 3T8KA 5EN5D 5FZQA 1OCCE 1QNFA 3HXFA 3FU6A 2AXZA 4JVSA 4K03A 2XZTG 4F1SA 3JQ0A 4HQDA 4TRQA 4YNDA 3ASGA 1O5MA 4APFA 5D2MC 5JJTA 5FINA 3J5QB 3RRNB 4EBAG 3SFYA 3EHMA 2YHEA 2WXMA 3T8MA 3MV3B 1HO8A 1OCZE 2QYUA 3FH5A 3PNLB 3RJVA 2VGXB 2ZGDA 5KBAA 3CKBA 3Q9NC 3AAAC 4EBAA 3G2UA 3B7SA 2VSNA 4O1OA 3LS8A 4G8LA 3Q15A 3CHQA 3S7DA 1SVXA 2E2EA 3OXGA 5AENA 3DSXA 1UN8A 1EDUA 5BXUA 3DRAA 4L2YA 1UW4B 5G04C 1V54E 1WM5A 3I3NA 3SBTB 4AEZC 1INZA 2YNQA 5BW8C 4I6EA 2X3MA 4EZLA 3ESKA 5ENTD 2ZISA 3E4BA 2QFCA 4GTOA 5KJKA 1D8EA 1RZ4A 2HR2A 4TUUA 3MX3A 3SO8A 3TL5A 1FVHA 1AP7A 4L23A 5ANRA 4AY5A 1UOHA 3DSTA 5FQ7A 3UM2A 4JHJA 4Q96A 1IHBA 4WUYA 1VDYA 4OAVB 4DK5A 1UN9A 4URKA 3PS6A 2YHCA 3T5VA 3FU0A 2H6GA 1GW6A 1ELKA 5FIOA 3KSLA 4XE0A 2OCCE 5ITZF 3SD5A 3SY2A 2VGEA 3CGHA 4WNGA 4KVOA 5EIDA 1Z3YA 1TR4A 3Q75A 5G05C 3MV2B 3UT4A 4F53A 3U66A 3NB2A 4UQXA 1OXJA 3ISMC 4GCOA 4RSYA 3V79K 5FZSA 3OXFA 4B93B 3EIQC 3UQ3A 4CEMA 3FWVA 3PEUB 2LSVA 4U63A 3PZ2A 3FTSA 3ULEG 5ENNA 1E90A 2I9CA 4ILIA 1TNZA 4J8YA 3EHQA 4KMOA 3FUMA 4C48B 4GTPA 1K1BA 4WAFA 3ZRHA 4CGWA 2J08A 1MX2A 3NQPA 2WQ7A 3NOGD 1TYQG 4I6JA 1JWGA 4M7CA 4HB5A 4YDWA 4ZHBA 3ZHEB 4EECA 4GZDA 1TNBA 3E30A 4J8FA 5FT9A 2EILE 2P9UG 4ANXA 4CDNA 2UY1B 3UKRG 5EILA 2AW6A 3LY7A 4Z68A 2IY0C 2M63A 4B89A 4B94A 2E0IA 4JEUA 3RRUA 4XEIG 3L6AA 3HVEA 2RG8A 4HLEA 3FFLA 2A5UA 4WNFA 1Z3XA 1A17A 4BY6A 4IRUA 1PY1A 4YVQC 5AQAA 5FTPA 3ZYMA 3ZYKA 2LNIA 2VTBB 2X6FA 2IFUA 2P9KG 3L54A 2XPYA 3WXXA 2KCKA 2ZGGA 3CK8A 4FLBA 3RIBA 4J6IA 4AV7A 3LPZA 2FF4A 2AXUA 3FHEA 2JABA 4G8KA 3LDZA 4H7YA 4JEHA 4A55A 5A6CA 1NFIE 3MKRA 4V3IA 1HS6A 1TEZA 3LY9A 1W3BA 3B7RL 3AG2E 3ZU7B 4ANWA 4GA1A 1H0AA 2XEHA 3MA5A 1XGWA 2J09A 4TXQA 4WWOA 4A3VA 3G2VA 3AG3E 3GW4A 3QWWA 1N4RA
chains in the Genus database with same CATH topology
2EIKE 1OCOE 3AG1E 3ABME 3AG4E 1OCCE 2Y69E 3AG2E 5IY5E 1V54E 3ABKE 1V55E 3ABLE 2ZXWE 2EINE 2EILE 3ASNE 5B1BE 2EIJE 5B3SE 5B1AE 1OCZE 2DYSE 3AG3E 3ASOE 3X2QE 2OCCE 3WG7E 1OCRE 2DYRE 2EIME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIK E;  1OCO E;  3AG1 E;  3ABM E;  3AG4 E;  1OCC E;  2Y69 E;  3AG2 E;  5IY5 E;  1V54 E;  3ABK E;  1V55 E;  3ABL E;  2ZXW E;  2EIN E;  2EIL E;  3ASN E;  5B1B E;  2EIJ E;  5B3S E;  5B1A E;  1OCZ E;  2DYS E;  3AG3 E;  3ASO E;  3X2Q E;  2OCC E;  3WG7 E;  1OCR E;  2DYR E;  2EIM E; 
#chains in the Genus database with same CATH topology
 3ZVV A;  1E8X A;  2LAI A;  4YDE A;  3TWR A;  3CR3 A;  3G2T A;  2L6J A;  4PS3 A;  3UI2 A;  3TWQ A;  4YDY A;  3DSW A;  2WXQ A;  2NSZ A;  4C0E A;  3SQV A;  2MHK A;  3FUH A;  1NP7 A;  3BEE A;  4G1T A;  3B13 A;  4LEU A;  3S7B A;  3W9G A;  3D9K A;  4P29 A;  1SZA A;  4FJY A;  3F6Q A;  3EDT B;  4CDR A;  1N11 A;  4FC8 A;  5CEC B;  3D9N A;  5AQ9 A;  1JCQ A;  3HHM A;  5JJ7 A;  3BQO A;  4N5Q A;  3ENE A;  1JCR A;  1SA5 A;  4HOS A;  2FBN A;  3MGB A;  3EHN A;  4EQF A;  3FTU A;  2Y4U A;  1X5B A;  1G3N B;  3Q47 B;  2ZU6 B;  1U2V G;  5ENR D;  5HS0 A;  3D3M A;  4UQZ A;  3D9O A;  4AOF A;  3S7J A;  5JMN D;  1X81 A;  3X2Q E;  4UWL A;  1HU3 A;  2XS1 A;  3MYV A;  4GML A;  3K9I A;  1NL4 A;  3UTM A;  2PQN A;  2JLB A;  5ENP D;  1H6K A;  3IHY A;  5T8I A;  2FUL A;  5IY5 E;  4K0R A;  4JL0 A;  1N9A A;  2WMO A;  3CHO A;  3CIA A;  2LSU A;  5E75 A;  3HXC A;  5CMY A;  1WAO 1;  3AG1 E;  3CHR A;  3G2W A;  4CGV A;  1EYH A;  3D9L A;  1N94 A;  2R59 A;  3ABL E;  4LER A;  2UY1 A;  2CHZ A;  5AQB A;  2DWZ A;  2X6K A;  5CRU A;  4GTS A;  2LXM A;  2XEN A;  2X38 A;  4I17 A;  1TN6 A;  3TJP A;  4DX7 D;  4MS6 A;  4F1P A;  1O1R A;  3T5X A;  3EIJ A;  1DNP A;  2AVP A;  3EJN A;  3UKU G;  1TN8 A;  4U8V D;  4ATG A;  1Y6I A;  4GU5 A;  2F8Y A;  4FAD A;  1FT1 A;  1H2T C;  3FY4 A;  3KEZ A;  3UUX A;  4M3O A;  2Y0B G;  3L17 A;  2L0T B;  3CVY A;  4U07 A;  4PS7 A;  1Z5S C;  3PE3 A;  3WG7 E;  3APD A;  5AJL A;  3R9A B;  2H6F A;  2DZO A;  3QNK A;  2ION A;  4A1S A;  1H2V C;  5EX0 A;  2KBX A;  1KPS B;  3U64 A;  2XPI A;  2WQ6 A;  5AYW D;  4J8S A;  3VTY A;  3P2B A;  1Q2Z A;  3QB2 A;  3UM3 A;  2DVW A;  2VSY A;  4ILH B;  1UJJ A;  1SW6 A;  3NF1 A;  5CHE E;  2F37 A;  3QKY A;  2LO6 A;  3B95 A;  3APF A;  1D8D A;  5G05 J;  5A7D B;  4JW1 A;  2VSO E;  3SF4 A;  4N2S A;  3UPV A;  1MQS A;  4BTB A;  4B8A A;  3FTW A;  4LRZ A;  4BES A;  3HDX A;  5EIB E;  3DPY A;  5EDS A;  4N3C A;  2V5F A;  4U7E B;  4HLL A;  3LJ3 A;  3S2A A;  2GRR B;  3ZXS A;  2VGY A;  1MYO A;  4LNG A;  4O1P A;  4NUR A;  4UI9 C;  3FTV A;  5BT1 A;  3CVV A;  2WVI A;  2OVF A;  3IEG A;  4KT6 B;  4GYY A;  4U0U A;  5G2N A;  3TXN A;  3DXK G;  4NRH B;  5B1A E;  3R7R A;  2WXI A;  3TG4 A;  4TXP A;  1OCO E;  4AXH A;  1YA0 A;  3QAQ A;  1OWP A;  3TGO A;  4IYP A;  4Y6W A;  5E76 A;  4G25 A;  3V31 A;  4JC8 A;  2J4D A;  1ELR A;  2GRO B;  5M72 A;  1UG3 A;  2X6H A;  4BWR A;  2IQC A;  1L5J A;  4O6F A;  3ASO E;  4K5C A;  4I1A A;  3RAU A;  1P5Q A;  2P9L G;  2EIK E;  5AAO A;  3Q73 A;  2J9Q A;  5CBN A;  2QYJ A;  2DCP A;  3UX4 A;  3SFZ A;  2WXN A;  3CVL A;  3FUD A;  4BER A;  2CG3 A;  5CRV A;  4F3V A;  1QBQ A;  4KZC A;  3QDN A;  4U8Y D;  2XGO A;  4KVM A;  4OVU A;  3V2O A;  3KSQ A;  4Q69 A;  5AN8 A;  3IBE A;  4MRU A;  2CFZ A;  1ZU2 A;  1H6P A;  1YYH A;  1TNO A;  1XNF A;  3AJI A;  3PNT B;  2L9B A;  4I6G A;  3MZL B;  2OND A;  3FUK A;  3FH8 A;  1MX6 A;  4UUC A;  1EPU A;  2R05 A;  4A3T A;  5EYL A;  2Y4T A;  3CK9 A;  4H7X A;  3L08 A;  4BX8 A;  5FQ4 A;  2FI7 A;  4BSX A;  2FO7 A;  4UWF A;  3V30 A;  3SHF A;  2R17 C;  2B0O E;  2QC9 A;  1JPL A;  3PRZ A;  3ZEF A;  5BUZ A;  1LD8 A;  4GYO A;  1HG2 A;  4ME2 A;  5ENS D;  1OWO A;  1SZ9 A;  2KM4 A;  3URZ A;  3HRA A;  4GZ3 A;  4RG9 A;  4ANV A;  4I2Z A;  4NIK A;  2MOW A;  3RRM B;  3CKC A;  4FLH A;  1IXV A;  3D9H A;  1JWF A;  4EPZ A;  2CHW A;  4KBQ A;  3UMV A;  3ZNG A;  1FCH A;  2IO2 C;  2IF4 A;  1N95 A;  2DYR E;  4RLY A;  4LG6 A;  2DBA A;  4UWH A;  1ELW A;  3CST A;  1TJC A;  1YMP A;  3LVQ E;  2Y69 E;  2BTD A;  4KXK B;  5JA4 D;  1SQM A;  4LCT A;  3LKU A;  2EIN E;  4U95 D;  1KT0 A;  2V5Q C;  4HXI A;  3APC A;  5CED B;  4GTM A;  3CEQ A;  3SZ7 A;  3QJZ A;  1QQE A;  3LJN A;  4FUL A;  2KZT A;  1H19 A;  4OAU C;  4WWN A;  1Y8M A;  5EKQ D;  3TAX A;  3AS8 A;  1AWC B;  4WWP A;  4U0S A;  3OXL A;  5J90 A;  4TUM A;  2EIJ E;  2PNN A;  4AVX A;  1S0P A;  2J4B A;  2P9I G;  4GTT A;  5KCM A;  5D0Q D;  1OWM A;  3L82 A;  3CQG B;  3CLJ A;  4FU3 A;  4K5A B;  2WXR A;  3UIO C;  4IUL A;  5C1D A;  3HYM B;  1PAQ A;  1IHG A;  2LXL A;  2XHE A;  4GZ6 A;  4MLP A;  2PM6 A;  2EIM E;  4HOU A;  1NA0 A;  4ACK A;  4G24 A;  2WXG A;  2P2C P;  4A1G A;  5CMW A;  1HG5 A;  3FUL A;  2GW1 A;  2XRY A;  4E85 A;  3C72 A;  4OYS A;  4OVV A;  1NI1 A;  4HNA D;  2CFU A;  4GCN A;  4DX1 A;  3TG5 A;  3FUN A;  5ENO D;  1U3D A;  4G26 A;  2C0L A;  3ZKJ A;  4X8Q A;  2C0M A;  4BT9 A;  2LAH A;  1QZ2 A;  2J49 A;  5G55 A;  2HO1 A;  4R7L A;  2XGS A;  2XEV A;  5A23 A;  3C3O A;  3TWV A;  4LUN U;  5ANL A;  5FQ6 A;  1E96 B;  1QYM A;  2QY7 A;  1TJF A;  3DPD A;  3D9M A;  3G2S A;  3CVQ A;  3ULY A;  3ASN E;  2BKG A;  4F7A A;  4WND A;  2P9P G;  3FEY A;  4YDO A;  4HOR A;  5FJY A;  2DIW A;  5HKP A;  2L6B A;  1WDY A;  5EX3 A;  3UIN C;  2RFA A;  5T3R A;  4AIF A;  3TWW A;  4TXR A;  4HI9 A;  3RU0 A;  2XRZ A;  4EHM A;  3NAW A;  4HFG A;  3E32 A;  3R9M A;  3R7Q A;  4ACL A;  3ZGQ A;  3ZYQ A;  2WXK A;  3E33 A;  2KCV A;  3IKO B;  4HRM B;  4XZ4 A;  3ZIM A;  1IQU A;  3SNX A;  4EZJ A;  5LX8 A;  3BU8 A;  5KWD A;  4DLQ A;  2P9S G;  3HXD A;  4LNU D;  2GGF A;  4L1B A;  2WXH A;  3CVN A;  4UWG A;  3PUJ A;  1UJK A;  2BUG A;  1N54 A;  3B7U X;  4XKB A;  1IKN D;  3ML9 A;  3LYA A;  3C3R A;  2OOE A;  4C0M A;  4GPM A;  3ULQ A;  3ASF A;  4UQY A;  1TN7 A;  3ZW3 A;  3J5P A;  3D9P A;  2J8S D;  2CHX A;  5CEA A;  1NZN A;  2ZIR A;  4FHK A;  2V0P A;  4W9R A;  4J7W A;  2Q7F A;  3BG1 B;  2PQR A;  3FDH A;  4I43 A;  4JA7 A;  2I2O A;  2R02 A;  2ETB A;  5FQ8 A;  2XGM A;  4PDX A;  1BI8 B;  2GRM A;  3AS4 A;  3ZFW A;  4HOQ A;  1FVF A;  3TXM A;  4CZ2 D;  3L16 A;  4TV3 A;  1N4Q A;  4ATZ D;  3DSV A;  4L9P A;  3JYS A;  5HRY A;  3UT7 A;  2WMN A;  4C9B B;  2WB2 A;  3CQC B;  2A4Z A;  4RVB A;  3QAR A;  2PL2 A;  2V8S E;  5LOZ A;  3RK6 A;  3B7T A;  2I1K A;  1HH8 A;  4ABN A;  4N3A A;  4BET A;  2MYO A;  4DPR A;  4DRX E;  3NOC D;  3UXG A;  4DX2 A;  3OTN A;  5C2Y A;  3PH0 C;  1N52 A;  3JXI A;  5BV0 A;  4UWK A;  3NZU A;  5BXO A;  3EU9 A;  4J8D A;  4E6H A;  2JEK A;  1MHQ A;  3MJW A;  3FU5 A;  3JUI A;  3AG4 E;  4GTR A;  2CG2 A;  4GPK A;  3GZ2 A;  3TWS A;  1V55 E;  3GYZ A;  3RO3 A;  3SBS A;  2X6I A;  1HX8 A;  1KLX A;  3EUV A;  3VLF A;  4I1M A;  2WXO A;  1K8K G;  2P58 C;  3GZ1 A;  4I9C A;  2WXL A;  2F8X K;  5AAR A;  3FU3 A;  3FUJ A;  4LSZ E;  2LUH A;  2VGX A;  2XCC A;  3KD7 A;  4N39 A;  3CHS A;  1JUQ A;  4APO A;  2L0I A;  4DUI A;  1HFA A;  3FTZ A;  4GA2 A;  3CHP A;  3LCA A;  5KJL A;  2KXP C;  1MZC A;  4JA9 A;  3JQ1 A;  5ENQ D;  2XCB A;  3RO2 A;  2NC9 A;  3CHM A;  5B3S E;  2DZN A;  3UIP C;  4L7T A;  1S70 B;  5JJ6 A;  5AJD A;  3PZD A;  1KT1 A;  4JPS A;  2BED A;  3RSE G;  4ZFH A;  4U0Z A;  2OVB A;  5BPP A;  4FA6 A;  4JD2 G;  4CYM D;  5LCW J;  1E7V A;  4G23 A;  4DX6 D;  1O1T A;  2VJ8 A;  2VYI A;  3E34 A;  3ZXP A;  3GZS A;  4I1O B;  4GAA A;  4CCA A;  3SGH A;  3FUI A;  4HOT A;  2BKK B;  2F0Y A;  2ETA A;  4U8H A;  4I2W A;  2GRL A;  3Q79 A;  4WNE A;  1A5E A;  4KZ0 A;  4AM9 A;  2AXV A;  1E8Y A;  4AJW A;  1DVP A;  3FP3 A;  2FO1 E;  1DCQ A;  3ESL A;  3AU4 A;  4BX9 A;  4UI9 K;  3QWV A;  1KZP A;  2X6J A;  3O48 A;  2XEE A;  3ZHE A;  1ZBP A;  1OUV A;  1B89 A;  3W9F A;  3FUF A;  3Q5M A;  3CVW A;  3NZS A;  5LFA A;  4LNB A;  3I5P A;  1PC2 A;  5EYP F;  4DJA A;  5AQ7 A;  2V4L A;  5LP0 A;  4GB9 A;  3DSU A;  3PDN A;  2Y1L E;  2PZI A;  1ZB1 A;  2EQX A;  2KC7 A;  1N0Q A;  1LD7 A;  3Q7F A;  3ML8 A;  4BFR A;  2AJA A;  2ETC A;  4HBD A;  2ZXW E;  3IHV A;  4PS8 A;  4XX5 A;  5LCW C;  3SFX A;  3FTY A;  3HG0 D;  4N3B A;  2XS8 A;  4MBG A;  2IO3 C;  2PM7 A;  1N4S A;  1OCR E;  3LXU X;  3E37 A;  3PRE A;  3CVX A;  5ARG A;  3D9I A;  1HF8 A;  2BF0 X;  4DI3 A;  4MKT A;  2RFM A;  1MJ0 A;  2KZT B;  2H6H A;  3PVL A;  4PH4 B;  2HE0 A;  1WY6 A;  2WXP A;  5D0O D;  3ONL A;  4RG6 A;  2YQ8 A;  4F6R D;  2V4H C;  3ONK A;  2IU1 A;  4PUC A;  3ZPJ A;  4XI9 A;  2OEW A;  4ILG A;  2VSX E;  1TNU A;  2WQH A;  3PZ4 A;  1EF1 C;  5CBO A;  3LY8 A;  1S63 A;  3Q78 A;  1IQR A;  4KYO B;  3PUK A;  3HXB A;  1E8Z A;  2I6H A;  3C3Q A;  2Y3A A;  4HRN A;  4N5C A;  2I1J A;  3NBN B;  3OAW A;  4HVB A;  1OY3 D;  3IV0 A;  3JCK C;  3S7F A;  2RKK A;  3Q9U C;  4GTQ A;  5HQ8 A;  2KCL A;  3C5R A;  3ZYL A;  2RD0 A;  3FUE A;  3U3W A;  4XI0 A;  3VLE A;  1BD8 A;  2QZA A;  4D10 C;  5JHB A;  4DX5 D;  3AS5 A;  1N4P A;  2A5E A;  3FTX A;  3TWT A;  3SI5 A;  4CT0 A;  2MRI A;  1HE8 A;  2WXJ A;  3QC1 A;  4N2Q A;  1MX4 A;  4UI9 J;  1BLX B;  4GTV A;  2UWJ G;  1TNY A;  3DBS A;  5T4Y A;  2HYZ A;  4J0U A;  3CVP A;  1D9S A;  5HI7 A;  3EHR A;  1DC2 A;  4CRW A;  4GZ5 A;  2OEV A;  4BSZ B;  3ZUV B;  3BUA A;  2VTB A;  4AY6 A;  1NA3 A;  3IXE A;  1JCS A;  3UM0 A;  1FT2 A;  4JXT A;  4GZC A;  4GMJ A;  3VLD A;  3I4G A;  4GMR A;  4G11 A;  4FHJ A;  4BT8 A;  4HI8 A;  3CV0 A;  5KJM A;  2J07 A;  4XIF A;  2FEZ A;  3AU5 A;  3UT8 A;  3ASH A;  1S64 A;  3U4T A;  1YCS B;  5G04 J;  1KZO A;  2GRP B;  5BV1 A;  3KS2 A;  1O1S A;  1OWL A;  4HS2 A;  2NXP A;  3QOU A;  1WG0 A;  3B7B A;  3Q4A B;  2OV8 A;  5CCM A;  3FEX A;  4QQI A;  2R2L A;  4RQI A;  3ZN3 A;  1E8W A;  4GYW A;  4U96 D;  4JZY A;  2XPZ A;  4CT4 A;  3Q7A A;  3HXE A;  3U9W A;  2IJG X;  5FZR A;  2R03 A;  3MCX A;  1LTX A;  2DYS E;  1H2U A;  3ABM E;  3O4Z A;  1K1A A;  2H6I A;  1U3C A;  3DWL G;  3PEV B;  5D66 A;  2IOS A;  1BU9 A;  3TWX A;  3DEP A;  3QK0 A;  5B1B E;  2XQ0 A;  4IN3 B;  3CK7 A;  3PZ1 A;  5AIJ A;  2NYJ A;  4L2L A;  1HZ4 A;  3V2X A;  2B6C A;  4JHK A;  4NQ0 A;  3L9T A;  4ANU A;  3CVU A;  3N71 A;  2P9N G;  3BG0 B;  5KJN A;  5BNW A;  2YIN A;  1HXI A;  2C2L A;  2XZD G;  3EU5 A;  4DLO A;  4JHR A;  4FP7 A;  5CER B;  3DSS A;  3TWU A;  3ASD A;  4XKC A;  4U04 A;  5ARF A;  4I9E A;  4NAC A;  2IOL A;  4K5B A;  3L13 A;  3VTX A;  3HIZ A;  4A63 B;  3DXM G;  1N0R A;  1E7U A;  2WXF A;  5JHA A;  1Z6T A;  3MEK A;  3UM1 A;  2IEJ A;  3C98 A;  4GA0 A;  5FWQ A;  5J08 A;  3KEA A;  3Q49 B;  3LVR E;  3ABK E;  3L22 A;  3KAE A;  3MKQ A;  1K3Z D;  2GRN B;  2VQ2 A;  4BEP A;  1DCE A;  5KNG A;  4G2V A;  4EZK A;  3JUE A;  3D9J A;  4B0Z A;  4J8E A;  5DBK A;  4YVO A;  4FJZ A;  5CCL A;  5DIZ A;  5H7P A;  4Q94 A;  1OT8 A;  3DEO A;  1H6O A;  1RW2 A;  3PE4 A;  1OWN A;  4DI4 A;  3PZ3 A;  4HRL A;  4JB8 P;  2R5S A;  4QFV A;  2HM8 A;  3HVE B;  5KNH D;  4B8C B;  1SA4 A;  3T9K A;  3CSF A;  2GRQ B;  2WM9 A;  2WPV A;  3LEW A;  1BPO A;  2KAT A;  4BTA A;  3FH7 A;  1FPP A;  4CDM A;  3RKV A;  3QWP A;  4AP2 A;  4Y6C A;  1BI7 B;  1IYG A;  2AWI A;  3P1U A;  1LF8 A;  2ILR A;  3JXJ A;  3MKQ B;  3I4R B;  4O60 A;  3T8K A;  5EN5 D;  5FZQ A;  1OCC E;  1QNF A;  3HXF A;  3FU6 A;  2AXZ A;  4JVS A;  4K03 A;  2XZT G;  4F1S A;  3JQ0 A;  4HQD A;  4TRQ A;  4YND A;  3ASG A;  1O5M A;  4APF A;  5D2M C;  5JJT A;  5FIN A;  3J5Q B;  3RRN B;  4EBA G;  3SFY A;  3EHM A;  2YHE A;  2WXM A;  3T8M A;  3MV3 B;  1HO8 A;  1OCZ E;  2QYU A;  3FH5 A;  3PNL B;  3RJV A;  2VGX B;  2ZGD A;  5KBA A;  3CKB A;  3Q9N C;  3AAA C;  4EBA A;  3G2U A;  3B7S A;  2VSN A;  4O1O A;  3LS8 A;  4G8L A;  3Q15 A;  3CHQ A;  3S7D A;  1SVX A;  2E2E A;  3OXG A;  5AEN A;  3DSX A;  1UN8 A;  1EDU A;  5BXU A;  3DRA A;  4L2Y A;  1UW4 B;  5G04 C;  1V54 E;  1WM5 A;  3I3N A;  3SBT B;  4AEZ C;  1INZ A;  2YNQ A;  5BW8 C;  4I6E A;  2X3M A;  4EZL A;  3ESK A;  5ENT D;  2ZIS A;  3E4B A;  2QFC A;  4GTO A;  5KJK A;  1D8E A;  1RZ4 A;  2HR2 A;  4TUU A;  3MX3 A;  3SO8 A;  3TL5 A;  1FVH A;  1AP7 A;  4L23 A;  5ANR A;  4AY5 A;  1UOH A;  3DST A;  5FQ7 A;  3UM2 A;  4JHJ A;  4Q96 A;  1IHB A;  4WUY A;  1VDY A;  4OAV B;  4DK5 A;  1UN9 A;  4URK A;  3PS6 A;  2YHC A;  3T5V A;  3FU0 A;  2H6G A;  1GW6 A;  1ELK A;  5FIO A;  3KSL A;  4XE0 A;  2OCC E;  5ITZ F;  3SD5 A;  3SY2 A;  2VGE A;  3CGH A;  4WNG A;  4KVO A;  5EID A;  1Z3Y A;  1TR4 A;  3Q75 A;  5G05 C;  3MV2 B;  3UT4 A;  4F53 A;  3U66 A;  3NB2 A;  4UQX A;  1OXJ A;  3ISM C;  4GCO A;  4RSY A;  3V79 K;  5FZS A;  3OXF A;  4B93 B;  3EIQ C;  3UQ3 A;  4CEM A;  3FWV A;  3PEU B;  2LSV A;  4U63 A;  3PZ2 A;  3FTS A;  3ULE G;  5ENN A;  1E90 A;  2I9C A;  4ILI A;  1TNZ A;  4J8Y A;  3EHQ A;  4KMO A;  3FUM A;  4C48 B;  4GTP A;  1K1B A;  4WAF A;  3ZRH A;  4CGW A;  2J08 A;  1MX2 A;  3NQP A;  2WQ7 A;  3NOG D;  1TYQ G;  4I6J A;  1JWG A;  4M7C A;  4HB5 A;  4YDW A;  4ZHB A;  3ZHE B;  4EEC A;  4GZD A;  1TNB A;  3E30 A;  4J8F A;  5FT9 A;  2EIL E;  2P9U G;  4ANX A;  4CDN A;  2UY1 B;  3UKR G;  5EIL A;  2AW6 A;  3LY7 A;  4Z68 A;  2IY0 C;  2M63 A;  4B89 A;  4B94 A;  2E0I A;  4JEU A;  3RRU A;  4XEI G;  3L6A A;  3HVE A;  2RG8 A;  4HLE A;  3FFL A;  2A5U A;  4WNF A;  1Z3X A;  1A17 A;  4BY6 A;  4IRU A;  1PY1 A;  4YVQ C;  5AQA A;  5FTP A;  3ZYM A;  3ZYK A;  2LNI A;  2VTB B;  2X6F A;  2IFU A;  2P9K G;  3L54 A;  2XPY A;  3WXX A;  2KCK A;  2ZGG A;  3CK8 A;  4FLB A;  3RIB A;  4J6I A;  4AV7 A;  3LPZ A;  2FF4 A;  2AXU A;  3FHE A;  2JAB A;  4G8K A;  3LDZ A;  4H7Y A;  4JEH A;  4A55 A;  5A6C A;  1NFI E;  3MKR A;  4V3I A;  1HS6 A;  1TEZ A;  3LY9 A;  1W3B A;  3B7R L;  3AG2 E;  3ZU7 B;  4ANW A;  4GA1 A;  1H0A A;  2XEH A;  3MA5 A;  1XGW A;  2J09 A;  4TXQ A;  4WWO A;  4A3V A;  3G2V A;  3AG3 E;  3GW4 A;  3QWW A;  1N4R A; 
#chains in the Genus database with same CATH homology
 2EIK E;  1OCO E;  3AG1 E;  3ABM E;  3AG4 E;  1OCC E;  2Y69 E;  3AG2 E;  5IY5 E;  1V54 E;  3ABK E;  1V55 E;  3ABL E;  2ZXW E;  2EIN E;  2EIL E;  3ASN E;  5B1B E;  2EIJ E;  5B3S E;  5B1A E;  1OCZ E;  2DYS E;  3AG3 E;  3ASO E;  3X2Q E;  2OCC E;  3WG7 E;  1OCR E;  2DYR E;  2EIM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...