3AG3E

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag3E00
1OCCE 1OCRE 2ZXWE 3AG1E 2DYRE 3X2QE 3AG2E 2Y69E 2EIJE 2EILE 5IY5E 2OCCE 1V54E 3ASNE 5B1AE 2EINE 3ASOE 1OCZE 2EIKE 1OCOE 1V55E 3ABKE 5B1BE 3WG7E 3AG4E 2DYSE 2EIME 3AG3E 3ABME 3ABLE 5B3SE
chains in the Genus database with same CATH superfamily
2LAHA 4XIFA 3VTYA 3U9WA 1ZBPA 4J8YA 3ASHA 4CT4A 2GRLA 4AP2A 2MHKA 3W9FA 3VLDA 5C1DA 3FU5A 1N4PA 3B13A 3RU0A 4R7LA 4N3CA 5BT1A 1EPUA 2KZTA 3D9IA 2WMNA 3FH5A 4GTTA 4PS8A 3MKRA 4LSZE 3G2UA 2X3MA 5EKQD 4CT0A 2QZAA 3FY4A 4LNUD 4JL0A 4LRZA 3UIOC 3ZGQA 1MX4A 4JEUA 2CG2A 1NA3A 3B7UX 1N54A 4GZ5A 5CEAA 2DBAA 1N11A 2OCCE 2VGYA 4GTQA 3TJPA 5AJDA 1N4QA 3PZ1A 1B89A 2E0IA 4WWPA 4ILIA 3PVLA 2JEKA 3HG0D 4LNGA 3I3NA 2R17C 4WNDA 5BUZA 2AWIA 3DXKG 5BXOA 3ZYQA 3CVNA 3UMVA 2IF4A 3IBEA 1IQUA 4A63B 4EPZA 1A17A 3ZHEA 2XHEA 2GRRB 3SHFA 3TXMA 4D10C 4UQZA 5BV0A 3QOUA 2ZXWE 1FPPA 1K3ZD 4F1PA 2LSVA 1OUVA 4UI9J 3PH0C 4U8VD 3T8MA 4Q96A 4YDOA 1DCEA 3Q15A 4ME2A 4A55A 3SGHA 3AJIA 4DK5A 3APCA 3QB2A 2R2LA 5BV1A 1OWLA 4U07A 2WXIA 3JCKC 5BNWA 5JJTA 3D9PA 3BU8A 4UQXA 4GTRA 1YCSB 5FZRA 3U3WA 4AIFA 2ILRA 2CFUA 1BD8A 4G23A 1X81A 3UTMA 4DX2A 3TWQA 4K03A 1H6KA 4GYWA 3DEPA 4HBDA 3HXBA 1TNZA 4FADA 2J07A 1HF8A 4JW1A 2JABA 4XX5A 3DSSA 3SO8A 3JQ1A 3DWLG 2L9BA 4KMOA 2ETAA 2NSZA 4GU5A 3UKUG 5LOZA 2GRNB 3CVLA 3LY9A 3TWVA 2FEZA 5ANRA 3ABLE 5ITZF 3FU6A 3V31A 5LP0A 2X6JA 3BG1B 3KSLA 5CERB 3JUEA 4LG6A 3S7BA 4AY6A 4GZCA 1YA0A 5CMWA 4JB8P 2XQ0A 4BESA 2L0IA 3O4ZA 3FTZA 4C0EA 1E7VA 4EHMA 2JLBA 3ZYMA 2VTBB 2B6CA 1PC2A 1ZU2A 3E32A 3SFYA 4J0UA 3LYAA 4CDRA 3FU3A 1UN8A 2VGEA 2X6FA 4KZ0A 4UUCA 3HYMB 3UXGA 3PEVB 5T8IA 3PZ3A 2XZDG 3FTXA 1N95A 3MYVA 3SNXA 1MQSA 4HVBA 4G1TA 4TXRA 1DCQA 3Q7FA 3S2AA 3PUKA 3FUHA 3FUJA 5CCMA 2UY1B 3ZXPA 5FQ4A 4WNFA 4HS2A 4U8HA 1JUQA 2V4LA 4K5CA 2LXLA 2X38A 1HZ4A 4L2LA 3EHNA 2WXFA 4DLOA 5HS0A 2RFMA 2EIME 5T3RA 4GCOA 2P9IG 1ELKA 2QYJA 3UM3A 3CVXA 2RG8A 3OTNA 1LTXA 1Z3XA 4LNBA 4N3AA 4WNEA 4FULA 3L17A 4GPMA 4J8DA 3ABKE 3DSWA 3TAXA 3QKYA 3RIBA 5EDSA 4J7WA 3AG1E 3O48A 1KT1A 4U7EB 3JUIA 3D9KA 3QNKA 4LEUA 5JMND 5EYLA 3DSUA 2E2EA 3UM1A 5D66A 3AS4A 4GA1A 4GAAA 5AAOA 4GZ6A 3DSTA 3AAAC 3N71A 2FF4A 1MZCA 4BX8A 2VSXE 4I6EA 4BTBA 4QQIA 3CHQA 4TXPA 3CR3A 2WXPA 3B7RL 5KJMA 2H6FA 3FTWA 4TV3A 1MX2A 5KJLA 3ZU7B 4NIKA 1XNFA 2LUHA 3FUDA 4AOFA 4G25A 1N4SA 3PE4A 4FU3A 1DNPA 4M7CA 3SI5A 2Y1LE 4ACKA 1O1TA 1HXIA 2YINA 5AIJA 4G24A 1JCSA 1TNBA 1QQEA 5CECB 4XZ4A 2DIWA 1TR4A 5G04J 3ZIMA 3HIZA 4F7AA 3RRUA 5E76A 4DJAA 4HNAD 3ML8A 3SBSA 3ZUVB 1X5BA 3FUEA 3HXEA 3D3MA 1HX8A 2F37A 3ZYLA 2WXJA 4JZYA 5FQ8A 1DC2A 3T9KA 4JA9A 3NF1A 4BT8A 3BEEA 3RKVA 3CHPA 3CHMA 2NC9A 2ZISA 3TWRA 2L6BA 2XGOA 3FUIA 2WXRA 4RG9A 4JD2G 1OCZE 5AQ9A 5J08A 4K5BA 2IO2C 5D0QD 3U64A 3NQPA 4RVBA 1H19A 3L22A 4IYPA 1HH8A 3TWSA 3Q7AA 1OCRE 4HOTA 4EZJA 1N0RA 2P9KG 3SZ7A 5G04C 4HRLA 4N2QA 3CK9A 4L9PA 3T5VA 3MJWA 1U3CA 2WXMA 1LF8A 2P9LG 4CRWA 3EIJA 1XGWA 4U0ZA 3MGBA 2KCVA 4N3BA 3GZ2A 2H6HA 4MS6A 1UJJA 3CKCA 2A5EA 3K9IA 4HLEA 2P2CP 3ZRHA 3LKUA 4KVOA 5EX3A 3HVEA 4ILGA 2IOLA 2VQ2A 1FVHA 2OEVA 3EJNA 3LJ3A 3FULA 4U96D 1S64A 4L2YA 4N5QA 2P9NG 2VSNA 3HHMA 2IQCA 4FHJA 5LX8A 4DX5D 2LO6A 4TUUA 1RW2A 1YYHA 4JHJA 2V5QC 1YMPA 4A1GA 2XGMA 4I43A 2IFUA 4XE0A 5CHEE 2BEDA 1U3DA 4N39A 5ENOD 3ZVVA 4GB9A 4B0ZA 1HO8A 1E8ZA 3FFLA 3DSVA 4WAFA 3WG7E 4B8CB 2XENA 1HS6A 4CDNA 2Y0BG 3W9GA 1Y6IA 5KNHD 3PE3A 3NAWA 2WM9A 4BY6A 3ASOE 1TNUA 4U0SA 3Q49B 5EIDA 3L82A 1WDYA 1NFIE 1HG2A 3JXJA 4YVOA 1UG3A 5B3SE 5ENPD 4PH4B 4HB5A 2GW1A 2EIJE 4FLHA 2WQHA 5B1AE 4YNDA 2YNQA 4KXKB 3CVUA 4N2SA 2PQRA 2IEJA 4JEHA 1Y8MA 1G3NB 3V79K 3ZHEB 3Q47B 3Q73A 3PNLB 5CRUA 4BTAA 3P2BA 1HE8A 1IYGA 1N52A 4HI9A 3ESLA 2R05A 1N4RA 3FUNA 4GA2A 4ANUA 1NZNA 4PS7A 3PZ2A 2CHXA 2YHCA 2CG3A 3DPDA 3I4RB 4I6JA 1MX6A 3IEGA 1LD7A 1H6OA 4URKA 4G8LA 5AQ7A 2DCPA 3D9MA 4JC8A 2ZGDA 5G2NA 1TNYA 3NB2A 3TL5A 4I1OB 2MRIA 2WXGA 3Q4AB 2GROB 3NZSA 1NL4A 1KZPA 2H6IA 2KCLA 2PM6A 2WXKA 3LVRE 4G8KA 4U04A 3LCAA 4PS3A 1TJCA 2XPIA 1FT1A 4O1PA 3Q75A 3IKOB 5KBAA 5BPPA 4J8EA 5CRVA 4F1SA 4EECA 1O1RA 3FDHA 2OEWA 1TN8A 3UM0A 4DI3A 3T5XA 1Z3YA 4GYYA 2XS1A 2J9QA 2ZU6B 3ZFWA 4KZCA 5JHAA 5AQBA 4JPSA 3EU9A 3UT8A 2VJ8A 3DPYA 2PNNA 3PNTB 1DVPA 1TN7A 5ENRD 3QK0A 2BTDA 2X6HA 1OWNA 1D8EA 3GZSA 2C2LA 3ZPJA 4B93B 2IJGX 2J49A 3AG2E 4UI9C 5KJKA 2V8SE 1V54E 2QYUA 3HRAA 3DBSA 3ZXSA 3ASGA 3DEOA 1WAO1 5HI7A 3AS8A 4XKBA 4ACLA 2I1JA 5ENTD 4E6HA 4ILHB 4HORA 3CQCB 1QBQA 2OV8A 5AENA 2VSOE 5H7PA 3LXUX 1H0AA 2J8SD 3J5PA 3LPZA 4J8SA 4ATGA 3HXDA 3CV0A 4H7XA 4O1OA 3G2VA 2XCCA 1BI7B 5E75A 4BSXA 5FT9A 1K1BA 3ZN3A 3ULQA 1W3BA 4HFGA 5A23A 2FO1E 4RG6A 4JHKA 3EHRA 4JXTA 1SQMA 5CCLA 4O60A 3ENEA 2BKKB 5B1BE 4FA6A 2KXPC 1H2UA 5KJNA 4DLQA 3R9MA 3DXMG 5FZSA 4BX9A 4OYSA 3C72A 3S7DA 3QWWA 4AXHA 3Q79A 1K1AA 4Z68A 3IHVA 1ZB1A 4DX7D 2F0YA 2XPYA 3LEWA 1PAQA 4I2WA 4NACA 4APFA 3UKRG 2P9PG 2C0MA 4GMLA 2VTBA 3GW4A 1IQRA 4YDYA 1TYQG 4J6IA 4LCTA 4XKCA 3CQGB 3QDNA 3C98A 3D9LA 3FUFA 2IOSA 3OAWA 2DYSE 4LERA 4IRUA 3UI2A 3UT7A 3PZ4A 2WXNA 3CGHA 3FTUA 3FTVA 2HE0A 2PQNA 2QY7A 2GRMA 2X6IA 1EDUA 5A6CA 2HYZA 1V55E 5FZQA 1L5JA 3QWVA 3QAQA 3CVPA 2MOWA 4RQIA 4OVUA 4ZHBA 1H6PA 3NZUA 1E7UA 2Y69E 3RRNB 4L1BA 4EZKA 2KATA 4F3VA 2OVFA 2CHWA 2UWJG 4DUIA 4F53A 3LS8A 2RD0A 4ATZD 3CVQA 4BWRA 3MKQB 3B7BA 3MV3B 3PREA 2L0TB 4I9EA 4HOUA 3SY2A 3AU4A 1LD8A 1KPSB 4V3IA 3APFA 4C9BB 3TGOA 4WWNA 4FJZA 5JHBA 4GMRA 3TWUA 4UWHA 4ANVA 5KNGA 3IV0A 3RJVA 1BI8B 2XZTG 3L16A 1MJ0A 5T4YA 5FJYA 3L54A 2DYRE 1D9SA 1UOHA 2R5SA 2CHZA 2EQXA 3ZEFA 3CK8A 4UQYA 2GRQB 4DPRA 4KYOB 3RAUA 4H7YA 3LVQE 4O6FA 4P29A 4FHKA 1QNFA 4HI8A 3V30A 1BU9A 2OOEA 2RKKA 3FH7A 3E33A 3IHYA 3E37A 3FH8A 3UUXA 4APOA 2QFCA 3HVEB 4EBAG 3C3OA 4BERA 4L7TA 2V4HC 2PZIA 2NYJA 1NP7A 4TUMA 1N0QA 5A7DB 3CKBA 3VTXA 4A1SA 1VDYA 2BF0X 5EX0A 1JCRA 2ONDA 3LJNA 5LCWJ 1QZ2A 1SW6A 1JWGA 2A5UA 3FP3A 4I9CA 3SD5A 3CVWA 2VSYA 1SZAA 3KD7A 3RSEG 3DRAA 3PDNA 1Z5SC 3E4BA 5J90A 3RRMB 2VGXA 4CZ2D 2XCBA 4AEZC 1OWMA 2P58C 1K8KG 1IHGA 1D8DA 1IXVA 4FP7A 2H6GA 3ZNGA 4C48B 3I5PA 1OXJA 3V2OA 1FVFA 4TRQA 3I4GA 2LSUA 3FEYA 4MKTA 4HOQA 1BPOA 2DWZA 4K0RA 4KBQA 4KVMA 4KT6B 4U0UA 1KZOA 2XRYA 2KZTB 5ENSD 4DI4A 4N5CA 2XRZA 2QC9A 2WMOA 5ENNA 3UT4A 1JWFA 3ZYKA 4AVXA 5LCWC 3J5QB 1S63A 4MRUA 4RSYA 2AVPA 3AG3E 3FUMA 4ANXA 4B94A 2Y4TA 4A3TA 3U4TA 4EBAA 4GMJA 1SA5A 1IKND 2KBXA 3BUAA 4C0MA 2PM7A 2KC7A 4HRMB 3PUJA 4LUNU 4DX1A 2EIKE 3PS6A 1OWPA 3ONKA 5G05J 3FEXA 3ASNE 3PZDA 2I9CA 3CVYA 3L13A 5BXUA 3D9NA 1AP7A 2DVWA 3L6AA 5EILA 4EZLA 4CDMA 4U63A 3R9AB 3URZA 3C3RA 1OCCE 3FU0A 2WXHA 2J4BA 3L08A 1N94A 4BSZB 2I2OA 2AXUA 1UN9A 5JA4D 4PDXA 3JYSA 4DRXE 1Q2ZA 4AM9A 2IY0C 5DBKA 1E8XA 4XEIG 5FTPA 3LDZA 3MCXA 2LAIA 1HG5A 4I17A 3ISMC 4HLLA 1N9AA 2WXLA 4JHRA 3T8KA 5G05C 5AARA 3LY7A 3BQOA 4MLPA 4HQDA 1IHBA 4WNGA 5HKPA 1S0PA 2ZGGA 5AJLA 1MYOA 3CSTA 1MHQA 4UWLA 5JJ7A 3D9OA 2XEEA 4I1MA 4JA7A 4CGVA 3OXGA 3CHRA 4Q94A 3ML9A 1E8WA 3CEQA 3TWWA 3KAEA 4I2ZA 4GTSA 3WXXA 3BG0B 1ELWA 2EILE 4BT9A 3ASDA 3RO3A 3FHEA 4GTPA 3SBTB 3CHSA 4M3OA 2I1KA 4ZFHA 3L9TA 3UIPC 1E96B 2ETBA 4NURA 3CIAA 5CMYA 3ABME 5EYPF 4NQ0A 3CHOA 3CLJA 3EU5A 3X2QE 1P5QA 3DSXA 4AY5A 3B7SA 2GGFA 3HXCA 4HRNA 3GZ1A 4F6RD 1KLXA 2I6HA 1FT2A 4OAUC 3SF4A 5FIOA 4FLBA 2FBNA 3EUVA 2WXQA 1RZ4A 3AU5A 5DIZA 3HDXA 3RK6A 3MA5A 1HFAA 5D0OD 3UX4A 2XS8A 4X8QA 3CK7A 4IN3B 1BLXB 4HOSA 3UM2A 3NOGD 4IULA 2WB2A 1EF1C 1PY1A 4JVSA 5IY5E 2AXZA 2R59A 3V2XA 2R03A 3QARA 3R7QA 1OY3D 3ZW3A 3KSQA 4AJWA 1AWCB 2LXMA 4CEMA 1WG0A 1H2VC 2J09A 1S70B 4GCNA 2M63A 3TXNA 4UWKA 3SFZA 3IXEA 5C2YA 3C3QA 5HRYA 2MYOA 5AYWD 4UI9K 3FTSA 5LFAA 3MZLB 3QC1A 4NRHB 2XEHA 3G2TA 2AJAA 1OCOE 3SQVA 3UQ3A 3S7FA 2V0PA 4G26A 1U2VG 3LY8A 2J4DA 3PRZA 5D2MC 3ESKA 2F8XK 4WUYA 5AN8A 4RLYA 1UW4B 2XPZA 2P9SG 2Y4UA 4GYOA 3G2SA 2IO3C 2XGSA 1TNOA 5FINA 1O1SA 1WM5A 2IU1A 2OVBA 2CFZA 4E85A 4GTOA 3VLFA 1OWOA 2KM4A 2DZOA 4OVVA 3SFXA 2XEVA 1NA0A 3FTYA 4U95D 1FCHA 3D9JA 3CVVA 5FQ7A 5EN5D 3EHQA 4BETA 4GTVA 5ARGA 2UY1A 1SA4A 3S7JA 5CEDB 5CBNA 3OXLA 3UPVA 1KT0A 5BW8C 5HQ8A 3ULYA 2DZNA 1QYMA 2P9UG 4G11A 2WVIA 3F6QA 2WQ6A 3EDTB 1TN6A 1SZ9A 2X6KA 2AXVA 4W9RA 4Y6WA 2C0LA 2LNIA 1WY6A 4Y6CA 2HO1A 4I1AA 4FC8A 1JPLA 5KWDA 2WPVA 3TG5A 4ANWA 3NOCD 4BEPA 4OAVB 1E8YA 2HM8A 3ULEG 5ENQD 3C5RA 2FI7A 1ELRA 1GW6A 2ZIRA 2F8YA 1O5MA 2HR2A 3ASFA 1INZA 5FQ6A 3Q9NC 4B89A 1E90A 1EYHA 3RO2A 3R7RA 4K5AB 3FUKA 4Q69A 3P1UA 3KEZA 4J8FA 1A5EA 2Y3AA 1Z6TA 3TWXA 4YDEA 4HXIA 3VLEA 4L23A 4MBGA 3MEKA 3KEAA 3TG4A 2VGXB 3D9HA 3Q5MA 4ABNA 2ETCA 2FULA 3APDA 4B8AA 4CYMD 3QWPA 3AS5A 3E34A 3TWTA 3Q78A 4DX6D 3MKQA 3JQ0A 3CSFA 4EQFA 4YDWA 2KCKA 3GYZA 4G2VA 2B0OE 5JJ6A 3HXFA 3ZKJA 4GZDA 3JXIA 4BFRA 5FWQA 2AW6A 3EIQC 4XI9A 5ARFA 4CGWA 5CBOA 3B95A 3Q9UC 5KCMA 1NI1A 3AG4E 2NXPA 4WWOA 1H2TC 2YQ8A 3OXFA 3MV2B 5EIBE 2GRPB 3U66A 1HU3A 2VYIA 1TJFA 3FWVA 2V5FA 4TXQA 4GTMA 4CCAA 2R02A 2IONA 5G55A 3G2WA 4FJYA 3B7TA 2YHEA 4AV7A 4UWGA 2WQ7A 3PEUB 5AQAA 1SVXA 4QFVA 2J08A 4UWFA 1OT8A 3ONLA 3UINC 1JCQA 3MX3A 3KS2A 2BUGA 4YVQC 3NBNB 4U8YD 2Q7FA 2RFAA 2BKGA 3QJZA 4I6GA 4GPKA 5ANLA 3E30A 1UJKA 2EINE 1TEZA 4GZ3A 3EHMA 4GA0A 4PUCA 2A4ZA 2L6JA 5M72A 2PL2A 2FO7A 4A3VA 4XI0A 2WXOA
chains in the Genus database with same CATH topology
1OCCE 1OCRE 2ZXWE 3AG1E 2DYRE 3X2QE 3AG2E 2Y69E 2EIJE 2EILE 5IY5E 2OCCE 1V54E 3ASNE 5B1AE 2EINE 3ASOE 1OCZE 2EIKE 1OCOE 1V55E 3ABKE 5B1BE 3WG7E 3AG4E 2DYSE 2EIME 3AG3E 3ABME 3ABLE 5B3SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC E;  1OCR E;  2ZXW E;  3AG1 E;  2DYR E;  3X2Q E;  3AG2 E;  2Y69 E;  2EIJ E;  2EIL E;  5IY5 E;  2OCC E;  1V54 E;  3ASN E;  5B1A E;  2EIN E;  3ASO E;  1OCZ E;  2EIK E;  1OCO E;  1V55 E;  3ABK E;  5B1B E;  3WG7 E;  3AG4 E;  2DYS E;  2EIM E;  3AG3 E;  3ABM E;  3ABL E;  5B3S E; 
#chains in the Genus database with same CATH topology
 2LAH A;  4XIF A;  3VTY A;  3U9W A;  1ZBP A;  4J8Y A;  3ASH A;  4CT4 A;  2GRL A;  4AP2 A;  2MHK A;  3W9F A;  3VLD A;  5C1D A;  3FU5 A;  1N4P A;  3B13 A;  3RU0 A;  4R7L A;  4N3C A;  5BT1 A;  1EPU A;  2KZT A;  3D9I A;  2WMN A;  3FH5 A;  4GTT A;  4PS8 A;  3MKR A;  4LSZ E;  3G2U A;  2X3M A;  5EKQ D;  4CT0 A;  2QZA A;  3FY4 A;  4LNU D;  4JL0 A;  4LRZ A;  3UIO C;  3ZGQ A;  1MX4 A;  4JEU A;  2CG2 A;  1NA3 A;  3B7U X;  1N54 A;  4GZ5 A;  5CEA A;  2DBA A;  1N11 A;  2OCC E;  2VGY A;  4GTQ A;  3TJP A;  5AJD A;  1N4Q A;  3PZ1 A;  1B89 A;  2E0I A;  4WWP A;  4ILI A;  3PVL A;  2JEK A;  3HG0 D;  4LNG A;  3I3N A;  2R17 C;  4WND A;  5BUZ A;  2AWI A;  3DXK G;  5BXO A;  3ZYQ A;  3CVN A;  3UMV A;  2IF4 A;  3IBE A;  1IQU A;  4A63 B;  4EPZ A;  1A17 A;  3ZHE A;  2XHE A;  2GRR B;  3SHF A;  3TXM A;  4D10 C;  4UQZ A;  5BV0 A;  3QOU A;  2ZXW E;  1FPP A;  1K3Z D;  4F1P A;  2LSV A;  1OUV A;  4UI9 J;  3PH0 C;  4U8V D;  3T8M A;  4Q96 A;  4YDO A;  1DCE A;  3Q15 A;  4ME2 A;  4A55 A;  3SGH A;  3AJI A;  4DK5 A;  3APC A;  3QB2 A;  2R2L A;  5BV1 A;  1OWL A;  4U07 A;  2WXI A;  3JCK C;  5BNW A;  5JJT A;  3D9P A;  3BU8 A;  4UQX A;  4GTR A;  1YCS B;  5FZR A;  3U3W A;  4AIF A;  2ILR A;  2CFU A;  1BD8 A;  4G23 A;  1X81 A;  3UTM A;  4DX2 A;  3TWQ A;  4K03 A;  1H6K A;  4GYW A;  3DEP A;  4HBD A;  3HXB A;  1TNZ A;  4FAD A;  2J07 A;  1HF8 A;  4JW1 A;  2JAB A;  4XX5 A;  3DSS A;  3SO8 A;  3JQ1 A;  3DWL G;  2L9B A;  4KMO A;  2ETA A;  2NSZ A;  4GU5 A;  3UKU G;  5LOZ A;  2GRN B;  3CVL A;  3LY9 A;  3TWV A;  2FEZ A;  5ANR A;  3ABL E;  5ITZ F;  3FU6 A;  3V31 A;  5LP0 A;  2X6J A;  3BG1 B;  3KSL A;  5CER B;  3JUE A;  4LG6 A;  3S7B A;  4AY6 A;  4GZC A;  1YA0 A;  5CMW A;  4JB8 P;  2XQ0 A;  4BES A;  2L0I A;  3O4Z A;  3FTZ A;  4C0E A;  1E7V A;  4EHM A;  2JLB A;  3ZYM A;  2VTB B;  2B6C A;  1PC2 A;  1ZU2 A;  3E32 A;  3SFY A;  4J0U A;  3LYA A;  4CDR A;  3FU3 A;  1UN8 A;  2VGE A;  2X6F A;  4KZ0 A;  4UUC A;  3HYM B;  3UXG A;  3PEV B;  5T8I A;  3PZ3 A;  2XZD G;  3FTX A;  1N95 A;  3MYV A;  3SNX A;  1MQS A;  4HVB A;  4G1T A;  4TXR A;  1DCQ A;  3Q7F A;  3S2A A;  3PUK A;  3FUH A;  3FUJ A;  5CCM A;  2UY1 B;  3ZXP A;  5FQ4 A;  4WNF A;  4HS2 A;  4U8H A;  1JUQ A;  2V4L A;  4K5C A;  2LXL A;  2X38 A;  1HZ4 A;  4L2L A;  3EHN A;  2WXF A;  4DLO A;  5HS0 A;  2RFM A;  2EIM E;  5T3R A;  4GCO A;  2P9I G;  1ELK A;  2QYJ A;  3UM3 A;  3CVX A;  2RG8 A;  3OTN A;  1LTX A;  1Z3X A;  4LNB A;  4N3A A;  4WNE A;  4FUL A;  3L17 A;  4GPM A;  4J8D A;  3ABK E;  3DSW A;  3TAX A;  3QKY A;  3RIB A;  5EDS A;  4J7W A;  3AG1 E;  3O48 A;  1KT1 A;  4U7E B;  3JUI A;  3D9K A;  3QNK A;  4LEU A;  5JMN D;  5EYL A;  3DSU A;  2E2E A;  3UM1 A;  5D66 A;  3AS4 A;  4GA1 A;  4GAA A;  5AAO A;  4GZ6 A;  3DST A;  3AAA C;  3N71 A;  2FF4 A;  1MZC A;  4BX8 A;  2VSX E;  4I6E A;  4BTB A;  4QQI A;  3CHQ A;  4TXP A;  3CR3 A;  2WXP A;  3B7R L;  5KJM A;  2H6F A;  3FTW A;  4TV3 A;  1MX2 A;  5KJL A;  3ZU7 B;  4NIK A;  1XNF A;  2LUH A;  3FUD A;  4AOF A;  4G25 A;  1N4S A;  3PE4 A;  4FU3 A;  1DNP A;  4M7C A;  3SI5 A;  2Y1L E;  4ACK A;  1O1T A;  1HXI A;  2YIN A;  5AIJ A;  4G24 A;  1JCS A;  1TNB A;  1QQE A;  5CEC B;  4XZ4 A;  2DIW A;  1TR4 A;  5G04 J;  3ZIM A;  3HIZ A;  4F7A A;  3RRU A;  5E76 A;  4DJA A;  4HNA D;  3ML8 A;  3SBS A;  3ZUV B;  1X5B A;  3FUE A;  3HXE A;  3D3M A;  1HX8 A;  2F37 A;  3ZYL A;  2WXJ A;  4JZY A;  5FQ8 A;  1DC2 A;  3T9K A;  4JA9 A;  3NF1 A;  4BT8 A;  3BEE A;  3RKV A;  3CHP A;  3CHM A;  2NC9 A;  2ZIS A;  3TWR A;  2L6B A;  2XGO A;  3FUI A;  2WXR A;  4RG9 A;  4JD2 G;  1OCZ E;  5AQ9 A;  5J08 A;  4K5B A;  2IO2 C;  5D0Q D;  3U64 A;  3NQP A;  4RVB A;  1H19 A;  3L22 A;  4IYP A;  1HH8 A;  3TWS A;  3Q7A A;  1OCR E;  4HOT A;  4EZJ A;  1N0R A;  2P9K G;  3SZ7 A;  5G04 C;  4HRL A;  4N2Q A;  3CK9 A;  4L9P A;  3T5V A;  3MJW A;  1U3C A;  2WXM A;  1LF8 A;  2P9L G;  4CRW A;  3EIJ A;  1XGW A;  4U0Z A;  3MGB A;  2KCV A;  4N3B A;  3GZ2 A;  2H6H A;  4MS6 A;  1UJJ A;  3CKC A;  2A5E A;  3K9I A;  4HLE A;  2P2C P;  3ZRH A;  3LKU A;  4KVO A;  5EX3 A;  3HVE A;  4ILG A;  2IOL A;  2VQ2 A;  1FVH A;  2OEV A;  3EJN A;  3LJ3 A;  3FUL A;  4U96 D;  1S64 A;  4L2Y A;  4N5Q A;  2P9N G;  2VSN A;  3HHM A;  2IQC A;  4FHJ A;  5LX8 A;  4DX5 D;  2LO6 A;  4TUU A;  1RW2 A;  1YYH A;  4JHJ A;  2V5Q C;  1YMP A;  4A1G A;  2XGM A;  4I43 A;  2IFU A;  4XE0 A;  5CHE E;  2BED A;  1U3D A;  4N39 A;  5ENO D;  3ZVV A;  4GB9 A;  4B0Z A;  1HO8 A;  1E8Z A;  3FFL A;  3DSV A;  4WAF A;  3WG7 E;  4B8C B;  2XEN A;  1HS6 A;  4CDN A;  2Y0B G;  3W9G A;  1Y6I A;  5KNH D;  3PE3 A;  3NAW A;  2WM9 A;  4BY6 A;  3ASO E;  1TNU A;  4U0S A;  3Q49 B;  5EID A;  3L82 A;  1WDY A;  1NFI E;  1HG2 A;  3JXJ A;  4YVO A;  1UG3 A;  5B3S E;  5ENP D;  4PH4 B;  4HB5 A;  2GW1 A;  2EIJ E;  4FLH A;  2WQH A;  5B1A E;  4YND A;  2YNQ A;  4KXK B;  3CVU A;  4N2S A;  2PQR A;  2IEJ A;  4JEH A;  1Y8M A;  1G3N B;  3V79 K;  3ZHE B;  3Q47 B;  3Q73 A;  3PNL B;  5CRU A;  4BTA A;  3P2B A;  1HE8 A;  1IYG A;  1N52 A;  4HI9 A;  3ESL A;  2R05 A;  1N4R A;  3FUN A;  4GA2 A;  4ANU A;  1NZN A;  4PS7 A;  3PZ2 A;  2CHX A;  2YHC A;  2CG3 A;  3DPD A;  3I4R B;  4I6J A;  1MX6 A;  3IEG A;  1LD7 A;  1H6O A;  4URK A;  4G8L A;  5AQ7 A;  2DCP A;  3D9M A;  4JC8 A;  2ZGD A;  5G2N A;  1TNY A;  3NB2 A;  3TL5 A;  4I1O B;  2MRI A;  2WXG A;  3Q4A B;  2GRO B;  3NZS A;  1NL4 A;  1KZP A;  2H6I A;  2KCL A;  2PM6 A;  2WXK A;  3LVR E;  4G8K A;  4U04 A;  3LCA A;  4PS3 A;  1TJC A;  2XPI A;  1FT1 A;  4O1P A;  3Q75 A;  3IKO B;  5KBA A;  5BPP A;  4J8E A;  5CRV A;  4F1S A;  4EEC A;  1O1R A;  3FDH A;  2OEW A;  1TN8 A;  3UM0 A;  4DI3 A;  3T5X A;  1Z3Y A;  4GYY A;  2XS1 A;  2J9Q A;  2ZU6 B;  3ZFW A;  4KZC A;  5JHA A;  5AQB A;  4JPS A;  3EU9 A;  3UT8 A;  2VJ8 A;  3DPY A;  2PNN A;  3PNT B;  1DVP A;  1TN7 A;  5ENR D;  3QK0 A;  2BTD A;  2X6H A;  1OWN A;  1D8E A;  3GZS A;  2C2L A;  3ZPJ A;  4B93 B;  2IJG X;  2J49 A;  3AG2 E;  4UI9 C;  5KJK A;  2V8S E;  1V54 E;  2QYU A;  3HRA A;  3DBS A;  3ZXS A;  3ASG A;  3DEO A;  1WAO 1;  5HI7 A;  3AS8 A;  4XKB A;  4ACL A;  2I1J A;  5ENT D;  4E6H A;  4ILH B;  4HOR A;  3CQC B;  1QBQ A;  2OV8 A;  5AEN A;  2VSO E;  5H7P A;  3LXU X;  1H0A A;  2J8S D;  3J5P A;  3LPZ A;  4J8S A;  4ATG A;  3HXD A;  3CV0 A;  4H7X A;  4O1O A;  3G2V A;  2XCC A;  1BI7 B;  5E75 A;  4BSX A;  5FT9 A;  1K1B A;  3ZN3 A;  3ULQ A;  1W3B A;  4HFG A;  5A23 A;  2FO1 E;  4RG6 A;  4JHK A;  3EHR A;  4JXT A;  1SQM A;  5CCL A;  4O60 A;  3ENE A;  2BKK B;  5B1B E;  4FA6 A;  2KXP C;  1H2U A;  5KJN A;  4DLQ A;  3R9M A;  3DXM G;  5FZS A;  4BX9 A;  4OYS A;  3C72 A;  3S7D A;  3QWW A;  4AXH A;  3Q79 A;  1K1A A;  4Z68 A;  3IHV A;  1ZB1 A;  4DX7 D;  2F0Y A;  2XPY A;  3LEW A;  1PAQ A;  4I2W A;  4NAC A;  4APF A;  3UKR G;  2P9P G;  2C0M A;  4GML A;  2VTB A;  3GW4 A;  1IQR A;  4YDY A;  1TYQ G;  4J6I A;  4LCT A;  4XKC A;  3CQG B;  3QDN A;  3C98 A;  3D9L A;  3FUF A;  2IOS A;  3OAW A;  2DYS E;  4LER A;  4IRU A;  3UI2 A;  3UT7 A;  3PZ4 A;  2WXN A;  3CGH A;  3FTU A;  3FTV A;  2HE0 A;  2PQN A;  2QY7 A;  2GRM A;  2X6I A;  1EDU A;  5A6C A;  2HYZ A;  1V55 E;  5FZQ A;  1L5J A;  3QWV A;  3QAQ A;  3CVP A;  2MOW A;  4RQI A;  4OVU A;  4ZHB A;  1H6P A;  3NZU A;  1E7U A;  2Y69 E;  3RRN B;  4L1B A;  4EZK A;  2KAT A;  4F3V A;  2OVF A;  2CHW A;  2UWJ G;  4DUI A;  4F53 A;  3LS8 A;  2RD0 A;  4ATZ D;  3CVQ A;  4BWR A;  3MKQ B;  3B7B A;  3MV3 B;  3PRE A;  2L0T B;  4I9E A;  4HOU A;  3SY2 A;  3AU4 A;  1LD8 A;  1KPS B;  4V3I A;  3APF A;  4C9B B;  3TGO A;  4WWN A;  4FJZ A;  5JHB A;  4GMR A;  3TWU A;  4UWH A;  4ANV A;  5KNG A;  3IV0 A;  3RJV A;  1BI8 B;  2XZT G;  3L16 A;  1MJ0 A;  5T4Y A;  5FJY A;  3L54 A;  2DYR E;  1D9S A;  1UOH A;  2R5S A;  2CHZ A;  2EQX A;  3ZEF A;  3CK8 A;  4UQY A;  2GRQ B;  4DPR A;  4KYO B;  3RAU A;  4H7Y A;  3LVQ E;  4O6F A;  4P29 A;  4FHK A;  1QNF A;  4HI8 A;  3V30 A;  1BU9 A;  2OOE A;  2RKK A;  3FH7 A;  3E33 A;  3IHY A;  3E37 A;  3FH8 A;  3UUX A;  4APO A;  2QFC A;  3HVE B;  4EBA G;  3C3O A;  4BER A;  4L7T A;  2V4H C;  2PZI A;  2NYJ A;  1NP7 A;  4TUM A;  1N0Q A;  5A7D B;  3CKB A;  3VTX A;  4A1S A;  1VDY A;  2BF0 X;  5EX0 A;  1JCR A;  2OND A;  3LJN A;  5LCW J;  1QZ2 A;  1SW6 A;  1JWG A;  2A5U A;  3FP3 A;  4I9C A;  3SD5 A;  3CVW A;  2VSY A;  1SZA A;  3KD7 A;  3RSE G;  3DRA A;  3PDN A;  1Z5S C;  3E4B A;  5J90 A;  3RRM B;  2VGX A;  4CZ2 D;  2XCB A;  4AEZ C;  1OWM A;  2P58 C;  1K8K G;  1IHG A;  1D8D A;  1IXV A;  4FP7 A;  2H6G A;  3ZNG A;  4C48 B;  3I5P A;  1OXJ A;  3V2O A;  1FVF A;  4TRQ A;  3I4G A;  2LSU A;  3FEY A;  4MKT A;  4HOQ A;  1BPO A;  2DWZ A;  4K0R A;  4KBQ A;  4KVM A;  4KT6 B;  4U0U A;  1KZO A;  2XRY A;  2KZT B;  5ENS D;  4DI4 A;  4N5C A;  2XRZ A;  2QC9 A;  2WMO A;  5ENN A;  3UT4 A;  1JWF A;  3ZYK A;  4AVX A;  5LCW C;  3J5Q B;  1S63 A;  4MRU A;  4RSY A;  2AVP A;  3AG3 E;  3FUM A;  4ANX A;  4B94 A;  2Y4T A;  4A3T A;  3U4T A;  4EBA A;  4GMJ A;  1SA5 A;  1IKN D;  2KBX A;  3BUA A;  4C0M A;  2PM7 A;  2KC7 A;  4HRM B;  3PUJ A;  4LUN U;  4DX1 A;  2EIK E;  3PS6 A;  1OWP A;  3ONK A;  5G05 J;  3FEX A;  3ASN E;  3PZD A;  2I9C A;  3CVY A;  3L13 A;  5BXU A;  3D9N A;  1AP7 A;  2DVW A;  3L6A A;  5EIL A;  4EZL A;  4CDM A;  4U63 A;  3R9A B;  3URZ A;  3C3R A;  1OCC E;  3FU0 A;  2WXH A;  2J4B A;  3L08 A;  1N94 A;  4BSZ B;  2I2O A;  2AXU A;  1UN9 A;  5JA4 D;  4PDX A;  3JYS A;  4DRX E;  1Q2Z A;  4AM9 A;  2IY0 C;  5DBK A;  1E8X A;  4XEI G;  5FTP A;  3LDZ A;  3MCX A;  2LAI A;  1HG5 A;  4I17 A;  3ISM C;  4HLL A;  1N9A A;  2WXL A;  4JHR A;  3T8K A;  5G05 C;  5AAR A;  3LY7 A;  3BQO A;  4MLP A;  4HQD A;  1IHB A;  4WNG A;  5HKP A;  1S0P A;  2ZGG A;  5AJL A;  1MYO A;  3CST A;  1MHQ A;  4UWL A;  5JJ7 A;  3D9O A;  2XEE A;  4I1M A;  4JA7 A;  4CGV A;  3OXG A;  3CHR A;  4Q94 A;  3ML9 A;  1E8W A;  3CEQ A;  3TWW A;  3KAE A;  4I2Z A;  4GTS A;  3WXX A;  3BG0 B;  1ELW A;  2EIL E;  4BT9 A;  3ASD A;  3RO3 A;  3FHE A;  4GTP A;  3SBT B;  3CHS A;  4M3O A;  2I1K A;  4ZFH A;  3L9T A;  3UIP C;  1E96 B;  2ETB A;  4NUR A;  3CIA A;  5CMY A;  3ABM E;  5EYP F;  4NQ0 A;  3CHO A;  3CLJ A;  3EU5 A;  3X2Q E;  1P5Q A;  3DSX A;  4AY5 A;  3B7S A;  2GGF A;  3HXC A;  4HRN A;  3GZ1 A;  4F6R D;  1KLX A;  2I6H A;  1FT2 A;  4OAU C;  3SF4 A;  5FIO A;  4FLB A;  2FBN A;  3EUV A;  2WXQ A;  1RZ4 A;  3AU5 A;  5DIZ A;  3HDX A;  3RK6 A;  3MA5 A;  1HFA A;  5D0O D;  3UX4 A;  2XS8 A;  4X8Q A;  3CK7 A;  4IN3 B;  1BLX B;  4HOS A;  3UM2 A;  3NOG D;  4IUL A;  2WB2 A;  1EF1 C;  1PY1 A;  4JVS A;  5IY5 E;  2AXZ A;  2R59 A;  3V2X A;  2R03 A;  3QAR A;  3R7Q A;  1OY3 D;  3ZW3 A;  3KSQ A;  4AJW A;  1AWC B;  2LXM A;  4CEM A;  1WG0 A;  1H2V C;  2J09 A;  1S70 B;  4GCN A;  2M63 A;  3TXN A;  4UWK A;  3SFZ A;  3IXE A;  5C2Y A;  3C3Q A;  5HRY A;  2MYO A;  5AYW D;  4UI9 K;  3FTS A;  5LFA A;  3MZL B;  3QC1 A;  4NRH B;  2XEH A;  3G2T A;  2AJA A;  1OCO E;  3SQV A;  3UQ3 A;  3S7F A;  2V0P A;  4G26 A;  1U2V G;  3LY8 A;  2J4D A;  3PRZ A;  5D2M C;  3ESK A;  2F8X K;  4WUY A;  5AN8 A;  4RLY A;  1UW4 B;  2XPZ A;  2P9S G;  2Y4U A;  4GYO A;  3G2S A;  2IO3 C;  2XGS A;  1TNO A;  5FIN A;  1O1S A;  1WM5 A;  2IU1 A;  2OVB A;  2CFZ A;  4E85 A;  4GTO A;  3VLF A;  1OWO A;  2KM4 A;  2DZO A;  4OVV A;  3SFX A;  2XEV A;  1NA0 A;  3FTY A;  4U95 D;  1FCH A;  3D9J A;  3CVV A;  5FQ7 A;  5EN5 D;  3EHQ A;  4BET A;  4GTV A;  5ARG A;  2UY1 A;  1SA4 A;  3S7J A;  5CED B;  5CBN A;  3OXL A;  3UPV A;  1KT0 A;  5BW8 C;  5HQ8 A;  3ULY A;  2DZN A;  1QYM A;  2P9U G;  4G11 A;  2WVI A;  3F6Q A;  2WQ6 A;  3EDT B;  1TN6 A;  1SZ9 A;  2X6K A;  2AXV A;  4W9R A;  4Y6W A;  2C0L A;  2LNI A;  1WY6 A;  4Y6C A;  2HO1 A;  4I1A A;  4FC8 A;  1JPL A;  5KWD A;  2WPV A;  3TG5 A;  4ANW A;  3NOC D;  4BEP A;  4OAV B;  1E8Y A;  2HM8 A;  3ULE G;  5ENQ D;  3C5R A;  2FI7 A;  1ELR A;  1GW6 A;  2ZIR A;  2F8Y A;  1O5M A;  2HR2 A;  3ASF A;  1INZ A;  5FQ6 A;  3Q9N C;  4B89 A;  1E90 A;  1EYH A;  3RO2 A;  3R7R A;  4K5A B;  3FUK A;  4Q69 A;  3P1U A;  3KEZ A;  4J8F A;  1A5E A;  2Y3A A;  1Z6T A;  3TWX A;  4YDE A;  4HXI A;  3VLE A;  4L23 A;  4MBG A;  3MEK A;  3KEA A;  3TG4 A;  2VGX B;  3D9H A;  3Q5M A;  4ABN A;  2ETC A;  2FUL A;  3APD A;  4B8A A;  4CYM D;  3QWP A;  3AS5 A;  3E34 A;  3TWT A;  3Q78 A;  4DX6 D;  3MKQ A;  3JQ0 A;  3CSF A;  4EQF A;  4YDW A;  2KCK A;  3GYZ A;  4G2V A;  2B0O E;  5JJ6 A;  3HXF A;  3ZKJ A;  4GZD A;  3JXI A;  4BFR A;  5FWQ A;  2AW6 A;  3EIQ C;  4XI9 A;  5ARF A;  4CGW A;  5CBO A;  3B95 A;  3Q9U C;  5KCM A;  1NI1 A;  3AG4 E;  2NXP A;  4WWO A;  1H2T C;  2YQ8 A;  3OXF A;  3MV2 B;  5EIB E;  2GRP B;  3U66 A;  1HU3 A;  2VYI A;  1TJF A;  3FWV A;  2V5F A;  4TXQ A;  4GTM A;  4CCA A;  2R02 A;  2ION A;  5G55 A;  3G2W A;  4FJY A;  3B7T A;  2YHE A;  4AV7 A;  4UWG A;  2WQ7 A;  3PEU B;  5AQA A;  1SVX A;  4QFV A;  2J08 A;  4UWF A;  1OT8 A;  3ONL A;  3UIN C;  1JCQ A;  3MX3 A;  3KS2 A;  2BUG A;  4YVQ C;  3NBN B;  4U8Y D;  2Q7F A;  2RFA A;  2BKG A;  3QJZ A;  4I6G A;  4GPK A;  5ANL A;  3E30 A;  1UJK A;  2EIN E;  1TEZ A;  4GZ3 A;  3EHM A;  4GA0 A;  4PUC A;  2A4Z A;  2L6J A;  5M72 A;  2PL2 A;  2FO7 A;  4A3V A;  4XI0 A;  2WXO A; 
#chains in the Genus database with same CATH homology
 1OCC E;  1OCR E;  2ZXW E;  3AG1 E;  2DYR E;  3X2Q E;  3AG2 E;  2Y69 E;  2EIJ E;  2EIL E;  5IY5 E;  2OCC E;  1V54 E;  3ASN E;  5B1A E;  2EIN E;  3ASO E;  1OCZ E;  2EIK E;  1OCO E;  1V55 E;  3ABK E;  5B1B E;  3WG7 E;  3AG4 E;  2DYS E;  2EIM E;  3AG3 E;  3ABM E;  3ABL E;  5B3S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...