3AG3E

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag3E00
2EIJE 2DYRE 1V55E 5B3SE 3ASOE 2EILE 2EINE 2EIKE 2EIME 5B1AE 3AG2E 2OCCE 3ABME 3AG3E 3ABLE 3AG4E 3ASNE 3AG1E 1OCCE 3X2QE 3WG7E 5B1BE 2DYSE 3ABKE 2Y69E 1V54E 1OCZE 2ZXWE 5IY5E 1OCOE 1OCRE
chains in the Genus database with same CATH superfamily
2OVFA 1V55E 1UN9A 4YDEA 5KCMA 2UWJG 4DX7D 3CHMA 4B94A 3AS4A 3MKQB 3U66A 1E8XA 1YMPA 4L2YA 4DI3A 5ENPD 4E85A 2R59A 3D9LA 4TRQA 3IBEA 4YVOA 1TJFA 1EF1C 5KJNA 4F1SA 4ZHBA 2KCKA 1NP7A 3TXMA 4BX9A 4L23A 5B3SE 1N94A 1DCEA 1TN7A 3PVLA 4KBQA 4HRNA 1HG5A 2YHEA 3KD7A 5KNGA 2J08A 3SD5A 3LPZA 2VSYA 1Z6TA 4AV7A 3IKOB 5B1AE 3ZVVA 4Q94A 1QZ2A 2DWZA 2RKKA 3UKUG 3FU0A 3UPVA 4DI4A 2HE0A 4XZ4A 4HOUA 2OOEA 4ATGA 1E8ZA 5LFAA 1U3DA 3LS8A 3MJWA 3FUJA 3VLFA 3UM2A 4UWHA 4ANVA 1HX8A 5ENNA 3UUXA 2WXOA 2ILRA 5BNWA 5FQ6A 3MGBA 1H2VC 3SQVA 5HS0A 1UJJA 4TUMA 2V5QC 1HS6A 3T8MA 2E0IA 1OWNA 3FTWA 4UWKA 4JEUA 2LXLA 1OUVA 4HLEA 3FH8A 2WXRA 3VLDA 4DRXE 5E75A 4I1OB 1WAO1 3NF1A 3B13A 2LUHA 3CVUA 2FO1E 2DIWA 2PNNA 4HXIA 3UM1A 4U8YD 4M3OA 5FWQA 3DSTA 3APFA 3FHEA 5EX0A 3LEWA 4OAVB 3AJIA 3RIBA 1Z3YA 2UY1B 3VTYA 3ESLA 5T4YA 4TXPA 3D9PA 3FUMA 4N5QA 5AN8A 4PH4B 3LXUX 3FWVA 2XHEA 4AXHA 2H6FA 4LERA 5FJYA 3ZGQA 4WUYA 2Y4TA 1JCQA 3OXLA 4UWGA 3RRMB 3FFLA 4XIFA 2P9SG 4G1TA 5AJLA 1N0QA 3G2SA 5C2YA 1K1BA 2R05A 5CERB 2I6HA 3IEGA 3HVEB 3ULEG 4HI9A 4JEHA 5ENTD 2UY1A 1BI7B 3C3RA 5FT9A 4MBGA 2I1JA 4GZ5A 5KBAA 4NURA 1FCHA 4Y6WA 2VGYA 1UJKA 3U3WA 3JQ0A 3Q7FA 5CEAA 2ZXWE 2XPIA 4JL0A 4HLLA 1S64A 3IXEA 5EIBE 5T8IA 3APDA 4BTAA 1MQSA 4APFA 3QARA 1PY1A 3ML9A 3PZDA 2L0IA 3ONKA 3HVEA 2X6IA 4RG9A 3JUIA 1UG3A 3UIOC 4JA7A 2EIJE 1HU3A 4HQDA 1E7VA 1HH8A 2X6KA 3HXBA 1B89A 4JD2G 3PZ4A 3CVWA 3LVQE 4N3AA 4C0MA 2XQ0A 4J8FA 5KNHD 4BSXA 3Q47B 5AQ9A 3D9NA 1DC2A 2GRQB 1JUQA 3AAAC 2M63A 3S7JA 4N2SA 3L82A 3FUIA 5LCWJ 4FJZA 2XGOA 5A7DB 3G2VA 3MYVA 1X5BA 3E30A 1KZOA 2YINA 3JUEA 4E6HA 3ZYLA 4N3BA 4CDRA 5JJTA 1JWGA 3CSFA 2IU1A 4I2WA 2QFCA 3CK9A 3ZHEB 1MX6A 1INZA 4I17A 4G11A 3R7RA 3EJNA 3X2QE 1YYHA 3R7QA 3QAQA 1OWMA 4I6JA 5KWDA 1D9SA 1BU9A 4K5CA 4CRWA 2GRLA 2LSUA 2VQ2A 1OWLA 3V79K 2VGXB 3C3OA 3EHNA 1S0PA 4DJAA 1SZAA 3E34A 3Q5MA 4F7AA 5LP0A 1ELRA 4BSZB 1WDYA 3S2AA 5CBOA 4LNUD 2YHCA 4GCNA 5AJDA 4GMRA 3CV0A 4ANXA 2J8SD 5EYLA 2XCCA 4YDOA 5FZSA 3SFZA 3TWUA 1XNFA 3NQPA 2OEVA 4HOTA 1JCSA 4U8VD 1E8WA 2QY7A 5CEDB 1TN8A 2MRIA 4YNDA 3KEAA 2EINE 4AM9A 3ASHA 2VGXA 1MJ0A 4HVBA 1K1AA 4U8HA 4LCTA 2Y4UA 3DPYA 5J08A 2F8XK 2R02A 4PS7A 4A3TA 4AY6A 3NZUA 1H19A 3ULQA 2AVPA 3EIJA 3TL5A 3Q75A 3C3QA 2ZU6B 3AG2E 5ANRA 3VLEA 4R7LA 2RG8A 2XEEA 3TJPA 4WNDA 1TN6A 4ATZD 5ITZF 2VGEA 2P2CP 2WXQA 3Q15A 1MX2A 4I9CA 4W9RA 4GZCA 3I4GA 4GZDA 4CYMD 1N4SA 1NFIE 4MLPA 2NC9A 4G8LA 4BX8A 2BTDA 1TNBA 1SA5A 2IJGX 3R9MA 1E96B 4UI9C 4OAUC 2DYRE 1W3BA 3MKRA 4DLOA 5AAOA 2EIKE 2EIME 5D0QD 1PC2A 2CHZA 5EX3A 3TWVA 4BY6A 2J4BA 2L6JA 2WXIA 5FZQA 1DVPA 3B7SA 5D66A 1JCRA 5BPPA 4EZLA 4OVUA 4JC8A 1BI8B 3CHPA 2IOLA 4EBAA 1S70B 4XE0A 1HG2A 4KZCA 4ILGA 3J5QB 4F3VA 4HRMB 3C98A 4HB5A 4C9BB 2GRNB 3IHYA 3I3NA 4I1AA 2GRMA 4I9EA 2I1KA 4FU3A 4EZKA 1MYOA 2WXKA 3SHFA 1NZNA 4GYOA 1N0RA 1HZ4A 5HI7A 3S7DA 2XRYA 2LAIA 4B8CB 2LAHA 2CHWA 4AOFA 4EBAG 4RG6A 4Q96A 3L6AA 3D9MA 4K0RA 3UQ3A 3ZU7B 3NOGD 4WNFA 2PQRA 1WM5A 3U64A 4X8QA 1BD8A 1UOHA 4CZ2D 2FO7A 2C2LA 5JHAA 2H6HA 3FUEA 4BFRA 4G26A 5EKQD 3JXJA 1HF8A 1L5JA 3G2TA 2C0LA 4JVSA 3AG4E 3DSXA 2P9NG 5FQ4A 3CQGB 2X6FA 4GA1A 3TWRA 4I43A 1KT1A 3FUHA 4J8EA 2J9QA 3FH5A 4J7WA 3L22A 4HRLA 3CHRA 4U0ZA 5JJ7A 3QKYA 2DBAA 5DBKA 3CHQA 5JHBA 3HHMA 3PNTB 2FF4A 1HFAA 1GW6A 3FUNA 4N2QA 3QDNA 3GW4A 1N95A 2NSZA 3SNXA 3LJ3A 2FBNA 4N39A 4LNBA 3RRNB 5BV0A 3TG4A 4DLQA 3MZLB 3FU5A 2V8SE 3CEQA 4OYSA 1UN8A 5A23A 4H7XA 4KXKB 3DXKG 4XI0A 4BT9A 1K3ZD 1MX4A 2P9PG 3DRAA 4Q69A 5ENQD 3UM3A 4GZ6A 3CVYA 4KYOB 4KT6B 3RO3A 4RVBA 4Y6CA 5CMYA 2LXMA 4U0UA 2DZOA 1NA3A 3BG0B 1IXVA 2VYIA 1H6PA 3FU6A 1FT1A 3KS2A 3WG7E 1N52A 5HQ8A 3PEVB 4GYWA 1ZB1A 1IKND 2WM9A 5JMND 3Q78A 3CVNA 3AG3E 3QC1A 2I2OA 1IYGA 1SZ9A 4BERA 1IHBA 3FUKA 3CSTA 3ONLA 4JHKA 2AJAA 2ZGGA 5ANLA 4O6FA 4GTOA 2CG2A 3RO2A 1NL4A 2VSXE 2ETBA 2DCPA 3RK6A 1LD8A 3CR3A 2PL2A 1ELWA 3RKVA 4APOA 4CEMA 2GW1A 2MOWA 1H6KA 3GYZA 3FEYA 3R9AB 2RFAA 2KM4A 4JW1A 2JABA 4GZ3A 4KMOA 3V31A 2X3MA 3UKRG 3BU8A 2XEVA 4CCAA 1Y6IA 1D8EA 5AARA 1JPLA 5BXUA 3UTMA 5BXOA 2IF4A 3SGHA 3KSQA 3DBSA 2A5UA 2WXHA 5ENRD 4F53A 2BUGA 3D9HA 4KZ0A 3ASFA 3ZYMA 5CBNA 5FQ7A 2XS8A 3G2UA 1DCQA 3BUAA 4NACA 3RU0A 3B95A 4AJWA 4FLBA 2ETCA 3L13A 3L54A 1H2UA 4B89A 1OXJA 4U63A 2R03A 1AWCB 4PDXA 4BEPA 1OY3D 3LYAA 3GZSA 2P9KG 2Y69E 3HG0D 4ILHB 1Q2ZA 4PUCA 2P9UG 5CCLA 3DEOA 4CDNA 2QYJA 4K5BA 3MEKA 5G04C 3TWTA 1P5QA 3FTUA 4ME2A 3FU3A 2AXZA 3SZ7A 3FTYA 2RFMA 3ABLE 2V0PA 1AP7A 2Y1LE 2CG3A 4K03A 1JWFA 2XZDG 5HKPA 2PM6A 2B6CA 4WNEA 4GTMA 2KC7A 3W9FA 3AU4A 3UM0A 4J8DA 4LRZA 2QZAA 5BT1A 4DX2A 4QFVA 1H6OA 3PZ3A 4JHRA 1SA4A 4M7CA 1QBQA 4EZJA 2IQCA 2J09A 4L1BA 3U4TA 3ZFWA 4FHKA 4BWRA 4GMJA 3GZ2A 2Q7FA 4N5CA 3KAEA 2A5EA 1N11A 1TNUA 3V2XA 3SFYA 5EIDA 3TG5A 2FI7A 2V4LA 3NB2A 5FQ8A 2FEZA 4I6GA 4LEUA 2XPYA 5FINA 1HE8A 4GA0A 3FUDA 3ZN3A 2H6GA 2WXFA 3BQOA 2DYSE 1S63A 3PNLB 4OVVA 3W9GA 4A55A 2DVWA 3TWQA 1E90A 2XGSA 3DSVA 4GU5A 3FTSA 1EDUA 4FP7A 1A17A 5ARFA 1NI1A 3D9JA 2XRZA 3DSWA 2F0YA 2RD0A 1OCZE 3LDZA 1IHGA 3QK0A 2L6BA 2P58C 1WY6A 3SFXA 3IV0A 3S7BA 3PEUB 2WXJA 2LO6A 2C0MA 4JXTA 4YDWA 3FEXA 3CGHA 3L9TA 5EDSA 1VDYA 2V5FA 5ENSD 2JEKA 1MZCA 3BG1B 4PS8A 1IQUA 3KEZA 3ASGA 5G05C 3UT4A 3PUKA 1Z3XA 2AW6A 2X6HA 1PAQA 1O1SA 2WB2A 3CVLA 4L9PA 4DK5A 4BETA 4D10C 1V54E 3CVXA 3QWVA 3NZSA 3T9KA 4IN3B 2MYOA 3C72A 5EN5D 3MCXA 3NBNB 1KZPA 3QNKA 3TAXA 4XKBA 5D2MC 3BEEA 1OCCE 2CHXA 2WMOA 3MA5A 1K8KG 3HIZA 4I2ZA 4O1PA 4G8KA 5LX8A 4P29A 3ASDA 2P9IG 2IFUA 4AY5A 2IOSA 3U9WA 5AQAA 3LCAA 2EQXA 2B0OE 2HO1A 2KCLA 3HXEA 3F6QA 4FULA 2A4ZA 4U95D 3FP3A 3DSSA 4HS2A 4J0UA 1KT0A 1D8DA 4GCOA 3JYSA 2J4DA 3Q4AB 3UT8A 3K9IA 1N54A 4U0SA 4AEZC 4UQZA 4G23A 5ARGA 3FUFA 1OWOA 3ZXSA 1ZU2A 4I1MA 1OT8A 3UXGA 4WWPA 4DPRA 4I6EA 5CMWA 3L17A 4RQIA 3SBTB 3RSEG 4YDYA 5FIOA 4CT4A 2BKGA 1ZBPA 1N4PA 4KVMA 3CVQA 2HYZA 3CKBA 2AXVA 1O5MA 5J90A 2XCBA 3Q9UC 4FADA 4UI9K 3CVPA 2BEDA 3AS8A 5H7PA 2VSOE 3FTXA 4NQ0A 4WWNA 3ZYKA 3UIPC 2X38A 3CLJA 5FTPA 2CFUA 3EHMA 4C0EA 2R2LA 4IULA 4WNGA 2IO3C 5AQBA 2WXPA 1N9AA 4XX5A 3C5RA 2I9CA 3UMVA 4ILIA 4UI9J 2WXNA 1BLXB 2EILE 2J07A 3HXDA 4B8AA 3E32A 3PZ1A 4GTQA 2BKKB 4ANWA 1SW6A 4GPMA 3CHOA 3IHVA 3OXGA 1KPSB 5AIJA 1TNZA 3LY7A 3ZIMA 2WMNA 3MKQA 4U7EB 4MRUA 3D9IA 1SVXA 3B7RL 3QB2A 2VSNA 2PM7A 3ZUVB 3JXIA 5C1DA 4GTVA 3AG1E 2YNQA 3JCKC 4B0ZA 3OTNA 1U3CA 4C48B 3L08A 4H7YA 3MX3A 4U04A 2WQ6A 3OXFA 2OEWA 4G24A 3B7UX 5FZRA 3D3MA 1DNPA 3TXNA 3KSLA 4K5AB 2P9LG 3RRUA 4WAFA 4ACLA 4GTRA 4AP2A 3Q79A 3UX4A 3FTVA 4RSYA 3EU9A 4TV3A 3UINC 4TUUA 4GB9A 3MV2B 5D0OD 2L0TB 3CKCA 3URZA 4A1GA 3SI5A 3WXXA 4GA2A 5EILA 4TXRA 2ZISA 3ASNE 3PS6A 4NIKA 4AVXA 3O48A 4A1SA 2L9BA 5G55A 4KVOA 3ABKE 3QWWA 4HOSA 3CK8A 4B93B 3EHRA 5AENA 3EDTB 2OVBA 4JZYA 3EIQC 1RW2A 3TWWA 5LCWC 3LY8A 3UT7A 4XEIG 5AQ7A 4XKCA 5AYWD 1LTXA 3DSUA 1N4QA 3DEPA 2Y0BG 2NYJA 3CHSA 4CGWA 3ML8A 1FPPA 2LSVA 4EECA 3ZYQA 2V4HC 5JA4D 4GPKA 1N4RA 3T8KA 3FTZA 1QYMA 4GYYA 2KBXA 5HRYA 2KCVA 1RZ4A 3D9KA 3VTXA 4J6IA 4WWOA 4JA9A 2XZTG 3O4ZA 4ABNA 3Q49B 3EUVA 5CRVA 3Q9NC 3S7FA 4MKTA 2AWIA 4F1PA 4PS3A 2KZTB 1O1RA 1Z5SC 2E2EA 3ZKJA 4CDMA 3ISMC 4FHJA 1H2TC 4GMLA 4J8YA 3P1UA 3Q73A 3T5XA 3CK7A 2AXUA 4GTTA 3TGOA 2FULA 4JPSA 4XI9A 4CT0A 3HRAA 2XEHA 3OAWA 3N71A 1OWPA 4V3IA 4GAAA 4EHMA 3FULA 2YQ8A 1QQEA 4IRUA 3QJZA 1SQMA 1U2VG 2GRPB 2IEJA 2KZTA 2QC9A 2WPVA 3LKUA 1WG0A 2J49A 4G2VA 4UWLA 2ZGDA 3E33A 2WVIA 5BUZA 4HNAD 2CFZA 4DX1A 2GRRB 3D9OA 2R17C 4MS6A 3DPDA 4L2LA 1YA0A 1YCSB 3DWLG 4AIFA 4F6RD 1O1TA 2XS1A 3EU5A 3DXMG 3LVRE 3PE3A 3EHQA 1IQRA 3ZEFA 3ZPJA 2JLBA 2KATA 5BV1A 1EYHA 1E7UA 2MHKA 4YVQC 3AS5A 4J8SA 3V30A 4ANUA 4HBDA 1UW4B 4TXQA 3GZ1A 5T3RA 4BESA 2VJ8A 1TEZA 3ABME 1FT2A 1EPUA 5JJ6A 2KXPC 5B1BE 3RJVA 4HFGA 3FY4A 3SO8A 5IY5E 2F8YA 2IO2C 5CRUA 1TNOA 1BPOA 3PH0C 4NRHB 3ULYA 3J5PA 5CCMA 1E8YA 5KJMA 3SY2A 3NAWA 4FA6A 2X6JA 3LJNA 4LG6A 5CHEE 2WXLA 3Q7AA 3ZHEA 1OCOE 2HM8A 2NXPA 4UQXA 4Z68A 1HO8A 3ZRHA 5G04J 4ZFHA 2PZIA 3ENEA 4URKA 4BTBA 4A63B 1XGWA 3ESKA 1X81A 1Y8MA 3HXCA 2WQHA 2ONDA 2F37A 3PREA 4UWFA 3SBSA 4GTSA 4ACKA 1H0AA 4UUCA 3I5PA 1MHQA 3E37A 2WQ7A 4L7TA 2XPZA 1FVHA 2BF0X 3B7TA 3PE4A 4JB8P 4EQFA 2GROB 2QYUA 1NA0A 3B7BA 4IYPA 4U96D 3QOUA 2WXGA 3TWSA 4CGVA 5KJKA 1TJCA 4EPZA 4FC8A 5M72A 3HYMB 4DX6D 2ZIRA 4O60A 5ENOD 2XGMA 3PDNA 4JHJA 3TWXA 4RLYA 3CVVA 5KJLA 1FVFA 4HOQA 5BW8C 2PQNA 3PUJA 3SF4A 3AU5A 1G3NB 4U07A 4A3VA 3FH7A 3JQ1A 4FJYA 3ZNGA 3P2BA 1OCRE 4DX5D 3G2WA 4LUNU 3V2OA 3HDXA 3I4RB 3E4BA 1TYQG 4N3CA 4HORA 3HXFA 4O1OA 4HI8A 2IONA 4QQIA 4FLHA 2VTBB 2Y3AA 5CECB 2GGFA 1KLXA 5DIZA 2R5SA 1QNFA 2OV8A 3QWPA 3MV3B 4UQYA 3UI2A 2OCCE 4LNGA 1LF8A 2XENA 3RAUA 3LY9A 5EYPF 2WXMA 1ELKA 5G2NA 3T5VA 2HR2A 2DZNA 5A6CA 5LOZA 2H6IA 3APCA 3ASOE 3CQCB 4DUIA 4BT8A 1LD7A 4G25A 2ETAA 5G05J 5E76A 3PZ2A 2VTBA 2IY0C 1HXIA 3FDHA 4GTPA 3L16A 1TNYA 4LSZE 3NOCD 3ZXPA 3PRZA 1A5EA 1TR4A 3CIAA 2LNIA 3ZW3A
chains in the Genus database with same CATH topology
2EIJE 2DYRE 1V55E 5B3SE 3ASOE 2EILE 2EINE 2EIKE 2EIME 5B1AE 3AG2E 2OCCE 3ABME 3AG3E 3ABLE 3AG4E 3ASNE 3AG1E 1OCCE 3X2QE 3WG7E 5B1BE 2DYSE 3ABKE 2Y69E 1V54E 1OCZE 2ZXWE 5IY5E 1OCOE 1OCRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIJ E;  2DYR E;  1V55 E;  5B3S E;  3ASO E;  2EIL E;  2EIN E;  2EIK E;  2EIM E;  5B1A E;  3AG2 E;  2OCC E;  3ABM E;  3AG3 E;  3ABL E;  3AG4 E;  3ASN E;  3AG1 E;  1OCC E;  3X2Q E;  3WG7 E;  5B1B E;  2DYS E;  3ABK E;  2Y69 E;  1V54 E;  1OCZ E;  2ZXW E;  5IY5 E;  1OCO E;  1OCR E; 
#chains in the Genus database with same CATH topology
 2OVF A;  1V55 E;  1UN9 A;  4YDE A;  5KCM A;  2UWJ G;  4DX7 D;  3CHM A;  4B94 A;  3AS4 A;  3MKQ B;  3U66 A;  1E8X A;  1YMP A;  4L2Y A;  4DI3 A;  5ENP D;  4E85 A;  2R59 A;  3D9L A;  4TRQ A;  3IBE A;  4YVO A;  1TJF A;  1EF1 C;  5KJN A;  4F1S A;  4ZHB A;  2KCK A;  1NP7 A;  3TXM A;  4BX9 A;  4L23 A;  5B3S E;  1N94 A;  1DCE A;  1TN7 A;  3PVL A;  4KBQ A;  4HRN A;  1HG5 A;  2YHE A;  3KD7 A;  5KNG A;  2J08 A;  3SD5 A;  3LPZ A;  2VSY A;  1Z6T A;  4AV7 A;  3IKO B;  5B1A E;  3ZVV A;  4Q94 A;  1QZ2 A;  2DWZ A;  2RKK A;  3UKU G;  3FU0 A;  3UPV A;  4DI4 A;  2HE0 A;  4XZ4 A;  4HOU A;  2OOE A;  4ATG A;  1E8Z A;  5LFA A;  1U3D A;  3LS8 A;  3MJW A;  3FUJ A;  3VLF A;  3UM2 A;  4UWH A;  4ANV A;  1HX8 A;  5ENN A;  3UUX A;  2WXO A;  2ILR A;  5BNW A;  5FQ6 A;  3MGB A;  1H2V C;  3SQV A;  5HS0 A;  1UJJ A;  4TUM A;  2V5Q C;  1HS6 A;  3T8M A;  2E0I A;  1OWN A;  3FTW A;  4UWK A;  4JEU A;  2LXL A;  1OUV A;  4HLE A;  3FH8 A;  2WXR A;  3VLD A;  4DRX E;  5E75 A;  4I1O B;  1WAO 1;  3NF1 A;  3B13 A;  2LUH A;  3CVU A;  2FO1 E;  2DIW A;  2PNN A;  4HXI A;  3UM1 A;  4U8Y D;  4M3O A;  5FWQ A;  3DST A;  3APF A;  3FHE A;  5EX0 A;  3LEW A;  4OAV B;  3AJI A;  3RIB A;  1Z3Y A;  2UY1 B;  3VTY A;  3ESL A;  5T4Y A;  4TXP A;  3D9P A;  3FUM A;  4N5Q A;  5AN8 A;  4PH4 B;  3LXU X;  3FWV A;  2XHE A;  4AXH A;  2H6F A;  4LER A;  5FJY A;  3ZGQ A;  4WUY A;  2Y4T A;  1JCQ A;  3OXL A;  4UWG A;  3RRM B;  3FFL A;  4XIF A;  2P9S G;  4G1T A;  5AJL A;  1N0Q A;  3G2S A;  5C2Y A;  1K1B A;  2R05 A;  5CER B;  2I6H A;  3IEG A;  3HVE B;  3ULE G;  4HI9 A;  4JEH A;  5ENT D;  2UY1 A;  1BI7 B;  3C3R A;  5FT9 A;  4MBG A;  2I1J A;  4GZ5 A;  5KBA A;  4NUR A;  1FCH A;  4Y6W A;  2VGY A;  1UJK A;  3U3W A;  3JQ0 A;  3Q7F A;  5CEA A;  2ZXW E;  2XPI A;  4JL0 A;  4HLL A;  1S64 A;  3IXE A;  5EIB E;  5T8I A;  3APD A;  4BTA A;  1MQS A;  4APF A;  3QAR A;  1PY1 A;  3ML9 A;  3PZD A;  2L0I A;  3ONK A;  3HVE A;  2X6I A;  4RG9 A;  3JUI A;  1UG3 A;  3UIO C;  4JA7 A;  2EIJ E;  1HU3 A;  4HQD A;  1E7V A;  1HH8 A;  2X6K A;  3HXB A;  1B89 A;  4JD2 G;  3PZ4 A;  3CVW A;  3LVQ E;  4N3A A;  4C0M A;  2XQ0 A;  4J8F A;  5KNH D;  4BSX A;  3Q47 B;  5AQ9 A;  3D9N A;  1DC2 A;  2GRQ B;  1JUQ A;  3AAA C;  2M63 A;  3S7J A;  4N2S A;  3L82 A;  3FUI A;  5LCW J;  4FJZ A;  2XGO A;  5A7D B;  3G2V A;  3MYV A;  1X5B A;  3E30 A;  1KZO A;  2YIN A;  3JUE A;  4E6H A;  3ZYL A;  4N3B A;  4CDR A;  5JJT A;  1JWG A;  3CSF A;  2IU1 A;  4I2W A;  2QFC A;  3CK9 A;  3ZHE B;  1MX6 A;  1INZ A;  4I17 A;  4G11 A;  3R7R A;  3EJN A;  3X2Q E;  1YYH A;  3R7Q A;  3QAQ A;  1OWM A;  4I6J A;  5KWD A;  1D9S A;  1BU9 A;  4K5C A;  4CRW A;  2GRL A;  2LSU A;  2VQ2 A;  1OWL A;  3V79 K;  2VGX B;  3C3O A;  3EHN A;  1S0P A;  4DJA A;  1SZA A;  3E34 A;  3Q5M A;  4F7A A;  5LP0 A;  1ELR A;  4BSZ B;  1WDY A;  3S2A A;  5CBO A;  4LNU D;  2YHC A;  4GCN A;  5AJD A;  4GMR A;  3CV0 A;  4ANX A;  2J8S D;  5EYL A;  2XCC A;  4YDO A;  5FZS A;  3SFZ A;  3TWU A;  1XNF A;  3NQP A;  2OEV A;  4HOT A;  1JCS A;  4U8V D;  1E8W A;  2QY7 A;  5CED B;  1TN8 A;  2MRI A;  4YND A;  3KEA A;  2EIN E;  4AM9 A;  3ASH A;  2VGX A;  1MJ0 A;  4HVB A;  1K1A A;  4U8H A;  4LCT A;  2Y4U A;  3DPY A;  5J08 A;  2F8X K;  2R02 A;  4PS7 A;  4A3T A;  4AY6 A;  3NZU A;  1H19 A;  3ULQ A;  2AVP A;  3EIJ A;  3TL5 A;  3Q75 A;  3C3Q A;  2ZU6 B;  3AG2 E;  5ANR A;  3VLE A;  4R7L A;  2RG8 A;  2XEE A;  3TJP A;  4WND A;  1TN6 A;  4ATZ D;  5ITZ F;  2VGE A;  2P2C P;  2WXQ A;  3Q15 A;  1MX2 A;  4I9C A;  4W9R A;  4GZC A;  3I4G A;  4GZD A;  4CYM D;  1N4S A;  1NFI E;  4MLP A;  2NC9 A;  4G8L A;  4BX8 A;  2BTD A;  1TNB A;  1SA5 A;  2IJG X;  3R9M A;  1E96 B;  4UI9 C;  4OAU C;  2DYR E;  1W3B A;  3MKR A;  4DLO A;  5AAO A;  2EIK E;  2EIM E;  5D0Q D;  1PC2 A;  2CHZ A;  5EX3 A;  3TWV A;  4BY6 A;  2J4B A;  2L6J A;  2WXI A;  5FZQ A;  1DVP A;  3B7S A;  5D66 A;  1JCR A;  5BPP A;  4EZL A;  4OVU A;  4JC8 A;  1BI8 B;  3CHP A;  2IOL A;  4EBA A;  1S70 B;  4XE0 A;  1HG2 A;  4KZC A;  4ILG A;  3J5Q B;  4F3V A;  4HRM B;  3C98 A;  4HB5 A;  4C9B B;  2GRN B;  3IHY A;  3I3N A;  4I1A A;  2GRM A;  4I9E A;  2I1K A;  4FU3 A;  4EZK A;  1MYO A;  2WXK A;  3SHF A;  1NZN A;  4GYO A;  1N0R A;  1HZ4 A;  5HI7 A;  3S7D A;  2XRY A;  2LAI A;  4B8C B;  2LAH A;  2CHW A;  4AOF A;  4EBA G;  4RG6 A;  4Q96 A;  3L6A A;  3D9M A;  4K0R A;  3UQ3 A;  3ZU7 B;  3NOG D;  4WNF A;  2PQR A;  1WM5 A;  3U64 A;  4X8Q A;  1BD8 A;  1UOH A;  4CZ2 D;  2FO7 A;  2C2L A;  5JHA A;  2H6H A;  3FUE A;  4BFR A;  4G26 A;  5EKQ D;  3JXJ A;  1HF8 A;  1L5J A;  3G2T A;  2C0L A;  4JVS A;  3AG4 E;  3DSX A;  2P9N G;  5FQ4 A;  3CQG B;  2X6F A;  4GA1 A;  3TWR A;  4I43 A;  1KT1 A;  3FUH A;  4J8E A;  2J9Q A;  3FH5 A;  4J7W A;  3L22 A;  4HRL A;  3CHR A;  4U0Z A;  5JJ7 A;  3QKY A;  2DBA A;  5DBK A;  3CHQ A;  5JHB A;  3HHM A;  3PNT B;  2FF4 A;  1HFA A;  1GW6 A;  3FUN A;  4N2Q A;  3QDN A;  3GW4 A;  1N95 A;  2NSZ A;  3SNX A;  3LJ3 A;  2FBN A;  4N39 A;  4LNB A;  3RRN B;  5BV0 A;  3TG4 A;  4DLQ A;  3MZL B;  3FU5 A;  2V8S E;  3CEQ A;  4OYS A;  1UN8 A;  5A23 A;  4H7X A;  4KXK B;  3DXK G;  4XI0 A;  4BT9 A;  1K3Z D;  1MX4 A;  2P9P G;  3DRA A;  4Q69 A;  5ENQ D;  3UM3 A;  4GZ6 A;  3CVY A;  4KYO B;  4KT6 B;  3RO3 A;  4RVB A;  4Y6C A;  5CMY A;  2LXM A;  4U0U A;  2DZO A;  1NA3 A;  3BG0 B;  1IXV A;  2VYI A;  1H6P A;  3FU6 A;  1FT1 A;  3KS2 A;  3WG7 E;  1N52 A;  5HQ8 A;  3PEV B;  4GYW A;  1ZB1 A;  1IKN D;  2WM9 A;  5JMN D;  3Q78 A;  3CVN A;  3AG3 E;  3QC1 A;  2I2O A;  1IYG A;  1SZ9 A;  4BER A;  1IHB A;  3FUK A;  3CST A;  3ONL A;  4JHK A;  2AJA A;  2ZGG A;  5ANL A;  4O6F A;  4GTO A;  2CG2 A;  3RO2 A;  1NL4 A;  2VSX E;  2ETB A;  2DCP A;  3RK6 A;  1LD8 A;  3CR3 A;  2PL2 A;  1ELW A;  3RKV A;  4APO A;  4CEM A;  2GW1 A;  2MOW A;  1H6K A;  3GYZ A;  3FEY A;  3R9A B;  2RFA A;  2KM4 A;  4JW1 A;  2JAB A;  4GZ3 A;  4KMO A;  3V31 A;  2X3M A;  3UKR G;  3BU8 A;  2XEV A;  4CCA A;  1Y6I A;  1D8E A;  5AAR A;  1JPL A;  5BXU A;  3UTM A;  5BXO A;  2IF4 A;  3SGH A;  3KSQ A;  3DBS A;  2A5U A;  2WXH A;  5ENR D;  4F53 A;  2BUG A;  3D9H A;  4KZ0 A;  3ASF A;  3ZYM A;  5CBN A;  5FQ7 A;  2XS8 A;  3G2U A;  1DCQ A;  3BUA A;  4NAC A;  3RU0 A;  3B95 A;  4AJW A;  4FLB A;  2ETC A;  3L13 A;  3L54 A;  1H2U A;  4B89 A;  1OXJ A;  4U63 A;  2R03 A;  1AWC B;  4PDX A;  4BEP A;  1OY3 D;  3LYA A;  3GZS A;  2P9K G;  2Y69 E;  3HG0 D;  4ILH B;  1Q2Z A;  4PUC A;  2P9U G;  5CCL A;  3DEO A;  4CDN A;  2QYJ A;  4K5B A;  3MEK A;  5G04 C;  3TWT A;  1P5Q A;  3FTU A;  4ME2 A;  3FU3 A;  2AXZ A;  3SZ7 A;  3FTY A;  2RFM A;  3ABL E;  2V0P A;  1AP7 A;  2Y1L E;  2CG3 A;  4K03 A;  1JWF A;  2XZD G;  5HKP A;  2PM6 A;  2B6C A;  4WNE A;  4GTM A;  2KC7 A;  3W9F A;  3AU4 A;  3UM0 A;  4J8D A;  4LRZ A;  2QZA A;  5BT1 A;  4DX2 A;  4QFV A;  1H6O A;  3PZ3 A;  4JHR A;  1SA4 A;  4M7C A;  1QBQ A;  4EZJ A;  2IQC A;  2J09 A;  4L1B A;  3U4T A;  3ZFW A;  4FHK A;  4BWR A;  4GMJ A;  3GZ2 A;  2Q7F A;  4N5C A;  3KAE A;  2A5E A;  1N11 A;  1TNU A;  3V2X A;  3SFY A;  5EID A;  3TG5 A;  2FI7 A;  2V4L A;  3NB2 A;  5FQ8 A;  2FEZ A;  4I6G A;  4LEU A;  2XPY A;  5FIN A;  1HE8 A;  4GA0 A;  3FUD A;  3ZN3 A;  2H6G A;  2WXF A;  3BQO A;  2DYS E;  1S63 A;  3PNL B;  4OVV A;  3W9G A;  4A55 A;  2DVW A;  3TWQ A;  1E90 A;  2XGS A;  3DSV A;  4GU5 A;  3FTS A;  1EDU A;  4FP7 A;  1A17 A;  5ARF A;  1NI1 A;  3D9J A;  2XRZ A;  3DSW A;  2F0Y A;  2RD0 A;  1OCZ E;  3LDZ A;  1IHG A;  3QK0 A;  2L6B A;  2P58 C;  1WY6 A;  3SFX A;  3IV0 A;  3S7B A;  3PEU B;  2WXJ A;  2LO6 A;  2C0M A;  4JXT A;  4YDW A;  3FEX A;  3CGH A;  3L9T A;  5EDS A;  1VDY A;  2V5F A;  5ENS D;  2JEK A;  1MZC A;  3BG1 B;  4PS8 A;  1IQU A;  3KEZ A;  3ASG A;  5G05 C;  3UT4 A;  3PUK A;  1Z3X A;  2AW6 A;  2X6H A;  1PAQ A;  1O1S A;  2WB2 A;  3CVL A;  4L9P A;  4DK5 A;  4BET A;  4D10 C;  1V54 E;  3CVX A;  3QWV A;  3NZS A;  3T9K A;  4IN3 B;  2MYO A;  3C72 A;  5EN5 D;  3MCX A;  3NBN B;  1KZP A;  3QNK A;  3TAX A;  4XKB A;  5D2M C;  3BEE A;  1OCC E;  2CHX A;  2WMO A;  3MA5 A;  1K8K G;  3HIZ A;  4I2Z A;  4O1P A;  4G8K A;  5LX8 A;  4P29 A;  3ASD A;  2P9I G;  2IFU A;  4AY5 A;  2IOS A;  3U9W A;  5AQA A;  3LCA A;  2EQX A;  2B0O E;  2HO1 A;  2KCL A;  3HXE A;  3F6Q A;  4FUL A;  2A4Z A;  4U95 D;  3FP3 A;  3DSS A;  4HS2 A;  4J0U A;  1KT0 A;  1D8D A;  4GCO A;  3JYS A;  2J4D A;  3Q4A B;  3UT8 A;  3K9I A;  1N54 A;  4U0S A;  4AEZ C;  4UQZ A;  4G23 A;  5ARG A;  3FUF A;  1OWO A;  3ZXS A;  1ZU2 A;  4I1M A;  1OT8 A;  3UXG A;  4WWP A;  4DPR A;  4I6E A;  5CMW A;  3L17 A;  4RQI A;  3SBT B;  3RSE G;  4YDY A;  5FIO A;  4CT4 A;  2BKG A;  1ZBP A;  1N4P A;  4KVM A;  3CVQ A;  2HYZ A;  3CKB A;  2AXV A;  1O5M A;  5J90 A;  2XCB A;  3Q9U C;  4FAD A;  4UI9 K;  3CVP A;  2BED A;  3AS8 A;  5H7P A;  2VSO E;  3FTX A;  4NQ0 A;  4WWN A;  3ZYK A;  3UIP C;  2X38 A;  3CLJ A;  5FTP A;  2CFU A;  3EHM A;  4C0E A;  2R2L A;  4IUL A;  4WNG A;  2IO3 C;  5AQB A;  2WXP A;  1N9A A;  4XX5 A;  3C5R A;  2I9C A;  3UMV A;  4ILI A;  4UI9 J;  2WXN A;  1BLX B;  2EIL E;  2J07 A;  3HXD A;  4B8A A;  3E32 A;  3PZ1 A;  4GTQ A;  2BKK B;  4ANW A;  1SW6 A;  4GPM A;  3CHO A;  3IHV A;  3OXG A;  1KPS B;  5AIJ A;  1TNZ A;  3LY7 A;  3ZIM A;  2WMN A;  3MKQ A;  4U7E B;  4MRU A;  3D9I A;  1SVX A;  3B7R L;  3QB2 A;  2VSN A;  2PM7 A;  3ZUV B;  3JXI A;  5C1D A;  4GTV A;  3AG1 E;  2YNQ A;  3JCK C;  4B0Z A;  3OTN A;  1U3C A;  4C48 B;  3L08 A;  4H7Y A;  3MX3 A;  4U04 A;  2WQ6 A;  3OXF A;  2OEW A;  4G24 A;  3B7U X;  5FZR A;  3D3M A;  1DNP A;  3TXN A;  3KSL A;  4K5A B;  2P9L G;  3RRU A;  4WAF A;  4ACL A;  4GTR A;  4AP2 A;  3Q79 A;  3UX4 A;  3FTV A;  4RSY A;  3EU9 A;  4TV3 A;  3UIN C;  4TUU A;  4GB9 A;  3MV2 B;  5D0O D;  2L0T B;  3CKC A;  3URZ A;  4A1G A;  3SI5 A;  3WXX A;  4GA2 A;  5EIL A;  4TXR A;  2ZIS A;  3ASN E;  3PS6 A;  4NIK A;  4AVX A;  3O48 A;  4A1S A;  2L9B A;  5G55 A;  4KVO A;  3ABK E;  3QWW A;  4HOS A;  3CK8 A;  4B93 B;  3EHR A;  5AEN A;  3EDT B;  2OVB A;  4JZY A;  3EIQ C;  1RW2 A;  3TWW A;  5LCW C;  3LY8 A;  3UT7 A;  4XEI G;  5AQ7 A;  4XKC A;  5AYW D;  1LTX A;  3DSU A;  1N4Q A;  3DEP A;  2Y0B G;  2NYJ A;  3CHS A;  4CGW A;  3ML8 A;  1FPP A;  2LSV A;  4EEC A;  3ZYQ A;  2V4H C;  5JA4 D;  4GPK A;  1N4R A;  3T8K A;  3FTZ A;  1QYM A;  4GYY A;  2KBX A;  5HRY A;  2KCV A;  1RZ4 A;  3D9K A;  3VTX A;  4J6I A;  4WWO A;  4JA9 A;  2XZT G;  3O4Z A;  4ABN A;  3Q49 B;  3EUV A;  5CRV A;  3Q9N C;  3S7F A;  4MKT A;  2AWI A;  4F1P A;  4PS3 A;  2KZT B;  1O1R A;  1Z5S C;  2E2E A;  3ZKJ A;  4CDM A;  3ISM C;  4FHJ A;  1H2T C;  4GML A;  4J8Y A;  3P1U A;  3Q73 A;  3T5X A;  3CK7 A;  2AXU A;  4GTT A;  3TGO A;  2FUL A;  4JPS A;  4XI9 A;  4CT0 A;  3HRA A;  2XEH A;  3OAW A;  3N71 A;  1OWP A;  4V3I A;  4GAA A;  4EHM A;  3FUL A;  2YQ8 A;  1QQE A;  4IRU A;  3QJZ A;  1SQM A;  1U2V G;  2GRP B;  2IEJ A;  2KZT A;  2QC9 A;  2WPV A;  3LKU A;  1WG0 A;  2J49 A;  4G2V A;  4UWL A;  2ZGD A;  3E33 A;  2WVI A;  5BUZ A;  4HNA D;  2CFZ A;  4DX1 A;  2GRR B;  3D9O A;  2R17 C;  4MS6 A;  3DPD A;  4L2L A;  1YA0 A;  1YCS B;  3DWL G;  4AIF A;  4F6R D;  1O1T A;  2XS1 A;  3EU5 A;  3DXM G;  3LVR E;  3PE3 A;  3EHQ A;  1IQR A;  3ZEF A;  3ZPJ A;  2JLB A;  2KAT A;  5BV1 A;  1EYH A;  1E7U A;  2MHK A;  4YVQ C;  3AS5 A;  4J8S A;  3V30 A;  4ANU A;  4HBD A;  1UW4 B;  4TXQ A;  3GZ1 A;  5T3R A;  4BES A;  2VJ8 A;  1TEZ A;  3ABM E;  1FT2 A;  1EPU A;  5JJ6 A;  2KXP C;  5B1B E;  3RJV A;  4HFG A;  3FY4 A;  3SO8 A;  5IY5 E;  2F8Y A;  2IO2 C;  5CRU A;  1TNO A;  1BPO A;  3PH0 C;  4NRH B;  3ULY A;  3J5P A;  5CCM A;  1E8Y A;  5KJM A;  3SY2 A;  3NAW A;  4FA6 A;  2X6J A;  3LJN A;  4LG6 A;  5CHE E;  2WXL A;  3Q7A A;  3ZHE A;  1OCO E;  2HM8 A;  2NXP A;  4UQX A;  4Z68 A;  1HO8 A;  3ZRH A;  5G04 J;  4ZFH A;  2PZI A;  3ENE A;  4URK A;  4BTB A;  4A63 B;  1XGW A;  3ESK A;  1X81 A;  1Y8M A;  3HXC A;  2WQH A;  2OND A;  2F37 A;  3PRE A;  4UWF A;  3SBS A;  4GTS A;  4ACK A;  1H0A A;  4UUC A;  3I5P A;  1MHQ A;  3E37 A;  2WQ7 A;  4L7T A;  2XPZ A;  1FVH A;  2BF0 X;  3B7T A;  3PE4 A;  4JB8 P;  4EQF A;  2GRO B;  2QYU A;  1NA0 A;  3B7B A;  4IYP A;  4U96 D;  3QOU A;  2WXG A;  3TWS A;  4CGV A;  5KJK A;  1TJC A;  4EPZ A;  4FC8 A;  5M72 A;  3HYM B;  4DX6 D;  2ZIR A;  4O60 A;  5ENO D;  2XGM A;  3PDN A;  4JHJ A;  3TWX A;  4RLY A;  3CVV A;  5KJL A;  1FVF A;  4HOQ A;  5BW8 C;  2PQN A;  3PUJ A;  3SF4 A;  3AU5 A;  1G3N B;  4U07 A;  4A3V A;  3FH7 A;  3JQ1 A;  4FJY A;  3ZNG A;  3P2B A;  1OCR E;  4DX5 D;  3G2W A;  4LUN U;  3V2O A;  3HDX A;  3I4R B;  3E4B A;  1TYQ G;  4N3C A;  4HOR A;  3HXF A;  4O1O A;  4HI8 A;  2ION A;  4QQI A;  4FLH A;  2VTB B;  2Y3A A;  5CEC B;  2GGF A;  1KLX A;  5DIZ A;  2R5S A;  1QNF A;  2OV8 A;  3QWP A;  3MV3 B;  4UQY A;  3UI2 A;  2OCC E;  4LNG A;  1LF8 A;  2XEN A;  3RAU A;  3LY9 A;  5EYP F;  2WXM A;  1ELK A;  5G2N A;  3T5V A;  2HR2 A;  2DZN A;  5A6C A;  5LOZ A;  2H6I A;  3APC A;  3ASO E;  3CQC B;  4DUI A;  4BT8 A;  1LD7 A;  4G25 A;  2ETA A;  5G05 J;  5E76 A;  3PZ2 A;  2VTB A;  2IY0 C;  1HXI A;  3FDH A;  4GTP A;  3L16 A;  1TNY A;  4LSZ E;  3NOC D;  3ZXP A;  3PRZ A;  1A5E A;  1TR4 A;  3CIA A;  2LNI A;  3ZW3 A; 
#chains in the Genus database with same CATH homology
 2EIJ E;  2DYR E;  1V55 E;  5B3S E;  3ASO E;  2EIL E;  2EIN E;  2EIK E;  2EIM E;  5B1A E;  3AG2 E;  2OCC E;  3ABM E;  3AG3 E;  3ABL E;  3AG4 E;  3ASN E;  3AG1 E;  1OCC E;  3X2Q E;  3WG7 E;  5B1B E;  2DYS E;  3ABK E;  2Y69 E;  1V54 E;  1OCZ E;  2ZXW E;  5IY5 E;  1OCO E;  1OCR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...