3AGLA

Complex of pka with the bisubstrate protein kinase inhibitor arc-1039
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Diversity of bisubstrate binding modes of adenosine analogue-oligoarginine conjugates in protein kinase a and implications for protein substrate interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 338
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3aglA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3aglA02
4L45A 3R8MA 3RVGA 3DJ6A 5DN3A 4XYFA 3R8UA 4AQCA 5KE0A 1PKGA 3FKNA 3OTVA 3PDTA 4U81A 5EYMA 5L8JA 1RJBA 3BYSA 4FZ7A 3ZEWA 4A06A 4IAFA 4RIWB 5FEDA 1YXTA 3O17A 3WF5A 5AADA 4MXYA 3KXMA 4O7SA 2VWWA 4XG7A 2WTDA 2YM8A 3LAUA 4QQJA 2OH4A 3BV2A 4X3FB 2NNWB 4BGGA 2QOKA 2NPQA 5EM7A 3RHKA 5E4HA 3DTWA 3BYVA 4C3FA 3FMKA 4WUNA 4U43A 1KWPA 1MRVA 4ZSEA 2RFDA 5F9EA 3UQCA 4FOCA 2JKKA 3VIDA 3GVUA 1H1PA 3QGWA 4DGOA 3ZUVA 2YWVA 3O71A 2R7IA 2ITQA 4JAJA 4D4VA 3AC3A 3V8SA 1P4OA 4PWNA 5KZ0A 2BZKB 2CNQA 2E9NA 2VGOA 4MF0A 3QRUA 2EWAA 4BKZA 5HE0A 5LCJA 2B9IA 3U6HA 4O7VA 3FLWA 4M15A 3KC3A 2JAVA 1FVVA 1K9AA 3DS6A 4LQMA 4MHAA 5FWKK 3QL8A 2BFXA 3LW0A 4JG8A 4EYMA 5LJJA 3QWKA 5CVGA 2O0UA 3NGAA 5CSVA 5IA3A 5J5SA 2HW7A 4X2NA 4E73A 2VTRA 3PPZA 5HNBA 4QYHA 4EUTA 3UZPA 3E87A 2C0TA 4GK4A 4ACCA 5E8YA 3I7CA 4FT9A 2FA2A 2Y0AA 4IZAA 3UNZA 2XRWA 3I4BA 4KS8A 3RGFA 3ZSGA 4I6FA 3R00A 1F5QA 5AX9A 3DKFA 4D9TA 5AAGA 5IH6A 3V8TA 2JBOA 2GSFA 3FJQE 2HZNA 1XHAA 3S4QA 3VUDA 4L3JA 2J0LA 2PMIA 5HO6A 3WF8A 4RJ7A 4JX3A 5CX9A 3WIGA 2PMOX 2C3JA 3P4KA 2OF4A 2QI8A 4EOIA 3D9VA 1LEWA 2GS2A 4NM0A 3RP9A 5ANIA 4FV2A 4BCGA 3KCKA 3R7YA 5IA1A 5CEMA 1B39A 1F3MC 3R8VA 3DKCA 3ZTXA 3FMJA 3LJ0A 3NR9A 2C6LA 5AP7A 2QR7A 5IQBA 3PLAE 4Q5HA 1XJDA 3FDNA 2C69A 2PZPA 4F6SA 1YVJA 3HMOA 3ZLYA 4I5MA 4EK8A 2VTIA 3DLZA 3IONA 4S2ZA 5L2WA 2V5QA 2CN8A 1PW2A 4ZS4A 3MFTA 2FGIA 3Q32A 4NIFA 3MYGA 4K1BA 4FUXA 3SG8A 2RG5A 4L46A 4NM7A 3ZU7A 5A4QA 3IW8A 4L3PA 3DY7A 4FKPA 4H36A 2O64A 4X3JA 3MBLA 1OKVA 4CRSA 4RX7A 1V1KA 3F69A 3GCPA 2VTTA 3RPOA 2C4GA 4FGBA 4OTRA 3L9PA 3NCZA 3VUIA 4XBUA 2J5FA 3D94A 4NEUA 4DGMA 4DG2E 3BBTB 1U59A 4C4IA 3R0TA 4M7IA 3DAEA 4FGRA 4BZDA 1WBNA 3G5DA 4U6RA 4Y72A 5AA9A 1EH4A 3KY2A 4NW5A 4PV0A 2OICA 4ASDA 2VD5A 3PP1A 5TO8A 4ZJVA 3DFCB 3QZGA 2C5YA 3FMMA 3VBYA 3BBWA 4GMYA 3QCQA 5HIEA 3FQSA 4EONA 2BRNA 5AIKA 2W1IA 4QPAA 3ZO3A 2PMLX 4DFXE 2BAKA 4FKWA 4CFMA 3FQHA 5ANEA 4TKSA 4YJTA 5JRSA 4GS6A 1H4LA 1SNXA 2PSQA 4FODA 4OBPA 3TV4A 4AFEA 1WZYA 4CFWA 1RQQA 1Q8ZA 3ACKA 4X21A 4ANLA 3ZUTA 1E1VA 1XH5A 2C6TA 3MY0A 4FZFB 4ZP5A 1GOLA 3KXXA 5C9CA 4AX8A 3BLRA 1ZARA 5KMJA 1R0EA 4XG2A 4FZDB 5T3QA 1B6CB 3ZONA 2OZAB 3PE1A 2Y6MA 4NTSA 4AA4A 3NYNA 4F9YA 5FDPA 2WU7A 2QKWB 3Q9ZA 4USDA 3NEWA 5IU2A 3L8SA 3HEGA 2W0JA 4O1OA 4FT3A 3QRJA 2YM4A 2UZVA 4F65A 4KNBA 4I24A 2XS0A 1M52A 4AA0A 5IG1A 3CPCA 3PVBA 5AIRA 3RJCA 4QMLA 3I6UA 3NPCA 4M3QA 3WF7A 3GP0A 1PXPA 3GC8A 4ANQA 3IOPA 4AF3A 3FI3A 5DI1A 5KZIA 4EWHA 3T8OA 4KRCA 2E2BA 3KB7A 5AR3A 3DZOA 2XYNA 3FV8A 1OECA 3MTLA 4KIPA 4RVKA 5EDRA 4FKJA 4F0IA 1GNGA 1OB3A 1PMNA 4W9XA 2YACA 2XBAA 4ANSA 2VTQA 4DC2A 4BKYA 2ITTA 5AP4A 2GQSA 2WTCA 4ZJJA 4W4XA 4JBVA 2KULA 2HYYA 3EQBA 3O23A 2W1HA 3VS6A 4A4OA 3FLNC 4Y5HA 2OU7A 4GT5A 1YOMA 3O8UA 4L01A 3MH0A 3TIYA 4D4YA 5AV1A 3KF4A 2VTSA 3BYUA 5GJDA 3F61A 4CFFA 4N0SA 1W0XC 2WMSA 2YM7A 5HORA 3ULZA 4KA3A 5ETIA 4EJNA 2QOIA 2C3IB 4ZOGA 3RAKA 1XH6A 5LVMA 3E7OA 5F94A 1KE5A 4GFOA 5T6KA 4MYGA 3MESA 3W8QA 1BL7A 2ETRA 3RNIA 4N6YA 4U45A 4DFZE 2QQ7A 2OBJA 3PLSA 4QMSA 5FGKA 3U55A 2Q83A 3BU3A 3ORIA 2ETMA 3IQ7A 3FYJX 4I4FA 3LFQA 1XBBA 2WMVA 1DS5A 4X2KA 4NFMA 4EKKA 4O7NA 2JAMA 3LXLA 4KRDA 2OFVA 5C01A 5C8MA 2HY81 3UO5A 4B8LA 3OOGA 3LJ2A 3ZLSA 3A61A 4C7TA 2ZMCA 3LFBA 3MFRA 3O7LD 4ALWA 4FT0A 3TZ7A 2RFSA 3JY9A 4LM5A 1H25A 5CF6A 5EKNA 2NO3A 1PYXA 5HE3A 4QRCA 3W16A 2UZWE 5KMNA 3NVKI 3KGAA 1KSWA 5I9YA 2YLFA 2UVXA 1ZAOA 3W32A 4L7FA 4UN0C 3D7TA 2OXYA 2J2IB 5CALA 5IPJA 1SVEA 3QZFA 5DHJA 4HYHA 4YJOA 3RK9A 3UVQA 1QPDA 4CZUA 4HGEA 4Z55A 4WG3A 2XK9A 3ZRKA 1NVRA 5GZ8A 4KIQA 4EOSA 3KFAA 3MVHA 2PVLA 4AA5A 4DH1A 5CAOA 4O0UA 3ZHPC 3CPBA 5J9YA 4FL3A 4ZLYA 3FZTA 3TXOA 2BMCA 3PSDA 4DCAA 3E63A 3HUCA 3MPMA 4Z16A 1SNUA 1JQHA 1REKA 3QYWA 3W33A 3ETAA 4RFZA 2XIKA 2ACXA 4TW9A 4O86A 2Y4IB 1YOJA 2BALA 4ZLZA 3A4PA 4MD8E 2RL5A 5GIOE 1JLUE 5HIDA 2UVZA 2J0MB 4JXFA 3UVRA 3U4UA 3PA5A 3S1HA 4DH3A 5A4CA 4LMUA 1VYWA 4QMYA 3V5WA 4IADA 2GNJA 3CTQA 3FE3A 4C33A 3KMWA 3UG1A 3R1SA 3VO3A 5KKRC 3L9MA 1PXJA 2BHHA 1S9IA 5L4QA 3FSFA 3FZ1A 3LQ8A 3AGLA 4IWQA 3BE2A 1V0PA 3EYGA 3PZEA 2Y8OA 4FT7A 4RMZA 4BDBA 4FTMA 3S00A 1BX6A 2QLUA 5EH0A 1AGWA 3OCTA 4CKRA 3D2KA 3OCBA 2LGCA 3D5VA 4II5A 3F66A 3UIMA 3CQUA 4UALA 4BDJA 1JOWB 3RZBA 4XNEA 5ETCA 5M56A 1S9JA 2PVKA 3FEGA 3THBA 5CAQA 4QMXA 5TE0A 4Q2AA 1CKIA 2ZB1A 3L8PA 3AC8A 3O0GA 3OUNB 2X4FA 3KRJA 4FF8A 5EW3A 5B2MA 5IQFA 4FI1A 2ITWA 5M4FA 3FXXA 1YDRE 2PE0A 4H3QA 4G5PA 3TCPA 4HNFA 3AMYA 3VF8A 3UYTA 5HCZA 1LR4A 2UW4A 5B7VA 4IH8A 4MTAA 4FKVA 1VYZA 4KBCA 5CI6A 3ZRLA 3QF9A 2ONLA 5ANJA 3P7BA 4D5KA 3QQUA 4MXOA 2UZOA 3LFDA 1WVWA 3R1QA 4U44A 2XUUA 3R04A 3KXNA 2IWIA 2B4SB 3DB8A 5DG5A 2W5BA 3W2CA 5C8NA 2B52A 4XOYA 4PDYA 2WHBA 3C0GA 2BUJA 4TNBA 3NAXA 5DIAA 2P0CA 3QRKA 5FEEA 2UW7A 4QYFA 5M57A 4QP4A 4CYJA 3JR1A 2JITA 2J0IA 3HX4A 4FSZA 5BQ0A 2XK8A 3UP2A 4DH5A 3QD0A 3FZRA 2R0UA 2JKQA 4BCMA 2WMQA 5E91A 2JEDA 5IISA 2X39A 5AAEA 2UVYA 5FTGA 2R2PA 3P79A 2HAKA 2QO7A 2WQMA 5CNNA 2BKKA 2R3IA 4U79A 4FTJA 1FBNA 5FD2A 3K2LA 2ZM3A 4QQ5A 3UBDA 4LRMA 3ZH8A 3IGGA 4IX6A 4I41A 5DH3A 5AEPA 1Q4LA 3QD3A 1XH4A 4YLLA 2XEYA 2CKPA 5BVOA 3NSZA 4RPVA 3QHWA 3VUHA 1SYKA 4S33A 3MIAA 4DFUA 3DAJA 3ERKA 2W1CA 3BGQA 5AR7A 1OIYA 5FBNC 3VJNA 3D5XA 3QTWA 4O22A 5K5XA 5AM7A 5LCKA 5JH6A 4ZXTA 4XJ0A 3UGCA 2V0DA 3MTFA 4BCIA 4EK4A 2GU8A 4IFCA 5H3QA 2PK9A 4QNAA 3L8VA 4EKLA 3PA4A 2V7OA 3FC1X 4Y8DA 4JQ8A 4RX8A 1WVYA 3LJ1A 3NNVA 1GZ8A 1PXLA 3V04A 5H8GA 4DLIA 4KWPA 3TNWA 5EFQA 5DVRA 5JFWA 1RE8A 4L42A 5ANOA 2JC6A 3UNKA 5D7VA 3MPTA 4AGUA 1MRUA 1TKIA 3BE9A 2UV2A 5AM6A 1QMZA 2B1PA 3LCKA 4BCPA 1FGKA 5EOBA 4E6QA 4HPTE 2JFLA 2UW6A 4BDIA 5IEXA 2PE2A 1Q61A 2OSCA 3Q6WA 1H0VA 1UU7A 4GU6A 3NS9A 4FKIA 4RSSA 4Y95A 3F5GA 3C9WA 4TRLA 4QT1A 4UY9A 5ETFA 3HMNA 3ZFMA 5L3AA 3QLGA 4G3GA 5FUTA 5H2UA 2WTJA 3KCFA 3PXQA 2QR8A 1M17A 3W1FA 4LRJA 1YKRA 4O7ZA 5ACKA 4AE6A 4O0TA 1GZOA 3R30A 1SVGA 2BKZA 4XG9A 5AUYA 4FG9A 5KNJA 3GCVA 4ZIMA 3QAME 4C58A 4HVSA 2QOFA 5J8IA 2A2AA 4A4LA 5CANA 3VW6A 4JBPA 4EK5A 5HE2A 4F1MA 4FV3A 3EH9A 5HCYA 2FVDA 3A7FA 4NM5A 5EOLA 3WYYA 5L6WL 4DG0E 1OUYA 5CF5A 4IWOA 5CQUA 1KE8A 3LMGA 3HGKA 4M97A 3R2YA 4EH3A 3D4QA 4DH8A 5ETAA 3FL4A 2FSTX 2WB8A 5IH5A 5IA0A 1CSNA 5G1XA 2G15A 3ENMA 4J71A 4RIWA 5H9BA 2WMAA 4Z9LA 4YTCA 3IOKA 4N6ZA 1P4FA 2IVUA 2J90A 1YQJA 2JIIA 3F3VA 4NWMA 2PZ5A 1A06A 2WFYA 2X2MA 4AU8A 1W98A 1PXKA 1LPUA 3TTIA 1YDSE 5AP3A 4UB7A 5HTBA 4P7EA 5AR8A 3RM7A 5M53A 3GCQA 4KS7A 4WBBB 4DGNA 3WI6A 2UZUE 4EH2A 3ALNA 2UW8A 3WF6A 3SVVA 3BI6A 4QOXA 1CMKE 2YJRA 3RI1A 3PTGA 3WZJA 2ONLC 4V05A 4C3RA 3LFNA 2A1AB 4FKTA 3PZHA 1J1BA 4OLIA 5CU6A 4E93A 2O2UA 4F09A 4IAKA 3E7VA 1G3NA 3AXWA 3BV3A 3CIKA 1WBSA 4BCOA 2B9JA 1KV1A 3COKA 4BCJA 4EQCA 4RVMA 1IAJA 4EOLA 5HE1A 3CLYA 5B2LA 5HO7A 4FK3A 2RG6A 4ZTHA 5GIPE 1CKPA 3HV3A 4RZVA 4R3CA 3GOPA 3UE4A 4C4FA 2UUEA 1PXIA 1Q24A 4GUEA 1JKSA 3I6WA 2HOGA 4H3PA 1JWHA 3C4CA 5L8LA 4UX9A 2YCFA 1H08A 3MH1A 3ORNA 3PYYA 5DR9A 3UYSA 4ANBA 5BPYA 4R7IA 2CLXA 3P23A 2QOCA 4ZEGA 5J9LA 1DAWA 1K3AA 5CU4A 3U6JA 4MWIA 5KX8A 4EH7A 4USFA 1QCFA 5C1QB 1OVEA 4GV1A 4HVGA 3MS9A 4BI2A 3A4OX 1UWHA 1ZWSA 3SOAA 3K5UA 5JFSA 2X7OA 5CWZA 3KVWA 4I5HA 2CN5A 3QTZA 4FX3A 4YSMA 1SM2A 3A7GA 4BIBA 4OAVB 5HD4A 3RPRA 5BVNA 2E9VA 4M0YA 1FPUA 2YIRA 1FQ1B 4X7QA 3EKNA 3EQFA 5AWMA 3F82A 4BICA 3KL8A 4AT3A 2XIZA 2OJFE 1MP8A 3NW5A 3OWKA 1P14A 5C03A 4DEBA 4NU1A 2CCHA 5A46A 4G6NA 1JSUA 2DYLA 4UMRA 5BYYA 2LAVA 2HELA 3POOA 4PMTA 1W84A 3Q3BA 1OL2A 3DK7A 2C6KA 3OOMA 2YDKA 3FMHA 3LXPA 3Q5IA 1QL6A 2VO7A 5TOZA 4E4XA 3UMXA 4D4SA 5JQ5A 2CGVA 2UW3A 3EOCA 2P33A 3FZPA 3PIYA 1YOLA 2PVRA 4CEGA 4EHGA 4AUAA 4EOJA 4R77A 4BR3A 4LOQA 5IDPA 3MY5A 5E8VA 5FBOA 4GCJA 3TZMA 4GYIA 4BL1A 1OL6A 1W82A 4PL3A 1HOWA 4FNYA 1DM2A 1FVTA 1A9UA 3BHHA 3E92A 3FZOA 3FXZA 3AC2A 4OBOA 5AUVA 4A7CA 2XM8A 4RA4A 4O91A 4RJ5A 5HTCA 4FK6A 4IVAA 3OP5A 3EQGA 4FVQA 2C5NA 3BLQA 3QZIA 3BHYA 4G9RA 3DT1A 3ZYAA 4EK3A 3KU2A 3O51A 3DDQA 2QLQA 3I79A 3KRLA 3KMUA 4HPUE 4L9IA 4QYGA 5T68A 3RMFA 1NT2A 3HVCA 5I9WA 4TYHB 3V5QA 3KK9A 1IRKA 3E3PA 4ZAUA 3ACJA 5DGZA 4RGJA 4YZ9A 2J0JA 3DJ7A 5EHOA 2OI4X 3ATSA 3U87A 4RG0A 4DBXA 3R8PA 3OY1A 4MNEA 2W9ZB 2YAKA 3G0FA 3AC4A 3HP5A 4PMMA 3LLTA 3FLZA 5CTPA 3VUGA 4ASEA 3MVJA 3W8LA 4PPBA 4Y83A 4NUSA 5M09A 5ANKA 4G3EA 5I0BA 3NIZA 4YHTA 5C4KA 4FSMA 2AC3A 2J6MA 5HCXA 5IQIA 2OZAA 1OL5A 4BZOA 5JT2A 4O83A 2PTKA 2XH5A 3K5VA 3PY3A 4AW1A 3MH2A 3FZSA 4P5QA 4UXQA 3R73A 4XLIA 5DR6A 1GAGA 3ITZA 4D0XA 4ENXA 4C34A 3ZO1A 3NRMA 4FZ6A 2PUIA 2WEIA 1M2QA 1Y6AA 1VR2A 5FXRA 4LYNA 4ACDA 3CJGA 2C3KA 3ORLA 4CCBA 3OMVA 4IFGA 3R9NA 4JI9A 1CKJA 2QHNA 4OT5A 4U9AA 5AV0A 3R6XA 2Z60A 4BDGA 5I9VA 1V0OA 2WELA 3DTCA 2QURA 4O1PA 3ZDIA 3NNWA 2A19B 4K9YA 5CQWA 4AG8A 3SXRA 4QMNA 3WILA 3Q4ZA 3H10A 3MN3A 2X2KA 5DWRA 5EYKA 1OMWA 1XWSA 2YHVA 4IAAA 4AGWA 5EDQA 3E8EA 4UEUA 3VBTA 4G3FA 2C6IA 1APME 4L3LA 4IDTA 3R7GA 2JDVA 4C61A 5FM3A 3RTPA 1OM1A 5IKWA 5CU0A 1CM8A 2GS6A 4H58A 4FMQA 3VRYA 2OIDA 4R3RA 1U54B 1B38A 4YJUA 5A54A 3ID6C 4IAZA 3FY2A 4BTMA 3MVLA 4YMJA 4EHVA 4O27B 3QZHA 5FQDC 4LL0A 1PMEA 3NUSA 4X2FA 4ERKA 2F4JA 2FSMX 4ASZA 2YDIA 1UVRA 4A07A 1IG1A 3S0OA 3OW4A 1SMHA 1NW1A 4G6LA 1TQPA 4ZS0A 2UZTA 3UG2A 2YIYA 5KBQA 4FNXA 3UP7A 3Q60A 3FUPA 3A60A 4YTHA 4QTEA 4ZTRA 3IDCA 5AP6A 1STCE 2XVDA 3FI8A 3COMA 1FINA 4EH8A 2BAQA 4EBWA 2F49A 3W2OA 1H1WA 3ORMA 4C8BA 3CD8A 3QGYA 5E9EA 1O6YA 3OEFX 3PRIA 3QWJA 4OTGA 4AXAA 4AZWA 1H27A 2IW6A 2XEZA 4YTIA 1BI7A 2ITZA 2OK1A 3DZQA 3HRCA 4KKEA 4R6VA 5BYZA 3LCDA 1Y8GA 2X7FA 5KMIA 4KBKA 3U6IA 2YZAA 3OEZA 3GQLA 4W4VA 2VWIA 3T9IA 3PXFA 3F3UA 5L2TA 3VQHA 2AYPA 2F2CB 2XRUA 5BUJA 1URCA 5KO1A 1OIUA 3GCSA 1YDTE 3C4ZA 5IMXA 3UZRA 3IW6A 4FIHA 2W1FA 5HQ0A 1PHKA 5KBRA 4L6QA 2B54A 4M14A 3NCGA 4TT7A 5DEYA 3G2FA 4L52A 5FG8A 2YM5A 1Y91A 4ALVA 4ANNA 1H0WA 2ERZE 2OJGA 4L67A 4I6HA 1YI6A 2EXCX 3GUBA 4IX5A 5CEPA 2JDOA 4U41A 2YA9A 5DE2A 4BDHA 2XK7A 3HAVA 4PF4A 3B8RA 2W9FB 3HL7A 4HZSA 4OT6A 2WMTA 5AUWA 4C4HA 4KSQA 2IZRA 4FE2A 3D2IA 3POZA 3SD0A 3HV4A 2XNMA 4BGHA 4DEHA 2P55A 3ORZA 4GVJA 4WG5A 4XUFA 5JK3A 3DXQA 5LQFA 5L2SA 4NCTA 2XIRA 2FSOX 2Y4PA 4EEVA 5CXZA 3VC4A 1PYEA 4GJ3A 2WQBA 3C13A 3PXKA 1ZY4A 4FSWA 4IB0A 4UWCA 4ITHA 3TKHA 4PP9A 4LFIA 3WARA 3SG9A 1GIJA 4NK9A 4CD0A 3NLBA 4DITA 4C35A 3TL8A 2GTNA 4CLJA 1V0BA 2WEVA 3R7IA 4JQEA 5EHYA 3UO6A 2YABA 2WMUA 5JQ8A 4YPSA 3NUYA 3MA3A 4LOPA 3VBWA 3UOKA 3GB2A 5AP0A 4CMUA 4IB3A 4BZNA 4ZY5A 4M67A 3CGOA 3RPVA 3I60A 3RPYA 4ENYA 3F7ZA 3UPZA 2WTKB 3Q52A 3D15A 2CPKE 1O6KA 2ERKA 5CT0A 3A7IA 5EM6A 2ZV7A 3NUPA 3FY0A 4IC7A 4KINA 3TZ9A 4IMYA 2C68A 1Q99A 3D14A 3GCUA 4WNPA 4MD7E 3FQEA 4FTKA 2RFEA 3QUDA 3JXWA 3QBNA 2G01A 2F9GA 3E8CA 3NYOA 3OXTA 4AACA 3M42A 4FV9A 2YDJA 3FHIA 2ZB0A 3R02A 5M51A 3MVMA 4O7LA 5IQGA 4BBEA 2J50A 5J9ZA 3A8WA 3QX2A 4W8EA 4AFJA 4O82A 3NMUF 3NUUA 3DDPA 4LUEA 3EYHA 2OW3A 5ANDA 3QKMA 3ZS5A 3ODZX 5M44A 5BMSA 3F3WA 3ZCLA 3O50A 2RKUA 5IEVA 4XS2A 5I9UA 4FKSA 4O6EA 4FIFA 4PPAA 5CEOA 2B53A 3HMMA 2ITVA 2XKFA 4EC9A 2GNHA 5BVWA 3CD3A 4BI1A 4MNEB 3SA0A 4QP2A 2J7TA 3DBQA 4EBVA 3KXGA 3EB0A 3MA6A 2QO2A 4CFUA 4JVGA 1BI8A 2X0GA 2A4LA 2W1GA 1IAHA 4I6BA 3R63A 5I9XA 4G3DA 1JKLA 3W2PA 5CS6A 3TZ8A 4LV8A 1YWVA 2ZDUA 1MRYA 3GFWA 4DT9A 3F5PA 4QO9A 1OGUA 2YCRA 3C5IA 5LMKA 3A8XA 5CEIA 2VWBA 3N4VA 2YERA 4M84A 4WOVA 4MX9A 3PJCA 4O0XA 3H30A 4ONAA 4MQ1A 4KIOA 2C5OA 3H9OA 2FO0A 3QC4A 5HG5A 4BTJA 4EHZA 4O6LA 1OBDA 4MXZA 3W55A 3O2MA 2J51A 2XK6A 1SVHA 3QHRA 4FYOA 4EYJA 4W4WA 1J7IA 3EMGA 3RWQA 3PRFA 2YN8A 3MSSA 4O84A 2R3MA 1OZ1A 2OKRA 2GNFA 1YI3A 4KSPA 4F4PA 1H07A 3MFSA 2PUPA 3R22A 1U5QA 1OPKA 3CQEA 3MDYA 4FEVA 5FRIA 3DK3A 3E62A 4AGCA 3ZBXA 3AC5A 1IASA 1R78A 2XNBA 4U3YA 4CZYB 2P4IA 4BBFA 4FEXA 2Z7LA 4EQMA 4Y85A 1KV2A 3EKKA 3OS3A 2H34A 5JEBA 4J97A 3NUAA 2XM9A 2BIKB 4F64A 4QTCA 2F57A 4PUZA 2W1EA 3F6XA 4D1XA 4D2TA 2PUNA 3SGCA 2H6DA 3CP9A 4FV1A 2BRGA 5LVOA 3EN9A 4E3CA 3U54A 1GZKA 2Y4IC 3FYKX 1PMUA 2R3OA 2O3PA 4DEAA 3VUMA 3CE3A 3A62A 4R78A 5ANGA 2X8DA 5CASA 4UZHA 1ZZLA 5CAVA 1Y6BA 4MEDA 2PVNA 2OLCA 4NCTC 4CZTA 3RWPA 3H3CA 4EK6A 4TWPA 3LKMA 4M13A 5M4IA 4E20A 3A99A 4R7BA 3BWJA 2Z2WA 4IWPA 4YNOA 2PU8A 2XNPA 1OKYA 4RLKA 5M4CA 4QMWA 5CSXA 3VWAA 3RAWA 2X6DA 1H1QA 4I92A 4BCQA 4TNDA 3QALE 4OBQA 5F1ZA 3TUDA 2R0IA 2WNTA 3BIZA 4DCEA 5DMZA 3E88A 5L8KA 2XYUA 4EORA 4TL0A 5IEYA 3R8ZA 2JKOA 1FOTA 2FB8A 5B2KA 2X9FA 4ACMA 3PY1A 4DEGA 4W8DA 5DOSA 1Q8UA 2VNWA 4XG6A 1YI4A 3LCOA 5K5NA 2GS7A 1WBPA 4DTAA 1P2AA 2BDJA 1YHSA 2GFCA 3PPKA 2B0QA 4OTWA 3D7ZA 2GMXA 1OI9A 2X7GA 3FLYA 4M8TA 3R8LA 4RJ8A 5CU2A 3A2CA 2XNGA 3MB6A 3ZEPA 2IJMA 4GFMA 3SC1A 5E8UA 3LE6A 5IH4A 3TKIA 5HIBA 5FM2A 4FR4A 4YZCA 5HICA 3ZZEA 2GQGA 3VS2A 4E6AA 4JAIA 5FTOA 2J4ZA 2P2HA 2PVJA 5BUIA 4UWBA 3OWJA 2ITXA 3PPJA 2CDZA 2W5HA 4FSNA 2C5VA 2WOTA 3RALA 4IAYA 3F7WA 4K2RA 3MPAA 4XRJA 2JDTA 5EW8A 4CFXA 3N4TA 4ZTMA 3OT8A 2RGPA 5TKDA 1W83A 4IC8A 5TF9A 3QX4A 3LOKA 2C1AA 3LFSA 5D1JA 5LVPA 1YXXA 2DWBA 5JSMA 2UZLA 1WBVA 3RK5A 1PXOA 2Z02A 3RKBA 1ZMWA 3JPVA 4FKRA 4NYEA 2QC6A 3ZM4A 3OF0A 4E7WA 1UNGA 4RBLA 3CKXA 1J7LA 3DCVA 3AT4A 4MKCA 4YBJA 2GTMA 4CQEA 1GIHA 2PWLA 3F2NA 5AP5A 3HDMA 2F7EE 3OROA 4FNWA 4J52A 4JT3A 2OH0E 3KK8A 3F5XA 3PP0A 3V01A 3VS0A 4ARKA 5C4LA 3UMWA 2KTYA 2J9MA 1LEZA 4FKLA 2QODA 1YWRA 5HU3A 1ZOEA 3QA8A 1AD5A 5LMKC 5BYLA 2ZVAA 4M12A 1DI8A 5E8WA 3G15A 5DLSA 2WO6A 1ZZ2A 4KIKB 3LIJA 4BDCA 2W7XA 2JFMA 2BDFA 4BIEA 4RX9A 3PXZA 2Y9QA 2QONA 2ITUA 2PZIA 3I0QA 5A3XA 4FKQA 1NXKA 3VBXA 2WIHA 4YZNA 2GHMA 3PG3A 5LWNA 1OIQA 5DPVA 2PUUA 4GT4A 4BVUA 4LGGA 3KULA 2UW9A 3U51A 4R8QA 4X2JA 5D11A 4WA9A 1H01A 2GPHA 4HGLA 4K0YA 3AOXA 4YZDA 3JVSA 2JGZA 2X1NA 4EOKA 5IA4A 4EI4A 4NH1A 3EN5A 4V0GA 4BHNA 2NRYA 2W06A 4MAOA 3QD2B 2E9OA 3ET7A 3KA0A 3EWHA 4CMTA 5IDNA 3ZFXA 4UV0A 4OTPA 5HLWA 4YUQA 2PPQA 5J7BA 2X9EA 2R7BA 4GL9A 1TQIA 3JUHA 3I81A 4FV8A 3RAIA 4IZYA 2VU3A 3DPKA 4FEQA 3VUKA 2G2FA 1QPCA 4I4EA 4IANA 1WCCA 3W2RA 3PFQA 4IACA 4NJDA 5EQPA 4K33A 3LCTA 4Y73A 5A4LA 4U0IA 2ZJWA 4CT2A 5C26A 4B8MA 2XJ2A 4X6QC 3KN5A 5E92A 4XV1A 3NYVA 2CNVA 2H96A 2XNOA 3PWYA 4OTHA 3GQIA 4L7SA 1J91A 3FI4A 3COHA 3IECA 5D12A 3SXFA 1JPAA 4QPMA 4XCUA 4NL0A 2IVSA 2YJSA 3FLSA 3Q4UA 3LQ5A 2PULA 4CG9A 4TYHA 2A0CX 4ZZMA 5LMBA 2I0HA 4H3BA 3AC1A 4WSYA 2VTOA 2O8YA 4EOPA 4G16A 5KMOA 5LXMA 1UKIA 1BUHA 3VS4A 4TWOA 1NY3A 3A7HA 2YITA 4D5HA 4IJ9A 4NT4A 3FXWA 2UW5A 2HWPA 5HLPA 1ZYSA 2R5TA 4D2RA 3Q9XA 2F2UA 3C4EA 1ZOHA 3BX5A 4PQNA 5F4NA 2XIXA 3AD5A 4S31A 4C62A 4CVAA 3FMLA 2QG7A 2ITNA 3BEGA 4DHFA 3UQFA 4RT7A 4QMQA 2XF0A 2JKMA 4NM3A 3DU8A 2NRUA 5GZAA 2CNUA 4FNZA 4O2PA 5EQYA 1YXVA 4N57A 2E9UA 3CY2A 4TYJA 2C0IA 5IUIA 3NIEA 4AW5A 5HU9A 3WZUA 3DNDA 3O96A 4IX3A 4W9WA 1AQ1A 4PMPA 4FV0A 4U40A 5AR4A 5CSPA 1G8AA 3F2RA 1WBWA 3PSCA 3RCDA 3G6HA 3AG9A 3DBDA 3P86A 4FTCA 2OF2A 4IQ6A 4XV9A 5HZNA 4PPCA 3LZBA 3RM6A 4AN3A 4K8AA 3LVPA 4AOIA 4CT1A 1L3RE 1OIRA 4YC8A 1YHWA 3OWLA 2Q0NA 3SXSA 4XHKB 3KXHA 4MXAA 4E4MA 3PIXA 3DJ5A 3RNYA 1NVQA 4YHFA 3VULA 4EZ3A 3OBJA 2W17A 3U4WA 5CEKA 2C3LA 3CC6A 1LUFA 3DKOA 3QXPA 3BKBA 4JS8A 3Q5ZA 4ASXA 4F9WA 4AN9A 2IG7A 1M2RA 1U54A 4AZVA 1Q8WA 2IVVA 5GNKA 1HCKA 3I5ZA 4H1MA 4ALUA 4BDAA 4ERWA 5I5ZA 2WQEA 3KEXA 4O0WA 4XEYA 4C2VA 4YJSA 2C6EA 5C8KA 3KKVA 2YWPA 5CSWA 5ICPA 5M55A 2VX1A 3GXLA 2OXXA 4HYSA 2YFXA 1OL1A 4M68A 4GEOA 3F88A 4BKJA 4ZMFA 5GINE 3DQWA 2HWOA 3TN8A 4BIDA 2ZV8A 3QTIA 4ZTSA 4LGDA 4GVAA 4TN6A 4BBMA 4HJOA 3RHXA 4F7JA 4U7ZA 3BHVA 5HNIX 4YURA 1BKXA 2IZUA 2HY0A 4R5SA 4DTBA 2OGVA 3CKWA 3K3IA 4PTEA 4MXXA 2VTJA 2C6DA 4GKIA 4IM0A 3WZKA 3CXWA 4F9BA 1IA8A 1Z57A 2VTPA 2WKMA 3FHRA 4M0ZA 4ZY6A 4CGAA 3TNPC 4E8AA 2R3GA 4FTTA 3BQRA 5I4NA 4MK0A 3UOJA 3O7LB 3LMHA 2VO3A 5I3OA 5EK7A 3DV3A 4ZJIA 5EG3A 4DBNA 3IW4A 2RFNA 1ZYDA 1H1SA 3QYZA 3QQFA 4CLIA 5BUEA 1Q8YA 3EZRA 4YJNA 4JOAA 4ZSJA 3ORTA 3T3VA 4DGLC 3HP2A 4ZSAA 3FWQA 3GOKA 4GUBA 2WAJA 2ETKA 3S95A 4F9AA 3ZUUA 1BL6A 2GHLA 4NKSA 3NDMA 1XKKA 3DNEA 5EYCA 4DH7A 4OTQA 3S3IA 2BCJA 4H05A 2J0KA 4ZSLA 4E4LA 5HI2A 4PX6A 3NUXA 4BDFA 1ZYJA 3DGKA 4DFBA 1ZY5A 4RJ6A 4L43A 5CAPA 1RW8A 4Z3VA 4Z7HA 4D1ZA 2CKEA 1VJYA 4AZSA 4QP7A 3VJOA 1NVSA 3FMEA 4I22A 1Q3DA 2XB7A 3O8PA 4JG7A 4AE9A 3REPA 4DLJA 1LP4A 3RPSA 4IXPA 4Q9ZA 3OHTA 1HCLA 3MB7A 4RIOA 1PXNA 4J8MA 3GFEA 4I23A 3KULB 3D5WA 1U46A 2VTHA 2IZSA 4AZTA 4O0VA 3N51A 5CVFA 4QP1A 4UYNA 3JY0A 3P5KA 4IVCA 4V0GB 3UC4A 4J96A 1Y8YA 4QTAA 3R9OA 4IIRA 4OW8A 4DA5A 1T45A 4G31A 5HX6A 3BCEA 3RCJA 3TWJA 4RVLA 2H9VA 2R64A 4XG8A 3EN6A 3D0EA 3E8DA 3HMPA 4HVIA 3AT2A 4IWDA 3SRVB 4A4XA 3PSBA 4ITIA 4JQ7A 2YCSA 2UZDA 3TUCA 4I1ZA 3PE2A 4DEIA 3NX8A 5L2IA 5IQEA 2NP8A 4QTBA 2J5EA 1XH7A 2EXEA 4D9UA 3PJ1A 1U5RA 2PY3A 4DN5A 5HGIA 1CTPE 5A6OA 3WE4A 1R39A 3G9NA 3AD6A 2YEXA 4NTTA 4AT5A 5IUGA 2Q0BA 2ZYBA 1KUTA 2GQRA 1H24A 4HOKA 2EB3A 2BPMA 4TWCA 3FPQA 2CKQA 2VX3A 1MQBA 4G9CA 4J1RA 3W10A 3TTJA 1YXSA 4RIXB 4YC6A 1GZNA 2VAGA 2BDWA 4EH5A 2YM6A 3UJGA 5J1VA 2Y6OA 3RZFA 4O81A 4MF1A 2PL0A 4XV2A 4D1SA 3Q96A 4L68A 2QU6A 4JX7A 5KMLA 4DG3E 1IA9A 1BYGA 4J8NA 2VO0A 4RVTA 2BZJA 3NNUA 2O63A 3HV6A 3KRXA 5EHLA 3VUTA 4BRXA 5IA5A 4IE9A 3PJ8A 4APCA 4A9UA 4ZZNA 5IZFA 4QMPA 4JL9A 2QOQA 5AV4A 4MH7A 2VUWA 2G2IA 3U8WA 3NVMB 3C5UA 4KKHA 1H26A 3MWUA 3QQJA 4KD1A 4KBAA 5D9HA 4OTFA 3E8NA 3CTJA 5IA2A 5HD7A 3QCSA 2VWVA 2XKEA 4H1JA 5HO8A 2H8HA 1M2PA 1T46A 2CMWA 3QRIA 1UU3A 1BLXA 4FZAB 3UDBA 3UZTA 3ZBFA 5GJFA 3GENA 3GU5A 1OKWA 4N4SA 5EM8A 3WE8A 4FEUA 4FTOA 4Y5QA 2W99B 4YU2A 3VBVA 2W05A 3QU0A 3N4UA 3EFJA 5AR2A 4GSBA 4AW0A 4BY9E 4KUJA 3OZ6A 4F1OA 2FYSA 4FT5A 3HV7A 2R3HA 4R3PA 3DBCA 4USEA 2BHEA 4WT6A 4JRVA 4FTRA 4PL5A 2OJJA 5DT0A 5KMKA 4D0WA 3IKAA 4KABA 3OCSA 3H9RA 2ZDTA 2GCDA 3C0HA 3LHJA 3BYOA 1H28A 3KMMA 4O21A 3PVGA 1TQMA 2BRBA 3PA3A 4HZRA 4QYEA 3W2SA 3NW7A 4ID7A 4JDKA 3O8TA 5C27A 5A4EA 1JSTA 4MXCA 5AUUA 4C4GA 3R71A 2GFSA 3EFWA 3LPBA 3P9JA 4GT3A 3PVWA 4LV5A 4RIYB 3FSKA 4B7TA 2BVAA 5AUZA 4CXAA 4KKGA 4GIIA 4IW0A 4QYYA 1Z9XA 3WOWA 2GNIA 4YJVA 5GZ9A 3ZMMA 1REJA 1W8CA 4K77A 2C1BA 4YR8A 5J5TA 2QOOA 5FTQA 3F3TA 3ODYX 4D4RA 4QMUA 5JKGA 3G0EA 4LGHA 2JIVA 4V04A 2WMRA 4O38A 3GU7A 5CZHA 3DOGA 1OBGA 3R7OA 3IW5A 4OUCA 3LCSA 4KAOA 4RQVA 3OXIA 3W18A 1BMKA 2X6EA 3PJ3A 3U9NA 3RBWA 2VZ6A 4FSQA 4FEWA 1UA2A 4O7TA 3WZDA 2PZRA 3AGMA 3HDNA 3G90X 4AZEA 2BZHB 3NZ0A 4GK3A 3HLLA 4FBXA 3ENHA 1PJKA 4G1WA 3PXYA 3BHUA 2WTKC 4YO4A 1G8SA 2ZM1A 2R4BA 3QA0A 3TV6A 3C4XA 2RSVA 5E1EA 4ACHA 3UIUA 3P1AA 4YJQA 5GJGA 2QCSA 1IEPA 3T3UA 5EI8A 5EKOA 4D2SA 5IMEA 2IW9A 4E6CA 2R3RA 1OUKA 4NW6A 3PJ2A 4YHJA 5LVLA 4FV6A 2HZ4A 4FV5A 3R7EA 4RWIA 3HZTA 3OW3A 4U97A 4AS0A 3Q4TA 4I0TA 5DA3A 2UZNA 3R7VA 4XP2A 2PYWA 3MGYA 4HCTA 3FI2A 2W5AA 5AR5A 2WQNA 3TNIA 3UC3A 4F6UA 3FLQA 3EQHA 5F20A 2VRXA 3BHTA 5K4IA 5DRBA 4U3ZA 4WSQA 3ULIA 1ERKA 3IW7A 2FSLX 3Q2MA 2W96B 2QD9A 1MQ4A 4JJRA 1KE6A 2P2IA 3W2QA 4HW7A 3BELA 3VN9A 5H8EA 4M69A 3GU8A 4AOJA 4ZK5A 4FV4A 5E7RA 4YSJA 5IQCA 4B9DA 4RFYA 4HYIA 2WTWA 4FTAA 4LUDA 4TYIA 3V51A 4B4LA 4FSYA 2BFYA 3OT3A 4YP8A 3VS7A 4PRJA 4FC0A 3VW8A 3SLSA 4JR3A 4AOTA 4JLCA 4O96A 3UO4A 1KOAA 5K3YA 3OFMA 1YXUA 3QRTA 5K4JA 3EFKA 3PXRA 1PMVA 3TNQB 5AFVA 3C7QA 4ZTLA 2OWBA 4YZMA 4C38A 2PVHA 4RFMA 1MUOA 2HZIA 4AP7A 3OVVA 4E5AX 2OXDA 5E8SA 4PDSA 4BCNA 4ACGA 4CMOA 2G9XA 4V01A 2YIXA 4E6DA 2VO6A 2VTMA 1KOBA 3COIA 1Q41A 4IVBA 4Q5EA 5FEQA 4Z7GA 5M08A 4BB4A 3SW4A 4XG3A 4KB8A 4MVFA 4OR5A 3BWFA 4KIKA 3P08A 4TWNA 3KREA 4IM3A 1FVRA 3FBVA 4QQCA 4C0TA 1O9UA 4I5CA 4BF2A 1PRYA 3MJ1A 3L9NA 1VEBA 2OIQA 4I20A 4I5PA 1P5EA 4I94A 4WBOA 3IK3A 5A4TA 2ESMA 2Z7QA 4QD6A 3RAHA 5HESA 3C4WA 4WO5A 4D58A 2ITOA 5LWMA 2W1DA 3ORKA 3Q2JA 2JLDA 3JYAA 4G6OA 2EUFB 1Y57A 4UXLA 2PZYA 2I0YA 4MBIA 5HTIA 4PP7A 4JDHA 3ANQA 4CYIA 1PXMA 4LMNA 4EHEA 2CHLA 4AT4A 3NUNA 4IVDA 3R21A 3HA6A 4CCUA 5EQEA 2B55A 3PY0A 5IF1A 4TPTA 4YJPA 3CTHA 4ORKA 2ZMDA 5GHVA 3Q6UA 3AMBA 3M2WA 4FV7A 3LM0A 3QFVA 4BCHA 4A9TA 4RWLA 4CQGA 2F7XE 1FMKA 3F9NA 5CYIA 3V8WA 2WU6A 3CQWA 5A14A 2PVMA 4BDDA 5KHXA 3F2AA 3HKOA 4PY1A 4AZFA 4ZY4A 3UTOA 2Z8CA 1WBTA 4RQKA 2YAAA 2QNJA 2REIA 3H9FA 3SOCA 5H8BA 3R9HA 2WIPA 4RC3A 4J98A 1Q62A 4A9YA 2ZM4A 2Z7RA 3DB6A 2HK5A 1KE7A 3PVUA 3FC2A 3IDPA 1ZOGA 5I3RA 4B0GA 3C4FA 3NYXA 4F08A 5JFVA 2QHMA 1H8FA 4RJ3A 3VF9A 3CS9A 2EXMA 5JFXA 4HVDA 2BTRA 5HVYA 3ELJA 4GYGA 5AUTA 2GNGA 4LRKA 5E8XA 3VNTA 1WVXA 5HKMA 3HRBA 5AP2A 3UIXA 4YPDA 2P3GX 1QPJA 4XBRA 3DBEA 5A9UA 3CY3A 4MBLA 3QQHA 1TVOA 4DGGA 3ZSHA 3OC1A 1IR3A 4PNIA 4F9CA 4IAIA 5CNOA 3L8XA 3OD6X 4GFGA 5DT4A 2X4ZA 4FTLA 4F99A 5FP6A 5B0XA 5D41A 5FP5A 4XP0A 3FPMA 1DI9A 1XQZA 4JDIA 5CSHA 3SW7A 2YIQA 2EVAA 4BDKA 3MJ2A 2XKDA 5DFPA 2CGXA 3ZO2A 5HLNA 2OO8X 4ZSGA 3TKUA 4AW2A 4FKGA 1XBAA 4P90A 4QMTA 4RX5A 3P7CA 2RF9A 2X8EA 3F5UA 1XH8A 4JBQA 5JZNA 3GNIB 3V5PA 5LOHA 4J7BA 5M4UA 5J79A 5DT3A 3OUKA 2UZBA 3ORPA 4TXCA 4JDJA 3GI3A 5LARA 4B6LA 4E4NA 4WG4A 1U4DA 4EOOA 4GG7A 4GRBA 4YGAA 4EH6A 4BN1A 1H00A 3OTUA 3BU6A 5BVKA 4WRSA 2XA4A 4I3ZA 1UU8A 4F7LA 4C59A 5L6OA 3LFAA 1PF8A 4MQ2A 4F6WA 2OJ9A 3SQQA 4E26A 4FIJA 2OZOA 2X81A 4U80A 3LXKA 4Y46A 5FXQA 2I0EA 4CKIA 4G2FA 3B2WA 4JR7A 3GBZA 4FOBA 4YC3A 3TT0A 4FA2A 4CNHA 1ATPE 5AV2A 2ITYA 3K54A 4FTQA 5BVEA 3V6SA 3QQGA 3IG7A 3TJDA 1XH9A 2HCKA 4FVPA 3GU6A 3TEIA 2XMYA 4ZMEA 4EUUA 3FKLA 3ZSIA 2DUVA 4PNKA 2W4JA 1VZOA 1UV5A 3IGOA 3VQUA 2C47A 2BIYA 3QUPA 5EM5A 4BWPA 5M07A 1K2PA 2YIWA 3QKLA 2GNLA 2VTLA 2JD5A 3AT3A 2VNYA 5BX0A 1FGIA 2CCIA 3LFFA 4QP8A 4Q9SA 3TM0A 3H4JA 3VHEA 2CGWA 2V22A 4E5WA 3ZO4A 5BNJA 3EQPA 1M14A 1ZYCA 3M11A 2JDRA 4NFNA 2DS1A 3Q4CA 4HCUA 2IPXA 3FMNA 2IN6A 2WQOA 4I0SA 4O0RA 4FIGA 4C4JA 4D28A 1ND4A 3ZM9A 4UMTA 1JNKA 2XCKA 2I6LA 4GH2A 4GJ2A 4I0RA 2BTSA 4S32A 4EWQA 1M7QA 4M69B 4DEEA 3KN6A 3GT8A 4XLVA 4XP3A 2UW0A 3HECA 3QCYA 3KQ7A 3DK6A 3SKCA 2RIOA 4W4YA 4S34A 3LMIA 3TDWA 3ZDUA 5K0KA 3AD4A 1I09A 2I1MA 3R28A 4CKJA 2Y7JA 2WTIA 3PIZA 4AAAA 1G5SA 4QMMA 5EI6A 2V62A 3UQGA 2C30A 3QUEA 4CV9A 4UMUA 5K9IA 1YHVA 2QO9A 1A48A 3N9XA 1UNHA 4IDVA 1GJOA 2O65A 1WMKA 4CTBA 2R3LA 1QPEA 5HEZA 2OFUA 3GC7A 5TR6A 3FAAA 3V3VA 4A9SA 2YM3A 4EOMA 2EB2A 2ITPA 4TYEA 4L8MA 2R3PA 4MWHA 1ZRZA 4HGSA 3VVHA 1E9HA 2XP2A 4LOOA 2OG8A 4FICA 4ANMA 3B2TA 4BC6A 2JDSA 4D2WA 2WMBA 3HV5A 2XNNA 5EI2A 1NA7A 4J95A 4CG8A 5AMNA 1UKHA 2BROA 3QCXA 4JG6A 3MFUA 4XOZA 5ITAA 1XR1A 3EHAA 1GIIA 3ANRA 1CDKA 3JS2A 4O0YA 4UMQA 4TTHB 1ZXEA 3DQXA 2B9FA 3BGZA 4RRVA 4ZTNA 5HBHA 2IW8A 3ZXZA 4NIFB 3OWPA 4MCVA 1RDQE 4BGQA 4FUYA 4GIHA 2VTAA 3IS5A 5HG8A 3ZC6A 3UPXA 2XIYA 3Q04A 2YCQA 4R1YA 3KRWA 4RC2A 5AUXA 4DFYA 3R83A 4GW8A 5HBJA 4OTIA 4EZ7A 3E64A 2PMNX 2PVFA 4L00A 2XBJA 3E5AA 4O2ZA 4WUAA 3SRVA 5BVDA 2W4KA 3EZVA 4XRLA 3Q53A 1UWJA 3K3JA 3LM5A 3UOLA 5K0XA 2R3JA 4HNIA 5DR2A 4WIHA 2YLEA 4C2WA 2ZV2A 4FKOA 2PE1A 4R1VA 5JGBA 3QLFA 5IQDA 4NZWB 5KUPA 4OAUC 2CJMA 4UWYA 5AJQA 4O7YA 3V5TA 4DFLA 2BILB 4HGTA 3QTXA 3IPHA 3QC9A 4FIEA 4RJ4A 4E5BA 2W4OA 3A7JA 2QVSE 5KHWA 4F7SA 4F70A 5KKRB 3E3BX 4C37A 3C0IA 4UBAA 5IUHA 5J7HA 2CGUA 3MW1A 3G6GA 4YO6A 3TJCA 4RIXA 5M06A 4IB1A 5CF4A 1JKTA 4X2GA 4QMOA 4PDPA 2HENA 3HAMA 3EQCA 2I7QA 2ZAZA 4BWXA 5ACBC 4FG8A 3EFLA 4P2KA 4XH6A 3SAYA 4D55A 4JIKA 2SRCA 3CGFA 3C50A 4EH9A 1M7NA 5CI7A 4A9RA 5CENA 4FSTA 3DKGA 4OTDA 3HMIA 4JIAA 2EU9A 4FTNA 2YZLA 1L8TA 1WBOA 3EN4A 4RA5A 3CBLA 4YLKA 3H0YA 4TYGA 5TT7A 4HVHA 2VX0A 3MV5A 5DEWA 4X6RA 1J1CA 2IVTA 1H1RA 4I6QA 5CU3A 1DAYA 3OXZA 4QTDA 3DA6A 3NWWA 3R01A 4I21A 3FMDA 4DF3A 4RWJA 2CKOA 3EQRA 1ZMVA 3OCGA 5IQAA 1SZMA 4NSTA 2BR1A 2OJIA 1YW2A 3P78A 4MNFA 4DTKA 3KVXA 1YRPA 4IJPA 3NW6A 1XO2B 3B8QA 2HZ0A 3QTSA 4PMSA 4PTGA 3V5JA 4RZWA 3BPRA 5CF8A 3SDJA 4P5ZA 4G34A 4XMOA 5CY3A 4QQTA 3DFAA 4C02A 4IX4A 4BHZA 5E8TA 3WIKA 2HXQA 1E1XA 2GHGA 4DYMA 3ROYA 3IO7A 3S2PA 4NKAA 4EOQA 2R3KA 3TDVA 5DYJA 3DXPA 4DAWA 5JMSA 4FIIA 2DQ7X 2VTNA 3BZ3A 4WNOA 3LLAA 4N70A 4YTFA 3PUPA 4O0SA 2VN9A 1ZMUA 3G33A 5L2QA 2XNEA 5HHWA 2X2LA 3HA8A 3UNJA 1JVPP 3MH3A 4IEBA 4M66A 3PWDA 1UU9A 4R5YA 4RIYA 3MY1A 1YWNA 4GKHA 3EQIA 4B99A 2XKCA 4CSVA 2G1TA 2G2HA 5HBEA 3BRBA 5KMMA 3E93A 5BMMA 3VHKA 2CLQA 1GY3A 3TV7A 2JBPA 2VGPA 4EQUA 4BWKA 5JGDA 2WTVA 5AAFA 3DAKA 2HIWA 3KF7A 4MD9E 4UYAA 3TG1A 1OPJA 4FKUA 3UOHA 4EC8A 4J99A 1OPLA 3V5LA 5CLPA 5J1WA 4XV3A 4EH4A 4F1TA 5JRQA 3C51A 4ANOA 4IB5A 1PY5A 5LVNA 3P7AA 4OGRA 3C1XA 4BI0A 3PG1A 3TI1A 4FL1A 4D2PA 3LXNA 3KXZA 4IBMA 1PKDA 4AGDA 1Q3WA 2W1ZA 4IHPA 3SV0A 3OG7A 4X3FA 3FL5A 3D7TB 2O5KA 3EIDA 3GGFA 3QD4A 2XJ0A 4AN2A 5CEQA 4L53A 3BYMA 1OITA 4H39A 4WKQA 4F0FA 3HRFA 2R3QA 2WXVA 3BLHA 2UZEA 4WNKA 3ZXTA 5FDXA 4WHZA 2XK3A 2B7AA 2FUMA 3ZZWA 5HX8A 3HYHA 3VS5A 4QPSA 3UIBA 4C4EA 3R9DA 3I1AA 2AUHA 2FH9A 3HNGA 4EJ7A 4I93A 4RLLA 3JVRA 5FXSA 4FTUA 2VWUA 1O6LA 2QOBA 1JBPE 3R2BA 4BTFA 2ZV9A 3LQ3A 4CV8A 3DXNA 4F0GA 4BDEA 4XX9A 3H0ZA 3CR0A 4IZ5A 5HNGA 3MIYA 4DFNA 2F7ZE 3ALOA 5HOAA 3IDBA 2ZOQA 1F0QA 3ZLXA 1Q97A 4U8ZA 4DE4A 2WPAA 3OBGA 2WGJA 4FSUA 4G5JA 4YLJA 3P0MA 3TUBA 3CJFA 4CTCA 3AMAA 1OKZA 2WZJA 5J95A 4LG4A 1J7UA 2V55A 3MI9A 3L1SA 2QU5A 3SHEA 5CXHA 5HG7A 3WZEA 3M1SA 4HYUA 3RINA 3CSVA 2QG5A 3ZLWA 4C36A 3VRZA 5AA8A 5D10A 1UNLA 5EYDA 4K18A 4E1ZA 3KRRA 1R3CA 3CCNA 4WRGA 1WFCA 2PHKA 5DRDA 3WF9A 2BZIB 3T9TA 4RC4A 3EJ1A 4U42A 1Q5KA 4K11A 2VV9A 2GDOA 4FVRA 4QP3A 4QNYA 3VAPA 4PL4A 2BAJA 5EDPA 3I7BA 4CFVA 4JNWA 3ZRMA 4C3PA 4BCKA 3ZOSA 5CVHA 4EL9A 1WAKA 2R9SA 4LI5A 5HG9A 2QOLA 5LMAA 4X0MA 2JIUA 1FMOE 3BQCA 3FKOA 4IZ7A 4J53A 3D83A 4FTIA 3D5UA 2R3NA 5IQHA 2V7AA 3Q9YA 4R7HA 5E1SA 5BVFA 4CRLA 2PVYA 2C5XA 2HXLA 3R7UA 3V6RA 5D7AA 4YZBA 3UVPA 4QMZA 4D2VA 3DBFA 2WMXA 3NAYA 4HCVA 4WNMA 5EW9A 3ZFYA 5JGAA 3GEQA 4F7NA 1X8BA 3QKKA 4O7RA 2IO6A 2R3FA 4FSRA 4AWIA 2X8IA 4K6ZA 3U9CA 4G3CA 4XG4A 5KCVA 4QP6A 4BCFA 2CSNA 4EZ5A 5AX3A 2BRHA 3L9LA 4C57A 5G6VA 5I9ZA 3I0OA 4APPA 3R1NA 4G17A 4JBOA 3CEKA 4UMPA 4BFMA 2IZTA 4TY1A 4U5JA 4ZZOA 3VS3A 3II5A 1ZLTA 1JKKA 2XK4A 4O7WA 5CT7A 3RK7A 2C0OA 2I0VA 2BRMA 3UODA 3ORXA 3QTQA 4BYJA 4UZDA 4FYNA 3VS1A 3ZC5A 4BYIA 5JZJA 1JSVA 3QQKA 4ZTQA 4PDOA 3TNHA 3QXOA 5J87A 4LL5A 3SX9A 1OL7A 3DLSA 3GU4A 5E90A 2C6OA 3GC0A 5FLFA 2Z7SA 4IM2A 2C6MA 2B9HA 4YJRA 3ROCA 3VBQA 4QP9A 4DT8A 1JAMA 1XBCA 5E8ZA 2OIBA 1Z5MA 2AC5A 1R0PA 3QTUA 4TZRA 4F63A 3EQDA 3EN7A 4GG5A 3HUBA 2XJ1A 2A27A 1Q8TA 3QQLA 2HW6A 3BEAA 3QTRA 5HVKA 4MBJA 1KE9A 4X3FC 2I40A 2XCHA 2QOHA 3G9LX 4FG7A 1J3HA 3BGPA 5AP1A 5JN2A 4GK2A 2E9PA 3LFCA 3EL8A 3EL7A 3LFEA 4CFNA 1R1WA 2WD1A 4PTCA 4GU9A 4WD5A 5CZIA 3TACA 1ZYLA 3F3ZA 4RWKA 4YNEA 1I44A 3AQVA 4QMVA 4S30A 4DINA 4P4CA 1URWA 2VWXA 4FL2A 3WYXA 5F95A 5AV3A 3OY3A 5HVJA 4NJ3A 3GC9A 4YBKA 3I5NA 2WMWA 3G51A 1W7HA 2WOUA 3R9RA 3TIZA 2VWYA 5CAUA 2VWZA 2QKRA 5DNRA 4ITJA 2YISA 3WBLA 5A6NA 4JRNA 3NNXA 4DEDA 4ZLOA 3BU5A 2XZSA 3Q9WA 4BTKA 3R1YA 4L44A 5L6PA 5DBXA 3ATTA
chains in the Genus database with same CATH superfamily
4L45A 3R8MA 3RVGA 3DJ6A 5DN3A 4XYFA 3R8UA 4AQCA 5KE0A 1PKGA 3FKNA 3OTVA 3PDTA 4U81A 5EYMA 5L8JA 1RJBA 3BYSA 4FZ7A 3ZEWA 4A06A 4IAFA 4RIWB 5FEDA 1YXTA 3O17A 3WF5A 5AADA 4MXYA 3KXMA 4O7SA 2VWWA 4XG7A 2WTDA 2YM8A 3LAUA 4QQJA 2OH4A 3BV2A 4X3FB 2NNWB 4BGGA 2QOKA 2NPQA 5EM7A 3RHKA 5E4HA 3DTWA 3BYVA 4C3FA 3FMKA 4WUNA 4U43A 1KWPA 1MRVA 4ZSEA 2RFDA 5F9EA 3UQCA 4FOCA 2JKKA 3VIDA 3GVUA 1H1PA 3QGWA 4DGOA 3ZUVA 2YWVA 3O71A 2R7IA 2ITQA 4JAJA 4D4VA 3AC3A 3V8SA 1P4OA 4PWNA 5KZ0A 2BZKB 2CNQA 2E9NA 2VGOA 4MF0A 3QRUA 2EWAA 4BKZA 5HE0A 5LCJA 2B9IA 3U6HA 4O7VA 3FLWA 4M15A 3KC3A 2JAVA 1FVVA 1K9AA 3DS6A 4LQMA 4MHAA 5FWKK 3QL8A 2BFXA 3LW0A 4JG8A 4EYMA 5LJJA 3O5AA 4QDVA 3QWKA 5CVGA 2O0UA 3NGAA 5CSVA 5IA3A 5J5SA 2HW7A 4X2NA 4E73A 2VTRA 3PPZA 5HNBA 4QYHA 4EUTA 3UZPA 3E87A 2C0TA 4GK4A 4ACCA 5E8YA 3I7CA 4FT9A 2FA2A 2Y0AA 4IZAA 3UNZA 2XRWA 3I4BA 4KS8A 3RGFA 3ZSGA 4I6FA 3R00A 1F5QA 5AX9A 3DKFA 4D9TA 5AAGA 5IH6A 3V8TA 3TMOA 2JBOA 2GSFA 3FJQE 2HZNA 1XHAA 3S4QA 3VUDA 4L3JA 2J0LA 2PMIA 5HO6A 3WF8A 4RJ7A 4JX3A 5CX9A 3WIGA 2PMOX 2C3JA 3P4KA 2OF4A 2QI8A 4EOIA 3D9VA 1LEWA 2GS2A 4NM0A 3RP9A 5ANIA 4FV2A 4BCGA 3UDSA 3KCKA 3W0NA 3R7YA 5IA1A 5CEMA 1B39A 1F3MC 3R8VA 3DKCA 3ZTXA 3FMJA 3LJ0A 3NR9A 2C6LA 5AP7A 2QR7A 5IQBA 3PLAE 4Q5HA 1XJDA 3FDNA 2C69A 2PZPA 4F6SA 1YVJA 3HMOA 3ZLYA 4I5MA 4EK8A 2VTIA 3DLZA 3IONA 4S2ZA 5L2WA 2V5QA 2CN8A 1PW2A 4ZS4A 3MFTA 2FGIA 3Q32A 4NIFA 3MYGA 4K1BA 4FUXA 3SG8A 2RG5A 4L46A 4NM7A 3ZU7A 5A4QA 3IW8A 4L3PA 3DY7A 4FKPA 4H36A 2O64A 4X3JA 3MBLA 1OKVA 4CRSA 4RX7A 1V1KA 3F69A 3GCPA 2VTTA 3RPOA 2C4GA 4FGBA 4OTRA 3L9PA 3NCZA 3VUIA 4XBUA 2J5FA 3D94A 4NEUA 4DGMA 4DG2E 3BBTB 1U59A 4C4IA 3R0TA 4M7IA 3DAEA 4FGRA 4BZDA 1WBNA 3G5DA 4U6RA 4Y72A 5AA9A 1EH4A 3KY2A 4NW5A 4PV0A 2OICA 4ASDA 2VD5A 3PP1A 5TO8A 4ZJVA 3DFCB 3QZGA 2C5YA 3FMMA 3VBYA 3BBWA 4GMYA 3QCQA 5HIEA 3FQSA 4EONA 2BRNA 5AIKA 2W1IA 4QPAA 3ZO3A 2PMLX 4DFXE 2BAKA 4FKWA 4CFMA 3FQHA 5ANEA 4TKSA 4YJTA 5JRSA 4GS6A 1H4LA 1SNXA 2PSQA 4FODA 4OBPA 3TV4A 4AFEA 1WZYA 4CFWA 2ZFYA 1RQQA 1Q8ZA 3ACKA 4X21A 4ANLA 3ZUTA 1E1VA 1XH5A 2C6TA 3MY0A 4FZFB 4ZP5A 3KIOC 1GOLA 3KXXA 5C9CA 4AX8A 3BLRA 1ZARA 5KMJA 1R0EA 4XG2A 4FZDB 5T3QA 1B6CB 3ZONA 2OZAB 3PE1A 2Y6MA 4NTSA 4AA4A 3NYNA 4F9YA 5FDPA 2WU7A 2QKWB 3Q9ZA 4USDA 3NEWA 5IU2A 3L8SA 3HEGA 2W0JA 4O1OA 4FT3A 3QRJA 2YM4A 2UZVA 4F65A 4KNBA 3W0PA 4I24A 2XS0A 1M52A 4AA0A 5IG1A 3CPCA 3PVBA 5AIRA 3RJCA 4QMLA 3I6UA 3NPCA 4M3QA 3WF7A 3GP0A 1PXPA 3GC8A 4ANQA 3IOPA 4AF3A 3FI3A 5DI1A 5KZIA 4EWHA 3T8OA 4KRCA 2E2BA 3KB7A 5AR3A 3DZOA 2XYNA 3FV8A 1OECA 3MTLA 4KIPA 4RVKA 5EDRA 4FKJA 4F0IA 1GNGA 1OB3A 1PMNA 4W9XA 2YACA 2XBAA 4ANSA 2VTQA 4DC2A 4BKYA 2ITTA 5AP4A 2GQSA 2WTCA 4ZJJA 4W4XA 4JBVA 2KULA 2HYYA 3EQBA 3O23A 2W1HA 3VS6A 4A4OA 3FLNC 4Y5HA 2OU7A 4GT5A 1YOMA 3O8UA 4L01A 3MH0A 3TIYA 4D4YA 5AV1A 3KF4A 2VTSA 3BYUA 5GJDA 3F61A 4CFFA 4N0SA 1W0XC 2WMSA 2YM7A 5HORA 3ULZA 4KA3A 5ETIA 4EJNA 2QOIA 2C3IB 4ZOGA 3RAKA 1XH6A 5LVMA 3E7OA 5F94A 1KE5A 4GFOA 5T6KA 4MYGA 3MESA 3W8QA 1BL7A 2ETRA 3RNIA 4N6YA 4U45A 4DFZE 2QQ7A 2OBJA 3PLSA 4QMSA 5FGKA 3U55A 2Q83A 3BU3A 3ORIA 2ETMA 3IQ7A 3FYJX 4I4FA 3LFQA 1XBBA 2WMVA 1DS5A 4X2KA 4AAYA 4NFMA 4EKKA 4O7NA 2JAMA 3LXLA 4KRDA 2OFVA 5C01A 5C8MA 2HY81 3UO5A 4B8LA 3OOGA 3LJ2A 3ZLSA 3A61A 4C7TA 2ZMCA 3LFBA 3MFRA 3O7LD 4ALWA 2XALA 4FT0A 3TZ7A 2RFSA 3JY9A 4LM5A 1H25A 5CF6A 5EKNA 2NO3A 1PYXA 5HE3A 4QRCA 3W16A 2UZWE 5KMNA 3NVKI 3KGAA 1KSWA 5I9YA 2YLFA 2UVXA 1ZAOA 3W32A 4L7FA 4UN0C 3D7TA 2OXYA 2J2IB 5CALA 5IPJA 1SVEA 3QZFA 5DHJA 4HYHA 4YJOA 3RK9A 3UVQA 1QPDA 4CZUA 4HGEA 4Z55A 4WG3A 2XK9A 3ZRKA 1NVRA 3P5JC 5GZ8A 4KIQA 4EOSA 3KFAA 3MVHA 2PVLA 4AA5A 4DH1A 5CAOA 4O0UA 3ZHPC 3CPBA 5J9YA 4FL3A 4ZLYA 3FZTA 3TXOA 2BMCA 3PSDA 4DCAA 3E63A 3HUCA 3MPMA 4Z16A 1SNUA 1JQHA 1REKA 3QYWA 3W33A 3ETAA 4RFZA 2XIKA 2ACXA 4TW9A 4O86A 2Y4IB 1YOJA 2BALA 4ZLZA 3A4PA 4MD8E 2RL5A 5GIOE 1JLUE 5HIDA 2UVZA 2J0MB 4JXFA 3UVRA 3U4UA 3PA5A 3S1HA 4DH3A 5A4CA 4LMUA 1VYWA 4QMYA 3V5WA 4IADA 2GNJA 3CTQA 3FE3A 4C33A 3KMWA 3UG1A 3R1SA 3VO3A 5KKRC 3L9MA 1PXJA 2BHHA 1S9IA 5L4QA 3FSFA 3VONA 3FZ1A 3LQ8A 3AGLA 4IWQA 3BE2A 1V0PA 3EYGA 3PZEA 2Y8OA 4FT7A 4RMZA 4BDBA 4FTMA 3S00A 1BX6A 2QLUA 5EH0A 1AGWA 3OCTA 4CKRA 3D2KA 3OCBA 2LGCA 3D5VA 4II5A 3F66A 3UIMA 3CQUA 4UALA 4BDJA 1JOWB 3RZBA 4XNEA 5ETCA 5M56A 1S9JA 2PVKA 3FEGA 3THBA 5CAQA 4QMXA 5TE0A 4Q2AA 1CKIA 2ZB1A 3L8PA 3AC8A 3O0GA 3OUNB 2X4FA 3KRJA 4FF8A 5EW3A 5B2MA 5IQFA 4FI1A 2ITWA 5M4FA 3FXXA 1YDRE 2PE0A 4H3QA 4G5PA 3TCPA 4HNFA 3AMYA 3VF8A 3UYTA 5HCZA 1LR4A 2UW4A 5B7VA 4IH8A 4MTAA 4BJJB 4FKVA 1VYZA 4KBCA 5CI6A 3ZRLA 3QF9A 2ONLA 5ANJA 3P7BA 4D5KA 3QQUA 4MXOA 2UZOA 3LFDA 1WVWA 3R1QA 4U44A 2XUUA 3R04A 3KXNA 2IWIA 2B4SB 3DB8A 5DG5A 2W5BA 3W2CA 5C8NA 1W2CA 2B52A 4XOYA 4PDYA 2WHBA 3C0GA 2BUJA 4TNBA 3NAXA 5DIAA 2P0CA 3QRKA 5FEEA 2UW7A 4QYFA 5M57A 4QP4A 4CYJA 3JR1A 2JITA 2J0IA 3HX4A 4FSZA 5BQ0A 2XK8A 3UP2A 4DH5A 3QD0A 3FZRA 2R0UA 2JKQA 4BCMA 2WMQA 5E91A 2JEDA 5IISA 2X39A 5AAEA 2UVYA 5FTGA 2R2PA 3P79A 2HAKA 2QO7A 2WQMA 5CNNA 2BKKA 2R3IA 4U79A 4FTJA 1FBNA 5FD2A 3K2LA 2ZM3A 4QQ5A 3UBDA 4LRMA 3ZH8A 3IGGA 4IX6A 4I41A 5DH3A 5AEPA 1Q4LA 3QD3A 1XH4A 4YLLA 2XEYA 2CKPA 5BVOA 3NSZA 4RPVA 3QHWA 3VUHA 1SYKA 4S33A 3MIAA 4DFUA 3DAJA 3ERKA 2W1CA 3BGQA 5AR7A 1OIYA 5FBNC 3VJNA 3D5XA 3QTWA 4O22A 5K5XA 5AM7A 5LCKA 5JH6A 4ZXTA 4XJ0A 3UGCA 2V0DA 3MTFA 4BCIA 4EK4A 2GU8A 4IFCA 5H3QA 4MUQA 2PK9A 4QNAA 3L8VA 4EKLA 3PA4A 2V7OA 3FC1X 4Y8DA 4JQ8A 4RX8A 1WVYA 3LJ1A 3NNVA 1GZ8A 1PXLA 3V04A 5H8GA 4DLIA 4KWPA 3TNWA 5EFQA 5DVRA 5JFWA 1RE8A 4L42A 5ANOA 2JC6A 3UNKA 5D7VA 3MPTA 4AGUA 1MRUA 1TKIA 3BE9A 2UV2A 5AM6A 1QMZA 2B1PA 3LCKA 4BCPA 1FGKA 5EOBA 4E6QA 4HPTE 2JFLA 2XAOA 2UW6A 4BDIA 5IEXA 2PE2A 1Q61A 2OSCA 3Q6WA 1H0VA 1UU7A 4GU6A 3NS9A 4FKIA 4RSSA 4Y95A 3F5GA 3C9WA 4TRLA 4QT1A 4UY9A 5ETFA 3HMNA 3ZFMA 5L3AA 3QLGA 4G3GA 5FUTA 5H2UA 2WTJA 3KCFA 3PXQA 2QR8A 1M17A 3W1FA 4LRJA 1YKRA 4O7ZA 5ACKA 4AE6A 4O0TA 1GZOA 3R30A 1SVGA 2BKZA 4XG9A 5AUYA 4FG9A 5KNJA 3GCVA 4ZIMA 3QAME 4C58A 4HVSA 2QOFA 5J8IA 2A2AA 4A4LA 5CANA 3VW6A 4JBPA 4EK5A 5HE2A 4F1MA 4FV3A 3EH9A 5HCYA 2FVDA 2XANA 3A7FA 4NM5A 5EOLA 3WYYA 5L6WL 4DG0E 1OUYA 5CF5A 4IWOA 5CQUA 3NFGB 1KE8A 3LMGA 3HGKA 4M97A 3R2YA 4EH3A 3D4QA 4DH8A 5ETAA 3FL4A 2FSTX 2WB8A 5IH5A 5IA0A 1CSNA 5G1XA 2G15A 3ENMA 4J71A 4RIWA 5H9BA 2WMAA 4Z9LA 4YTCA 3IOKA 4N6ZA 1P4FA 2IVUA 2J90A 1YQJA 2JIIA 3F3VA 4NWMA 2PZ5A 1A06A 2WFYA 2X2MA 4AU8A 1W98A 1PXKA 1LPUA 3TTIA 1YDSE 5AP3A 4UB7A 5HTBA 4P7EA 5AR8A 3RM7A 5M53A 3GCQA 4KS7A 4WBBB 4DGNA 3WI6A 2UZUE 4EH2A 3ALNA 2UW8A 3WF6A 3SVVA 3BI6A 4QOXA 1CMKE 2YJRA 3RI1A 3PTGA 3WZJA 2ONLC 4V05A 4C3RA 3LFNA 2A1AB 4FKTA 3PZHA 1J1BA 4OLIA 5CU6A 4E93A 2O2UA 4F09A 4IAKA 3E7VA 1G3NA 3AXWA 3BV3A 3CIKA 3UDTA 1WBSA 4BCOA 2B9JA 1KV1A 3COKA 4BCJA 4EQCA 4RVMA 1IAJA 4EOLA 5HE1A 3CLYA 5B2LA 5HO7A 4FK3A 2RG6A 3AKKA 4ZTHA 5GIPE 1CKPA 3HV3A 4RZVA 4R3CA 3GOPA 3UE4A 4C4FA 2UUEA 1PXIA 1Q24A 4GUEA 1JKSA 4F78A 3I6WA 2HOGA 4H3PA 1JWHA 3C4CA 5L8LA 4UX9A 2YCFA 1H08A 3MH1A 3ORNA 3PYYA 5DR9A 3UYSA 4ANBA 5BPYA 4R7IA 2CLXA 3P23A 4QEBA 2QOCA 4ZEGA 5J9LA 1DAWA 1K3AA 5CU4A 3U6JA 4MWIA 5KX8A 4EH7A 4USFA 1QCFA 5C1QB 1OVEA 4GV1A 4HVGA 3MS9A 4BI2A 3A4OX 1UWHA 1ZWSA 3SOAA 3K5UA 5JFSA 2X7OA 5CWZA 3KVWA 4I5HA 2CN5A 3QTZA 4FX3A 4YSMA 1SM2A 3A7GA 4BIBA 4OAVB 5HD4A 3RPRA 5BVNA 2E9VA 4M0YA 1FPUA 2YIRA 1FQ1B 4X7QA 3EKNA 3EQFA 5AWMA 3F82A 4BICA 3KL8A 4AT3A 2XIZA 3BLAA 2OJFE 1MP8A 3NW5A 3OWKA 1P14A 5C03A 4DEBA 4NU1A 2CCHA 5A46A 4AXEA 4G6NA 1JSUA 2DYLA 4UMRA 5BYYA 2LAVA 2HELA 3POOA 4PMTA 1W84A 3Q3BA 1OL2A 3DK7A 2C6KA 3OOMA 2YDKA 3FMHA 3LXPA 3Q5IA 1QL6A 2VO7A 5TOZA 4E4XA 3UMXA 4D4SA 5JQ5A 2CGVA 2UW3A 3EOCA 2P33A 3FZPA 3PIYA 1YOLA 2PVRA 4CEGA 4EHGA 4AUAA 4EOJA 4R77A 4BR3A 4LV7A 4LOQA 5IDPA 3MY5A 5E8VA 1XMLA 5FBOA 4GCJA 3TZMA 4GYIA 4BL1A 1OL6A 1W82A 4PL3A 1HOWA 4DDGA 4FNYA 1DM2A 1FVTA 1A9UA 3BHHA 3E92A 3FZOA 3FXZA 3AC2A 4OBOA 5AUVA 4A7CA 2XM8A 4RA4A 4O91A 4RJ5A 5HTCA 4FK6A 4IVAA 3OP5A 3EQGA 4FVQA 2C5NA 3BLQA 3QZIA 3BHYA 4G9RA 3DT1A 3ZYAA 4EK3A 3KU2A 3O51A 3DDQA 2QLQA 3I79A 3KRLA 3KMUA 4HPUE 4L9IA 4QYGA 5T68A 3RMFA 1NT2A 3HVCA 5I9WA 4TYHB 2X0PA 3KK9A 1IRKA 3E3PA 3V5QA 4ZAUA 3ACJA 5DGZA 4RGJA 4YZ9A 2J0JA 3DJ7A 5EHOA 2OI4X 3ATSA 3U87A 4RG0A 4DBXA 3R8PA 3OY1A 4MNEA 2W9ZB 2YAKA 3G0FA 3AC4A 3PUFC 3HP5A 4PMMA 3LLTA 3FLZA 5CTPA 3VUGA 4ASEA 3MVJA 3W8LA 4PPBA 4Y83A 4NUSA 5M09A 5ANKA 4G3EA 5I0BA 3NIZA 4YHTA 5C4KA 4FSMA 3BL9A 2AC3A 2J6MA 5HCXA 5IQIA 2OZAA 1OL5A 4BZOA 5JT2A 4O83A 2PTKA 2XH5A 3K5VA 3PY3A 4AW1A 3MH2A 3FZSA 4P5QA 4UXQA 3R73A 4XLIA 5DR6A 1GAGA 3ITZA 4D0XA 4ENXA 4C34A 3ZO1A 3NRMA 4FZ6A 2PUIA 2WEIA 4QDEA 1M2QA 1Y6AA 1VR2A 5FXRA 4LYNA 4ACDA 3CJGA 2C3KA 3ORLA 4CCBA 3OMVA 4IFGA 3R9NA 4JI9A 1CKJA 2QHNA 4OT5A 4U9AA 5AV0A 3R6XA 2Z60A 4BDGA 5I9VA 1V0OA 2WELA 3DTCA 2QURA 4O1PA 3ZDIA 3NNWA 2A19B 4O4EA 4K9YA 5CQWA 4AG8A 3SXRA 4QMNA 3WILA 3Q4ZA 3H10A 3MN3A 2X2KA 5DWRA 5BV3A 5EYKA 1OMWA 1G8KA 1XWSA 2YHVA 4IAAA 4AGWA 5EDQA 3E8EA 4UEUA 3VBTA 4G3FA 2C6IA 1APME 4L3LA 4IDTA 3R7GA 2JDVA 4C61A 5FM3A 3RTPA 1OM1A 5IKWA 5CU0A 1CM8A 2GS6A 4H58A 4FMQA 3VRYA 2OIDA 4R3RA 1U54B 1B38A 4YJUA 5A54A 3ID6C 4IAZA 3FY2A 4BTMA 3MVLA 4YMJA 4EHVA 4O27B 3QZHA 5FQDC 4LL0A 1PMEA 3NUSA 4X2FA 4ERKA 2F4JA 2FSMX 4ASZA 2YDIA 1UVRA 4A07A 1IG1A 3S0OA 3OW4A 1SMHA 1NW1A 4G6LA 1TQPA 4ZS0A 2UZTA 3UG2A 2YIYA 5KBQA 4FNXA 3UP7A 3Q60A 3FUPA 3A60A 4YTHA 4QTEA 4ZTRA 3IDCA 5AP6A 1STCE 2XVDA 3FI8A 3COMA 1FINA 4EH8A 2BAQA 4EBWA 2F49A 3W2OA 1H1WA 3ORMA 4C8BA 3CD8A 3QGYA 5E9EA 1O6YA 3OEFX 3PRIA 3QWJA 4OTGA 4AXAA 4AZWA 1H27A 2IW6A 2XEZA 4YTIA 1BI7A 2ITZA 2OK1A 3DZQA 3HRCA 4KKEA 4R6VA 5BYZA 3LCDA 1Y8GA 2X7FA 5KMIA 4KBKA 3U6IA 2YZAA 3OEZA 3GQLA 4W4VA 2VWIA 3T9IA 3PXFA 3F3UA 5L2TA 3VQHA 2AYPA 2F2CB 2XRUA 5BUJA 1URCA 5KO1A 1OIUA 3GCSA 1YDTE 3C4ZA 5IMXA 3UZRA 3IW6A 4FIHA 2W1FA 5HQ0A 1PHKA 5KBRA 4L6QA 2B54A 4M14A 3NCGA 4TT7A 5DEYA 3G2FA 4L52A 5FG8A 2YM5A 1Y91A 4ALVA 4ANNA 1H0WA 2ERZE 2OJGA 4L67A 4I6HA 1YI6A 2EXCX 3GUBA 4IX5A 5CEPA 2JDOA 4U41A 2YA9A 4FRFA 5DE2A 4BDHA 2XK7A 3HAVA 4PF4A 3B8RA 2W9FB 3HL7A 4HZSA 4OT6A 2WMTA 5AUWA 4C4HA 4KSQA 2IZRA 4FE2A 3D2IA 3POZA 3SD0A 3HV4A 2XNMA 4BGHA 4DEHA 2P55A 3ORZA 4GVJA 4WG5A 4XUFA 5JK3A 3DXQA 5LQFA 5L2SA 4NCTA 2XIRA 2FSOX 2Y4PA 4EEVA 5CXZA 3VC4A 1PYEA 4GJ3A 2WQBA 3C13A 3PXKA 1ZY4A 4FSWA 4IB0A 4UWCA 4ITHA 3TKHA 4PP9A 4LFIA 3WARA 3SG9A 1GIJA 4NK9A 4CD0A 3NLBA 4DITA 4C35A 3TL8A 2GTNA 4CLJA 1V0BA 2WEVA 3R7IA 4JQEA 5EHYA 3UO6A 2YABA 2WMUA 5JQ8A 4YPSA 3NUYA 3MA3A 4LOPA 3VBWA 3UOKA 3GB2A 5AP0A 4CMUA 4IB3A 4BZNA 4ZY5A 4M67A 3CGOA 3RPVA 3I60A 3RPYA 4ENYA 3F7ZA 3UPZA 2WTKB 3Q52A 3D15A 2CPKE 1O6KA 2ERKA 5CT0A 3A7IA 5EM6A 2ZV7A 3NUPA 3FY0A 4IC7A 4KINA 3TZ9A 4IMYA 2C68A 1Q99A 3D14A 3GCUA 4WNPA 4MD7E 3FQEA 4FTKA 2RFEA 3QUDA 3JXWA 3QBNA 2G01A 2F9GA 3E8CA 3NYOA 3OXTA 4AACA 3M42A 4FV9A 2YDJA 3FHIA 2ZB0A 3R02A 5M51A 3MVMA 4O7LA 4BJJA 5IQGA 4BBEA 2J50A 5J9ZA 3A8WA 3QX2A 4W8EA 4AFJA 4O82A 3NMUF 3NUUA 3DDPA 4LUEA 3EYHA 2OW3A 5ANDA 3QKMA 3ZS5A 3W0SA 3ODZX 5M44A 5BMSA 3F3WA 3ZCLA 3O50A 2RKUA 5IEVA 4XS2A 5I9UA 4FKSA 4O6EA 4FIFA 4PPAA 5CEOA 2B53A 3HMMA 2ITVA 2XKFA 4EC9A 2GNHA 5BVWA 3CD3A 4BI1A 4MNEB 3SA0A 4QP2A 4JMQA 2J7TA 3DBQA 4EBVA 3KXGA 3EB0A 3MA6A 2QO2A 4CFUA 4JVGA 4DHJA 1BI8A 2X0GA 2A4LA 2W1GA 1IAHA 4I6BA 3R63A 5I9XA 4G3DA 1JKLA 3W2PA 5CS6A 3TZ8A 4LV8A 1YWVA 2ZDUA 1MRYA 3GFWA 4DT9A 3F5PA 4QO9A 1OGUA 2YCRA 3C5IA 5LMKA 3A8XA 5CEIA 2VWBA 3N4VA 2YERA 4M84A 4WOVA 4MX9A 3PJCA 4O0XA 1VLRA 3H30A 4ONAA 4MQ1A 4KIOA 2C5OA 3H9OA 2FO0A 3QC4A 5HG5A 4BTJA 4EHZA 4O6LA 1OBDA 4MXZA 3W55A 3O2MA 2J51A 2XK6A 1SVHA 3QHRA 4FYOA 4EYJA 4W4WA 1J7IA 3EMGA 3RWQA 3PRFA 2YN8A 3MSSA 4O84A 2R3MA 1OZ1A 2OKRA 2GNFA 1YI3A 4KSPA 4F4PA 1H07A 3MFSA 2PUPA 3R22A 1U5QA 1OPKA 3CQEA 3MDYA 4FEVA 5FRIA 3DK3A 3W0RA 3E62A 4AGCA 3ZBXA 3AC5A 1IASA 3W0MA 1R78A 2XNBA 4U3YA 4CZYB 2P4IA 4BBFA 4FEXA 2Z7LA 4EQMA 4Y85A 1KV2A 3EKKA 3OS3A 2H34A 5JEBA 4J97A 3NUAA 2XM9A 2BIKB 4F64A 4QTCA 2F57A 4PUZA 2W1EA 3F6XA 4D1XA 4D2TA 2PUNA 3SGCA 2H6DA 3CP9A 4FV1A 2BRGA 5LVOA 3EN9A 4E3CA 3U54A 1GZKA 2Y4IC 3FYKX 1PMUA 2R3OA 2O3PA 4DEAA 3VUMA 3CE3A 3A62A 4R78A 5ANGA 2X8DA 5CASA 4UZHA 1ZZLA 5CAVA 1Y6BA 4MEDA 2PVNA 2OLCA 4NCTC 4CZTA 3RWPA 3H3CA 4EK6A 4TWPA 3LKMA 4M13A 5M4IA 4E20A 3A99A 4R7BA 3BWJA 2Z2WA 4IWPA 4O4BB 4YNOA 2PU8A 2XNPA 1OKYA 4RLKA 5M4CA 4QMWA 5CSXA 3VWAA 3RAWA 2X6DA 1H1QA 4I92A 4BCQA 4TNDA 3QALE 4OBQA 5F1ZA 3TUDA 2R0IA 2WNTA 3BIZA 4DCEA 5DMZA 3E88A 5L8KA 2XYUA 4EORA 4TL0A 5IEYA 3R8ZA 2JKOA 1FOTA 2FB8A 5B2KA 2X9FA 4ACMA 3PY1A 4DEGA 4W8DA 5DOSA 1Q8UA 2VNWA 4XG6A 1YI4A 3LCOA 5K5NA 2GS7A 1WBPA 4DTAA 1P2AA 2BDJA 1YHSA 2GFCA 3PPKA 2B0QA 4OTWA 3D7ZA 2GMXA 1OI9A 2X7GA 3FLYA 4M8TA 3R8LA 4RJ8A 5CU2A 3A2CA 2XNGA 3MB6A 3ZEPA 2IJMA 4GFMA 3SC1A 5E8UA 3LE6A 5IH4A 3TKIA 5HIBA 5FM2A 4FR4A 4YZCA 5HICA 3ZZEA 2GQGA 3VS2A 4E6AA 4JAIA 5FTOA 2J4ZA 2P2HA 2PVJA 5BUIA 4UWBA 3OWJA 2ITXA 3PPJA 2CDZA 2W5HA 4FSNA 3ML1A 2C5VA 2WOTA 3RALA 4IAYA 3F7WA 4K2RA 3MPAA 4XRJA 2JDTA 5EW8A 4CFXA 3N4TA 4ZTMA 3OT8A 2RGPA 5TKDA 1W83A 4IC8A 5TF9A 3QX4A 3LOKA 2C1AA 3LFSA 5D1JA 5LVPA 1YXXA 2DWBA 5JSMA 2UZLA 1WBVA 3RK5A 1PXOA 2Z02A 3RKBA 1ZMWA 3JPVA 4FKRA 4NYEA 2QC6A 3ZM4A 3OF0A 4E7WA 1UNGA 4RBLA 3CKXA 1J7LA 3DCVA 3AT4A 4MKCA 4YBJA 2GTMA 4CQEA 1GIHA 2PWLA 3F2NA 5AP5A 3HDMA 2F7EE 3OROA 4FNWA 4J52A 4JT3A 2OH0E 3KK8A 3F5XA 3PP0A 3V01A 3VS0A 4ARKA 5C4LA 3UMWA 2KTYA 2J9MA 1LEZA 4FKLA 2QODA 1YWRA 5HU3A 1ZOEA 3QA8A 1AD5A 5LMKC 5BYLA 2ZVAA 4M12A 1DI8A 5E8WA 3G15A 5DLSA 2WO6A 1ZZ2A 4KIKB 3LIJA 4BDCA 2W7XA 2JFMA 2BDFA 4BIEA 4RX9A 3PXZA 2Y9QA 2QONA 2ITUA 2PZIA 3I0QA 5A3XA 4FKQA 1NXKA 3VBXA 2WIHA 4YZNA 2GHMA 3PG3A 5LWNA 1OIQA 5DPVA 2PUUA 4GT4A 4BVUA 4LGGA