3AGLA

Complex of pka with the bisubstrate protein kinase inhibitor arc-1039
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Diversity of bisubstrate binding modes of adenosine analogue-oligoarginine conjugates in protein kinase a and implications for protein substrate interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 338
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3aglA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3aglA02
3Q9YA 4PQNA 2W1DA 3LCKA 2ZB1A 5GJFA 2GNJA 2XA4A 1YRPA 1JKSA 3F5GA 4RIYB 1Q8UA 1NY3A 2RFSA 5EM5A 4FC0A 3A8XA 2UW5A 2W7XA 2I0VA 4R3CA 3KMUA 5FBOA 3R7IA 4PDPA 3I0OA 4WHZA 4J99A 2R9SA 2UW6A 4DH3A 5ETFA 3MYGA 4O84A 1IA8A 1JVPP 4TXCA 4ZSLA 3F88A 3UJGA 3HVCA 3LQ5A 3PPZA 1H1SA 5ANGA 1PXNA 1I09A 2XKEA 3L9PA 4MXXA 3UO5A 3ENMA 3MB6A 4BCOA 2ITTA 1SVEA 3SG9A 4JDIA 4FIFA 4IVCA 5DT4A 3WZJA 4BCHA 4CYJA 3WZDA 4ASXA 3DDPA 2VTLA 3NUXA 2ZAZA 3DT1A 5CSVA 3VUTA 5AM6A 5CYIA 5FWKK 4Z7GA 3ZRLA 4P2KA 3VS2A 4QP8A 5BYLA 3QZFA 3KF7A 3PVBA 5F20A 4EUTA 3C0GA 3Q96A 5CQUA 3FPQA 2GNHA 4EH5A 4BCGA 4RX8A 3JR1A 4AACA 4ASEA 1QL6A 5FP6A 3Q52A 3MDYA 1TQPA 3VIDA 2XUUA 2B54A 3HDMA 3OT8A 3R1YA 5HO6A 3FI3A 4OT5A 5DGZA 1XH5A 3DAKA 3M1SA 3VN9A 4A4LA 1J7LA 4MQ1A 1M2RA 1WVWA 1JSTA 3G33A 3BGPA 3HP5A 5BX0A 3QQJA 3RAIA 4EH6A 3LFEA 4S30A 4DLJA 3EZVA 3UTOA 4ZP5A 3QXPA 4QMSA 5AP4A 3KXNA 3T9IA 5IQBA 5A4TA 5CF5A 4WIHA 5IA2A 2JIUA 1UKIA 3KL8A 4R1VA 1YOJA 4JNWA 3TKHA 4AG8A 5CAOA 3NUAA 3JVSA 3RWPA 3TACA 4BKYA 2ONLA 4AXAA 1ZRZA 3R9RA 4HW7A 2ERZE 1NVSA 3OUNB 4YC3A 5CF8A 1ND4A 4HGEA 2C6KA 4I4EA 2IZUA 3Q9ZA 3MPTA 2CNQA 2R3MA 4U40A 3LQ8A 3R7UA 2FYSA 4YTFA 4CG9A 4CLJA 2X9EA 4I0RA 3OOGA 3QD0A 4MYGA 4OBPA 3E8NA 3PXRA 5FEEA 4FKUA 3PA3A 3KGAA 4LG4A 2HAKA 3UP7A 5HIDA 5CEMA 3IO7A 3ORXA 3MY0A 1STCE 3ZFXA 4QP6A 5L2IA 4AE6A 3FKOA 4S31A 5LXMA 2KULA 4OUCA 4HPTE 5CAUA 1S9IA 1R0PA 3FKLA 4PPBA 3UO6A 2OZAA 4FTRA 4FVPA 4KA3A 2O65A 4IIRA 3GU7A 3WI6A 4ERWA 3GQIA 5T68A 4FOBA 4C2WA 4Y5QA 1Y8YA 4EL9A 2GTNA 1H8FA 2XIXA 3SVVA 5HLNA 5LMBA 3QWJA 4IX6A 3TJDA 5E8WA 4G16A 4TZRA 1URWA 2PVYA 3KB7A 5CXZA 2OXYA 5AP6A 1Q4LA 4FV9A 1RDQE 4CGAA 4LRJA 1KUTA 5HNGA 2YM4A 5AEPA 4BTMA 3F5XA 5GJDA 5I9YA 4D2RA 3HV3A 4GK3A 1W8CA 4J1RA 1UKHA 2W96B 3R83A 5F4NA 3V8WA 2HK5A 5BPYA 4D9UA 4NKAA 2KTYA 5DR6A 3WOWA 3ZOSA 2XJ2A 2J5FA 2QKRA 1M7NA 4WA9A 4BICA 5L2TA 2B0QA 1MRVA 5ETCA 1U4DA 3QTUA 4QMWA 4NIFA 5EKNA 4E1ZA 2OIDA 2XK8A 3GCSA 4ENXA 2G1TA 3DJ5A 5DYJA 5AX3A 2HW6A 3ZZWA 3BHYA 3FQSA 5HLPA 4HGLA 2UV2A 2C5YA 5AR7A 2Y0AA 4BDCA 2ZMDA 5AP0A 1XWSA 3P86A 4UV0A 4FUYA 5AWMA 3SC1A 3NVKI 3UOJA 4H3QA 2UZWE 1K9AA 5BQ0A 4HVDA 1OI9A 4R6VA 4B4LA 3AC8A 3GVUA 4RWKA 3QFVA 1U46A 1SYKA 2XS0A 4J96A 2ZM1A 4LUEA 2YA9A 4M0YA 2XIKA 2ETRA 4L44A 1YHWA 2NNWB 5EI2A 4UWCA 4EOPA 4WNPA 3ITZA 4ZTRA 2VTRA 2P2HA 3R8PA 4FTTA 2WEIA 4FSQA 4E5WA 4Z7HA 5HQ0A 4HYHA 5IQFA 3HDNA 4RQKA 1B6CB 2QONA 2XNEA 3COHA 3CTHA 4BIDA 2C6IA 4F7LA 3AMAA 4L3PA 4AZTA 3SW7A 3GBZA 3R7GA 4L01A 3F3UA 3IOKA 4BKJA 3DLZA 3E3BX 5I4NA 3PJ3A 4U0IA 5EW8A 1S9JA 2OLCA 3SG8A 4YO6A 4G5PA 3DK7A 4CZTA 1OUKA 3BI6A 5C27A 3DQWA 4FSMA 4AOIA 2XJ0A 5ETAA 1IAHA 3VW8A 3I5ZA 4RPVA 2XKCA 4BDFA 1PMNA 1W82A 2GPHA 4Y72A 3F7ZA 3IDPA 1JAMA 4YZMA 3GP0A 3C4WA 5JK3A 4CFXA 2C5NA 5J79A 2JC6A 4RG0A 1KOAA 1DS5A 3W2RA 3W32A 5BVWA 2BRBA 5HLWA 5I9WA 4ENYA 1KWPA 2GNGA 2UW9A 4MD9E 3WF8A 4EBWA 3HL7A 2BRHA 1OIQA 4FIEA 3MY5A 5LWNA 3TNIA 3EQBA 3W33A 4MBIA 4IWOA 2J50A 3POZA 1JBPE 2BTSA 3MFSA 4UMRA 2VTSA 2RFEA 2ACXA 3UBDA 1NXKA 3FLNC 1G8AA 1YWRA 2WPAA 1VYWA 2VV9A 3KRWA 2YLEA 2QR7A 5IQHA 2DQ7X 4X6QC 4RC4A 4RIWB 5HVYA 4DEBA 5JQ5A 3FUPA 5M4CA 1FVTA 2J0JA 1JQHA 3VF9A 3NAXA 3DK6A 3NUUA 5CSXA 4I22A 4F9WA 5B2MA 3UIBA 1TQMA 2VGOA 2XP2A 3NW5A 1YXSA 2X2LA 4Y46A 2VO7A 3PUPA 4CTBA 1O6LA 2YM8A 3PSBA 4HJOA 4BN1A 2BRMA 3LMHA 3KA0A 2NP8A 3P78A 4NM5A 2XBJA 3HV4A 3HMNA 2PUNA 3AGMA 4ACGA 2O5KA 4TKSA 3RK9A 2IO6A 2IVUA 4TW9A 2Z7RA 4I21A 2J0MB 4WT6A 3VUDA 1NVRA 2VO3A 2JAVA 3PA5A 3QTXA 4RWIA 2O64A 4XLIA 5DRDA 4ZTHA 4FZ7A 2O3PA 3BWJA 5CX9A 4ZSEA 4X21A 5KZIA 2CDZA 1ZOGA 5DI1A 4CNHA 5AAGA 3KK8A 3OEZA 3B8RA 2E9UA 4K6ZA 1R39A 4PPAA 5H8BA 3K3IA 3RK5A 4GW8A 4F0FA 5CI7A 4USFA 3JVRA 5HE2A 4JQEA 3U9CA 1M14A 3OWPA 2XNPA 3G15A 3PZEA 3IW5A 4FKLA 4W9XA 3R8UA 4AWIA 2QCSA 2W4JA 3R1QA 1YOMA 4L3LA 1BMKA 3VS4A 4CMTA 4CQGA 4I4FA 4O2ZA 3OROA 4L68A 4DGGA 4L6QA 2J0LA 2X0GA 1VYZA 2C6LA 2IW6A 4J97A 4Y95A 3PLSA 2IZRA 1U59A 3O17A 4OTQA 4BVUA 1G5SA 3SXSA 1U54A 3E64A 3ANRA 3DTWA 2RFNA 4BI2A 3WE8A 5M07A 1ZMUA 2WTKB 3ZCLA 2BROA 4O0VA 3ZRMA 2Y8OA 4IX3A 4RFMA 4XUFA 4CEGA 4E6CA 5K0XA 4PL5A 5JN2A 2WQOA 3UNKA 1A9UA 4GG7A 4BKZA 5FLFA 2ZYBA 3R2BA 5K3YA 3KXMA 4QMNA 3M2WA 2X4FA 3TIZA 1JSUA 3QF9A 3QQKA 2GS7A 5EM6A 4DFZE 4DTAA 3VBQA 3CD8A 4AAAA 4R8QA 4FEXA 1QMZA 3R8MA 2ITVA 1J1BA 1W0XC 4E3CA 3ZSGA 4OTFA 2WTIA 3C4EA 2V22A 4FKPA 3COMA 2WOTA 4BIBA 1PRYA 3NMUF 5B0XA 2XIZA 3SDJA 3R04A 4RJ7A 4BY9E 5F9EA 1PXIA 2BAQA 4FICA 4QPSA 4XX9A 4W9WA 4YURA 2FO0A 4FK3A 2XKFA 4B99A 4XH6A 3S95A 3ORKA 5CTPA 2SRCA 1UNGA 3A62A 4OBQA 4ACMA 1IEPA 1YXTA 3BLHA 4BYIA 4D4RA 2ZM4A 1H07A 5EM8A 4UX9A 1R0EA 3ET7A 3W2SA 3R9NA 5M51A 4R7BA 3QD2B 4FGBA 3PG1A 4ZZMA 3WIGA 3IQ7A 2YDJA 4OBOA 3CKWA 3JYAA 4NK9A 3HMOA 5EK7A 3ZO1A 3EN7A 5JQ8A 2J7TA 2QG5A 5A14A 1UWJA 5CENA 5ANEA 3EMGA 4JG7A 2OJGA 4MXZA 3I79A 2ITNA 2GHLA 1H01A 4MWHA 3WZKA 4CRLA 3ORMA 4FTMA 3DU8A 5GZ9A 2J5EA 4RIOA 2HYYA 4XLVA 3SHEA 3UO4A 2WB8A 3BZ3A 3IGOA 4CYIA 1Y57A 2R3NA 3QRKA 2PVKA 3BEAA 4FVQA 2WMSA 3A4PA 4XV2A 5AUWA 2PMOX 4X3FB 5HD7A 4CD0A 1MRYA 2X81A 3QKLA 4FKRA 5IF1A 2YAKA 4HPUE 1H1WA 5CT0A 3ZU7A 2E9PA 4GL9A 2HZ4A 3NIZA 2J2IB 3WF5A 3M42A 5HCXA 3R7VA 2EVAA 4FEUA 2W1FA 4OR5A 5CY3A 2WTJA 4AA4A 4D9TA 4LOQA 4ZTLA 5E8XA 1SNXA 2WMRA 4FV0A 4IX5A 4N6YA 1FVVA 3RM6A 4G3FA 5EDQA 4XV9A 4FYNA 4XG6A 5A6OA 1DAYA 2BZJA 4IEBA 4C8BA 4YR8A 3AT2A 4WBOA 2H6DA 5HEZA 3BRBA 2YEXA 4IJ9A 4GFMA 1YDRE 2YM6A 3ULZA 4QQCA 5A54A 4ZS0A 3FXZA 3NNWA 5IUHA 1F3MC 4DGOA 2PMNX 3G6HA 5ANKA 5CEQA 2HWOA 2XIRA 3F9NA 4CCBA 2FUMA 4IANA 4PY1A 3ZEPA 3ANQA 3LFNA 4KIOA 3DK3A 2JKMA 4LYNA 3TNQB 3L8SA 3QRUA 4JG8A 5DFPA 4CMUA 3D2KA 3TXOA 5CF4A 5KHXA 5CF6A 3GU4A 1OKWA 2PE2A 2QR8A 2CGVA 3F7WA 4HCUA 5HZNA 2QOQA 3POOA 4NT4A 3RAHA 2WTKC 2RKUA 3VW6A 1VZOA 2XNBA 3ERKA 3UVRA 5AR2A 2OU7A 3DFCB 1ZYJA 2H9VA 4FTQA 4J53A 2GNFA 1ZY5A 2HELA 4QQ5A 5DR2A 5HVJA 5BUIA 4CV9A 3DKGA 3BHHA 3FZ1A 4C4GA 3V5JA 3VUHA 5T6KA 4M13A 2J51A 3QQGA 4OTWA 4DT9A 3ELJA 4RX7A 3BE9A 3BYSA 3O7LD 3CTJA 5BMMA 3G90X 4TYHA 3N4TA 3ZONA 3RWQA 4RC3A 4IQ6A 4FI1A 4KUJA 4ALWA 2BAJA 2G9XA 3HV5A 2RG5A 4GVAA 4ZJVA 4DH1A 4FTCA 4W4YA 4GT3A 4UZDA 3NDMA 5CVFA 4CTCA 4L42A 3ORZA 4YJNA 3HEGA 2UVZA 2XK6A 3R0TA 2VTOA 2JLDA 4J98A 4K2RA 3WILA 5JGAA 5JRSA 4RZVA 5LMAA 4P4CA 4MEDA 1LPUA 4GIHA 5BUEA 3CY3A 5G6VA 1J3HA 5D1JA 5AUXA 4F70A 4YUQA 3V5LA 4O82A 2VTHA 1R3CA 3KRLA 2G15A 5EI6A 3DPKA 4O0TA 3JY0A 2ERKA 3I6WA 3NYVA 4ASDA 3GT8A 3AXWA 3NUNA 3FLWA 3FYJX 3PWDA 3R8ZA 4MK0A 1OL2A 4D1SA 4U80A 2YM7A 5JFXA 4OTPA 4CQEA 4EK8A 4Z16A 3EZRA 4ITJA 5M06A 3QX4A 4YHJA 3OC1A 4J8NA 3F3WA 4IFGA 4AFEA 5IU2A 2X7FA 3AD6A 4G6LA 4F1OA 1PYXA 5AADA 4UALA 4NFNA 5CNOA 1PF8A 1QPCA 2JFLA 4QPMA 4QOXA 3TV6A 2HZNA 1JLUE 2WMUA 4IZAA 2UW4A 4IH8A 4C4JA 4A06A 2VTQA 4DCAA 3KMWA 4U45A 5GHVA 5CEOA 3SAYA 3MFRA 3A7FA 3OTVA 4USDA 2OH4A 4EOLA 1Z5MA 4QNAA 4XG9A 1Q8WA 2YM5A 4EJNA 4FL1A 4YMJA 2E9OA 1Y6BA 5KMKA 5HCZA 3R2YA 3KVWA 2XJ1A 3EIDA 3KQ7A 4JS8A 3UOHA 2Q83A 5FM3A 3BU5A 3JUHA 4MXYA 1H24A 5JZNA 3FZSA 3ZUVA 3P9JA 3EQHA 2YERA 4MHAA 3SKCA 3NRMA 2ITZA 4EK3A 3EFWA 2XNNA 3NGAA 4J95A 5CSPA 1NVQA 3DNEA 1Q61A 3D2IA 4K18A 4AU8A 1YWVA 2PVFA 2JKOA 5I9VA 3WZEA 1WAKA 1ZWSA 2PYWA 5AP7A 1EH4A 3C0HA 3FMKA 5KBQA 4FTOA 4EH3A 2BPMA 4ZK5A 4D2SA 5AUUA 3ZO2A 4I5PA 1AGWA 4LV5A 3EHAA 3PPKA 4FIIA 4GCJA 4QP2A 3GQLA 4KIKB 2XVDA 3BYUA 5DA3A 3TI1A 4YHTA 3VJNA 3R7YA 1H4LA 4PWNA 2R7IA 4O0RA 4ARKA 4TTHB 4Z3VA 2JITA 2CKEA 2EXMA 2UZBA 3EFKA 3R63A 3RM7A 3O50A 3V8SA 3ZXTA 4FK6A 2BAKA 2WTDA 4NW5A 2BRGA 4BCIA 4UMTA 2BZIB 2CNUA 3R02A 2EXEA 3W2CA 1OL1A 1Q8TA 2VNYA 5A4LA 1V0OA 4OGRA 2C5XA 3CGOA 3O71A 3NX8A 3C5UA 2XH5A 3NYOA 1OECA 2OZAB 3MI9A 3NNXA 3OP5A 5BVKA 3SW4A 4O0UA 3GB2A 3LCOA 3PYYA 3TM0A 2A2AA 3U8WA 3G5DA 2CPKE 4AQCA 4MH7A 4WNKA 1WBSA 3QZHA 1MQBA 3KMMA 2UUEA 5HO8A 2ZV2A 3SQQA 1LEWA 3FMLA 4JDHA 3LMGA 1VJYA 3DS6A 3IK3A 3QD3A 4WOVA 3VHKA 3NW6A 4P5ZA 4YSJA 4FT3A 3UE4A 2RG6A 1SVHA 1OZ1A 4FSZA 2XK9A 4NM3A 4EZ3A 4BC6A 3QHRA 4C0TA 2ITYA 5IISA 5CU2A 1YHVA 2OZOA 3D7TA 4NTTA 2W5HA 3FXXA 4B8MA 3DTCA 3FLQA 1WVYA 2C6MA 3DXPA 4O22A 2QOLA 4AT3A 2QOIA 2QODA 3HRFA 4XG2A 5BNJA 4M67A 1U5RA 5J95A 2QU5A 4WBBB 2IW9A 1V0BA 3MTFA 4FT9A 5BYZA 4V0GB 4I94A 5LWMA 3U55A 4UXLA 5AUVA 4ALVA 5JKGA 3RZFA 3QA8A 3UQFA 2HW7A 3QX2A 4FL3A 4FT0A 3ATTA 3QWKA 3BV2A 2Y4IB 4KIPA 4XOYA 3WF9A 5LMKA 4RVMA 3DKOA 2PULA 4FKVA 5AV0A 5K0KA 3VS7A 2R3PA 3QGWA 3ZM4A 3Q6WA 1OITA 2FA2A 4IDTA 4FZDB 4YZCA 4H3BA 4QMPA 5AP1A 2WZJA 2YISA 4LOPA 4BHNA 1WBVA 1LEZA 2QVSE 3FHIA 3GOKA 3OXIA 5AP5A 4F64A 2WELA 3I81A 4ACDA 4O0WA 4JXFA 4O96A 4BDIA 4BCPA 2VTNA 2IZSA 5M53A 3FWQA 2OI4X 4I6BA 4NCTA 3QLGA 4FG9A 5C03A 2QURA 2IVSA 4YZDA 3DY7A 3KRRA 4QYHA 4CT1A 5HTBA 5LJJA 2XEYA 3AMBA 4E4MA 3C4CA 4DE4A 1IASA 5F94A 1YWNA 4JVGA 2WMBA 2ZJWA 1X8BA 4ZZNA 5AIRA 1P14A 5KMOA 3P7BA 2A0CX 2P2IA 2V7OA 3WYYA 5LCJA 3FAAA 4GK4A 4A4OA 4O6LA 3NVMB 3DAEA 4LL5A 4F0IA 2PPQA 3OVVA 5JGDA 3COIA 4ZY6A 3FL4A 4WNMA 3DA6A 2EUFB 4GU9A 5K5XA 4IB0A 3L8XA 2ONLC 4QQTA 3QA0A 4ZAUA 5KZ0A 4DFYA 2V62A 5E90A 5CEPA 2Y6OA 3VJOA 1Y91A 4G5JA 5EQEA 4QP4A 4C3FA 3KF4A 4EJ7A 4JT3A 4E20A 4UMQA 4YJSA 5HU9A 4HVHA 4PNKA 4K0YA 2LAVA 3UPZA 3CLYA 3MS9A 4Y73A 5KMLA 2X39A 4CKJA 2W1HA 4KSQA 4UB7A 1UNHA 1WVXA 3LE6A 4H1JA 2UZNA 1OL5A 2WIHA 1ZARA 3FSFA 3FZTA 4FVRA 1Q97A 3PY0A 4ITHA 3TEIA 3MVMA 5E8TA 2XRUA 3C5IA 1URCA 4JL9A 4U79A 5FRIA 2E2BA 4X2NA 3LM0A 4FZAB 3W2PA 2XIYA 1RW8A 3SXFA 4EWHA 5DNRA 5HTIA 3OY3A 4G9RA 4JX7A 3GU5A 2GNLA 4D4VA 4LQMA 2CHLA 2GS2A 5B2KA 2VWUA 2XCKA 2X7GA 2JBOA 3TZ9A 2VZ6A 3QQFA 4P7EA 4Q5HA 5AP2A 1OBGA 4FE2A 4Q5EA 3VUMA 3E5AA 2Z7QA 3E88A 2HXLA 4F4PA 5JFVA 4MF0A 2JGZA 4WKQA 1OVEA 3A8WA 4ANBA 4JBVA 4EH8A 3UZTA 3FSKA 4O7TA 2XMYA 1J7IA 3MJ2A 4J71A 5L2SA 3IG7A 2AYPA 2BHEA 3SXRA 3EL8A 3PJ8A 5KHWA 4GRBA 2YACA 4BDHA 4H3PA 3PDTA 2Q0BA 3FY2A 4IM3A 1FGKA 3O51A 2WXVA 5IQAA 4HOKA 3QD4A 3U6HA 4I92A 5FEDA 5B2LA 4MNEB 3LFAA 2PK9A 3E8CA 4KNBA 5HGIA 4DBXA 2UZTA 4YPDA 2DWBA 4DT8A 2ZM3A 4A4XA 4RIXA 1DAWA 5LCKA 4WRGA 5JRQA 3R9HA 4M15A 2I40A 2I0HA 2RSVA 4LV8A 4XG4A 4X2FA 4PF4A 4BHZA 3DZQA 2Y4IC 4C3PA 4C4HA 4O86A 4TN6A 5AA9A 1H0VA 5IDPA 5I3RA 1M7QA 2UVYA 1U54B 1JPAA 3CTQA 2OBJA 4CFFA 4AW2A 2J9MA 2PWLA 1WBNA 3QTWA 4U8ZA 5EM7A 3PE1A 4RJ8A 5IQGA 3O7LB 4FNYA 2A1AB 4J52A 3BV3A 1GIHA 5HE1A 4HZSA 4TWCA 3WE4A 1CDKA 4XG8A 4YLLA 1ZZLA 4M97A 2QNJA 3EQFA 3WZUA 5EOBA 3BWFA 3BX5A 4GFGA 2NRYA 4XBRA 5D41A 4E6DA 3F66A 5E7RA 3V8TA 2VGPA 1Q62A 3FBVA 4Y85A 4M66A 4GYGA 4JRVA 3EN9A 4D2PA 2QHNA 4YSMA 3CP9A 2C6TA 4IAIA 4R78A 1SM2A 5J1WA 3LLTA 3ID6C 5E1EA 2F2CB 1UU7A 2OKRA 3TT0A 4MD7E 4EQUA 1YXUA 3AG9A 3CBLA 4RC2A 5E9EA 4DGMA 2ITUA 2ITPA 4M84A 2R0UA 4PPCA 4UXQA 4AZWA 2PMIA 4NSTA 5GIPE 1T46A 3ZLSA 5CAPA 4R3RA 5IG1A 3OCSA 2AUHA 4DG0E 2UZUE 4YNOA 3UZPA 5IH6A 5CU3A 3NLBA 3T3VA 1FMKA 2BIKB 5AX9A 4TWNA 5CLPA 3RPSA 2WTWA 2REIA 4N4SA 3A7IA 4XHKB 4BCNA 3BU6A 4YGAA 3FPMA 3QZGA 2YAAA 3H30A 5HX6A 3ZFMA 5AUZA 3UMXA 2QO9A 3VQUA 4QMZA 4HGTA 2YIQA 2ZDUA 3D4QA 3OG7A 4JBQA 5AR5A 4CFNA 2GQSA 2ZV8A 4V05A 4MXAA 1Z9XA 2BFYA 3QBNA 4LOOA 1YQJA 2F7XE 4UMPA 5HHWA 1UWHA 4ITIA 4O1OA 3EJ1A 3H9FA 3ZBFA 3MN3A 4I6FA 3DXQA 1QPEA 2PZIA 3NWWA 1GIIA 2UZLA 2Z2WA 4EH4A 3DCVA 4FNZA 4DH5A 3P1AA 4EOKA 3QRTA 1ZXEA 4ASZA 4CFMA 5CAQA 4FV2A 4BWKA 4XMOA 2R0IA 2R3HA 2WU7A 4RA4A 1KOBA 3S1HA 3Q9XA 2AC3A 2RIOA 3D9VA 5AA8A 4BRXA 3HV6A 4S33A 4FTKA 4DINA 4HVSA 5L8JA 4CG8A 3MJ1A 3V5QA 3OWKA 4OW8A 1O6YA 4M69A 4YJPA 5EHLA 4M3QA 2XNMA 4CVAA 4U6RA 4B0GA 4BGGA 4ONAA 3RALA 2IPXA 3LAUA 5EYKA 4R7IA 2OO8X 1Y6AA 4UZHA 5JFWA 5K4IA 3EKKA 3FC1X 4E7WA 2OJFE 1GOLA 4C4FA 2OG8A 4HVGA 3HA8A 2GS6A 4GJ3A 1QCFA 4IJPA 2F7EE 4YZ9A 4KS8A 5IA1A 4QNYA 2OJ9A 4CZUA 4F7JA 3A99A 3RHKA 5BVNA 3Q6UA 2R3JA 1OIUA 5D11A 4BCKA 4EQMA 1AQ1A 3C13A 3OWLA 4HNIA 3OOMA 2H96A 4IB5A 4GFOA 3ORLA 4FOCA 5EHOA 4IB3A 3NIEA 4FL2A 4ZTSA 3IW8A 3PSCA 5IMEA 4LGGA 4YO4A 3SGCA 4ZSGA 3UNJA 4YJVA 3FY0A 1XQZA 2F4JA 1HCKA 1OPKA 4GK2A 3PXKA 4QTBA 3VUIA 3CY2A 3VWAA 3Q5IA 5AUTA 2OXDA 2WQBA 4L8MA 3ACKA 3W16A 3RGFA 4U81A 4UEUA 2JD5A 3G0EA 3RPVA 4GT4A 1NW1A 4XRJA 4V04A 3HNGA 2QOFA 4QYGA 4PTEA 3DB6A 4C58A 3EYHA 4TT7A 2W9FB 3H9RA 2UVXA 3PIZA 4JLCA 3DBEA 3CE3A 3R28A 4MWIA 4YC6A 3EN6A 4RQVA 2ZDTA 1SMHA 3FQEA 5IA4A 5AFVA 1NA7A 3D83A 3LM5A 4HGSA 4IADA 4EOIA 4XP2A 5J9YA 4GSBA 3TNHA 4RBLA 3R71A 3AOXA 5HOAA 3NUPA 2WQNA 1UU8A 3EB0A 1PHKA 3ORTA 4CZYB 5IEVA 2EB2A 1BI7A 3DAJA 3GCUA 4FZ6A 2X8DA 3RNIA 5IUGA 3LW0A 3RCJA 3ZLYA 4BZOA 5K5NA 4ANNA 4GVJA 3QLFA 5M08A 5FBNC 4NL0A 4F63A 2R3KA 3G0FA 3F5PA 1SVGA 4D5HA 1ZLTA 2XRWA 4F9YA 2YCFA 5LVPA 5LOHA 5D12A 3GU8A 2JDRA 4A9UA 1ZY4A 2C6DA 2HXQA 3R7EA 4O7NA 3UVPA 5CALA 3N4UA 3LXNA 2XKDA 2J0IA 3QCSA 5L8KA 4O83A 5A4EA 3ETAA 3QQUA 4QP7A 4D1XA 2HOGA 4JR3A 3OUKA 3VUKA 1T45A 1Q24A 3VS3A 3EN5A 1TVOA 4FGRA 1GZ8A 3PY3A 3R1SA 4EYMA 3FYKX 4YTCA 1APME 4XYFA 3HMIA 2X9FA 3LCTA 4HYUA 4PP7A 2HY81 2CNVA 3E87A 2O8YA 4EHEA 4EONA 3JS2A 4F9BA 5C4LA 3MBLA 3EQDA 3KCKA 3ZFYA 3NYXA 2G2IA 3KULB 3TTIA 4GJ2A 4XOZA 4LM5A 4BCQA 4ANLA 5DPVA 2QOCA 4QTAA 4L7FA 4NEUA 4TPTA 3P4KA 4O7YA 3EFLA 4HCVA 3LCSA 2PZRA 4I0TA 4JIAA 2OIQA 5TR6A 1H27A 3EFJA 4IACA 1FOTA 4QTCA 4O7ZA 1CKJA 4JAJA 4X0MA 3ALNA 2XNGA 4BDAA 3NNVA 3R01A 4G9CA 3CJFA 2VTIA 3CCNA 3NAYA 4YZNA 4B9DA 4EKKA 5JEBA 3FMDA 5E8ZA 3MWUA 3N51A 3ODYX 3ATSA 4QMLA 4DTBA 2RGPA 3C1XA 3L9LA 4L43A 4EOQA 2C3JA 4O2PA 3K5UA 3K5VA 3QAME 2F49A 2PTKA 2PZYA 4IE9A 4FKWA 4KIQA 4AT5A 4FV7A 5A46A 4OAUC 4I1ZA 4WUAA 3TZMA 3ZSIA 4UWBA 1ATPE 5FXSA 5LVNA 2OFUA 2R3LA 5EQYA 3RMFA 2W06A 3ROYA 3ACJA 4MBLA 4DG2E 4UWYA 4DEHA 4U9AA 4ID7A 3I60A 4G2FA 5FTGA 4F6UA 1ZMVA 2WOUA 4NUSA 2J4ZA 4AGUA 3H10A 4MF1A 4QP1A 3RNYA 5M44A 3PXQA 3D5UA 4ZTQA 2HWPA 2OICA 4D2TA 1XBAA 2PVRA 3L1SA 2E9NA 5HG5A 5KBRA 5EDRA 3AT4A 4G3CA 4JOAA 5AV1A 4C33A 5IA3A 5HG9A 5IQCA 2A4LA 3IW4A 4H05A 1P2AA 3CQUA 4KWPA 3MVHA 2VWWA 2W4OA 3QC9A 4BZDA 4WD5A 4JX3A 3EQRA 3HECA 4WNOA 3RTPA 3OW4A 5ACKA 4X2GA 5IH4A 4D55A 3QTIA 4FT7A 4QMTA 4IWQA 1VEBA 3CEKA 4N70A 4ZMFA 4H36A 3PG3A 1G3NA 5L3AA 4C61A 2WQEA 1XH4A 3ZC5A 2WTVA 5F95A 4BI0A 1XO2B 3K54A 4L7SA 4X3JA 4EC8A 5HIBA 2BDFA 2QLQA 4OTRA 2J0KA 1I44A 1WBTA 2X8EA 2UZVA 3OCBA 1PY5A 1H1RA 4PRJA 4X2JA 4TYEA 4DFNA 3SRVB 3HZTA 4YTIA 3G9LX 1H0WA 4FIHA 2CLQA 3KREA 2YZAA 4YNEA 3PZHA 3D7TB 2P4IA 4FTNA 4H1MA 3RKBA 3VULA 3NNUA 4B7TA 4F1MA 3C9WA 1YXVA 4G3DA 3MFTA 4L00A 2RF9A 3GOPA 4IVBA 4YHFA 4O7SA 1PMUA 5KMIA 4M14A 3A2CA 4A7CA 4N57A 3NR9A 1ZOEA 4AZVA 2PY3A 3PTGA 5HTCA 4E4LA 4QMVA 3A4OX 3BGQA 5CNNA 4NZWB 4EWQA 3EYGA 3LFCA 4I0SA 1XH7A 4X6RA 1PXMA 1P4OA 1WCCA 2VU3A 5C9CA 2JEDA 2YWPA 4A07A 4Z55A 5LVOA 1KE5A 2ITWA 3LLAA 5E92A 2G2FA 3QKMA 3Q4UA 4M7IA 2GQGA 5CSHA 4I5CA 4D1ZA 3DBQA 4JG6A 3ROCA 4M12A 3ALOA 4LGHA 2IWIA 4UN0C 3TNWA 5T3QA 3EQGA 2P3GX 3UP2A 4QYYA 2DYLA 1KE8A 4U7ZA 2WMAA 5KMJA 4O81A 4AN9A 3F3TA 4G31A 3VC4A 1E1VA 4BFMA 2CJMA 2B55A 4RSSA 4RFZA 3W18A 3IS5A 3GC7A 1Q8YA 3S4QA 4ZTNA 1O9UA 2QO7A 5M57A 3HUCA 5DLSA 5L6WL 3KFAA 3AC3A 3GU6A 4NU1A 3MVLA 2CLXA 3C50A 2C47A 3BYMA 2WO6A 1GZKA 3OBGA 3P79A 4K1BA 4LRMA 4MKCA 3GXLA 5I9ZA 5HU3A 3PE2A 2XM8A 4W4XA 2UZDA 2ESMA 4JJRA 5DH3A 3TWJA 4E6QA 2BIYA 3GENA 2HCKA 3ZUTA 2BZKB 1A48A 4GYIA 3MPAA 2IVVA 5TO8A 4FX3A 4Y83A 4E93A 4APCA 4FKTA 4RJ5A 5LVMA 5CU6A 4I20A 4U97A 4C38A 3GCPA 2C5OA 4BDEA 3S00A 3NCGA 5AM7A 4R1YA 3UOKA 5L8LA 1DM2A 2YCSA 3PRIA 4NH1A 4C34A 2JDVA 2FH9A 5EW9A 2C3KA 2FSTX 5F1ZA 3FMHA 1IR3A 2JDOA 3QC4A 1YI3A 3I1AA 4RX9A 2WD1A 3AC5A 3C0IA 4XJ0A 2W1IA 4AGCA 3TKIA 4RWLA 3A60A 4FT5A 4IVDA 2PL0A 3FLYA 2HY0A 3FZRA 1UV5A 4C62A 4DAWA 5DN3A 4BDGA 1KE6A 4II5A 5BYYA 3OHTA 4XCUA 1QPDA 2Z7LA 4LI5A 3F61A 1KSWA 2OJIA 3PFQA 3R21A 1O6KA 3EH9A 3ZO3A 5CZHA 3S0OA 3AC1A 1OL6A 4D4SA 4AGWA 4O0SA 3DNDA 4EH9A 3FMNA 5DR9A 3TUDA 1YDSE 2GCDA 5FDXA 4EBVA 3I6UA 5HESA 3U9NA 2XCHA 1W7HA 5CZIA 2EWAA 4ZJJA 3UG1A 1DI9A 1IAJA 5D7AA 5ACBC 3OEFX 5E8YA 3FMEA 3COKA 4IZ7A 3G9NA 1FGIA 4I93A 2F2UA 4M68A 4ANOA 5JH6A 2QOHA 4OT6A 4DN5A 4E6AA 2XEZA 4E5BA 4WG4A 5ANOA 4KRDA 4YJOA 1XJDA 3KU2A 3OD6X 1REJA 5G1XA 5C01A 4QMQA 5BVOA 2EU9A 4EZ5A 3DDQA 5LVLA 2B4SB 3HMPA 5A3XA 3TNPC 3A7JA 3MVJA 4D2WA 4FR4A 4DFXE 5DVRA 2WMVA 4IC8A 4EOOA 3E7OA 2OJJA 3HAMA 5JMSA 2ZB0A 5ANDA 3HRCA 3H9OA 3RJCA 3VUGA 4D58A 4N6ZA 2YIRA 2BMCA 2C1AA 3LMIA 2JKQA 3H0ZA 3CS9A 4EZ7A 5LMKC 5ANIA 1CMKE 4RVTA 4FEQA 4FNXA 4KKEA 4OTHA 4DBNA 5FXRA 5IA0A 3R30A 3Q4ZA 3A7GA 3LFFA 4CT2A 2ITQA 4FSNA 1ZZ2A 4ZTMA 5GNKA 2X6DA 5E8SA 5IA5A 4O27B 4E4NA 3KXZA 3NEWA 2X8IA 3CR0A 5TKDA 3ZO4A 3W2OA 5IEYA 3OCTA 2OSCA 3KC3A 4JBOA 4YZBA 3ZMMA 5FD2A 4IX4A 4AOJA 4BIEA 5IZFA 2GNIA 1XH8A 4MX9A 4YJQA 1BL7A 3ZXZA 4EUUA 3ZBXA 2OWBA 1YI6A 4KKGA 3LHJA 4QMYA 4ZMEA 3UYSA 1JSVA 4FIJA 2PMLX 3THBA 4BDKA 4MXOA 3O96A 2X1NA 1OIYA 4X3FA 3RZBA 4AW5A 4ZIMA 4CV8A 3MH0A 3QQHA 4PV0A 4XNEA 4FG8A 3T9TA 4D5KA 2JBPA 5FQDC 4ZJIA 1SNUA 5I0BA 1K2PA 3EQIA 5CAVA 4D2VA 3D94A 3V6RA 2QG7A 4NIFB 4TY1A 5EDPA 4F9CA 5AR8A 4AA0A 1R78A 2BTRA 3ORIA 4PMSA 4XP3A 3TV4A 3ZS5A 5KMMA 2WMTA 2R5TA 2XM9A 2YN8A 3V5TA 4DFUA 3HV7A 5LQFA 4G34A 3CSVA 1LUFA 4FV5A 1UU3A 1G8SA 3MIYA 5IUIA 1MUOA 1ZMWA 4USEA 4ANQA 2NO3A 2WAJA 4FV8A 5AV3A 4F99A 2WEVA 4NYEA 4BWPA 2WKMA 3CPCA 4FV3A 4AFJA 2JFMA 2VTAA 3LKMA 3UVQA 4PMPA 3BHTA 5C1QB 2Z7SA 3HGKA 3LCDA 4ORKA 2ITOA 2FVDA 3NUYA 1E1XA 1H1QA 4WG3A 2YDIA 4QD6A 1CKIA 4BBEA 4NW6A 3KRXA 2V5QA 3ORNA 4F6WA 1W83A 3GCVA 3TZ7A 4AE9A 4D28A 2XZSA 2BKKA 4G3GA 2A19B 3OW3A 2VWIA 3NPCA 4NKSA 3MH2A 4XV1A 5ETIA 5DWRA 2QHMA 2I0YA 4HVIA 2QKWB 4W8DA 1IG1A 2VO0A 1HOWA 2PVLA 4NTSA 4WG5A 4CFVA 2P0CA 5TE0A 4DEAA 3ODZX 3RPOA 5E4HA 5J9LA 4DF3A 3MPMA 2RFDA 2P55A 2UW7A 5A4CA 4DFLA 4O0YA 1QPJA 3MH1A 5DEWA 2IG7A 1J1CA 1WFCA 1ZOHA 4ZY5A 3VRZA 3MGYA 3FJQE 2Z60A 5GZAA 3DLSA 5FEQA 2UZEA 5CEIA 1J7UA 5FXQA 3W55A 4QQJA 4O7RA 5E1SA 1L3RE 1MQ4A 3MTLA 3PSDA 3BELA 3CIKA 3E7VA 3NCZA 1LR4A 4DEEA 4P90A 3MIAA 4ACCA 2JDTA 2JDSA 3HRBA 4XG3A 3FV8A 5CU0A 2FGIA 3CQEA 2OGVA 3EQCA 4BR3A 3QU0A 3BHUA 1WBWA 2C69A 3QUPA 4DH7A 2W9ZB 3GNIB 1GNGA 5IDNA 5M56A 4DITA 3PXZA 3TV7A 4DA5A 4PP9A 3V51A 5A6NA 5FUTA 2C0OA 1JKKA 4RWJA 5EFQA 4APPA 3OS3A 3ZH8A 4FTJA 1OUYA 5EOLA 3OTUA 4YJTA 3UQGA 5HNIX 3EQPA 3R6XA 2V55A 5TT7A 2YJRA 3CKXA 3E93A 5CWZA 4EYJA 5GIOE 3LFBA 3PPJA 3KXGA 5FDPA 4I6HA 2R2PA 3Q3BA 3BLRA 3VBTA 1BI8A 4FSUA 4HZRA 3IW6A 4PL4A 3IGGA 4FIGA 2CCHA 3P0MA 4K33A 3ZLWA 2CGWA 3PLAE 3CQWA 4O6EA 4R3PA 4CKIA 4R7HA 4JDKA 2PVJA 3UG2A 2CGXA 3P7AA 3Q04A 4DEIA 4AZEA 4BWXA 1PMEA 3UQCA 2B9HA 4ANSA 1PW2A 3REPA 2P33A 3I4BA 4QMUA 3PRFA 2VWZA 3CD3A 1BX6A 3CGFA 4ACHA 5DG5A 1OKZA 1P5EA 3ZHPC 2C3IB 4EHZA 3CC6A 2PE0A 3FZPA 2QD9A 4IVAA 4BF2A 2B7AA 2HZIA 4E26A 4IXPA 2W1CA 2CKPA 3RI1A 4GUEA 3TG1A 5IQEA 3VVHA 5HNBA 3QHWA 3RBWA 2IJMA 5IQIA 4O7LA 2O2UA 4PDSA 4CXAA 2YCRA 4G6NA 3BYVA 5C26A 4FBXA 3V3VA 1PXPA 3V04A 2ETMA 5CS6A 4LL0A 4F65A 3TTJA 3MFUA 4KINA 4IWPA 1JKLA 5HG7A 4E5AX 2IZTA 4IDVA 5CQWA 1H28A 2B52A 2YABA 3D5VA 4UYNA 1HCLA 4U5JA 4CMOA 4KIKA 1JNKA 3F3VA 3HLLA 2GQRA 1GAGA 1JWHA 2WIPA 5ITAA 2E9VA 4C57A 2Q0NA 2YHVA 3BYOA 3BQRA 4K9YA 4QMMA 3GFWA 4E4XA 1RJBA 3Q5ZA 2W17A 3FMJA 4NWMA 1KE9A 5AIKA 1OGUA 3ZUUA 3UPXA 2Y4PA 3E3PA 4KBKA 4XEYA 1J91A 3AQVA 3BHVA 5J87A 3BKBA 4TYJA 4J7BA 2R3GA 5EI8A 4BDBA 5KO1A 1H08A 5DT3A 3HYHA 4FSWA 3VBWA 4FTIA 2F9GA 5CI6A 4PMTA 4J8MA 1K3AA 3KK9A 4P5QA 4U42A 3ULIA 1Q5KA 4C4IA 5HX8A 5J5SA 3OMVA 3CJGA 4LMNA 5DMZA 4EQCA 4F7SA 2C68A 3IONA 1B39A 1ZYDA 3U54A 2I1MA 3LXPA 4Q9ZA 3TUBA 3BLQA 3R8VA 2X7OA 4JIKA 4YLKA 2GSFA 2QOOA 3PJCA 3KEXA 4I3ZA 3ZC6A 2ZV7A 3FMMA 2BDJA 5JFSA 3Q32A 4IC7A 5C8MA 2QI8A 1OIRA 2XYUA 5L6OA 3DJ6A 4RLLA 2CSNA 4BL1A 3GFEA 4IAZA 4XS2A 2GTMA 4EH7A 3U87A 1VR2A 4FKSA 2R4BA 2R3IA 4QT1A 1KV1A 4ZXTA 4ZLYA 4BCFA 4IW0A 2WFYA 2WMQA 2AC5A 2GHMA 5B7VA 2VX1A 3FI4A 3JY9A 3VRYA 3N4VA 2FB8A 2PU8A 4QTEA 1WBOA 4GV1A 3F2NA 5EG3A 4A9YA 3WARA 5EQPA 4MD8E 4CFUA 2VN9A 2QO2A 3OT3A 3FE3A 2XBAA 4BI1A 4V0GA 2Y9QA 5IH5A 4RJ3A 2YITA 3R7OA 4A9TA 3L8PA 4EK4A 2YLFA 3GEQA 4NJDA 2DUVA 4NM0A 4YJUA 4BBFA 1LP4A 3OXTA 2X2MA 3TZ8A 5CSWA 3FI8A 1UNLA 4PMMA 4ZY4A 3JXWA 4L9IA 4M8TA 3II5A 2W05A 3QZIA 1YKRA 3V6SA 1Q99A 5GJGA 4A9RA 5EKOA 5J9ZA 2BR1A 4DFBA 1FBNA 4FEVA 3KCFA 5AUYA 1GZOA 4S32A 1NT2A 4ZSAA 1WBPA 2UW0A 3QXOA 4GT5A 3SX9A 4AGDA 4CFWA 3MV5A 4XRLA 1KE7A 4DHFA 5IPJA 3F69A 4L67A 2JIVA 3GC0A 4WRSA 4V01A 2ZOQA 4IWDA 2GFCA 1CTPE 2R64A 1TQIA 1GZNA 3VAPA 2BVAA 4YC8A 5HG8A 3LVPA 3DZOA 4DTKA 1U5QA 4DLIA 1UVRA 4GKIA 3MA3A 2VWBA 5HORA 4FYOA 3FHRA 2C3LA 2OF2A 4H58A 4PUZA 5L2QA 4RIYA 3SOCA 3SOAA 4DH8A 3UC3A 5IEXA 5H3QA 3SA0A 4BDJA 2YFXA 3PWYA 2YDKA 2IVTA 5CT7A 2RL5A 4GH2A 3ZM9A 2PVHA 3EKNA 3AT3A 3IW7A 1PXKA 3ZDUA 4O7WA 4C7TA 4TL0A 1XHAA 4I41A 4FV4A 4KAOA 5KMNA 3F6XA 4MCVA 4NJ3A 4EHVA 4AF3A 3LJ2A 3Q60A 4DGLC 5CU4A 2CMWA 1PYEA 4X2KA 3VS0A 4TYHB 3VHEA 3PVWA 3QYZA 3AD4A 3FDNA 3QTRA 4N0SA 3OF0A 2CCIA 5TF9A 3PP0A 4RA5A 1OPJA 2F57A 2PVMA 3OXZA 2FSMX 3L9NA 4KB8A 3W10A 4LUDA 3O8PA 2VWXA 5DT0A 4NFMA 3WBLA 1XKKA 3O2MA 1H26A 3KN5A 4AW1A 1YVJA 2V7AA 3QQLA 4KABA 3KVXA 3PJ1A 4QMOA 3I0QA 4TYIA 4C3RA 2VO6A 4PTCA 4FTLA 3LZBA 4AS0A 5AV4A 4XBUA 1OKVA 5DE2A 3U4WA 2OK1A 5HE0A 4RFYA 3NZ0A 3UZRA 1IRKA 3UIMA 4ALUA 2B53A 5FTOA 5M55A 3UDBA 5BVDA 3B2TA 3LXLA 3PJ2A 3VF8A 5M4FA 4G3EA 1JOWB 5H8EA 4BTKA 5K4JA 3LIJA 3DBCA 3DOGA 3O8UA 1YI4A 4I23A 4EOJA 3MA6A 5IQDA 2JKKA 1GIJA 2VNWA 1OM1A 1M2QA 3GCQA 3KXHA 3QCXA 4GIIA 4AX8A 5M09A 3HUBA 4FMQA 1PXOA 1YDTE 2C0IA 2YM3A 4AOTA 5ICPA 3V5PA 2LGCA 4FSTA 4QRCA 3UC4A 3V5WA 4B8LA 4IMYA 4D4YA 5HCYA 2BHHA 3R73A 4GMYA 4MXCA 4HYSA 4C02A 4PNIA 2PZPA 2XK3A 3FLSA 4F7NA 3VNTA 1MRUA 4FKIA 2I6LA 3FQHA 3GC9A 4MNEA 2W99B 1ZYSA 2IN6A 5CVGA 4FEWA 3NYNA 2GFSA 3UIUA 3PXYA 4L52A 2WMWA 4ZSJA 2VTPA 2R3OA 5KE0A 4LFIA 5C8KA 4MTAA 2EXCX 1F0QA 2XK7A 4JQ7A 1XH9A 2VTMA 5J7HA 2VRXA 2YIYA 2VD5A 2XF0A 5EHYA 2H8HA 3BIZA 3O0GA 4QO9A 1MP8A 2PVNA 3R9OA 2YWVA 5AR3A 3KN6A 5E8VA 4EK6A 4F6SA 3TKUA 4S34A 3NSZA 3ORPA 3OBJA 3Q53A 2CN5A 3PY1A 2Y6MA 2YCQA 4F1TA 4FA2A 4TNDA 4QYEA 4IHPA 5AV2A 4JRNA 5KX8A 3OFMA 1UU9A 2R7BA 5FTQA 3UGCA 2W1ZA 3LFDA 4AW0A 4B6LA 2QC6A 2GDOA 3C4ZA 2G2HA 3E92A 4ERKA 4UYAA 3O8TA 3RVGA 4RT7A 3VBXA 4K77A 2Y7JA 1PKGA 3I7BA 4L53A 3U51A 5LARA 4UY9A 4LRKA 2OIBA 3D5WA 4ZEGA 3W8LA 3ZSHA 4C37A 2WTCA 5CEKA 1Q3WA 4AT4A 5JSMA 3N9XA 3LJ1A 3RPYA 3QYWA 3F82A 3RAKA 2ITXA 4JI9A 1FMOE 2VUWA 4GEOA 1BKXA 4IM2A 2C5VA 4JAIA 4W4WA 4YBKA 5C8NA 4IZYA 4MNFA 3HMMA 3D7ZA 5D9HA 4I5HA 1H25A 3W2QA 4Y8DA 4LMUA 4BYJA 4UBAA 3WF6A 4JQ8A 4RMZA 2IW8A 4AN2A 5JT2A 1WMKA 4RZWA 2W0JA 2PUUA 3G6GA 3GC8A 3R9DA 3D0EA 3DFAA 4C36A 2W5BA 3G51A 4WSYA 2CN8A 3KKVA 3QUEA 5H9BA 3QTSA 3RPRA 1PXLA 2BRNA 5E8UA 3B2WA 3U4UA 3IOPA 4FSRA 3UYTA 5J1VA 1Q3DA 3U6IA 1WZYA 2VWVA 4F9AA 5J5TA 2VTTA 5CANA 2WMXA 5HD4A 2VAGA 4DGNA 2C4GA 4HCTA 3RINA 2Z02A 4IBMA 2A27A 3PA4A 4X7QA 2NRUA 3EN4A 4PX6A 5EW3A 2OW3A 3Q4TA 1RE8A 4DCEA 5IMXA 2FSLX 4PDOA 4UMUA 5KNJA 3PIYA 2OFVA 1A06A 4FSYA 5J7BA 3DXNA 2VX0A 3E62A 4XV3A 2HZ0A 3TCPA 3C7QA 5AAFA 4KD1A 4A9SA 4XP0A 2NPQA 1Q8ZA 5TOZA 3P7CA 5FP5A 3T3UA 2HENA 1V1KA 4GG5A 5M4IA 2DS1A 2R3QA 4L3JA 5HIEA 2I7QA 4IM0A 4YPSA 3Q2MA 3TDVA 3BEGA 2CKOA 1M17A 1W84A 2YJSA 3JPVA 5C4KA 4RVLA 4KBAA 4FV1A 2BALA 4YJRA 2OXXA 1OKYA 3B8QA 1JKTA 3RHXA 1ZAOA 4KSPA 2GHGA 3I7CA 2BFXA 4Q9SA 4I5MA 5I9XA 1UA2A 3GI3A 2BILB 3F5UA 1OPLA 3L8VA 3QTZA 1XH6A 1YHSA 5HI2A 2BDWA 1XBBA 3W1FA 4FNWA 4FKJA 3IECA 3Q9WA 4RVKA 3Q4CA 3HX4A 4JR7A 5J8IA 2UZOA 3LFSA 1OBDA 2YIXA 4ZZOA 3E8EA 2GMXA 4FG7A 4R5YA 1FINA 3OWJA 4MAOA 2YZLA 3PIXA 4CKRA 2JAMA 4RIWA 2UW8A 3S3IA 5KUPA 4F08A 2V0DA 4DEDA 3LPBA 4F0GA 5A4QA 3VS6A 1DI8A 4GU6A 1YOLA 4U3ZA 3LJ0A 4C35A 3NUSA 2WQMA 3DKCA 1PKDA 2EB3A 3GGFA 3MW1A 3QRJA 4O0XA 4YTHA 4W8EA 3P23A 5AMNA 3VO3A 4IAFA 4ZS4A 3PXFA 2O63A 4R5SA 4E8AA 5BVFA 2OH0E 3BGZA 4QMXA 3UOLA 3U6JA 4YP8A 1CM8A 4H39A 2ZV9A 4MBJA 1Q41A 2B9JA 2XNOA 3AMYA 2CGUA 3AC2A 2QQ7A 4PTGA 3KY2A 4AA5A 1TKIA 3FI2A 3RP9A 1XR1A 2QU6A 3D15A 2XK4A 4ZLOA 1L8TA 4FKQA 3BCEA 5ANJA 2WNTA 4KBCA 1FPUA 2R3FA 4ZOGA 5KKRB 4FKOA 2VTJA 4HNFA 3DKFA 4RX5A 3FZOA 4OTDA 3R1NA 5CVHA 3TDWA 2X6EA 4YU2A 4K11A 4MVFA 5L4QA 1H00A 3DV3A 4LGDA 3ZZEA 5KCVA 1B38A 4NM7A 1M52A 3H4JA 4QP9A 4O91A 3BE2A 5AR4A 5EYCA 4ZLZA 3FLZA 4OLIA 3EWHA 3R22A 4JDJA 3HP2A 5FM2A 5HE3A 3UMWA 1OB3A 2C30A 3F2AA 3QKKA 3BPRA 4DC2A 1GJOA 2QOKA 4TRLA 4BCJA 1ZYCA 2PUPA 5JZJA 4I24A 3ZEWA 1YW2A 2GU8A 4IB1A 2ZVAA 3UODA 3AD5A 3BBTB 4BTFA 3MH3A 2BCJA 4WSQA 3V01A 1FVRA 2C1BA 3WIKA 5HKMA 3ZDIA 3TN8A 1E9HA 2R3RA 3O23A 4C2VA 3E8DA 4IAKA 3PVUA 2G01A 5DOSA 3QGYA 2B1PA 1FQ1B 3ZRKA 4X3FC 4O7VA 3FC2A 3KULA 5EYMA 2QLUA 3LOKA 3D14A 1IA9A 4AUAA 4G17A 3ZYAA 4FF8A 3FKNA 3R8LA 4EK5A 3TL8A 4I6QA 3FXWA 3PP1A 4O21A 1KV2A 4O38A 2B9IA 4KRCA 5EYDA 3IPHA 4U44A 2PUIA 5HBHA 4RLKA 4DG3E 3AC4A 4R77A 2PE1A 5DRBA 5I5ZA 3OCGA 4FTAA 1PMVA 4CRSA 2CKQA 2PHKA 3H0YA 4BGQA 5AP3A 4BTJA 2JIIA 4RIXB 2ZMCA 3VBYA 3ZTXA 3TUCA 3P5KA 4PDYA 2X2KA 4KS7A 2BZHB 1PJKA 4IFCA 5DHJA 5I3OA 4TWOA 5L6PA 3L9MA 4AZSA 4EC9A 5HO7A 3DB8A 4FKGA 1REKA 2B9FA 3IDCA 5AJQA 4BDDA 5EH0A 4F09A 4QTDA 4Q2AA 1P4FA 4OTGA 3QCYA 2BUJA 2ETKA 3IKAA 3TIYA 1PXJA 4E73A 3MESA 1ERKA 4FV6A 2X4ZA 2VWYA 2W5AA 3RK7A 2UW3A 5BVEA 3DBDA 4GUBA 1BLXA 3ZLXA 3VQHA 3BU3A 3E63A 3NS9A 4O1PA 4RRVA 5DBXA 3VS1A 4JBPA 1Y8GA 4D0WA 4NCTC 4QPAA 4OTIA 3T8OA 2PZ5A 3BBWA 4S2ZA 3QALE 4TNBA 3FL5A 1XBCA 3CXWA 4PL3A 3UNZA 2PSQA 4BB4A 4CCUA 3SV0A 4G1WA 1RQQA 3LXKA 4L46A 5GZ8A 5L2WA 1M2PA 4QYFA 1BYGA 3LQ3A 2QOBA 4DYMA 3QTQA 5D10A 5HICA 3Q2JA 4C4EA 3RCDA 4D0XA 4EH2A 4EKLA 3G2FA 4MQ2A 5H2UA 4AN3A 2O0UA 3DBFA 4RGJA 2VX3A 1Z57A 4HYIA 2XB7A 3OZ6A 3BQCA 3K3JA 5D7VA 3SD0A 5GINE 2C6OA 4IZ5A 2W1GA 4BCMA 1BL6A 3HAVA 4U41A 1GY3A 4FUXA 5KKRC 1AD5A 3VS5A 1W98A 2OF4A 5H8GA 4K8AA 3ENHA 1ZYLA 1V0PA 1H1PA 2J6MA 3EOCA 3QRIA 1CKPA 4EORA 3CPBA 3F3ZA 4C59A 4CSVA 4RJ6A 4IAYA 3EL7A 2HIWA 3C4XA 3K2LA 3DGKA 3M11A 3MB7A 4FODA 4TWPA 4L45A 5IKWA 3SRVA 5A9UA 3HKOA 4U3YA 3FEGA 1OL7A 2J90A 3WYXA 4XG7A 4AP7A 4TYGA 3OY1A 4OAVB 5K9IA 1YXXA 3PVGA 5FGKA 1F5QA 4BBMA 3AGLA 4ANMA 3P08A 2WHBA 4EEVA 4EI4A 5CASA 5DIAA 1R1WA 4G6OA 4KKHA 4M0ZA 5M4UA 3VBVA 3QUDA 4YBJA 2XYNA 4WUNA 2BKZA 5DEYA 2H34A 3D5XA 3C51A 4BGHA 3NW7A 5HVKA 4WO5A 3I5NA 4M69B 4QP3A 3W8QA 2YIWA 4FZFB 3IDBA 3C4FA 3HA6A 3DQXA 3UIXA 4GKHA 5CXHA 3F2RA 4EHGA 2C6EA 3MSSA 4CLIA 4EOSA 4IAAA 1BUHA 3QL8A 4DEGA 4AZFA 4YLJA 2F7ZE 2I0EA 3A7HA 3QCQA 3WF7A 5BMSA 2WGJA 5HBEA 3LFQA 4Y5HA 3RAWA 4U43A 3R00A 5AAEA 3A61A 5JGBA 4RJ4A 3TJCA 1SZMA 3KRJA 2W1EA 4EOMA 2FSOX 4Z9LA 5I9UA 2W4KA 3MY1A 1CSNA 3KXXA 2Z8CA 4FTUA 2C0TA 5E91A 4BZNA 5HBJA 3H3CA 5FG8A 4W4VA 3GUBA 3S2PA 3DJ7A 4GS6A 1OMWA 2WU6A 3SLSA 5BUJA
chains in the Genus database with same CATH superfamily
3Q9YA 4PQNA 2W1DA 3LCKA 2ZB1A 5GJFA 2GNJA 2XA4A 1YRPA 1JKSA 3AKLA 3F5GA 4RIYB 1Q8UA 1NY3A 2RFSA 5EM5A 4FC0A 3A8XA 2UW5A 2W7XA 2I0VA 4R3CA 3KMUA 5FBOA 3R7IA 4PDPA 3I0OA 4WHZA 4J99A 2R9SA 2UW6A 4DH3A 5ETFA 3MYGA 4O84A 1IA8A 1JVPP 4TXCA 4ZSLA 3F88A 3UJGA 3HVCA 3LQ5A 3PPZA 1H1SA 5ANGA 1PXNA 1I09A 2XKEA 3L9PA 4MXXA 3UO5A 3ENMA 3MB6A 4BCOA 2ITTA 1SVEA 3SG9A 4JDIA 4FIFA 4IVCA 5DT4A 3WZJA 4BCHA 4CYJA 3WZDA 4ASXA 3DDPA 2VTLA 3NUXA 2ZAZA 3DT1A 5CSVA 3VUTA 5AM6A 5CYIA 5FWKK 4Z7GA 3ZRLA 4P2KA 3VS2A 4QP8A 5BYLA 3QZFA 3KF7A 3PVBA 5F20A 4EUTA 3C0GA 3Q96A 5CQUA 3FPQA 2GNHA 4EH5A 4BCGA 4RX8A 3JR1A 4AACA 4ASEA 1QL6A 5FP6A 3Q52A 3MDYA 1TQPA 3VIDA 2XUUA 2B54A 3HDMA 3OT8A 3R1YA 5HO6A 3FI3A 4OT5A 5DGZA 1XH5A 3DAKA 3M1SA 3VN9A 4A4LA 1J7LA 4MQ1A 1M2RA 1WVWA 1JSTA 3G33A 3BGPA 3HP5A 4DDIA 5BX0A 3QQJA 3RAIA 4EH6A 3LFEA 4S30A 4DLJA 3EZVA 3UTOA 4ZP5A 3QXPA 4QMSA 5AP4A 3KXNA 3T9IA 5IQBA 5A4TA 5CF5A 4WIHA 5IA2A 2JIUA 1UKIA 3KL8A 4R1VA 1YOJA 4JNWA 3TKHA 4AG8A 5CAOA 3NUAA 3JVSA 3RWPA 3TACA 4BKYA 2ONLA 4AXAA 1ZRZA 3R9RA 4HW7A 2ERZE 1NVSA 3OUNB 4YC3A 5CF8A 1ND4A 4HGEA 2C6KA 4I4EA 2IZUA 3Q9ZA 3MPTA 2CNQA 2R3MA 4U40A 3LQ8A 3R7UA 2FYSA 4YTFA 4AXDA 4CG9A 4CLJA 2X9EA 4I0RA 3OOGA 3QD0A 4MYGA 4OBPA 3E8NA 3PXRA 5FEEA 4FKUA 3PA3A 3KGAA 4LG4A 2HAKA 3UP7A 5HIDA 5CEMA 3IO7A 3ORXA 3MY0A 1STCE 3ZFXA 4FJVA 4QP6A 5L2IA 4AE6A 3FKOA 4S31A 5LXMA 2KULA 4OUCA 4HPTE 5CAUA 1S9IA 1R0PA 3FKLA 4PPBA 3UO6A 2OZAA 4FTRA 4FVPA 4KA3A 2O65A 4IIRA 3GU7A 3WI6A 4ERWA 3GQIA 5T68A 4FOBA 4C2WA 4Y5QA 1Y8YA 4EL9A 2GTNA 1H8FA 2XIXA 3SVVA 5HLNA 5LMBA 3QWJA 4IX6A 3TJDA 5E8WA 4G16A 4TZRA 1URWA 2PVYA 3KB7A 5CXZA 2OXYA 5AP6A 1Q4LA 4FV9A 1RDQE 4CGAA 4LRJA 1KUTA 5HNGA 2YM4A 5AEPA 4BTMA 3F5XA 5GJDA 5I9YA 4D2RA 3HV3A 4GK3A 1W8CA 1W2FA 4J1RA 1UKHA 2W96B 3R83A 5F4NA 3V8WA 2HK5A 5BPYA 4D9UA 4NKAA 2KTYA 5DR6A 3WOWA 3ZOSA 2XJ2A 2J5FA 2QKRA 1M7NA 4WA9A 4BICA 5L2TA 2B0QA 1MRVA 5ETCA 1U4DA 3QTUA 4QMWA 4NIFA 5EKNA 4E1ZA 2OIDA 2XK8A 3GCSA 4ENXA 2G1TA 3DJ5A 5DYJA 5AX3A 2HW6A 3ZZWA 3BHYA 3FQSA 5HLPA 4HGLA 2UV2A 2C5YA 5AR7A 2Y0AA 4BDCA 2ZMDA 4QDVA 5AP0A 1XWSA 3P86A 4UV0A 4FUYA 5AWMA 3SC1A 4I6LA 3UOJA 4H3QA 2UZWE 1K9AA 5BQ0A 4HVDA 1OI9A 4R6VA 4B4LA 3AC8A 3GVUA 4RWKA 3QFVA 1U46A 1SYKA 2XS0A 4J96A 2ZM1A 4LUEA 2YA9A 4M0YA 2XIKA 2ETRA 4L44A 1YHWA 2NNWB 5EI2A 4UWCA 4EOPA 4WNPA 3ITZA 4ZTRA 2VTRA 2P2HA 3R8PA 4FTTA 2WEIA 4FSQA 4E5WA 4Z7HA 5HQ0A 4HYHA 5IQFA 3HDNA 4RQKA 1B6CB 2QONA 2XNEA 3COHA 4BJJA 3CTHA 4BIDA 2C6IA 4F7LA 3AMAA 4L3PA 4AZTA 3SW7A 3GBZA 3R7GA 4L01A 3F3UA 3IOKA 4BKJA 3DLZA 3E3BX 5I4NA 3PJ3A 4U0IA 5EW8A 1S9JA 2OLCA 3SG8A 4YO6A 4G5PA 3DK7A 4CZTA 1OUKA 3BI6A 5C27A 3DQWA 4FSMA 4AOIA 2XJ0A 5ETAA 1IAHA 3VW8A 3I5ZA 4RPVA 2XKCA 4BDFA 1PMNA 1W82A 2GPHA 4Y72A 3F7ZA 3IDPA 1JAMA 4YZMA 2XANA 3GP0A 3C4WA 5JK3A 4CFXA 2C5NA 5J79A 2JC6A 4RG0A 1KOAA 1DS5A 3W2RA 3W32A 5BVWA 2BRBA 5HLWA 5I9WA 4ENYA 1KWPA 2GNGA 2UW9A 4MD9E 3WF8A 4EBWA 3HL7A 2BRHA 1OIQA 4FIEA 3MY5A 5LWNA 3TNIA 3EQBA 3W33A 4MBIA 3BLAA 4IWOA 2J50A 3POZA 1JBPE 2BTSA 3MFSA 4UMRA 2VTSA 5BV3A 2RFEA 2ACXA 3UBDA 1NXKA 3FLNC 1G8AA 1YWRA 2WPAA 1VYWA 2VV9A 3KRWA 2YLEA 2QR7A 5IQHA 2DQ7X 4X6QC 4RC4A 4RIWB 5HVYA 4DEBA 5JQ5A 3FUPA 5M4CA 1FVTA 2J0JA 1JQHA 3VF9A 3NAXA 3DK6A 3NUUA 5CSXA 4I22A 4F9WA 5B2MA 3UIBA 1TQMA 2VGOA 2XP2A 3NW5A 1YXSA 2X2LA 4Y46A 2VO7A 3PUPA 4CTBA 1O6LA 2YM8A 3PSBA 4HJOA 4BN1A 2BRMA 3LMHA 3KA0A 2NP8A 3P78A 4NM5A 2XBJA 3HV4A 3HMNA 2PUNA 3AGMA 4ACGA 2O5KA 4TKSA 3RK9A 2IO6A 2IVUA 4TW9A 2Z7RA 4I21A 2J0MB 4WT6A 3VUDA 1NVRA 2VO3A 2JAVA 3PA5A 3QTXA 4RWIA 2O64A 4XLIA 5DRDA 4ZTHA 4FZ7A 2O3PA 3BWJA 5CX9A 4ZSEA 4X21A 5KZIA 2CDZA 1ZOGA 5DI1A 4CNHA 5AAGA 3KK8A 3OEZA 3B8RA 2E9UA 4K6ZA 1R39A 4PPAA 5H8BA 3K3IA 3RK5A 4GW8A 4F0FA 5CI7A 4USFA 3JVRA 5HE2A 4JQEA 3U9CA 1M14A 3OWPA 2XNPA 3G15A 3PZEA 3IW5A 4FKLA 4W9XA 3R8UA 4AWIA 2QCSA 2W4JA 3R1QA 1YOMA 4L3LA 1BMKA 3VS4A 4CMTA 4CQGA 4I4FA 4O2ZA 3OROA 4L68A 4DGGA 4L6QA 2J0LA 2X0GA 1VYZA 2C6LA 2IW6A 4J97A 4Y95A 3PLSA 2IZRA 1U59A 3O17A 4OTQA 4BVUA 1G5SA 3SXSA 1U54A 3E64A 3ANRA 3DTWA 2RFNA 4BI2A 3WE8A 5M07A 1ZMUA 2WTKB 3ZCLA 2BROA 4O0VA 3ZRMA 2Y8OA 4IX3A 4RFMA 4XUFA 4CEGA 4E6CA 5K0XA 4PL5A 5JN2A 2WQOA 3UNKA 1A9UA 4GG7A 4BKZA 5FLFA 2ZYBA 3R2BA 5K3YA 3KXMA 4QMNA 3M2WA 2X4FA 3TIZA 1JSUA 3QF9A 3QQKA 2GS7A 5EM6A 4DFZE 4DTAA 3VBQA 3CD8A 4AAAA 4R8QA 4FEXA 1QMZA 3R8MA 2ITVA 1J1BA 1W0XC 4E3CA 3ZSGA 4OTFA 2WTIA 3C4EA 2V22A 4FKPA 3COMA 2WOTA 4BIBA 1PRYA 3NMUF 5B0XA 2XIZA 3SDJA 3R04A 4RJ7A 4BY9E 5F9EA 1PXIA 2BAQA 4FICA 4QPSA 4XX9A 4W9WA 4YURA 2FO0A 4FK3A 2XKFA 4B99A 4XH6A 3S95A 3ORKA 5CTPA 2SRCA 1UNGA 3A62A 4OBQA 4ACMA 1IEPA 1YXTA 3BLHA 4BYIA 4D4RA 2ZM4A 1H07A 5EM8A 4UX9A 1R0EA 3ET7A 3W2SA 3R9NA 5M51A 4R7BA 3QD2B 4FGBA 3PG1A 4ZZMA 3WIGA 3IQ7A 2YDJA 4OBOA 3CKWA 3JYAA 4NK9A 3HMOA 5EK7A 3ZO1A 3EN7A 5JQ8A 2J7TA 2QG5A 5A14A 1UWJA 5CENA 5ANEA 3EMGA 4JG7A 2OJGA 4MXZA 3I79A 2ITNA 2GHLA 1H01A 4MWHA 3WZKA 4CRLA 3ORMA 4FTMA 3DU8A 5GZ9A 2J5EA 4RIOA 2HYYA 4XLVA 3SHEA 3UO4A 2WB8A 3BZ3A 3IGOA 4CYIA 1Y57A 2R3NA 3QRKA 2PVKA 3BEAA 4FVQA 2WMSA 3A4PA 4XV2A 5AUWA 2PMOX 4X3FB 5HD7A 4CD0A 1MRYA 2X81A 3QKLA 4FKRA 5IF1A 2YAKA 4HPUE 1H1WA 5CT0A 3ZU7A 2E9PA 4GL9A 2HZ4A 3NIZA 2J2IB 3WF5A 2XARA 3M42A 5HCXA 3R7VA 2EVAA 4FEUA 2W1FA 4OR5A 5CY3A 2WTJA 4AA4A 4D9TA 4LOQA 4ZTLA 5E8XA 4DHJA 1SNXA 2WMRA 4FV0A 4IX5A 4N6YA 1FVVA 3RM6A 4G3FA 5EDQA 4XV9A 4FYNA 4XG6A 4QDEA 5A6OA 1DAYA 2BZJA 4IEBA 4C8BA 4YR8A 3AT2A 4WBOA 2H6DA 5HEZA 2XALA 3BRBA 2YEXA 4IJ9A 4GFMA 1YDRE 2YM6A 3ULZA 4QQCA 5A54A 4ZS0A 3FXZA 3NNWA 5IUHA 1F3MC 4DGOA 2PMNX 3G6HA 5ANKA 5CEQA 2HWOA 2XIRA 3F9NA 4CCBA 2FUMA 4IANA 4PY1A 3ZEPA 3ANQA 3LFNA 4KIOA 3DK3A 2JKMA 4LYNA 3TNQB 3L8SA 3QRUA 4JG8A 5DFPA 4CMUA 3D2KA 3TXOA 1TZDA 5CF4A 5KHXA 5CF6A 3GU4A 1OKWA 1W2CA 2PE2A 2QR8A 2CGVA 3F7WA 4HCUA 5HZNA 2QOQA 3POOA 4NT4A 3RAHA 2WTKC 3W0SA 2RKUA 3VW6A 1VZOA 2XNBA 3ERKA 3UVRA 5AR2A 2OU7A 3DFCB 1ZYJA 2H9VA 4FTQA 4J53A 2GNFA 1ZY5A 2HELA 4QQ5A 5DR2A 5HVJA 5BUIA 4CV9A 3DKGA 3BHHA 3FZ1A 4C4GA 3V5JA 3VUHA 5T6KA 4M13A 2J51A 3QQGA 4OTWA 4DT9A 3ELJA 4RX7A 3BE9A 3BYSA 3O7LD 3CTJA 5BMMA 3G90X 4TYHA 3N4TA 3ZONA 3RWQA 4RC3A 4IQ6A 4FI1A 4KUJA 4ALWA 2BAJA 2G9XA 3HV5A 3TMOA 2RG5A 4GVAA 4ZJVA 4DH1A 4FTCA 4W4YA 4GT3A 4UZDA 3NDMA 5CVFA 4CTCA 4L42A 3ORZA 4YJNA 3HEGA 2UVZA 2XK6A 3R0TA 2VTOA 2JLDA 4J98A 4K2RA 3WILA 5JGAA 5JRSA 4RZVA 5LMAA 4P4CA 4MEDA 1LPUA 4GIHA 5BUEA 3CY3A 5G6VA 1J3HA 5D1JA 5AUXA 4F70A 4YUQA 3V5LA 4O82A 2VTHA 1R3CA 3KRLA 2G15A 5EI6A 3DPKA 4O0TA 3JY0A 2ERKA 3I6WA 3NYVA 4ASDA 3GT8A 3AXWA 3NUNA 3FLWA 3FYJX 3PWDA 3R8ZA 4MK0A 1OL2A 4D1SA 4U80A 2YM7A 5JFXA 4OTPA 4CQEA 4EK8A 4Z16A 3EZRA 4ITJA 5M06A 3QX4A 4YHJA 3OC1A 4J8NA 3F3WA 4IFGA 4AFEA 5IU2A 2X7FA 3AD6A 4G6LA 4F1OA 1PYXA 5AADA 4UALA 4NFNA 5CNOA 1PF8A 1QPCA 2JFLA 4QPMA 4QOXA 3TV6A 2HZNA 1JLUE 2WMUA 4IZAA 2UW4A 4IH8A 4C4JA 4A06A 2VTQA 4DCAA 3KMWA 4U45A 5GHVA 5CEOA 3SAYA 3MFRA 3A7FA 3OTVA 4USDA 4DHZA 2OH4A 4EOLA 1Z5MA 4QNAA 4XG9A 1Q8WA 2YM5A 4EJNA 4FL1A 4YMJA 2E9OA 1Y6BA 5KMKA 5HCZA 3R2YA 3KVWA 2XJ1A 3EIDA 3KQ7A 4JS8A 3UOHA 2Q83A 3PUFC 5FM3A 3BU5A 3JUHA 4MXYA 1H24A 5JZNA 3FZSA 3ZUVA 3P9JA 3EQHA 2YERA 4MHAA 3SKCA 3NRMA 2ITZA 4EK3A 3EFWA 2XNNA 3NGAA 4J95A 5CSPA 1NVQA 3DNEA 1Q61A 3D2IA 4K18A 4AU8A 1YWVA 2PVFA 2JKOA 5I9VA 3WZEA 1WAKA 1ZWSA 2PYWA 5AP7A 1EH4A 3C0HA 3FMKA 5KBQA 4FTOA 4EH3A 2BPMA 4ZK5A 4D2SA 5AUUA 3ZO2A 4I5PA 1AGWA 4LV5A 3EHAA 3PPKA 4FIIA 4GCJA 4QP2A 3GQLA 4KIKB 2XVDA 3BYUA 5DA3A 3TI1A 4YHTA 3VJNA 3R7YA 1H4LA 4PWNA 2R7IA 4O0RA 4ARKA 4TTHB 4Z3VA 2JITA 2CKEA 2EXMA 2UZBA 3EFKA 3R63A 3RM7A 3O50A 3V8SA 3ZXTA 4FK6A 2BAKA 2WTDA 4NW5A 2BRGA 4BCIA 4UMTA 2BZIB 2CNUA 3R02A 2EXEA 3W2CA 1OL1A 1Q8TA 2VNYA 5A4LA 1V0OA 4OGRA 2C5XA 3CGOA 3O71A 3NX8A 3C5UA 2XH5A 3NYOA 1OECA 2OZAB 3MI9A 3NNXA 3OP5A 5BVKA 3SW4A 4O0UA 3GB2A 3LCOA 3PYYA 3TM0A 2A2AA 3U8WA 3G5DA 2CPKE 4AQCA 4MH7A 4WNKA 1WBSA 3QZHA 1MQBA 3KMMA 2UUEA 5HO8A 2ZV2A 3SQQA 1LEWA 4LV7A 3FMLA 4JDHA 3LMGA 1VJYA 3DS6A 3IK3A 3QD3A 4WOVA 3VHKA 3NW6A 4P5ZA 4YSJA 4FT3A 3UE4A 2RG6A 1SVHA 1OZ1A 4FSZA 2XK9A 4NM3A 4EZ3A 4BC6A 3QHRA 4C0TA 2ITYA 5IISA 5CU2A 1YHVA 2OZOA 3D7TA 4NTTA 2W5HA 3FXXA 4B8MA 3DTCA 3FLQA 1WVYA 2C6MA 3DXPA 4O22A 2QOLA 4AT3A 2QOIA 2QODA 3HRFA 4XG2A 5BNJA 4M67A 1U5RA 5J95A 2QU5A 4WBBB 2IW9A 1V0BA 3MTFA 4FT9A 5BYZA 4V0GB 4I94A 5LWMA 3U55A 4UXLA 5AUVA 4ALVA 5JKGA 3RZFA 3QA8A 3UQFA 2HW7A 3QX2A 4FL3A 4FT0A 3ATTA 3QWKA 3BV2A 2Y4IB 4KIPA 4XOYA 3WF9A 5LMKA 4RVMA 3DKOA 2PULA 3NVKI 4FKVA 5AV0A 5K0KA 3VS7A 2R3PA 3QGWA 3ZM4A 3Q6WA 1OITA 2FA2A 4IDTA 4FZDB 4YZCA 4H3BA 4QMPA 5AP1A 2WZJA 2YISA 4LOPA 4BHNA 1WBVA 1LEZA 2QVSE 3FHIA 3GOKA 3OXIA 5AP5A 4F64A 2WELA 3I81A 4ACDA 4O0WA 4JXFA 4O96A 4BDIA 4BCPA 2VTNA 2IZSA 5M53A 3FWQA 2OI4X 4I6BA 4NCTA 3QLGA 4FG9A 5C03A 2QURA 2IVSA 4YZDA 3DY7A 3KRRA 4QYHA 4CT1A 5HTBA 5LJJA 2XEYA 2A98A 3AMBA 4E4MA 3C4CA 4DE4A 1IASA 5F94A 1YWNA 4JVGA 2WMBA 2ZJWA 1X8BA 4ZZNA 5AIRA 1P14A 3W0QA 5KMOA 3P7BA 2A0CX 2P2IA 2V7OA 3WYYA 5LCJA 3FAAA 2AEGA 4GK4A 4A4OA 4O6LA 3NVMB 3DAEA 4LL5A 4F0IA 2PPQA 3OVVA 5JGDA 3W0RA 3COIA 4ZY6A 3FL4A 4WNMA 3DA6A 2EUFB 4GU9A 5K5XA 4IB0A 3L8XA 2ONLC 4QQTA 3QA0A 4ZAUA 5KZ0A 4DFYA 2V62A 5E90A 5CEPA 2Y6OA 3VJOA 1Y91A 4G5JA 5EQEA 4QP4A 4C3FA 3KF4A 4EJ7A 4JT3A 4E20A 4UMQA 4YJSA 5HU9A 4HVHA 4PNKA 4K0YA 2LAVA 3UPZA 3CLYA 3MS9A 4Y73A 5KMLA 2X39A 4CKJA 2W1HA 4KSQA 4UB7A 1UNHA 1WVXA 3LE6A 4H1JA 2UZNA 1OL5A 2WIHA 1ZARA 3FSFA 3FZTA 4FVRA 1Q97A 3PY0A 4ITHA 3TEIA 3MVMA 5E8TA 2XRUA 3C5IA 1URCA 4JL9A 4U79A 5FRIA 2E2BA 4X2NA 3LM0A 4FZAB 3W2PA 2XIYA 4FEWA 1RW8A 3SXFA 4EWHA 5DNRA 5HTIA 3OY3A 4G9RA 4JX7A 3GU5A 2GNLA 4D4VA 4LQMA 2CHLA 2GS2A 5B2KA 2VWUA 2XCKA 2X7GA 2JBOA 3TZ9A 2VZ6A 3QQFA 4P7EA 4Q5HA 5AP2A 1OBGA 4FE2A 4Q5EA 3VUMA 3E5AA 2Z7QA 3E88A 2HXLA 4F4PA 5JFVA 4MF0A 2JGZA 4WKQA 1OVEA 3A8WA 4ANBA 4JBVA 4EH8A 3UZTA 3FSKA 4O7TA 2XMYA 1J7IA 3MJ2A 4J71A 5L2SA 3IG7A 2AYPA 2BHEA 3SXRA 3EL8A 3PJ8A 5KHWA 4GRBA 2YACA 4BDHA 4H3PA 3PDTA 2Q0BA 3FY2A 4IM3A 1FGKA 3O51A 2WXVA 5IQAA 4HOKA 3QD4A 3U6HA 4I92A 5FEDA 5B2LA 4MNEB 3LFAA 2PK9A 3E8CA 4KNBA 5HGIA 4DBXA 2UZTA 4YPDA 2DWBA 4DT8A 2ZM3A 4A4XA 4RIXA 1DAWA 5LCKA 4WRGA 5JRQA 3R9HA 4M15A 2I40A 2I0HA 2RSVA 4LV8A 4XG4A 4X2FA 4PF4A 4BHZA 3DZQA 2Y4IC 4C3PA 4C4HA 4O86A 4TN6A 5AA9A 1H0VA 5IDPA 5I3RA 1M7QA 2UVYA 1U54B 1JPAA 3CTQA 2OBJA 4CFFA 4AW2A 2J9MA 2PWLA 1WBNA 3QTWA 4U8ZA 5EM7A 3PE1A 4RJ8A 5IQGA 3O7LB 4FNYA 2A1AB 4J52A 3BV3A 1GIHA 5HE1A 4HZSA 4TWCA 3WE4A 1CDKA 4XG8A 4YLLA 1ZZLA 4M97A 2QNJA 3EQFA 3WZUA 5EOBA 3BWFA 3BX5A 4GFGA 2NRYA 4XBRA 5D41A 4E6DA 3F66A 5E7RA 3V8TA 2VGPA 1Q62A 3FBVA 4Y85A 4M66A 4GYGA 4JRVA 3EN9A 4D2PA 2QHNA 4YSMA 3CP9A 2C6TA 4IAIA 4R78A 1SM2A 5J1WA 3LLTA 3ID6C 5E1EA 2F2CB 1UU7A 2OKRA 3TT0A 4MD7E 4EQUA 1YXUA 3AG9A 3CBLA 4RC2A 5E9EA 4DGMA 4AAYA 2ITUA 2ITPA 4M84A 2R0UA 4PPCA 4UXQA 4AZWA 2PMIA 4NSTA 5GIPE 1T46A 3ZLSA 5CAPA 4R3RA 5IG1A 3OCSA 2AUHA 4DG0E 2UZUE 4YNOA 3UZPA 5IH6A 5CU3A 3NLBA 3T3VA 1FMKA 2BIKB 5AX9A 4TWNA 5CLPA 3RPSA 2WTWA 2REIA 4N4SA 3A7IA 4XHKB 4BCNA 3BU6A 4YGAA 3FPMA 3QZGA 2YAAA 3H30A 5HX6A 3ZFMA 5AUZA 3UMXA 2QO9A 3VQUA 4QMZA 4HGTA 2YIQA 2ZDUA 3D4QA 3OG7A 4JBQA 5AR5A 4CFNA 2GQSA 2ZV8A 4V05A 4MXAA 1Z9XA 2BFYA 3QBNA 4LOOA 2X0OA 1YQJA 2F7XE 4UMPA 5HHWA 1UWHA 4ITIA 4O1OA 3EJ1A 3H9FA 3ZBFA 3MN3A 4I6FA 3DXQA 1QPEA 2PZIA 3NWWA 1GIIA 2UZLA 2Z2WA 4EH4A 3DCVA 4FNZA 4DH5A 3P1AA 4EOKA 3QRTA 1ZXEA 4ASZA 4CFMA 5CAQA 4FV2A 4BWKA 4XMOA 2R0IA 2R3HA 2WU7A 4RA4A 1KOBA 3S1HA 3Q9XA 2AC3A 2RIOA 3D9VA 5AA8A 4BRXA 3HV6A 4S33A 4FTKA 4DINA 4HVSA 5L8JA 4CG8A 3MJ1A 3V5QA 3OWKA 4OW8A 1O6YA 4M69A 4YJPA 5EHLA 4M3QA 2XNMA 4CVAA 4U6RA 4B0GA 4BGGA 4ONAA 3RALA 2IPXA 3LAUA 5EYKA 4R7IA 2OO8X 1Y6AA 4UZHA 5JFWA 5K4IA 4DDGA 3EKKA 3FC1X 4E7WA 2OJFE 1GOLA 4C4FA 2OG8A 4HVGA 3HA8A 3W0MA 2GS6A 4GJ3A 1QCFA 4IJPA 2F7EE 4YZ9A 4KS8A 5IA1A 4QNYA 2OJ9A 4CZUA 4F7JA 3A99A 3UDZA 3RHKA 5BVNA 3Q6UA 2R3JA 1OIUA 5D11A 4BCKA 4EQMA 1AQ1A 3C13A 3OWLA 4HNIA 3OOMA 2H96A 4IB5A 4GFOA 3ORLA 4FOCA 5EHOA 4IB3A 3NIEA 4FL2A 4AXCA 4ZTSA 3IW8A 3PSCA 5IMEA 4DHIB 4LGGA 4YO4A 3SGCA 4ZSGA 3UNJA 4YJVA 3FY0A 1XQZA 3AKJA 2F4JA 1HCKA 1OPKA 4GK2A 3PXKA 4QTBA 3VUIA 3CY2A 3VWAA 3Q5IA 5AUTA 2OXDA 2WQBA 4L8MA 3ACKA 3W16A 3RGFA 4U81A 4UEUA 2JD5A 3G0EA 3RPVA 4GT4A 1NW1A 4XRJA 4V04A 3HNGA 2QOFA 4QYGA 4PTEA 3DB6A 4C58A 3EYHA 4TT7A 2W9FB 3H9RA 2UVXA 3PIZA 4JLCA 3DBEA 3CE3A 3R28A 4MWIA 4YC6A 3EN6A 4RQVA 2ZDTA 1SMHA 3FQEA 5IA4A 5AFVA 1NA7A 3D83A 3LM5A 4HGSA 4IADA 4EOIA 4XP2A 5J9YA 4GSBA 3TNHA 4RBLA 3R71A 3AOXA 5HOAA 3NUPA 2WQNA 1UU8A 3EB0A 1PHKA 3ORTA 4CZYB 5IEVA 2EB2A 1BI7A 3DAJA 3GCUA 4FZ6A 2X8DA 3RNIA 5IUGA 3LW0A 3RCJA 3ZLYA 4BZOA 5K5NA 4ANNA 4GVJA 3QLFA 5M08A 5FBNC 4NL0A 4F63A 2R3KA 3G0FA 3F5PA 1SVGA 4D5HA 1ZLTA 2XRWA 4F9YA 2YCFA 5LVPA 5LOHA 5D12A 3GU8A 2JDRA 4A9UA 1ZY4A 2C6DA 2HXQA 3R7EA 4O7NA 3UVPA 5CALA 3N4UA 3LXNA 2XKDA 2J0IA 3QCSA 5L8KA 4O83A 5A4EA 3ETAA 3QQUA 4QP7A 4D1XA 2HOGA 4JR3A 3OUKA 3VUKA 1T45A 1Q24A 3VS3A 3EN5A 1TVOA 4FGRA 1GZ8A 3PY3A 3R1SA 4EYMA 3FYKX 4YTCA 1APME 4XYFA 3HMIA 2X9FA 3LCTA 4HYUA 4PP7A 2HY81 2CNVA 3E87A 2O8YA 4EHEA 4EONA 3JS2A 4F9BA 5C4LA 3MBLA 3EQDA 3KCKA 3ZFYA 3NYXA 2G2IA 3KULB 3TTIA 4GJ2A 4XOZA 4LM5A 4BCQA 4ANLA 5DPVA 2QOCA 4QTAA 4L7FA 4NEUA 4TPTA 3P4KA 4O7YA 3EFLA 4HCVA 3LCSA 2PZRA 4I0TA 4JIAA 2OIQA 5TR6A 1H27A 3EFJA 4IACA 1FOTA 4QTCA 4O7ZA 1CKJA 4JAJA 4X0MA 3ALNA 2XNGA 4BDAA 3NNVA 3R01A 4G9CA 3CJFA 2VTIA 3CCNA 3NAYA 4YZNA 4B9DA 4EKKA 5JEBA 3FMDA 5E8ZA 3MWUA 3N51A 3ODYX 3ATSA 4QMLA 4DTBA 2RGPA 3C1XA 3L9LA 4L43A 4EOQA 2C3JA 4O2PA 3K5UA 3K5VA 3QAME 2F49A 2PTKA 2PZYA 4IE9A 4FKWA 4KIQA 4AT5A 4FV7A 5A46A 4OAUC 3O5AA 4I1ZA 4WUAA 3TZMA 3ZSIA 4UWBA 1ATPE 5FXSA 5LVNA 2OFUA 2R3LA 5EQYA 3RMFA 2W06A 3ROYA 3ACJA 4MBLA