3AGTA

Hemerythrin-like domain of dcrh (met)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemerythrin-like domain protein DcrH
publication title Characteristics of Diiron Site with Large Cavity in Hemerythrin-like Domain of DcrH
rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3agtA00
4XPXA 3WAQA 2HMQA 1A7DA 1I4YA 3WHNA 2MHRA 1A7EA 2AWYA 2AWCA 3AGTA 2AVKA 4XPWA 3AGUA 4XQ1A 4XPYA 2HMZA 1HMDA 1I4ZA 1HMOA
chains in the Genus database with same CATH superfamily
2OQMA 3RYLA 1M6TA 2ICWG 4A2NB 4YT5A 4IWBA 1M56C 3WAQA 1T01A 2V3CC 1GGQA 2HFIA 3HNLA 3JYYA 3K33A 2QNLA 4PJMA 1Y6DA 4N4WA 2CNWA 1M2VA 4J30B 4MTGA 2G3KA 3NKEA 4O79A 3U8VA 4A4AA 3LJBA 2ZXRA 3WHNA 4OD5A 5A6BD 1MMAA 1OW6A 3S9OA 4MW8A 1FFHA 2GDCA 4YN0B 2YLDA 4MVOA 2AWYA 3NRHA 3DM5A 3I5QA 3NYLA 3GM1A 2FAPB 3C7JA 3DWWA 3GM3A 1ORYA 3ZTZA 2YLIA 4U5DE 3EGDB 4U5EE 3SP1A 5CI9A 4CX9A 4JJGA 5L0FA 1KTMA 1HMOA 4BG0A 1IZMA 3DE8A 1RCPA 2CCYA 1TWGA 2LSEA 4E0HA 2KNHA 4Z9JA 4Z9IA 2Q7RA 4NC3A 5JP7A 1A7DA 3AG3C 3VF0A 3HNJA 1JAFA 3NDBB 2ASRA 2M64A 2NSGA 2CW0F 3TQOA 3UNGC 3C8GD 1RMVA 2XLMA 1NSGB 1U89A 1XZQA 4WGZA 5F28E 1LE4A 2WVNA 3ZSUA 1O87A 1Y4CA 5EGYA 5EHHA 1OXKA 2A69F 2J8WA 2P7VA 2X51A 1BZ4A 2JD3A 5L3QA 2ZXPA 3RF3A 3G4ZA 1KU2A 2Y39A 4E0IA 3ZVRA 2XM4A 1K04A 2R9RB 2VCBA 1TWCA 4YT2A 2NSFA 2X0CA 3S0XA 4QI2A 2HJ3A 5KYXB 2P1AA 1H7IA 4ZLDA 2DGJA 1R5ID 1RKCA 1YARO 2QY9A 4JURI 4DBQA 3HTKC 3LNMB 1YYXA 3FHDA 2IXMA 4ULWA 4G0HA 1GQAA 4JEAA 1O3UA 2CGEA 2HUJA 4JTCB 3HNIA 1SR2A 1T9KA 1F1MA 1QPUA 3JTLO 3M4BA 3ZQVA 5A6JA 4NTBA 3EFOB 1DOVA 5COFA 4GQHA 5JS5A 2G3VA 1Z5ZA 1VK5A 2XM0A 3TK0A 4JVSA 2YQYA 4OD4A 3W4YA 2UUIA 5KYYB 1WOLA 5BQHA 4DRJB 2A6EF 2R7TA 2Y69C 4BJ6A 1XWJA 4KC9A 3FDQA 4XLNF 3KPHA 2G62A 3Q6NA 1C02A 1SYQA 3BEHA 1V4AA 2R7QA 2XRHA 2FFHA 1OXBA 3LEVA 3NYMA 3US6A 1HMDA 2YL1A 5E3CA 3W8IA 1QLEC 4XEFA 4CS8A 2MYSA 4GYTA 1GS9A 1APCA 1OR2A 2BC5A 3BRJA 2YL3A 4NCQA 3SXMA 2R7UA 5KYUB 1NFOA 2IBFA 3A9CA 2UUHA 1VTMP 1HW1A 1H9GA 3UGOA 1Z3IX 4U5CE 3E9VA 3U3BA 3UR3C 4AK9A 3ZDLA 2LIGA 1ZHZA 3JSEO 3L0IA 1QZXA 2AP3A 4HE8D 1LS1A 4KNWA 1AUEA 2Q9BA 3B0PA 3DM9B 2V26A 4MVSA 4MVMA 2I8BA 4N6HA 2YVKA 1L3PA 1OCCC 4LACB 5BQIA 4IAOA 1LS4A 5COGA 5T3WA 1Q0FA 1T6UA 3EQLF 4OINF 4YT4A 1B68A 1E85A 3B0VC 3POVA 2HV6A 1T6IA 1KNYA 3IQ6A 4BJ1A 1MNEA 4E7ZA 1JOGA 3LEOA 4P9FA 5BQGA 2XLVA 5CIVA 2NG1A 1I4ZA 3DJNB 3FXHA 3NMKA 4LERA 1NG1A 4MQ9F 3U9JA 4WJ0A 3RW0A 4ER9A 5JLIA 5DS6A 1Z23A 3ATPA 2L6HA 3C62A 1HW2A 4JTAB 4PK4A 3WODF 3W8HA 3EGDA 1FFTC 1YZCA 3K1IA 4M63A 1NBBA 4EBBA 3SYNA 2Q9AA 1ORJA 3EH1A 4OIPF 4MNDA 2Y3DA 4PJNA 4CBEA 1H9TA 2Q9CA 1D0YA 5B1AC 3I5PA 5DS5A 3GEIA 3EHMA 1QVXA 4Q5SF 4G7OF 2XLHA 3AJMA 2RSEB 4FESA 1JR8A 2HSQA 3KYJA 2W9YA 2XL8A 1EI7A 4U5FE 2Q4FA 4DOZA 1AVOB 2IOQA 1TFKB 2A68F 4DVZA 2R05A 3GWNA 3KKBA 4O6MA 5KYXA 3ZG1A 4FWVA 1OQCA 3MYFA 2XLEA 1VYIA 2L9JA 1FTSA 4I3MA 2IXOA 3QTHA 3ZQYA 1Q0MA 4BJ5A 1TFOB 1D0XA 4JW1A 4EKWA 4U5BE 2HZ8A 4JC7A 5A6BA 4K0DA 1SMYF 3IEEA 2R02A 4LDQA 3CQZA 2LQGA 3DAFA 4NQFA 1U0BB 2Q00A 4JE9A 2HV7A 3EFOA 3JYHA 4XPWA 1PD0A 2OG2A 3FMSA 4EBKA 3F46A 2AU5A 2HMZA 1A0BA 1MMNA 2EIMC 4NTAA 4CDAA 2XL6A 5JT4A 2GWWA 2YL0A 5KYYA 3FOOA 3Q7GA 2GAQA 4BEMJ 5KYNA 1VYKA 4ZLCA 3DZAA 3N24A 4PJLA 2Q3TA 2VASA 3GM2A 3C18A 4JRZA 1YA9A 1HE9A 5EK0A 2CNWD 3DAGA 3ECSA 3IHUA 3H2UA 3IQTA 1VLTA 3RFYA 5T1DB 5JVEA 1E83A 2KW3C 4KI2A 2R7SA 1S05A 4EWCA 2IXPA 3SXKA 4BEJA 1CPRA 2YL7A 5D92A 2MWQA 1YAUO 4LLCA 3FVYA 3R7CA 2RD9A 5KYUA 5B3IA 4CDYA 3C8GA 4WABA 1Q0DA 2WVOA 1UG7A 2EPMX 2PX3A 3PCVA 1Z7Qc 4D4NA 1BBHA 3QVYA 2OOCA 1ORSC 1R4TA 1G4WR 2DYRC 2YLGA 1E2XA 1QKRA 2KJGA 4U5HA 4E17A 4EBJA 4EIYA 4AL0A 2R7WA 5L3VA 4CJGA 1RKEA 3ABKC 3O55A 2R7XA 1E84A 1T5OA 3UMIA 4CS9A 4PFPA 5A69A 3T9OA 3AQBA 3JZ0A 4XPXA 1RXQA 2EIKC 3RVZA 1N1CA 1S7ZA 2KSFA 2J9WA 1CGOA 3DE9A 5D91A 2H7BA 2F22A 2QLAA 3F47A 5CI8A 4DXWA 3IQCA 1ST6A 3DKAA 3JCUQ 2LFFA 3EHNA 1O5HA 5DQZA 3LS0A 4MTOA 3MBGA 2YZSA 1H6GA 2C04A 3KL4A 2J7PA 2PP4A 3DD7A 1YA7O 2CDQA 2VCCA 4IB4A 2CYDA 4I1OB 4DBRA 1WN0A 3H65A 3S84A 1D1CA 1ZHYA 1K40A 4PACA 1ZHXA 2J0XA 2WVQA 1V54C 1PD1A 3B0UX 3K1IC 5TJ5E 3T4RA 5L0CA 2ZXWC 2H7OA 1OKKA 1NLXA 2KK1A 3I4UA 4JJFA 3MFNA 4YL0A 5F5FA 4C3BA 1D1AA 3ZIBA 4AE4A 3S90A 4XWJA 4W8PA 1YZAA 4BPMA 4YK5A 4DVYP 1WGWA 5E3AA 3CZ6A 1LI7A 2PBEA 4HFKB 3C8GB 4MS2A 3T6GB 3AOUA 1PCXA 3JRTA 3M4CA 1YVIA 3S28A 3W2WA 1E86A 2HS5A 5AC5A 4NTFA 2BE5F 4XLPF 1I5NA 3EJNA 2XLWA 4J7YA 4MVUA 3SZRA 3G50A 1FNTc 2R25A 4MVRA 2LD6A 1JRAA 5DQTA 2EPKX 1RKEB 2W4BA 1OCOC 3J06A 4H4KC 1NU7D 3RQGA 3K7DA 2OJQA 2I15A 3ASOC 1CGME 5L0IA 2XXAB 1G4US 1OCRC 3MYIA 3K66A 3V7OA 1ZZPA 2R7RA 2ZD9A 2L6FA 4XTKA 3VM6A 3V5XA 2B0JA 3QZCA 5HSWA 1WTYA 3X2QC 5JRAA 3VRCA 4G7HF 3FOPA 4KNVA 4N6CA 4YL3A 3RH3A 1LPEA 4DRHB 5L0HA 2VC9A 4ULVA 2YKZA 1YYJA 1J8MF 2YWAA 4CDVA 1OCZC 2LP4A 4AL1A 2H7VC 1HE1A 1A7EA 1LIHA 4XEVA 3RQEA 1LE2A 4FAPB 1PV3A 3RVYA 4D4XA 1OW7A 3AGTA 3U8PA 3DXJF 2WB7A 1WASA 3CAXA 3CSKA 1LVKA 2PNOA 3JT1A 3T6JA 4AE4B 3OWTA 4W8KA 1D1BA 2P0NA 3EZIA 3GODA 4K1OA 3TJ6A 3SEOA 3M79A 4L6RA 3UGPA 4F4BA 1Q0KA 2OU6A 3NG1A 1JPNA 2A6HF 4JTDB 4P6IC 4DJ9A 1NZEA 1TWHA 2O9XA 3B71A 4MVQA 3NMIA 4RD9A 1SF8A 1JMWA 3L8JA 3LESA 2PF4E 2HKVA 1FMWA 3IQ5A 5DS4A 2VH3A 2GFHA 2QE9A 3SXYA 2GA0A 3LUTB 4U5GA 1AEPA 5K0IA 2LCHA 1XZPA 3OEOA 3MLGA 1QSPA 1WWPA 1RJ9A 2EILC 1ZU5A 2YHSA 1LM3B 3AG2C 2PFDA 3NKDA 1LI5A 2HJMA 3AQCA 3PHF2 3T6BA 2EIJC 4O7GA 3ABLC 4C3DA 3OA1A 1VMAA 3AG4C 4I1MA 2ETSA 4JIOA 3UMKA 3QW0A 1EKYA 3GEEA 1YJGA 4K7BA 2QUPA 3FAPB 3C8ZA 2D5RB 1LKXA 1U6HA 1Z6AA 2P61A 2D4UA 3WG7C 4O6YA 4IARA 2ZXOA 4QI0A 1ZW3A 3U2LA 5HV9A 4JCHA 2A0BA 2L6GA 4BJ6C 3O10A 4H54A 1BDJB 2EPLX 4E7SA 1I4YA 3HJCA 3KYIA 1ZVZA 4IJJA 1EA8A 2XS8A 1CGNA 4IRUA 4GEHA 3TD7A 1T6QA 2NUPB 4CS8C 2XSEA 2DB4A 1ZHWA 4LDRA 2NUTB 2J46A 1UFBA 3GWLA 3VAYA 4OIQF 2DI3A 4YT8A 2EINC 4CSAA 3RQFA 4BJTA 3ASNC 4CS7A 3SNHA 2WZLA 1TKNA 1EQ1A 2VCAA 1J8YF 1MQVA 5E33A 4OIOF 2J9UA 2R7VA 2XLDA 4IAQA 5DVWA 3RKOF 3TJ5A 3U5SA 4R32A 3LNRA 4I44A 3V5ZA 1RJ9B 2M4EA 5F5HA 1G8XA 4CIHA 2W45A 5JUAA 2Y3BA 3IPMO 3QMKA 5B1BC 4UDVA 2XXAA 3ZTMA 1K05A 3K1HA 4WGYA 5L0GA 2LK4A 3GORA 4QDLA 1W2WA 3EG9A 2MHRA 1OR3A 3DJUB 5L0JA 2VB6A 256BA 3ABMC 3TULA 4PJJA 2Y3HA 3LLKA 1BR4A 3HLZA 4Q7CA 3ZWIA 4IGGA 3U0CA 3U2MA 4J7TA 2AVKA 2QTVA 2YRFA 3S29A 5AC4A 3L34A 3EGXA 5E2QA 1BR2A 3TOMA 2ZPAA 4E18A 3DMDA 4XPYA 2IM8A 5KYWA 3U3FA 2J45A 4PR9A 1NFNA 3N0TA 5JSLA 2Z15A 1M2VB 3L8IA 3ITFA 1QQ3A 4AX2A 1GM5A 3ZC4A 2L81A 4JZAA 1ZU4A 4ONSA 3TOLA 2WZGA 4MW3A 3GEHA 1OW8A 1G5ZA 3EPVA 1JPJA 2KC3A 2JPUA 3B29A 1A41A 1L7CA 1ZHTA 4X0RA 1CPQA 4J32B 1MNDA 4JKVA 1TR2A 1HY5A 2IYLD 2J7PD 3LLIA 2WL8A 5COMA 5A6AA 3K6BA 3X1OA 4HEAJ 2J9BA 4KBLA 4C7OA 2DYSC 2IXNA 4LLEA 3PMRA 1D0ZA 1YDIA 2L7AA 2AWCA 3NYJA 4LDKA 3R2PA 5FZTA 2A0UA 5DLJA 3DI5A 1BR1A 2P6VA 1OKKD 2YEVA 3AG1C 3FAJA 5A6KA 2OCCC 3H2VA 4RBNA 4YJWA 4OIRF 4G7ZF 1VLSA 2KGOA 2KYHA 2R7OA 3HKKA 4XQ1A 4B6IA 4DRIB 2PX0A 4MTFA 3QVZA 1DOWA 5GPGB 3C63A 4BJ5C 4EHPA 2J9VA 1A7VA 1C17M 1NU9C 3EG9B 3O6XA 3M1CB 2OJED 3LS1A 4FX5A 4C3EA 2TMVP 2A1DD 3SXZA 2HMQA 2J0WA 1TWAA 1ZW2A 3L1MA 5IY5C 4U9DA 2R03A 3VYWA 1V74B 3GANA 3Q7LA 4XEKA 1YLMA 4YWQA 4YL1A 3EGXB 2C03A 4G78A 2XS1A 5KYWB 3QW1A 4JCZA 1ZYRF 4HFFB 2W4MA 3EH2A 1MMGA 2JX0A 1FR0A 2XL4A 1VB5A 2OEXA 4Q4ZF 4Z9HA 1M57C 4NY3A 4EUKB 2NUPA 3HNKA 2OKUA 1V55C 1Q0GA 2EPOA 3Q6MA 1IW7F 3E70C 4MVZA 5L0DA 3B9QA 3JSZA 2NUTA 2WZFA 2B0HA 4ANJA 4CIPA 3O39A 2H8AA 4N06A 2FGYA 2NPUA 1FMVA 1TQGA 1VOMA 3KMIA 3LAYA 4U9EA 5B3SC 4C7OB 1C03A 3N2ZB 2KQ9A 3U9MA 3NMJA 3M15A 2E87A 3KH2A 3RIPA 4CSAC 1MMDA 1FAPB 4RDAA 2Y3GA 4P9TA 1Z63A 1WATA 2EPNA 2BL2A 5T3TA 3PDMP 4CS9C 3CEXA 2OEVA 2LFDA 3MX3A 4PFOA 5AGFA 4JEBA 1SZIA 3AGUA 1M2OA 2XLOA 3S27A 5FCLA 3G4XA 3A11A 3W2VA 3EZHA 4CJOA 5BUOA 2HSBA 3UMHA 3V5YA 3JRMO 4O6NA
chains in the Genus database with same CATH topology
4XPXA 3WAQA 2HMQA 1A7DA 1I4YA 3WHNA 2MHRA 1A7EA 2AWYA 2AWCA 3AGTA 2AVKA 4XPWA 3AGUA 4XQ1A 4XPYA 2HMZA 1HMDA 1I4ZA 1HMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPX A;  3WAQ A;  2HMQ A;  1A7D A;  1I4Y A;  3WHN A;  2MHR A;  1A7E A;  2AWY A;  2AWC A;  3AGT A;  2AVK A;  4XPW A;  3AGU A;  4XQ1 A;  4XPY A;  2HMZ A;  1HMD A;  1I4Z A;  1HMO A; 
#chains in the Genus database with same CATH topology
 2OQM A;  3RYL A;  1M6T A;  2ICW G;  4A2N B;  4YT5 A;  4IWB A;  1M56 C;  3WAQ A;  1T01 A;  2V3C C;  1GGQ A;  2HFI A;  3HNL A;  3JYY A;  3K33 A;  2QNL A;  4PJM A;  1Y6D A;  4N4W A;  2CNW A;  1M2V A;  4J30 B;  4MTG A;  2G3K A;  3NKE A;  4O79 A;  3U8V A;  4A4A A;  3LJB A;  2ZXR A;  3WHN A;  4OD5 A;  5A6B D;  1MMA A;  1OW6 A;  3S9O A;  4MW8 A;  1FFH A;  2GDC A;  4YN0 B;  2YLD A;  4MVO A;  2AWY A;  3NRH A;  3DM5 A;  3I5Q A;  3NYL A;  3GM1 A;  2FAP B;  3C7J A;  3DWW A;  3GM3 A;  1ORY A;  3ZTZ A;  2YLI A;  4U5D E;  3EGD B;  4U5E E;  3SP1 A;  5CI9 A;  4CX9 A;  4JJG A;  5L0F A;  1KTM A;  1HMO A;  4BG0 A;  1IZM A;  3DE8 A;  1RCP A;  2CCY A;  1TWG A;  2LSE A;  4E0H A;  2KNH A;  4Z9J A;  4Z9I A;  2Q7R A;  4NC3 A;  5JP7 A;  1A7D A;  3AG3 C;  3VF0 A;  3HNJ A;  1JAF A;  3NDB B;  2ASR A;  2M64 A;  2NSG A;  2CW0 F;  3TQO A;  3UNG C;  3C8G D;  1RMV A;  2XLM A;  1NSG B;  1U89 A;  1XZQ A;  4WGZ A;  5F28 E;  1LE4 A;  2WVN A;  3ZSU A;  1O87 A;  1Y4C A;  5EGY A;  5EHH A;  1OXK A;  2A69 F;  2J8W A;  2P7V A;  2X51 A;  1BZ4 A;  2JD3 A;  5L3Q A;  2ZXP A;  3RF3 A;  3G4Z A;  1KU2 A;  2Y39 A;  4E0I A;  3ZVR A;  2XM4 A;  1K04 A;  2R9R B;  2VCB A;  1TWC A;  4YT2 A;  2NSF A;  2X0C A;  3S0X A;  4QI2 A;  2HJ3 A;  5KYX B;  2P1A A;  1H7I A;  4ZLD A;  2DGJ A;  1R5I D;  1RKC A;  1YAR O;  2QY9 A;  4JUR I;  4DBQ A;  3HTK C;  3LNM B;  1YYX A;  3FHD A;  2IXM A;  4ULW A;  4G0H A;  1GQA A;  4JEA A;  1O3U A;  2CGE A;  2HUJ A;  4JTC B;  3HNI A;  1SR2 A;  1T9K A;  1F1M A;  1QPU A;  3JTL O;  3M4B A;  3ZQV A;  5A6J A;  4NTB A;  3EFO B;  1DOV A;  5COF A;  4GQH A;  5JS5 A;  2G3V A;  1Z5Z A;  1VK5 A;  2XM0 A;  3TK0 A;  4JVS A;  2YQY A;  4OD4 A;  3W4Y A;  2UUI A;  5KYY B;  1WOL A;  5BQH A;  4DRJ B;  2A6E F;  2R7T A;  2Y69 C;  4BJ6 A;  1XWJ A;  4KC9 A;  3FDQ A;  4XLN F;  3KPH A;  2G62 A;  3Q6N A;  1C02 A;  1SYQ A;  3BEH A;  1V4A A;  2R7Q A;  2XRH A;  2FFH A;  1OXB A;  3LEV A;  3NYM A;  3US6 A;  1HMD A;  2YL1 A;  5E3C A;  3W8I A;  1QLE C;  4XEF A;  4CS8 A;  2MYS A;  4GYT A;  1GS9 A;  1APC A;  1OR2 A;  2BC5 A;  3BRJ A;  2YL3 A;  4NCQ A;  3SXM A;  2R7U A;  5KYU B;  1NFO A;  2IBF A;  3A9C A;  2UUH A;  1VTM P;  1HW1 A;  1H9G A;  3UGO A;  1Z3I X;  4U5C E;  3E9V A;  3U3B A;  3UR3 C;  4AK9 A;  3ZDL A;  2LIG A;  1ZHZ A;  3JSE O;  3L0I A;  1QZX A;  2AP3 A;  4HE8 D;  1LS1 A;  4KNW A;  1AUE A;  2Q9B A;  3B0P A;  3DM9 B;  2V26 A;  4MVS A;  4MVM A;  2I8B A;  4N6H A;  2YVK A;  1L3P A;  1OCC C;  4LAC B;  5BQI A;  4IAO A;  1LS4 A;  5COG A;  5T3W A;  1Q0F A;  1T6U A;  3EQL F;  4OIN F;  4YT4 A;  1B68 A;  1E85 A;  3B0V C;  3POV A;  2HV6 A;  1T6I A;  1KNY A;  3IQ6 A;  4BJ1 A;  1MNE A;  4E7Z A;  1JOG A;  3LEO A;  4P9F A;  5BQG A;  2XLV A;  5CIV A;  2NG1 A;  1I4Z A;  3DJN B;  3FXH A;  3NMK A;  4LER A;  1NG1 A;  4MQ9 F;  3U9J A;  4WJ0 A;  3RW0 A;  4ER9 A;  5JLI A;  5DS6 A;  1Z23 A;  3ATP A;  2L6H A;  3C62 A;  1HW2 A;  4JTA B;  4PK4 A;  3WOD F;  3W8H A;  3EGD A;  1FFT C;  1YZC A;  3K1I A;  4M63 A;  1NBB A;  4EBB A;  3SYN A;  2Q9A A;  1ORJ A;  3EH1 A;  4OIP F;  4MND A;  2Y3D A;  4PJN A;  4CBE A;  1H9T A;  2Q9C A;  1D0Y A;  5B1A C;  3I5P A;  5DS5 A;  3GEI A;  3EHM A;  1QVX A;  4Q5S F;  4G7O F;  2XLH A;  3AJM A;  2RSE B;  4FES A;  1JR8 A;  2HSQ A;  3KYJ A;  2W9Y A;  2XL8 A;  1EI7 A;  4U5F E;  2Q4F A;  4DOZ A;  1AVO B;  2IOQ A;  1TFK B;  2A68 F;  4DVZ A;  2R05 A;  3GWN A;  3KKB A;  4O6M A;  5KYX A;  3ZG1 A;  4FWV A;  1OQC A;  3MYF A;  2XLE A;  1VYI A;  2L9J A;  1FTS A;  4I3M A;  2IXO A;  3QTH A;  3ZQY A;  1Q0M A;  4BJ5 A;  1TFO B;  1D0X A;  4JW1 A;  4EKW A;  4U5B E;  2HZ8 A;  4JC7 A;  5A6B A;  4K0D A;  1SMY F;  3IEE A;  2R02 A;  4LDQ A;  3CQZ A;  2LQG A;  3DAF A;  4NQF A;  1U0B B;  2Q00 A;  4JE9 A;  2HV7 A;  3EFO A;  3JYH A;  4XPW A;  1PD0 A;  2OG2 A;  3FMS A;  4EBK A;  3F46 A;  2AU5 A;  2HMZ A;  1A0B A;  1MMN A;  2EIM C;  4NTA A;  4CDA A;  2XL6 A;  5JT4 A;  2GWW A;  2YL0 A;  5KYY A;  3FOO A;  3Q7G A;  2GAQ A;  4BEM J;  5KYN A;  1VYK A;  4ZLC A;  3DZA A;  3N24 A;  4PJL A;  2Q3T A;  2VAS A;  3GM2 A;  3C18 A;  4JRZ A;  1YA9 A;  1HE9 A;  5EK0 A;  2CNW D;  3DAG A;  3ECS A;  3IHU A;  3H2U A;  3IQT A;  1VLT A;  3RFY A;  5T1D B;  5JVE A;  1E83 A;  2KW3 C;  4KI2 A;  2R7S A;  1S05 A;  4EWC A;  2IXP A;  3SXK A;  4BEJ A;  1CPR A;  2YL7 A;  5D92 A;  2MWQ A;  1YAU O;  4LLC A;  3FVY A;  3R7C A;  2RD9 A;  5KYU A;  5B3I A;  4CDY A;  3C8G A;  4WAB A;  1Q0D A;  2WVO A;  1UG7 A;  2EPM X;  2PX3 A;  3PCV A;  1Z7Q c;  4D4N A;  1BBH A;  3QVY A;  2OOC A;  1ORS C;  1R4T A;  1G4W R;  2DYR C;  2YLG A;  1E2X A;  1QKR A;  2KJG A;  4U5H A;  4E17 A;  4EBJ A;  4EIY A;  4AL0 A;  2R7W A;  5L3V A;  4CJG A;  1RKE A;  3ABK C;  3O55 A;  2R7X A;  1E84 A;  1T5O A;  3UMI A;  4CS9 A;  4PFP A;  5A69 A;  3T9O A;  3AQB A;  3JZ0 A;  4XPX A;  1RXQ A;  2EIK C;  3RVZ A;  1N1C A;  1S7Z A;  2KSF A;  2J9W A;  1CGO A;  3DE9 A;  5D91 A;  2H7B A;  2F22 A;  2QLA A;  3F47 A;  5CI8 A;  4DXW A;  3IQC A;  1ST6 A;  3DKA A;  3JCU Q;  2LFF A;  3EHN A;  1O5H A;  5DQZ A;  3LS0 A;  4MTO A;  3MBG A;  2YZS A;  1H6G A;  2C04 A;  3KL4 A;  2J7P A;  2PP4 A;  3DD7 A;  1YA7 O;  2CDQ A;  2VCC A;  4IB4 A;  2CYD A;  4I1O B;  4DBR A;  1WN0 A;  3H65 A;  3S84 A;  1D1C A;  1ZHY A;  1K40 A;  4PAC A;  1ZHX A;  2J0X A;  2WVQ A;  1V54 C;  1PD1 A;  3B0U X;  3K1I C;  5TJ5 E;  3T4R A;  5L0C A;  2ZXW C;  2H7O A;  1OKK A;  1NLX A;  2KK1 A;  3I4U A;  4JJF A;  3MFN A;  4YL0 A;  5F5F A;  4C3B A;  1D1A A;  3ZIB A;  4AE4 A;  3S90 A;  4XWJ A;  4W8P A;  1YZA A;  4BPM A;  4YK5 A;  4DVY P;  1WGW A;  5E3A A;  3CZ6 A;  1LI7 A;  2PBE A;  4HFK B;  3C8G B;  4MS2 A;  3T6G B;  3AOU A;  1PCX A;  3JRT A;  3M4C A;  1YVI A;  3S28 A;  3W2W A;  1E86 A;  2HS5 A;  5AC5 A;  4NTF A;  2BE5 F;  4XLP F;  1I5N A;  3EJN A;  2XLW A;  4J7Y A;  4MVU A;  3SZR A;  3G50 A;  1FNT c;  2R25 A;  4MVR A;  2LD6 A;  1JRA A;  5DQT A;  2EPK X;  1RKE B;  2W4B A;  1OCO C;  3J06 A;  4H4K C;  1NU7 D;  3RQG A;  3K7D A;  2OJQ A;  2I15 A;  3ASO C;  1CGM E;  5L0I A;  2XXA B;  1G4U S;  1OCR C;  3MYI A;  3K66 A;  3V7O A;  1ZZP A;  2R7R A;  2ZD9 A;  2L6F A;  4XTK A;  3VM6 A;  3V5X A;  2B0J A;  3QZC A;  5HSW A;  1WTY A;  3X2Q C;  5JRA A;  3VRC A;  4G7H F;  3FOP A;  4KNV A;  4N6C A;  4YL3 A;  3RH3 A;  1LPE A;  4DRH B;  5L0H A;  2VC9 A;  4ULV A;  2YKZ A;  1YYJ A;  1J8M F;  2YWA A;  4CDV A;  1OCZ C;  2LP4 A;  4AL1 A;  2H7V C;  1HE1 A;  1A7E A;  1LIH A;  4XEV A;  3RQE A;  1LE2 A;  4FAP B;  1PV3 A;  3RVY A;  4D4X A;  1OW7 A;  3AGT A;  3U8P A;  3DXJ F;  2WB7 A;  1WAS A;  3CAX A;  3CSK A;  1LVK A;  2PNO A;  3JT1 A;  3T6J A;  4AE4 B;  3OWT A;  4W8K A;  1D1B A;  2P0N A;  3EZI A;  3GOD A;  4K1O A;  3TJ6 A;  3SEO A;  3M79 A;  4L6R A;  3UGP A;  4F4B A;  1Q0K A;  2OU6 A;  3NG1 A;  1JPN A;  2A6H F;  4JTD B;  4P6I C;  4DJ9 A;  1NZE A;  1TWH A;  2O9X A;  3B71 A;  4MVQ A;  3NMI A;  4RD9 A;  1SF8 A;  1JMW A;  3L8J A;  3LES A;  2PF4 E;  2HKV A;  1FMW A;  3IQ5 A;  5DS4 A;  2VH3 A;  2GFH A;  2QE9 A;  3SXY A;  2GA0 A;  3LUT B;  4U5G A;  1AEP A;  5K0I A;  2LCH A;  1XZP A;  3OEO A;  3MLG A;  1QSP A;  1WWP A;  1RJ9 A;  2EIL C;  1ZU5 A;  2YHS A;  1LM3 B;  3AG2 C;  2PFD A;  3NKD A;  1LI5 A;  2HJM A;  3AQC A;  3PHF 2;  3T6B A;  2EIJ C;  4O7G A;  3ABL C;  4C3D A;  3OA1 A;  1VMA A;  3AG4 C;  4I1M A;  2ETS A;  4JIO A;  3UMK A;  3QW0 A;  1EKY A;  3GEE A;  1YJG A;  4K7B A;  2QUP A;  3FAP B;  3C8Z A;  2D5R B;  1LKX A;  1U6H A;  1Z6A A;  2P61 A;  2D4U A;  3WG7 C;  4O6Y A;  4IAR A;  2ZXO A;  4QI0 A;  1ZW3 A;  3U2L A;  5HV9 A;  4JCH A;  2A0B A;  2L6G A;  4BJ6 C;  3O10 A;  4H54 A;  1BDJ B;  2EPL X;  4E7S A;  1I4Y A;  3HJC A;  3KYI A;  1ZVZ A;  4IJJ A;  1EA8 A;  2XS8 A;  1CGN A;  4IRU A;  4GEH A;  3TD7 A;  1T6Q A;  2NUP B;  4CS8 C;  2XSE A;  2DB4 A;  1ZHW A;  4LDR A;  2NUT B;  2J46 A;  1UFB A;  3GWL A;  3VAY A;  4OIQ F;  2DI3 A;  4YT8 A;  2EIN C;  4CSA A;  3RQF A;  4BJT A;  3ASN C;  4CS7 A;  3SNH A;  2WZL A;  1TKN A;  1EQ1 A;  2VCA A;  1J8Y F;  1MQV A;  5E33 A;  4OIO F;  2J9U A;  2R7V A;  2XLD A;  4IAQ A;  5DVW A;  3RKO F;  3TJ5 A;  3U5S A;  4R32 A;  3LNR A;  4I44 A;  3V5Z A;  1RJ9 B;  2M4E A;  5F5H A;  1G8X A;  4CIH A;  2W45 A;  5JUA A;  2Y3B A;  3IPM O;  3QMK A;  5B1B C;  4UDV A;  2XXA A;  3ZTM A;  1K05 A;  3K1H A;  4WGY A;  5L0G A;  2LK4 A;  3GOR A;  4QDL A;  1W2W A;  3EG9 A;  2MHR A;  1OR3 A;  3DJU B;  5L0J A;  2VB6 A;  256B A;  3ABM C;  3TUL A;  4PJJ A;  2Y3H A;  3LLK A;  1BR4 A;  3HLZ A;  4Q7C A;  3ZWI A;  4IGG A;  3U0C A;  3U2M A;  4J7T A;  2AVK A;  2QTV A;  2YRF A;  3S29 A;  5AC4 A;  3L34 A;  3EGX A;  5E2Q A;  1BR2 A;  3TOM A;  2ZPA A;  4E18 A;  3DMD A;  4XPY A;  2IM8 A;  5KYW A;  3U3F A;  2J45 A;  4PR9 A;  1NFN A;  3N0T A;  5JSL A;  2Z15 A;  1M2V B;  3L8I A;  3ITF A;  1QQ3 A;  4AX2 A;  1GM5 A;  3ZC4 A;  2L81 A;  4JZA A;  1ZU4 A;  4ONS A;  3TOL A;  2WZG A;  4MW3 A;  3GEH A;  1OW8 A;  1G5Z A;  3EPV A;  1JPJ A;  2KC3 A;  2JPU A;  3B29 A;  1A41 A;  1L7C A;  1ZHT A;  4X0R A;  1CPQ A;  4J32 B;  1MND A;  4JKV A;  1TR2 A;  1HY5 A;  2IYL D;  2J7P D;  3LLI A;  2WL8 A;  5COM A;  5A6A A;  3K6B A;  3X1O A;  4HEA J;  2J9B A;  4KBL A;  4C7O A;  2DYS C;  2IXN A;  4LLE A;  3PMR A;  1D0Z A;  1YDI A;  2L7A A;  2AWC A;  3NYJ A;  4LDK A;  3R2P A;  5FZT A;  2A0U A;  5DLJ A;  3DI5 A;  1BR1 A;  2P6V A;  1OKK D;  2YEV A;  3AG1 C;  3FAJ A;  5A6K A;  2OCC C;  3H2V A;  4RBN A;  4YJW A;  4OIR F;  4G7Z F;  1VLS A;  2KGO A;  2KYH A;  2R7O A;  3HKK A;  4XQ1 A;  4B6I A;  4DRI B;  2PX0 A;  4MTF A;  3QVZ A;  1DOW A;  5GPG B;  3C63 A;  4BJ5 C;  4EHP A;  2J9V A;  1A7V A;  1C17 M;  1NU9 C;  3EG9 B;  3O6X A;  3M1C B;  2OJE D;  3LS1 A;  4FX5 A;  4C3E A;  2TMV P;  2A1D D;  3SXZ A;  2HMQ A;  2J0W A;  1TWA A;  1ZW2 A;  3L1M A;  5IY5 C;  4U9D A;  2R03 A;  3VYW A;  1V74 B;  3GAN A;  3Q7L A;  4XEK A;  1YLM A;  4YWQ A;  4YL1 A;  3EGX B;  2C03 A;  4G78 A;  2XS1 A;  5KYW B;  3QW1 A;  4JCZ A;  1ZYR F;  4HFF B;  2W4M A;  3EH2 A;  1MMG A;  2JX0 A;  1FR0 A;  2XL4 A;  1VB5 A;  2OEX A;  4Q4Z F;  4Z9H A;  1M57 C;  4NY3 A;  4EUK B;  2NUP A;  3HNK A;  2OKU A;  1V55 C;  1Q0G A;  2EPO A;  3Q6M A;  1IW7 F;  3E70 C;  4MVZ A;  5L0D A;  3B9Q A;  3JSZ A;  2NUT A;  2WZF A;  2B0H A;  4ANJ A;  4CIP A;  3O39 A;  2H8A A;  4N06 A;  2FGY A;  2NPU A;  1FMV A;  1TQG A;  1VOM A;  3KMI A;  3LAY A;  4U9E A;  5B3S C;  4C7O B;  1C03 A;  3N2Z B;  2KQ9 A;  3U9M A;  3NMJ A;  3M15 A;  2E87 A;  3KH2 A;  3RIP A;  4CSA C;  1MMD A;  1FAP B;  4RDA A;  2Y3G A;  4P9T A;  1Z63 A;  1WAT A;  2EPN A;  2BL2 A;  5T3T A;  3PDM P;  4CS9 C;  3CEX A;  2OEV A;  2LFD A;  3MX3 A;  4PFO A;  5AGF A;  4JEB A;  1SZI A;  3AGU A;  1M2O A;  2XLO A;  3S27 A;  5FCL A;  3G4X A;  3A11 A;  3W2V A;  3EZH A;  4CJO A;  5BUO A;  2HSB A;  3UMH A;  3V5Y A;  3JRM O;  4O6N A; 
#chains in the Genus database with same CATH homology
 4XPX A;  3WAQ A;  2HMQ A;  1A7D A;  1I4Y A;  3WHN A;  2MHR A;  1A7E A;  2AWY A;  2AWC A;  3AGT A;  2AVK A;  4XPW A;  3AGU A;  4XQ1 A;  4XPY A;  2HMZ A;  1HMD A;  1I4Z A;  1HMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...