3AGTA

Hemerythrin-like domain of dcrh (met)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characteristics of Diiron Site with Large Cavity in Hemerythrin-like Domain of DcrH
rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
molecule keywords Hemerythrin-like domain protein DcrH
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3agtA00
1A7EA 3AGUA 2HMZA 2HMQA 4XPWA 4XPXA 3WHNA 3AGTA 3WAQA 2MHRA 1A7DA 1HMOA 1I4YA 2AVKA 4XQ1A 1I4ZA 4XPYA 2AWYA 1HMDA 2AWCA
chains in the Genus database with same CATH superfamily
3DM5A 3X2QC 3AG1C 1RXQA 2CGEA 2J0WA 1I5NA 1Q0FA 3IQ5A 3EQLF 4N4WA 3T6BA 2XSEA 1BBHA 3ITFA 3NMIA 3RQEA 3I4UA 3VYWA 2A0BA 4QI0A 1ORYA 4MTFA 5L0DA 2HSQA 2KC3A 1HE9A 3IEEA 3ZTMA 2WZLA 2Y3GA 5IY5C 3MLGA 1Z63A 3ASOC 4GQHA 4MVRA 3SXZA 2ZXWC 5KYWB 3B71A 3K1IA 1QSPA 1Z3IX 2R7VA 1OR2A 4YL0A 2HZ8A 1D0ZA 1OCZC 2CNWA 1H9TA 3DE9A 5B1BC 3KPHA 4JTAB 3IPMO 4AK9A 2YRFA 4F4BA 2KGOA 3Q7GA 1YYXA 4O6YA 2I15A 4U5HA 2V26A 4H4KC 3ZTZA 3HNKA 4G7ZF 4DVYP 4U9DA 3DAGA 2J9WA 2P0NA 3EJNA 4MNDA 4PFPA 5COFA 3ZSUA 4DRHB 1JR8A 5JSLA 3EG9A 1ZYRF 2OJQA 2XLEA 1YDIA 3LAYA 3W8HA 3WAQA 2P7VA 2DGJA 4Z9HA 3R2PA 4K0DA 5EGYA 2LCHA 2LQGA 2YKZA 3K33A 3WODF 1IZMA 3FHDA 3DZAA 4MW8A 4ULVA 2EIMC 4IWBA 4W8KA 3QVYA 4CIHA 3CZ6A 4HE8D 4JVSA 1FMWA 3TOLA 2L6HA 1ZU5A 3OEOA 1Z7Qc 4C3EA 3C8GD 3PMRA 5DS6A 2KK1A 3SXYA 3CAXA 3KH2A 4LLCA 2NUTB 1JOGA 1V74B 1ZU4A 4E0IA 4E7ZA 2EPKX 1ZZPA 2XLVA 3B0UX 3M79A 4NQFA 4A2NB 2CNWD 2KNHA 1RJ9A 1LS1A 3O6XA 1WN0A 2C04A 2HJ3A 1LE4A 2PF4E 3PHF2 3RVZA 2IM8A 4BJ5A 5KYXB 3S90A 2IYLD 2YQYA 3DWWA 1U0BB 2JD3A 2W9YA 2ZXRA 3G50A 3QTHA 2QE9A 2YVKA 3N24A 3NKDA 3TJ5A 3GM2A 3LNMB 1Q0MA 1S05A 3C7JA 3ZVRA 5KYYA 4E18A 3CSKA 3GM1A 4LDRA 2NSFA 1ZW3A 5FZTA 4XPYA 4CS8A 2H8AA 2XRHA 2EPNA 4AL1A 1WTYA 2ZPAA 3M4BA 1GM5A 4OD4A 4Z9JA 4XLNF 2VB6A 4DJ9A 1LI5A 4U5BE 5B3IA 4CIPA 5AC4A 2WL8A 3JCUQ 2XLOA 5JT4A 3MYFA 4OIOF 4IAQA 5D91A 3NDBB 3FDQA 1QLEC 4C7OB 4ER9A 1YARO 4U5GA 1A7DA 3U2LA 1OQCA 1ORSC 3NYMA 3I5QA 4NTFA 1ZHTA 2R9RB 3W8IA 2LFFA 2VASA 4MS2A 1RKCA 3A9CA 3LUTB 2PX0A 4JW1A 2ZD9A 3R7CA 1YVIA 4DRIB 1D1BA 3TK0A 3FOOA 5EK0A 4EUKB 3GEIA 3NMJA 2RSEB 3LS1A 4BJ5C 4DXWA 2LIGA 3EGXA 3GM3A 1SYQA 1K04A 3ATPA 1RKEB 3CQZA 3UNGC 2J9UA 2Q9CA 1WATA 5FCLA 4WABA 2YL3A 4MVZA 4N6CA 5DQTA 2FGYA 5BQGA 2R7WA 3L8IA 5T1DB 1D0XA 2CW0F 4XTKA 3GORA 1SR2A 4U5FE 4PJJA 4XWJA 3BEHA 5JLIA 1YZCA 4BG0A 4PFOA 3H2VA 3AG3C 3TJ6A 5CI9A 5TJ5E 1R4TA 3K1HA 1TWCA 4BEJA 3LNRA 4BPMA 5A6AA 2CCYA 1DOWA 1OKKA 1OW6A 3FOPA 3KYJA 3UGPA 2HJMA 2L9JA 2Y3HA 3IHUA 4XEKA 3KKBA 5AC5A 3EG9B 3VAYA 1HW1A 4QI2A 3L0IA 4U5DE 3C63A 1H9GA 2Q9AA 5A6BA 4EWCA 2R7RA 2W45A 3MX3A 3OWTA 2E87A 3TULA 2LP4A 4DVZA 5T3TA 3GEEA 1OCCC 3HNIA 1Q0DA 3AOUA 2UUHA 3C62A 3FAJA 4N6HA 4Z9IA 1GGQA 4ONSA 5F28E 4MTOA 1NBBA 3I5PA 1U6HA 1NLXA 1TFOB 4CSAC 1HW2A 1FAPB 3TQOA 3DI5A 5L0JA 1E83A 1RJ9B 3UMKA 1A0BA 1PV3A 4RD9A 4U5EE 5K0IA 3ZWIA 3F47A 2Q4FA 3EH2A 3ZC4A 3LESA 2VCAA 4ZLDA 1EQ1A 4MVMA 4FX5A 3LJBA 1RCPA 1SZIA 3ZQVA 1LM3B 3M4CA 4EBJA 2GA0A 2DI3A 4YL1A 3QVZA 2J8WA 4DOZA 1F1MA 1M2VB 3NG1A 1C02A 2W4MA 1BR1A 1CGME 2H7BA 2YWAA 2H7OA 3L34A 1A41A 1TWGA 4AX2A 3LLIA 1A7VA 2AP3A 3PCVA 4JTCB 3UMHA 3DJUB 3DJNB 1XZQA 3JTLO 1MQVA 3GEHA 3EFOA 1OCRC 1VB5A 3ECSA 1QQ3A 2Y39A 3AGUA 2GAQA 1NG1A 3EFOB 1ORJA 4WJ0A 4JTDB 4ANJA 5A6BD 2L81A 2CDQA 2IXMA 4C3DA 4G7HF 2XXAB 3VRCA 5JUAA 2XL8A 3U2MA 1AUEA 4W8PA 4CJGA 3RH3A 3SXMA 1VLSA 1YLMA 2D4UA 4D4XA 2MHRA 1FNTc 4N06A 4P9TA 5KYWA 4K1OA 1PD1A 2M64A 2A68F 3S0XA 3S27A 2HSBA 3EZHA 2P6VA 1OR3A 2R7QA 3C8GB 1M57C 3QZCA 4K7BA 1CGOA 2ETSA 3UR3C 2WVOA 4XQ1A 3NKEA 4M63A 3DKAA 3BRJA 2IXOA 1T5OA 4YN0B 1OCOC 1HE1A 3T4RA 1PCXA 5F5HA 3HNLA 1VMAA 1BR4A 4CDVA 4MQ9F 4JC7A 2XL4A 2A6EF 5KYUA 4JJGA 1KTMA 3V5YA 2VCBA 3B29A 3JSZA 1Y4CA 4B6IA 3ZG1A 4YT2A 3LS0A 1LE2A 4IAOA 3SP1A 2R7XA 1LPEA 3DAFA 1JAFA 2Q3TA 3ASNC 5F5FA 3IQCA 1VYKA 5JS5A 3HJCA 1H7IA 2IBFA 1O87A 1WGWA 3JT1A 1AVOB 2HUJA 3K6BA 4KC9A 4LERA 4LLEA 3FXHA 4CBEA 4XLPF 1OXKA 2UUIA 5AGFA 4JZAA 4JJFA 1MMDA 2OOCA 3WHNA 1V55C 3C18A 4YJWA 3S9OA 2KW3C 2GWWA 3SEOA 1MMGA 3MFNA 1VLTA 2VC9A 3QMKA 4R32A 4BJTA 2P1AA 4KNWA 5BUOA 2Y3DA 3E9VA 4O79A 2Y3BA 1J8YF 3KL4A 1JRAA 1BDJB 2A69F 1GQAA 2EIKC 2NUPA 4O6MA 2OJED 1NU9C 3RKOF 1WWPA 4HEAJ 4J7YA 2C03A 4MW3A 5KYXA 1M2OA 1VYIA 2KYHA 2QLAA 1LVKA 2G62A 4JKVA 1TWAA 4I1OB 4CS9C 3HNJA 2YLIA 5KYYB 3QW0A 4YK5A 2H7VC 1CPRA 3HLZA 3LEOA 1HMDA 1FFHA 3JRTA 2D5RB 4U5CE 4NTAA 4AE4A 4PJNA 3JZ0A 1H6GA 2XL6A 2VCCA 3G4XA 1VOMA 3EH1A 5E33A 3U9MA 3DD7A 2OU6A 2R25A 1A7EA 1E85A 4LACB 5JP7A 4CS8C 4OD5A 2IXNA 3DXJF 5COMA 3K66A 4PK4A 1V54C 1TR2A 4E7SA 2WVQA 4YT8A 1J8MF 1Y6DA 2Z15A 3G4ZA 3Q6MA 4O7GA 1FR0A 4J7TA 2RD9A 2BL2A 2QNLA 4ULWA 2EIJC 3IQ6A 1UFBA 3T6GB 3T6JA 3RFYA 2P61A 2WB7A 1ZHZA 2PX3A 2Q9BA 4I1MA 4DBRA 5A6KA 3UMIA 1KNYA 2YZSA 3POVA 1QKRA 3EHNA 3M1CB 1W2WA 1TKNA 3TOMA 4Q4ZF 2OQMA 4MTGA 1CGNA 5EHHA 2TMVP 2Y69C 4MVQA 4RBNA 4X0RA 4KBLA 2V3CC 1EA8A 1E2XA 3L8JA 4J30B 3NYLA 1G8XA 1DOVA 5DVWA 5JVEA 1RKEA 2OCCC 3QW1A 2R7OA 4I3MA 1YA9A 4LDQA 3ZQYA 2VH3A 5JRAA 2B0JA 3EHMA 1D0YA 1QVXA 2IOQA 4BJ6A 4U9EA 4Q5SF 4HFFB 4I44A 4DBQA 4JE9A 3U3BA 1BR2A 3AQCA 5GPGB 1NU7D 1LIHA 2R02A 3EGDA 3GANA 3SNHA 3W4YA 2AU5A 2J45A 3SZRA 2MWQA 2GFHA 1I4YA 4NY3A 2OKUA 3FMSA 4BEMJ 3AG4C 1WASA 3U0CA 1NSGB 4CS9A 3J06A 1L7CA 3LLKA 3AG2C 5A69A 3A11A 1IW7F 1C03A 5CI8A 1RMVA 4NTBA 4DRJB 4PACA 2OEVA 3K7DA 1ZW2A 2JX0A 2R05A 3HKKA 2DB4A 4XEVA 1Z6AA 1C17M 2O9XA 4KI2A 3OA1A 2FAPB 4IJJA 4CSAA 4XPXA 3U8PA 4P6IC 2XLHA 3KYIA 4FAPB 1MNDA 2HMQA 5E3AA 5T3WA 1TQGA 1L3PA 2YL0A 2YLGA 4MVOA 2PBEA 2DYRC 5DS5A 1O5HA 1APCA 1WOLA 2X51A 1G4WR 3VM6A 4OIQF 2XM0A 5B1AC 3HTKC 3Q6NA 3S29A 4PJLA 3RVYA 2PNOA 1QPUA 3RIPA 4A4AA 5L3VA 3PDMP 2I8BA 1V4AA 2KQ9A 3AQBA 1JMWA 4LDKA 3TD7A 4PJMA 3U8VA 5L0IA 4D4NA 1KU2A 1TFKB 2B0HA 2YL1A 4CDYA 2HV6A 1MMNA 3T9OA 1OW7A 4EKWA 3KMIA 1YZAA 3DM9B 2XS1A 3B9QA 4G0HA 4JURI 3NRHA 2WZFA 1EI7A 3RF3A 3B0VC 2R7SA 1XWJA 3H65A 1FMVA 2A1DD 4YT4A 4HFKB 1Q0KA 2ZXOA 5E2QA 4CS7A 1T6UA 3V5XA 2HFIA 3GWNA 4JRZA 3U9JA 3N2ZB 2L6GA 1G5ZA 2NPUA 3SYNA 1MMAA 1NFNA 2NUTA 4RDAA 3V7OA 3H2UA 3V5ZA 3EPVA 3EGXB 3M15A 4J32B 1OKKD 2NSGA 3C8GA 1LI7A 2XS8A 2EINC 2YEVA 4AE4B 4XPWA 1E86A 1UG7A 2HS5A 2PP4A 2WZGA 3Q7LA 1D1CA 1TWHA 1AEPA 2MYSA 2J7PA 2WVNA 3K1IC 4WGZA 1Z5ZA 2LD6A 3RQGA 1I4ZA 3MYIA 3DE8A 2A0UA 3NMKA 1U89A 4NC3A 3U3FA 1R5ID 2EPMX 4Q7CA 3US6A 2ZXPA 3N0TA 2QY9A 4C7OA 1T6QA 4L6RA 3RYLA 4FESA 3X1OA 3U5SA 1ST6A 4BJ6C 2G3KA 2QTVA 3UGOA 1ZHYA 2EILC 3EZIA 2XM4A 2CYDA 3S84A 3AJMA 1YA7O 4MVUA 4O6NA 1Z23A 2F22A 5L0GA 1BZ4A 1ZVZA 4NCQA 4UDVA 2J9BA 4GEHA 5KYNA 4G7OF 5D92A 5HSWA 4EHPA 4IGGA 1OXBA 2LSEA 4P9FA 5HV9A 2XXAA 4IRUA 2NG1A 4JEAA 5L0FA 3SXKA 3W2WA 3F46A 3EGDB 1Q0GA 4GYTA 5B3SC 4JIOA 1FTSA 5L3QA 1M56C 3ZDLA 1YJGA 3ABMC 2BC5A 4H54A 2KSFA 3CEXA 5DQZA 3LEVA 1O3UA 3AGTA 1VK5A 2NUPB 1K05A 3E70C 4EBKA 3GODA 3GWLA 2AVKA 4KNVA 3RQFA 5BQIA 1ZHWA 3NYJA 5COGA 2LFDA 4JCHA 2XLWA 3MBGA 2EPLX 2KJGA 3DMDA 1QZXA 1JPJA 2YL7A 3ABLC 3B0PA 1FFTC 3JSEO 1NFOA 2OEXA 5CIVA 2M4EA 4IB4A 4CX9A 1YYJA 5KYUB 3WG7C 1OW8A 2G3VA 4JEBA 1HY5A 1D1AA 1LKXA 2J9VA 4EBBA 3W2VA 1T9KA 2IXPA 2YHSA 4JCZA 1E84A 1MNEA 2DYSC 3O55A 4AL0A 1ZHXA 3C8ZA 1K40A 4E17A 2ASRA 2QUPA 1SMYF 2R03A 3FAPB 3JRMO 2HKVA 4IARA 2FFHA 4YT5A 3S28A 1S7ZA 5L0CA 2A6HF 3O39A 1B68A 256BA 5L0HA 2XLDA 2R7UA 3FVYA 3JYYA 2PFDA 2Q7RA 1HMOA 3ZIBA 1GS9A 2OG2A 4ZLCA 2R7TA 1VTMP 2HV7A 1NZEA 3IQTA 4MVSA 2X0CA 4YWQA 1M6TA 2AWCA 2GDCA 2XLMA 4BJ1A 2ICWG 4CJOA 1EKYA 4WGYA 1T6IA 1JPNA 2J0XA 5BQHA 2L7AA 1LS4A 1M2VA 2J46A 4CDAA 2EPOA 4E0HA 1SF8A 5DS4A 2W4BA 4FWVA 5E3CA 4EIYA 1PD0A 2BE5F 1T01A 3JYHA 1YAUO 1XZPA 4G78A 2JPUA 2Q00A 2J7PD 4QDLA 4C3BA 5A6JA 2L6FA 2YLDA 4PR9A 4XEFA 3O10A 4OIRF 2HMZA 3ABKC 4OIPF 4OINF 1G4US 5DLJA 3VF0A 1CPQA 4YL3A 3RW0A 2LK4A 3L1MA 1N1CA 2AWYA
chains in the Genus database with same CATH topology
1A7EA 3AGUA 2HMZA 2HMQA 4XPWA 4XPXA 3WHNA 3AGTA 3WAQA 2MHRA 1A7DA 1HMOA 1I4YA 2AVKA 4XQ1A 1I4ZA 4XPYA 2AWYA 1HMDA 2AWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7E A;  3AGU A;  2HMZ A;  2HMQ A;  4XPW A;  4XPX A;  3WHN A;  3AGT A;  3WAQ A;  2MHR A;  1A7D A;  1HMO A;  1I4Y A;  2AVK A;  4XQ1 A;  1I4Z A;  4XPY A;  2AWY A;  1HMD A;  2AWC A; 
#chains in the Genus database with same CATH topology
 3DM5 A;  3X2Q C;  3AG1 C;  1RXQ A;  2CGE A;  2J0W A;  1I5N A;  1Q0F A;  3IQ5 A;  3EQL F;  4N4W A;  3T6B A;  2XSE A;  1BBH A;  3ITF A;  3NMI A;  3RQE A;  3I4U A;  3VYW A;  2A0B A;  4QI0 A;  1ORY A;  4MTF A;  5L0D A;  2HSQ A;  2KC3 A;  1HE9 A;  3IEE A;  3ZTM A;  2WZL A;  2Y3G A;  5IY5 C;  3MLG A;  1Z63 A;  3ASO C;  4GQH A;  4MVR A;  3SXZ A;  2ZXW C;  5KYW B;  3B71 A;  3K1I A;  1QSP A;  1Z3I X;  2R7V A;  1OR2 A;  4YL0 A;  2HZ8 A;  1D0Z A;  1OCZ C;  2CNW A;  1H9T A;  3DE9 A;  5B1B C;  3KPH A;  4JTA B;  3IPM O;  4AK9 A;  2YRF A;  4F4B A;  2KGO A;  3Q7G A;  1YYX A;  4O6Y A;  2I15 A;  4U5H A;  2V26 A;  4H4K C;  3ZTZ A;  3HNK A;  4G7Z F;  4DVY P;  4U9D A;  3DAG A;  2J9W A;  2P0N A;  3EJN A;  4MND A;  4PFP A;  5COF A;  3ZSU A;  4DRH B;  1JR8 A;  5JSL A;  3EG9 A;  1ZYR F;  2OJQ A;  2XLE A;  1YDI A;  3LAY A;  3W8H A;  3WAQ A;  2P7V A;  2DGJ A;  4Z9H A;  3R2P A;  4K0D A;  5EGY A;  2LCH A;  2LQG A;  2YKZ A;  3K33 A;  3WOD F;  1IZM A;  3FHD A;  3DZA A;  4MW8 A;  4ULV A;  2EIM C;  4IWB A;  4W8K A;  3QVY A;  4CIH A;  3CZ6 A;  4HE8 D;  4JVS A;  1FMW A;  3TOL A;  2L6H A;  1ZU5 A;  3OEO A;  1Z7Q c;  4C3E A;  3C8G D;  3PMR A;  5DS6 A;  2KK1 A;  3SXY A;  3CAX A;  3KH2 A;  4LLC A;  2NUT B;  1JOG A;  1V74 B;  1ZU4 A;  4E0I A;  4E7Z A;  2EPK X;  1ZZP A;  2XLV A;  3B0U X;  3M79 A;  4NQF A;  4A2N B;  2CNW D;  2KNH A;  1RJ9 A;  1LS1 A;  3O6X A;  1WN0 A;  2C04 A;  2HJ3 A;  1LE4 A;  2PF4 E;  3PHF 2;  3RVZ A;  2IM8 A;  4BJ5 A;  5KYX B;  3S90 A;  2IYL D;  2YQY A;  3DWW A;  1U0B B;  2JD3 A;  2W9Y A;  2ZXR A;  3G50 A;  3QTH A;  2QE9 A;  2YVK A;  3N24 A;  3NKD A;  3TJ5 A;  3GM2 A;  3LNM B;  1Q0M A;  1S05 A;  3C7J A;  3ZVR A;  5KYY A;  4E18 A;  3CSK A;  3GM1 A;  4LDR A;  2NSF A;  1ZW3 A;  5FZT A;  4XPY A;  4CS8 A;  2H8A A;  2XRH A;  2EPN A;  4AL1 A;  1WTY A;  2ZPA A;  3M4B A;  1GM5 A;  4OD4 A;  4Z9J A;  4XLN F;  2VB6 A;  4DJ9 A;  1LI5 A;  4U5B E;  5B3I A;  4CIP A;  5AC4 A;  2WL8 A;  3JCU Q;  2XLO A;  5JT4 A;  3MYF A;  4OIO F;  4IAQ A;  5D91 A;  3NDB B;  3FDQ A;  1QLE C;  4C7O B;  4ER9 A;  1YAR O;  4U5G A;  1A7D A;  3U2L A;  1OQC A;  1ORS C;  3NYM A;  3I5Q A;  4NTF A;  1ZHT A;  2R9R B;  3W8I A;  2LFF A;  2VAS A;  4MS2 A;  1RKC A;  3A9C A;  3LUT B;  2PX0 A;  4JW1 A;  2ZD9 A;  3R7C A;  1YVI A;  4DRI B;  1D1B A;  3TK0 A;  3FOO A;  5EK0 A;  4EUK B;  3GEI A;  3NMJ A;  2RSE B;  3LS1 A;  4BJ5 C;  4DXW A;  2LIG A;  3EGX A;  3GM3 A;  1SYQ A;  1K04 A;  3ATP A;  1RKE B;  3CQZ A;  3UNG C;  2J9U A;  2Q9C A;  1WAT A;  5FCL A;  4WAB A;  2YL3 A;  4MVZ A;  4N6C A;  5DQT A;  2FGY A;  5BQG A;  2R7W A;  3L8I A;  5T1D B;  1D0X A;  2CW0 F;  4XTK A;  3GOR A;  1SR2 A;  4U5F E;  4PJJ A;  4XWJ A;  3BEH A;  5JLI A;  1YZC A;  4BG0 A;  4PFO A;  3H2V A;  3AG3 C;  3TJ6 A;  5CI9 A;  5TJ5 E;  1R4T A;  3K1H A;  1TWC A;  4BEJ A;  3LNR A;  4BPM A;  5A6A A;  2CCY A;  1DOW A;  1OKK A;  1OW6 A;  3FOP A;  3KYJ A;  3UGP A;  2HJM A;  2L9J A;  2Y3H A;  3IHU A;  4XEK A;  3KKB A;  5AC5 A;  3EG9 B;  3VAY A;  1HW1 A;  4QI2 A;  3L0I A;  4U5D E;  3C63 A;  1H9G A;  2Q9A A;  5A6B A;  4EWC A;  2R7R A;  2W45 A;  3MX3 A;  3OWT A;  2E87 A;  3TUL A;  2LP4 A;  4DVZ A;  5T3T A;  3GEE A;  1OCC C;  3HNI A;  1Q0D A;  3AOU A;  2UUH A;  3C62 A;  3FAJ A;  4N6H A;  4Z9I A;  1GGQ A;  4ONS A;  5F28 E;  4MTO A;  1NBB A;  3I5P A;  1U6H A;  1NLX A;  1TFO B;  4CSA C;  1HW2 A;  1FAP B;  3TQO A;  3DI5 A;  5L0J A;  1E83 A;  1RJ9 B;  3UMK A;  1A0B A;  1PV3 A;  4RD9 A;  4U5E E;  5K0I A;  3ZWI A;  3F47 A;  2Q4F A;  3EH2 A;  3ZC4 A;  3LES A;  2VCA A;  4ZLD A;  1EQ1 A;  4MVM A;  4FX5 A;  3LJB A;  1RCP A;  1SZI A;  3ZQV A;  1LM3 B;  3M4C A;  4EBJ A;  2GA0 A;  2DI3 A;  4YL1 A;  3QVZ A;  2J8W A;  4DOZ A;  1F1M A;  1M2V B;  3NG1 A;  1C02 A;  2W4M A;  1BR1 A;  1CGM E;  2H7B A;  2YWA A;  2H7O A;  3L34 A;  1A41 A;  1TWG A;  4AX2 A;  3LLI A;  1A7V A;  2AP3 A;  3PCV A;  4JTC B;  3UMH A;  3DJU B;  3DJN B;  1XZQ A;  3JTL O;  1MQV A;  3GEH A;  3EFO A;  1OCR C;  1VB5 A;  3ECS A;  1QQ3 A;  2Y39 A;  3AGU A;  2GAQ A;  1NG1 A;  3EFO B;  1ORJ A;  4WJ0 A;  4JTD B;  4ANJ A;  5A6B D;  2L81 A;  2CDQ A;  2IXM A;  4C3D A;  4G7H F;  2XXA B;  3VRC A;  5JUA A;  2XL8 A;  3U2M A;  1AUE A;  4W8P A;  4CJG A;  3RH3 A;  3SXM A;  1VLS A;  1YLM A;  2D4U A;  4D4X A;  2MHR A;  1FNT c;  4N06 A;  4P9T A;  5KYW A;  4K1O A;  1PD1 A;  2M64 A;  2A68 F;  3S0X A;  3S27 A;  2HSB A;  3EZH A;  2P6V A;  1OR3 A;  2R7Q A;  3C8G B;  1M57 C;  3QZC A;  4K7B A;  1CGO A;  2ETS A;  3UR3 C;  2WVO A;  4XQ1 A;  3NKE A;  4M63 A;  3DKA A;  3BRJ A;  2IXO A;  1T5O A;  4YN0 B;  1OCO C;  1HE1 A;  3T4R A;  1PCX A;  5F5H A;  3HNL A;  1VMA A;  1BR4 A;  4CDV A;  4MQ9 F;  4JC7 A;  2XL4 A;  2A6E F;  5KYU A;  4JJG A;  1KTM A;  3V5Y A;  2VCB A;  3B29 A;  3JSZ A;  1Y4C A;  4B6I A;  3ZG1 A;  4YT2 A;  3LS0 A;  1LE2 A;  4IAO A;  3SP1 A;  2R7X A;  1LPE A;  3DAF A;  1JAF A;  2Q3T A;  3ASN C;  5F5F A;  3IQC A;  1VYK A;  5JS5 A;  3HJC A;  1H7I A;  2IBF A;  1O87 A;  1WGW A;  3JT1 A;  1AVO B;  2HUJ A;  3K6B A;  4KC9 A;  4LER A;  4LLE A;  3FXH A;  4CBE A;  4XLP F;  1OXK A;  2UUI A;  5AGF A;  4JZA A;  4JJF A;  1MMD A;  2OOC A;  3WHN A;  1V55 C;  3C18 A;  4YJW A;  3S9O A;  2KW3 C;  2GWW A;  3SEO A;  1MMG A;  3MFN A;  1VLT A;  2VC9 A;  3QMK A;  4R32 A;  4BJT A;  2P1A A;  4KNW A;  5BUO A;  2Y3D A;  3E9V A;  4O79 A;  2Y3B A;  1J8Y F;  3KL4 A;  1JRA A;  1BDJ B;  2A69 F;  1GQA A;  2EIK C;  2NUP A;  4O6M A;  2OJE D;  1NU9 C;  3RKO F;  1WWP A;  4HEA J;  4J7Y A;  2C03 A;  4MW3 A;  5KYX A;  1M2O A;  1VYI A;  2KYH A;  2QLA A;  1LVK A;  2G62 A;  4JKV A;  1TWA A;  4I1O B;  4CS9 C;  3HNJ A;  2YLI A;  5KYY B;  3QW0 A;  4YK5 A;  2H7V C;  1CPR A;  3HLZ A;  3LEO A;  1HMD A;  1FFH A;  3JRT A;  2D5R B;  4U5C E;  4NTA A;  4AE4 A;  4PJN A;  3JZ0 A;  1H6G A;  2XL6 A;  2VCC A;  3G4X A;  1VOM A;  3EH1 A;  5E33 A;  3U9M A;  3DD7 A;  2OU6 A;  2R25 A;  1A7E A;  1E85 A;  4LAC B;  5JP7 A;  4CS8 C;  4OD5 A;  2IXN A;  3DXJ F;  5COM A;  3K66 A;  4PK4 A;  1V54 C;  1TR2 A;  4E7S A;  2WVQ A;  4YT8 A;  1J8M F;  1Y6D A;  2Z15 A;  3G4Z A;  3Q6M A;  4O7G A;  1FR0 A;  4J7T A;  2RD9 A;  2BL2 A;  2QNL A;  4ULW A;  2EIJ C;  3IQ6 A;  1UFB A;  3T6G B;  3T6J A;  3RFY A;  2P61 A;  2WB7 A;  1ZHZ A;  2PX3 A;  2Q9B A;  4I1M A;  4DBR A;  5A6K A;  3UMI A;  1KNY A;  2YZS A;  3POV A;  1QKR A;  3EHN A;  3M1C B;  1W2W A;  1TKN A;  3TOM A;  4Q4Z F;  2OQM A;  4MTG A;  1CGN A;  5EHH A;  2TMV P;  2Y69 C;  4MVQ A;  4RBN A;  4X0R A;  4KBL A;  2V3C C;  1EA8 A;  1E2X A;  3L8J A;  4J30 B;  3NYL A;  1G8X A;  1DOV A;  5DVW A;  5JVE A;  1RKE A;  2OCC C;  3QW1 A;  2R7O A;  4I3M A;  1YA9 A;  4LDQ A;  3ZQY A;  2VH3 A;  5JRA A;  2B0J A;  3EHM A;  1D0Y A;  1QVX A;  2IOQ A;  4BJ6 A;  4U9E A;  4Q5S F;  4HFF B;  4I44 A;  4DBQ A;  4JE9 A;  3U3B A;  1BR2 A;  3AQC A;  5GPG B;  1NU7 D;  1LIH A;  2R02 A;  3EGD A;  3GAN A;  3SNH A;  3W4Y A;  2AU5 A;  2J45 A;  3SZR A;  2MWQ A;  2GFH A;  1I4Y A;  4NY3 A;  2OKU A;  3FMS A;  4BEM J;  3AG4 C;  1WAS A;  3U0C A;  1NSG B;  4CS9 A;  3J06 A;  1L7C A;  3LLK A;  3AG2 C;  5A69 A;  3A11 A;  1IW7 F;  1C03 A;  5CI8 A;  1RMV A;  4NTB A;  4DRJ B;  4PAC A;  2OEV A;  3K7D A;  1ZW2 A;  2JX0 A;  2R05 A;  3HKK A;  2DB4 A;  4XEV A;  1Z6A A;  1C17 M;  2O9X A;  4KI2 A;  3OA1 A;  2FAP B;  4IJJ A;  4CSA A;  4XPX A;  3U8P A;  4P6I C;  2XLH A;  3KYI A;  4FAP B;  1MND A;  2HMQ A;  5E3A A;  5T3W A;  1TQG A;  1L3P A;  2YL0 A;  2YLG A;  4MVO A;  2PBE A;  2DYR C;  5DS5 A;  1O5H A;  1APC A;  1WOL A;  2X51 A;  1G4W R;  3VM6 A;  4OIQ F;  2XM0 A;  5B1A C;  3HTK C;  3Q6N A;  3S29 A;  4PJL A;  3RVY A;  2PNO A;  1QPU A;  3RIP A;  4A4A A;  5L3V A;  3PDM P;  2I8B A;  1V4A A;  2KQ9 A;  3AQB A;  1JMW A;  4LDK A;  3TD7 A;  4PJM A;  3U8V A;  5L0I A;  4D4N A;  1KU2 A;  1TFK B;  2B0H A;  2YL1 A;  4CDY A;  2HV6 A;  1MMN A;  3T9O A;  1OW7 A;  4EKW A;  3KMI A;  1YZA A;  3DM9 B;  2XS1 A;  3B9Q A;  4G0H A;  4JUR I;  3NRH A;  2WZF A;  1EI7 A;  3RF3 A;  3B0V C;  2R7S A;  1XWJ A;  3H65 A;  1FMV A;  2A1D D;  4YT4 A;  4HFK B;  1Q0K A;  2ZXO A;  5E2Q A;  4CS7 A;  1T6U A;  3V5X A;  2HFI A;  3GWN A;  4JRZ A;  3U9J A;  3N2Z B;  2L6G A;  1G5Z A;  2NPU A;  3SYN A;  1MMA A;  1NFN A;  2NUT A;  4RDA A;  3V7O A;  3H2U A;  3V5Z A;  3EPV A;  3EGX B;  3M15 A;  4J32 B;  1OKK D;  2NSG A;  3C8G A;  1LI7 A;  2XS8 A;  2EIN C;  2YEV A;  4AE4 B;  4XPW A;  1E86 A;  1UG7 A;  2HS5 A;  2PP4 A;  2WZG A;  3Q7L A;  1D1C A;  1TWH A;  1AEP A;  2MYS A;  2J7P A;  2WVN A;  3K1I C;  4WGZ A;  1Z5Z A;  2LD6 A;  3RQG A;  1I4Z A;  3MYI A;  3DE8 A;  2A0U A;  3NMK A;  1U89 A;  4NC3 A;  3U3F A;  1R5I D;  2EPM X;  4Q7C A;  3US6 A;  2ZXP A;  3N0T A;  2QY9 A;  4C7O A;  1T6Q A;  4L6R A;  3RYL A;  4FES A;  3X1O A;  3U5S A;  1ST6 A;  4BJ6 C;  2G3K A;  2QTV A;  3UGO A;  1ZHY A;  2EIL C;  3EZI A;  2XM4 A;  2CYD A;  3S84 A;  3AJM A;  1YA7 O;  4MVU A;  4O6N A;  1Z23 A;  2F22 A;  5L0G A;  1BZ4 A;  1ZVZ A;  4NCQ A;  4UDV A;  2J9B A;  4GEH A;  5KYN A;  4G7O F;  5D92 A;  5HSW A;  4EHP A;  4IGG A;  1OXB A;  2LSE A;  4P9F A;  5HV9 A;  2XXA A;  4IRU A;  2NG1 A;  4JEA A;  5L0F A;  3SXK A;  3W2W A;  3F46 A;  3EGD B;  1Q0G A;  4GYT A;  5B3S C;  4JIO A;  1FTS A;  5L3Q A;  1M56 C;  3ZDL A;  1YJG A;  3ABM C;  2BC5 A;  4H54 A;  2KSF A;  3CEX A;  5DQZ A;  3LEV A;  1O3U A;  3AGT A;  1VK5 A;  2NUP B;  1K05 A;  3E70 C;  4EBK A;  3GOD A;  3GWL A;  2AVK A;  4KNV A;  3RQF A;  5BQI A;  1ZHW A;  3NYJ A;  5COG A;  2LFD A;  4JCH A;  2XLW A;  3MBG A;  2EPL X;  2KJG A;  3DMD A;  1QZX A;  1JPJ A;  2YL7 A;  3ABL C;  3B0P A;  1FFT C;  3JSE O;  1NFO A;  2OEX A;  5CIV A;  2M4E A;  4IB4 A;  4CX9 A;  1YYJ A;  5KYU B;  3WG7 C;  1OW8 A;  2G3V A;  4JEB A;  1HY5 A;  1D1A A;  1LKX A;  2J9V A;  4EBB A;  3W2V A;  1T9K A;  2IXP A;  2YHS A;  4JCZ A;  1E84 A;  1MNE A;  2DYS C;  3O55 A;  4AL0 A;  1ZHX A;  3C8Z A;  1K40 A;  4E17 A;  2ASR A;  2QUP A;  1SMY F;  2R03 A;  3FAP B;  3JRM O;  2HKV A;  4IAR A;  2FFH A;  4YT5 A;  3S28 A;  1S7Z A;  5L0C A;  2A6H F;  3O39 A;  1B68 A;  256B A;  5L0H A;  2XLD A;  2R7U A;  3FVY A;  3JYY A;  2PFD A;  2Q7R A;  1HMO A;  3ZIB A;  1GS9 A;  2OG2 A;  4ZLC A;  2R7T A;  1VTM P;  2HV7 A;  1NZE A;  3IQT A;  4MVS A;  2X0C A;  4YWQ A;  1M6T A;  2AWC A;  2GDC A;  2XLM A;  4BJ1 A;  2ICW G;  4CJO A;  1EKY A;  4WGY A;  1T6I A;  1JPN A;  2J0X A;  5BQH A;  2L7A A;  1LS4 A;  1M2V A;  2J46 A;  4CDA A;  2EPO A;  4E0H A;  1SF8 A;  5DS4 A;  2W4B A;  4FWV A;  5E3C A;  4EIY A;  1PD0 A;  2BE5 F;  1T01 A;  3JYH A;  1YAU O;  1XZP A;  4G78 A;  2JPU A;  2Q00 A;  2J7P D;  4QDL A;  4C3B A;  5A6J A;  2L6F A;  2YLD A;  4PR9 A;  4XEF A;  3O10 A;  4OIR F;  2HMZ A;  3ABK C;  4OIP F;  4OIN F;  1G4U S;  5DLJ A;  3VF0 A;  1CPQ A;  4YL3 A;  3RW0 A;  2LK4 A;  3L1M A;  1N1C A;  2AWY A; 
#chains in the Genus database with same CATH homology
 1A7E A;  3AGU A;  2HMZ A;  2HMQ A;  4XPW A;  4XPX A;  3WHN A;  3AGT A;  3WAQ A;  2MHR A;  1A7D A;  1HMO A;  1I4Y A;  2AVK A;  4XQ1 A;  1I4Z A;  4XPY A;  2AWY A;  1HMD A;  2AWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...