3AGTA

Hemerythrin-like domain of dcrh (met)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characteristics of Diiron Site with Large Cavity in Hemerythrin-like Domain of DcrH
rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
molecule keywords Hemerythrin-like domain protein DcrH
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3agtA00
2HMQA 3AGUA 1I4YA 4XQ1A 2AWCA 1A7EA 1HMOA 1I4ZA 3WHNA 4XPYA 4XPXA 3WAQA 1HMDA 1A7DA 2MHRA 2HMZA 3AGTA 2AWYA 4XPWA 2AVKA
chains in the Genus database with same CATH superfamily
3SYNA 3L8IA 1XZPA 3O39A 3T6GB 4EBBA 3IHUA 1MNDA 3KMIA 4QI2A 4Z9HA 3JYHA 1E2XA 2LCHA 2P0NA 1K05A 1VMAA 5E3CA 4YT4A 3U9MA 3VRCA 3O10A 4ULVA 1IZMA 2XLMA 2VASA 2ZXRA 4GYTA 4D4NA 3KYJA 1PD1A 3I5QA 3C63A 3LNRA 4OD4A 2TMVP 2XLWA 3DD7A 4EBJA 2L6GA 5L0CA 1ZU4A 3RVZA 3FXHA 3U8VA 4BG0A 1OR3A 1O5HA 1NZEA 1Z63A 2LIGA 4JW1A 1BR2A 3H2UA 4YT8A 3FMSA 1Z3IX 3EH1A 4LLCA 4OD5A 1QLEC 4O6NA 1V55C 3GORA 1OCOC 4NTFA 5L3VA 5KYXB 5JLIA 1H9TA 4CJOA 3QVYA 2YRFA 4N4WA 4Q4ZF 1A7EA 4MVRA 2OKUA 1OW7A 1Z5ZA 2PFDA 4X0RA 3TULA 2RSEB 3MFNA 4MTOA 4RBNA 5HSWA 5COMA 5CIVA 3B0VC 3DJNB 2P1AA 2H8AA 3RIPA 2CW0F 3SXZA 1Q0MA 3RW0A 4BJ5A 4E18A 5K0IA 2D5RB 2R7OA 5DLJA 3LS1A 3N24A 1VK5A 1Y4CA 2LSEA 3NKEA 3UGOA 4AE4B 1LI5A 4CSAC 5E3AA 3RFYA 1H6GA 4YT5A 5E2QA 1UG7A 1FR0A 5F5FA 2P7VA 5A6BD 2YLIA 4P6IC 3DM5A 4CIPA 4AK9A 3LESA 1T6UA 1YA7O 2W4BA 1RKEA 4U9EA 1LI7A 1ZW2A 3N2ZB 1BR1A 3EHMA 2YHSA 2HKVA 2NUPA 3MX3A 4MS2A 2DGJA 3RH3A 4AL0A 2R7RA 1XZQA 5A6AA 3E70C 2I15A 5JT4A 5L0DA 2R7UA 1TR2A 2EPMX 2C03A 2PP4A 1TKNA 2WL8A 5EK0A 1H9GA 3AQBA 3POVA 4PJMA 1W2WA 2IXMA 2FFHA 3AJMA 2HMZA 4G0HA 4MTFA 1APCA 2AP3A 3TOLA 3O55A 3K1HA 1ZHYA 4JTAB 2HJ3A 5B1AC 3IEEA 1RJ9A 1FAPB 5A69A 1YAUO 5CI8A 2DB4A 2HSQA 3AGUA 1R4TA 5T3TA 3U3FA 3IQ6A 3SEOA 1FFHA 1DOVA 2HV7A 4DXWA 1ST6A 2YLGA 2NSFA 3KYIA 2J0WA 3NG1A 3LJBA 3HLZA 5DVWA 3NKDA 1L3PA 2A0UA 2KK1A 1EQ1A 3PCVA 2QTVA 3Q6MA 2OCCC 256BA 4JIOA 3C8GA 3HNJA 4IARA 4OIQF 1LS1A 2XLDA 4JEBA 2M4EA 3JYYA 5KYUA 3NRHA 2Q3TA 3SXMA 5DQTA 1D0ZA 3V5YA 4JTCB 4ZLCA 1ZYRF 2OJQA 3TQOA 5JSLA 4E7ZA 3GEIA 2HMQA 1JR8A 3EJNA 2DYSC 3NYMA 2EIJC 2IXNA 3B29A 2QY9A 4O6MA 3MLGA 4YN0B 5HV9A 3OEOA 3RYLA 3HJCA 4CX9A 3EZIA 4I1MA 1WATA 3E9VA 3LLIA 5GPGB 2IXOA 5DS4A 1O3UA 1VYIA 1YLMA 4YL1A 3H2VA 3GANA 1FMVA 4XEKA 1FFTC 4XLNF 3L8JA 2DYRC 2GDCA 2WZGA 4EKWA 1RMVA 2HUJA 3NMJA 4YJWA 3A11A 4D4XA 2P61A 2YEVA 4GEHA 4E0IA 2NPUA 3VM6A 2KC3A 2W4MA 3ECSA 2Q9BA 5B1BC 4W8KA 3ABLC 1CPRA 1D1BA 2J7PD 4B6IA 1MMGA 4G7HF 4O7GA 1A41A 4AE4A 5EGYA 3UMHA 5L0JA 1KTMA 4MVQA 3U0CA 4ONSA 1DOWA 2R7XA 4BJ6A 3UMKA 4WGZA 3JCUQ 5A6JA 4W8PA 3W2VA 3IQ5A 3QW1A 4DVZA 1GS9A 3NMIA 1LE2A 3M1CB 3HNKA 1ZVZA 2HFIA 3U2MA 3DWWA 4P9FA 2J9UA 1OW8A 1KU2A 2XS8A 1V74B 2A6HF 4JC7A 4XLPF 2LFFA 2NG1A 4IAQA 2G3KA 3ABMC 1MMDA 2A6EF 2Y3GA 4J7YA 4R32A 4XPYA 3RVYA 1E84A 3CQZA 4MNDA 4JJFA 2HSBA 1Q0KA 3EZHA 4N6CA 2GFHA 2MWQA 1T6IA 2KJGA 3QW0A 4PJNA 2R7TA 4WGYA 3U5SA 2WVNA 3SZRA 2R03A 4JRZA 3KH2A 2OEVA 3JZ0A 2ZXPA 5AGFA 2Q00A 3A9CA 3AGTA 1VYKA 2I8BA 3ZSUA 4DRIB 4XQ1A 5KYXA 2IOQA 2GAQA 2XLVA 1RKEB 3FOOA 2MYSA 5KYWB 2R7QA 1HE1A 1G5ZA 4XEVA 2J9WA 1YA9A 2A68F 2CNWA 3N0TA 3M79A 2A0BA 1RXQA 3SXKA 1GM5A 4HE8D 4BEJA 2PNOA 2AU5A 2P6VA 2Y3DA 4U5EE 1ORYA 4MVZA 1OKKA 2J46A 5L0FA 2L6HA 4XTKA 5KYUB 3GM2A 3EGXA 4YK5A 1V54C 2G3VA 3SXYA 2YVKA 1MNEA 3LNMB 2YL3A 1VOMA 4KNVA 3S27A 3VAYA 4E0HA 3B0UX 1TQGA 2IM8A 2O9XA 5T1DB 1SR2A 2E87A 4LACB 5D92A 3T6BA 5COFA 1OQCA 3MYFA 4DBQA 4KNWA 5CI9A 1ZHZA 3JRMO 3ZQYA 4J32B 3DXJF 2OJED 2C04A 3WAQA 3S29A 3QTHA 3RKOF 1TWAA 1CGME 2GA0A 1C03A 3L34A 3U9JA 3LUTB 5B3SC 1FMWA 3CEXA 3HNIA 1FTSA 1LIHA 3TJ6A 1CGOA 4LDKA 1PD0A 2YL7A 4F4BA 4ULWA 2VB6A 2VH3A 1QZXA 2WZLA 1D0XA 4PJLA 2UUIA 1T01A 2CYDA 4N06A 4O79A 4Q7CA 3ITFA 1GGQA 3L0IA 4IB4A 4IGGA 3CSKA 4NCQA 3G4ZA 3U8PA 2EIMC 3B9QA 1YYXA 1QPUA 1TWCA 4P9TA 4NY3A 4CS9A 1T5OA 3C8ZA 4YT2A 2EPLX 3DAGA 2BC5A 4IRUA 5A6BA 4BPMA 1G4WR 3EGXB 4CS7A 5JRAA 2L6FA 1MMAA 4JVSA 4QDLA 4HFKB 2WVOA 1TFOB 2R25A 4XWJA 4DOZA 4FAPB 5L3QA 2CDQA 5COGA 4OIOF 3W8IA 4BJ1A 1E86A 2Y39A 1NFNA 1JPJA 3UNGC 1EKYA 1BBHA 2EIKC 2R02A 4JE9A 2KQ9A 2NUTA 4FX5A 4CDVA 5DS6A 3WHNA 3AQCA 4KBLA 5EHHA 3IPMO 2J9VA 4HEAJ 2KSFA 1TFKB 1I5NA 1NU9C 5BQHA 2VCCA 1Y6DA 2J45A 4I3MA 4J7TA 4LDQA 4RD9A 2L7AA 4C3BA 1MQVA 3V7OA 4CS9C 1NBBA 2XXAB 4RDAA 2EPKX 1LS4A 2X0CA 3AG2C 3B71A 3S9OA 3DE9A 4CBEA 1GQAA 2QNLA 1HMDA 1OXBA 1YDIA 1NU7D 3AG4C 1M57C 1WWPA 1AEPA 1XWJA 1ZHWA 1R5ID 2FGYA 2WVQA 3DMDA 3H65A 2AWCA 3ABKC 3UGPA 5T3WA 3US6A 2EPOA 2OG2A 3J06A 4EUKB 2J9BA 3DAFA 1LKXA 1WOLA 1LE4A 1BZ4A 1YZCA 2JPUA 2HV6A 1V4AA 2R9RB 2LP4A 1CGNA 4HFFB 4NQFA 3C62A 4U9DA 3RQFA 4M63A 3VF0A 5L0IA 5KYWA 5JS5A 4BJ6C 2CGEA 2VCBA 1LM3B 1YJGA 4XPWA 3QMKA 2YL0A 2CNWD 4I44A 3FDQA 5JP7A 1CPQA 1H7IA 2ZXWC 5A6KA 4MVUA 1FNTc 3ZTMA 2PF4E 3GWLA 2R7VA 4DRHB 1JMWA 2QE9A 5FZTA 5KYNA 2L81A 3ZTZA 2ICWG 1QKRA 2EINC 5BQIA 3EFOB 3M4BA 3FAPB 2BE5F 2XL4A 3KKBA 1M56C 3CAXA 4A4AA 2IYLD 4C7OA 3FOPA 3HNLA 3JT1A 2CCYA 3C8GD 3WG7C 4CSAA 4BEMJ 4CS8A 4C3EA 1EA8A 1ZZPA 3DM9B 1A0BA 1I4YA 4NTBA 2NSGA 4K7BA 2PBEA 1Q0FA 4MVOA 3C7JA 1M6TA 1M2OA 3R7CA 4WABA 1U0BB 1ZHTA 4MVSA 2HZ8A 4DVYP 2H7OA 1YVIA 2R05A 2VC9A 2G62A 3LEOA 4CDAA 1C02A 4AX2A 2Q9CA 3HTKC 1Z23A 2RD9A 2ASRA 4MW8A 3LAYA 4LLEA 1ZW3A 1BR4A 2YKZA 3ASNC 1J8MF 3EHNA 1NSGB 3TK0A 4BJTA 3JTLO 2H7VC 1QVXA 4CJGA 1PCXA 3C8GB 4MTGA 4YL3A 4EBKA 3PHF2 2M64A 1C17M 3K1IC 4C7OB 2WZFA 5KYYB 2EILC 4JZAA 1E83A 2A1DD 3WODF 4IWBA 2V26A 5TJ5E 2Y3HA 3BEHA 3X1OA 1HW2A 2HJMA 3Q6NA 1D0YA 4L6RA 2Y3BA 1KNYA 4MW3A 3JSZA 3NYLA 4UDVA 4XEFA 1G8XA 1RJ9B 4KC9A 3F47A 3K1IA 5AC4A 2ETSA 2KW3C 3CZ6A 3AG1C 3IQTA 4CIHA 4Q5SF 3IQCA 2YL1A 3S28A 2XXAA 1YYJA 1ZU5A 2LD6A 1HE9A 1S05A 2XM4A 3HKKA 1VB5A 1OCCC 5AC5A 3GEHA 3K6BA 1WN0A 1OR2A 2KNHA 1NG1A 3JRTA 4PFPA 4DJ9A 3QVZA 2Q4FA 4U5GA 4DBRA 3BRJA 5JUAA 3NMKA 2OEXA 3TJ5A 3DI5A 3FAJA 1M2VA 2NUPB 2Q9AA 1LVKA 3W2WA 3DZAA 2PX3A 4IAOA 1D1CA 2J7PA 1K04A 2A69F 2W9YA 1ZHXA 2ZPAA 3F46A 4GQHA 4MVMA 1SF8A 1WTYA 2F22A 4NC3A 3G4XA 3RQGA 3ZVRA 5DQZA 2QLAA 1VLSA 1TWHA 2L9JA 4PK4A 1EI7A 4EIYA 3MYIA 4EWCA 1QQ3A 3VYWA 3ZDLA 3LLKA 1T6QA 1AUEA 2GWWA 1K40A 2OOCA 5BUOA 3GODA 2H7BA 3EGDB 2XLHA 3K66A 4JTDB 1B68A 4O6YA 4OIRF 2LFDA 2Z15A 5B3IA 3FHDA 2MHRA 1OW6A 1N1CA 4PJJA 3ZWIA 1L7CA 3G50A 3S90A 1LPEA 3I4UA 4BJ5C 4JKVA 1S7ZA 1A7DA 2Y69C 2JX0A 3RF3A 3EH2A 4WJ0A 2W45A 3V5ZA 3ASOC 1TWGA 1JOGA 2IXPA 3ZQVA 3OWTA 1Q0DA 3GEEA 4PACA 3TOMA 4E7SA 2NUTB 3LS0A 4Z9IA 4U5FE 4OIPF 1HMOA 1QSPA 1WASA 2YQYA 3B0PA 2J8WA 3PMRA 2EPNA 1HW1A 4PR9A 1OKKD 4AL1A 4E17A 4U5CE 4N6HA 5F28E 2X51A 3DKAA 3EGDA 1SMYF 3EG9B 3W8HA 4QI0A 4LERA 3O6XA 1WGWA 3UR3C 2XS1A 2XL8A 1Z6AA 3OA1A 4IJJA 4MQ9F 1VTMP 4YL0A 2BL2A 1JAFA 2UUHA 1J8YF 3DE8A 4ANJA 1RKCA 2KGOA 2XLOA 1AVOB 2XRHA 3X2QC 2Q7RA 1BDJB 2YWAA 3AG3C 2V3CC 1IW7F 1U6HA 2D4UA 4FESA 5BQGA 3NYJA 3U3BA 1I4ZA 3ZIBA 3K7DA 2WB7A 4JURI 1MMNA 3T6JA 3ZG1A 3AOUA 2ZD9A 5E33A 3ZC4A 3PDMP 3SNHA 5JVEA 4LDRA 1E85A 4CS8C 4ZLDA 2LK4A 2R7SA 1ORSC 4JJGA 4G7OF 3S0XA 4K0DA 3R2PA 2R7WA 1OXKA 4C3DA 1M2VB 3EPVA 3I5PA 2LQGA 4JCHA 3SP1A 1T9KA 3UMIA 1Z7Qc 1O87A 2HS5A 3DJUB 3GM1A 3QZCA 4YWQA 5D91A 5L0HA 5L0GA 5KYYA 4CDYA 4Z9JA 3GWNA 4EHPA 3MBGA 1U89A 3EG9A 4ER9A 3Q7LA 1YARO 1OCZC 2KYHA 1F1MA 2AVKA 4J30B 3NDBB 4JCZA 2PX0A 2JD3A 1OCRC 4NTAA 4G78A 2XLEA 3V5XA 3M15A 4JEAA 2QUPA 3LEVA 5IY5C 4A2NB 3S84A 4FWVA 4K1OA 1A7VA 4XPXA 1SZIA 3W4YA 3KL4A 3EQLF 3M4CA 4H4KC 1G4US 2FAPB 1JRAA 3ATPA 2IBFA 2ZXOA 4PFOA 3RQEA 3U2LA 4KI2A 2XSEA 2YLDA 3T9OA 2J0XA 1YZAA 2VCAA 3K33A 1UFBA 4U5BE 1RCPA 2OQMA 5FCLA 1JPNA 1HY5A 4G7ZF 4OINF 1D1AA 3T4RA 1NLXA 2B0HA 4U5DE 5DS5A 2XL6A 1ORJA 2B0JA 4H54A 3JSEO 1SYQA 2DI3A 2YZSA 3EFOA 2AWYA 3C18A 3L1MA 2OU6A 3FVYA 3Q7GA 4I1OB 4DRJB 1VLTA 2XM0A 1NFOA 1Q0GA 3TD7A 4U5HA 1PV3A 3KPHA 5F5HA 3GM3A
chains in the Genus database with same CATH topology
2HMQA 3AGUA 1I4YA 4XQ1A 2AWCA 1A7EA 1HMOA 1I4ZA 3WHNA 4XPYA 4XPXA 3WAQA 1HMDA 1A7DA 2MHRA 2HMZA 3AGTA 2AWYA 4XPWA 2AVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMQ A;  3AGU A;  1I4Y A;  4XQ1 A;  2AWC A;  1A7E A;  1HMO A;  1I4Z A;  3WHN A;  4XPY A;  4XPX A;  3WAQ A;  1HMD A;  1A7D A;  2MHR A;  2HMZ A;  3AGT A;  2AWY A;  4XPW A;  2AVK A; 
#chains in the Genus database with same CATH topology
 3SYN A;  3L8I A;  1XZP A;  3O39 A;  3T6G B;  4EBB A;  3IHU A;  1MND A;  3KMI A;  4QI2 A;  4Z9H A;  3JYH A;  1E2X A;  2LCH A;  2P0N A;  1K05 A;  1VMA A;  5E3C A;  4YT4 A;  3U9M A;  3VRC A;  3O10 A;  4ULV A;  1IZM A;  2XLM A;  2VAS A;  2ZXR A;  4GYT A;  4D4N A;  3KYJ A;  1PD1 A;  3I5Q A;  3C63 A;  3LNR A;  4OD4 A;  2TMV P;  2XLW A;  3DD7 A;  4EBJ A;  2L6G A;  5L0C A;  1ZU4 A;  3RVZ A;  3FXH A;  3U8V A;  4BG0 A;  1OR3 A;  1O5H A;  1NZE A;  1Z63 A;  2LIG A;  4JW1 A;  1BR2 A;  3H2U A;  4YT8 A;  3FMS A;  1Z3I X;  3EH1 A;  4LLC A;  4OD5 A;  1QLE C;  4O6N A;  1V55 C;  3GOR A;  1OCO C;  4NTF A;  5L3V A;  5KYX B;  5JLI A;  1H9T A;  4CJO A;  3QVY A;  2YRF A;  4N4W A;  4Q4Z F;  1A7E A;  4MVR A;  2OKU A;  1OW7 A;  1Z5Z A;  2PFD A;  4X0R A;  3TUL A;  2RSE B;  3MFN A;  4MTO A;  4RBN A;  5HSW A;  5COM A;  5CIV A;  3B0V C;  3DJN B;  2P1A A;  2H8A A;  3RIP A;  2CW0 F;  3SXZ A;  1Q0M A;  3RW0 A;  4BJ5 A;  4E18 A;  5K0I A;  2D5R B;  2R7O A;  5DLJ A;  3LS1 A;  3N24 A;  1VK5 A;  1Y4C A;  2LSE A;  3NKE A;  3UGO A;  4AE4 B;  1LI5 A;  4CSA C;  5E3A A;  3RFY A;  1H6G A;  4YT5 A;  5E2Q A;  1UG7 A;  1FR0 A;  5F5F A;  2P7V A;  5A6B D;  2YLI A;  4P6I C;  3DM5 A;  4CIP A;  4AK9 A;  3LES A;  1T6U A;  1YA7 O;  2W4B A;  1RKE A;  4U9E A;  1LI7 A;  1ZW2 A;  3N2Z B;  1BR1 A;  3EHM A;  2YHS A;  2HKV A;  2NUP A;  3MX3 A;  4MS2 A;  2DGJ A;  3RH3 A;  4AL0 A;  2R7R A;  1XZQ A;  5A6A A;  3E70 C;  2I15 A;  5JT4 A;  5L0D A;  2R7U A;  1TR2 A;  2EPM X;  2C03 A;  2PP4 A;  1TKN A;  2WL8 A;  5EK0 A;  1H9G A;  3AQB A;  3POV A;  4PJM A;  1W2W A;  2IXM A;  2FFH A;  3AJM A;  2HMZ A;  4G0H A;  4MTF A;  1APC A;  2AP3 A;  3TOL A;  3O55 A;  3K1H A;  1ZHY A;  4JTA B;  2HJ3 A;  5B1A C;  3IEE A;  1RJ9 A;  1FAP B;  5A69 A;  1YAU O;  5CI8 A;  2DB4 A;  2HSQ A;  3AGU A;  1R4T A;  5T3T A;  3U3F A;  3IQ6 A;  3SEO A;  1FFH A;  1DOV A;  2HV7 A;  4DXW A;  1ST6 A;  2YLG A;  2NSF A;  3KYI A;  2J0W A;  3NG1 A;  3LJB A;  3HLZ A;  5DVW A;  3NKD A;  1L3P A;  2A0U A;  2KK1 A;  1EQ1 A;  3PCV A;  2QTV A;  3Q6M A;  2OCC C;  256B A;  4JIO A;  3C8G A;  3HNJ A;  4IAR A;  4OIQ F;  1LS1 A;  2XLD A;  4JEB A;  2M4E A;  3JYY A;  5KYU A;  3NRH A;  2Q3T A;  3SXM A;  5DQT A;  1D0Z A;  3V5Y A;  4JTC B;  4ZLC A;  1ZYR F;  2OJQ A;  3TQO A;  5JSL A;  4E7Z A;  3GEI A;  2HMQ A;  1JR8 A;  3EJN A;  2DYS C;  3NYM A;  2EIJ C;  2IXN A;  3B29 A;  2QY9 A;  4O6M A;  3MLG A;  4YN0 B;  5HV9 A;  3OEO A;  3RYL A;  3HJC A;  4CX9 A;  3EZI A;  4I1M A;  1WAT A;  3E9V A;  3LLI A;  5GPG B;  2IXO A;  5DS4 A;  1O3U A;  1VYI A;  1YLM A;  4YL1 A;  3H2V A;  3GAN A;  1FMV A;  4XEK A;  1FFT C;  4XLN F;  3L8J A;  2DYR C;  2GDC A;  2WZG A;  4EKW A;  1RMV A;  2HUJ A;  3NMJ A;  4YJW A;  3A11 A;  4D4X A;  2P61 A;  2YEV A;  4GEH A;  4E0I A;  2NPU A;  3VM6 A;  2KC3 A;  2W4M A;  3ECS A;  2Q9B A;  5B1B C;  4W8K A;  3ABL C;  1CPR A;  1D1B A;  2J7P D;  4B6I A;  1MMG A;  4G7H F;  4O7G A;  1A41 A;  4AE4 A;  5EGY A;  3UMH A;  5L0J A;  1KTM A;  4MVQ A;  3U0C A;  4ONS A;  1DOW A;  2R7X A;  4BJ6 A;  3UMK A;  4WGZ A;  3JCU Q;  5A6J A;  4W8P A;  3W2V A;  3IQ5 A;  3QW1 A;  4DVZ A;  1GS9 A;  3NMI A;  1LE2 A;  3M1C B;  3HNK A;  1ZVZ A;  2HFI A;  3U2M A;  3DWW A;  4P9F A;  2J9U A;  1OW8 A;  1KU2 A;  2XS8 A;  1V74 B;  2A6H F;  4JC7 A;  4XLP F;  2LFF A;  2NG1 A;  4IAQ A;  2G3K A;  3ABM C;  1MMD A;  2A6E F;  2Y3G A;  4J7Y A;  4R32 A;  4XPY A;  3RVY A;  1E84 A;  3CQZ A;  4MND A;  4JJF A;  2HSB A;  1Q0K A;  3EZH A;  4N6C A;  2GFH A;  2MWQ A;  1T6I A;  2KJG A;  3QW0 A;  4PJN A;  2R7T A;  4WGY A;  3U5S A;  2WVN A;  3SZR A;  2R03 A;  4JRZ A;  3KH2 A;  2OEV A;  3JZ0 A;  2ZXP A;  5AGF A;  2Q00 A;  3A9C A;  3AGT A;  1VYK A;  2I8B A;  3ZSU A;  4DRI B;  4XQ1 A;  5KYX A;  2IOQ A;  2GAQ A;  2XLV A;  1RKE B;  3FOO A;  2MYS A;  5KYW B;  2R7Q A;  1HE1 A;  1G5Z A;  4XEV A;  2J9W A;  1YA9 A;  2A68 F;  2CNW A;  3N0T A;  3M79 A;  2A0B A;  1RXQ A;  3SXK A;  1GM5 A;  4HE8 D;  4BEJ A;  2PNO A;  2AU5 A;  2P6V A;  2Y3D A;  4U5E E;  1ORY A;  4MVZ A;  1OKK A;  2J46 A;  5L0F A;  2L6H A;  4XTK A;  5KYU B;  3GM2 A;  3EGX A;  4YK5 A;  1V54 C;  2G3V A;  3SXY A;  2YVK A;  1MNE A;  3LNM B;  2YL3 A;  1VOM A;  4KNV A;  3S27 A;  3VAY A;  4E0H A;  3B0U X;  1TQG A;  2IM8 A;  2O9X A;  5T1D B;  1SR2 A;  2E87 A;  4LAC B;  5D92 A;  3T6B A;  5COF A;  1OQC A;  3MYF A;  4DBQ A;  4KNW A;  5CI9 A;  1ZHZ A;  3JRM O;  3ZQY A;  4J32 B;  3DXJ F;  2OJE D;  2C04 A;  3WAQ A;  3S29 A;  3QTH A;  3RKO F;  1TWA A;  1CGM E;  2GA0 A;  1C03 A;  3L34 A;  3U9J A;  3LUT B;  5B3S C;  1FMW A;  3CEX A;  3HNI A;  1FTS A;  1LIH A;  3TJ6 A;  1CGO A;  4LDK A;  1PD0 A;  2YL7 A;  4F4B A;  4ULW A;  2VB6 A;  2VH3 A;  1QZX A;  2WZL A;  1D0X A;  4PJL A;  2UUI A;  1T01 A;  2CYD A;  4N06 A;  4O79 A;  4Q7C A;  3ITF A;  1GGQ A;  3L0I A;  4IB4 A;  4IGG A;  3CSK A;  4NCQ A;  3G4Z A;  3U8P A;  2EIM C;  3B9Q A;  1YYX A;  1QPU A;  1TWC A;  4P9T A;  4NY3 A;  4CS9 A;  1T5O A;  3C8Z A;  4YT2 A;  2EPL X;  3DAG A;  2BC5 A;  4IRU A;  5A6B A;  4BPM A;  1G4W R;  3EGX B;  4CS7 A;  5JRA A;  2L6F A;  1MMA A;  4JVS A;  4QDL A;  4HFK B;  2WVO A;  1TFO B;  2R25 A;  4XWJ A;  4DOZ A;  4FAP B;  5L3Q A;  2CDQ A;  5COG A;  4OIO F;  3W8I A;  4BJ1 A;  1E86 A;  2Y39 A;  1NFN A;  1JPJ A;  3UNG C;  1EKY A;  1BBH A;  2EIK C;  2R02 A;  4JE9 A;  2KQ9 A;  2NUT A;  4FX5 A;  4CDV A;  5DS6 A;  3WHN A;  3AQC A;  4KBL A;  5EHH A;  3IPM O;  2J9V A;  4HEA J;  2KSF A;  1TFK B;  1I5N A;  1NU9 C;  5BQH A;  2VCC A;  1Y6D A;  2J45 A;  4I3M A;  4J7T A;  4LDQ A;  4RD9 A;  2L7A A;  4C3B A;  1MQV A;  3V7O A;  4CS9 C;  1NBB A;  2XXA B;  4RDA A;  2EPK X;  1LS4 A;  2X0C A;  3AG2 C;  3B71 A;  3S9O A;  3DE9 A;  4CBE A;  1GQA A;  2QNL A;  1HMD A;  1OXB A;  1YDI A;  1NU7 D;  3AG4 C;  1M57 C;  1WWP A;  1AEP A;  1XWJ A;  1ZHW A;  1R5I D;  2FGY A;  2WVQ A;  3DMD A;  3H65 A;  2AWC A;  3ABK C;  3UGP A;  5T3W A;  3US6 A;  2EPO A;  2OG2 A;  3J06 A;  4EUK B;  2J9B A;  3DAF A;  1LKX A;  1WOL A;  1LE4 A;  1BZ4 A;  1YZC A;  2JPU A;  2HV6 A;  1V4A A;  2R9R B;  2LP4 A;  1CGN A;  4HFF B;  4NQF A;  3C62 A;  4U9D A;  3RQF A;  4M63 A;  3VF0 A;  5L0I A;  5KYW A;  5JS5 A;  4BJ6 C;  2CGE A;  2VCB A;  1LM3 B;  1YJG A;  4XPW A;  3QMK A;  2YL0 A;  2CNW D;  4I44 A;  3FDQ A;  5JP7 A;  1CPQ A;  1H7I A;  2ZXW C;  5A6K A;  4MVU A;  1FNT c;  3ZTM A;  2PF4 E;  3GWL A;  2R7V A;  4DRH B;  1JMW A;  2QE9 A;  5FZT A;  5KYN A;  2L81 A;  3ZTZ A;  2ICW G;  1QKR A;  2EIN C;  5BQI A;  3EFO B;  3M4B A;  3FAP B;  2BE5 F;  2XL4 A;  3KKB A;  1M56 C;  3CAX A;  4A4A A;  2IYL D;  4C7O A;  3FOP A;  3HNL A;  3JT1 A;  2CCY A;  3C8G D;  3WG7 C;  4CSA A;  4BEM J;  4CS8 A;  4C3E A;  1EA8 A;  1ZZP A;  3DM9 B;  1A0B A;  1I4Y A;  4NTB A;  2NSG A;  4K7B A;  2PBE A;  1Q0F A;  4MVO A;  3C7J A;  1M6T A;  1M2O A;  3R7C A;  4WAB A;  1U0B B;  1ZHT A;  4MVS A;  2HZ8 A;  4DVY P;  2H7O A;  1YVI A;  2R05 A;  2VC9 A;  2G62 A;  3LEO A;  4CDA A;  1C02 A;  4AX2 A;  2Q9C A;  3HTK C;  1Z23 A;  2RD9 A;  2ASR A;  4MW8 A;  3LAY A;  4LLE A;  1ZW3 A;  1BR4 A;  2YKZ A;  3ASN C;  1J8M F;  3EHN A;  1NSG B;  3TK0 A;  4BJT A;  3JTL O;  2H7V C;  1QVX A;  4CJG A;  1PCX A;  3C8G B;  4MTG A;  4YL3 A;  4EBK A;  3PHF 2;  2M64 A;  1C17 M;  3K1I C;  4C7O B;  2WZF A;  5KYY B;  2EIL C;  4JZA A;  1E83 A;  2A1D D;  3WOD F;  4IWB A;  2V26 A;  5TJ5 E;  2Y3H A;  3BEH A;  3X1O A;  1HW2 A;  2HJM A;  3Q6N A;  1D0Y A;  4L6R A;  2Y3B A;  1KNY A;  4MW3 A;  3JSZ A;  3NYL A;  4UDV A;  4XEF A;  1G8X A;  1RJ9 B;  4KC9 A;  3F47 A;  3K1I A;  5AC4 A;  2ETS A;  2KW3 C;  3CZ6 A;  3AG1 C;  3IQT A;  4CIH A;  4Q5S F;  3IQC A;  2YL1 A;  3S28 A;  2XXA A;  1YYJ A;  1ZU5 A;  2LD6 A;  1HE9 A;  1S05 A;  2XM4 A;  3HKK A;  1VB5 A;  1OCC C;  5AC5 A;  3GEH A;  3K6B A;  1WN0 A;  1OR2 A;  2KNH A;  1NG1 A;  3JRT A;  4PFP A;  4DJ9 A;  3QVZ A;  2Q4F A;  4U5G A;  4DBR A;  3BRJ A;  5JUA A;  3NMK A;  2OEX A;  3TJ5 A;  3DI5 A;  3FAJ A;  1M2V A;  2NUP B;  2Q9A A;  1LVK A;  3W2W A;  3DZA A;  2PX3 A;  4IAO A;  1D1C A;  2J7P A;  1K04 A;  2A69 F;  2W9Y A;  1ZHX A;  2ZPA A;  3F46 A;  4GQH A;  4MVM A;  1SF8 A;  1WTY A;  2F22 A;  4NC3 A;  3G4X A;  3RQG A;  3ZVR A;  5DQZ A;  2QLA A;  1VLS A;  1TWH A;  2L9J A;  4PK4 A;  1EI7 A;  4EIY A;  3MYI A;  4EWC A;  1QQ3 A;  3VYW A;  3ZDL A;  3LLK A;  1T6Q A;  1AUE A;  2GWW A;  1K40 A;  2OOC A;  5BUO A;  3GOD A;  2H7B A;  3EGD B;  2XLH A;  3K66 A;  4JTD B;  1B68 A;  4O6Y A;  4OIR F;  2LFD A;  2Z15 A;  5B3I A;  3FHD A;  2MHR A;  1OW6 A;  1N1C A;  4PJJ A;  3ZWI A;  1L7C A;  3G50 A;  3S90 A;  1LPE A;  3I4U A;  4BJ5 C;  4JKV A;  1S7Z A;  1A7D A;  2Y69 C;  2JX0 A;  3RF3 A;  3EH2 A;  4WJ0 A;  2W45 A;  3V5Z A;  3ASO C;  1TWG A;  1JOG A;  2IXP A;  3ZQV A;  3OWT A;  1Q0D A;  3GEE A;  4PAC A;  3TOM A;  4E7S A;  2NUT B;  3LS0 A;  4Z9I A;  4U5F E;  4OIP F;  1HMO A;  1QSP A;  1WAS A;  2YQY A;  3B0P A;  2J8W A;  3PMR A;  2EPN A;  1HW1 A;  4PR9 A;  1OKK D;  4AL1 A;  4E17 A;  4U5C E;  4N6H A;  5F28 E;  2X51 A;  3DKA A;  3EGD A;  1SMY F;  3EG9 B;  3W8H A;  4QI0 A;  4LER A;  3O6X A;  1WGW A;  3UR3 C;  2XS1 A;  2XL8 A;  1Z6A A;  3OA1 A;  4IJJ A;  4MQ9 F;  1VTM P;  4YL0 A;  2BL2 A;  1JAF A;  2UUH A;  1J8Y F;  3DE8 A;  4ANJ A;  1RKC A;  2KGO A;  2XLO A;  1AVO B;  2XRH A;  3X2Q C;  2Q7R A;  1BDJ B;  2YWA A;  3AG3 C;  2V3C C;  1IW7 F;  1U6H A;  2D4U A;  4FES A;  5BQG A;  3NYJ A;  3U3B A;  1I4Z A;  3ZIB A;  3K7D A;  2WB7 A;  4JUR I;  1MMN A;  3T6J A;  3ZG1 A;  3AOU A;  2ZD9 A;  5E33 A;  3ZC4 A;  3PDM P;  3SNH A;  5JVE A;  4LDR A;  1E85 A;  4CS8 C;  4ZLD A;  2LK4 A;  2R7S A;  1ORS C;  4JJG A;  4G7O F;  3S0X A;  4K0D A;  3R2P A;  2R7W A;  1OXK A;  4C3D A;  1M2V B;  3EPV A;  3I5P A;  2LQG A;  4JCH A;  3SP1 A;  1T9K A;  3UMI A;  1Z7Q c;  1O87 A;  2HS5 A;  3DJU B;  3GM1 A;  3QZC A;  4YWQ A;  5D91 A;  5L0H A;  5L0G A;  5KYY A;  4CDY A;  4Z9J A;  3GWN A;  4EHP A;  3MBG A;  1U89 A;  3EG9 A;  4ER9 A;  3Q7L A;  1YAR O;  1OCZ C;  2KYH A;  1F1M A;  2AVK A;  4J30 B;  3NDB B;  4JCZ A;  2PX0 A;  2JD3 A;  1OCR C;  4NTA A;  4G78 A;  2XLE A;  3V5X A;  3M15 A;  4JEA A;  2QUP A;  3LEV A;  5IY5 C;  4A2N B;  3S84 A;  4FWV A;  4K1O A;  1A7V A;  4XPX A;  1SZI A;  3W4Y A;  3KL4 A;  3EQL F;  3M4C A;  4H4K C;  1G4U S;  2FAP B;  1JRA A;  3ATP A;  2IBF A;  2ZXO A;  4PFO A;  3RQE A;  3U2L A;  4KI2 A;  2XSE A;  2YLD A;  3T9O A;  2J0X A;  1YZA A;  2VCA A;  3K33 A;  1UFB A;  4U5B E;  1RCP A;  2OQM A;  5FCL A;  1JPN A;  1HY5 A;  4G7Z F;  4OIN F;  1D1A A;  3T4R A;  1NLX A;  2B0H A;  4U5D E;  5DS5 A;  2XL6 A;  1ORJ A;  2B0J A;  4H54 A;  3JSE O;  1SYQ A;  2DI3 A;  2YZS A;  3EFO A;  2AWY A;  3C18 A;  3L1M A;  2OU6 A;  3FVY A;  3Q7G A;  4I1O B;  4DRJ B;  1VLT A;  2XM0 A;  1NFO A;  1Q0G A;  3TD7 A;  4U5H A;  1PV3 A;  3KPH A;  5F5H A;  3GM3 A; 
#chains in the Genus database with same CATH homology
 2HMQ A;  3AGU A;  1I4Y A;  4XQ1 A;  2AWC A;  1A7E A;  1HMO A;  1I4Z A;  3WHN A;  4XPY A;  4XPX A;  3WAQ A;  1HMD A;  1A7D A;  2MHR A;  2HMZ A;  3AGT A;  2AWY A;  4XPW A;  2AVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...