3AHEA

Phosphoketolase from bifidobacterium breve complexed with dihydroxyethyl thiamine diphosphate
Total Genus 323
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
323
sequence length
802
structure length
802
Chain Sequence
VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
molecule tags Lyase
molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
total genus 323
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aheA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aheA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aheA01
3DVAB 2BFEB 1W88A 4Q9DA 1JSCA 5EJAA 5FEMA 2PDAA 5EXEA 1T9AA 5EXDA 5HHTA 4JU9A 1X7YB 3EXG2 1T9BA 1YD7A 1Y9DA 4XEUA 2G28A 4C7VA 2JLAA 3ZHTA 1UMDA 1V11B 5HYVA 1WCIA 2Q29A 4RJKA 4KXVA 1POWA 4C7XA 2BEUB 3HYLA 1YHZA 3AHDA 3M7IA 3FLMA 3MOSA 4JUAA 3M34A 3LQ4A 2IHUA 2O1SA 2VBGA 1UPCA 3DVAA 4RJJA 5EJMA 5IMSA 2Q5JA 1OLUB 3D7KA 4GG1A 1W85B 1W88B 2BFEA 3AI7A 2Q5QA 1UM9B 3LPLA 2R8PA 1DTWB 1YI1A 4D5GA 4GM4A 5K6TA 1QS0A 3IAFA 1UMCB 3ZHUA 1UPAA 4MZXA 2J9FB 2BFDA 1GPUA 2JGDB 2UZ1A 3ZHVA 2C3YA 3UK1A 3JU3A 2BEWB 5HJEA 2YICA 4K9NA 2G67A 1V5FA 3OOYA 2BFCB 4QPZA 4D5EA 2C3OA 3DV0B 3L84A 2IHVA 1OLXA 2BEVA 1TKAA 5EJ7A 2E6KA 1TKCA 1X7YA 3EXFB 4JUFA 2UZAA 4K9LA 3E9YA 5K3SA 2QTCA 5EJ5A 1T9DA 1V1RB 3AHEA 4MPJA 4FEGA 1UMBB 3ZHSA 2WVGA 2JI6A 4MPRA 1X7ZB 2WVHA 1NI4B 3EY9A 2BFFB 1OZGA 2R5NA 1V16A 2OZLA 2X7JA 3ZHRA 3DUFA 1T9CA 4K9OA 1R9JA 4JUDX 1U5BB 2BP7B 4MQ5A 4QELA 4ZP1A 4COKA 1OVMA 4WBXC 5ERXA 2XT9A 2BFBB 4K9KA 3EXIB 1X7WA 1PO7A 1POXA 1UPBA 2C3UA 2EZ8A 3EA4A 5ERYA 5K6RA 3EXHC 1IK6A 1L8AA 5HGXA 5I4IA 1OLSA 3DUFB 1V5GA 3EXHA 3FSJX 2C31A 4JUCA 3M49A 1X7XA 1NI4A 3EYAA 5EJ6A 3OE1A 3M6LA 3RIMA 2VK4A 1UMBA 4K9QA 2YIDA 5DGTA 3LQ1A 3EXEA 2IHTA 4GM1A 4K9PA 1YHYA 1AY0A 2C42A 2XTAA 4MPPA 1X80B 1BFDA 2FWNA 2Q28A 2DJIA 1V1MA 4KXWA 2VK1A 3EXG1 3HWWA 5EJ8A 2R8OA 4JU8A 2O1XA 1TRKA 1X7WB 3EXIA 2BFBA 1YBHA 5DGDA 2Q27A 3KOMA 4RJIA 5I5EA 2PGOA 2JLCA 4QQ8A 5C4IA 2EZ9A 3ZHQA 5DEIA 2V3WA 2OZLB 2W93A 1V1MB 4GPEA 4KXYA 4K9MA 1U5BA 2BP7A 2EZTA 3LQ2A 1B0PA 5I5GA 3AHJA 5I51A 1V5EA 1X80A 1UM9A 1YNOA 2EZ4A 3AHHA 4KXUA 1V16B 1NGSA 2FN3A 1QGDA 3EXEB 1PVDA 1W85A 1Z8NA 2Y0PA 1X7ZA 3F6EX 1TKBA 5ESDA 3EXFA 5K2OA 3HWX1 5AHKA 3AHIA 1V1RA 2VBIA 1QPBA 1X7XB 5EJ9A 2BEVB 1PI3A 3AHFA 2VBFA 2PANA 3EXHB 3FZNA 2BEUA 4JUBA 1OLSB 2XT6A 2AG1A 2BFCA 2G25A 1OZFA 2VJYA 4FEEA 4KGDA 3UPTA 1OLXB 5EJ4A 2BEWA 3DV0A 1WCIB 2IEAA 1V11A 2NXWA 1UMDB 3F6BX 2QTAA 4JD5A 2C3MA 3AHCA 2AG0A 2EZUA 1KEKA 2JI7A 4GP9A 3IAEA 1QS0B 1MCZA 1ITZA 1PYDA 2JGDA 2Q5OA 4KXXA 2BFDB 1N0HA 1Q6ZA 2J9FA 2PGNA 2UZ1B 2VK8A 2WVAA 1UMCA 2BFFA 2Q5LA 1ZPDA 2JIBA 2C3PA 3AHGA 4GM0A 2JI9A 1OLUA 1DTWA 1RP7A 1YI0A 2JI8A 1OZHA
chains in the Genus database with same CATH superfamily
3IPXA 1EA5A 2BFEB 1LCIA 3LPNA 3QBEA 5CDFA 1KI9A 3U1BA 3AXTA 3OFJA 4WXYB 2ZSBA 3KL4A 2QW8A 4KO1S 3T52A 1EUDB 4BE7B 2XB4A 2X2PA 4OYYA 2FW8A 4S1NA 1GCGA 3DZIA 1CE8A 1WCIA 2VPXA 4GX0A 1N2ZA 1T2DA 3P32A 5CDTA 5JASA 1XQWA 1QC5B 1BH6A 4MIEA 4EHNA 1PK7A 3M81A 2FF7A 4ZOCA 2YZGA 4JL8A 1U94A 2JD1A 4YRJA 3UYKA 2HSZA 4GEGA 1W4AA 2G77B 2G63A 1PJ4A 3HR8A 4E4RA 3DBIA 5FLEX 1L9XA 2YHBA 3SEFA 2I6GA 2EDAA 3CW9A 3UCXA 3VRHA 3M3PA 2WP8J 4O33A 3TVTA 2WTNA 3NNNA 4R1UA 4P4SB 3ZU5A 2P6PA 3JRNA 2JNWA 2R9VA 3L5KA 4LRUA 1RTTA 4YJKA 4EHDA 5BPHA 2FMTA 2X77A 5KB3A 1PZFA 2RGXA 1KSFX 4J0EA 4IPTA 1E9DA 4M1QA 4PONA 4WPGA 1AQLA 3NKFA 3MAJA 3DV0B 2EJTA 4JLVA 4FIZA 4EHJA 3E05A 5ELXA 5HQ3A 1I4WA 2K87A 1DAFA 5KQPA 1ZJYA 2EG9A 5F3WB 4RK5A 3STYA 4MUHA 4XJVA 3OZWA 5BNIA 4HX5A 3PGKA 4L0QA 4X44A 1NW4A 1GSIA 3B8EA 4BKMA 1A4UA 3O3OB 1GZHB 4HZUA 4GXRA 5J2UF 4ZJZA 3CUUA 2ZW9A 1S02A 3CSUA 1GARA 1FU4A 3DVSX 3IJPA 2I4MA 3E0QA 4AJEA 4BAUA 4MJ3A 1YAJA 3QF7A 4EI9A 5EWJA 3GJSA 1Q22A 4IMRA 1P29A 1G63A 4YP1A 5HS6A 2D3TA 1K6EA 3DGEC 4A10A 4B7UA 1B14A 1UIRA 1R6BX 3HCOA 2VUTA 3CNLA 1RRPA 1P60A 3MYYA 5AKEA 4M1SA 1L3BA 3FGPA 4LZLA 1W1IA 2FOXA 3PHIA 3QQ5A 3GH1A 4I5IA 3T3EA 3V80A 4BPRA 3GLVA 3JQAD 3HKEA 1BXRB 4GVLA 3JARB 2BGNA 4IIBA 2ZZNA 1NI3A 2JJ2A 1UZUA 2AZDA 2OHOA 3K16A 4JMPA 4HZIA 2QT9A 3BE4A 4P4NA 3OE4A 4QBIA 2J3EA 3HL0A 2QLBA 1P39A 3IQGX 1J2EA 1GT6A 1NVFA 2DFVA 4FUQA 4WT7A 5H7XA 2WD7A 5B6JA 1A9XB 1NE2A 4P3OA 2DM6A 1DE0A 2ZYUX 3GFFA 4C0SA 4P0QB 2BZ1A 3KXLA 1OAOA 3GFQA 5KX5A 2OECA 2QRLA 2AOVA 1SC1A 1C3EA 1KH3A 2A7XA 1KMCA 2CXQA 2GBIA 1TAGA 3L0ZA 4G25A 5DCYA 3TS1A 3IFSA 1QFYA 4OXQA 1YXMA 2J5RA 4KBGA 4UBJA 3IYLW 4ACAA 3QE9Y 5BWMA 1GPDG 1RWBA 1WCYA 2OD2A 3D4LA 2WIDA 3EXHB 2C92A 4RIGA 3I92A 4FE3A 5DP1A 4ZTBA 3IVMA 3MUNA 4D92A 1H22A 1O94D 1BVUA 5DTJA 3RFUA 5ALQA 3WWCA 1K92A 1KI1A 1M2JA 2EFEB 5JH7B 1RLIA 1JIXA 5DIZA 1WOMA 5DISB 5CA0A 2JIRA 2B61A 5M29A 5D3MA 3WJ1A 1LH0A 4WFQA 3F5MA 1JMKC 1QH9A 2AE2A 4PZ9A 1E6WA 1K2WA 4H7DA 1BWQA 3K94A 1T5OA 3EAGA 2FGJA 2QYOA 4TOIA 1CDDA 4KI7A 1QTIA 5LB4A 1RRCA 4E09A 1NOJA 2ZUVA 4OA5A 3LHFA 5KMGB 3ZZ1A 4R2IA 1Z0UA 2CVHA 3JAKA 1Q1AA 3IQIX 2O2CA 1Z75A 3RUHA 5IXYA 2I1WA 1MIOB 1X1CA 1Y7HA 4E13A 2NGRA 13PKA 2XIQA 3RT9A 1A88A 2C54A 2D4AA 2ECOA 4LV8B 3OFND 1IIBA 4B1FA 4XYBA 2G9UA 1E4EB 4QDZA 2MU1A 1N2JA 3JS5A 4C7BA 4XDGA 4L22A 1F5SA 3HJAA 2NQ8A 4HYEA 4L02A 5TMEA 4BMOB 2R8PA 1NPYA 3CUWA 5DLQC 4QTUB 1Y3AA 2FPSA 1EFKA 4IEFB 4YA6A 1SXJA 3QBTA 4FMPA 3O4HA 4LWZA 5EMNA 5HILA 4MW7A 2ES4A 3ENKA 4O5OA 4FCTA 4RIHA 4WADA 4Z6KA 3AT1A 1WG8A 1YULA 1X15A 4X61A 4CM3A 1C0LA 4UNQA 5KYWA 3GAAA 3ZNPA 1K06A 1UH5A 2IRWA 3SSNA 2WSSD 4Q3CA 3JARA 4UHFA 1QV6A 5AVSA 2XT0A 2C9ZA 2PCLA 3OJOA 4MS1A 1NBHA 1J6UA 5A71A 3HBAA 1Z2AA 2Q45A 2PT5A 2Z3VA 3DMNA 3FTEA 2CNNA 2Q6IA 4G4SO 4R9UC 2JAXA 1QU3A 3D3WB 5FYQA 1DAEA 1Y9EA 3WMFA 2Q0QA 3ITKA 5DWDA 2Z8YA 3H8JA 4J29A 5A9SB 1PR6A 1HFKA 4BFYA 5CX1B 2Q3MA 3HXLA 1GR1A 4TXNA 5CCBA 2WUDA 5JFTA 3UC9A 4K7JA 4C07A 1J8MF 3RC1A 2YWBA 5E1MA 3CG4A 1A95A 5HVNA 2VH1A 3KZOA 2A86A 5IKPA 3MCTA 3RR2A 5CA1A 4YCNA 3WAKA 4MWEA 3LPMA 4J9VA 2ZJ1A 2B1RA 1LLFA 2A2ZA 2QRPA 5BN3B 1E1MA 2J6IA 2P9JA 3L93A 3PBKA 3UN1A 2GZRA 1BFDA 4R9VA 3WGNA 2IDKA 3K6KA 1JHUA 1XBTA 2H63A 2PGJA 2EJCA 4D0RA 3PI7A 1QP7A 5JCJD 2WMDA 1RYEA 5J2UA 4QUDA 3ZW9A 3HC7A 5J9FA 3TMYA 2PUDA 1GUBA 1N25A 3U2QA 3B85A 5HUJA 1W6UA 4PS0A 2FW9A 3NATA 1QJCA 2FZ4A 1VE9A 2JCVA 1X94A 2NG1A 1RWMA 2HSDA 3OLCX 4PICA 3PVZA 4PRYA 2DVMA 4AG6A 1HRKA 3FWYA 1MGOA 3R3JA 1BXKA 2RH9B 1M1NB 4YR7A 1KDOA 3DG9A 4WASA 1MOZA 3IEPA 4OIMA 2Z83A 1ZNXA 2UXCB 4AMYA 4NC9A 1QYCA 2FW0A 3CGGA 2DKNA 3KZNA 2AEEA 3AJEA 3CLSD 3MBKA 4KQXA 1XRRA 1I3OA 1GPAA 2PNFA 3K1YA 3MRVA 1X1TA 3IXQA 1YVDA 2Y9MB 1JJ7A 4IWNA 1NQAO 2ONJA 3VR3D 3WTCA 2G70A 1UXHA 4ZI3A 5KYWB 1ISMA 2CL6X 1V11A 2XUOA 4YJHB 2AOTA 2Z2IA 3B78A 3CZRA 3N3BC 1UDBA 3R20A 3PSHA 4L28A 1JLHA 3T3PB 1SVMA 3DMYA 3MUOA 2G4VA 3AC0A 5KCZA 1O58A 3OJFA 5C1BA 2NACA 4L9AA 1GGVA 2WSLA 2PQMA 4PYOA 3P0EA 1VYTA 3R5TA 3JYOA 3DCIA 4HXFB 4RXTA 2C2KA 4IIJB 2JL1A 1OF1A 1OBFO 2OC4A 2CLEB 4DR6B 1KFKB 2H07A 4MUAA 3CX4A 4D9NA 1NG1A 5C53B 2J08A 1H2AS 1HDCA 1K68A 1NZDA 1OILA 1YFJA 2WWWA 1HTTA 1Q20A 4A0FA 2GDZA 1G7SA 2CYAA 3MBOA 4MUIA 4X6LA 5K4GA 3TLGA 3UJCA 3VC7A 1CS4C 5HKBA 3Q87B 5T7BA 2HDHA 4MEBA 1LS1A 4PCUA 2XXAA 2C57A 4OKSA 4ERNA 1V9CA 3FKQA 3QBVA 4XPZA 5K51A 3KEGA 2K7ZA 1SXIA 2RMKA 3W4JA 1MG5A 4P3NA 3UUWA 4YT8A 5BWLA 2W4MA 2PMFA 1Q3HA 3R76A 1IE3A 2OM6A 3DOFA 1ZK2A 3IAFA 2C4WA 4UEJA 1K5HA 2ODTX 5AP9A 3DMGA 3ZHVA 1VLHA 2GYWA 2PAAA 2AXQA 5LDDC 3MUEA 1JG6A 3TGLA 3WGGA 3T9EA 5BVHA 2VDOB 4UVGA 5KYYA 2EYUA 3WMRA 5CFRA 3TNJA 3FCOA 1NULA 4KFSA 1Q1BA 4UVIA 3KJHA 5HIMA 1SCKA 3ISJA 2ZUTA 1K63A 2WT9A 3LQQA 4MX8A 2E48A 4IICA 5J2TF 1IAQA 2FRVA 4O1HA 3EF0A 1SB8A 4FEGA 4WN3A 1CD5A 3DZDA 1H2ZA 3HLYA 4M21A 4W1RA 1L5LA 1E3TA 3IR6A 5IDYA 1SVLA 2PU5A 3KFVA 2O6LA 5FOUA 3TXYA 4LWPA 4LC0A 5AI8A 5CA0F 4PG4A 2ANCA 1S3FA 3JWJA 1BWRA 1DXYA 1M7BA 2WD7B 3BDAA 4MS4B 1SUWA 3KUCA 4PX9A 1V48A 1R5NA 2AH5A 2WYVA 2Q3BA 4NAUA 4F4IA 3AQIA 3RS8A 4RMHA 4ESEA 4ZEWA 2G8LA 4ZVRA 1Q7BA 3SDSA 5BP7A 3VR6H 1LC0A 3WIVA 3VPCA 3VR4D 5AR1A 1X14A 3EEFA 2I4IA 5G41A 4G85A 2FSVA 1CY1A 2NV2B 1C50A 4LWQA 4YRKA 2Q28A 1RZRA 1U9YA 4GRIA 4LQ4A 4II7A 1Y98A 3SF8B 4K0KB 2VAPA 1XAHA 4TMVA 1W8IA 2A6PA 2F3SA 3CLTC 1TMKA 1F6WA 4OBWA 1ML4A 3HB1A 3V1NA 5C4IA 2JEZA 2B1IA 3A6HA 5T3YA 4ARZA 2BYTA 1M67A 3BD7A 3PHCA 3FDZB 3AHHA 2EU8A 2OA0A 3WDKA 1QHNA 5JXIA 3Q5EA 1Y5IA 3GGCA 1NLUA 5ELMA 2OHJA 2VDQB 5SZIA 1MO2A 4IGFA 4OHBA 1U7TA 4ESVA 1WZIA 5DMHA 5L3RA 3ANYB 3L4BC 2O0LA 4Q1AA 5IM4F 1UKZA 2GPJA 1RPNA 2R25B 1SXJE 3UCFA 3N87A 2O8NA 1OD6A 3PUYA 4JVMA 4FB4A 2Z56A 3LYAA 1V7QA 4QBKA 4NYJR 7ADHA 1ZICA 3ASUA 2WPNA 4M0LA 2GK6A 2YNMD 2YYYA 2HA0A 2EARA 2H1RA 3AJ9A 1L9KA 3THWB 2YWDA 4DC1A 2DKFA 4FMDF 1NW9B 1SBHA 4FONA 3A6KA 1GNVA 4QUKA 2NU8A 1R0KA 1P7WA 1U3TA 2GRJA 1IM8A 3KQNA 3SQWA 2XNHA 2Q6OA 2A5DA 3USZA 5CM8B 1DBWA 3LTNC 1BS2A 3KOUA 1J9EA 4TM7A 4X41A 3D7RA 3FSGA 1ZOSA 5AYVA 1ENZA 5CXSA 3DD5A 3W7BA 3K0SA 4LK2A 1I4TD 2NUPB 3ROQA 3ZDAA 4R68A 1Y6QA 2CXHA 2A92A 2XQIA 721PA 1N9GA 3SZUA 1GKKA 4FGSA 1JPVA 4WY5A 4I50A 1GL9B 1Y4DE 2BM9A 1KVQA 2O1SA 2PFKA 4TRMA 3LGSA 2PA0A 4Y2QA 4K81B 3QW2A 1B2RA 1B3BA 2D06A 4RV5A 4IIJA 4OP3A 1M2EA 2VJCA 4X20A 2YMQA 3H9GA 4Q6BA 3EUFA 2EKDA 4AECA 1EXMA 1TW3A 2OZKA 2DTXA 3DV9A 2XE6A 4PBTA 4Q34A 4X62B 2BT4A 1NN3A 4L15A 1CUYA 1JEDA 3L6BA 1IHYA 2GZ1A 4QPZA 3SFTA 4YEDA 1E79A 1AKVA 4JUIA 2XD9A 1I6MA 5FPYA 2B78A 1A5ZA 4AN4A 2Y1OA 3GLHB 2G17A 1E5QA 3B5IA 2ORWA 2ZG6A 1N2CB 1Z06A 3PNKA 2ZTUA 4OHVA 4TS1A 5BW6B 1RPZA 3INGA 4NPAA 4PHTA 1R74A 1XTJA 3D4IA 1WZEA 1DRUA 5T8KC 4ALNA 3WFIA 1GG9A 5L6MB 4DPMA 3DEJA 2Z1NA 3QOXA 3V6MA 1ZRNA 2P9HA 4V3CA 4EHBA 3BE8A 1P7PA 5C8YF 1G291 1J2YA 1J7KA 3CF2A 4F1KA 4C76A 4IGEA 1DRJA 4KTTE 1QCYA 3NCHA 2C8LA 2QAGC 3HNPA 4GF5A 5E3IA 2BOVA 3LFHA 3Q15C 3OX1A 5FFNA 4C0XA 1W5BA 3AV3A 3B6ZA 2GSWA 3DUFB 2RB4A 1FZQA 1ZJZA 1NW8A 1Q7TA 4UC0A 3STVA 3VTAA 4F06A 3KPJA 2CVFA 4B3SB 3P9SA 2IJGX 4J8PA 1G60A 3PC4A 3BXOA 1I1QB 2JGAA 2LW7A 1Z37A 4AZTA 1SOAA 2VSNA 2MCFA 1PJQA 5E3JA 5GP1A 1GHTA 3ZE6A 3ZWVA 4FB5A 1N78A 2PRYA 2XTMA 5G4LA 3CLTD 5IT0A 1FSPA 2BFBA 3F7TA 3LO8A 4JJIA 5LR6A 1LLDA 5FBZA 2EFHB 3I30X 4XWTA 5J59A 1RCTE 5EIBC 3M6IA 4N7MA 2I8CA 1I7PA 3KYDA 3MT8A 4K2AA 4TMWA 1JT2A 1ZUWA 1X2EA 1YJAA 3G5TA 3QP9A 4WZ6A 5ALWA 2FN3A 3FKSA 2HA5A 2HXSA 2Z1DA 3V7NA 5FWYA 2GKOA 3V46A 4V0MA 4AX8A 2BEJA 2W2XA 1ZINA 5IBRA 1FS4A 1YZLA 4MCJA 4N5MA 4AY4A 1F2TA 2C5EA 5CYFA 1RKVA 3WLEA 2ZB7A 2RDMA 5JSHA 4I2NA 2EV9A 3ADOA 4CQJA 4B7CA 1Z5ZA 3QPUA 4Q19A 4ABYA 4W7IA 5B7PA 3JAWA 4CF4A 1LPMA 4UD6A 2C4HA 3L4KA 1BQEA 1XNGA 4GP9A 1E5LA 4BVEA 3LCRA 4C0LA 1NW3A 2JIPA 4UEOA 4R3NA 3ZWCA 2Y27A 2QSJA 3FCEA 5BN4A 5LQKA 3BFPA 2VWHA 2YBDA 3G6WA 1XI2A 5JD3A 3LNCA 4ZTZB 1VGVA 3O26A 4H6XA 3H3XA 5FAXA 2AHRA 5FPQA 2ODQA 3H9QA 4R40A 3JV7A 2FUEA 2M9MA 4FJ0A 4R1NA 1PFQA 3RHFA 3FMOB 4TL7A 5KZMB 1OKKD 1N8NA 4YP6A 4GI1A 3W3AA 2F4NA 2WG1A 1JKMA 4NMLA 3U7EB 4CODB 1MVOA 1XJ5A 2CNOA 1YKFA 2Y93A 3PXCX 4JB0A 4LX8A 1WKCA 4OXRA 1E58A 5DOVA 4N12A 3N7TA 5E1BA 1C8VB 3VU3A 5AO9A 3R7SA 4G0PA 1UBHS 2NTVA 1RJFA 3PGMA 4QM6A 1XVUA 3PR1A 1KJ8A 3PC8C 5FLYA 3E5NA 3ITDA 4I5EA 3LDHA 4OM8A 4OUDB 1J21A 1R50A 3B1WA 3FYSA 4I66A 4ZYXA 1VZ2A 3AKDA 1XV5A 4NTZA 2R96A 5AXDA 2J4FA 4R5HA 2JJ1A 4YAEA 4MP3A 4Q37A 3LC7O 2BGRA 1RC8A 2BHLA 5JBNA 3QU7A 1KU6A 2OY0A 3AEUB 3SVTA 1XRJA 2JCYA 5TT0A 3KTAB 2QJRA 3EN0A 3KQOA 3ZS9A 3PICA 4B8YA 2B9VA 1D6SA 1QHGA 3BHJA 4EUKA 5EIEA 5K0JA 1G42A 2F1OA 2O5CA 1E2QA 2B7LA 2H00A 4NZYA 4ZDWA 1JHAA 1C4XA 3PFWO 3P27A 1ZFNA 5HCIA 1E5XA 4BFUA 2OMEA 2VAWA 2UYYA 2Y0BA 2CHGA 3QMPA 5JXHA 1E96A 1Q3TA 1XUOA 1YMVA 2VH2A 3MRTA 2RONA 3D8UA 1WQ3A 4BO8A 1CZKA 1T3ZA 2KM1A 3CW8X 4IXDA 1BVYF 3SOZA 1N9ZA 2XSZA 3I5UA 1NIJA 2C96A 2Z98A 4DDWA 4URZR 2VZ9A 2XTZA 5E6SB 1WM1A 2ODEA 4FI3F 1NQ5A 3VC3A 5IZCA 4K26A 4LDQA 1I9GA 1EGAA 1VJGA 5IYZF 2Z5GA 1Y3IA 4YAGA 1VZ3A 2QLJA 5F1KA 3QUQA 1AXEA 3BK2A 4JKYA 4UUMA 1GCOA 5EZSA 5FTJA 1HK7A 4HN9A 3ZHYA 5LBUA 4KPYA 2PSEA 2O9JA 4TZ6A 2YL2A 4MQUA 4MDYA 2BKUA 2YJ5A 4N01A 4V2IA 3TTSA 1GQFA 1UC9A 3PEUA 1YJCA 5DULA 3IP6A 3L7YA 1E2UA 1NF2A 3WA6A 1DZ3A 1WXDA 2QTGA 2DQKA 5CVDA 1T6YA 1ZN2A 1EBBA 1WDWB 1I7LA 4UPVA 2KLBA 3TINA 3CNBA 2JGIA 2KMLA 1JVBA 1PG5A 2WSYB 1HNNA 3IVRA 1KBZA 3AEKA 3H11B 2F3PA 3I6QA 1GL3A 3L02A 3P19A 1U28A 3H3JA 1DO8A 1EFCA 3U3RA 4F2GA 2Q6TA 2RG7A 2PUEA 3AERA 5DT9A 3S8MA 3SHVA 5IVKA 4DY6A 2RKOA 4ETNA 3PQFA 1XZGA 2G1KA 1AKTA 4KWHA 3BJEA 4BDTA 4EF4A 2A0YA 3AEQB 2JIBA 4N6OA 1OH8A 2Y1LA 3IKJA 2F43A 4Y7CA 1BKDR 2MSNA 1PJLA 3T41A 1R6UA 1ZGAA 1ZU5A 1KAGA 3EC1A 1R37A 2HWYA 1RLTA 4JWTA 1W8DA 3ONVA 3RVMA 1NZJA 2XWSA 3HWRA 1C7QA 2QP3A 3JR7A 3WS7A 5AM1A 2WTEA 1JHOA 3OZDA 4LXIA 4LZNA 2JC3A 3U80A 4F04A 5BRJA 5C37A 3M1YA 3PU6A 3F6CA 4DIUA 1KRXA 1R4ZA 3H0CA 2HW8A 1ZXXA 1K97A 1AZSC 3NAGA 3KSBC 2IBSA 3HA7A 1HL7A 3CLKA 3KO8A 4BV3A 4DT1A 1K66A 1FVXA 3UWKA 2B36A 3AXSA 3A2LA 1BGXT 4J91A 4JT2A 4X90A 4Y2XA 2BFEA 1KYZA 3K15A 4ZO7A 4BWFB 4TYQA 2X7HA 4BQSA 4GBED 1Q14A 3FOEC 1GPWB 2IU4A 4CE6A 2OCIA 4Y2UA 2WKSA 3OPYB 3S7TA 1OAAA 3TECE 1WLYA 4H1VA 3O82A 1W48A 3UHJA 2HRCA 3K09A 3UICA 1GNLA 3JQRA 4QOIA 4OX9Y 1RWKA 1JIVA 2DWQA 2IZOA 4MVJA 2ZREA 2IPXA 4TN1A 4ENSA 4KQKA 2PZEA 4WKGA 1EIWA 1VPEA 3AVXA 3R5HA 2XCRB 5CU7A 3DYBA 3LBHA 2BTEA 2Q6VA 3DB2A 1LDMA 2IPMA 4GYYA 2WC1A 3NTRA 3DKRA 2PKQO 4Q05A 5H3LA 1M2NA 4ALKA 2JKZA 3JQAA 2K7FA 3NHSA 3L4BA 4HT3B 3IIEA 3V4PB 3A26A 2CLDX 4RL6A 2MSLA 2NZYA 4KGVA 3HS3A 4J7XA 4O8ZA 3O4FA 4W6QA 3LIPA 4AO6A 4ENRA 2VTBA 3C87A 2MINA 2PQ6A 3NV7A 1XJ0A 4JYCA 1R27A 2RHBA 3M6LA 1MABA 2CWWA 2PWZA 1CR0A 1NFQA 2FP4B 4TROA 4ZGGA 3AINA 4BMZA 2REXB 3FXAA 3QWIA 5CT9A 1OGIA 3D6NB 4DLUA 3WGMA 4EZBA 4QULA 2JHCA 1FDSA 3BAFA 5F5LA 5LYYA 4J2TA 5L40A 4B79A 3E8SA 1JAYA 2ZWIA 3W9UA 1ZR2A 1IC6A 3VI4B 2HXYA 3HHPA 1EFVB 2FR0A 4HNAB 1R3UA 2HA3A 2C7GA 3GCZA 5CJ2A 3GJYA 2CFSA 2E85A 5ANRB 2P3QA 1L5MA 3OY2A 4ZVUA 3GD7A 1IBKB 4DLLA 4K9MA 3PGXA 4B5LA 4TZKA 2NU7B 2GZDA 1PZMA 4X1YB 2CLFB 3HU2A 3VKFA 1C7FA 2Z9CA 3DBVO 3DLPX 4G8DA 3ROKA 4NZMA 5TQVA 1C1XB 4CGYA 4ZOBA 5KYKA 2WZBA 2DBYA 2RI1A 4CBVA 1SVKA 2H85A 3RYCB 4Y2SA 1VI2A 1W1UA 1VIDA 2XUJA 2OPHA 3KK0A 5HMLA 3VO2A 4D8XA 2PPLA 3LVFO 3O2NA 2DETA 4NK4A 2G9RA 2ZYHA 4GOMD 5HA5A 1U5AA 4PLGA 4NMMA 3VPHA 2D2IA 1XZAA 5DLYA 2WIBA 3A7DA 1O96B 3R23A 4Q93A 4XWGA 3QE3A 5DHRA 4RS3A 4BS9A 1M6VA 1JHDA 4FLMA 4I1RA 3T15A 2IX9A 5BMVA 5CGQB 5E0KB 3EQ8A 5HKOA 1XRPA 2BD0A 2HTEA 4JC5A 3K0KA 1BW9B 3L6EA 2CJXA 1A2OA 4RMGA 3LK7A 2BBTA 1CUHA 2J4DA 2YIVX 4TMZA 4D4JA 2F1RA 4X95A 5JBQA 5ITWA 2POCA 4OREX 5E1DA 3A05A 3QPCA 1T29A 4CKBA 3O9VA 1NJFA 3BMCB 1M2WA 1RFGE 3EASA 3K1AB 4OB6A 5JNRA 5JSKA 4CTMA 1UC4B 2X8BA 5FUVA 3E53A 1ZOIA 4U39A 3BHNA 1FYXA 3HFGA 2IW3A 3R6WA 1JFTA 4FSXA 1K5DA 1RQNA 2ZIXB 3CN9A 4P58A 2QD3A 1PZHA 3JVVA 3LE8A 1NLZA 2B8WA 1I10A 3OM1A 2AE1A 4LNAA 4YDHB 4WK2B 1TTQB 3Q98A 1JSRA 5I3CA 1JMVA 2D1FA 1JECA 3HK2A 2IUEA 3IEKA 4IL5A 3S27A 3ZHBA 1E3JA 4UTZA 5D5QA 1CZLA 1DAOA 2YRFA 3NM6B 1L7AA 3Q2OA 4YP5A 2KSQA 5DI3B 5E7QA 5DBHX 1USVA 5CEJA 3AUFA 2QUIA 1A7AA 2GWRA 1NRXA 5COQA 5CXQA 4JDPA 1EX1A 4WVLA 2D1QA 1T9DA 2VJAA 1U9ZA 3CTMA 3WGOA 4OXKA 5I7UA 4TL8A 1FLAA 5TQ0B 3AR8A 4MPRA 5K3AA 2QN8A 1GGKA 3BRWD 5IAGA 1NN5A 4H7JA 2P3OA 3QTBA 2VAXA 4N18A 1G5PA 3QMVA 4ZCPA 1T8PA 2M6KA 3CZMA 4AMVA 3KLBA 1WMBA 4YWJA 1ZNZA 3KJIA 2F1IA 3MQ2A 4QEZA 5DCWA 3IUSA 1LQTA 4LVOA 3FROA 3IQZA 3UBMA 1H4SA 4XWAA 5SYAA 3KT3A 1NW7A 1EWYA 3GNLA 1LBQA 4LJSA 2X15A 4P22A 1GUAA 1CY8A 3HO8A 3DH0A 1VL6A 2PFSA 3QXCA 4TVSA 4AY6A 4ZMBA 4JA0A 3GPIA 4BUCA 3IEMA 1NC1A 3LT1A 4EJSA 4Q0MA 1NSTA 1MC5A 4G89A 1VJ0A 2DP4E 1DCMA 4EFNA 2LTAA 2YVQA 2MSCB 4L5IA 5LU9A 1JG4A 1K75A 1CUXA 5CPBA 5CB0A 1P19A 4OU5A 1AXGA 2FPRA 1TRKA 3M83A 3RJ9A 1I2CA 1I6WA 1VYUA 1L5HA 3UFBA 2VA9A 4XGNA 4BQRA 4ZVMA 3QELA 3NXSA 4XM2A 4ZXPA 1EZ4A 2Z1MA 4PLHA 4L72A 1Z4MA 4LFCB 2IIBA 4CHGA 3MJ4A 1XVVA 1FDRA 4GLFA 2BMFA 4ARAA 3I0MA 4P81A 3IP5A 1NQOA 1PD1A 4FDVA 1Z62A 3T5TA 2NZJA 3K6JA 2WAOA 1E69A 2B3TA 4KN5A 1GRCA 2EGHA 1B4DA 1U0EA 3EXFA 1E6CA 4GGMX 4HBGA 4YFVA 2GEBA 3IIKA 2R44A 1P2SA 1L7VC 2VBIA 1LBSA 2AI1A 5DIFA 5JCJA 2VBFA 2F90A 1MGPA 2DY0A 2SNIE 2UYGA 3BMOB 4OV6B 2NQ2C 3RVQA 3CVYA 1M5RA 2OV1A 1IAVA 3I58A 5DWQA 5K0EA 3RVOA 2REBA 1TMYA 1RJDA 1TZBA 3QX8A 2ZRFA 2C9DA 4B7XA 1JPNA 3DLBA 1DP4A 2Q1XA 3ANNA 3PPVA 4XE5A 4YC7A 1S8OA 1RP1A 2PUHA 3PI6A 1NBME 2AQHA 5HCNA 2J9FA 4AN1A 1QGZA 1T1IA 2VQ3A 2Q5LA 5FBHA 1NV8A 2JHFA 2PL3A 4TKZA 3U61B 2R6AA 1CB7A 4KCGA 1F3OA 4D2IA 4XTCS 3O8RA 2C7VA 1FDWA 1ZSYA 4J3FA 4I50B 4JSRA 5ICGA 1FTQA 4YV7A 1X1QA 2FSSA 1R4NB 2Z6UA 5EXDA 3SF0A 3ZN2A 4K6GA 2HHHB 3S81A 3OWOA 16PKA 2D0OB 3VNVA 1JHZA 3DDHA 4IEIA 3G0IA 2IEIA 3USES 4MUFA 1AS3A 3UPUA 2FQWA 3RFVA 3RC7A 3KU4A 5AW7A 4JYZA 4EB6B 1RRVA 2ZU6A 4M53A 5EZYA 4W7SA 3HEMA 4DCJA 3AYZB 4FDMA 4PC7A 5CB6A 5I45A 4ZODA 5IJ9B 5IN4A 1F2UB 4MR7A 2GCOB 3TR6A 3VR3A 3WK7A 3EULA 3LPLA 1MR3F 2NVWA 3AV0B 4LSZA 4B4UA 2VUIB 2ZDGA 4MYDA 4C3UA 2ADOA 2PEZA 4MZXA 2FHPA 4XJXA 2BUCA 4BQFA 1JW9B 5FT9A 4JB8A 1OFTA 1ZM4A 2QENA 3MGGA 2JCGA 4JC4A 4OL0A 3DM9B 3UV7A 3P9YA 4J75A 1LPOA 1TJPB 2JLUA 3ICQB 4HEA1 4PTLA 4GL4A 3QU9A 2ZYSA 4YCAA 5K3SA 1H8HD 4NJEA 1E1QD 3TQSA 3O1HB 1GOTA 1FYFA 4L0DA 3STWA 3TTXA 1OPRA 4W8HA 3DEKA 3PF9A 2IYAA 1AT1A 5EEHA 1PW5A 5FBRB 4JI0B 4YAIA 2RAVA 3L7KA 4K6OA 3D4PA 1GSHA 1P3JA 3WMGA 2H4FA 3CX8A 4V38A 4X84A 2GOYA 1T5DX 1UT6A 3S8EA 3RC2A 4AJLA 1E2JA 2YVKA 4BJ3A 3CPSA 1WQ1R 3NVMB 4DLXA 5KX5F 4LHYA 4MV7A 2QP9X 1D3AA 3HJTA 3OKCA 1LRJA 2ODWA 1YGYA 3OWXA 4QBHA 3T7RA 1NONA 5TY0A 3KV1A 1E9EA 2ZXFA 3G9UA 5DV9A 5JRJA 5KPJA 4OKIA 1THTA 3TUZC 1S8NA 4J7UA 1F51E 5FPHA 5F77A 4H6PA 2BTOA 4RKWA 1U7HA 2HL6A 1ONBA 1U8XX 1PU2A 4Q4HB 1O0CA 5F9HA 1H6AA 3HL4A 4ZRMA 1WBBA 2GERA 1UAGA 3N2GB 3OTWA 2WKQA 2BJHA 1VM6A 3D31A 4P31A 4R7TA 2C94A 2H4XA 4MKGA 4EEZA 2AFIB 4WD3A 2BSXA 4WGFA 4WVFA 1HT3A 4CV1A 1DAKA 5DEIA 5E2BA 2UYOA 3IV6A 4MKFA 4LJRA 1KSJA 4B5KA 4DIMA 4NOMA 3AM4A 4UHBA 1YBAA 1A8UA 2YXPX 4MULA 3G1UA 4TKMA 1H94A 1JSXA 3UAOA 1MX9A 3WNDA 4CL2A 3OJLA 4PFKA 4XIGS 4NFLA 1DWOA 2ET6A 2FPIA 3DE4X 2HT1A 2VHXA 1C30A 1I0LA 2CFIA 1D07A 5ISMA 4WKNA 3UQZA 4TTJA 5TARA 3L01A 2BFMA 4TV8F 1VJTA 4OMFG 1YS1X 4RWZA 5T4HA 3CPEA 2FZVA 1KJJA 1ES9A 3UF0A 2O8CB 1J39A 4KTVE 4KSCA 3UMMA 3O0DA 2OCGA 1II0A 1ZH2A 3K0EA 1QVRA 3CRNA 2WF5A 1SULA 2NXNA 2J32A 2Q49A 4PN7A 4HAVA 5FEUA 3ECSA 4CKZA 1LK5A 1XXHB 2PKWA 1PS0A 4QXQA 5AI0A 5H9VA 4F7DA 5H4GA 1HR0B 1YIAA 3UZUA 1X6VA 3ZZNA 3F73A 1OTHA 1P5HA 3VHRA 2C84A 3GJ0A 4NXNB 5H4HA 3KAJA 2XUFA 2XH8A 4WV3A 2HD4A 1Z6ZA 3UB4A 2JKYA 2IYTA 5INTA 1IULA 1KS2A 1RLMA 3RFTA 3ZH9B 4BB5A 4TLEA 1H2FA 3E23A 3TOCA 4FD2A 4NU6A 1PRYA 1ORHA 2C1XA 1HOTA 4LY6A 3NRJA 4X91A 4F2PA 4DUYB 1TZCA 1ODFA 1TM4E 4IH4A 4MWDA 1G8MA 4WDRA 5C8DA 3KSUA 4NU0A 3DKPA 4JX9A 1PQPA 3O21A 3ADKA 3O4VA 3C6KA 5F2OA 3QXGA 1KVSA 1NY6A 2BUAA 4DW8A 1BGVA 1YSCA 2AOTB 2IOYA 3INRA 2ENUA 2BGIA 1JU9A 2HF2A 4L3OA 4BVAA 1TF5A 2GJAA 3JVEA 3KPUA 3N75A 1UBJS 2ACKA 5E6RB 4DKJA 4H3SA 1U7UA 4F38A 1UJ5A 4AKHA 1EFUA 5EG5A 2BHSA 1TKAA 1Z4LA 2REQB 3SLKA 4A2WA 4EA8A 4Y2PA 1V43A 2GX6A 1XAIA 4HGNA 5DK6A 4TXHA 3W34A 1A5BB 2ECQA 4BO2A 3HUUA 5B58C 4W5NA 3JASA 1R18A 4C7JA 4A16A 2AEMA 1ZM2A 3D64A 3EBLA 3P5BA 2I91A 1RHQA 8MHTA 3EZNA 2IS2A 3WK8A 2AG6A 3GV0A 1UKEA 2RGEA 2XCQA 4PLYA 4TL9A 1D5WA 2IHYA 1JTFA 2CVZA 3RIXA 2DQ4A 3J81k 3AF3A 1AGYA 4ASUA 1Q5PA 3WNVA 3CT4A 4ZQEA 5LXTB 4OXNA 3BTUA 3QLVA 4TKVA 1PJBA 2VJKA 3M49A 2XCSB 3EIHA 5C18A 2A9JA 5P21A 1A9ZA 1O5TA 5BUZA 2VR1A 4J3JA 1LTQA 3GT3A 3T34A 1KDTA 3FETA 4CFSA 4Y0VA 4Q3KA 5CH8A 5ITZA 4GE3A 2ZUFA 3ZHXA 5EJ8A 4M60A 4UE6A 5ALVA 4AJ9A 4TTQA 4BKOA 1W47A 3W7AA 2PUTA 3RHTA 4UTVA 3KOMA 3DE3X 3Q9LA 3A2NA 1J5EB 4P7KA 1S4MA 4FMCB 3MT0A 4UHHA 2L0XA 3WRWA 4L5BA 3EZLA 1AUXA 2P4UA 4RHYA 1KJIA 4BO6A 1EBUA 4ISBA 1Z45A 5BW8A 2GEVA 4EW1A 3I42A 1RHMA 3HMKA 5ERGB 4B3FX 1A2QA 1DC6A 3HY3A 4BGUA 2JFVA 2NIPA 2J9ZB 3VNBA 2OUKA 5AJHA 1NOIA 1YJXA 1ZU4A 1AGRA 1C80A 2FSFA 3KQVA 4HEJA 4BMSA 2J3JA 3N3AC 1MB3A 1CW2B 4D3ZA 3VDNB 2AG5A 4YY3B 3LHDA 4YH1A 2GBPA 5D7NA 2QPTA 5JWOA 2GJKA 3ZE2B 4OQYA 1HYEA 4KE7A 3WWDA 2YYAA 5EIBD 2D1SA 4DR5B 2EGGA 1QV7A 1CJBA 1Y6RA 4CLOA 4BXOA 2H9IA 4B2PA 4EIWA 1XU9A 3RRNA 1T9GS 4AT1A 5AUPB 2BFWA 3CLUC 2J3KA 1LSJA 1XZLA 1UWKA 1W4ZA 2V8BA 1Y81A 3HSSA 4NCNA 3V2UA 3PJDA 1HPLA 2ZBPA 2RKWA 4XIJA 3X1MA 1KDZA 4ARBA 2CJWA 2J0UB 3E81A 2IQ5A 4IHJA 4R0NA 3EOBI 4RU1A 4XARA 2CHEA 3WLNA 3TZ6A 4JEHA 5B6PA 4M4SA 4YDQA 1U2ZA 4R8SA 1R4AA 4EUEA 3FAKA 2WTBA 4WK6A 5KMGA 1M73E 4A9AA 2NZ2A 2R84A 4UNNA 5EP2A 3GLHE 2XVXA 1DVRA 1Z16A 3FUVA 3TIFA 2OV4A 1G59A 1FTGA 1RWVA 4ZAVA 4Y9SA 1QYIA 4OHOA 3UPDA 4EQ6A 1RYZA 3T1TA 5CIYA 3IBYA 1GPUA 4NFSA 3IDZA 5CLJA 3NLLA 4GKJB 4K9NA 3AR7A 3CWCA 4N6NA 1SWVA 2VWGA 2FMUA 3B51X 2DHEA 3Q8MA 3ILXA 2IXTA 3R7WB 2FR1A 3VZDA 1T13A 5JVDB 1GADO 2GZMA 2XQKA 3L7OA 4TYNA 4D4HA 3L4JA 1DKNA 1QUEA 1RC0A 1Y4SA 1V1RB 4XB2A 3ZBQA 4UBMA 4JLDA 4EMBA 1C9NA 1ESMA 5JJBA 2YWGA 3AFHA 1DJNA 3EQ6A 1FFEA 3SEAA 3NDPA 4F7WA 2C61A 4AKEA 1U0GA 3I8SA 2VEDA 2NZVG 2C2WA 4HXYA 4QEDA 1J4AA 3JXEA 5A03A 4DV0B 5KWJA 1A77A 1EK5A 4DDVA 2QPAA 3CZAA 3EC2A 4LRXA 2GXSA 2CBXA 5ED0A 3HSYA 3X3HA 2ZIGA 3TD9A 2J0QA 4OPMA 1K89A 2MR5A 1IHPA 1CKEA 1D1QA 3D0OA 2VT7A 3LIIA 5ER6A 1E8MA 1YVUA 5C8XA 1SEVA 5D3QA 5AW1A 4N48A 4JS0A 3OLVA 4MI1A 2EHJA 3MTGA 4RPIA 4QA9A 1OB2A 1YR1A 1T4BA 4EHHA 2C2XA 4HQRA 4GPBA 3OQPA 1NLMA 2PL9A 2YWXA 2VNJA 1SQFA 5CA1B 2A84A 2XVYA 3CB2A 3DP7A 1RJ9B 4AF7A 4DV6B 3EVGA 3SKXA 1S9DA 2Q5CA 4WNAB 4B80A 1CCWA 5EE9A 3F8SA 3VR2A 3ZWAA 4WZAE 4F3YA 2PQ2A 3GROA 4AYTA 3HRKA 1W35A 4G86A 2QG6A 1KYYA 1LX6A 3CM0A 2X1VA 4YFYA 5JS1A 4L95C 1X80A 1UZAA 2C00A 2R1TA 3HDYA 3LVQE 3RLFA 2YCLA 2AB0A 4RPGA 5JNVA 1U2DC 2WF7A 4PPYA 3VH2A 3RG8A 2BDTA 4D4MA 2J9GA 4EO9A 3PXXA 4FFBA 2GXUA 3FF1A 3Q9SA 3AIMA 4GSYA 4IOJA 1U9IC 5GGXA 1KU0A 1EUCB 3F8TA 3O84A 1SA0A 3THRA 4P92A 1G4HA 4EH1A 2CXPA 3CF0A 3KXPA 3FA2A 2ZUBA 2WYIA 3S99A 2H1FA 2OLEA 1PTJC 4RWEA 4G5GA 2DFPA 2W2QA 3N53A 2CV0A 2VYCA 3AVWA 2ATXA 4QHTA 1UZLA 3CPHA 1VYHA 4XX0B 5HQTA 3ZV7A 3GN1A 2FJUA 3KCNA 3KLOA 3V9AA 5DYWA 2AC4A 5EGSA 2GCPA 1ZJJA 3AJ8A 3L40A 4R6WA 1D6JA 4U2DA 5EXEA 5F33A 2QBYA 3QVMA 1YE8A 3R7WA 1AS0A 2WHXA 2GEUA 2QD2A 1DC5A 4O2BA 3ZIAD 2DJ5A 5JSYA 3HR4A 4NY1A 4IINA 3U4HA 4CF5A 1CZOA 3PNSA 2E4YA 3G89A 4TKUB 2P6OA 1A9PA 4HDSB 5B53A 1G38A 1TI7A 3AF2A 2WR8A 4PLZA 1DJLA 1FTNA 4WWHA 3FPEA 1FNSA 1JHPA 5BMVB 1AUPA 5BUSA 5DM4A 4IILA 4L7QA 5FPKA 1NW6A 4Q01A 5AVZA 3PVCA 3KSRA 4EHAA 4EG8A 2GHTA 3ZXIA 2COUA 3AQ4A 5THXA 4GECA 1L7DA 4POAA 2TECE 4GWKA 5K8UA 4P0PB 2P90A 1SKUA 1XK6A 4F84A 1A69A 2AJBA 1IRXA 3UMRA 3IAHA 2AOXA 3S40A 3DNMA 1K4MA 3E35A 5DLEA 4BO3A 1EP2B 1PQYA 1QXSA 5LMUB 5DYYA 3AP3A 3QPVA 4PHFA 3GA7A 4MVJM 4RULA 1YZNA 1M1XB 2GAJA 4TRNA 3LAWA 3W6OA 1AA6A 4CQLA 2YZMA 1QG6A 4JMLA 3LKVA 3SG0A 3CSSA 3K9QO 1L1QA 2NOAA 4JR1A 4V0KA 5BN1A 2I6FA 2NMVA 4KRYA 2VQEB 3B36A 4TGLA 4K0RA 1E5DA 1TU4A 1UWVA 2ETVA 5AW0A 1HDZA 3I3SR 2WYOA 1TAQA 2P27A 2OV2A 1J8YF 1QH0A 3EUAA 2R00A 5HJ7A 4AZWA 3EQ9A 3IAUA 1OBHA 4NEHB 2Q2NA 2Y1KA 3F2VA 3NX4A 1QE5A 1P0QA 5A1JA 4RABA 1NE7A 2JFFA 3DR5A 1NWHA 1IRIA 4N54A 5IN5A 1SVSA 5H70A 3H1EA 3A1TA 3HVKA 2D0PB 3EGDA 4D57A 1U2QA 2WI8A 3TW0A 5JH7F 2FXVA 2IIPA 4B09A 2VTDA 3QVJA 4FJ1A 3S55A 3RABA 4ACBA 1L5QA 1U7ZA 3U19A 5BW4A 4WCFC 1KF0A 2ZE7A 4GZ6A 3TSWA 4O63O 3IV7A 5DYGA 1XSEA 4JXZA 5COBA 4HDNB 2D59A 1JBQA 8ABPA 2VJLA 7REQB 2XAUA 2ZI7A 1MJGA 5HJ2A 3KAPA 1ZA2A 2XVMA 4FFPA 1EDZA 1L8QA 2O2XA 4BX2A 4NMWA 3Q2KA 3WIUA 1B0AA 2GK7A 3BJMA 4E5KA 3RDPA 4QZVA 5I4IA 3CKMA 1NTOA 3WL5A 2J9YB 4DQ0A 4RA9A 10MHA 1TUBB 4BLOA 2QD4A 1K7EB 2C59A 4F3KA 3HQ4O 1W5SA 3B6MA 3KL2A 1U63A 2NXWA 6Q21A 2BCJQ 2D1RA 3T4EA 3NBXX 4KXLA 3IHTA 4M8IA 4AS3A 1W73A 1O3YA 3O94A 3Q3GE 4LIPD 3SMQA 2RGUA 1MCZA 3GJXC 1IM5A 4GXQA 5ENDA 2RIRA 4YLYA 1R0ZA 3PDIB 1VJDA 2FU5C 2JVJA 3GG2A 2FJ0A 3L8EA 4YO8A 3VHXA 1DC4A 5EOVA 1L7NA 2LKCA 3UJ6A 1VHQA 3TQCA 3S1LA 3VMMA 3PEFA 3LUCA 3ETHA 4EKDA 5EAIA 4RV4A 4S35A 1X7YB 3BSFA 3GUUA 2VA8A 2X40A 3RKUA 4UDXX 1XU7A 2JEOA 4FFRA 4IDBA 1FTSA 2OHXA 1C81A 4R2XA 4H1WA 5BT8A 2EJUA 1GZ5A 2DTEA 3U4GA 1Q0HA 3TM4A 1JIJA 2X13A 4ALLA 1H5UA 4E4YA 3AHDA 3FLMA 1NDUA 3GVHA 2CEKA 4UHCA 3GJ3A 5DZSA 2X9GA 5KNBD 4OFBA 2DC1A 4GX2A 1TMOA 4PTZA 3U56A 1PKEA 2NZ8A 421PA 4DTCA 4FOPA 1AX9A 1T9GR 4FHCA 3RVJA 4DS3A 2W5UA 1B1AA 3IUJA 4ROTA 5FTMA 4BZZA 4BFWA 3QVUA 4B45A 2B69A 2DGDA 2P41A 3KUUA 1XL0A 3C6BA 3QI7A 4JKOA 3TE7A 3ZWWA 5I7EA 1A3CA 4UUBA 1PD0A 3SBDA 5C5DA 3MTEA 4F93B 3AWIA 4OYLA 1CY0A 5B4TA 1QPGA 1EIZA 4HUTA 4BDSA 5FTNA 1HL3A 1QMGA 3BQ9A 3TAXA 5HW0A 3G5MA 4DR2B 4URUR 4MRRA 4WNIA 1T2EA 1AGXA 1KVTA 2A1UB 1J00A 4V1CA 2QV7A 2R5NA 2FQ1A 3EY4A 3LGAA 1L4YA 3P97A 5GOZA 3TZKA 3KLMX 4NS4A 1ZNWA 1IQRA 1GYQA 1AZTA 1RLJA 1BXGB 2Y0CA 3M6AA 4J49A 4RKEA 1CS0B 3U48A 3ZE0B 1OCEA 5LJLA 2B0JA 3GDFA 3F6RA 1LA2A 4B4OA 1OXXK 5AJVB 1OI7A 3TQOA 2XUAA 1VB5A 1V5GA 2OBMA 3OPYI 1Q1GA 1MOPA 4G0MA 1LNQA 2WAYA 1UMBA 4KQFA 5DGTA 2R4UA 4BMCA 5HWSA 3TLJA 1GUZA 3D6UA 2IHTA 2CYCA 1LLQA 2X3FA 1YJ5A 1NFRA 4WOCA 5JD6A 1S3SA 3L8HA 1ZY2A 2WHEA 3AONB 1BWSA 2Q3FA 3KHKA 5CHYA 1EFHA 2O1XA 3V4FA 1TT5A 2IEYA 3QENA 5K3DA 2DPMA 3QEJA 4W63A 2FK7A 4INPA 2Q3JA 1SG0A 2XOEA 2Q9CA 3LBNA 1TQ8A 4NCAA 1KS9A 2B82A 3JALB 2PJDA 5DB4A 4MLZA 2H4ZA 1Y9ZA 4D0GA 3M9XA 2OFWA 2ZVJA 4HZGA 4MRMB 4QGFA 1QR6A 4C6RA 3CLUD 5IULC 4CRWB 1D0SA 1ISIA 4H1TA 4IDPA 2YXLA 1QO0A 3P96A 4FWIB 4HWSA 4DSUA 3HYTA 5BW5A 1F0YA 1LW7A 4GR4A 1UKYA 2W2PA 3OG9A 2O8FA 5AKXA 4OMCA 3OD5A 5HZHA 1FYVA 3RRZA 1SRRA 3KOXA 2CY0A 2AMJA 2PZAA 5KYXB 5CFMA 4K2HA 2J5XA 3O74A 3E5HA 1B8OA 1K6XA 4IUBS 4U02A 4U3JB 2Q4TA 3UWOA 4ZN6A 1NF8A 5B7NA 3ZGXA 3O8OB 1HLFA 5HIIA 4LRTB 1T10A 4DJ5X 2ZS9A 4QU5A 4QXPA 1YFZA 4TWRA 4KVAA 2ZXUA 3FPBA 1XTVA 2X0KA 4US2R 1QX3A 3PHLA 1YDEA 4FDUA 5CXXA 5HX7A 4IQFA 4IXTA 2Y2UA 1DEAA 1J70A 3U4QB 4PSUA 1C1DB 3MOGA 3R24A 3LVBA 4CMEA 3NQ41 5ADUS 5JPCA 1H6CA 2J0EA 3MF4A 2EC5A 4IVPA 4B2YA 2PBFA 4BV8A 1CDEA 2XWPA 3OHSX 1VL8A 4DCVA 1MHTA 1VE7A 4A27A 1Z5UA 4G0XA 4PBSA 4D80A 3ICPA 2ORYA 4UZEA 4GM4A 5FJJA 2XUKA 3R5JA 2PWYA 3ETDA 5JCOA 3MAAC 1Z47A 3QQPA 2CWDA 4GGPA 5B4UA 2H1SA 4TWJA 4CLRA 2YWFA 2HU8A 3IILA 1ZJ6A 3A3NA 4XKJA 5JDCC 3TBFA 2A88A 4C88A 4CTKA 2FPGA 2D8MA 3ZQUA 2QN3A 4DLWA 1OX6A 3LH5A 2FRDC 3GC6A 3KLNA 3N2GA 2P5TB 3AFNA 4PEVA 3ZDQA 4CEJA 3BEOA 3EZXA 3SC6A 3NB0A 4XSGA 3HLKA 4PLPA 5MN6A 1R2QA 1HURA 4RVUA 3L7IA 1BH2A 4RD0A 2PK3A 3N28A 4R2JA 1BMFA 4S1PA 2QVGA 4PQEA 2CK3A 1TMGE 5TRTA 2YXBA 2BP7B 1SCNE 3I72A 4G67A 4RHFA 2ANBA 1H8EA 1I51A 2QP4A 2CDRA 2O8DA 4FFMA 1XX6A 4TKLA 5E7IA 2Z6QA 1D1TA 3V3TA 3EA4A 2QX4A 1L8AA 3E27A 3M2PA 5FP0A 3JY6A 4MKIA 5HK9A 3MB5A 2JLXA 5L53A 3DVRX 1YTUA 2PR7A 3H8SA 1DG9A 3UJ8A 2ONKA 2L18A 4Q4DA 4BGVA 1MABB 5A5EA 1K5GA 4XLTA 1D5CA 2IPLA 4ID3A 4ECEA 5B3LA 5JSFA 2P4EA 1SCBA 5CGZA 3ZPXA 3CCCA 3AETB 4KMRA 1LKZA 1Z38A 4A26A 5D87A 1OFUA 3E7XA 1A9RA 4AJOA 5KVVA 2GKGA 5FQOA 1W87A 2IOFK 2PU7A 4C7KA 3I9NA 3K9NA 3KP1A 3PV0A 5ADWA 1FFDA 2FJPA 3K7EA 3OTQA 2Z9DA 3TLZA 3GP3A 3LQKA 2CT8A 1SU7A 4YAOA 4EA9A 3FSGD 4NBKA 4LCEA 4E94A 1U80A 2F9LA 4D56A 4S1OA 3JQFA 2GN9A 1JEQA 3S2SA 1X7XB 3HNOA 4JAVC 4LCBA 2LZ0A 1ACLA 1WJGA 2NYAA 4P93A 4EB6A 4RVOA 4Z4EA 1QVWA 1YE3A 4IFIA 4GX5A 4DSNA 2UYHA 1WW2A 1CZRA 2HA7A 4KDEA 1OIWA 2WWVD 1D2GA 3NOOA 4YCMA 4KOAA 1M0TA 3KKQA 4Q1BA 5DBEX 1C5KA 4IMIB 3RYFA 4G8JA 5GV8A 1NQWA 1T35A 3O8BA 1ETUA 4ZD6A 3S3TA 5ES4B 1Q16A 5P8WA 4IDHA 3NFYA 5CFOA 2R8ZA 5AVOA 3AY0A 4AWXA 2OYCA 3K9LA 4BNLA 2YY5A 4Q9DA 5C80A 1S7GA 3FB1A 3TB6A 2JHPA 5C46F 4BNVA 3S1SA 4HLQB 3EXG2 1SXJC 2DY1A 3KSAC 1ZAKA 4HFMA 3U0VA 2FMIA 2QM8A 3IT2A 4G3XA 2Q29A 2H2WA 1PT7A 1I3LA 1XRNA 2G6BA 3IELA 3JD2A 3OZRA 4URYR 1AO0A 4G09A 1KJZA 1DXQA 2VNSA 5F4ZA 3TRFA 3CJQA 2JAWA 4J0JA 4IMPA 1T34A 5F9FA 3D3JA 2YJ3A 3KOYA 1IDN1 2G7ZA 3OOJA 1R0CA 1QP0A 1JKFA 2CSXA 4UBKA 4GBGA 3KR2A 3FMGA 2XYGA 3H4TA 3HXMA 3VKVA 3PGVA 3I2JA 2ZBUA 4QX6A 4D9IA 1RQLA 3A6PC 1DEXA 1CEXA 1H1LB 3NCTA 1W0JA 4LYAA 3R8CA 3DQPA 3RM3A 3DPUA 2EHDA 5BV0A 2CZGA 1OTXA 3G1WA 4IO0A 1E9VA 4YMUA 3T3HA 4HDAA 1PNQA 1TJNA 4UXHA 9ABPA 4CFYA 3FBGA 1P61B 2ODPA 2IVFA 7MDHA 1I2ZA 2FE1A 3GFBA 1BS9A 2VHUA 4W5TA 3OCYA 3PDHA 4HDRB 3FHTA 1JBEA 4RKQA 3TSOA 3WRVA 1TUGA 5K8IA 2YH2A 1A0OA 2B5VA 4XWKA 4IIXA 3AZQA 5GOTA 1OA1A 4H7IA 2HZ7A 5GMOA 3WIDA 3ROPA 1Z6TA 3H19A 2QNBA 3RREA 1AKNA 2EL9A 3FFAA 3RU7A 4GGOA 1TEHA 1Q21A 4OYHA 4UFNA 3PR2B 1JG1A 4XUGB 2HSWA 2VKTA 4FYYA 4H7HA 2JIZA 1OAOC 1FNMA 2I4TA 1B41A 1OBCA 2CYBA 1JTEA 2VWQA 4MW5A 3CVOA 4ZANA 1OROA 3NM4A 1MH9A 1TO2E 3NC4A 2A7QA 2X5XA 4RPJA 3BIWA 1XRMA 3PWKA 4P7FA 4X24A 5CJPA 1SU6A 5BQPA 4KITB 4AP6A 4MS4A 3BGOS 1WXXA 3LJKA 4M87A 1X9HA 1Z4NA 4W5OA 2GN0A 1KOFA 1CQIA 1Q12A 5LWHA 1UZMA 1RFLA 1A98A 4O6VA 1KE1A 4CLRB 1FX1A 5DNAA 5JDIA 3SXPA 3X1YA 3BE6A 2G06A 5DTIA 3SNKA 4YI3A 4G1FA 1EXDA 3H5OA 2AN4A 1NVGA 1QJ4A 2ZPAA 3MWYW 4KQ9A 3UWSA 2J33A 3G0BA 3MSCA 1I7NA 2PTGA 1QHYA 1YKGA 1FBNA 2C5SA 2ODNA 3FE2A 2XYQA 3LF2A 3QZUA 3HBFA 4IJ5A 4Q24A 3VC1A 3VR6D 1W2HA 3FYTA 4GKBA 3ZZ0A 1I5EA 5MFZA 5AHKA 4ZOLB 4ZRDA 5B3AA 3WOHA 2F3QA 7MHTA 1RT9A 4BLWA 2QVLA 3D8TA 2W00A 1PFUA 3WWPA 2BEWA 1K8RA 2QDKA 5DSZA 4DJTA 4NAVA 1BXGA 1MJFA 5EPOA 1M7GA 1KZ1A 3L8GA 5KSYA 4PLFA 1ONOA 2CLLB 4J0DA 3CH5A 4U9UA 3AEZA 1P3DA 3RASA 1LPPA 4NU8X 3CUTA 4PRZA 3WLOA 5LYJF 2JI8A 2I2AA 2PS0A 3LOPA 2ABWA 3RRJA 3TAHA 4OSPA 4BVBA 4OATA 3U1TA 3N0TA 1N2IA 5FEMA 2K4MA 2CXOA 4D26A 3PXGA 1KYXA 1QO0D 1G2PA 3G23A 1BD3A 3BN3A 3D81A 3FDIA 3IAM1 3NWBA 3CNOA 4PYQA 1ONNA 1CNMA 4NAHA 4OHWA 5AKYA 3D8SA 5B1YA 1XTRA 1VKJA 1VQ1A 3EH1A 3R09A 2ZBFA 3P4UA 4LGCA 2A4MA 5LC1A 4DCTA 3THXB 5EI5A 1AUQA 1QGUA 4LHXA 4BQOA 3RTCA 4IJMA 2VL7A 1SG6A 4GHWA 6GPBA 3CVVA 4F85A 3ZJTA 1EHCA 3CJTA 3QRWA 4QATA 1B16A 1T3LA 4FFSA 4Z9FA 1TYZA 4C4AA 3TMKA 3GHYA 1PZEA 3QPAA 2IXFA 1HX7A 2H3EA 2I7XA 1I24A 1R5OA 3L8MA 1X9IA 1XK7A 4W8OA 3RC3A 3LI2A 1NHWA 3OX4A 4PPFA 3NWPA 3DKKA 3W9SA 2R8BA 4HDQB 2Y4OA 3HN6A 4QGHA 1NURA 5EIAA 2VK2A 2F00A 5L45A 1E77A 2KBFA 3B60A 4F6RB 1KYIA 3FJOA 3QKWA 3H2YA 3B3FA 1UBEA 3V4LA 3RI3A 2HRZA 4MTLA 3RRMA 1Z3IX 3Q6MA 1GM5A 5K3FA 3S2FA 3E9YA 3R0XA 4HLUA 4K8RB 3M1LA 5L7YA 4I9FA 3OIDA 4LJAA 5IHXA 1UBTS 2C5GA 5K8CA 2XUZA 1ZCBA 4DANA 1DAGA 2ZPUA 1TF2A 2L69A 2JVIA 3BTOA 3GVXA 4FJ2A 4LMAA 2XNJA 2ZVPX 3E9ZA 5AK0A 2B35A 2GCGA 1L7BA 2AMYA 3TQTA 4Q1FA 5FBWB 3UMBA 5EHQA 4QM7A 1KRWA 1SQ0A 3NUGA 5EFOA 3HXQA 2BFBB 2FCAA 1Z26A 4G0OA 4JJ7A 5JBIA 2W70A 4I8XA 1Y80A 2ZQZA 4HNRA 3QBDA 5A3RA 5HRAA 2AD5A 1G5TA 3SHTA 5J43A 1GA4A 1UJ4A 1Z83A 2HI0A 3R3XA 1OWLA 4RA9B 5BQXA 4RFVA 2OWEA 3FCYA 4MR9A 3LZCA 4JZYA 3PTZA 5LIRA 1KHTA 4BO5A 5HTKA 4CL3A 1QNLA 2WT8A 4HDRA 2VJBA 1GQSA 1KBQA 2Q0SA 1ZK4A 4RVDA 1NXTA 3B70A 3HU3A 4RKRA 5EESA 5DWVA 2ZYRA 4EPTA 2VI5A 4F45A 4JQOA 4MV5A 1UT5A 4E14A 1GQYA 2GTPA 3F9RA 2HY7A 3URMA 5KJCA 1WZCA 1HG0A 1XRSB 3MLBA 4JFAA 3RVPA 3VH3A 9ATCA 4XUEA 5HP4A 2W4IA 4N3NA 5JPIA 2QLTA 2FSHA 2J85A 4MRVA 1TYDE 1T2UA 2P77A 3D3WA 1KWKA 1DDIA 4UXJA 3HR7A 3VYRB 4C2UA 1UDWA 5GAJA 2QRNA 1D2AA 2X42A 2G80A 2J41A 1WEHA 1DLJA 1Z8NA 4MUGA 3O38A 3TGPA 4R1OA 4B6EA 3FTDA 4PE5B 5JATA 3AYXB 3B6IA 3CEHA 4Y6LA 5KAPA 4B35A 2V6MA 2AUNA 4IJQA 4Y0AA 3SWWA 2WMOB 2FXIA 3A28A 5D2CA 4EMUA 1NP3A 2ZUUA 5IAEA 4F6RA 4OQNA 2NV0A 4H7KA 3JVUA 3DTVA 1OXVA 4L5AA 4KL8S 4O4HF 3SY8A 2HPZA 1IFXA 2PL1A 5LLDA 4EECA 1UJ6A 4D0SA 4PFJA 4CCSA 3IRUA 5IVPA 1SQ6A 2JLVA 3BGDA 5CNIA 5FL7A 3S1AB 2H57A 4OU4A 4EPXA 2FZ5A 2EKBA 5TPWA 3LX4A 4LXXA 1IN6A 3QTLA 1N1DA 2VF8A 4LZPA 4G65A 4OQMA 4B73A 5LPNA 4P08A 1A8HA 5H82A 4YRNA 1KAMA 2P9FA 4FC6A 4IRMA 1TK9A 3FNGA 4WESB 3DBRA 4RSMA 3IUNA 3SMVA 3B3JA 3OFKA 3VOAA 4F9FA 3HV2A 2DFLA 4D97A 2ZBQA 4XGKA 5AI5A 2B6HA 5IDWA 1M1YA 1FFYA 1USUA 1NBMA 1Z4QA 3OQVA 4KO2S 4AP9A 4I46A 1RYHA 1BOOA 4RTJA 3DO5A 4MS3A 4TXLA 1DTSA 1VHDA 4QYXA 2XE8A 2BE9A 3PA6A 1P62B 2I03A 2PLWA 3M4XA 3EC7A 4H3HB 3R7BA 1GZUA 1KY2A 3C3AA 4X00A 4YMWA 5EE5B 4ETIA 3D2LA 4ZT5A 2DLDA 3FNFA 3OOEA 3ROMA 3ZWNA 2NNWB 4EPVA 1J0AA 3JQCA 5IVIA 4EKYA 2QMZA 5LOVF 4LY9A 3RNOA 1Q7EA 4K9LA 4RKYA 2XHZA 2UVQA 5LQMA 4PGGA 2IY9A 4KPEC 4WLNA 3HGTA 4W6ZA 5KYTA 5ILOA 2ZP1A 5THKA 4ZHSA 4KVFA 3PUKA 1MAHA 3DMFA 1KOJA 5DM2A 3L05A 3WFZA 2NTYC 4PIVA 5LDGA 4DCUA 3V34A 2DCMA 3UVEA 1LVGA 4JC0A 3UUGA 1MX3A 3ZE8A 4ZCTA 4NDAA 5LP6A 5A3SA 4NX2A 3ZGVA 2YC4C 2YNMA 1F4LA 5ITZB 5HGXA 4YV1A 3T7IA 3O4GA 5JV5A 5AKZA 1LZLA 2GFIA 4FLEA 4L2IA 2O2YA 3FNEA 5DHAA 2WE7A 4LDNA 1FVHA 3B1VA 2IXAA 1HEUA 1KAHA 1MAAA 3WWOA 3NBUA 1EWKA 1W4LA 2ZRLA 3IEVA 5IAKA 1HUQA 2O2GA 2W2NA 2AQIA 2X86A 1UQTA 5DT2A 4DIKA 3MIIA 4X71A 2V0CA 1GSOA 3I3OA 4H15A 3LG2A 1V7CA 4D9CA 4X1KB 2FLVA 4Q18A 1K0UA 1RR6A 3OZVA 3V8NA 1QP4A 2J7PA 3C3YA 4TS9A 4IOMA 1R6DA 3H2KA 5IXSA 3N86A 1F3LA 2H7XA 4JVSB 2QN6A 3UIEA 3GBSA 1E61A 3QU2A 4E46A 4NQRA 1MJGM 3BG5A 3HPRA 1SU4A 4Y98A 4J2HA 1FYDA 3HCAA 3PHHA 4KW7A 4WRRA 4LHEA 4IIYA 1NT4A 4C08A 5CB4F 1MBZA 2BMEA 3D0KA 3CURA 4RBNA 3BPSA 2ZVDA 4TTRA 2D2FA 4TYPA 4ZZIA 5BVHB 3LA8A 2HCJB 2XDWA 2AN3A 1YT5A 5CLLA 1KP2A 3M5DA 4DLVA 4JD5A 3OTOB 2IV2X 4LZJA 1PJAA 1WXIA 1PYDA 4PG6A 2N46A 1VDZA 1LBHA 1WW8A 4LE1A 2VQDA 4CKXA 3K35A 1RMYA 1TD9A 3NGXA 3SFVA 1R6VA 3K2BA 3P9XA 2GLUA 4JP3A 4RL4A 5CAEB 3EZ6A 1CZHA 1PT9A 2HSEA 3LW7A 4JU9A 4M6WA 2BKLA 2HQSA 1ICEA 1D03A 3CFYA 3UXEA 3REQA 1V35A 2EX1A 4UNPA 5HYVA 2I7VA 3MERA 1XNRB 2R7NA 2EF0A 3P4YA 5C9ZA 3H86A 2Q8NA 1Z6XA 1JIIA 1ZS9A 2P0YA 2BEUB 5K0LA 3SR0A 4QGGA 3T7KA 2PT9A 3MCAA 2G72A 3RD5A 3VPFA 3BUSA 3LA6A 3AW9A 3QOYA 2NPIA 4RJJA 1BX3A 4K40A 4QUAA 1EK6A 1FUEA 4DABA 1NM5A 4M22A 1OXKB 1ZYUA 4LMBA 4TT3A 5EZ6B 1MEOA 2PH5A 3AOEA 5DW3A 1NA5A 1MC8A 4D5GA 4LOHA 5IW8A 2I7TA 3UY4A 1MNQA 2FEWB 1SXQA 5BSTA 4QJ3A 3DFUA 4I4TB 1JLSA 3ER9A 1NDQA 2EFJA 2YQZA 3A9WA 4EAAA 1JPJA 1DOHA 1KO5A 3LLUA 5JANA 3TQFA 2SECE 1YRHA 3G13A 1XMOB 4RK6A 3AP2A 1P0MA 1SC3A 2C2OA 1DAHA 3GHHA 3KWLA 5EJ7A 3GN2A 5L8VA 1W94A 3B2EA 4AKSA 4ARSA 1AMUA 4MEJA 1T6XA 4K46A 2ZB3A 2KB0A 4INAA 2P75A 3FPCA 3ER6A 3D6VA 2CNBA 1DX6A 3FFWA 4M9CA 4NH4A 1AN0A 4M0FA 5KYGA 3FKJA 1H05A 2F2TA 2Z09A 4MUJA 4NMXB 1ZA1A 4XQCA 3MA0A 4BN5A 1W9MA 3I8OA 1RCFA 1PLKA 3PTAA 3U4MA 1DLIA 4IBOA 4C14A 4BO0A 1X7WA 2ZJBA 2P0EA 4KFUA 1GRQA 4ZYTA 4OLAA 3PNVA 2C98A 3RS3A 4C7MA 5CNMA 5D1NA 2W43A 4UAUA 2QX8A 1CUZA 1EM6A 2ODBA 1J2UA 3QEAZ 2W6MA 2R1VA 1X87A 4MWGA 2Q1UA 2QRKA 4LZWA 3V4ZA 2H1LA 1W4BA 1G20E 1OXBB 3OQ6A 2QI9F 1OX4B 4YBZA 5BV2P 3D8BA 2C8KA 5DX8A 3ZWMA 1XZQA 4G1MB 3T5PA 1H42A 1KL7A 4MW0A 1NPTO 2R8OA 2OQIA 1FVOA 1SBCA 1ZQ1A 4XZ3A 1B23P 1CUWA 2W8ZA 2FPPB 2X6QA 4WCVA 1XNQB 2J48A 1K08A 4F4CA 2ZSKA 1WDMA 3M6WA 1REQA 1XDWA 2X0NA 4NSNA 1WUYA 1F06A 2P2DA 2NADA 3T7CA 3DMPA 4MVJP 4MKHA 2CUZA 4QBTA 4AO7A 4AXBA 3QWFA 5D00A 5IPFA 3MQFA 1JYEA 4KXUA 8ATCA 1UBRS 4R05A 3ZKWA 3DEIA 3IMFA 2CHQA 1PGNA 3WO1A 4N5DA 3IKLA 4MQFB 4F86A 1L5YA 3NDRA 4DILA 3PQEA 4WECA 1I2DA 1S0UA 4R8MA 4TKVB 3VPSA 3V4SA 5FOVA 3L7MA 4TQUS 4Y1RA 5D6NA 5A4MS 3KE8A 4WX2B 3F3YA 3DMTC 5DHTA 2LD4A 4FFWA 1LSOA 3LVRE 3SJ7A 2DHRA 3FNBA 3NU1A 1IPEA 1WX1A 1IPFA 1ORVA 2GMWA 3FJ1A 3UJPA 2OUIA 2CL0X 3QVOA 1V3VA 4YALA 5HKAA 3EVFA 5JSZB 2VPYA 1F2UA 4MR7B 5BNFA 5LLTA 5IJ9A 3CE9A 3SVZA 2O48X 3VHXB 2ZJ3A 3DF9A 2AV6A 5B2ZA 1AS2A 4NECA 3VZBA 1UP7A 1A7JA 3EAFA 2XZOA 2B5OA 1H0HA 2BFNA 2C1ZA 4WK0B 1NBWB 4OBXA 4JFRA 5I4CA 5FWXB 1QIMA 5DSXA 3O8DA 1VRCA 2IXGA 2ZRJA 3LBYA 2XTJA 3HFSA 4P82A 4AQYB 1E1NA 2PD4A 4AXXA 1ZK3A 3A9RA 1PK8A 4OQDA 4PLVA 5FBLB 2CGEA 3ZCRA 4X65B 2HJHA 4ZHQF 1LWNA 4JX8A 4ZDJA 1UM9B 4MRPA 4Y6OA 3PE3A 1NVMB 2J3LA 4KRGA 2IHNA 3RANA 2OXIA 2BFDA 2HV9A 3KQKA 3QUTA 3OF3A 3RVRA 4YRBA 3CR7A 1RXCA 1EUZA 1M1UA 1UWCA 4HRXA 2AUMA 1AQUA 3DCNA 3L2OB 3R8XA 2GEDA 3HKBB 2Q7DA 3R7FA 4ZOQI 2ZBEA 1YL7A 3LDGA 3SC2A 4J0HA 4JROA 4MR8B 5ALHA 3VAYA 6LDHA 5KQGA 4UU8A 1I14A 1U1EA 1HM5A 1XLTC 1AQIA 4X93A 5LL6P 3GMTA 1G6OA 4QKQA 4M37A 3C97A 4MUXA 3M3HA 1QTNA 3MILA 1SIBE 2W48A 4JL5A 2X5JO 3AFOA 4JBLA 1E3IA 2JATA 4HBZA 1P6XA 2YWCA 1P4AA 5BWBA 1HWYA 2HEIA 4BO4A 2GNAA 1G5HA 3WWEA 2QM7A 3BFJA 2VSXA 2I1QA 4FI3C 5BSWA 1OLSA 4RYDA 4KBYA 5DMXA 5EY5B 4UARA 3NVKI 2NAPA 2A5YB 3CZQA 2OXCA 1M8FA 3H5LA 3N8KA 2NSJA 3FFBA 4GLBA 4LW8A 5DXAA 2Q0XA 1IY8A 5JYEA 2WAMA 3AOGA 2O2EA 3GDWA 4ZU6X 4CUJA 1FSGA 2EBUA 3CY6A 1HH4A 3A2KA 3MEQA 4KXWA 2EWWA 4OKNA 5DU2A 4HDCA 3SS7X 4EP1A 3PZRA 3K3PA 4OQZA 4DJDC 2PEYA 3H04A 2AN5A 4YGXB 3LPCA 4FFDA 2FZWA 3RRXA 3SYMA 3H1FA 4FW8A 1JDBC 2YMPA 4C5AA 1VCOA 4KDFA 4G97A 4CIAA 1DPFA 1R12A 2DSTA 4M1EA 2XGGA 3PJEA 2Y71A 4COOA 1WSWA 4DLRA 4GZ3A 3ZBUA 5I51A 2Q2QA 2A59A 3AGPA 2QLLA 4IVRA 3ELUA 3AF0A 1V8BA 4MK4A 2OBFA 4TWZA 5EYPA 3NONA 4BLSA 4EG6A 3BFKA 4AM8A 2P9CA 5CM9C 5JZ9A 1IU9A 2G1PA 2ZRBA 2PANA 2EEPA 4IYRA 2POQX 2HEGA 3QXSA 1CHNA 1YHNA 3TLGB 1IBSA 2M6RA 2PUFA 3ZJYA 4R4JA 1AV7A 2O3RA 3O03A 4R1TA 2VSQA 1O4VA 4ENTA 1HLPA 2QT0A 3I6MA 4M0DA 1TADA 1DJMA 4M7OA 1JLLA 3SIWA 4WUVA 5KI6A 3WJAA 4N76A 4OH7A 1WPRA 5L3VA 3H8WA 4DA7A 2C82A 4DCGA 4L75A 2B2XA 4NBSA 3W90A 5JJCA 4RVFA 1KI7A 5CURA 2Q4RA 2XRZA 2PSFA 1QPZA 1BCRB 2RGBA 3EQ2A 4PQGA 1SBNE 1HV8A 4TSRA 3C43A 5AM4A 2O6HA 4Y9DA 2XA9A 3W5JA 3Q3JB 5LZ9A 1G21E 1B3RA 5BYKA 1KOLA 3IB6A 3WG9A 2IS4A 3MWLA 2JZNA 2VVTA 3ZJ5A 4B7ZA 1I5RA 2JLQA 1YQ9A 1CB0A 1YR7A 2HQBA 3WNCA 1M2VA 3K73O 2GQ0A 2QQFA 3JAMA 5IMSA 1KAOA 1BCSB 1MO6A 1EWRA 3DM5A 3DV2A 2FKNA 3O4IA 3OPQA 1OA0A 4IV8A 5ES3A 4B6PA 3IEUA 3KUKA 4IY1A 5BSMA 5BXYA 2I71A 3EMKA 5CT5A 2R97A 4CEHA 1XGKA 3FVWA 3TRIA 5TGTA 4W5QA 1QMPA 3M6XA 4MIKA 3CEJA 4U7GA 4OFWA 3B7WA 1AXRA 4WESA 1QFSA 2IODA 2XNCA 4IWXA 1I1NA 4G1VA 3CKLA 2X4IA 3MJHA 4RVHA 3A70A 4C43A 2YX1A 3UB2A 3IR7A 1YJBA 3L0YA 3O9MA 1XYYA 1EPUA 2RI0A 2ZR8A 3LHKA 5F3DA 3L7AA 3ADCA 5CDSA 3SDBA 3ZLTA 3HV0A 1N1EA 1O89A 2HADA 4OBEA 2ESRA 4PR0A 2Q3LA 3ESZA 3LD9A 3IT1A 3CONA 1KWGA 3REFA 3WGHA 2H2IA 2W2LA 1J8QA 2RB5A 2VF4X 4EITA 1G7RA 3H18A 3CH4B 5ALOA 3KKNA 2WWTA 3ZVNA 4E5NA 2C8VA 1U1GA 2NW6A 1M0EA 3CRVA 2J5QA 1HMPA 1VA4A 3N2KB 3WL6A 4F6LA 2O8BB 1MO5A 3LXXA 1GDTA 2NPFA 4GZMA 4YP0A 2ZETA 3ACBA 3FYUA 3ESQA 4GPAA 4JI6B 3RF6A 1NI4A 1QORA 3VUFA 2BFAA 2WTMA 3LYUA 4M0CA 1RYNA 4RDHA 1B6GA 1TVMA 2J46A 4UTPA 1T4DA 3NHFA 3RTAA 1ANKA 4YCCA 1CK4A 2C42A 4JHXA 4K1LA 4MPPA 4URFA 3SYLA 3KS9A 3UHFA 4OHRA 5TC4A 4GYJA 1P6UA 1EINA 4FYVA 4YPFA 1A7UA 5EKDA 1WV0A 1V3UA 1P2VA 2P9YA 4EY6A 3Q7PA 2G5GX 2FMHA 5ITSA 2DEUA 1VOTA 2PD6A 2QSZA 3DSRA 4MNTA 2I22A 4HHEA 5ECWA 4PYKA 2ECFA 3EEIA 1C9MA 4MJ7A 4BX8A 4MRNA 4LTMA 1ORRA 2QN1A 1K8YB 5BSUA 1NQTA 1U0OC 4CN8A 2C5HA 3COPA 3OZXA 3V3KA 2HV8A 4XQEA 1XPJA 1Z2DA 1KK0A 2P1RA 1C3LA 2WAXA 1F20A 3NHKA 1TTHA 1B8UA 4H0FA 3SR4A 1IB0A 1FP4B 3OA2A 5FNVF 3WHPA 5ESDA 2GTIA 2IXBA 3DVQX 4NEGA 2BN4A 1O97C 1XTKA 3MD9A 5DNEA 2LCQA 3PWZA 2Q4DA 1GGMA 3MT7A 1UFVA 3Q9UA 4LYGA 5FPPA 1W4CA 1UDRA 1T36A 4IRXA 4FDLA 1M8KA 2PVPA 1Y7TA 2E0IA 1C9KA 2YOHA 4LOIA 4QHSA 5TS3A 1U04A 3Q7RA 2JI9A 3M9WA 3NW9A 3RG2A 1KFCB 1YA8A 2BELA 2H59A 5DGHA 4FOLA 4Z2YA 2JCBA 5IABA 3WYDA 1R5BA 1WE2A 3FIUA 3ZD8A 4B3DA 5JD4A 3GJZA 1E3WA 3MHPA 4G01B 2JFZA 3T4UA 3U13A 1DT3A 1YQWA 3A32A 3SZGA 1TZJA 1VIMA 4F72A 1FBTA 3TW6A 4BUJA 1G8KA 1UMDA 3U40A 1Y1LA 3ZU2A 1L4EA 3EBPA 3NR2A 3R0VA 3BL5A 2DUNA 3AG5A 1GDDA 2QYHA 2ZR0A 1P74A 3HJNA 1QR2A 5C1IA 4AC9A 1XQ9A 3KSZO 5B5SA 5CM2Z 4ZT2A 4P4SA 3VYVA 2B34A 3PXDA 4DCSA 2RK6A 1G4AE 3BCSA 2ZYTX 5KTKA 2ACEA 2VRBA 2WUVA 4RLSA 4C0BA 3A8TA 4YV2A 2C88A 4AMBA 1QAMA 5JD5A 2BLLA 5LZ5A 4C0QC 3ADPA 4K6CA 2O7RA 1O54A 1U9CA 3ZHUA 1NRIA 5KWVA 2HBRA 3AB7A 3ZK8A 4BMXA 2EERA 4ZCMA 3KQWA 3I1IA 2FPXA 2OOSA 3AEKB 3DZKA 1TZMA 3IMGA 4I1IA 4P54A 3SNHA 4RZQA 4CKEB 4Z4HA 5CIQA 2W42A 2WM2A 4O2RA 1DAMA 2XYHA 3RRYA 1C1HA 3WGYA 3RS5A 1EVYA 4ATNA 4LNUB 1EDDA 4NZNA 4MJLA 1V1JA 1KBOA 2P35A 5ALLA 3D6FA 3TTUA 4AB1A 4B6OA 4YMVA 4J0KA 5EJ5A 1HYQA 4K9RA 4AZ0A 1J8DA 3FNIA 3ANXA 1YB1A 1OZ0A 4PYJA 5C1PA 3TW4A 3IOBA 3KG2A 2VT2A 4EY7A 2Q8QA 1OFIA 1LGYA 1KYVA 3I9OA 1V8ZA 2PPVA 1XN4A 1A9QA 2HQRA 5JTTA 4Q12A 1HSOA 2JFGA 5ADHA 1EJ6A 2HRDA 2EKZA 5LBTA 4WNAA 1TAUA 2XE7A 1E5TA 2FDRA 2QR2A 4PIMA 3FSEA 1Y3DE 2AKAB 4HPXB 4AULA 4BLQA 3N0WA 1WP9A 3TQHA 5JXJA 3ACDA 3GELA 3IULA 3UK6A 2C5AA 2YDYA 3G0GA 4MRSA 1AY0A 1FP2A 1DCFA 1P5JA 1T1GA 4IH9A 1GPH1 5FUYA 3RYHA 2YS6A 5F2KA 3TLMA 2WYWA 4HB4A 5C8VA 1UBUS 2CLSA 4Q39A 4XPIA 2QSUA 3C24A 2XITA 1W49A 4CMHA 2NU9A 1R0BA 1CY7A 1KJWA 3QYAA 4RK4A 2PGOA 1ZHHA 4A36A 3MCUA 1BQ4A 1II9A 5AJYA 3P52A 4DF3A 4H16A 4JVNA 4UUNA 4DLZA 3EDCA 1DFHA 5I5GA 4F91B 2WU4A 3DHVA 3H16A 1AMNA 4LHVA 4UPDA 1GILA 3GEPA 2JAOA 4P35A 5CH5A 3KTAA 3FHLA 1J1IA 1TYBE 1SBTA 3MM4A 4GI7A 3GUVA 5FIUA 3CN7A 1EFDN 4WY2A 4G9EA 3HB7A 3AHFA 1J0CA 4PQFA 5E9AA 1O97D 2PT6A 1QQ7A 3A6ZA 2BFCA 1A71A 1SCUB 2QY6A 1JHXA 3MSXA 3MMPA 3OC6A 1OHHA 2ACWA 1SCJA 4DDKA 4MGKR 1DBRA 1ZCFA 1SCAA 3T4PA 1QRUA 3K53A 3NIWA 4O4LA 2CCKA 1ITZA 2MSDB 1TK3A 2CMGA 4ECAA 1YDWA 3V1MA 2RHJA 2ZK7A 1UMCA 3IHLA 2O1WA 3JCZA 2QS9A 5AM0A 1DTWA 3E1SA 1SIOA 3GOQA 2CVQA 4YTEA 1R8YA 4YCBA 2C2MA 4H7FA 1R0XA 4LVCA 2A9FA 1KR2A 2AC7A 2CFOA 4NJEB 4CIYA 2Q3HA 5J40A 1YBVA 4V0QA 3C1TA 5BSFA 4Y7DA 1D2CA 1NL3A 3ZDZB 3RK1A 3YASA 1RXYA 2H4JA 4NR0A 4WLUA 4EFDA 3Q8WA 1VSVA 2QXUA 5T4FA