3AHPA

Crystal structure of stable protein, cuta1, from a psychrotrophic bacterium shewanella sp. sib1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
106
structure length
106
Chain Sequence
KPEQLLIFTTCPDADIACRIATALVEAKLAACVQIGQAVESIYQWDNNICQSHEVPMQIKCMTTDYPAIEQLVITMHPYEVPEFIATPIIGGFGPYLQWIKDNSPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of stable protein CutA1 from psychrotrophic bacterium Shewanella sp. SIB1
pubmed doi rcsb
source organism Shewanella
molecule tags Electron transport
molecule keywords CutA1
total genus 20
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ahpA00
2VD3A 1OSCA 4OZNA 4Y65A 4NYOA 4ZK7M 5D4PA 4CO2A 1V9OA 1V3SA 3AA9A 3O5TB 5DRKA 1PILA 2DCLA 2XULA 4USHA 2O66A 2ZFHA 4IYQA 4YB7A 2GNKA 4RWXA 4D3HA 4USJC 1NH8A 5D4NA 2V5HG 1XK8A 4WK3A 2J9DA 4RWWA 3GSDA 1NH7A 5D4OA 4E98A 1UL3A 3T9ZA 4AFFA 4Y6IA 2NUUG 3BZQA 3DFEA 3MHYA 4RLEA 2GX8A 2JJ4D 4CO3A 4USIA 3NCPA 2PIIA 1QY7A 4CO1A 2XZWA 3N5BA 2NS1B 2RD5C 4D3GA 3M05A 3CE8A 2O67A 3TA2A 4C3LA 2CZ4A 4RX6A 1UMJA 3HLUA 3LF0A 1Q1KA 3AH6A 1O5JA 4CNYA 4CO0A 5L9NA 2GW8A 2NUHA 3NCQA 4CO5A 2E66A 1NAQA 4R25A 2Z0GA 3O8WA 1V3RA 3L7PA 1J2VA 3AA8A 2J9DE 2ZOMA 4CO4A 1P1LA 4WK1A 2XG8A 2J9CA 4C3KA 3OPKA 4C3MA 3X3UA 1NZAA 1O51A 1VFJA 1UKUA 4OZJA 4YB6A 1VHFA 5D4LA 4YB5A 1UFLA 3NCRA 2EG1A 2XBPA 1H3DA 3TA1A 4OZLA 2EG2A 1V6HA 5DS7A 1KR4A 1GNKA 3TA0A 1HWUA 4NYPA 3AHPA 4CNZA 2J9EA
chains in the Genus database with same CATH superfamily
4JI8F 3R6GB 4MIBA 4P75A 5KT3A 4AE5A 1B4SA 4KQZA 5L1LA 1X4BA 2E1PA 3OVSA 3SSQA 1NDCA 2MZRA 2RJZA 4LR8A 3PJXA 1UVJA 1REVB 1MWQA 2HEKA 4QR0A 4ENOA 2AQ4A 3TAMA 1NRKA 1X8DA 3HI9A 4A8XA 1YG0A 3MM6A 1RHKB 2KZMA 4YB7A 2K3KA 5KT6A 4NEZA 4NMLA 4JI8J 4D3HA 4CT8A 3HP6A 3EGWB 3QATA 4KSEB 2DVIA 1FO1A 3HHEA 5KT7A 2ZZNA 5GAHU 1MLAA 2IM2A 4GO5X 3CMAS 2CPYA 2D69A 2XI3A 3MFIA 4O3QA 3CO0P 2JX2A 2Z57B 4LFBJ 3P96A 3JB9k 2DGUA 5K14B 2GZOA 1U6BA 3HVTB 1LWXA 4U8YA 3GV8B 1HARA 1RTDA 4YOEA 4RW7B 1IKYB 3K0JA 3OL7A 1IM6A 4LSNB 1OSDA 1GMWD 3CDBA 2ZH1A 2BQRA 3K8VA 5KFYA 5B09A 4CH1A 1N33F 1JJ4A 2MY7A 1UJ6A 4TU8A 1RBLA 1WG5A 4DL2A 2HBRB 1UJ5A 3Q22A 4CIOA 2PGCA 1AW0A 1XNQJ 4LSLA 1LW0A 5K8PA 1YQHA 1FE4A 4RLEA 3THVA 1NCLA 2JJ4D 3TAMB 1TL1A 4NLDA 4USIA 4B9TA 2VBXA 2I38A 5FD1A 1REVA 1JLEB 2CPIA 2EFOA 3Q2SC 2FZCB 2F8HA 4KT0C 1S76D 3I32A 3N5BA 2XMAA 1HBUB 1VJWA 3HT3A 2O3DA 4PQAA 3TR5A 3J7Z5 2GAHC 2QYGA 2OMLA 2W7PA 1NPRA 2RS8A 2YKNA 4C0BA 4CLKA 2KFYA 1KTQA 1BWEA 1RTHA 2L48A 4QWDA 1E6YB 2IYIA 5A0YB 3LWLA 2J7UA 2ZH5A 1K8AT 1R43A 2LU1A 2HHUA 1RSCA 2H1YA 2MLZA 3NY0A 4ILRA 3AH6A 3SCLE 2GMJA 1EP4B 2YWWA 4PWDB 4M5DB 4HI2A 5GAGI 4X4VA 1JLGA 3W9JA 1VIXA 1JLQA 1MMLA 2W01A 2MJUA 2ZWPA 3OL6A 1JXLA 4ZCMA 2IJRA 3VAJA 3TQEA 4G1QA 3CJ3A 4K0KF 4EGLA 4URQU 4X4QA 2RQ4A 1XWLA 3CCVS 4DFKA 3D0IE 4AL5A 4CM0A 5L46A 3U02A 2MDAA 3M6UA 3ZZOA 3RAMA 4MH8A 4ETXA 2MKCA 2O5DA 1L3KA 2DTJA 3JSBA 2CJKA 4LF7J 2A10A 3O44A 4J5OA 4DHVA 3TZXA 3A12A 2GJ2A 2MLYA 3SEOA 2IMWP 4F4WA 1I3OB 5EWEA 4MK8A 2B4UA 1Z2LA 5I3PA 3T9NA 1K73T 3TVKA 2ZKTA 1HYSA 1YTYA 1N54B 3QGHA 2DGSA 4AT1B 3CCTA 3CD5A 3UQSA 1JJHA 4CLFA 5E5NA 2HG4A 4YB5A 4CDIA 2VKRA 3GE9A 2DISA 4DLGA 1N36F 2ABYA 3ETMA 1D8YA 1XNRJ 1VQYA 5HROA 1EHWA 1YZ7A 3FQLA 1T05A 5CD4A 2H54B 4OQJA 4AYBD 1N34J 3C16A 2GO9A 3H98A 1P27B 1RGVA 2RB7A 2DR6A 2CWXA 1KHWA 1U02A 2AZ3A 3P45B 3R3TA 2ZHBA 2UUTA 3OHBA 4EYIB 3MPVA 1NJWA 2DJWA 2KFNA 4ZPDA 4A8MP 2CNOB 4GKJJ 1C0TB 1RZMA 2LXIA 5KFMA 4HDGA 4IDKA 4J9LA 2VG6B 3FBBA 2YH0A 1OPZA 4JV0A 3GV7B 1N34F 3W61A 4M95A 3POTA 4NLPA 4O3SA 4Q8FA 2DHGA 5KFIA 4IRKA 2VQEF 2DT9A 1URRA 4ID5B 1F2HA 2J5AA 1Q8BA 3AD7C 4EWTA 1YJTA 1BQMA 3BR9A 2X3GA 3D9BA 4KV8B 1O0PA 3BBCA 1L3TA 2MKJA 3BQ2A 1VK8A 4B17A 2HNZB 1Y5LB 1FERA 2OP5A 2QL7B 5IT4A 2ZM6J 2KRRA 3UD5A 1KP6A 2ZH2A 3TUIC 4UQGA 2Z30B 2B5JB 2M70A 2IVFB 2D7SA 1YJ7A 4QCLA 5LMNJ 2CXEA 4UUXA 2EK6A 2R7TA 3NOCA 2DR9A 4OLOA 6FD1A 2Y9HA 2IBOA 1R0CB 1PYTA 1R0BG 2RT3A 1ZPVA 2Z2ZA 2ZBQA 1UVKA 3OTBA 5A8RB 2XSJB 3I5BA 4KKOA 3H8YA 5KG2A 2V4JB 3H40A 2LECA 4C8LA 1TZ0A 5D8HB 4U8VA 3IRXA 1HBMB 4PKDB 3Q0AA 4NCBA 2MQMA 2OO4A 1FNXH 2EKYA 2C3UA 3DI6A 4RNOA 4Y6IA 3TANA 1KWMA 4FN5A 3C46A 2HHSA 2GX8A 2GMHA 2LXUA 3G6ES 4CCHA 1C1BB 3D3CJ 1QY7A 2DGTA 4HKQA 3CJKA 1YVFA 1VC5A 5LMUJ 5F8LA 2FJVA 2ZJPQ 1PGZA 1XR7A 2B9YA 1CLFA 4RU2A 2ZH4A 4ZVEA 3UD4P 4DQIA 2FGCA 3DLHA 4IOBA 3UN5A 3R5CA 1FK9A 2BDPA 3CMES 1Q5VA 3D0HE 3FBFA 3UVJB 3NLCA 2HBQB 4ZCLA 2V9WA 1ZM4A 3QRRA 2DIUA 3CNQP 4DSJA 2ZBRA 3GIJA 2Q1LA 3D1HA 2AYBA 2F9DA 1NHKL 3U1MA 5L9NA 1KLMB 1X0PA 2RHQB 3ET6B 4PEOA 2PMZD 1KQSR 2CJXB 1QAIA 1NNDA 2KJWA 2BXJA 1P9QC 2Z2LA 4WFXA 5CAAA 3VAFA 2VU5A 2VC0A 3IXQA 2R7SA 1IR2A 5ETQA 3JQMA 2HBYB 1F1BB 2Y1RI 3RW6A 4BLGA 5H9FK 1GEHA 2CQDA 4DN9A 4M5KA 2LEBA 1VGYA 2WB4A 3D6TB 1UEUA 2FLOA 2E9RX 2IAJA 2C3OA 2Z56B 3L95X 5ETPA 5IQQA 1VQOS 4DR1J 5IT9U 5A6WA 1OO0B 4HVZA 1R0AA 3QAEA 2IBKA 2GIQA 2XG8A 1SJRA 2Z58B 4YDXA 1YSJA 1XJWB 5HBMA 4ZP7A 4FBTA 1VOMA 5T7LA 4PABA 1O51A 1MROB 1TVRA 2KFZA 5DLGA 1NSAA 2CQCA 4JI2F 1FVQA 2LMIA 1VFJA 2AD9A 2DNGA 5LXYA 4DWIA 2EI5A 4DCJB 3GU0A 1DTTB 5AJ3J 4A8SA 2BX6A 5KG6A 1DBDA 3D6MB 2QLBB 3FMBA 5F3TA 1HQEA 4N77A 1HA1A 2B9EA 1QSLA 3MGJA 3M2UB 2MZTA 2CZVC 2SXLA 3D6FB 4OZLA 3ZTQA 4ES1A 2QJ3A 1CEZA 2KHDA 2KO1A 1D3WA 1LWEA 3NGKA 2BM0A 2OAUA 3IWLA 4PXDA 1UAWA 4X66F 3PV8A 3P8BB 1S0MA 1R6VA 5D0EA 2G0CA 3LGHA 5L1KA 1KR4A 4ZVPB 3ZFVA 3ZXWA 4B9VA 2XWYA 4KAIA 4M5IA 3IBCB 2BJ1A 3HHLB 3W2VA 1J5OA 3FK4A 5A6PA 1VQ8S 3R5JB 5IV3A 5EWGA 1SQGA 1BQXA 2CQGA 3I82A 3TP2A 5HMZA 1SKRA 4Q8EA 4UZCA 1YHQS 2PE8A 1YJRA 3BYPA 4NX9A 1BE4A 2XC9A 1IR0A 3RB4A 3IM9A 1TL7A 2CPEA 4AL7A 4FF2A 3E01B 3GJTB 5B0BA 4L73A 4OYAA 2HFZA 2DY1A 1A7GE 3R7SB 4I4BA 2P2CB 3BN4A 4PXEA 3ZTRA 5KFOA 3RTVA 2HVIA 3EM1A 2YNGA 3GCWP 2E5HA 2V5HG 2L41A 5M2UA 2HYIB 2NYHA 2X1AA 3SYZA 4RR5A 1RWKB 3OUYB 3MDFA 2VJVA 5D3GB 1FE0A 2GMLA 3F0NA 2D3O1 3K2YA 3UWTA 1SC6A 3RBDA 5CYQA 1S57A 3RGIA 3AJDA 3MOZA 4OX6A 1Q81T 3OR1A 1FRXA 4WZQA 2E7XA 1WHWA 4JI6F 2AWZA 3HVRA 4NLVA 1IKVB 1RISA 4OJ3A 4ZVTB 4EMDA 1M90T 3MEEA 2YXLA 3KUHA 1UZHA 1X9MA 3FEXB 1NEEA 1NXIA 4DU8A 2IFXA 4DX6A 3J80Y 1SL0A 1RUSA 1RWMB 4C98A 1RTZA 2CJQA 2KU7A 3CDEA 2HW3A 1IKWA 4DS4A 4OYPA 4OYIA 2E9ZA 2VPXB 2GS8A 3CSKA 1F5AA 5LM7E 3KNGA 3O2IA 4TLQA 2FLPA 4I64A 1TKZB 3OJUA 3B78A 5KFVA 5GAGU 3G71S 3GSIA 4QR2A 2ZHAA 1FEEA 1Y00A 5BJRA 4DV6F 1I51B 1S1TA 1HNIB 1WKKA 2O67A 2RF2B 3W62A 5KFDA 4RNMA 4X4NA 2DNYA 4RZRA 3MEEB 4I6YA 4LF8F 2E7VA 3AT1B 1YJVA 4MFBB 3EICA 2WONA 1ICEB 2LEAA 3S01A 5KFKA 1WEYA 3VZHA 2CQ2A 1RBAA 4S0MA 3IRWP 3HK2A 2FZKB 2KB2A 1BY9A 4EZ9A 4O3PA 4WCEQ 3KLEB 4CO5A 1D1UA 4J91A 2ZITA 3OUYA 1RA6A 1I5OB 2LVWA 1JLFB 2VBYA 1R8CA 2XMWA 2Z2MA 3GG0A 3QIPB 4IFVA 1HBOA 2D74B 3M8ZA 4KGKA 2R7WA 2YNGB 2G0JA 3VGVA 3QYYA 1OY8A 4G1IA 4ECSA 4GKKF 3NL0A 4UQTA 5J1NA 2GAGC 3EVWA 4B3OB 4K4SA 2QL9B 4OJGA 2VF3A 3OPKA 4TKTA 5F0UA 4DV4F 1RT2B 2ATLA 4OYMA 3LAMA 1RWXB 1S1XB 9ATCB 2OFGX 5HMYA 5L1IA 1KKHA 4HT5A 1LWFB 1RAEB 3MR2A 2HS0A 1KTVA 3TVZA 5B7WA 1MMDA 1GMVA 3W60A 4QWCA 4B02A 2L08A 1U7LA 2B4OA 2BYCA 4KYZA 3Q23A 4CLPA 1N8RT 1M1HA 2B6AB 3QT8A 5BXIA 1HQUB 3A8IA 3MPDA 4XAKA 1N88A 2HVDA 5H9EJ 4LFAJ 3BKFA 1LWEB 4K5RA 3IG1A 1EARA 4RUHA 4OHXA 3IS9A 4ZP9A 3DRSB 1H2UX 1FDNA 3AHPA 4NPOA 2H4YB 7FD1A 5KG5A 1QJHA 2DRAA 1HQEB 1XIQA 2DRBA 4HTJA 4KGZB 1OSCA 3S7RA 3GB0A 2F63A 1QTMA 2JEIA 4ZK7M 4ED0A 1DTTA 2PMWA 5F8JA 3WZ0A 3BPDA 4WFBQ 1WF2A 5KG0A 4ECRA 2NPFA 1S72S 4H4OA 3DRRA 3P6YC 2IRYA 1G6BA 3E8OA 3H7HB 4U9RA 3BSAA 3I96A 4IH7A 4DSKA 3KLIB 5HBMB 2MQ8A 2V4QA 2XEXA 4IYQA 3KMSA 1VRQC 4Y00A 1B7YB 4RWXA 4N56A 3ENVA 1CPZA 4KR0B 3ILOA 2R2RA 2HAIA 4HI1A 4CLTA 3R7BB 1Y10A 4Y2MA 3DLGA 2BJEA 3M30A 4ZHRA 2VICA 1NK9A 5D4NA 5DG8A 5HI7A 4I67A 2CPFA 1TL4A 2I8EA 4BC9A 5LXRA 4F25A 2R7VA 3CJ0A 1NZ8A 4W92B 1PYOB 2XMMA 4QZVB 3UR3C 3DGVA 3PEJA 2UUWA 3MFHA 2XI2A 3QLHA 4L74A 5HSPA 4LFCJ 1VC6A 4J9QA 3V6DB 2MYFA 2DNNA 4PRFA 1SV5B 2FGOA 3ONQA 4DPYA 3UD3P 3D28A 2M7SA 4OX9J 1LKZA 2KYZA 3RU0A 3AJ2A 4LIRA 4O0NA 4UW2A 2K06A 1WSVA 3N79A 1RAOA 3KDNA 1ZOTA 3P5TL 4I2PB 3FMWA 2JDJA 4GC6A 3R27A 3UVJA 3EVOA 3HMJG 5J2QA 5CXTA 4DSLA 2BJ7A 4FKXA 4MK7A 4CT9A 3RBZA 5EDWA 4ECUA 5LL6d 3CCLS 1ZYQA 3Q8RB 3AAWB 2E5LF 2BJ8A 2KN4A 5I3QA 3W3SA 4XTTA 2IC3B 3H2LA 2F1FA 2FPHX 3FCVA 3G87A 2CPJA 1BHNA 1BQNA 4JI2J 2XZWA 2LA6A 5KFNA 1YLXA 3I87A 1SQEA 4FXWA 2EVZA 3QSIA 3MTJA 2QFIA 1SBRA 5J1EA 3OJSA 4LJMA 4UOGA 2JRSA 4O4GA 4F67A 2BEFA 5H1SV 4OX8A 5E41A 5GMKa 2V6AA 5F3ZA 1SC1B 1N5TA 3SQGA 2M9KA 3IRXB 2FUG9 1Q1KA 4IRDA 1Q0NA 3NP5A 2WSFC 3TI0A 4M8LA 1MW7A 4UF4A 5FDLB 4M5HA 1RAHB 5A8RA 1HR0F 2RUGA 4ANDA 5LSRA 2ZNZA 1TMJA 2BE2B 4B08A 1X31C 1JMTA 3FDSA 3KK1B 1ZZFA 3T5KA 1K9MT 3DXSX 2FD2A 4A8OA 1FRJA 4CZCA 1T02A 3SCJE 3CULA 4NLRA 2AJ2A 2DEIA 5L39A 1D0EA 5J2MA 4LRAA 3I55S 3D66A 4ICLB 1VRUB 4CLUA 3KLGB 1L5UA 2W9AA 5DM7Q 1U1KA 4JI7J 8ATCB 4KV8A 4ELVA 1F5CA 5I4MA 4C3KA 3MR5A 2UXDF 1S6OA 1J27A 3CCZA 4ID5A 2AKWB 4DBQA 4FS1A 2MZ1A 1IR1A 3G6VA 2R2TA 4CWBA 2QX0A 4G3IA 4DR6F 1W25A 1PAUB 3SBMA 2C2RA 3D0GE 2VA3A 1IUJA 4MYUA 3W66A 1KS2A 1S0OA 4JI6J 1XNRF 2UV8G 5G0RA 1FHTA 1EETA 1E6VA 1WACA 1N36J 1S1UB 1PC4A 4QU7A 1W2BR 2HFUA 1Z4UA 3AQOA 5E7OB 2MQOA 2UUAJ 4PYDA 1APSA 4OI2A 4M5JA 2VL1A 3NEKA 2YQ1A 1NM2A 3DXBA 4ZVHA 5IM0A 3K5MA 3T5JA 1QSYA 2OH2A 2V94A 1XERA 4HH0A 1KVJA 1WDTA 4F3OA 1OPIA 2FJBB 4CYUB 1LV5A 1FNMA 4BCAA 4IFYB 3TA0A 4NYPA 1S6QA 1WG4A 3CCWA 3ENQA 4NA3A 2V8DA 4RW4B 1QUVA 2AZ1A 4I2QA 1S9FA 4FNIA 3L7UA 2HLUA 2KHCA 1X9WA 1M5SA 5E3AA 2C42A 1OIAA 4B3MJ 3HHNB 2YNFA 5C2GA 1V3SA 1WKLA 5B0CA 4R8UB 3BSCA 4PG5A 2DCLA 2XULA 3F44A 2N82B 1HBNB 2CQIA 1EZZB 2LXFA 2O66A 1S1WB 2V68A 5ITHA 4QIEA 2VQEJ 1W7WA 4NLUA 1B0VA 1EKRA 1U09A 3CF5Q 1VQPS 1S49A 4OLPA 4OZ0A 1ACMB 1RTJA 1SJ1A 1JLBB 2E44A 1XMQJ 2DNZA 3PIPQ 2E5IA 2W7OA 1RB0A 4YP3A 1WORA 4KO0A 2ZD1A 2VC1A 2LQJA 1DTQA 2CVIA 2XTJP 1XMBA 4WK3A 3GFYA 2RQCA 1A0OB 2J0SD 2KI2A 2Y3YA 4W4MA 1JWWA 4C8OA 5JVGQ 2R7RA 4ZPWR 3QFHA 1S0VA 1DTQB 1JLGB 1X5SA 2I9SA 2J0XA 4YN3B 1HW9A 1RK8A 3U1LA 4PWDA 2FLNA 3N9UC 2J6UA 2YNHB 5B08A 1AUSL 3AQPA 1M0SA 4HHUA 3QRPA 3TJAA 1HWIA 1E6YA 2POKA 2XHWA 4K5SA 1S6PB 2XMTA 4Y3CA 4X2BA 3K5NA 4F8RA 1NK8A 2ASLA 3QGGA 4UOCA 4DR5F 2CDRB 2MZQA 3IC1A 4GMKA 5C7PA 4LF2A 2K7KA 1FFSB 1VCTA 3F41A 1TL1B 3CUNA 2EC2A 4WF9Q 2WVBA 2VB6A 4I2QB 2RDDA 3PXGa 5C2CA 5F8MA 2XHCA 1U0HB 4KFBB 5IT9Y 3A3OB 3LF0A 2AEJA 3QT6A 4Q2LA 9RUBA 4LF7F 3M4XA 1CC7A 2WB1D 5IM0B 3K5PA 2MTLA 3M6XA 3MD3A 1FTCA 1VQ4S 5ETNA 2PT0A 1IKYA 2V2QA 3NCQA 3HKWA 4CRJA 3PO5A 1M1KT 1RAIB 2X1BA 1RTDB 1S1UA 1WDDA 2UUCF 1QUPA 3TVYA 4FF1A 3V6JA 3PKMA 1MSWD 2QV6A 5G0RB 4M5GA 3UCZP 2A3JA 2HMIB 2RKIB 2W1BA 3HFVA 1M5VC 1V3RA 2YX7A 2ZDPA 4FPIA 3AB4B 2N7YA 4ZLPA 2UUBF 1T11A 2HQDA 1NO8A 2AX1A 3G2XA 2A2DA 5CYMA 2B9WA 3CC7S 4OI0A 3QJJA 3PG9A 4ZIWA 3S8SA 1Y7PA 3BR8A 4WIQA 3OL9A 1K0TA 3CJ2A 3CCQS 2DY9A 5HN0A 1TFYA 3EUNA 4FXVA 1EQMA 4DF8A 1RAGB 2B4PA 1X60A 2W9CB 4ICLA 1KNZA 4LQ9A 3R6LB 4GC7A 3C8YA 3EDRB 4ECVA 2HRUA 1FXLA 2CJBA 3UI3A 1TELA 2OSRA 5D4LA 3V6HA 3ZZ0A 3M8WA 1Y3KA 1XNQF 3SQOP 3VAGA 1Y11A 5KFEA 5F8GA 2NQPA 4JI3F 3GPAA 2YTCA 2ASJA 3W9IA 2E1AA 1TK5A 2R8KA 2DNLA 4LFCF 5E3CA 3ZNJ1 4R0JA 3HSJA 3KXDA 2VOOA 4UOFA 2OMOA 2OKQA 2DNKA 5FDLA 4ES3A 5RUBA 3EPIA 1LW2A 4ZLJA 4X66J 3FFIB 3Q8YA 4QIVA 3CWJA 4FDFA 3H5XA 2U1AA 2MGZB 4KTQA 1KEKA 1RA7A 3HFZB 3IMQJ 4O4GB 5LMNF 1OYDA 3TQ1A 1S1VA 4DXLA 5J1EB 1IXKA 2DEJA 4X64F 1CQMA 1CJUA 3HHLC 3Q8SB 1L3VA 3RZAA 2E5LJ 2AX0A 3U27A 4YFUA 4W90B 4ZOSA 1RTIB 1YBAA 2IC3A 2BUNA 1B0PA 1T9WA 1PIEA 1S9GB 3BGRB 3MM7A 3RW7A 2YQ3A 4USHA 2VH7A 2NLWA 4RUCA 1GFWB 1U1OA 1IWAA 2YPYA 2PA3A 3JQJA 4ZVOB 3KLVA 2YPZA 3CJ8A 3CIZA 2DD8S 3MEDA 4YR3A 3UW1A 1KLNA 1KHVA 2HWTA 3K17A 2AJ4A 3QT7A 4P72A 1WC3A 1Q5YA 3DKDA 4RBVA 5AXMA 2HFVA 3GFHA 2VPYB 4UY85 3W5XA 3MXHP 3I56S 2Q3PA 3I9ZA 2RUSA 2XY6A 4ZPAA 2XGPA 1WTBA 3OLBA 2FZGB 4OYWA 3QLHB 2OEKA 3PO4A 3KHHA 1FDBA 1H2TZ 4I6WA 1CULA 3H59A 4CM2A 1UEKA 4NASA 2MZSA 3JSRA 2AJQA 4H4KC 4Q43A 3E2EA 3TZWA 3DLGB 4ZHRB 4PQUA 1DARA 1WC0A 5CQGA 1P1TA 2EKNA 1VRTA 1CC8A 2H5EA 1HWLA 2I5JA 2QRRA 3DCAA 5D0HA 5E0OA 3OQ2A 1NSQA 3W8PA 3EGVA 2XYPB 3GCXP 3KLIA 4IG3B 3M8PB 3UDCA 4X65F 1YI2S 3NCPA 4TQRA 2PIIA 3DRRB 2DKOB 4H4OB 4CLWA 2HKEA 1U1RA 3GFZA 3FJ2A 1H72C 5ETVA 4NLQA 4ZPTR 3DHWC 2NS1B 3Q86A 4M5MA 4O3OA 3W2WB 4Q7AA 1NJXA 3B4DA 4FYDA 4DX7A 2R7XA 2ZWOA 1YK9A 2AJFE 2KZZA 4RX6A 2FVRA 2GIRA 3LP0A 3IG1B 3HHLD 1SPBP 1UZDA 3GMGA 4RO0A 3ISNC 1SH3A 4DG1B 5KFXA 1LNQA 4B3TF 2KRBA 1HNXJ 2WK4A 2CAJA 2W24A 1A6LA 2W4CA 4HL9A 2B6AA 3LPEA 2O01C 4UUWA 1YBUA 5KFPA 3J81U 2JEJA 5DDOC 3F56A 2E66A 2NXEA 3HT0A 3CCRS 1SL1A 1HLWA 2UV8A 4R25A 2GV1A 1NB7A 3PRVA 1HI1A 4G1PA 4OHZA 4DX5A 4DR4J 1V5VA 1TL3A 2PMHA 1HHQA 1LXJA 1YX2A 3DOMB 4ZVFA 4ZJOA 2P5VA 1UWAA 4JI5J 3LP1A 5HQ8A 2ILZA 3FBCA 1S1XA 2V34A 4FYXB 1XMOF 4WFYA 4WE1A 3LWMA 1U8SA 3JTNA 1NHVA 1RT2A 4K8RA 2L9WA 4WK1A 4CO4A 4EYHB 4C3MA 2XS2A 3QGIA 1R8BA 4IUFA 4A8QA 4PPDA 3IGNA 4TY8A 3VHQA 5BR8J 4NLGA 4DV1J 3UCGA 4KH0B 2DGQA 4N5SA 1RWOB 3GIMA 5DG9A 4YB1P 2DPJA 5HVHA 3TUPA 2XWXA 5DGBA 4DUZF 1S9EB 4K2JA 3CIMA 2DHXA 1UFLA 2MHEA 1JNZB 3DU6A 5K9FA 4ELTA 1QAXA 4QYRA 1H2VZ 1H3DA 2Y0SD 3ZTOA 4B3RF 3JS9A 4IG0B 3CDAA 1SKUB 2ZKUA 2V8PA 3IFEA 5GADI 3J7ZT 2DGWA 2WONB 3NGSA 3FGVA 2QG9B 1HNWJ 3G9CA 2A1BA 2BJDA 2HNYB 3CCMS 4ECYA 1Q16B 2RF2A 2GCFA 1UPPA 1C0UB 3I5CA 1TQLA 2XLIA 3A8JA 2HGNA 4WU2A 4N8NA 5KFAA 4URGA 2BQ3A 2OPRB 1RAJA 1Q7YT 2R8GA 3C66A 4QYZJ 1IQTA 2DCUB 1YRUA 2NXNA 4MMOA 1KQFB 2OGUA 1JB0C 2XMVA 4O3NA 1N4LA 5BYSA 2Q6BA 2CQ1A 4NWBA 2MQNA 4ED8A 1RABB 2FQQB 4M63A 2XLJA 5GAEU 3NS6A 3PM9A 2XLKA 2YY3A 2DNRA 3AOAA 3I4PA 3MM8B 4K4XA 2QN6B 2IJNA 3ZTPA 1DLOB 1XR6A 3MMBA 2V2KA 2M3DA 2BV3A 3PIOQ 4LFBF 2HHWA 1C1CB 2ROGA 1DJ0A 1NMEB 2RAQA 3KHGA 2ZJQQ 4B3TJ 3PW2A 3LGNA 1FA0A 5MLCV 4YR0A 1WF0A 3M8QB 4DQPA 2OPSB 3NBPB 2HHHJ 1RT1A 1IBKJ 2J0WA 2C2OB 1QVGR 2J9DA 4X4PA 1IBLF 1WC1A 4G65A 4JUZA 3QZ7A 1AROP 2M88A 4F02A 3IR5B 3AOBA 3GSDA 4FNHA 1S48A 4KHRA 5C24B 1RT5B 4ED3A 1V5IB 5KFGA 2UUBJ 3KTQA 5D4OA 4FKYA 4E98A 4JI5F 3C6UA 3EPGA 1TAUA 2E5GA 4AFFA 3EMTA 2BMBA 1AB8A 2UXBF 1TL7B 4USVA 2RILA 1BUXA 1K0VA 1IBLJ 4NLOA 4J9KA 1NB2A 2XGQA 3MWBA 2RRBA 2XNQA 5E2QA 3UR0A 3VV2B 4NCGA 2ALYB 4NA2A 3M6VA 1ZPWX 1UW4A 5KG4A 3W63A 2AYMA 2PN6A 2ZH3A 3MZIA 4Q2MA 3ZZZA 4I7FB 1KQGB 3HHLA 4HHJA 2HPUA 2EFNA 2W2OP 1UA0A 3W9HA 3M32A 3V4IB 1TAQA 5DQGA 4NA1A 1B7FA 3H4DA 1WC6A 2FJAB 1WHYA 4DPOA 3Q89A 4TXSA 3SFUA 5AE1A 1FWKA 2MMYA 1A9NB 3GIRA 3PDNA 1N33J 2JLEA 4DR3J 3QBCA 3G82A 4JYAF 2W8KA 4NXNJ 2OEJA 2PSZA 5B0DA 3DGPB 3S1TA 4NCAA 1X4CA 1RT1B 4DR2F 2W4DA 5AE2A 4ZMMA 1JJCB 3GFXA 3PJ9A 5A2QU 3OL8A 2QA1A 2Z0GA 3NXZA 2QO3A 2YKQA 2EXUA 4LR7A 4BWJA 4R0EA 3PX6A 3M2RB 2QLFB 3BBFA 3OXLA 3VGUA 1VISA 3U1NA 2LEPA 2EFGA 3MMBB 3HHKA 2GQQA 3FVYA 3HZGA 3R97A 1IBMJ 3MM8A 2IYGA 2QMWA 5D0GA 1B3TA 3DC2A 4P73A 1Y4ZB 2DHSA 2W25A 3NGUA 3I5AA 5HMWA 4DR7J 2HBZB 3R1HA 1R0AB 3DMJA 3IBWA 3ENAA 3PZPA 2IAJB 5L1JA 1G7CB 2LA4A 3TUZC 1NUEA 4OZJA 4DDFA 1G4CA 3H2VE 4OL8A 2HHPA 5I42A 1DQAA 5FLXU 4TQSA 4BS2A 3Q24A 2VQFJ 4ANEA 1VQ9S 2RDIA 2IJFA 2RU9A 2IRXA 3SCKE 2HNYA 4DFPA 1YITS 2QEXS 3A3NB 2BQUA 2P6SA 4JP8A 4WXOA 1K44A 2DGOA 5K20B 4HACB 3TZYA 4QQBA 3KJVB 3CC4S 4YS2A 5DG7A 3DLLQ 2C2NA 1Q8IA 2HSEB 1WOPA 1BWVA 3CO9A 4IG0A 3TYTA 1HKAA 4DJBA 2RU3A 3J7AN 2WRMA 1RJJA 4OZ1A 4U7UK 3QSYB 3VR1A 1NJZA 2NR0A 3C6TB 2VFVA 3CJSA 1Q95G 1Z2ZA 2XS5A 1ZAVA 2MJNA 1S9EA 3AODA 1OWXA 4H4MA 4LRBA 4NRUA 4RJVA 4A46A 3JTPA 1QLNA 2GVZB 5BYQA 1HD0A 1YZ6A 3KK3B 3MTKA 3GIKA 3RB3A 1RE1B 2PFFB 4TY8B 1HNXF 3AD9C 1JQGA 3AY0A 4EO6A 1BLUA 1WHXA 5IC6B 2CNNB 2ALZA 2AV5A 2ACYA 4UT4A 2OD6A 2RMLA 3LANA 1S7HA 2YKMB 2U2FA 3DI6B 3T6JA 3T6BA 1EIYB 1HBMA 3EE3A 4OI1A 3G8TA 2YNIB 4OZ3A 2YVSA 2XSJA 3TOQA 2IVYA 4QWAA 1S4FA 5EWFA 2R3VA 1RCXB 2RQMA 2D3UA 2RE1A 3RG6A 4XIUA 5HATA 2FTRA 1D9DA 3NWGA 3Q8QB 2AJ1A 4XDDA 2XMUA 5B0EA 2DH8A 4MYTA 2B51A 3HSGA 3OVAA 2FY1A 4QW8A 3MEKA 4FXDA 2CG4A 1JJ2R 4WTOB 2HNZA 2AMCB 2NXUA 2ROPA 3MM5A 3EXYA 1WF1A 4Y34A 2BABA 1UA1A 1BQMB 2R2UA 4ERDA 2V0NA 3DFEA 2NSCA 4DPWA 3MHYA 4DR7F 2IA0A 5FLXY 1AXQA 2A6MA 4WZMA 5LJ3Y 1QM9A 3JAMU 1HFEL 2CG8A 2XZTB 4WXWA 3UN3A 4DV1F 2HVEA 1X4EA 2RQKA 2B3TB 3MEGB 4C8MA 4FF4A 2VG6A 4DQQA 1VBZA 3L7OA 4IDKB 4WFZA 3JAMY 3W1YC 3HJFA 2ZH7A 4IG3A 2V50A 5EX3A 4K4UA 2CNLB 3BB5A 3M05A 4DV4J 5GMEA 3SSSA 5DM6Q 1NKCA 4C3LA 3HO1A 1IJEB 2VFUA 1VRTB 3B82A 5B0AA 3ZNUA 1HNZJ 1WEZA 1CQNA 3TEHB 2GQCA 3ULHA 1SCJB 4NXNF 1NDKA 4B3RJ 3HD1A 2G1HA 4ZPCA 3MMAA 1O5JA 4URSA 4OHVA 4CO0A 1SH2A 2MLXA 4TYAA 2DNPA 2EFVA 3SFGA 4RPFA 2GW8A 2ZEJA 5JJBA 2G1DA 1RXOB 1MWYA 2E29A 3EWGA 3M7VA 4LVOP 1YIJS 3W65A 2N4CA 4FS2A 4WJBA 2G0IA 2EK1A 3SSRA 3K58A 3PW4A 2ZH8A 2KH9A 3L7PA 4DZ6A 4C2MA 2ZBIA 1MU2A 3RAQA 3VQTA 2GFFA 2CQ3A 1CBKA 5KOWA 2EW9A 4WP8A 3E51A 1Q8LA 3MD1A 2E9TA 2WVCA 4NZ7A 2CPXA 1TU0B 1S9GA 1TTHB 3BGRA 3FCHA 3MM7B 3WIVA 4OX9F 4P7VA 1NSKL 1LFWA 2XNRA 2J8SA 5A2QY 1RT7A 1CJUB 4NRTA 1R7IA 1WKJA 3JSYA 4GRSA 3UDLA 2WVEA 4DCPB 5LOQA 3KG4A 5SZTA 4DL3A 2Y8WA 4KPCA 2MGZA 3M1VA 2H5JB 2FHMA 3RBXA 2L3MA 4RW6A 4U95A 2BJ9A 1JLQB 1R27B 2KT3A 5KOXA 5F8HA 1NJIT 3BKTA 3H5UA 3CGIA 3I9V9 1EP4A 1V3ZA 2RIJA 1AT1B 1KOOA 2FVSA 3ZTSA 3DLEB 3CXCR 1RKIA 3NOGA 3R5BA 2YBVA 2KG1A 1GNKA 3DYAB 2FJEB 4KE5A 3GJSB 3OXGA 4KY3A 4USMA 3OTOJ 4CNZA 1RTHB 4O23A 4KHPF 1NK6A 1F2GA 1DAXA 2V8VA 4OZNA 4ZPBA 4K59A 2UXBJ 2PO4A 2XY5A 1N52B 1R89A 3OTDA 3O3LA 3M9MB 3IWXA 1BGXT 5F41A 4K2XA 1ZM2A 3AA9A 4FYYB 5EGYA 4K50A 1NPKA 2RNEA 1JLEA 2ZC3A 2NZ4A 3BGFA 2W9CA 3A3PB 4RU9A 3HJVA 2N7CA 2VBWA 4LR9A 1U8WA 2QTWA 3CJ5A 3K7RA 4ALZA 2ZJRQ 4DF4A 2Q43A 2BACA 2GNKA 3OV7A 1H7XA 4Z7YA 3TJ8A 4KBIA 3OBIA 1RU1A 2MPUA 2RHSB 4NEYA 2D3ZA 4EFAC 3RR8A 1JLAA 4LFAF 4DV2F 2HMIA 2CPZA 1RWUA 4ZVUB 1GX5A 1N5VA 3FSYA 3LH2S 2MKHA 5DO2A 1U4BA 2BOPA 4ED4A 2NXJA 1KDNA 4MKBA 2Q79A 4K7QA 1XQIA 2W2MP 5K14A 4CP5A 3V81B 2MY8A 1JLAB 5F0WA 1QTNB 2R42A 2OI2A 2P9CA 1NH7A 1Y5NB 4QIGA 4IQMA 1NK7A 2XY7A 1D09B 3T9ZA 3DN9A 4KFBA 1U0HA 2WTFA 2NUUG 4F0KA 1FXDA 1HNZF 4B9SA 1HW8A 2X7IA 1ROFA 3AXMA 4FVMA 3KOAA 5L8RC 1SB6A 4ZLNA 3VAHA 3C14A 3DOLB 2WW8A 1YJ9S 1HWJA 5HO4A 4CO1A 3CJTA 2EC0A 2AEFA 2LQ5A 1GTEA 2YKPA 4J9VA 2XCPA 2AF6A 4EZ6A 4HDHA 3SDEB 2F8EX 3KJFB 1TUGB 1PJ7A 4MAKA 3J7A1 4LF4J 3RUBL 4C0OC 2IPOB 3FZBA 3P4UB 3I4HX 4C8KA 1S77D 1S6PA 2OD4A 2YQ0A 4XPCA 2FC9A 4JI4J 1EKSA 1HHSA 3A1YG 3QNWB 1Q8KA 3N0VA 1WNEA 1U6ZA 3MR7A 1LWCA 2AYGA 2YNHA 2KL8A 4H4KA 4MKVA 4AL6A 3FNNA 3IGVA 3EXCX 1X5TA 2G2ZA 3OFFA 4RW9B 4ZVGA 4PQUB 3NNHA 1H74A 2CNKB 3TJ9A 1UFWA 1S97A 4LRCA 1U25A 4RW6B 4Y2CA 3SCIE 2VA2A 1NBEB 1GMUA 1X4GA 3M1VB 4JI3J 4BWMA 2QC3A 3GYNA 1NDPA 3D54A 3N6NA 3ITHA 5DETA 2Y8YA 1RHMB 1RT7B 1ZAXA 2GIFA 4OMFG 3Q8UA 5FIIA 4DX8H 2ILYA 4O3RA 4YHHF 2KM8C 1NLKL 3O8WA 4X4OA 2JLGA 2WBRA 1L3UA 5LSLA 4AQYJ 1JLBA 1RTJB 3DLKB 1RAAB 4P6QA 2ZOMA 3MM9B 3TW0A 4C6AA 1P1LA 5C25A 3PW7A 3Q83A 1TK8A 1RHUB 2FLLA 1S1WA 1SQFA 1N6QA 1SXLA 1HBNA 1SC4B 2BZ2A 3L4BC 2Z8QA 4P2FA 4IR9A 2QA4S 1RT6B 1JXVA 4U96A 3T41A 4YHHJ 3NNAA 2YNFB 3MCNA 1HWKA 4KJIA 2IVMA 1HR0J 2R8JA 4I1TA 2I1RA 2F7VA 2ZE2A 3AB2B 3CTRA 4P9SA 3RBEA 2VOPA 3B8HA 1VBXA 3J81Y 1B70B 3GG1A 4RW4A 4IFYA 3CD6S 2JHEA 3O1LA 3M8SA 4DUYJ 4WFNQ 2H51B 4LF5F 2EG2A 3GLJA 3ILJA 4X4TA 3TZZA 2X1FA 2WVFA 3CCUS 4QPTA 3E3XA 5DS7A 1CJVB 1WG1A 2GGPA 3CJQA 1N5QA 4NOHA 3TX8A 1RT4A 5H9FJ 1JLCA 1T9VA 1UJ4A 3WC0A 2QIFA 4IO9Q 4Q0BB 4OHWA 2DNQA 2J9EA 3I0SA 3I31A 1E6VB 4NYOA 4IOCQ 4K4WA 3EYZA 2MXYA 1WTFA 2VUGA 2VKZG 1QAJA 3M6WA 4F4ZA 3MMCB 5ETOA 2UP1A 1PILA 2APOA 1X9SA 3R5DA 4LIWA 2PEHA 4DL4A 1Q82T 2IDLA 4U7UD 2F65A 2G2YA 4C8YA 1ITPA 1DZ5A 2UVRA 1HI0P 5IXUA 1B64A 4LQ3A 4CLSA 1VRUA 3MM5B 1T94A 3MF5A 4USJC 3KLGA 4V19X 3MAHA 1WSRA 3PX4A 3PY8A 4NXMF 1J5EJ 4CQ1A 4QU6A 1T03A 5MAOA 1T9XA 4A48A 2CRLA 3SIPB 3D5MA 4NYZA 5KFHA 2CQBA 2HK2A 3KK1A 3UE2A 3GILA 2MZJA 4NLXA 4HYKA 1SVDA 2QA2A 5IQ6A 1NK0A 1CVJA 1AUDA 2OELA 4HR2A 3BKUA 5J2QB 2O1PA 3BN7A 2YNIA 3V5RA 5KTQA 5HLFB 1J5OB 2ERRA 3SQGB 5M2RA 2QGFB 4ZVRB 2YKMA 3FRZA 4ILLA 5L38A 1ZM9A 1KVKA 3FEYB 3JXOA 1S10A 2QSFA 3BH7B 1YWXA 3WHIA 3LTOA 1FRLA 4LF9J 2DHHA 2F40A 1R3NA 2W9BA 2DITA 3KK3A 3DU5A 3H4BA 4P2MA 1BQNB 2JFDA 4FYWB 4H4MB 3QJLA 1TFWA 1KQKA 4DV7F 2MEWA 3EGNA 4CLZA 4OV6A 5A8WA 1PJ6A 1X4DA 2BBEA 3C6TA 5KG1A 3TO8A 3R2DJ 4F0MA 2WOMA 2CZ4A 1FWPA 2VONA 1VQSA 3K5LA 3CCJS 1W26A 1H98A 3UNGC 1U45A 1VQ6S 1SV5A 2HLTA 2FHJD 2R7QA 3O6QA 5THWA 4ED6A 1BMQB 1XEZA 1WJ9A 3TRGA 1VQKS 1TK0A 3QWPA 2FJXA 3NMRA 3CW2C 5JXSA 2AJ0A 2CQ0A 3JYTA 4NZ0A 1UWBA 4ZP8A 4DSFA 5KT5A 5I42B 3KFWX 2RVJA 3HDSA 1QVFR 1LQ9A 3VAMA 4GO7X 5IS2A 2ZBCA 5HJYA 2DH9A 3OFEA 4ZA1A 1VLOA 4FP9A 3M30B 1AZSA 2LP4A 2MSSA 2VFRA 3NMAA 4W98A 1FDDA 1U0SA 2V8GA 4B9NA 1BD6A 2Y1IA 5HP1A 1VBYA 2WZ1A 2C2KB 3AFGA 4NLWA 2WCXA 3NAHA 1NZAA 2FHJA 5KG7A 3WDOA 2G2OA 4ED5A 2E1RA 1N5SA 3H2UB 1DFDA 2J7WA 1MN9A 2LKZA 3LAKA 3R1LA 3BGLA 1UFKA 2K1RB 1ZA1B 1T95A 2FB0A 2HVHA 5KFJA 5A8KA 2CKWA 2ZZMA 2ZH9A 3DNCA 2JL9A 2EG1A 2K2PA 5KFZA 3L3CA 2VIHA 4JI7F 2AYEA 3VCDA 4L72B 2C28A 3P49B 2C22A 3C3LA 2V63A 2EFQA 5KFSA 3IS9B 4IRCA 4O44A 2BA9A 2HGMA 3G82B 4PUOA 1DRZA 1TMMA 1KSPA 1V6HA 4E0DA 1DQ8A 1HQ2A 3J80U 1AYEA 2F4FA 2W2PP 1T3NA 5CH7B 4N8OA 3V4IA 4Z2XA 4F3QA 4LF4F 1JIHA 2VFSA 3PRBA 4Y65A 3WQPA 3PHEA 4I7FA 4EBDA 1SL2A 2KM8B 4NCGB 1LWFA 3DDNA 1U2RA 4Y28C 2BKPA 1HMVA 1Y5IB 1OQ3A 2CFXA 2JWNA 4C11A 3BQ1A 4ECXA 5FJ4A 3FZ2A 3GJRB 4RKUC 5ADZA 2G13A 2J7KA 1C4CA 4DQSA 1N48A 2NSBA 2Y1JA 1T9UA 1NKBA 1VMBA 2YX1A 3A8EA 1S0NA 2PDAA 2QLXA 3C6UB 3IAM9 2OHDA 3Q2TC 3VALA 1RT5A 5C24A 2AEMA 5KFFA 2YWHA 4B3MF 1Y9OA 1LK7A 5J2PB 4DQRA 4USKA 4NI2B 3G96A 1HBOB 3UN2A 1WC5A 2DIVA 1FD8A 1WHVA 3VGSA 3QIPA 4ED1A 5C5JA 1CJTB 2B8PA 1Q86T 2BW2A 4ANCA 7AT1B 3KLEA 4LMZA 2CVEA 3BJYA 4U7CA 2DR8A 2OPSA 4NMXA 3VF0B 4DN0A 1TV6B 2GC8A 1TKTA 2QMUB 4I6AA 2HZCA 3FBEA 4M5NA 1YJNS 3UDVA 4FZVA 2D41A 3DOKB 3ZZPA 3BSOA 1C1CA 3H90A 4MFBA 2VG5A 4OFZA 2Q66A 4WWSA 1DLOA 2HWIA 1UL3A 2Y1LB 4G6VB 1Q4RA 3ADAC 3CCES 4DV0J 4HHHA 5I3UB 5CZVA 3BZQA 1HNIA 3ILLA 2ROEA 2C2ZB 5AXNA 4OYBA 3BREA 3A4TA 4R5PA 2UXDJ 1FKOA 1IJFB 1JKHA 3MUMP 5HJXA 1N32F 2CIMA 2OPQB 4IKAA 1O6XA 2DK2A 4I56A 4M1KA 3T19A 5IWAJ 4WP3A 1ZETA 2LU2A 2AT1B 2BRLA 1R6YA 3NWRA 4Y2AA 1SIWB 2BKOA 1IKWB 3S6EA 3TNVA 3MR6A 1WOOA 3LQVA 1JKHB 3OFGA 4USWA 3MUVP 1WI8A 4F2RA 2W2QP 4N7TA 3JSMA 4AXIA 4D3GA 3D6HB 4QBUA 5KFCA 1VQMS 3WX8A 2JC0A 5CYJA 3ZZRA 3MCOA 1IKVA 3VGTA 3M2VB 2XMKA 1PBAA 2VG5B 4ED2A 3PW5A 1T7PA 3DOKA 3C15A 2N4DA 1MWZA 1R8PA 1FKAF 2JVOA 1VJQA 3OR1B 1TKTB 3G6YA 3VVTA 3KK2B 2UXCJ 5CYQB 1PC5A 1OMSA 1T9YA 4ZN1A 4J9MA 2J0QD 5D3GA 3PR5B 1CJTA 1F5BA 2DBBA 3BF4A 3H5SA 4I68A 2A2CA 4WP9A 2AGPA 3PVXA 3VQSA 3MUTP 4CI0B 1U6FA 1NU4A 1Q78A 3QRQA 3PCOB 1I94J 3BO2A 1KRPA 4C8ZA 3EVMA 4OZ5A 1HNWF 3AA8A 2J9DE 4IQXA 5IT0A 2J9CA 3BPSP 2OTJS 3BO3A 3MMJA 3FC9A 4ED7A 1HI8A 3BYRA 3MCSA 4WE1B 3MOJB 2VG7A 3D4JA 3FKBA 1RHQB 4K4ZA 3NGTA 1S12A 2LQBA 4OI4A 3CMQA 1HMVB 4C11B 5DDPC 3KMQA 1KFDA 1C4AA 4HT7A 5C42B 1UVIA 1BC6A 3HPOA 4KRWA 3AOCA 2CQPA 3SMZA 2QYCA 1SJFA 3DHXA 2KVIA 1UPMB 4DSEA 2MQLA 2C2MB 4DL5A 2CQ4A 2DO0A 3ZO7A 3GIIA 2JEFA 3OSNA 3IWNC 4PG7A 4RNHA 2HS3A 2R8IA 1KC8T 3K8WA 4DEZA 2BRKA 2H3EB 3OTCA 4DG1A 2IMOA 4RNNA 4PUOB 1TUWA 2MKKA 1RU2A 4ZCIA 1FFWB 1XMOJ 2YWEA 2PI4A 1RT3B 3RB0A 2NREA 2GO8A 4K4VA 2K7JA 2GA7A 2K3IA 4ECZA 2F8MA 4LVNP 3R8YA 5A8KB 1EAYC 1IBMF 4IO1A 5ETMA 5D4PA 1TR0A 2K1RA 4OX7A 4LF9F 2XMJA 4Z37A 1S59A 2CDQA 4LBHA 2AP6A 5CCMA 2QFJA 3MPUB 5DZ7A 1ULRA 2N3OA 2ADBA 1RLDA 3EZOA 4LUBA 2DR5A 1HD1A 4L6V3 3M8PA 1U1MA 2HNDB 1LOUA 2JFKA 1YJWS 4J9PA 1DHMA 1FKPB 1N56A 4YUDA 2A6OA 4J37A 5DGAA 1FX2A 4JV2A 4A8WA 1RBOB 3CC2S 1RWVB 4QWEA 6AT1B 1NH8A 2BKNA 5KFLA 5HK4A 2HIYA 5KFUA 4CLLA 5AE3A 2JZ5A 1VQ7S 1NKEA 5CABA 1U1QA 2CPHA 4P52A 3DM2A 3GP9A 3T1HJ 3JYTB 3FEZA 4JI0F 4JV5F 3DRPA 4B9LA 5EHHA 2N3LA 1W2IA 1D8ZA 3KUGA 2PA8D 3NS7B 4YEAA 5DZ6A 3GV5B 1X5PA 5CHCB 3RRHA 3T1YJ 1KLMA 3ET6A 5U47A 1M5PC 3I6PA 4RWWA 1F0XA 1VQLS 5D15A 3OW2R 2MHNA 4QR1A 3CJ4A 5HANA 5F9NA 5DDRC 3D68A 4F4YA 2FHOB 5D0RA 3P5BP 4X84A 2Z4PA 3M8RA 1SH0A 2VQFF 5E3QA 1TP7A 1SC3B 2FHKA 2WOMB 2ASYA 1R8HA 1FK9B 1M5HA 3L9ZA 4ZKAA 1PSDA 3CT9A 3IO1A 5A8WB 2A0FB 5HQMA 1YJUA 4CO3A 5HVGA 2HRYA 2VJUA 5K8OA 2R2SA 4OJ1A 3CD7A 2RRAA 4X4UA 3MAAA 2V2VA 2XZDB 3CJKB 5GADU 1X7VA 3QQCD 3ZZYA 4IOAQ 2G4BA 1REGX 1VQ5S 2B9XA 2VZ9A 1SJ4P 1GMWA 3ILIA 4B3SJ 2NYIA 2EFPA 1U2FA 3NG8A 5HVFA 1FJGJ 4MKAA 5HLFA 1FRIA 5KFTA 4EI2A 3B4MA 3FFIA 5K8MA 5F9LA 1RYSA 3QJPA 1LW2B 2BOAA 3IP0A 5ETRA 3UNYA 4F26A 3T5LA 1L3SA 4GKKJ 3W5ZA 3KJNB 2V69A 1LFPA 3QMQA 1FEHA 1SUQA 4TU9A 3LA0A 1URNA 5K5MA 1SI9A 4DV3J 3BQ0A 2ACMA 2F5GA 2VODA 2FC8A 2I0XA 1QD1A 2PFDA 1IKXA 1RDRA 1T03B 2HHVA 1B99A 2AU0A 4ZPVR 3D3BJ 4KGXB 1GTHA 2M2BA 2HHHF 4LRFA 1PBUA 2WW4A 4QW9A 4PWWA 4AQYF 3HX9A 2DYAA 1M1GA 3LO3A 1RWPB 3N01A 3TAPA 2EWHA 1FJ7A 3UDEA 2PC6A 5CYMB 1XMQF 4RL1A 1QSSA 4JI1F 3POTB 2VBZA 2E7WA 3MMCA 2RKIA 1H6KX 1UKUA 4QOTA 3CJRA 1CG2A 1GX6A 2BE7D 1VHFA 4YB6A 3GR0A 1HNVA 4OV1A 2HFSA 4WU3A 1HPZB 1N0VC 4BBYA 1C0TA 1JX4A 1X4FA 4X4SA 5G4DA 1IM4A 2HZAA 1DY3A 3US5A 4ETZA 4DV0F 1D9FA 4IH5A 2VDIA 2Z2YB 3IN5A 4JV5J 1RT4B 1Z1ZA 2GJIA 4DPUA 2NPIA 5BR8F 4IR1A 2J8AA 1N32J 1KN6A 1VIOA 3C16B 2ZOGA 1TKXA 2CPDA 3VVUA 4A8YA 1X0FA 5EX0A 1HL6A 1RHRB 2JC1A 4JV1A 1QE1B 4C97A 4Q45A 2E1MC 4OYOA 2ZE2B 5E33A 3MI7X 1T9TA 1UETA 2CADA 1S6UA 2COLA 3CD0A 4WFAQ 4O0IA 2ZM6F 1PYSB 4QWBA 1P8GA 1V9OA 2R8HA 1WUUA 2J6TA 3EZ5A 1VI7A 4PG8A 4WTYA 3CDWA 5EUHA 1ZBTA 3ZC4A 3PNIA 3T5HA 5AXLA 4F4KA 4J9RA 2WVDA 1M5KC 2XYHB 3CB4A 3LALA 3MM9A 4HEA9 2HFNA 4ID8A 5C25B 2DNHA 3QFWA 3DLKA 2Y0BB 1XR5A 2LQ9A 4RBUA 3WX4A 5IC4B 2HQ3A 3OFHA 2B7BB 2BE9B 1RLCL 1X4HA 1ZS6A 4MIWA 3DRYA 1RWWB 2A18A 1NPPA 1WC4A 2KXNB 2BW7A 4M5LA 3CCSS 2QLJB 1H38A 3HFKA 1UVNA 2MKYA 4L3KA 4RNFA 3EJMA 1UVLA 3PEHA 4USUA 3C2PA 2FY8A 2UUAF 3N28A 3G4SS 3MAQA 3LUYA 2HQIA 2QA4G 4JI4F 4UY8T 4WBFA 2KJVA 2UU9F 2ZD1B 4M5DA 4RW9A 2M8DB 1OY6A 4KO0B 2KXFA 3J7YI 1WD6A 4DR4F 4A8FA 4LF1A 1I94F 1LWCB 3BDEA 5A0YA 1X5OA 2QZ8A 2AHOB 4UOHA 2LCWA 2BJ3A 4B3SF 4JB8B 1G2EA 2MKIA 1S7IA 2YKNB 3KG1A 4DPXA 2JVRA 4C0HA 4YQWA 3FCWA 2DB1A 2KT2A 3SDEA 4LT6A 1HBUA 1RCOB 1NDLA 4TNOA 4R8UA 1VR6A 1S79A 4FF3A 1FTRA 2RD5C 3D2WA 2CZ9A 4EO8A 2M4MA 3DOLA 3C14B 4EBCA 4ER8A 5E3PA 5T14A 1LW0B 3CVKA 4LSLB 2QT7A 2ZDOA 1QE1A 1S6QB 2AW0A 5F8NA 3PX0A 1S4EA 1UMJA 2OUGA 2V8HA 3AJ1A 3PTWA 4CYUA 5IV4A 1TKXB 3GONA 4WIIA 3EX7B 4M94A 3G6XA 4Q44A 2FVPA 1F9HA 2B7CB 4A4JA 3RB6A 2KTQA 4CNYA 5GMDA 2LQ8A 3V81A 1GK8A 4LSNA 1TKDA 3KNAA 1HHTP 3PYFA 4ZCKA 1YBTA 3QIDA 3GTYX 1K1QA 4RW7A 4L3NA 4DU7A 2DPIA 4PXBA 4UZBA 3HVTA 1EETB 1F3VA 1HPZA 1ELOA 2DHAA 3PYDA 1HNVB 5KFBA 1FRKA 2X1GA 4B9UA 2IM1A 1F60B 2IRUA 2KG0A 2HGLA 1FDAA 1KBRA 3B54A 3KHLA 2LDYA 4C4WA 5EN1A 2UVWA 3RRGA 1GAOA 2DGXA 3TARA 2F4VF 2HFOA 4ELUA 4OI3A 3EGZA 3MM6B 2FJWA 2HQFA 4DR2J 2F3JA 1NSPA 2H9ZA 4P10A 2C3YA 3H42A 3TUJC 4K4YA 3J7YU 1UTAA 3NNCA 4TLRA 4DR5J 1KD1T 5J2MB 3F73A 4C8NA 2HHQA 2VHGA 4DR3F 4DPTA 1GQEA 3WBZA 4ZIVA 2W8LA 1IKXB 4FVCA 1H0HB 3M9NB 2BM1A 2R7UA 3ZZUA 3OVBA 3NCRA 2XQCA 2ZVSA 3OT9A 1T3OA 4OYZA 4ZITA 3SV3A 2M0GB 4AXJA 1BXNA 1SUQB 1DURA 2Q6CA 2D9PA 3DYAA 2BE2A 1F6TA 3ICLA 4WPAA 4LREA 4EUVA 1EB0A 4J9UE 5HQLA 1FD2A 2BANA 3PFOA 2QMXA 3DLEA 3Q8PB 4TYBA 1AA1B 2UU9J 1G1XA 4X4RA 2FVCA 2GJFA 3BEGB 4P2SA 4CTAB 2JLFA 4Y0FA 3HF5A 2C2DA 2YWGA 4TVAB 3QZ8A 2FDNA 1HIYA 2J76E 3P3DA 5J2NB 1FESA 5T41A 4X65J 3ISND 5KT2A 4UTGA 4PG4A 2QLWA 4DS5A 3N5FA 4CO2A 4J9OA 1FJGF 1Y0HA 2AGOA 3MAAB 1PAEX 3G86A 4FYVB 3IAS9 5DRKA 4C9DA 4KGMA 1AFJA 2P9GA 1IBKF 1N5YB 1U2CA 2CYYA 3BM7A 3PRDA 3R5AA 2ZFHA 1JK9B 1N0UA 1K1SA 4I2PA 4X62J 3GYGA 4DR6J 2EBEA 1S99A 2YWKA 5DQHA 4KB7A 1MU2B 4DUTA 3GR1A 2XYGB 3G8SA 2B56A 1SJQA 3MPYA 3SV4A 1U1PA 1EQ0A 2CA9A 1VBKA 3DLBA 2PI5A 1XK8A 2GVDB 3R9LA 1VHIA 1YDLA 3V6DA 3NS5A 3DRPB 3OTOF 2EEYA 3OR2B 4CH0S 2KT5A 3DM2B 5KFRA 3ZZTA 1LK5A 3DDIA 3HZEA 3HHDA 3KLHA 3D7SB 2W4PA 4FBUA 4HTIA 3ELHA 1OS5A 1EJ7L 3MMAB 3I0RA 3QO9A 2CQHA 2R9LA 3TX0A 2H5IB 3BS9A 4ES2A 4B9MA 1PO6A 3IBFB 5JUMA 5J1PA 4QYZK 2HQGA 2LYVA 1FKPA 2JOQA 1WELA 3B6BA 4BHQA 4RUBA 2YWFA 1QAYA 2KYXA 2HNDA 3QT5A 4LSZB 4ATNA 1PJ5A 4OYXA 4HLBA 3LW5C 3K5OA 3PJWA 2M8HA 3BO4A 3MECA 2V4RA 2ZUAA 4KIAA 4JI1J 3MEGA 3TEGA 4V19J 5ETTA 3MCMA 2E5JA 5AXKA 1ZM3A 1PG5B 5SUHA 2CJ9A 4EK2A 5ETLA 4GVBB 3TA2A 1RT3A 2XM3A 1ZTTA 3DRSA 1UCNA 3HLUA 1YKWA 3NKYA 2LFVA 4NE9C 4CLYA 3KLFB 3V6KA 3IR6B 4ITSA 3V2UC 2HQCA 3GYXB 5HL7Q 4H54A 2NXCA 2VPWB 3C19A 1R8AA 1GXUA 2KDOA 3BDPA 1FF2A 1HQUA 4J90A 2MKSA 1RP5A 5IOLA 3NRBA 3OTEA 2FJDB 5LT5A 4ZVQB 1NAQA 3ENWA 1JNRB 5CA5A 3M9OB 1FJCA 5GAHI 3MR3A 4DSIA 6FDRA 3LOUA 3BV8A 1VC0A 5C42A 4EBEA 3HXMA 1J5EF 5LMUF 4MKYA 4PYAA 3WIUA 4P2XA 5DQIA 2MQPA 1OQ6A 3K59A 4EEYA 2VG7B 4FPRA 1CS4A 3EZUA 3AD8C 3FRYA 2D1CA 1U49A 3M8YA 2GHVC 3TWZA 1SJ3P 4B3OA 2GHPA 2CUYA 4V1Ak 4U6PA 3IR7B 4AD6A 4KPYA 4IH6A 1IWGA 1U1NA 4MTPA 3JQKA 2GVZA 2HAFA 4DL0C 1VQNS 1KFSA 1GH8A 3VAKA 1XC9A 3HSDA 3H20A 4NL5A 1NK5A 3R7NB 3T3FA 1JLFA 4IFVB 5KAKA 1IN0A 5ETSA 4KC5A 4RW8A 1XN9A 1D9AA 3D67A 3KK2A 4F04B 3UPFA 4LF6F 2V9KA 2IM0A 1CJKB 1Q7LB 3C15B 3W5YA 3N6LA 3BGOP 5DLFA 4LBPA 4DFJA 2IHR1 4HACA 3M2VA 3KJVA 4NXMJ 4DR1F 4MT1A 2L9NA 4Y2IA 5AT1B 4P7TA 2H65B 1HWUA 4PAAA 2ZNYA 5M2PA 1S1TB 1I6JA 4X62F 3RRKA 4C48A 2VD3A 2HVZA 3JSMB 2YH1A 5H9EK 2C3MA 4GKJF 1TKZA 4QIFA 5A76A 3FSIA 2D3OR 2HHXA 2OJ3A 4LF8J 1Q53A 1DQ9A 2HIQA 4LF5J 3O5TB 1LXNA 4ILMA 3MURP 1F9FA 4QPXA 1IBCB 2OPQA 4DL7A 4Z7CA 4PWUA 2DO4A 3DMJB 1FKOB 3KJQB 2OPPA 3LPYA 4P71A 2CWKA 4P74A 4QIWD 5D77A 4R5PB 2E1CA 3EDQB 5I3UA 4N47A 4XPEA 1KOHA 1Y3JA 1FWLA 2B0GA 3IA0A 1U1LA 2F9JA 1M5OC 2HURA 2IIHA 2UZAA 4PXCA 4F36A 3KYLA 2JEGA 4C7QA 2B4VA 1FVSA 1CSJA 2WSEC 3M2RA 3PHTA 4ZN3A 4DUZJ 2XO7A 5JMNA 4JYAJ 4DV7J 1YRTA 4LBIA 1RHJB 4JBCA 1TV6A 3H25A 3SZ2A 4OZ2A 3RR7A 4KHPJ 1VDHA 2W2NP 2VASA 4CH7A 1ZA2B 3H0PA 5F8IA 1WI6A 3DGPA 4DCOB 1TUVA 5HMXA 1YGYA 2AIRB 4DOZA 4NI2A 2KVQE 3Q8VA 1XBWA 5KFQA 1PKUA 5J2PA 3LP2A 1KONA 3K89A 3BGUA 3MPWA 4BC7A 3E01A 1WEXA 5LSOA 3M32B 2R7OA 1OYEA 4MJKA 3V4MA 2UUCJ 2D9OA 4WYLA 3NGDA 2OTLS 1RQ0A 2DR7A 3KDOA 2CJYB 2BR0A 1MMNA 2JSXA 3N4WA 3OLAA 3W2VB 4DFMA 3KKFA 4A8KA 5KFWA 7FDRA 5GAEI 3QPIA 5IFMA 1RYRA 2IY5B 3HKZD 1FCAA 1T0TV 3PYGA 2JNJA 1LEOA 2X3DA 3LP2B 3BH6B 4F7VA 3NAIA 2HWHA 2GQ2A 3HULA 3HVWA 1U48A 1YRXA 2GHWA 2UVVA 2DNOA 3THTA 4ECQA 2UVUA 2XSFA 4O44B 5HAOA 3M2UA 4ZP6A 4DV3F 1H73A 3L09A 5DJBA 3VWSA 3SI8A 3OSPA 2K8GA 3NBPA 4YDDB 2X51A 1MG7A 1EX8A 3M8QA 4DL6A 2VFTA 1S5ZA 1FFGB 1IVZA 2RH3A 1KVIA 3W8GA 4ECTA 4OI6A 5LJ5Y 2VPZB 4I0WA 3PYEA 4PZVA 3UO0A 2MB0B 1J2VA 1U26A 4PPZA 4TY9A 4YMEA 1MROA 1MN7A 1TVRB 4NLYA 4OJHA 4DLEA 2OSQA 5T7LB 4OHYA 2R4FA 4DV6J 2JH3A 5JVHQ 3PFEA 2M5YA 2DRDA 1SKSA 2P8IA 2RRNA 3OXFA 1NHUA 3QGPA 2OPPB 1FI4A 4NLSA 5KG3A 5HP1B 1B0TA 4X64J 4KHMA 4DZDA 2YX4A 1AZSB 4PG6A 3SXLA 3K57A 3HCXA 5IZHA 1UVMA 2KKHA 2ZZTA 3KUEA 4ZVSB 4DV2J 2OPRA 4YY3F 2QSWA 5AJ3F 3GWCA 2AGQA 1UWBB 3VTIA 4WKYA 1C0UA 4ECWA 4RBTA 3CEDA 5GVQA 1K47A 5L9XA 4F2SA 1VS3A 2OEMA 1GT8A 3N6MA 3U7JA 1WOSA 2EBGA 2FIUA 3OD2A 4QJVA 3PW0A 1CJKA 4TU7A 3DDKA 2OIHA 5B0GA 2DXEA 5ETKA 2ZBPA 3HM9A 4O4RA 4F0HA 3T1HF 3JTOA 1XTZA 4RW8B 1RAFB 1VLYA 4I69A 3KWMA 2B8QA 4DUYF 2DH7A 3T1YF 1FJEB 4JOUA 2DXFA 2HK3A 2NZCA 1IQZA 1MNEA 4XDCA 4PR6A 4TN2A 2OLWA 1C1BA 1P6TA 4MIAA 1ZTWA 1RADB 3AXKA 4ZS6A 3D1OA 3ETOA 2W9BB 2RDJA 2UXCF 1ZAWA 2WHOA 4K4TA 1FNOA 2HRTA 5CD4H 1PCAA 3RAXA 4KGVB 4DV5F 3W7BA 1CS4B 1FRHA 3DRXA 5IWAF 1G3OA 1WWHA 2EPIA 2HS4A 1OJ4A 1Q79A 1FXRA 2LLZA 2P9EA 2QL5B 2V4JA 3LP1B 3LGMA 3DOMA 1TL3B 4KKOB 2C2EA 1SKWA 2PEBA 2HZVA 1ZH5A 3VAIA 4ZLLA 2XO6A 4NLTA 3FUYA 2DXDA 4L75A 4WYWA 5CZXA 3G8QA 5K8NA 4Y2KA 4F3MA 4DV5J 2ADCA 5D78A 2B5JA 4F50A 3TAQA 2M52A 3OHAA 4MK9A 4NZ6A 1RKJA 2H48B 8RUCA 2B43A 3KLFA 3LP0B 4Q5VA 2LDIA 2XB2D 1P9YA 2BVZA 2V67A 4GVBA 3GQCA 3VZIA 1F3FA 4ZDNA 4J9NA 3HD2A 2DNMA 2I2YA 2ZVIA 4U67Q 3W2WA 4GVLA 2YKAA 2ZC4A 4LF6J 4N76A 3PACA 2G9OA 3BBBA 4EU0A 4L76A 3MECB 2ZUGA 4ZJLA 2VV5A 3THPA 3RJMB 2KXHA 1GXLA 2W7AA 4YY3J 3I0SB 3CE8A 2I5JB 2L9DA 2PD1A 4Q0BA 1OY9A 1JLCB 3FSXA 3CDUA 1CJVA 2GGPB 8AT1B 5KT4A 3HVAA 3I0RB 3QO9B 3CPWR 4J9SA 3KHRA 1JXEA 1RACB 2NCKL 3QWUA 1CULB 4LRDA 4OIXA 4XK8C 3UFCX 3KLHB 4WKRA 2NUHA 3GZ7A 4USTA 3GJQB 4F4AA 1T05B 2CJAA 3R2CJ 3PR4A 2WAQD 1FT8A 3OR2A 5HROB 1U24A 1C2PA 2ATCB 3UCUP 2WSCC 2I6WA 4F4XA 4YR2A 1FX4A 3RYLA 1QDUB 2GVDA 3R5GA 2H4WB 2C1EB 4PCQA 4AUKA 4E8UA 1ZZNA 3KG0A 4DI6A 1RT6A 1NK4A 3D1QA 1HYSB 1VK3A 4HH1A 3MEDB 2ASDA 2RSQA 1RWNB 2XCAA 1N6QB 2XS7A 3X1LB 2HHTA 1AFIA 3ISZA 3T1AA 4N41A 3DLJA 1T8EA 2FYXA 2F4VJ 3QAUA 1NJYA 2C3PA 3X3UA 5D6GA 2J6SA 5E3RA 1N5YA 3IM8A 2DGVA 4BDPA 1RTIA 2RS2A 2ZHOA 2VDHA 3WC2A 1R31A 2WBMA 4RUAA 4KH1B 2ZOFA 2ZH6A 1I1GA 3J81j 2V2ZA 3ITHB 3A13A 1S1VB 4E2FB 2FVQA 4A47A 5J2NA 2MSTA 2IDEA 1RI7A 1H7WA 2XBPA 4G1QB 1VYAA 3A8KA 4DMZA 1F9EB 3TA1A 2QE5A 1O8BA 3PKYA 4J7CA 1GXTA 3W64A 3FQKA 2IA6A 4CTAA 1UP1A 5DDQC 2MQQA 3H5YA 2IM3A 4ZJQA 1SIZA 1TL5A 1UW9A 2OFHX 2YKOA 5B0FA 2BANB 4XO0A 2P6TA 3BSNA 4K0KJ 1UEVA 5CCLA 3HSZA 1X4AA 3NGRA 4JI0J 5BYRA 1U47A 1FRMA
chains in the Genus database with same CATH topology
4JI8F 4MIBA 5KT3A 4AE5A 4KQZA 5L1LA 1X4BA 3OVSA 3SSQA 2RJZA 2MZRA 1UVJA 3PJXA 1REVB 4QR0A 2AQ4A 3TAMA 1NRKA 1X8DA 3HI9A 4A8XA 1YG0A 3MM6A 2KZMA 4YB7A 2K3KA 5KT6A 4NMLA 4D3HA 4CT8A 3HP6A 3EGWB 4KSEB 2DVIA 1FO1A 3HHEA 5KT7A 2ZZNA 5GAHU 2IM2A 4GO5X 3CMAS 2CPYA 2XI3A 3MFIA 4O3QA 2JX2A 3P96A 3JB9k 2DGUA 5K14B 1U6BA 3HVTB 3GV8B 4YOEA 1HARA 1RTDA 4RW7B 1IKYB 3K0JA 3OL7A 4LSNB 1OSDA 2ZH1A 3CDBA 2BQRA 3K8VA 5KFYA 5B09A 4CH1A 1N33F 1JJ4A 2MY7A 1UJ6A 4TU8A 1WG5A 4DL2A 1UJ5A 3Q22A 4CIOA 2PGCA 1AW0A 4LSLA 1LW0A 5K8PA 1YQHA 1FE4A 4RLEA 3THVA 2JJ4D 3TAMB 1TL1A 4NLDA 4USIA 4B9TA 2VBXA 2I38A 5FD1A 1REVA 1JLEB 2CPIA 2EFOA 3Q2SC 4KT0C 2F8HA 1S76D 3I32A 3N5BA 1HBUB 1VJWA 3HT3A 2O3DA 4PQAA 3TR5A 3J7Z5 2W7PA 2OMLA 2RS8A 2YKNA 4C0BA 2KFYA 1KTQA 1BWEA 1RTHA 2L48A 4QWDA 1E6YB 2IYIA 5A0YB 3LWLA 2J7UA 2ZH5A 1K8AT 1R43A 2LU1A 2HHUA 4ILRA 3SCLE 3AH6A 2GMJA 1EP4B 4PWDB 4M5DB 4HI2A 5GAGI 4X4VA 1JLGA 1VIXA 1JLQA 1MMLA 3OL6A 2MJUA 1JXLA 4ZCMA 3VAJA 4K0KF 4G1QA 3CJ3A 4EGLA 4URQU 4X4QA 2RQ4A 1XWLA 3CCVS 4DFKA 3D0IE 4AL5A 3U02A 2MDAA 3M6UA 3ZZOA 3RAMA 4MH8A 4ETXA 2MKCA 2O5DA 1L3KA 2DTJA 3JSBA 2CJKA 2A10A 3O44A 4J5OA 4DHVA 2GJ2A 3SEOA 2IMWP 4F4WA 5EWEA 4MK8A 2B4UA 1Z2LA 5I3PA 3T9NA 1K73T 3TVKA 2ZKTA 1HYSA 1YTYA 1N54B 3QGHA 2DGSA 3CCTA 3CD5A 3UQSA 1JJHA 5E5NA 2HG4A 4YB5A 4DLGA 2VKRA 3GE9A 2DISA 1N36F 1M5VC 2ABYA 1D8YA 4GKKF 1VQYA 5HROA 3FQLA 1T05A 4OQJA 4AYBD 2GO9A 3H98A 1P27B 1RGVA 2RB7A 1KHWA 3R3TA 2ZHBA 2UUTA 3OHBA 4EYIB 3MPVA 1NJWA 2DJWA 2KFNA 4ZPDA 4A8MP 1C0TB 2LXIA 5KFMA 4HDGA 4IDKA 4J9LA 2VG6B 2YH0A 1OPZA 4JV0A 3GV7B 1N34F 4M95A 3POTA 4NLPA 4O3SA 4Q8FA 2DHGA 5KFIA 4IRKA 2VQEF 2DT9A 1URRA 4ID5B 2J5AA 4EWTA 1Q8BA 5KFPA 1YJTA 1BQMA 3BR9A 2X3GA 4KV8B 1L3TA 1O0PA 2MKJA 3BQ2A 1VK8A 4B17A 2HNZB 1Y5LB 1FERA 2OP5A 5IT4A 2KRRA 2ZH2A 3TUIC 4UQGA 2B5JB 2M70A 2IVFB 2D7SA 4QCLA 4UUXA 2R7TA 2EK6A 2DR9A 4OLOA 6FD1A 2IBOA 2RT3A 5DG7A 5CCLA 1ZPVA 1UVKA 3OTBA 5A8RB 2XSJB 3I5BA 4KKOA 3H8YA 5KG2A 2V4JB 3H40A 2LECA 4C8LA 1TZ0A 5D8HB 3IRXA 1HBMB 4PKDB 3Q0AA 4NCBA 2MQMA 2OO4A 1FNXH 3DI6A 2EKYA 2C3UA 4RNOA 4Y6IA 3TANA 4FN5A 3C46A 2HHSA 2GX8A 2GMHA 2LXUA 3G6ES 4CCHA 1C1BB 1QY7A 2DGTA 4HKQA 3CJKA 1YVFA 1VC5A 5F8LA 2FJVA 2ZJPQ 1PGZA 1XR7A 2B9YA 1CLFA 4RU2A 2ZH4A 4ZVEA 3UD4P 4DQIA 2FGCA 3DLHA 4IOBA 3R5CA 1FK9A 2BDPA 3CMES 3D0HE 3NLCA 4ZCLA 2V9WA 1ZM4A 2DIUA 4DSJA 3GIJA 2Q1LA 3D1HA 2AYBA 2F9DA 3U1MA 5L9NA 1KQSR 1KLMB 1X0PA 2PMZD 1APSA 1QAIA 1NNDA 2KJWA 2BXJA 1P9QC 2Z2LA 4WFXA 3VAFA 2VC0A 3IXQA 2R7SA 2Y1RI 3RW6A 2CQDA 4DN9A 2LEBA 1VGYA 2WB4A 1UEUA 2FLOA 2E9RX 2IAJA 2C3OA 3L95X 5IQQA 1VQOS 5A6WA 1OO0B 4HVZA 1R0AA 3QAEA 2IBKA 2GIQA 2XG8A 1SJRA 4YDXA 5HBMA 1YSJA 4FBTA 4ZP7A 1VOMA 5T7LA 1O51A 1MROB 1TVRA 2KFZA 5DLGA 2CQCA 4JI2F 1FVQA 2LMIA 1VFJA 2AD9A 2DNGA 5LXYA 4DWIA 2EI5A 1DTTB 4A8SA 5KG6A 1DBDA 3FMBA 5F3TA 1HQEA 4N77A 1HA1A 1QSLA 3MGJA 3M2UB 2MZTA 2CZVC 2SXLA 4OZLA 4ES1A 1CEZA 2KHDA 2KO1A 1D3WA 1LWEA 3NGKA 2BM0A 2OAUA 3IWLA 4PXDA 1UAWA 4X66F 3PV8A 1S0MA 2G0CA 5L1KA 1KR4A 3ZFVA 4B9VA 2XWYA 4KAIA 3W2VA 3HHLB 5A6PA 1VQ8S 5EWGA 1BQXA 2CQGA 3I82A 3TP2A 5HMZA 1SKRA 4Q8EA 1YHQS 2PE8A 1YJRA 2XC9A 4NX9A 1IR0A 3RB4A 2CPEA 4AL7A 4FF2A 3E01B 5B0BA 2HFZA 1A7GE 3RTVA 4I4BA 4PXEA 3BN4A 2HVIA 5KFOA 2YNGA 2E5HA 2V5HG 2L41A 5M2UA 2HYIB 2X1AA 3SYZA 3OUYB 3MDFA 5D3GB 1FE0A 2GMLA 3K2YA 3UWTA 1SC6A 3RBDA 5CYQA 4WZQA 3MOZA 4OX6A 1Q81T 3OR1A 1FRXA 2E7XA 1WHWA 4JI6F 2AWZA 3HVRA 4NLVA 1IKVB 1RISA 4OJ3A 1M90T 3MEEA 1X9MA 3FEXB 1NEEA 3J80Y 2IFXA 1SL0A 4C98A 2CJQA 2KU7A 3CDEA 2HW3A 1IKWA 4DS4A 2E9ZA 2VPXB 3CSKA 1F5AA 3KNGA 3O2IA 4TLQA 2FLPA 4I64A 1TKZB 3OJUA 3B78A 5KFVA 5GAGU 3G71S 2ZHAA 4QR2A 1FEEA 1Y00A 5BJRA 4DV6F 1S1TA 1HNIB 2O67A 5KFDA 2RF2B 4X4NA 2DNYA 4RZRA 3MEEB 4I6YA 4LF8F 1YJVA 4MFBB 2WONA 2LEAA 3S01A 5KFKA 1WEYA 3VZHA 2CQ2A 3IRWP 3HK2A 2KB2A 1BY9A 4EZ9A 4O3PA 4WCEQ 3KLEB 4CO5A 1D1UA 2ZITA 3OUYA 1RA6A 2LVWA 2VBYA 2XMWA 1JLFB 1R8CA 3GG0A 2Z2MA 3QIPB 4IFVA 1HBOA 2D74B 4KGKA 2R7WA 2YNGB 3QYYA 4G1IA 4ECSA 3NL0A 4UQTA 5J1NA 4B3OB 4K4SA 4OJGA 5F0UA 3OPKA 4TKTA 4DV4F 1RT2B 2ATLA 3LAMA 1S1XB 2OFGX 5HMYA 5L1IA 3MR2A 4HT5A 1LWFB 2HS0A 1KTVA 3TVZA 5B7WA 1MMDA 4QWCA 4B02A 2L08A 1U7LA 2B4OA 2BYCA 3Q23A 1N8RT 2B6AB 1HQUB 4XAKA 5H9EJ 1N88A 1LWEB 4K5RA 3IG1A 4RUHA 4OHXA 3IS9A 4ZP9A 3DRSB 1H2UX 1FDNA 3AHPA 4NPOA 7FD1A 5KG5A 1QJHA 2DRAA 1HQEB 2DRBA 4HTJA 3S7RA 1OSCA 3GB0A 1QTMA 2JEIA 4ZK7M 4ED0A 1DTTA 5F8JA 3WZ0A 4WFBQ 4ECRA 1WF2A 5KG0A 2NPFA 1S72S 4H4OA 3DRRA 3P6YC 2IRYA 1G6BA 3E8OA 4U9RA 4DSKA 3BSAA 3I96A 4IH7A 3KLIB 5HBMB 2V4QA 2XEXA 4IYQA 3KMSA 4Y00A 4N56A 4RWXA 3ENVA 1CPZA 4KR0B 2R2RA 2HAIA 4HI1A 4Y2MA 3DLGA 2BJEA 3M30A 4ZHRA 1NK9A 5D4NA 5DG8A 5HI7A 4I67A 2CPFA 1TL4A 2I8EA 4BC9A 5LXRA 4F25A 2R7VA 3CJ0A 4W92B 2XMMA 4QZVB 3UR3C 3PEJA 2UUWA 3MFHA 2XI2A 3QLHA 1VC6A 4J9QA 3V6DB 2MYFA 2DNNA 4PRFA 1SV5B 2FGOA 3ONQA 3UD3P 3D28A 2M7SA 1LKZA 2KYZA 3RU0A 3AJ2A 4LIRA 4UW2A 3N79A 1ZOTA 3P5TL 4I2PB 3FMWA 2JDJA 4GC6A 3R27A 5CXTA 3HMJG 4DSLA 4CT9A 4MK7A 5EDWA 1ZYQA 4ECUA 5LL6d 3CCLS 2E5LF 3Q8RB 3AAWB 3W3SA 2KN4A 5I3QA 2IC3B 3H2LA 2F1FA 2FPHX 2CPJA 1BQNA 2XZWA 2LA6A 5KFNA 3I87A 1SQEA 4FXWA 2EVZA 5J1EA 3MTJA 1SBRA 3OJSA 4LJMA 2JRSA 4O4GA 4F67A 5H1SV 4OX8A 5E41A 5GMKa 5F3ZA 1N5TA 3SQGA 2M9KA 3IRXB 2FUG9 1Q1KA 4IRDA 3NP5A 2WSFC 3TI0A 4M8LA 1MW7A 5FDLB 5A8RA 1HR0F 2RUGA 5LSRA 2ZNZA 2BE2B 4B08A 3KK1B 1JMTA 3FDSA 1ZZFA 3T5KA 1K9MT 3DXSX 2FD2A 4A8OA 1FRJA 4CZCA 1T02A 3SCJE 3CULA 4NLRA 5L39A 1D0EA 5J2MA 3I55S 4ICLB 1VRUB 3KLGB 1L5UA 2W9AA 5DM7Q 1U1KA 4KV8A 4ELVA 1F5CA 5I4MA 4C3KA 3MR5A 2UXDF 1S6OA 3CCZA 4ID5A 4DBQA 4FS1A 2MZ1A 4G3IA 3G6VA 2R2TA 4DR6F 1W25A 2C2RA 3D0GE 2VA3A 1IUJA 4MYUA 1KS2A 1S0OA 1XNRF 2UV8G 5G0RA 1FHTA 1EETA 1E6VA 1WACA 1S1UB 1PC4A 4QU7A 1W2BR 3AQOA 1Z4UA 5E7OB 2MQOA 4OI2A 2VL1A 5IM0A 3K5MA 3DXBA 3T5JA 4ZVHA 1QSYA 2OH2A 2V94A 1XERA 4HH0A 1KVJA 4F3OA 1OPIA 2FJBB 1LV5A 1FNMA 4BCAA 4IFYB 3TA0A 4NYPA 1S6QA 3CCWA 1WG4A 3ENQA 4NA3A 2V8DA 4RW4B 1QUVA 4I2QA 1S9FA 4FNIA 1X9WA 2HLUA 2KHCA 1M5SA 5E3AA 2C42A 1OIAA 3HHNB 2YNFA 4R8UB 1V3SA 5B0CA 3BSCA 4PG5A 2DCLA 2XULA 3F44A 2N82B 1HBNB 2CQIA 2LXFA 2O66A 5ITHA 1S1WB 4QIEA 4NLUA 1B0VA 1U09A 1VQPS 3CF5Q 1S49A 4OLPA 4OZ0A 1RTJA 1SJ1A 1JLBB 2E44A 2DNZA 3PIPQ 2E5IA 2W7OA 4YP3A 4KO0A 2ZD1A 2VC1A 2LQJA 1DTQA 2CVIA 4WK3A 1XMBA 2RQCA 3GFYA 2J0SD 2KI2A 1JWWA 4C8OA 5JVGQ 2R7RA 4ZPWR 1S0VA 1DTQB 1JLGB 1X5SA 2I9SA 2J0XA 1HW9A 1RK8A 3U1LA 4PWDA 2FLNA 3N9UC 2J6UA 2YNHB 5B08A 3AQPA 1M0SA 1HWIA 1E6YA 2POKA 2XHWA 4K5SA 1S6PB 2XMTA 4Y3CA 4X2BA 3K5NA 4F8RA 1NK8A 2ASLA 3QGGA 4UOCA 4DR5F 4GMKA 2MZQA 3IC1A 2K7KA 3F41A 1TL1B 3CUNA 4WF9Q 2VB6A 4I2QB 3PXGa 5F8MA 4KFBB 5IT9Y 3LF0A 4Q2LA 3M4XA 1CC7A 2WB1D 5IM0B 3K5PA 3M6XA 3MD3A 1FTCA 1VQ4S 2PT0A 1IKYA 3NCQA 3HKWA 1M1KT 1RTDB 2X1BA 4FF1A 1S1UA 3PKMA 2UUCF 1QUPA 3TVYA 1MSWD 3V6JA 2QV6A 5G0RB 3UCZP 2A3JA 2HMIB 2RKIB 1V3RA 2YX7A 2ZDPA 4ZLPA 3AB4B 2N7YA 2UUBF 4MKYA 5CYMA 3CC7S 1NO8A 2AX1A 4OI0A 2A2DA 2B9WA 3QJJA 3S8SA 1Y7PA 3BR8A 3OL9A 1K0TA 3CJ2A 3CCQS 5HN0A 1TFYA 3EUNA 4FXVA 4DF8A 2B4PA 2W9CB 4ICLA 1KNZA 4LQ9A 4ECVA 4GC7A 3C8YA 1FXLA 2HRUA 2CJBA 3UI3A 2OSRA 5D4LA 3V6HA 3ZZ0A 1Y3KA 1XNQF 3VAGA 5KFEA 5F8GA 2NQPA 4JI3F 2ASJA 2YTCA 2R8KA 2E1AA 1TK5A 2DNLA 4LFCF 5E3CA 4R0JA 2VOOA 2OMOA 2OKQA 2DNKA 5FDLA 4ES3A 3EPIA 1LW2A 3FFIB 4QIVA 3CWJA 3H5XA 2U1AA 2MGZB 4KTQA 1KEKA 1RA7A 4O4GB 5LMNF 3TQ1A 1S1VA 4X64F 5J1EB 1IXKA 2XS7A 1CQMA 3HHLC 3Q8SB 1L3VA 3RZAA 2AX0A 3U27A 4YFUA 4W90B 4ZOSA 1RTIB 1YBAA 2IC3A 2BUNA 1B0PA 4RNMA 3BGRB 1S9GB 3MM7A 3RW7A 4RUCA 2YQ3A 4USHA 2VH7A 2NLWA 1U1OA 3KLVA 2PA3A 3CIZA 2DD8S 3MEDA 4YR3A 3UW1A 1KLNA 1KHVA 2HWTA 4RBVA 2AJ4A 5AXMA 3GFHA 2VPYB 4UY85 3MXHP 3I56S 2Q3PA 3I9ZA 2XY6A 4ZPAA 2XGPA 1WTBA 3OLBA 3QLHB 3PO4A 3KHHA 1FDBA 1H2TZ 4I6WA 3H59A 2MZSA 3JSRA 2AJQA 4H4KC 4Q43A 3E2EA 3DLGB 4ZHRB 1DARA 5CQGA 1P1TA 2H5EA 1VRTA 1CC8A 1HWLA 2I5JA 3DCAA 2QRRA 5E0OA 3OQ2A 4X65F 3KLIA 4IG3B<