3AIAA

Crystal structure of duf358 reveals a putative spout-class methltransferase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
200
structure length
200
Chain Sequence
MREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCITIIHNVLDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0217 protein MJ1640
publication title Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.257: tRNA (pseudouridine(54)-N(1))-methyltransferase.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04013 Methyltrn_RNA_2 Putative SAM-dependent RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3aiaA00
3ONPA 1K3RA 2EGWA 3E5YA 4CNEA 3OINA 4YVJA 4YPXA 4YQOA 3L8UA 4KGNA 2QWVA 3QUVA 4YQTA 2Z0YA 1MXIA 1UAKA 4X3MA 1J85A 1NS5A 4KDZA 4RG1A 1X7OA 3O7BA 4YQJA 4YQNA 5FAIA 4YQ5A 4YQSA 3DCMX 3IEFA 1UALA 4YQ4A 3N4KA 3ILKA 4CNGA 1VH0A 4YQBA 4J3CA 4YQPA 3AI9X 4YQIA 3GYQA 4YPZA 4YQ2A 4YVKA 1UAJA 3KY7A 3N4JA 4YQ0A 4YQ6A 4YQ7A 4CNFA 1UAMA 5GMCA 4YVIA 1Z85A 3KTYA 1VHYA 1P9PA 2V3KA 2QMMA 3BBDA 5CO4A 1X7PA 4YQGA 5D9FA 1IPAA 1NXZA 4YQCA 1V2XA 4YQKA 3IC6A 4IG6A 4H3YA 3OIIA 4FAKA 4YQ9A 4YQ3A 3AIAA 4H3ZA 2I6DA 4JAKA 3NK6A 2V3JA 3KNUA 4YQAA 1ZJRA 5GMBA 4MCCA 1VHKA 1O6DA 4CNDA 4MCBA 3AXZA 3BBHA 1V6ZA 4YPYA 1TO0A 4YVGA 4YQRA 2O3AA 4YQLA 2HA8A 4XBOA 2CX8A 2EGVA 4YQDA 4YQQA 4YQ1A 2YY8A 4PZKA 4MCDA 5GM8A 3BBEA 1OY5A 4YPWA 1GZ0A 3NK7A 4L69A 4YQ8A 3KW2A 4E8BA 4JALA 4YVHA 3OIJA 4X3LA
chains in the Genus database with same CATH superfamily
3ONPA 1K3RA 2EGWA 3E5YA 4CNEA 3OINA 4JWJA 4YVJA 4YPXA 4YQOA 3L8UA 4KGNA 2QWVA 3QUVA 4YQTA 2Z0YA 1MXIA 1UAKA 4X3MA 1J85A 1NS5A 4KDZA 4RG1A 1X7OA 3O7BA 4YQJA 4YQNA 5FAIA 4YQ5A 4YQSA 3DCMX 3IEFA 1UALA 4JWGA 3N4KA 4YQ4A 3ILKA 4CNGA 1VH0A 4YQBA 4J3CA 4YQPA 3AI9X 4YQIA 3GYQA 4YPZA 4YQ2A 4YVKA 1UAJA 3KY7A 3N4JA 4YQ0A 4YQ6A 4YQ7A 4CNFA 1UAMA 4JWHA 5GMCA 4YVIA 1Z85A 3KTYA 1VHYA 1P9PA 2V3KA 2QMMA 3BBDA 5CO4A 1X7PA 4YQGA 5D9FA 1IPAA 1NXZA 4YQCA 1V2XA 4YQKA 3IC6A 4IG6A 4H3YA 3OIIA 4FAKA 4YQ9A 4YQ3A 3AIAA 4H3ZA 2I6DA 4JAKA 3NK6A 2V3JA 3KNUA 4FMWA 4YQAA 1ZJRA 5GMBA 4MCCA 1VHKA 1O6DA 4CNDA 4MCBA 3AXZA 3BBHA 1V6ZA 4YPYA 1TO0A 4YVGA 4YQRA 2O3AA 4YQLA 2HA8A 4XBOA 2CX8A 2EGVA 4YQDA 4JWFA 4YQQA 4YQ1A 2YY8A 4PZKA 4MCDA 5GM8A 3BBEA 1OY5A 4YPWA 1GZ0A 3NK7A 4L69A 4YQ8A 3KW2A 4E8BA 4JALA 4YVHA 3OIJA 4X3LA
chains in the Genus database with same CATH topology
3ONPA 1K3RA 2EGWA 3E5YA 4CNEA 3OINA 4JWJA 4YVJA 4YPXA 4YQOA 3L8UA 4KGNA 2QWVA 3QUVA 4YQTA 2Z0YA 1MXIA 1UAKA 4X3MA 1J85A 1NS5A 4KDZA 4RG1A 1X7OA 3O7BA 4YQJA 4YQNA 5FAIA 4YQ5A 4YQSA 3DCMX 3IEFA 1UALA 4JWGA 3N4KA 4YQ4A 3ILKA 4CNGA 1VH0A 4YQBA 4J3CA 4YQPA 3AI9X 4YQIA 3GYQA 4YPZA 4YQ2A 4YVKA 1UAJA 3KY7A 3N4JA 4YQ0A 4YQ6A 4YQ7A 4CNFA 1UAMA 4JWHA 5GMCA 4YVIA 1Z85A 3KTYA 1VHYA 1P9PA 2V3KA 2QMMA 3BBDA 5CO4A 1X7PA 4YQGA 5D9FA 1IPAA 1NXZA 4YQCA 1V2XA 4YQKA 3IC6A 4IG6A 4H3YA 3OIIA 4FAKA 4YQ9A 4YQ3A 3AIAA 4H3ZA 2I6DA 4JAKA 3NK6A 2V3JA 3KNUA 4FMWA 4YQAA 1ZJRA 5GMBA 4MCCA 1VHKA 1O6DA 4CNDA 4MCBA 3AXZA 3BBHA 1V6ZA 4YPYA 1TO0A 4YVGA 4YQRA 2O3AA 4YQLA 2HA8A 4XBOA 2CX8A 2EGVA 4YQDA 4JWFA 4YQQA 4YQ1A 2YY8A 4PZKA 4MCDA 5GM8A 3BBEA 1OY5A 4YPWA 1GZ0A 3NK7A 4L69A 4YQ8A 3KW2A 4E8BA 4JALA 4YVHA 3OIJA 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONP A;  1K3R A;  2EGW A;  3E5Y A;  4CNE A;  3OIN A;  4YVJ A;  4YPX A;  4YQO A;  3L8U A;  4KGN A;  2QWV A;  3QUV A;  4YQT A;  2Z0Y A;  1MXI A;  1UAK A;  4X3M A;  1J85 A;  1NS5 A;  4KDZ A;  4RG1 A;  1X7O A;  3O7B A;  4YQJ A;  4YQN A;  5FAI A;  4YQ5 A;  4YQS A;  3DCM X;  3IEF A;  1UAL A;  4YQ4 A;  3N4K A;  3ILK A;  4CNG A;  1VH0 A;  4YQB A;  4J3C A;  4YQP A;  3AI9 X;  4YQI A;  3GYQ A;  4YPZ A;  4YQ2 A;  4YVK A;  1UAJ A;  3KY7 A;  3N4J A;  4YQ0 A;  4YQ6 A;  4YQ7 A;  4CNF A;  1UAM A;  5GMC A;  4YVI A;  1Z85 A;  3KTY A;  1VHY A;  1P9P A;  2V3K A;  2QMM A;  3BBD A;  5CO4 A;  1X7P A;  4YQG A;  5D9F A;  1IPA A;  1NXZ A;  4YQC A;  1V2X A;  4YQK A;  3IC6 A;  4IG6 A;  4H3Y A;  3OII A;  4FAK A;  4YQ9 A;  4YQ3 A;  3AIA A;  4H3Z A;  2I6D A;  4JAK A;  3NK6 A;  2V3J A;  3KNU A;  4YQA A;  1ZJR A;  5GMB A;  4MCC A;  1VHK A;  1O6D A;  4CND A;  4MCB A;  3AXZ A;  3BBH A;  1V6Z A;  4YPY A;  1TO0 A;  4YVG A;  4YQR A;  2O3A A;  4YQL A;  2HA8 A;  4XBO A;  2CX8 A;  2EGV A;  4YQD A;  4YQQ A;  4YQ1 A;  2YY8 A;  4PZK A;  4MCD A;  5GM8 A;  3BBE A;  1OY5 A;  4YPW A;  1GZ0 A;  3NK7 A;  4L69 A;  4YQ8 A;  3KW2 A;  4E8B A;  4JAL A;  4YVH A;  3OIJ A;  4X3L A; 
#chains in the Genus database with same CATH topology
 3ONP A;  1K3R A;  2EGW A;  3E5Y A;  4CNE A;  3OIN A;  4JWJ A;  4YVJ A;  4YPX A;  4YQO A;  3L8U A;  4KGN A;  2QWV A;  3QUV A;  4YQT A;  2Z0Y A;  1MXI A;  1UAK A;  4X3M A;  1J85 A;  1NS5 A;  4KDZ A;  4RG1 A;  1X7O A;  3O7B A;  4YQJ A;  4YQN A;  5FAI A;  4YQ5 A;  4YQS A;  3DCM X;  3IEF A;  1UAL A;  4JWG A;  3N4K A;  4YQ4 A;  3ILK A;  4CNG A;  1VH0 A;  4YQB A;  4J3C A;  4YQP A;  3AI9 X;  4YQI A;  3GYQ A;  4YPZ A;  4YQ2 A;  4YVK A;  1UAJ A;  3KY7 A;  3N4J A;  4YQ0 A;  4YQ6 A;  4YQ7 A;  4CNF A;  1UAM A;  4JWH A;  5GMC A;  4YVI A;  1Z85 A;  3KTY A;  1VHY A;  1P9P A;  2V3K A;  2QMM A;  3BBD A;  5CO4 A;  1X7P A;  4YQG A;  5D9F A;  1IPA A;  1NXZ A;  4YQC A;  1V2X A;  4YQK A;  3IC6 A;  4IG6 A;  4H3Y A;  3OII A;  4FAK A;  4YQ9 A;  4YQ3 A;  3AIA A;  4H3Z A;  2I6D A;  4JAK A;  3NK6 A;  2V3J A;  3KNU A;  4FMW A;  4YQA A;  1ZJR A;  5GMB A;  4MCC A;  1VHK A;  1O6D A;  4CND A;  4MCB A;  3AXZ A;  3BBH A;  1V6Z A;  4YPY A;  1TO0 A;  4YVG A;  4YQR A;  2O3A A;  4YQL A;  2HA8 A;  4XBO A;  2CX8 A;  2EGV A;  4YQD A;  4JWF A;  4YQQ A;  4YQ1 A;  2YY8 A;  4PZK A;  4MCD A;  5GM8 A;  3BBE A;  1OY5 A;  4YPW A;  1GZ0 A;  3NK7 A;  4L69 A;  4YQ8 A;  3KW2 A;  4E8B A;  4JAL A;  4YVH A;  3OIJ A;  4X3L A; 
#chains in the Genus database with same CATH homology
 3ONP A;  1K3R A;  2EGW A;  3E5Y A;  4CNE A;  3OIN A;  4JWJ A;  4YVJ A;  4YPX A;  4YQO A;  3L8U A;  4KGN A;  2QWV A;  3QUV A;  4YQT A;  2Z0Y A;  1MXI A;  1UAK A;  4X3M A;  1J85 A;  1NS5 A;  4KDZ A;  4RG1 A;  1X7O A;  3O7B A;  4YQJ A;  4YQN A;  5FAI A;  4YQ5 A;  4YQS A;  3DCM X;  3IEF A;  1UAL A;  4JWG A;  3N4K A;  4YQ4 A;  3ILK A;  4CNG A;  1VH0 A;  4YQB A;  4J3C A;  4YQP A;  3AI9 X;  4YQI A;  3GYQ A;  4YPZ A;  4YQ2 A;  4YVK A;  1UAJ A;  3KY7 A;  3N4J A;  4YQ0 A;  4YQ6 A;  4YQ7 A;  4CNF A;  1UAM A;  4JWH A;  5GMC A;  4YVI A;  1Z85 A;  3KTY A;  1VHY A;  1P9P A;  2V3K A;  2QMM A;  3BBD A;  5CO4 A;  1X7P A;  4YQG A;  5D9F A;  1IPA A;  1NXZ A;  4YQC A;  1V2X A;  4YQK A;  3IC6 A;  4IG6 A;  4H3Y A;  3OII A;  4FAK A;  4YQ9 A;  4YQ3 A;  3AIA A;  4H3Z A;  2I6D A;  4JAK A;  3NK6 A;  2V3J A;  3KNU A;  4FMW A;  4YQA A;  1ZJR A;  5GMB A;  4MCC A;  1VHK A;  1O6D A;  4CND A;  4MCB A;  3AXZ A;  3BBH A;  1V6Z A;  4YPY A;  1TO0 A;  4YVG A;  4YQR A;  2O3A A;  4YQL A;  2HA8 A;  4XBO A;  2CX8 A;  2EGV A;  4YQD A;  4JWF A;  4YQQ A;  4YQ1 A;  2YY8 A;  4PZK A;  4MCD A;  5GM8 A;  3BBE A;  1OY5 A;  4YPW A;  1GZ0 A;  3NK7 A;  4L69 A;  4YQ8 A;  3KW2 A;  4E8B A;  4JAL A;  4YVH A;  3OIJ A;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...