3AIKA

Crystal structure of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 303aa long hypothetical esterase
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 102
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aikA00
1T2NA 2ZSHA 5AK3A 4ZWNA 1ZD3A 4GXNA 2ECFA 3PI6A 1XZHA 3LP5A 3VJMA 5JAUA 4B9AA 5HQ3B 2BUCA 5T4BA 1LNSA 4B0OA 3IUNA 2LIPA 2QJRA 1EH5A 1MNAA 1XRRA 1DTEA 1JU3A 1LLFA 3WL8A 2X5XA 4RE6A 4CG3A 2ZJ7A 4HTAA 1O6GA 4CIAA 2OCGA 3WZLA 1G42A 4KJXA 4K6KA 2RHTA 1BRTA 1H2ZA 6YASA 4KAJA 3N2ZB 5ALTA 1EDEA 2D5LA 5K3FA 1SC9A 2ZJ6A 4DMKA 4OSEA 1EDDA 5JARA 3VDXA 4FFVA 4X92A 1BCSA 4KACA 4CCYB 5LKRA 2E3JA 1Y37A 2HA4A 3FVRA 4FNMA 5FP0A 2QR5A 4DIUA 3DKKA 4LYDA 4X95A 3LCRA 3D3NA 3IUJA 3WKBA 2DQZA 3BJMA 5CT5A 4J0KA 4B85A 4G4GA 1ZIYA 2PUJA 4OD0A 4Y2VA 3O4HA 2ACEA 3V1NA 2PBLA 4K5QA 1XLVA 2QS9A 3STUA 1YS2X 3G0BA 2JEZA 3DOIA 5ALZA 5CURA 3GFFA 4HZGA 2ONCA 1GKKA 1OCEA 4FLFA 4AN0A 3STXA 2Y6UA 1CPYA 1YASA 4MYDA 2J3DA 2JIDA 5C81A 2HM7A 4WFKA 4X00A 1AUOA 4H77A 4L0CA 1D07A 4X71A 1CUHA 4C89A 1CUSA 5CXUA 3CXUA 3D2AA 3QMWA 1W1IA 1N8SA 1IZ8A 4B0PA 3IDAA 1FSSA 1EDBA 1WB5A 1IVYA 2OQIA 1AURA 3ESDA 1CUEA 4M0MA 2RONA 2VJCA 4V2IA 4HXEB 4RGYA 1QJ4A 1ACLA 4RNCA 5FV4A 3G9XA 4DMCA 4G5XA 1CUVA 1C7IA 1XQWA 3ED1A 1J07A 2JGFA 3KDAA 2WFLA 5HF8A 1FJ2A 2QT9A 5K5EA 1ISPA 3EBLA 5C8XA 3EQ9A 1THGA 2D0DA 3HLKA 3WKAA 4GDMA 4PQEA 1UT6A 5AOBA 4J7AA 4OCZA 3WQHA 1LPPA 5BV7A 1JI3A 2XMRA 1WHTA 4FKBA 1LBTA 4DNPA 1UWCA 3KXPA 2EDAA 4FMPA 3DL4A 5IVIA 2V9ZA 2VJBA 1A8UA 5CBKA 3C6BA 1E8DA 3FYUC 1A7UA 1QIFA 5DNWA 3ZLUA 1QIMA 4PNZA 1E5TA 2Y1KA 4DYHA 4ZRDA 1GT6A 4BVKA 4HXGA 2DHEA 2C0PA 2WFMA 4EA6A 2QXTA 1F0PA 1L7RA 3AZOA 2WHQA 5IVDA 3VJKA 4BATA 1Q84A 5HQ3A 4DGQA 4CG2A 1VKHA 5EHQA 5DWDA 4X3CA 3BIWA 5IH7A 5LP1A 1XZBA 4E14A 5BWCA 4DSZA 2QMQA 5HKAA 5SYNA 1CUJA 3HI4A 3V48A 3BXPA 2CBGA 5JAHA 2PM8A 4JNCA 1EK1A 2QJWA 1HPLA 3C45A 4H35A 4BCBA 5AM4A 1FFDA 4BP8A 4IQ4A 3A2NA 4EY5A 3OURA 3BF8A 1QIJA 4B83A 3IA2A 1W76A 5E2IA 4CCYA 4BC0A 1U2EA 1ZICA 4BAGA 3ICWA 2BGNA 3LIPA 4TVKA 4DNFA 5FPQA 5AM0A 5C8ZA 5CT9A 3RARA 3K6KA 4MWTA 2O2IA 4RE5A 2HHAA 1LGYA 3EQ7A 3JW8A 3BF7A 2WUGA 5AJHA 1R88A 1MTZA 3BL8A 2XUOA 4G8DA 4UHFA 4ROTA 4X7BA 2C5FA 1HQDA 3VISA 4JYPA 3HABA 1UFOA 5AKZA 1E89A 4GW3A 2PPLA 3C5WP 4P08A 3HACA 5HFNA 4Y2XA 5EHXA 1YSCA 3PUHA 2QRUA 4UHEA 4X97A 4ZGBA 2G4LA 5ALPA 2PSFA 3H2JA 1ZJ4A 2R8BA 2BJHA 2XLBA 2QUAA 1MNQA 1EA5A 3ANTA 2HRQA 2JEYA 5AI8A 1EVEA 1TRHA 1WHSA 3A6ZA 1DX6A 1BEZA 1AX9A 4N8DA 1DWPA 5DYYA 2WSLA 5AK5A 2H7CA 1UKBA 2OLEA 4FOLA 2RAUA 3BDIA 4KYVA 4FTWA 3H19A 4E15A 3M83A 2VT6A 1BROA 1YCDA 3D4LA 5AK6A 1XQXA 2ZVDA 1LPMA 5A71A 3C87A 3SK0A 1UK7A 4GWLA 3K2IA 4PO3X 2J4FA 5I7UA 2WIJA 4CIBA 3DKRA 3W05A 1SCIA 1IMJA 3VXKA 2VAXA 4UHHA 3PDCA 5I9IA 2IIVA 3NUZA 5K3DA 3DJYA 1W52X 2CB9A 3JWEA 1CUDA 3F97A 2DR0A 2R11A 2W6CX 2VSQA 2XUFA 4Y7DA 4IH1A 2WUFA 1YAJA 3F96A 3ESAA 4WY5A 2P8SA 3A70A 4UFNA 4U2EA 3ANSA 1WB4A 1IUNA 4AO8A 1JJBA 1VXRA 2C0QA 2G5TA 1DWOA 2WIKA 3WA6A 5FXMA 4OU4A 4UFOA 5LZ9A 4X91A 2Z3ZA 3O9VA 5JZ9A 1XLWA 3A2MA 2NW6A 4G9GA 3HZOA 2Z5GA 1EXWA 4C88A 3I2FA 3WIBA 1E8NA 3FCXA 3YASA 4DMFA 2XE4A 5A6VA 3H2IA 3ESBA 1GGVA 1XKLA 3RLIA 2XUJA 2FJ0A 2WUDA 3CN7A 1WB6A 4UHBA 1CVLA 4AMZA 5FUMA 2CMFA 5AIBA 4LHEA 1HDEA 5JZBA 4K6GA 4H7IA 1HLGA 4Y2TA 5JZSA 1GPKA 1CUFA 5CH5A 1L7QA 5LIPA 3OTQA 1XZLA 2WFZA 2PSEA 5CMLA 3M81A 4C87A 3FBWA 4XJVA 1CQZA 2I78A 2OGZA 4C4XA 3QBJA 2XDWA 3V1MA 4FLMA 2WTMA 5K3BA 4IHAA 1FFCA 4YPVA 1QLWA 2PU7A 4MQLA 5HF9A 3R0VA 3G0IA 1CFJA 4KEAA 1G66A 2HA7A 2VTVA 3L1JA 4FBLA 4Y9SA 5ALSA 1N5RA 4FHZA 1UK6A 3HSSA 3DS8A 1NX9A 1IUPA 1TCCA 5LLSA 1XZMA 1LPBB 1MAAA 2HA3A 3EIOA 2GZRA 3KD2A 4QZVA 3FWHA 5AKKA 4MJ3A 4H7HA 1SCQA 3KOOA 3PUIA 1HBJA 1CRLA 1THTA 4GEGA 1LPNA 4NVRA 2XUIA 2QZPA 3AFIA 3IVMA 4F5ZA 5EHNA 1CEXA 1CUCA 1AQLA 5A7GA 1GZ7A 2XT0A 3DYVA 1X2BA 1CR6A 2XB6A 1AKNA 3GA7A 4EY8A 4NS4A 2HU8A 4OUKX 1XZIA 4QDZA 3W06A 2JGIA 3QPAA 1BS9A 2PL5A 3QITA 2Y6VA 4FNGA 1QO9A 1JJFA 1YB7A 2XUKA 2PSHA 2WQZA 3JYHA 2RGUA 2RHWA 4I19A 5AI9A 2XQFA 1ACJA 3R3VA 4DSAA 4H7EA 2BKLA 4CI9A 3NGMA 5HFAA 1J2EA 4UBMA 1P0PA 2GBGA 3I6YA 5F4ZA 5FDFA 4XWGA 4Y2UA 1BN6A 1LPSA 1HKHA 3H2GA 3IUQA 2DQYA 5HK8A 2JGJA 3H0CA 4N8EA 1HL7A 2X76A 4J0IA 4Y2RA 4U2GA 3STTA 3S8YA 1EINA 4PF1A 3B3QA 4PSUA 3I2IA 1E8MA 3STYA 3WK4A 1DT5A 2K2QB 2ZYIA 2HADA 3F67A 4QWWA 2CJPA 1ZI9A 1UK9A 4Y2JA 4IH4A 5BWBA 3M82A 3X3HA 5D7BA 4DTCA 3Q8WA 5ALJA 3AILA 4ITVA 2O2GA 3OG9A 5JADA 1AMNA 5CT4A 1N5MA 1R9MA 5ALUA 1FFAA 1AZWA 3A2LA 2XUHA 1TK3A 4EY4A 5AOAA 1LBSA 1UK8A 1ORVA 3FCYA 1XZDA 1BN7A 2XQKA 2WJ3A 1CLEA 5AI5A 4A23A 1H22A 5ALKA 1FFBA 1LPAB 2XMQA 4U2DA 1QTRA 5AI4A 1DQZA 2O2HA 3G7NA 3PF8A 4W63A 4BCCA 3G0DA 4QDOA 2ZSIA 1VLQA 1JJIA 2JF0A 4X90A 3NOXA 2O7RA 1LZKA 5C8VA 4UHCA 3DEAA 2DSNA 5AOCA 4QDUA 4AQDA 1R4ZA 5JD4A 1AC5A 4W1RA 4Y2SA 2OQVA 3U1TA 4NZZA 3OM8A 1ODCA 1DQYA 1M33A 1QOZA 2WG0A 2WHPB 5ALMA 2OXEA 3FLAA 3UUFA 4H7JA 2H7YA 5DTJA 2V97A 3H18A 4ARBA 3HYSA 2WM2A 4WDRA 4Q3LA 5KREA 4Q34A 2XUGA 3C43A 4B9EA 3D5EA 5CRIA 5AP9A 3I28A 2BGRA 4C4ZA 4WCVA 5AKHA 1PV1A 3C8HA 5C7YA 3IBTA 3QPCA 4LIPD 5JYCA 5ALHA 2PX6A 1VJ5A 4ZV9A 4UBLA 4GI1A 5JD6A 3E3AA 2ZYHA 3H17A 2JGLA 3LLCA 5FOQA 1K5PA 1UKCA 1LPOA 2VQ6A 2I03A 3E0XA 3K9BA 3ZLVA 3FOBA 2HDWA 1XZCA 1L7AA 3R3ZA 1XRPA 3AIKA 2AJDA 3T4UA 2AXEA 1R50A 2GYUA 4ZXFA 5T4FA 3G02A 3SC2A 4BB0A 2OPHA 4CG1A 4FDMA 3I6ZA 3LS2A 5A7FA 1MO2A 2XI4A 3PICA 3U0VA 1ORWA 1MJ5A 3HRHA 3WWOA 1GQSA 4DNQA 3B12A 4GBGA 2VJDA 2FX5A 2QM0A 2JGKA 3TRDA 2AJCA 1GQRA 1VZ2A 5EIEA 3SWWA 4K6HA 1PFQA 4RPCA 2VATA 1W4LA 5HF5A 3H2KA 3L1IA 5FRDA 1XROA 2RIPA 2WUEA 5ALDA 3WA7A 2YASA 3D59A 4UHDA 4OB8A 4QE3A 3MGAA 3KSRA 3QMVA 2XUPA 3WWDA 1X70A 2YH2A 4KE6A 4W9RA 1O6FA 2OAGA 4KRYA 3QZUA 1MU0A 2OCKA 5EGNA 1BCRA 4UBKA 3GZJA 5I8PA 3C70A 3I2HA 3OC0A 4L9AA 4Q3OA 4JEIA 2B9VA 2VF2A 4J3JA 1R1DA 1QGED 3BWXA 2DHDA 5ALGA 4X85A 2V96A 4BE9A 4EBBA 2B61A 4J0JA 5IKXA 1CQWA 2HRRA 4P92A 1ZD2P 4KAAA 2XMGA 4KRXA 4H0CA 4NMWA 3VVMA 1GPNA 1XQYA 3STVA 2J4CA 5K3EA 3RK4A 1CUBA 2QOEA 4JUIA 1JFRA 4EY7A 3AUKA 3W9UA 1UKAA 1YB6A 2Z8XA 4E46A 1I6WA 2Y2VA 4DMHA 1ZI8A 4BP9A 4IH9A 3WK9A 3H1AA 4KE8A 2AJLI 1TKRA 2GYVA 3O9MA 2WILA 4EY6A 4U2BA 3DL7A 3FSGA 4FLEA 1OXMA 5LYYA 1C7JA 3EF3A 1DINA 1TCAA 1Q0RA 3I2JA 1SFRA 4CCWA 1ZD5A 5ALOA 4MEAA 1E66A 4UBNA 4G4JA 2AJ8A 3G9TA 3PFBA 1IZ7A 4AXBA 3WMRA 2WU3A 3H04A 1MAHA 1QIIA 3O95A 2OGSA 5A2GA 2ZYRA 1U4NA 4QEKA 1WPXA 1K63A 4TPKA 3DCNA 1LZLA 2PSJA 2WHPA 2JGEA 2C5GA 1N1MA 3E4DA 3Q0TA 3WKCA 4EZIA 4WFJA 3QPDA 4MWSA 4CFSA 4HRYA 2CKMA 3E1GA 5T4EA 1K6EA 1A8SA 4LXIA 1MX9A 5E4YA 2HIHA 1Q0ZA 1TIBA 4FWBA 2QVBA 3FVTA 2XMCA 1YA8A 3F98A 1XRNA 2OCLA 2I3ZA 2QXUA 1TQHA 5K3CA 3R40A 5EIHA 3MVEA 3KWJA 2JGMA 2HFKA 5DNUA 3OOSA 1FFEA 2YYSA 4H7KA 4Y2PA 4EHBA 5AH0A 2HFJA 3DD5A 4B82A 1E3QA 1SOMA 1TAHA 3EQ8A 4PSCA 4Q82A 1Q83A 2Z3WA 3WK6A 1ODTC 4F60A 1XRLA 7YASA 5AICA 5ALRA 4EUSA 4XX1A 1H2XA 4BVJA 1ZI6A 2ZJFA 5FPPA 2CZQA 2ROQA 5ALEA 1F0NA 4YX9A 1CUWA 4KR0A 4QLOA 5LZ4A 3WL5A 4QLAA 3FSGD 1QONA 1XZFA 2WTNA 3WK5A 1OILA 4B7ZA 3D7RA 5AM5A 1QO7A 1H2WA 5AM1A 2XQIA 1A8QA 2C4HA 1EB9A 5DYWA 2XMSA 5AKIA 1UXOA 2XMBA 4E11A 2QTBA 5H3HA 5ALVA 3ESCA 2G5PA 1R3DA 1Y7HA 3F9CA 4MYSA 4BZZA 4Z49A 3VKFA 4W1SA 1RP1A 5KBYA 2EEPA 3BDVA 1W6RA 1G4HA 3OPMA 2VA9A 5JIBA 3WZMA 3M3DA 2H7XA 3I1IA 1T4MA 2QUBA 4UBIA 2XLCA 1QFMA 4P93A 3C6YA 1JKMA 1IUOA 3IIIA 4QWMA 5HF6A 2HA5A 4BDSA 3FNBA 2PSDA 3WWCA 3PFCA 3B5EA 4S0XA 4BRZA 3G8YA 1P0IA 4N5HX 4OPMA 1QIEA 1KU6A 3QH4A 4ZV7A 4BAZA 5D3ZA 2YXPX 4Q1VA 5YASA 1BE0A 3ZWQA 1RYYA 4LYEA 2ACKA 3AZPA 1QIHA 3IB3A 2HL6A 4KAFA 2EDCA 3GUUA 2W22A 2XMZA 3C5VA 5ALNA 2UZ0A 4BE4A 1TCBA 2WIFA 3G0GA 2GYWA 3O4JA 5DTIA 5IVKA 4HXFB 1SCKA 4QDXA 3BIXA 4LKOA 1CUGA 4I3FA 1XRQA 3WWEA 1CUIA 1QFSA 4AB1A 3WK8A 4I4CA 2JBWA 4IO0A 1CUAA 1XFDA 4G9EA 4GECA 1RWQA 4WDQA 1MPXA 4PSDA 1BEEA 1GXSA 4TGLA 1DU4A 1P0MA 4G8CA 4UPDA 1XQVA 1QIGA 5ALLA 2VEOA 1K4YA 2OCIA 5EI5A 3QMMA 1PJAA 1R9NA 5AKLA 3G9UA 2BAGA 4OB6A 1BU8A 1VXOA 3FYUB 2DCMA 3KWFA 2FUKA 5EIAA 3WI7A 5JALA 5ALYA 1CV2A 3WWPA 3WL7A 3ZPXA 3MUOA 2VAVA 4BDTA 1JU4A 3BE8A 3QM1A 5DJ5A 1Y7IA 3HC7A 4L3WA 2ZYSA 1P0QA 5JASA 2H9YA 5ALQA 1YA4A 1W75A 2FJPA 4P9NA 3C6XA 3HEAA 4AX4A 4FBMA 4O08A 4ARAA 1JMKC 3UMJA 5AM3A 3S2ZA 3F8SA 3FLEA 3I6MA 1CUUA 4U2FA 4UBJA 1F6WA 4HAIA 1S8OA 3SX4A 1VOTA 2OAEA 3PF9A 4XVCA 1UOOA 5ISMA 4X94A 3V1KA 1B6GA 3G9ZA 4DLNA 1F8UA 2B4KA 3W04A 3WJ1A 4J0GA 2GZSA 4BAUA 1QE3A 4H18A 5AKJA 4MQMA 3V1LA 4WFIA 2AJBA 3V9AA 4B6GA 3ZI7A 3ZLTA 4N5IX 3VJLA 4LXHA 1K8QA 2WJ4A 1ODSA 2WLSA 4BTLA 5AI6A 5AKEA 1WOMA 4AO6A 5LKAA 1VE7A 4JH0A 2HU5A 1EVQA 5JATA 1EX9A 2J3QA 4AO7A 4F0JA 2C7BA 2WHRA 3DLTA 4J0CA 5FKJA 2VJAA 5E4JA 2HA2A 3CCCA 1ZIXA 3R3WA 5CT8A 3GROA 4ZREA 2XQJA 3LIIA 2ES4A 4KE9A 3ZV7A 3WKDA 3R3UA 5HKBA 4J0DA 5DYTA 3D2BA 3AIOA 3IUMA 3DNMA 3W2TA 3ICVA 5AO9A 5EHZA 3AINA 1WCYA 4G8BA 1YR2A 2WKWA 2XUAA 1KU0A 2X8BA 1X2EA 1EI9A 5J3JA 4BYMA 4D9JA 2IITA 1XZEA 5JD5A 4OB7A 4HS9A 3UUEA 5AM2A 1ZJ5A 3DQZA 4A5SA 3O0DA 5E4TA 2GBIA 1G5FA 3CN9A 1UZAA 4W1QA 2BCEA 2PUHA 3I2KA 5CH8A 4N8SA 5CXXA 2GBCA 2PU5A 1MT3A 5KWJA 1VA5A 4XIIA 4OYYA 5A7HA 1QTIA 1UOQA 2Z8ZA 2WJ6A 1XZAA 4Y2QA 3VVLA 4X6YA 1GPLA 1ZD4A 3H1BA 3N0TA 5A62A 4YK7A 4ZI5A 3TGLA 4W1PA 3ILSA 1CUZA 1AGYA 1MX1A 1YAHA 3AIMA 2GBFA 4B81A 3H2HA 5ALIA 3P2MA 5D3KA 3NWOA 1CIJA 2IX9A 5DLPA 2PKYX 1VE6A 2CEKA 4QA9A 1JT2A 3TJMA 3FLBA 4C01A 5FLKA 5AHXA 5LZ7A 1H23A 5CW2A 1YS1X 3DDUA 1ETHA 4H7DA 2WG1A 2Y2UA 3R3YA 4F21A 4AN1A 1J06A 1XZJA 4QDTA 1U65A 1WPRA 5K3FB 4M0EA 2WIGA 3L1HA 3WK7A 2HU7A 5AKGA 5LZ2A 3QVMA 1KEZA 1XRMA 2XUQA 4BC1A 3FYUA 4BBZA 3IURA 5K3AA 5HZGA 3RM3A 3RKSA 3WLAA 3AJAA 3HJUA 5CH3A 2G63A 2HA0A 4U2CA 4UUQA 3DOHA 4H7FA 4K2AA 5D6OA 3DYIA 4JYMA 5AIAA 4C4YA 3O4IA 4J0HA 3T52A 4DNOA 2I3DA 4UFPA 3PE6A 1MN6A 1VZ3A 3GBSA 2PVSA 3CCBA 3G0CA 3QYJA 1B41A 4Q05A 5AKXA 3D0KA 2ORYA 4AMYA 5ALWA 4AZ0A 1NU8A 4HVTA 5AK4A 4Y2YA 4WY8A 1NU6A 1DX4A 4BCDA 2DFPA 1XZKA 1Z68A 1XZGA 2Q0XA 2WIDA 4M0FA 5BOVA 5KWIA 3WYNA 4BZWA 4GHWA 2XUDA 1QIDA 4C6HA 4MXDA 1DWQA 2OG1A 4QNNA 5ESRA 2VT7A 5AKYA 4BTVA 3WL6A 5DNVA 2BUBA 2WG2A 5AI0A 5LZ5A 3WJ2A 2QKYA 4B80A 2HA6A 3R3XA 1QIKA 2XMDA 3MUNA 2DHCA 4AZ3A 4ETWA 4X93A 2O7VA 1WM1A 2V98A 3WYDA 4G4IA 1XKTA 4A16A 1U8EA 3HXKA 1GKLA 4X6UA 3D2CA 3FYTA 5EFZA 2OGTA 4HRXA 3W9BA 3STWA 1VA4A 4YASA 4BRSA 1ZOIA 4J03A 2BFNA 4L72A 5HCUA 4KE7A 1CUYA 3C8DA 4G1FA 1EB8A 3C6ZA 2RI6A 4LXGA 1ZGBA 3I1YA 5IVHA 2C58A 3WKEA 3FAKA 1USWA 5ALFA 5JANA 3BJRA 5JAPA 4PV7A 4GLBA 3TEJA 1C4XA 2WFLB 3R41A 5JAOA 5LZ8A 5CT6A 3WIOA 1EHYA 1H2YA 4MEBA 4EB0A 2CUTA 1UOPA 3GELA 5T4HA 4DM7A 1QZ3A 1DT3A 4FFWA 1MX5A 1ZGCA 5SYMA 2XQGA 4WJLA 4OU5A 1XLUA 1CUXA 1J1IA 2WU4A 1A88A 4PW0A 5ALXA 5HK9A 4UBOA 4X6XA 3IULA 4Q3KA 2B20A 3I2GA 5CTAA 1EK2A 1JMYA 3AZQA 2H1IA 4B84A 3O4GA 2BUAA 4OYLA 4BVLA 4INZA
chains in the Genus database with same CATH superfamily
2PCJA 2ZSHA 1GDDA 4PLGA 4GXQA 5AK3A 4TX1A 2EJVA 4KO8A 3WVNA 3OM9A 4X1OA 1NM5C 4M86A 2ZREA 4MQ4A 5FV7A 3G2JA 3PL5A 3PPXA 4LFCB 1OZGA 4DBLC 1U28A 5G2OA 4KPUB 4TN5A 4JLSA 1E1YA 4A2QA 5TX7A 1DCTA 2WR8A 3PXEA 3GV0A 3PCTA 1K1EA 3AO0B 1VJDA 1F51E 4YN3A 4B9AA 5JAUA 3GGSA 3GJZA 4U39A 3UENA 1ETUA 2PO7A 1KMNA 2BUCA 4LSMA 4V3BA 1OA1A 3G8BA 4EBFA 4IKEA 3A6HA 3GLTA 1Z75A 3I2YX 2G3YA 4YUXA 2LIPA 2QJRA 1EH5A 2OLJA 1W581 1CULC 2VQDA 1JU3A 1I5EA 1VGRA 2O3RA 2GEJA 1RI5A 1K8ZB 1R00A 2X5XA 3EGOA 4Z1MA 4QPCA 4AWAA 4YJKA 4J3NA 1O2DA 2B8TA 2XQVA 3WNDA 1O6GA 4M1SA 4IWXA 2YY7A 2BI4A 2ALJA 3ZHOA 4AFNA 4QPZA 1G42A 1MO5A 4HG2A 1Z4OA 4AQ7A 1Y1SA 2R62A 3PQCA 5EJMA 3CLTC 5SV2A 4K6KA 2GVZC 3VO8A 1N2JA 3TQOA 5KCMA 1YUBA 3LDHA 4N49A 4RY0A 4L9WA 1H2ZA 3OIYA 4IGKA 2J6IA 1FS6A 2J45A 4OREX 3VBEA 4ML3A 3OOHA 6YASA 1PR1A 2GAIA 4CCSA 3H9UA 4KAJA 1ZM3A 2VSFA 4WKNA 2J6HA 3N2ZB 1XV5A 3NEYA 3EZXA 4X1YA 1Y1QA 1C3VA 6AT1A 3C3JA 4BJHB 5A4JA 4JC5A 1E7WA 4LF7B 4DEYA 1SC9A 5KB3A 1A9TA 1GEGA 1I2AA 1KSFX 1QQTA 1EWVA 1EE2A 2Y99A 3AJ9A 2CEAA 4OSEA 3NDPA 3FZNA 4TSKA 1KOLA 4B75A 5JARA 1NBMD 1BJTA 1RZVA 2JK1A 2WWVD 3QTTA 2ZI4A 4M7RA 5L6LB 4FFPA 4TL7A 2VHWA 4DG9A 1Z2EA 1R5NA 4QXOA 3OKAA 4GVPA 5FHRA 3R0ZA 1NHGA 3KTDA 4KDFA 3UB4A 5LKRA 2E3JA 2X5KO 3CUYA 2EWVA 1XDDA 3CZMA 3FRIA 1P45A 2O0MA 3FW1A 3IHLA 3PUYA 1PTJC 2JAHA 3K0BA 1PZFA 4PZAA 4F12A 5FP0A 4O4JB 5A4IS 1MZPA 1H9AA 3Q9NA 3R9WA 3SBXA 4DIUA 1MFPA 3K0CC 3CHYA 4XCQA 2RHCA 4C4TA 3T0IA 4ZQIA 3KM0A 3C3DA 1E0AA 1KF0A 5BUCA 1PQPA 4BFVA 3L8HA 1HRDA 1KQFA 1W93A 3IUJA 1E3SA 2XADA 3PLRA 3QJYA 1N7IA 3VU9B 1NZDA 1NPTO 5ERXA 1ZZEA 3EAQA 5KYXA 1IK6A 2DQZA 4FJ2A 3RFVA 1JSCA 1V5IA 3DE6X 5CT5A 4G5HA 4B79A 4MAFA 1OFGA 2IHJA 1J4AA 3EXHB 4WXYB 3SS8A 3V33A 2YBDA 1DHTA 4UD2A 2W42A 1PWXA 5F5XA 5EUBA 3Q3GE 3OCJA 1SHUX 3HSKA 3LGXA 5EN4A 3R5KA 3O4HA 1QRTA 3VR6A 2GESA 2YFYA 2ZYUX 1ZXBA 5CB6A 2H3EA 1T5DX 1WUKS 3GT3A 2PBLA 3MSCA 1A4RA 4UQLA 1T5TA 1YZLA 2QS9A 4WCFA 1FS5A 1OWMA 2O48X 4KJZA 4E13A 2UXDB 4DDWA 2JIMA 4BX3A 1E1MA 5CLJA 3F9RA 4ZOLA 2Y1EA 5ESXA 4OTZA 4YAEA 5IC4A 1LQ2A 1TZMA 3SC4A 2I80A 3UJNA 1VL1A 16PKA 4R2MA 5JCOA 3W1WA 1SQFA 2IHUA 5C18A 2XITA 4XCVA 2HNKA 3DOIA 4ZYZA 1CY4A 1WVMA 1WEKA 1SVWA 1BQ4A 3OQHA 2AN5A 4W5WA 4MDYA 3VZBA 1JG2A 1C9KA 1IEWA 1U8ZA 1C1XB 4NFHA 2H11A 5THKA 5CEFA 3SSNA 1J22A 3HDVA 3KOMA 1Q1BA 5C5CA 4LHZA 1TAUA 1NNI1 2SCUA 1MJNA 3BQMB 4KNWA 4MYDA 3QBEA 4P0TA 2R6FA 3RKRA 3PV0A 4MVJP 4A1FA 4EF6A 4CL3A 2E4ZA 4JN6B 5KO2A 2CJXA 2GK3A 3CEJA 4YRTA 5DYGA 2ZI7A 3HBMA 2XGMA 4DR3B 5AUPB 3R77A 2ZVPX 3IAEA 1LY1A 2B37A 1P4GA 4MS3B 2APJA 3ZTYA 4AKSA 4CM4B 3SZGA 2VWGA 2ZJAA 4IUYA 4YJ2A 2QUIA 3FKQA 2FPOA 4LW8A 3FCSB 4QHYA 2WZCA 5KJ6A 5EXSA 4ZYUA 1NUUA 1TD1A 4CDRA 5IBRA 2FMHA 1CUHA 1S8FA 1K8RA 4OI4A 3ABIA 3CXUA 2VL7A 3PUXA 1S7GA 1VHQA 2PMDA 2WU0A 1EQUA 1KC3A 1L4BA 1N8SA 1E6UA 1QDEA 2PN1A 2WWFA 3FOWA 3N2LA 1I9GA 5ENVA 4UJ3A 2PUBA 5H7XA 1KFEB 3ZY4A 1E3DA 4MRNA 1FSSA 4RIIA 2GXAA 4J1SA 4Y1EA 2AF4C 1X8KA 2PJRA 3KHUA 3DXZA 3SSMA 4W5HA 4ECEA 3ESDA 4KQIA 4YT4A 2GEBA 2J87A 4JHLA 5HGJA 3RVOA 4TKVB 3S99A 1BD4A 4BNNA 5F2EA 3TIIA 4YROA 2CHEA 3OO1A 5J47A 1KXJA 2OLKA 2B82A 1DOZA 2NVOA 5B1EA 5LA6B 3OJXA 1NSTA 2ZTMA 3NEPX 2Y76A 3KKMA 1ACLA 2FP4B 2UYYA 4IICA 2GEFA 4G5XA 4GT1A 5DTRA 1TO1E 2DKNA 1OY1A 3L0OA 2JJYA 5CITA 1LUAA 2Q29A 2R85A 3ED1A 3RS3A 5M04A 5K99A 1QUFA 1ZK4A 1E4VA 2IQIA 3KDAA 4L4YA 4XJXA 4LYJA 1R64A 1ZMRA 3GRZA 3W2IA 2ZS9A 1PK7A 2QT9A 2O8EB 3ZE2B 3EBLA 1DC3A 5K3OA 3Q7PA 4TSFA 4AECA 4KNYA 1UPTA 2D0DA 2FZEA 4ZVNA 3DO6A 5KOJA 4GDMA 4TYQA 3I9FA 1O4WA 4HHEA 1F7UA 3HADA 4YJHA 5JSUA 1RM3A 1ML3A 4J4HA 1R0YA 3RYFA 5L4SA 3MD9A 1JI3A 1X1TA 1NAHA 4FKBA 3L7OA 3PXDA 4GH5A 3FI0A 3MLAA 3SEFA 4DNPA 3QVLA 3KXPA 4K8OA 5IYZA 1E1CA 3SIRA 2ZYGA 4MI1A 3MTEA 1J0AA 1SC1A 2ZBPA 1TB4A 2QJFA 1QVVA 4UNRA 1RAAA 2VXYA 3I9OA 5JTUA 4QOEA 3E5HA 4CKWA 2VNIA 3CKMA 2VJBA 2QX8A 4FFRA 3INRA 3UJCA 3DOUA 4RYDA 1B4DA 3SHTA 3H8JA 3LHDA 1Y4ZA 3P9CA 3GRFA 3EGDA 1J0CA 3IVXA 3QXGA 3RVPA 3F6YA 4QTXA 2IHKA 3WGQA 5BW6B 4KWHA 2X7XA 1D3AA 2ZR9A 1ZBQA 1EJ2A 3EXFA 2Y1KA 3OZCA 1W5AA 2A88A 3OQIA 2Z2ZA 1GAJA 4YDHB 4DYHA 3TQTA 2WZQA 4NATA 2QX7A 2WM9B 4EYEA 5F5LA 3UCXA 1IBCA 1O8BA 4HXGA 3WNZA 4BVKA 4JYAB 2D5AA 3RG2A 1N78A 1C3OA 3WYGA 2BD0A 2FR8A 3FUXA 2RB5A 4KIJA 3F73A 2G7ZA 4RHEA 3E03A 2XODA 2QRZA 5LBTA 1FC0A 2K7ZA 3IR6A 4DCCA 1FQKA 1M8PA 2PS3A 4MDFA 1ND5A 1KQGA 1F0PA 1L7RA 2OSBA 1ZRNA 2BKXA 3BHIA 3F2IA 2GPSA 2R7KA 3OEYA 3R5TA 1JHVA 4KPUA 4P7FA 4RF5A 4F6RB 1J7JA 4GOMD 3N75A 2SBTA 3ZWMA 2YX1A 5FTJA 1JQAA 3DBVO 7MDHA 2AMFA 3BWYA 1J25A 2I66A 1N2BA 1SVLA 2GCOB 4XQCA 5GJBA 2ZBVA 4L7QA 1L4EA 4C06A 5KPDA 3O6VA 4CG2A 5TARA 2E6UX 4WY2A 1FNBA 1XCPA 2CUKA 3P4UA 4RSHA 3H05A 3MCVA 5DWDA 4BV3A 2OHOA 1ZN7A 2CXUA 4L5YA 5J9FA 3GLFE 1FTGA 3IPAA 4EY3A 1LW7A 4DSZA 3BD6A 1OOEA 4DG8A 3H6HA 5HKAA 1O3YA 2IA5A 5SYNA 2QAIA 3Q8XB 5HR5A 1NNLA 3HI4A 3LDUA 4EHLA 3V48A 5CLLA 3BXPA 3VO1A 3GX1A 1SUAA 2CBGA 5CHEA 1H8HA 5JAHA 5B1DA 1VKRA 3PLNA 3RPEA 3NRCA 4M6WB 3C8UA 3RUIA 4EEKA 4H35A 4PZCA 4YLGA 2V3CC 2NLOA 1VLVA 2IF0A 4MIYA 3NBKA 4MRMB 4E4RA 1ZG3A 4CTMA 3UAXA 4RTQA 1W30A 5CD1A 4CMIB 5AJWA 4AZWA 1N5DA 2WJGA 1IH8A 1ODLA 3G5LA 4RESA 1NLZA 1U0HC 5CEJA 5HRAA 2BH2A 5ERGB 1OFTA 1PFGA 2CNLA 2D59A 1E92A 2B7LA 5HBGA 2QYOA 5CA0B 1JHOA 1OHHA 5EKTA 1W76A 4ZAXA 1UP4A 3RHFA 1HLDA 2CCKA 5EZQA 1O9BA 1XJQA 4J16A 1OBVA 4JUAA 4MV9A 4MVJG 5JZOA 1GTMA 3MGBA 1L1QA 2FWIA 2Y1FA 1U2EA 4WK0B 2ZXFA 3Q6IA 3T1VA 4ZP1A 3ICWA 4IIBA 2P1DA 2BC9A 1UEIA 2AK3A 2O5CA 2OC9A 1BAPA 3OWHA 5AJUA 4YXWD 2NU6B 4GOKA 4O4JA 1M76A 3RCBA 1LS6A 4DRYA 1Y7PA 1WSDA 1DPGA 1YI1A 1RQPA 4TVKA 2WD9A 2X2PA 3TKLA 5KIAA 1MXFA 1N2CB 5E38A 1BGWA 4BMZA 4AJIA 3RARA 3TUZC 2O2IA 4DPKA 4D6PA 1LGYA 2QIOA 4Y1FA 1JDBC 2FEKA 3U56A 5LJLA 1YJ8A 4R54A 4E7PA 2H1OA 1BE6A 3LI2A 1YTLA 3DNPA 2ATCA 3QUSA 1U3TA 4F3TA 2Z8YM 2HGZA 3EXHA 1Z17A 4KHPB 1MTZA 3NO4A 4XVHA 5D87A 3RF7A 4MMYB 4MKRA 4ZT3A 3IPCA 1D1TA 3SS7X 4D92A 4X7MA 5DGHA 3V3TA 1LW6E 1E7RA 4KFRA 2BT4A 1FE8A 5B7NA 1ULBA 1WE2A 2A57A 2NM0A 4X7BA 2LIVA 2Q3EA 5BNFA 5C4GB 3DAHA 1GQOA 4FYYA 4D4GA 4BXOB 2C2XA 1RRGA 1Z5VA 2AN1A 1QPBA 1UMKA 4TYWA 5K03A 2Y68A 3TL6A 2FX3A 1WU7A 3DR3A 1KJ9A 3D81A 4PG7A 2GDJA 4R69A 3O3OB 3I76A 2EW1A 2ZZNA 4ZEMA 3C5WP 2WE8A 3GMIA 2JARA 3TM4A 2JD0A 1Y9JA 2XNKA 4P08A 1KVQA 4XLTA 4YRRA 4GL4A 1DIOB 3UANA 1CY8A 3KPYA 1AXGA 2PMFA 2X3UA 3U4AA 4R8VA 4OGWA 3QY0A 3UW3A 2GZDA 1KPGA 1CEEA 1N1GA 5CNJA 4D5GA 1C1XA 4GPTA 1OU0A 1Z7YA 4ZGBA 4Z0TA 4NHEA 4IY1A 3WBBA 1X9IA 2G4LA 3TLJA 3THXB 2PSFA 4NU8X 1FRQA 3DFUA 4LF9B 3EW7A 1XZPA 4AJPA 1U81A 1XHLA 1NMSA 4BNKA 3T9BA 1S2GA 4BQOA 1MNQA 3JWHA 2IZZA 2FUG1 2OR3A 4PSKA 5KNBA 4YY3B 1NG1A 2M2IA 4MS3A 4ZT5A 4BVHA 4CM4A 3UJDA 4MW5A 4ALMA 4LFAB 3LXMA 2C7GA 1JXMA 2IUUA 2Q3BA 4TT3A 4M7OA 1CQPA 3ISVA 1PD0A 4CF6A 1BEZA 1TW2A 1N6NA 1HNWB 3H4VA 4QPJC 1PQ4A 4EPVA 3PX7A 2QXYA 2QRHA 2WT4A 3OFKA 3M6AA 4X84A 4KPFC 2C2KA 4LJRA 1IHXA 4EO9A 1MRZA 1H8EA 1QOQB 2RARA 1PGJA 2C2WA 4M88A 4ND6A 5ECDA 3IIMA 2VHQA 5IVPA 2YMQA 2BEKA 4UM9B 1KJJA 4ICIA 3GCZA 3NJ4A 4Y2GA 1HF3A 3LP8A 1J0XO 1M2GA 1R4MB 4I2VA 4Q1CA 3ELBA 3FYDA 3K35A 3ZDZB 3SJCA 4BNDB 3AI1A 1L4NA 3BK7A 3WMFA 4YPOA 2W6ZA 1W7AA 2BKEA 2ZJ2A 4U5QA 5DHUA 4P81A 4D44A 3D4PA 3JQ7A 1JR3A 3TW6A 5GINE 1I3CA 1D4AA 1V25A 2RKBA 3A4LA 3MWGA 3R7FA 4TKVA 4AF8A 3U5ZB 3H19A 3L7NA 1KP9A 2P6UA 3BL6A 4DR4B 5LA6A 2Q45A 1CFZA 1DBRA 1U28C 2N1MA 2VT6A 2ZTVA 3GFOA 4RYLA 3VX3A 2ZVDA 1PWZA 1WW3A 2FP4A 3RAPR 3GLHE 2EIHA 2GPTA 2GNAA 2WP8J 4F5WA 3H99A 4UMFA 1M2WA 3ONNA 2O14A 3VPHA 4CYMA 2IXEA 3CZ5A 1UK7A 3ZK8A 5CFRA 1WZIA 2VJYA 1GN9A 3K2EA 4GWLA 3K2IA 1XWFA 2B2NA 1TGVA 3M6MD 4PO3X 1OZAA 1MB2A 4XH9B 3U7RA 1L7PA 2W70A 3AV0B 4BL5A 3D7KA 1EXMA 1HXHA 5K4GA 5IRCD 5HTOA 2PLAA 4REQB 4ZN6A 2O8EA 4HWSA 1TM3E 4R3UC 3PGKA 1DBQA 2ECPA 1PX0A 1YJXA 1IZZA 3AL3A 4I8IA 4L4XA 1YZUA 4LVUA 2W4QA 4UDOA 4BVAA 6ADHA 2H51A 4FFSA 3PJRA 1T9BA 3DFMA 2NUPB 3VZCA 1ZK0A 1U2GA 2WINI 1OKKD 1YCFA 1KH1A 1V5WA 2I6FA 3MSXA 1J0DA 3VXKA 2VAXA 4RD0A 3PDCA 4AVYA 1IBKB 1FTQA 1KMIY 2ZATA 1KR2A 4KX5A 3VMFA 1KKLA 1YRHA 2V9PA 2A5DA 3UICA 4DJJA 3K1YA 4Z6KA 5DCWA 2PIAA 4AWBA 5DV9A 4OJTA 1W52X 3PNSA 4R8LA 4BLUA 3CPEA 4PS1A 3PE4A 1DBSA 2JFVA 3ZEIA 5IJ0B 2XUFA 1VIYA 3OAAD 3BKXA 1JH8A 2GPNA 1DKQA 3ABRB 4TV9B 2C9YA 1KJNA 3WADA 2IBSA 4RPJA 1F9AA 4AMBA 3F4LA 4PZ0A 4ITRC 4ZVVA 5DM0A 5KU1A 3I9MA 1N6KA 4F8YA 1JEDA 1ZD1A 2Q50A 1I0IA 3ESAA 5ICCA 3JQDA 4M49A 5CYPA 1A0OA 1I36A 3RU2A 3ND6A 4PVDA 3TZBA 3K96A 3CZ9A 3CX4A 2QD5A 3U7GA 3FBTA 1G6KA 4ZYYA 1VXRA 2C0QA 5TQVA 2LCIA 4V1CB 5M2QA 4ZQCB 2VOJA 2ZANA 4Z9AA 3W8FA 4EFNA 1DWOA 1PNVA 2KW5A 5F2OA 4I55B 1I3KA 3VUEA 5F1YA 4OU4A 4YP5A 5I7AA 3F49S 1KYVA 1J90A 3HFJA 2A5YB 4O4HF 4LYYA 2WLTA 4X91A 2IJGX 3IXLA 3IQFA 3N59A 4P5PA 5JCJD 4EPXA 4KR2A 2Z3ZA 1D1PA 2ORIA 1CRPA 3DFIA 4QPNA 4Q9LA 1N7HA 2ZB8A 5JZ9A 1XLWA 1ENOA 1HG0A 4G9GA 4K9PA 5B3AA 4F6RA 2W6IA 4C2TA 3TBHA 2B9EA 3GOQA 2FR0A 3RNLA 2TECE 1P4JA 3I5UA 2Z5GA 1VSQA 5A3RA 2GCOA 4UTZA 5HDQA 3W4IA 3A1TA 4K6MA 3WIBA 1C8VB 1E8NA 3YASA 3HCOA 1PJBA 4N3BA 1JPVA 4DMFA 2XE4A 3HXLA 1WP4A 5TE9A 3H2IA 3IVGA 4XRGA 1JHAA 4YONB 1GGVA 2ISQA 4ZAWA 3HXTA 4WCFC 1M75A 2ST1A 3TLGB 2VBIA 1CNMA 4ACBA 4AY4A 1ZMXA 3NTXA 4DJDC 4QRHA 1GV0A 4DWWA 1YQEA 4AYWA 4BO7A 2LR0A 2WUDA 4G3XA 4GLOA 4Q1FA 1OI4A 1POWA 1WB6A 4RW0A 2JDID 5F9MA 1NVKA 2QDXA 3RSQA 3T9DA 1CVLA 1QQBA 1KOJA 1ADGA 3R5SA 3L0PA 1DKPA 2CMFA 4HQ0A 3SQWA 4LV6A 3UGTA 4YMLA 2NSYA 5JCOC 1PNTA 1HDEA 1EDZA 4M6WA 2JL1A 4K6GA 2Q7XA 3NHUA 3OEWA 1JDUA 4HL6A 1USUA 4MRMA 2GF9A 4H3VA 4ZQHA 2QLJA 4GKVA 1BNCA 5JHGB 3L46A 4C6RA 5JZSA 3ZGZA 2X0KA 4CMIA 1PUJA 1GNSA 4UXIA 1JAXA 2VDJA 3H5AA 4Y0NA 5LIPA 3LY7A 3A9TA 3VO9A 1VHJA 3KOXA 3RASA 1E79D 5CA0A 3FKJA 1QQ7A 1Y1RA 2HEGA 5E3JA 3AW8A 2A5FA 3UMBA 5HUHA 1RQNA 2WFZA 3D3EA 4A6PA 5KC8A 4BO6A 3T1HB 3VNAA 1FDRA 5CMLA 1Y5LA 3PDWA 4EUEA 1YCGA 2ZWMA 5K0ZA 1YS6A 4XJVA 2B5OA 4F2GA 2HT1A 4TROA 1Q77A 1Z8DA 2JLXA 1RJWA 1YRQA 2I78A 2EATA 2MR5A 1AKRA 2PLWA 3ROZA 1D03A 4KTTE 4BZQA 4CUZA 1GM5A 2MINB 4EGCB 2ZWPA 4M83A 1W4RA 2XE8A 3ECCA 3EXIA 3IO3A 4E3ZA 4XWKA 3V1MA 3QLJA 1D7OA 2NU6A 3COPA 1N9GB 4JVNA 5AJVB 4RH0A 4WVLA 2P6NA 2QTAA 3DH0A 3A26A 1FFCA 5K3BA 3BRQA 3PR2B 3FGPA 1N2CA 2FVXA 2NU8B 3G0IA 4X5OA 3SZUA 3W4JA 4JASB 4Q1BA 2PS1A 4JR0A 2QIPA 2YMMA 2UYOA 2NX2A 4I4LA 2ERYA 2C2OA 2HA7A 4FNAA 4RA9B 5KYTA 2VTVA 4FBLA 4Y9SA 3JQQA 2AT1A 2CUZA 3IRUA 2QTRA 3PGLA 4FHZA 3UAVA 1NF8A 1P31A 1NX9A 3K4HA 2BFWA 4JQYA 1NVGA 4LN1A 3ZHSA 1L7BA 4EB8A 5C2JB 3L4JA 3NVKI 2H2DA 2R6JA 1K89A 2E5LB 1EFCA 4ISCA 2F8SA 4YV2A 1Z37A 5BYJA 4OM7A 4N48A 1XKXA 2CLHB 2O07A 2FPIB 1QGUB 4DHWA 4BXOA 4UU8A 3GRCA 5IK2D 1GKUB 4IXWA 3P19A 5FUXA 3AHIA 3FWHA 2W4IA 4JLMA 4X1IB 1WF3A 2X7HA 5AKKA 5FULA 1DFGA 1II9A 2G72A 2Y0BA 3ZEAA 2UYHA 1SU6A 2X9VA 3JYQA 4C1BA 2A6PA 1F9EA 1NQWA 4M0UA 5COBA 2BL4A 3ZWVA 4EO7A 1PHRA 1UFRA 3DQPA 4JBXA 1ZNYA 2HV9A 5EVJA 3NEAA 4LHYA 2ISSD 1S9HA 3IEMA 1M3SA 5JJ5A 3VSEA 3WFIA 1RHJA 2PZKA 3H5LA 2QZPA 1Y7TA 4KLNA 3C6QA 5F7JA 2KE5A 3Q2KA 4CQNA 5EHNA 1CUCA 5JNVA 5A7GA 1L7XA 2ATVA 2NAFA 3THXA 2FFRA 4LK3A 5JO9A 1H2RS 1M6VB 1X2BA 5FOTA 2N0SA 3GMDA 2V5AA 2XB6A 4GOLD 2OHFA 3R6WA 5FYQA 1KS2A 1S7CA 3PQ6A 1I14A 1AKNA 2XRFA 4QBKA 1T2UA 1JIXA 2AFRA 2ZW9A 2GILA 3SSOA 3A6EA 1OFUA 2OCDA 1YQWA 3C97A 4NS4A 3NS7A 3HHPA 4FZ5A 4EY8A 2GZAA 2QTGA 3AHEA 4FILA 5BURA 1BQ3A 1DWUA 2C3UA 3VH2A 2PSSA 2JA1A 2JGIA 3FSEA 5BNZA 5LYJF 2BRUC 4GWGA 2JCXA 4OHCA 1TA4A 1P72A 3BDAA 3P45A 2EX4A 1TF5A 4FNGA 1QO9A 1ZEJA 4CR8A 4F71A 3IQIX 1POXA 3BSFA 1KIAA 2R3SA 3V1UA 5B6IA 1JJFA 5LBUA 2F62A 1ZYUA 2PSHA 4BQSA 4DY4A 1X38A 1G8FA 1Y98A 3I3OA 1ZFNA 4KGVA 1LSOA 4MWCA 3NQ41 4Q9DA 3KR2A 5BMVF 5GPBA 1G0OA 1R4MA 4D3DA 4OFWA 1E1QD 4QUHA 5AI9A 1LVHA 4O0MA 4BNDA 2REOA 2XQFA 3AM3A 1ACJA 1K3UB 3SBOA 3NTVA 1IXYA 2GB4A 2FG6C 2IYYA 2FR8C 3N5KA 3N9IA 1YZVA 4GX1A 4A3SA 1XJCA 3X43A 1OB5A 1T8UA 1P1FA 1V5EA 2QYTA 4DLZA 3FNFA 2CFRA 5HM6A 3MUEA 4UBMA 1AGRA 4HBGA 4NQRA 1P19A 3S1AB 5BSKA 1P0PA 2QRGA 4D9KA 4D8VA 3JQPA 1S96A 4XWGA 3KQOA 3L1UA 3GB9A 5CLIA 2WAAA 2PFKA 1AV7A 1HKHA 1MENA 1LDYA 1US8B 4M9XA 4RLHA 3TL3A 4EARA 3NM4A 5I5GA 3D6UA 1TM1E 4MUMA 3TW4A 3WMGA 4HX2A 4E5SA 1T35A 4REQA 3PQ2A 2EKZA 5EWLB 3CVJA 3MYYA 1HUQA 1X87A 3L4SO 4Q5IA 5K0LA 1EXDA 4PO8A 1M1ZA 4ZARA 2H29A 2YKGA 4FUTA 2JFBA 2NUPA 1GJRA 1MVNA 2PXAA 4P7KA 2ZBRA 3EPRA 2D74A 5GOTA 1R8QA 4EX6A 5JJIA 1M34B 4GDFA 4OJNA 4PSUA 2YXLA 5IDWA 5EPOA 4RK1A 2I3BA 4YXFA 3ENWA 1AHIA 4V0MA 1K8YB 2JEOA 1DT5A 1N0UA 2FK8A 3MT7A 4FI3C 3S6JA 2ZR8A 4BEBA 4YYZA 1I1QB 4WLFA 4S0ZA 1R5JA 1ONPA 2K2QB 4CKXA 1P2GA 3E9EA 4IEFB 1RQGA 5HPYB 1MDBA 2JFNA 1X1BA 5IJ0A 1JEOA 1JHPA 2HADA 2ZYIA 2YCBA 3W6UA 4NNOA 5E95A 3GLIE 1CP2A 2J7PA 4TV9A 2QY6A 4IH4A 4W9MC 5FEUA 1B8UA 1G63A 1GO2A 4GI2A 5B6PA 1T8TA 3U7FB 5F9FA 3L7KA 5FTMA 4KMMA 3FDIA 3VVCA 1WW8A 3ZVRA 5BOSB 5KWVA 2P0YA 4G5RA 2XNSA 2AI3A 1TKBA 3AFMA 2DLNA 4J16C 3WYCA 2FGJA 3OZBA 4MKHA 5EAIA 3U4HA 1HDGO 3DXFA 5DHTA 4P82A 3QA3E 4Z2AA 3W79A 3CG4A 4GX0A 4ABTA 4MPDA 4Y18A 1AMNA 5CT4A 3NONA 1N5MA 2QT1A 1L7VC 3KPWA 4D3ZA 2AUTA 3I9JA 4KV9A 1RIFA 1EP2B 2HQRA 3OT1B 4XD7D 3RT9A 4I55A 5E2AA 1SN7A 4IGFA 2C07A 1EWRA 1VL2A 1PS0A 3O8NA 5DPMA 3DE7X 4WKBA 1ZIDA 3IBFA 4GO1A 1BS1A 4F04A 4ZRNA 4DV4B 1UK8A 3EAGA 1X13A 4PPYA 3THWB 1N8KA 5FFFA 3PXCX 4JSTA 3JWGA 4E2YA 1ZU4A 1C29B 3D6FA 2UUAB 5B2ZA 1BN7A 1WXIA 2VK8A 3K4QA 4MA4A 5HFJA 3EXHC 5HIIA 4FEAA 3H3XA 2VSXA 1PVDA 1KK0A 1XVVA 2ONZA 3D7MA 3RSGA 3SOPA 4JI3B 5COQA 4EKDA 4EUFA 1ZCZA 3TG2A 2IS6A 3TBKA 4YP9A 1DARA 1P2VA 1Y5IA 3AONB 5ALKA 1GU7A 2KLHA 3V4ZA 2XMQA 2H65A 3MB8A 1HLPA 3TLGA 1CQIB 1JECA 3PF8A 3HVKA 3TLAA 3QX9A 1OW3B 4Q01A 3UA4A 4WGFA 4ZPJA 2IOQA 2F3PA 1FTYA 5DX1A 1V4VA 2HT6A 4YECA 5D85A 3UA3A 4HI0E 3VHQA 1QO0A 3U3RA 1XNQB 2P9TA 2RH8A 2O7RA 4JJAA 2CLDX 4UHCA 5AOCA 1P73A 3EBPA 4E30A 1I4EB 4LV8B 1R4ZA 1QWSA 1V9LA 4W1RA 4Y2SA 3WR5A 1KY3A 5DULA 1OX6A 2HX1A 1ISSA 1PYDA 1PDVA 1KJYA 1ODCA 3EY9A 3TEFA 4AJKA 1QOZA 4R51A 3SP1A 2VLIA 4G1CA 2WHPB 4N40A 3NCTA 4BB9A 3CZQA 3D8HA 3NTUA 3OO0A 3FLAA 4XWYA 4FWTA 1QU2A 2NSDA 4HNGA 1DCMA 2E9SA 3RUDA 1RBQA 3T94A 3ZI0A 5DM2A 3F47A 3THOA 3R4CA 5DTJA 3V46A 1ZOPA 2B25A 3JD3A 3WBKA 3FCEA 2RCYA 2V97A 3BD9A 4ARBA 3ZZUA 4FKZA 1N5IA 1BYIA 1PVVA 3HO6A 1VRCA 3KZ1E 1FVFA 2MINA 2PFSA 2HSGA 3GFPA 1JP7A 4BIMA 1F20A 2XT6A 1N9GA 4J0QA 1KO5A 4IFIA 2Q4EA 4JI1B 3P26A 4C4RA 2ECKA 1Z38A 3CJQA 5D1HA 2AKEA 2J85A 4E22A 1AV6A 4WERA 3D6JA 2ZU0C 1RAIA 1HEUA 1NRIA 2QTVB 3IQEA 3Q3HA 4NDNE 4YQEA 3RAGA 1XCBA 2CDNA 3DOOA 3W6ZA 3ZUPA 5AESA 1LDMA 4C4ZA 3FUWA 1PK8A 2B7BA 3H2ZA 4CHTA 3D3JA 4RA9A 5HA5A 5BYKA 3C8HA 3TPZA 2X1VA 2OHGA 3EVFA 3ZDFA 1FYWA 4B2PA 1TA0A 3BZUA 3QPCA 4EOGA 4LIPD 5CP8A 4DLRA 2A59A 1V8OA 3PWZA 2CWDA 3D5TA 1KFCB 1N6LA 1C1DB 3DBRB 2PX6A 3T5TA 4KQ9A 3TX6A 1PT9A 2FXVA 4XSGA 1VJ5A 4ZV9A 4UBLA 4CODB 1UKZA 4GI1A 5JD6A 1UMBB 3W7AA 5ENZA 4EJ6A 2FPIA 4QT0A 2CL7X 4XWAA 2Q4TA 1AF7A 4BIIA 4EHJA 1JDPA 2I03A 2JJ1D 3EH1A 1G6HA 1S1MA 3K0FB 3AM4A 5AVVA 3WO0A 1T9HA 4KXXA 1TUBB 2VDKB 2O50A 3R3ZA 1Z4IA 3D4NA 3OVMA 2AUNA 3QOWA 3LWBA 2G4VA 4Q39A 2IZ6A 1MB4A 2FYTA 3JYNA 3AESB 3T4UA 3AYXB 1LLCA 3HDQA 1B1CA 3SHVA 2HLNA 4G1UC 5D7NA 3A4VA 1P2UA 4RQBA 2OSVA 4ZXFA 4DC0A 4DDKA 4DPLA 2KWIA 1VDZA 3BXHA 1U2GC 3G02A 3A1DA 4ND5A 1OFUX 2PT9A 3I4CA 2CC2A 2HCRA 4F56A 3U3XA 1M6VA 1QB7A 2NO4A 3CNBA 1B43A 3OEHA 4CG1A 4N4AA 3LS2A 3RTDA 4X9XA 1UR5A 4RLFA 4WADA 1Z8FA 2ZUVA 2F8MA 2EIXA 1G9TA 1NY6A 2QMHA 3U0VA 2DZDA 1PEAA 1MJ5A 2ZRLA 3AEKB 4MR8B 1GQSA 2Z2JA 2P4HX 4DNQA 1T0IA 4JODA 3WLQA 4GBGA 4OMFG 4IIVA 1BMTA 3RFXA 3GJTA 3EVGA 2JGKA 2TMGA 1JSXA 3G8DA 4UUNA 3TRDA 4YUWA 2FG5A 2OESA 3O8BA 2JFHA 1FSGA 3N8DA 1XSEA 1BOFA 4GLLA 1QVZA 3T54A 4E2WA 5G0VA 1PFQA 5K6AA 5FI0B 5HRUA 4R01A 1L5RA 2MJLA 5KOHA 4WN3A 4R16A 1Q17A 3ETDA 221PA 4ZU1X 4C3ZA 4C7VA 1NHWA 2POQX 4YMSA 3C3CA 3KDSE 2N46A 3PX3A 1TOAA 3L6OO 1S8NA 5B55A 5JMWA 2P75A 1MH9A 2GDZA 2WUEA 1T5IA 4UHJA 2VK2A 2OVBA 2C4KA 3DZBA 3EVNA 3W6NA 1I2CA 1NMXA 3IP6A 2X8JB 3RC1A 4OATA 3BRWA 2C82A 2FFJA 1C14A 2QN6A 3SS9X 3CNHA 2FR1A 3HVJA 3LO5A 3P96A 2WW8A 4UHDA 2QTFA 3V7YA 2YWGA 3JQFA 2AQHA 2F67A 3WNCA 4C0QC 2WTAA 3KSRA 3H8VA 1UWVA 5F23A 1PNQA 2XUPA 3WWDA 4C08A 2R60A 1KOFA 5DLDA 4BX8A 5EXPA 4A1OA 2Z5VA 1KFJB 1UANA 3GMSA 3S1AA 1QQAA 3HYRA 4Q1DA 4W9RA 4EFMA 1KJWA 2RGWA 4S1PA 1AN0A 1E18A 1Q7GA 3IAS6 3KAPA 3ROQA 3ENVA 2D0PB 2JW5A 4M54A 3M4XA 2I8CA 4BQQA 5BN1A 3HBNA 2IYRA 1US8A 3N39C 3S5JA 2ZCJA 3DBIA 1MRNA 1PTKA 2FSVA 1KEWA 3RVKA 2PR7A 3DO8A 2I71A 4UVHA 4XUCA 2ZUTA 3QZUA 3UCEA 2X0JA 4LJKA 3ZVLA 3SQMA 5EWLA 4PANA 2J0VA 1R8YA 3VC7A 5HW0A 4Q4AB 1M2VB 1AUVA 3FHOA 4ZAFA 4CQJA 3HBLA 3C15C 3EA4A 4AJ9A 5J1TB 1CRZA 5HX7A 4FGWA 3C70A 2NZJA 2VG8A 3GLQA 4L9AA 2A0UA 4Q3OA 4YA6A 5DHPA 5J59A 2OP0A 1MQSA 2B9VA 2PHZA 4E12A 2J67A 1U1GA 1M34A 3LY5A 1R1DA 4PIVA 5BVGB 3U44B 4FFMA 4DN6A 4YRQA 1BEUB 3MJRA 4W7HA 3UY4A 3WXMA 3LBFA 4OH1A 1J8YF 3SF8B 5JRZA 2XTNA 4OHWA 5MDHA 4W5OA 2ZM5A 1HNNA 1JTVA 4ETIA 3O74A 2IH4A 1T9KA 1PL6A 1FUEA 4E5DA 1Q7BA 1V43A 1TXGA 3N7AA 1D1QA 4PINA 5DK4A 5EJ5A 2UZIR 1BFUA 2GK4A 3OBBA 4KHZA 1QPZA 1CQWA 3KIPA 2E85A 4KDCA 4OXKA 1BRMA 3SXPA 3D4IA 4OXYA 2NPOA 5EE1A 5ER6A 4COOA 5BOSA 2PX4A 3UQYS 3OLQA 4PPNA 3OSZA 4KAAA 3MHTA 2SKEA 1K6XA 1RM5A 3VX4A 3AUTA 2LWIA 1N2HA 3VVMA 2K2WA 2WSYB 3GJYA 5H4GA 2BTQB 5FNZA 5ICEA 1L3CA 5K3EA 4GQAA 2VYFA 4QO8A 4B7UA 1VHWA 2F00A 2Y77A 4ZEXA 3SVLA 4WPGA 1E5QA 1U4SA 3GGGA 1W73A 4Q3DA 5H70A 3QXCA 1LBHA 3OTIA 2DBYA 4ITUA 4KLRA 4N5DA 2HQSA 3FMVA 4BGVA 1UDBA 1DG9A 3W6PA 1RADA 4M21A 2A9RA 3A6LA 2R8XA 1NNUA 3H83A 4E46A 2JI9A 1U3UA 2YVKA 3CFYA 1XCOA 2YBEA 3QXHA 5K01A 2Q5JA 2QL5A 4RY2A 2JHGA 3V4SA 1Q0LA 1H94A 1DO0A 2H4XA 2O1WA 3R0IA 3FG9A 3V2IA 3UMRA 4JB0A 4B7CA 5ECYA 4O4HB 3TVDA 3L8EA 5DTEA 1HZJA 1KDRA 521PA 2Z1DA 2AMLA 1RHMA 4I5IA 1JA0A 1Z3IX 1J1ZA 5LYYA 3NWBA 2OK7A 1ZLXA 1EXNA 3A28A 4MUYA 2R8RA 1DINA 1KPHA 1SFRA 1Z5UA 4GMXA 4HB4A 1ZD5A 2G08A 1P2SA 1EFLA 3LA6A 3MCAA 3Q7SA 4IMIB 4XR4A 3B5JA 1UBKS 1CQIA 3MELA 2TYSB 4IYJA 3NDJA 4Q4LA 1KYYA 2CLSA 4GBMA 4ZGWA 2QD2A 1TTTA 5F21A 2XIJA 4CDMA 1IZ7A 3H5OA 3KLBA 3GXBA 3ZTTA 1H5UA 2GASA 2AXPA 4LDZA 3IUEA 1GXSB 2CXSA 4UATA 2AC4A 2I3AA 2P79A 2ONKA 1IG3A 3NBZC 3Q2IA 3AB8A 2X5OA 4TQ9A 5ELXA 4NRDA 3OQBA 1H93A 2JCVA 4NZMA 4ZEVA 4YCAA 4IWYA 2ZYRA 4L16A 4YV0A 3I6IA 3GP8A 3AI2A 3VU3A 3ANXA 3LKBA 4LRTB 4I3GA 2JIOA 2VBFA 3DCNA 4LZJA 1Y3FE 4R71A 3H97A 2F1IA 3BMQB 5DNCA 3W34A 2W71A 4Y8VA 1QK5A 2WHPA 3LF2A 3ZXSA 3T3MB 3D4OA 1Z6TA 5B7QA 2ZVQX 5L4NA 2CD9A 4AJHA 4YNBA 2RAFA 3BTUA 3BYZA 3K9LA 3MMXA 4Q3CA 1U04A 3VZRA 5KNCH 2AQKA 5KU7A 3HXOA 2CHUA 2G6TA 2HDOA 3Q0TA 4QM6A 3NUGA 2C9ZA 3DE5X 3IP8A 3GA5A 2JHFA 4ZI2A 4EF4A 5JTTA 2NVBA 1SXGA 1H85A 4LF5B 1OZ0A 3QPDA 2OHHA 3ZZTA 1D8TA 3RRFA 3E1GA 4A7PA 4ENPA 1CR4A 4L57A 1ES9A 2NXNA 3I83A 1NY5A 2B83A 5AVWA 1ULZA 1A8SA 1J5XA 4OF4A 4PYIA 5KNCD 3IDOA 4LXIA 2QTVA 2J9YB 3L4BC 3IUPA 4Q7JB 4EHFA 4J1TA 4HTFB 4MKZA 1SBQA 5KSZA 2HIHA 1IVSA 1U3WA 1LFAA 3U3OA 3ANNA 4K9KA 5FWDA 5BT8A 4Q4CA 2QVBA 3BJZA 3C7CB 4YIKA 1K9SA 1TU0A 2B4QA 3QUTA 4OQEA 3KQLA 1SG0A 1NRJB 4HDKB 2GPAA 4KBYA 3DBRA 1C1DA 5K3CA 2EZUA 2V54A 3MVEA 4RBNA 3EB9A 4HD8A 4JBHA 1Z12A 4TMFA 1VCIA 2GBPA 1UMBA 2DERA 1CSEE 2HIGA 2BGTA 2W2PA 1QC5B 3OOSA 4O1HA 4O29A 1IRIA 4WA8A 3W9SA 1FFEA 2FEWB 3K15A 4NPCA 1D2AA 3ZJ4A 1V8BA 1AS0A 1MA0A 2YYSA 2Q28A 3KT6A 4Q00A 3DPUA 4ZOBA 1HL3A 4NG4A 3VTKA 4B1FA 5B3JC 2EG5A 3K0FA 8ABPA 3IJPA 3EFOB 4EHBA 4B82A 3WK5A 1C2YA 4BNUA 1G21B 1Q7TA 3IXMA 4KODA 4IGAA 1TUBA 4BMXA 3EQ8A 3K1JA 1NBME 1ESZA 4Q82A 3BRSA 2P1ZA 3NDBB 3AESA 2X0RA 1H0HA 4RSMA 2ZYWX 3H2YA 4PX9A 1XRLA 4AC9A 3AUUA 3L8CA 3RANA 5AICA 4R7ZA 3KLOA 3Q6NA 1EDOA 1EFVB 5CX1B 4OHUA 4EUSA 2A33A 4S12A 3CSDA 3D3WB 3M5WA 5IDYA 5K0NA 5IXYA 1WL8A 5EKXA 3ASUA 3T95A 1ZI6A 3H3FA 5TMPA 5FPPA 2C7PA 1CQXA 3PNYA 3NORA 1PHPA 4W82A 4BUJA 2HO4A 2XX3A 1FNCA 3RJ5A 3RS0A 3SG0A 5CAEB 4TWZA 5A4FS 1TAGA 4YX9A 4UJ5A 2DU8A 5KYGA 4PCAA 4QLOA 4UMVA 2BGGA 3AEKA 5LZ4A 1J56A 1MP0A 2EJWA 4MR8A 3GPLA 3R09A 4OIMA 5BQ3A 2P27A 5E6UB 5A04A 3DOCA 2G9VA 4QLAA 2D2FA 1UZMA 4LMAA 8LDHA 3GJ5A 1P8AA 5CDHA 2EQBA 4CT5A 2BGMA 5JFOA 3JWIA 1NFFA 3DR5A 1N33B 4DZRA 3UGKA 1GTSA 5ITVA 2D7DA 4PZEA 2PQ0A 2AH5A 3IHWA 1NVBA 4K9QA 4HDRB 4QG3A 4OX9B 1GGKA 2W0MA 1Q2XA 3IMEA 5CK5A 2BHSA 3LF1A 1ZUWA 1NULA 4GM1A 4LRSB 4XOUA 3UATA 2CYBA 1I7SB 5FF9A 5IU6A 4AURA 1HFKA 2R5FA 3U7QB 3LPCA 5FLYA 5GADl 1AU9A 2ANCA 2I2XB 3AVPA 4JCCA 4R7TA 1SZPA 1WTAA 2YHUA 5JO0A 4I14A 2X8JA 2QTBA 4E11A 2W48A 5BMVB 5LNK1 4I5FA 3ESCA 1E32A 1TJ5A 1R3DA 1H65A 4HNRA 5A0VA 2EZ9A 4MYSA 5WRFA 1VJTA 1N2SA 1JEEA 4E5KA 3TLYA 4R5HA 4RENA 2KPOA 5IEBA 2WSSA 3CUUA 4D9MA 5KBYA 1IE3A 5B4UA 3K7EA 4K9NA 3OX2A 2ZQYA 3PRYA 4Q16A 4HPXB 4QUKA 3F6SA 1G4HA 2PK3A 2VHVA 2H54A 4ZMSA 1QGAA 4MPRA 3NV7A 1XVTA 4MVJI 3RTAA 1ZEMA 4HYTA 4R9NA 3I53A 4R0VA 1BDMA 3I1IA 2II6A 2QEQA 3LT4A 4EW2A 2GM5A 4KH1A 5I45A 4M22A 3NVDA 1PDOA 3VH3A 1DEKA 1IY1A 3IH5A 4Q3BA 1M1UA 1WDWB 4LKRA 1QFMA 2Y66A 3CW2A 1XJ0A 5AVJA 2Q5LA 4Q4AA 1M2VA 2CLFB 1DCFA 6PFKA 3IIIA 1JIVA 2HA5A 2FWNA 7ADHA 3E58A 2PSDA 3FROA 1JW9B 3LG2A 2HMSA 4MGIR 3AEQB 2KLBA 1ECJA 3NR2A 1RWOA 3P27A 1BIFA 5EE5B 1Q14A 5BVGA 5LJIA 3U44A 3SYKA 4RTLA 3A1SA 2A1TR 3ECSA 3Q0EA 5TJHA 3UBMA 3A10A 4NXMB 2E49A 1HE2A 4XIYA 4BGUA 4ZV7A 1GN8A 3PZBA 3SF8A 1RPNA 2CZCA 5D3ZA 3UMFA 4BO5A 3KVNA 2O6LA 3TZ6A 1XTVA 4UDYX 1VLMA 2X41A 1S5PA 1BHSA 5GZ3A 1QF6A 3KEMA 2JIRA 2Q1TA 2FN7A 3IQHX 1M2OB 2I62A 3OF3A 4EKYA 4OVKA 1CVRA 5SICE 2BFPA 1QHIA 5EJEA 2FVYA 1AQ6A 3PKIA 2XTZA 1X1CA 2EFCB 2IUEA 2Z2IA 2HL6A 3BIOA 2BIFA 2JIQA 3LP6A 3RVNA 1L4MA 3B6ZA 3LPDA 4ND7A 4BO0A 5TEWA 4ESVA 3KU4A 1AGXA 2Z83A 2BTQA 1XTTA 2X8AA 4JR1A 3C5VA 1EU1A 1JSRA 3A4NA 3LTEA 5HJ2A 4BVBA 5HWSA 3CUTA 1M0EA 4N0QA 1FVXA 1P5RA 4JI0B 4LE0A 1KPIA 2L42A 1QH1B 4PFKA 3DZGA 4YFYA 1Z8HA 4ZCIA 1MB0A 1J49A 1MBZA 1O77A 3W7VA 2NV0A 5IABA 4G81A 5JWRA 2KBEA 1U0FA 3PNQA 4RLQA 4BE4A 4BJ5A 4PGAA 5TT0A 1XA3A 2ZT6A 2C92A 3G0GA 1UCFA 4JFRA 3AM1A 2B0JA 4X8OA 4D4HA 4G1EB 3PKZA 4IRUB 2WICA 3VO2A 5IVKA 1KZ9A 2GA9A 4O4HA 3UOWA 2JFPA 5DOVA 4P6VF 1T0HB 1ZQ1A 2GCGA 2J3EA 3T7TA 1XMVA 4U9HS 4TSRA 4EENA 3WXBA 4LKOA 2A58A 4YQYA 4MWDA 4NE2A 3JV7A 4L22A 3OIDA 5AW1A 2YRWA 3K5PA 1EUYA 1O87A 4ECAA 2ZUUA 4EG7A 5BXQC 3BULA 4AY2A 2BGUA 1KNXA 1A9ZA 3D8TA 5IAGA 3B3GA 5MGNA 3F6BX 4ATNA 3WK8A 2VCEA 3UWDA 3UAGA 4B33A 1P2FA 2HK9A 1KARA 1CUAA 1UJ2A 2GOYA 1A8PA 4WDQA 1RWQA 3F71A 4POAA 5GGYA 5IZCC 1SUIA 4LY6A 3QIVA 1GXSA 1DU4A 1UC8A 1VFPA 5KKAA 1CC1S 5SY9A 1Z0FA 1PFVA 2G71A 3O4VA 4G8CA 1BU5A 1XQVA 1NR7A 1VI5A 1BX3A 2OPBA 4WINA 2B2CA 3UJ7A 2VNKA 4JL8A 1W2HA 3IEXA 2VRWA 5A5DA 3FPEA 1PJAA 4ALKA 1BE1A 2VWQA 3TD6A 1R6TA 5AKLA 3G9UA 3PD1A 4FYWA 3E05A 3HCFA 4RPHA 3V2UA 2VJPA 1TO6A 3BMQA 4ND4A 4OB6A 1GLGA 1W59A 5L53A 1HDOA 5GY7A 1IVNA 1P33A 1YO6A 1VXOA 2A92A 5EUMA 2YV1A 3CEPB 5B5SA 3R7WB 5JI2E 3PIDA 1OLXB 4DCMA 2BFEB 3JAMA 3GLHB 3WI7A 3SEAA 1ISGA 1W4ZA 5JALA 2R47A 4YAGA 1YWGO 3MQFA 4NCHA 4QGFA 5CHYA 5GIPE 3THSA 5J5VA 3R24A 1N36B 2OV6A 4RY8A 3VR5H 1DVRA 2CNBA 4I6GA 2BP7B 2VHUA 3ZKAA 4DV3B 2QYHA 3HC7A 1WD7A 1BD3A 3LLVA 2GXSA 3R0JA 2QRKA 4URZR 1X7ZB 2JD1A 5K6AC 1G8YA 4L08A 4MPTA 4QX6A 2ZYSA 1P0QA 3DZIA 2D6FA 2ZIWB 4IJMA 5ALQA 5NLLA 3EDCA 1G98A 4CL2A 4HTFA 5KSOA 2FQQA 2YWCA 1XG5A 1RMQA 3HEAA 1VG8A 3R8FA 4FDAA 3VR5D 1FYDA 2P5YA 1TZCA 1BSVA 1ZH0A 4NBWA 4KKXB 5DOZA 3UMJA 4ARAA 5KVCA 3L49A 4HAXA 3S2ZA 1NI3A 1N34B 3QVTA 3F8SA 4D8TA 2F3TA 4HDKA 2HHJA 1VIAA 3ML1A 3S44A 4UBJA 1CUUA 3JQFC 4U2FA 3T5MA 4DA4A 2CLIB 4QGBA 3FPHA 4I50F 4ED9A 2BF7A 3BE5A 5IAAA 1GZSA 1NOJA 1B8PA 1M9NA 1QC5A 3ZDDA 2ASEA 3TD2A 5LU8A 1J09A 1FQOA 1M6YA 1K75A 3JZIA 2P67A 4P2BA 1R4AA 4A0SA 3EFOA 3I9V6 1EFKA 2F6RA 2BWJA 4XVCA 5ERYA 5ITZB 1G21A 4X94A 4OFXA 3S3TA 1FY2A 2NT3A 3V1KA 2FSVC 2ZSBA 2Q2VA 3JSAA 4QODA 4ZVTA 1KEUA 4PHTA 4RMIA 1Q7RA 5BQFA 1U5AA 2N3ZA 1YIOA 2ZJZA 2FRXA 2PH5A 5DRTA 3ZDRA 4JVLA 2PIDA 3EIEA 3JQ9C 3VBCA 1JG7A 3WJAA 1MQAA 1EFVA 1IZ9A 5CX1A 2HSEA 5E9QA 5B64A 4QNMA 4PAWA 3V8BA 1OREA 2HSJA 2AJBA 3D3WA 4M0DA 4ZRMA 1GZDA 3PSHA 3EW9A 5FUBA 4I1UA 3Q8MA 4MUIA 1USIA 2GKGA 2PZAA 3DMRA 1DUSA 5CAEA 4CMJA 4KO3S 1MMFB 4Q7KA 4ZOEA 1JFTA 1VE9A 2LUOA 3VNBA 1Y5RA 2CNWD 1SHLA 1X39A 3U19A 2VK1A 3F8TA 3U3MA 1YS7A 5E6UA 2XCUA 3BERA 3PE3A 2QX4A 4MTCA 1Y42X 2FEOA 4MJXA 4RIEA 4C2AA 1Q92A 1EVQA 2X40A 3OTWA 1V16B 3HP4A 1VYVA 3WNBA 3PUWA 5JATA 1U1DA 4IXTA 1ZW6A 4P4TA 5BRJA 1EX9A 4IEEA 4NJEB 3AR2A 4F0JA 2JLCA 5BXYA 1XF1A 4HDRA 3QV2A 3PC3A 1UBJS 1R27A 1DHRA 1DJLA 4LS3A 2AEMA 4Y9TA 5A1TA 4Q03A 3L0BA 4J0CA 5A3JA 4YRBA 1HY3A 5CCEA 1M1YE 3U7QA 5FTWA 1Q21A 2R2GA 3QI2A 4ZQBA 5JJBA 3D6VA 5K8IA 2QNBA 1RWPA 4HN9A 4QHTA 2C99A 5BMVA 4LCJA 3B8EA 1H9BA 2YVAA 1OZFA 1DBVO 1M6HA 1T3SA 1W1UA 3I30X 1CZKA 2DP4E 1U6KA 4H60A 4M8LA 4YPFA 3R7NA 3GROA 4HUQB 1Y6RA 2XQJA 1YS4A 1LV7A 3WLNA 5AVQA 2WKSA 4WT7A 4MV1A 3H9GA 1PR5A 2JJ2A 4IINA 4KE9A 1I24A 4PFJA 4NP6A 2OQ2A 5JECA 3U9LA 5C35A 5HKBA 2KB0A 1ZA2A 2H1RA 3ABQB 4XPIB 1LWNA 5TMBA 3GLGB 4ZYVA 3U16A 1DTWA 1RXVA 1K7SN 3E27A 3DNMA 3IUMA 3KZVA 5AO9A 2X3YA 1G64A 2H3HA 3HM2A 1ECGA 1XA4A 5DWVA 1WCV1 2E48A 3AETB 2YJTD 3EY4A 3IVCA 2JI4A 5TGDA 4DLPA 1RMYA 1YR2A 3HUTA 3V7NA 2PL9A 2NSLA 4A91A 1QVWA 1AZTA 1RT9A 4MLCA 1KU0A 4C22A 1FA9A 1JYSA 3FCOA 3FBGA 4M9ZA 1H6DA 3H2SA 3UHJA 1H9CA 1I32A 2VPIA 2Y1CA 2LVBA 1VPLA 2IIPA 3OMXA 3O75A 4D81A 2I2BA 2IDZA 4RH1A 4U6NA 1Q3KA 3N2NA 2IDJA 4NBUA 3L0CA 3GWGA 2CMDA 2DECA 3AEQA 3HYCA 1XZEA 2FF7A 4WK6A 3KQHA 2IZ1A 3VYVA 4UQOA 4HS9A 4LGCA 4JI5B 3TW8B 1DELA 3UUEA 5AM2A 1W6UA 3MG9A 2JJQA 3T7RA 3TNLA 2GFIA 3AF0A 1LLDA 3G89A 3BN3A 4GG1A 4DSTA 3FFWA 1QANA 4AMGA 1NXXA 1C3EA 3UXMA 2ZAOA 3CN9A 3TBFA 3X1MA 4F92B 1SWVA 1UUFA 2VPYA 1DDIA 3D1VA 2VQFB 3W8NA 1KGDA 4NDZA 3C16C 4RD3A 1VB3A 5DSXA 5CJJA 2NU9B 5BSGA 1M2OA 4ALLA 3CSUA 3EE6A 3ETNA 4WKGA 3ZWKA 2DUUA 1OFIA 1JFSA 2PU5A 3ZIDA 2C1EA 4B35A 4BWFB 4XIIA 1CETA 4JBIA 5LDDC 5A7HA 5DXJA 2QAGB 3FN4A 3TTUA 4URVR 1WU8A 1K66A 4J1QA 4AD8A 4DRZA 4DVJA 1VQ1A 2FWPA 2I6TA 2QGFA 3CLTD 1XZAA 2XWJI 3H1BA 1SIWA 1ZJZA 3G2QA 3N0TA 3INYA 3ESYA 2EFGA 3Q98A 1Q95A 4LZWA 1TLTA 4RVDA 4TS9A 4YK7A 3AC0A 3ZHXA 1QH1A 5CR9A 3TGLA 6LDHA 3OZTA 1QRUA 4K0KB 3CEHA 3MJHA 1GUYA 4V0QA 2C42A 2OFXA 2GEVA 4MRRA 1MX1A 1XMJA 1YAHA 2ZJ3A 3AIMA 3PB3A 3QBDA 5DCLA 2C03A 1RRFA 2OE2A 2VF4X 3WGZA 4CHGA 1T9DA 3FOCA 1V11B 2PUWA 3FYHA 2ZAGA 5EP3A 4ZODA 5JS2A 5KDLA 3HYTA 5FUWA 3RG8A 1N5LA 3P2MA 1G20B 2I6UA 2WRZA 1YRAA 2XJ4A 1HE1C 1SG9A 2FOIA 2LBPA 3LRTA 3NWOA 2IX9A 3KJXA 3VR2A 5BNWA 2NO9A 1QJCA 3QEJA 3RVMA 1VE6A 2Y4OA 5B7GA 4A26A 3TLEA 4ZFNA 1Z33A 1SGWA 4L5IA 2RKOA 2ZSFA 3KETA 1XJ5A 3E9ZA 3IPLA 1QAMA 3NT5A 2HWYA 4HT3B 4HAOA 3GJRA 5LZ7A 1H23A 3COSA 2YYZA 4A5OA 1AQNA 4DIOA 3W78A 2ODEA 1U8AA 1KBQA 5DW3A 1KP2A 2XBLA 2VO1A 1RJFA 2R1VB 1AXEA 2WMOB 3KT0A 1UC5B 2PGLA 3CRW1 2WG1A 2Y2UA 3R3YA 5JMOA 2A0FA 4RTPA 3KCNA 4JLBA 3JSXA 4AN1A 3OEED 3T3OA 5G1NA 4MP3A 1Z88A 1XZJA 3GRAA 1E3MA 3DAFA 4QDTA 1E7QA 1PQUA 3W1EA 4JBNA 5K3FB 1Z83A 1WCIB 2WIGA 4L76A 4RL4A 4CW7A 1FBTA 2XHEA 5TF4A 5G0WA 1JEQB 2V7PA 3UMSA 2GAJA 3C5CA 1U90A 3NIBA 4PHFA 1Q0PA 2Q6IA 5H5JA 4TUYB 3QVMA 1AKQA 1KEZA 1E1KA 1OYWA 2B6HA 2XUQA 1TMOA 3F7MA 3G1WA 4JUDX 5AVKA 1DC8A 3ZBUA 4EP1A 1YMQA 2EQAA 5L40A 1WB9A 4OV6B 5E1OA 1OLXA 2DWCA 4BWVA 2BFEA 5EJ7A 3GLHA 3WWYA 1Q0QA 3U7HB 4MDEA 3UYLA 1I33A 2AWNA 1Z5ZA 2AG5A 3FCAA 3HJUA 5DMHA 1RBMA 3MGKA 5CH3A 3U1BA 1ZC4A 4RVOA 4KRGA 2Q3CA 3DPIA 1SXHA 2G63A 4U2CA 3WDSA 2BP7A 3CX3A 4MINA 4UUQA 3NHRA 1GDTA 3CTMA 2ZDGA 1INLA 5HTKA 1SVOA 2AD1A 4WWHA 4M38A 3OX1A 1X7ZA 3WGOA 4JLVA 4JYMA 3Q4GA 3IV7A 3O4IA 3OF5A 4C4YA 3R76A 1OGJA 3T52A 2OXCA 5DT9A 4DNOA 1M66A 3B5IA 4B3DA 1NUSA 1S2LA 4B4WA 3PE6A 4UFPA 3PCXA 1EWQA 3KJNA 4RJKA 3CCBA 2FE4A 4MVJH 2NYRA 2XSZD 1B41A 1Z47A 3OICA 4XM2A 5I47A 1HFWA 1IHDA 2NZVG 3QFHA 4AMYA 1N2ZA 2EF1A 1KH2A 2CLKB 3TZHA 3WTCA 1JB1A 2F2TA 3D0QA 4X63A 5AK4A 4Y2YA 4CR6A 4WY8A 4B3TB 1NU6A 2RHLA 2ZB4A 1GYRA 7AT1A 2RHDA 1XZKA 3ZWAA 4RDIA 1Z0KA 1AB5A 3C4QA 3D8UA 3GDHA 3GIDA 3GLIB 4HQFA 4AJJA 4H4DA 5CGZA 4FEEA 2Q0XA 4HCJA 2BZGA 3A3PA 4CNQA 4MVJD 4CETA 3JQAD 3OPYI 4O4IF 3H5IA 1SO8A 2VUIB 1P1CA 2H16A 1K3FA 4CQMB 1SBTA 2IZ7A 1T0PA 4CPDA 4FJ1A 4ZKDA 5LQDA 5ITZA 5KPJA 5H80A 3MD0A 1QIDA 1TJPB 4QPPA 1SQSA 5C1PA 5TS3A 4OKNA 3SZ3A 3Q72A 2XB4A 3HWWA 1YACA 1VL8A 1RPJA 5ESRA 3ZQUA 4C0XA 1OD6A 2WAXA 1JUDA 1IN1A 1YTUA 3ZCQA 4V0RA 3NHBA 4LOHA 5DNDA 1DX9A 1PFYA 3WGMA 4NI5A 2YN2A 2H5JA 2MTBA 2D2XA 4L0QA 1XVLA 1Z2CA 4TMXA 1I4TD 5LZ5A 5NULA 3WJ2A 5CFLA 2HA6A 1FNDA 2CJYA 3P2OA 1XNRB 3U4MA 2YWDA 3HMKA 2R9VA 1QBKC 1YVRA 3GYGA 4RVGA 2IV3A 3SDSA 3WOHA 1QHEA 4AG3A 2BGJA 3RT7A 3T34A 4WCDA 2R6CA 1KYXA 1TAQA 1U3FA 1XKTA 1DB3A 1KZ7B 1R6AA 1O0SA 1NLFA 4TYYA 1U8EA 1DIHA 3WRXA 1TTHA 4L07A 4B32A 4HB0A 1PK9A 1IHYA 3UK1A 4AZVA 1V16A 1NG9A 1SHTX 1F48A 1RW4A 4YGXB 1E9EA 3W2FA 1T10A 1BE8A 1CR0A 2AVNA 4NJEA 4HFNA 3TFOA 3FYTA 3GRPA 4YCCA 1X8JA 1PL7A 4HRXA 3W9BA 1J5EB 3ZH9B 1VA4A 1RWWA 5LB2A 2V4UA 3LMKA 3DBLB 2WTBA 1LU9A 3QEKA 4GYYA 3ONWA 4LDJA 2OXTA 1SXJB 1NQ5A 3ZDEA 1A5SB 1MEEA 4J03A 1CX9B 3DBHA 1GSIA 3MK31 3W3AH 2DEUA 2E2WA 2W5UA 3RC3A 4H6VA 3IOCA 1QG0A 3E2IA 4RJJA 2PZEA 3HGQA 2QE7D 3IDQA 1Z08A 1P1RA 4NV3A 1Z0SA 2RI6A 3GLSA 3D7LA 3KR1A 4PICA 4YAWA 1JAZA 3OOEA 5U1PA 2WPDA 2Z4RA 4HUQA 2GTHA 3OT4A 3BQNB 4YP7A 4MJ7A 4Z0PA 4ARVA 5C5EA 1BH6A 1GPUA 1Q6ZA 3ROGA 1V8FA 3BJRA 3CH4B 3W3AD 3PNVA 4DQDA 1VLZA 4RKWA 5ARDA 4GLBA 1PZMA 4KYTA 4B3RB 4XPIA 1Q0UA 1R8XA 1XL0A 2EJBA 4F1KA 3T0FA 2PH1A 1O94A 1A5BB 5A5GA 3GLGA 2L19A 2GHIA 3R41A 4LECA 5LUBA 4H1WA 3OFND 1TI7A 4R9UC 1KS9A 4GMDA 1XP5A 1PLJA 5CT6A 3WIOA 3BA6A 3CLSC 2JAPA 3G5TA 1NR1A 1PJZA 1ZD8A 5IUKC 4EMTA 3B82A 3PQ3A 5D3MB 4DXDA 3FDFA 4LMPA 4F9FA 1IG0A 3HA7A 3E7XA 4H15A 3PG5A 5FB3A 1BXRB 3CLVA 4HQRA