3AIKA

Crystal structure of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
molecule keywords 303aa long hypothetical esterase
molecule tags Hydrolase
source organism Sulfolobus tokodaii
total genus 102
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aikA00
1BE0A 4ZWNA 4FBMA 4IH4A 4BE4A 2YASA 2QXUA 5ALKA 4DGQA 1ODCA 1UOQA 3I28A 1J07A 2BAGA 3O95A 4AO8A 3LCRA 1CUDA 3WKBA 4H77A 2XUHA 4MWTA 1VZ3A 4CG1A 3WWOA 3GBSA 1BRTA 3OURA 3VJMA 4UFPA 2HA2A 3WMRA 1MAAA 3A2NA 2XUPA 2YYSA 3DD5A 3I1IA 1VKHA 1XZMA 3I1YA 1QIGA 1IUNA 3AZQA 1CUYA 5AI9A 4C4ZA 2XLCA 1BN7A 4QA9A 4BDTA 4B0OA 2GYVA 4FDMA 1YA4A 1XZGA 3QYJA 5JAUA 3LIPA 5FKJA 3DOHA 2QZPA 3F98A 5CBKA 4C89A 2VJCA 4G8BA 3KOOA 4ZRDA 3ZLTA 5K3AA 2WU3A 3WYDA 3RKSA 5HF5A 5CMLA 5EHNA 1R50A 4Q05A 1S8OA 3G0CA 3WKCA 4H7JA 4C6HA 1QIMA 3G0BA 3ICVA 3IUQA 4JYPA 4M0EA 1AKNA 5AM2A 2O7RA 2VJBA 5DNUA 3DL7A 4IH1A 5IVIA 1QJ4A 5ALOA 4G9EA 3RK4A 1F0NA 4KYVA 2OQVA 1USWA 1DQYA 5JAOA 3PICA 5ISMA 5AK4A 1DINA 3E0XA 4BVKA 2ACEA 5DYYA 4WCVA 4U2EA 1G4HA 1UOPA 1X2BA 2DR0A 2GBFA 1CR6A 3F96A 2Y6VA 2JGLA 4U2GA 1QE3A 1CUIA 1JI3A 1W4LA 2GYWA 4BAZA 1K4YA 4DMCA 1PFQA 1JMKC 1O6FA 3ZV7A 3SWWA 3BWXA 2QUBA 3LIIA 2VT7A 4X91A 2PX6A 5HZGA 4GBGA 5IVKA 3B5EA 4ZV9A 4WFKA 1W1IA 4ROTA 5A71A 2AXEA 1XZCA 4ZI5A 4AQDA 4DNQA 1ZJ5A 4X00A 1KEZA 1LGYA 1LBSA 2J3DA 1GPNA 1N5MA 2ZJFA 3L1HA 1W52X 3K6KA 2VAVA 4CFSA 4ZV7A 1VZ2A 3TEJA 4CIBA 2WHPB 1MPXA 2X5XA 4J03A 1MJ5A 2JEZA 2HFJA 2XMBA 1SC9A 2XQGA 4YK7A 4U2BA 4BRZA 3HEAA 1DWPA 1N5RA 5JYCA 2NW6A 5ALLA 4X6YA 5LP1A 1YA8A 1B6GA 1XZBA 2DSNA 1AX9A 4P93A 4U2CA 3G0DA 3E1GA 2HM7A 3E3AA 2WILA 5AKXA 4W1SA 4K6HA 1U4NA 2GYUA 2WTMA 1EB8A 4S0XA 5ALWA 4H7DA 3G7NA 4DNOA 3T4UA 4FFVA 1XROA 1ZD4A 5JATA 2G5TA 2X8BA 4MXDA 3UMJA 2QM0A 2RIPA 4UBLA 5A2GA 4UBNA 1E5TA 3DJYA 4C88A 4XX1A 5JALA 5JZSA 4K2AA 1YSCA 1ZD5A 2ZYRA 2WG1A 5CT9A 3W9BA 3EQ7A 4JNCA 3ZLUA 5JARA 2WM2A 4QDXA 1GGVA 1TQHA 1QTIA 2O2GA 5LZ2A 4BC0A 4MWSA 1LZLA 4P08A 4X92A 1GQSA 1ZI9A 2OGZA 2HL6A 3O4JA 5F4ZA 1Q84A 5DTIA 4HZGA 1JJIA 5YASA 3WKEA 5K3FA 5DJ5A 1CUSA 5EIHA 3C6BA 2XB6A 4PV7A 1G66A 4WY5A 3W06A 4WFIA 4FLEA 2CB9A 2RHWA 4BAUA 4BYMA 1YAJA 1A88A 1H22A 2HU5A 4RE5A 3OG9A 3OM8A 2OLEA 1U65A 1RYYA 2C4HA 4O08A 4Y2UA 2XUIA 3VXKA 2WUFA 5K5EA 1ISPA 3HSSA 3WK5A 4B85A 5ALPA 5EIAA 2FUKA 1QIIA 2PPLA 3VJKA 4UHBA 3O4HA 3PF8A 5HKBA 1LLFA 4DNPA 2AJDA 4X95A 1YS1X 3MGAA 5FP0A 1H2YA 4Y2XA 5KBYA 4L9AA 4H0CA 4W1PA 5T4BA 1UWCA 2WHQA 5AM3A 4U2DA 2DHDA 2ECFA 2ORYA 3ILSA 2C0QA 1XZHA 3STXA 2EDCA 1ACJA 3QZUA 2PU5A 4UUQA 1TIBA 1OCEA 2Z8ZA 1EA5A 3AZOA 1EB9A 3M83A 3PUHA 3W2TA 1BEZA 3QPCA 3FLAA 4H7HA 1UFOA 4IO0A 4HXFB 4OYLA 2PL5A 1W6RA 4EY5A 2E3JA 2JGIA 2AJBA 4YASA 5AKYA 1CRLA 1ODTC 5AI0A 2ZVDA 2C0PA 4FBLA 3G0GA 1DU4A 2QUAA 3KSRA 4QDZA 5JAPA 1QFMA 5E4JA 3WWDA 5LYYA 4BCBA 4CG2A 1AMNA 3EQ9A 5EGNA 4G4GA 3WL7A 1QOZA 3CN9A 4UBMA 5AM1A 2HA6A 2C58A 1DTEA 1ZD3A 2PKYX 2ONCA 4TGLA 4FLMA 3FVTA 4V2IA 1XLVA 2ZYIA 1SCQA 5IVDA 2CKMA 2BFNA 4G9GA 1H2XA 5D6OA 5HF8A 3S2ZA 5KREA 3N2ZB 2UZ0A 3FLEA 2WG2A 4BVLA 1H2ZA 2LIPA 1VXRA 4WDRA 4DM7A 3MUNA 4BP8A 3R40A 5EI5A 3HRHA 4UFOA 5IVHA 2XMGA 5ALSA 3EF3A 5C8XA 4FNMA 4KAFA 1ORVA 4RE6A 1HDEA 1E8DA 1TCCA 1SFRA 4LXGA 5ALVA 3MUOA 5AI5A 1QFSA 4ZGBA 4Z49A 5LZ5A 3AIKA 1QLWA 3DQZA 3G9ZA 2OXEA 1MNAA 1VE7A 4UPDA 2H7YA 4EY6A 4LXHA 1EDDA 2BUCA 1XLUA 3H18A 3FBWA 1VJ5A 4A5SA 2HA4A 1A8QA 4W1RA 3A2LA 4AZ0A 1SOMA 4KE6A 2XE4A 4MYSA 4UHFA 3C6ZA 4Y2TA 4Q3LA 2PSFA 4MQLA 3ICWA 1KU6A 4BRSA 5E4TA 4G1FA 1GXSA 5AK3A 1XZIA 3I2HA 3IVMA 5A6VA 3LLCA 5ALFA 3ESBA 5CT5A 4QWWA 3X3HA 1ZD2P 2WHPA 1FFBA 3IBTA 2X76A 3F8SA 4CCYB 5AH0A 4Q3OA 3O4GA 4FFWA 5AHXA 2XQFA 4HRXA 1YB6A 2HU7A 2QS9A 2WIFA 3IURA 2ZJ7A 1XZAA 4RNCA 5CT4A 4E14A 1EI9A 1W76A 3GA7A 1LPNA 4N8SA 4RGYA 4H7FA 4ZREA 5AKZA 3O0DA 2QRUA 4QLAA 1CUXA 4Y2YA 1GKKA 3ZI7A 4CIAA 4MJ3A 2BCEA 5AM5A 1QO7A 1UKBA 2Z3ZA 5JANA 5K3BA 1CLEA 1XQWA 5CT6A 3D3NA 1P0QA 4XVCA 3WWCA 1XRMA 1L7RA 4PNZA 1ODSA 2OGSA 5EFZA 1PV1A 2W6CX 5FPPA 4B83A 5CH3A 1Y7HA 4NS4A 5FUMA 2CJPA 2XUGA 2RI6A 1JKMA 1FFAA 1EK1A 1QIDA 3RLIA 2CEKA 4IQ4A 4EZIA 1EHYA 1LPSA 1XRLA 1ZI6A 4BAGA 2PSHA 4CG3A 2B4KA 4W1QA 1UKCA 3DKKA 4X6XA 5ALMA 2K2QB 1RWQA 3H1BA 4X93A 4LYEA 3BDIA 4PO3X 3TJMA 1UK8A 1TRHA 5FDFA 5LZ4A 3BJRA 3FCYA 5ALYA 4KE7A 4F0JA 5JAHA 2WTNA 3H17A 3I2IA 5DWDA 1BU8A 4AO6A 3NOXA 2XUJA 2DQZA 2VSQA 4OU5A 5JASA 5CRIA 4B82A 2JGEA 4AXBA 1SCIA 3I2JA 4KRYA 5ALNA 1CUUA 4BB0A 3H2IA 5DYTA 3QMVA 5DTJA 4GHWA 3TGLA 1LPPA 1QZ3A 4QDUA 1EXWA 1F0PA 3H2GA 2PSEA 4AZ3A 3BXPA 4KE9A 3M81A 1U8EA 1VA5A 1MAHA 5LZ8A 3BIWA 1AGYA 2XQJA 4RPCA 4G8CA 3DEAA 3HJUA 2VAXA 1CUEA 3DS8A 1WM1A 4NVRA 3VVMA 4Y2VA 3WZMA 4KAAA 4QEKA 3WL5A 4DLNA 4J0DA 4EA6A 1O6GA 2OCGA 3D59A 3STWA 4AX4A 3PE6A 3CXUA 4F60A 4PF1A 1G42A 3NUZA 4G4IA 1UOOA 1BEEA 4N5HX 4OB8A 2FJPA 2HRRA 1X2EA 5KWJA 2R11A 4QE3A 3QBJA 1GKLA 5C8ZA 1EH5A 2I3ZA 5AKEA 3STTA 3C70A 2WIGA 4UBKA 1CPYA 1AZWA 3DL4A 3BIXA 3C8DA 2XT0A 4AMZA 4BZZA 3M82A 3WA6A 5KWIA 3GFFA 2JBWA 4DIUA 1JU3A 3FYUB 3H2KA 1EDBA 4OB7A 3QM1A 2XI4A 1OXMA 2Z8XA 3WJ1A 1MT3A 1CUZA 1YCDA 4UBJA 2VQ6A 1UK7A 1N8SA 1Y37A 2PVSA 1THTA 5H3HA 4GXNA 2XUAA 1W75A 1CVLA 3I6ZA 3DLTA 1DX6A 2FX5A 3WK9A 1E89A 2I3DA 1DX4A 1K5PA 3FYUC 4B0PA 1BCSA 3D7RA 1CUCA 1JMYA 4Y9SA 2VT6A 4EY8A 4J0HA 3BJMA 4QWMA 4GWLA 1XRRA 2H1IA 1QIEA 4WDQA 1FFDA 2WQZA 5FLKA 1XZJA 3G9TA 1XRPA 4J3JA 1JT2A 4DSAA 3R3VA 3V1KA 1BROA 4EB0A 5CURA 2Y2VA 2PSJA 3JWEA 3SX4A 3ESAA 1IZ8A 1XKTA 2D0DA 4JUIA 5LZ9A 3WKAA 4H7IA 1MTZA 4X7BA 5I9IA 5CH8A 4OPMA 4HS9A 1MX1A 4BCDA 1ZICA 3I2KA 1WB5A 2P8SA 5T4FA 1YS2X 4LYDA 4OUKX 3WK6A 3FSGA 1XFDA 1G5FA 3VVLA 5T4HA 3V1NA 4GEGA 3R3ZA 2HA5A 1R1DA 5FPQA 4D9JA 3C6XA 4UHHA 3EIOA 4B80A 1T2NA 2WU4A 4M0FA 4N8EA 2WHRA 4N8DA 3G0IA 5EIEA 5I8PA 1CUGA 4U2FA 2HU8A 4J0KA 4B7ZA 1CUAA 2WFZA 1LPMA 4CCYA 5C8VA 4FMPA 1P0PA 1TK3A 3F67A 1WOMA 2HDWA 2WJ4A 3F9CA 1QIJA 2JEYA 1J06A 3BE8A 1C7JA 1ORWA 4C87A 3PF9A 3ZWQA 2IIVA 4PSDA 4EBBA 2XUKA 1CUJA 2OG1A 4L3WA 3WL6A 4BTLA 4KRXA 1LPBB 4WY8A 5ESRA 3VDXA 1VXOA 4E46A 3I6YA 4K5QA 5HKAA 5ALRA 3HC7A 5HQ3B 2O2HA 1UK6A 3D0KA 5AI8A 4FKBA 3ANTA 5HF6A 3ZLVA 5CXUA 2HHAA 4UBIA 2ROQA 3HZOA 1ZI8A 5AK6A 4I3FA 5FV4A 3AIMA 3PFCA 4OU4A 2BUAA 4P92A 5EHXA 5ALDA 2OQIA 3QMWA 4LIPD 3R3YA 4HAIA 1XKLA 5AOCA 3BDVA 3H19A 1GPKA 4GLBA 1EVEA 4HVTA 5AJHA 4Q1VA 2XUFA 1CQWA 6YASA 4KAJA 3C5VA 5JZ9A 2PUHA 1TCAA 1EVQA 2RAUA 2XMQA 2XMDA 2HADA 3CCCA 4BP9A 4H35A 2DQYA 3M3DA 1EINA 3G9XA 3QPDA 1NU8A 3AUKA 4F21A 5A7GA 4DSZA 1MNQA 4Q82A 5AKGA 4L72A 1UKAA 4BTVA 3IULA 1VOTA 2XMZA 4C4XA 1CIJA 1PJAA 1H23A 1WHSA 4X71A 3VJLA 1R3DA 1WCYA 3WIOA 1IUOA 3BF8A 3QVMA 4G5XA 1YR2A 4ARAA 5CW2A 3KWFA 3MVEA 2GZSA 1Z68A 2H7XA 5BWCA 4BDSA 4OD0A 2JIDA 2CUTA 3WA7A 1AC5A 4PQEA 2V96A 2WJ3A 1Q0ZA 5AICA 1E3QA 1ZGBA 2WFMA 4HXEB 5CH5A 2HRQA 5FRDA 3ANSA 3H04A 3HXKA 5CTAA 2C5GA 2JGJA 3OC0A 4MEAA 1XQXA 2Y6UA 3SK0A 3D2BA 3WZLA 2G4LA 2B9VA 4BZWA 1C7IA 4Y2QA 2WJ6A 5JADA 4JH0A 2XQIA 3Q0TA 2JGFA 2ZYSA 4OYYA 1QGED 1X70A 3D4LA 4M0MA 3AINA 5ALQA 2XLBA 3W05A 1QO9A 1YASA 5AO9A 4GDMA 4MEBA 5AIAA 2BGRA 3WWPA 3EQ8A 4QLOA 5I7UA 1GQRA 2RHTA 3AJAA 1VE6A 1AQLA 3PI6A 1WHTA 1IUPA 3LP5A 2O2IA 3A2MA 1T4MA 4PSCA 2QMQA 2QJWA 3G02A 2ES4A 3FYUA 3QITA 3P2MA 4EUSA 3QPAA 2D5LA 2HA7A 4Y2SA 1CUVA 3C5WP 1XZFA 2QJRA 2J4FA 2XDWA 1TCBA 1EDEA 1CUHA 2G5PA 3QMMA 2GBIA 3HYSA 1MX5A 1LPOA 2O7VA 1TAHA 4UHEA 4E11A 3NWOA 1YB7A 2GZRA 3ESDA 3OTQA 3S8YA 1J2EA 2XQKA 1XZLA 3R3WA 3F97A 1OILA 5AM0A 2GBCA 1EX9A 5AP9A 5AKKA 3DDUA 3STVA 4DNFA 1BN6A 3SC2A 2W22A 1L7QA 3KD2A 5LKRA 2QOEA 4Y7DA 2Y1KA 2I78A 2V9ZA 2OAEA 3VISA 3T52A 5ALJA 5LIPA 1QIFA 4W63A 4BATA 4Q3KA 3L1JA 4FLFA 4J0CA 4B6GA 5K3DA 2WUDA 4XIIA 4DYHA 5JZBA 2VA9A 2WKWA 1XRQA 2CBGA 3W9UA 4YPVA 5T4EA 3DOIA 4J0GA 2ACKA 4GI1A 3WL8A 3O9MA 4E15A 1BS9A 2C7BA 1R88A 5AM4A 3WKDA 2WIJA 2AJ8A 3HLKA 2PBLA 1R4ZA 4KJXA 5AI4A 3H2HA 1DWQA 1ZGCA 1K8QA 4NZZA 2ZSHA 3R3XA 4A16A 1UZAA 1L7AA 1Q83A 1P0IA 3AIOA 3O9VA 1CEXA 5JIBA 1THGA 3FSGD 1TKRA 4QDOA 2WSLA 3Q8WA 4QNNA 4H18A 2XUQA 5AKLA 5BWBA 1WPXA 2DHEA 1ZJ4A 3AILA 5ALEA 3A6ZA 3V1LA 2FJ0A 3IUMA 4BBZA 2WIDA 3W04A 3C87A 1E8NA 1H2WA 5HQ3A 1QONA 1LPAB 4B81A 1P0MA 5D3KA 1HKHA 3PFBA 3UUFA 1DT3A 3LS2A 2OCKA 2G63A 3FYTA 5JD5A 3FVRA 4X85A 4BC1A 3V1MA 1Q0RA 4UHCA 3PDCA 3GZJA 2DCMA 1ZOIA 4JYMA 1E66A 4KE8A 5EHQA 2HA0A 5AKIA 2VJDA 2BGNA 3I2FA 2XMRA 3C6YA 3IA2A 4AB1A 1Y7IA 5ALGA 2WFLB 2XMCA 2VJAA 3WK8A 5HK9A 2WG0A 4GECA 1MO2A 1HQDA 1DQZA 2VTVA 4ZXFA 1C4XA 4PSUA 4QZVA 2R8BA 4KR0A 4FNGA 3BF7A 4UFNA 1XLWA 3STYA 4FOLA 1JFRA 2BJHA 5IKXA 3IUJA 1YAHA 2ZYHA 4H7EA 4WFJA 4C4YA 4EY7A 2BUBA 4AN1A 3DCNA 3JW8A 1SCKA 3HABA 5AIBA 1HLGA 1DT5A 1HL7A 3O4IA 4J0IA 1JU4A 3C8HA 2OPHA 3D5EA 3B12A 1KU0A 4UHDA 5AKJA 1DWOA 5EHZA 2VATA 3K2IA 1IZ7A 2J3QA 1R9NA 5BOVA 1A8UA 2EEPA 3VKFA 2ZJ6A 4MYDA 2Q0XA 1R9MA 5JD4A 3IB3A 5C81A 3CCBA 4IH9A 3WLAA 2QXTA 4KACA 2XMSA 5C7YA 1UXOA 3GROA 1AUOA 5IH7A 3CN7A 2XUOA 3A70A 4FWBA 5AOAA 4Y2JA 5FOQA 5E2IA 1CQZA 4B9EA 1LNSA 3G9UA 5SYMA 1XZKA 1WB4A 1QTRA 1EK2A 3FOBA 1FFCA 4J7AA 5AOBA 2WLSA 4FHZA 4DMFA 2DFPA 3ZPXA 3N0TA 5HF9A 4K6KA 2IX9A 2JGKA 3R41A 1FFEA 1F6WA 2EDAA 4F5ZA 3GELA 5JD6A 4OSEA 2Z5GA 1IMJA 1D07A 2HA3A 2GBGA 2QVBA 3B3QA 3U0VA 1N1MA 5CXXA 2BKLA 4BVJA 1CUBA 3ED1A 3TRDA 2ZSIA 1FSSA 4AO7A 1K63A 4X94A 2I03A 3L1IA 3HACA 1CUFA 5HFNA 3WK4A 1J1IA 3RARA 1QIHA 2C5FA 2J4CA 5AI6A 1XZDA 4BCCA 2WIKA 1I6WA 4TVKA 2RGUA 3WQHA 2PSDA 2HFKA 3QH4A 1XRNA 4IHAA 5J3JA 1BCRA 2QKYA 2XUDA 4Y2PA 1NU6A 4W9RA 3KXPA 1VLQA 4KEAA 5E4YA 4TPKA 1M33A 3WK7A 1LBTA 2V98A 5K3EA 2OCIA 2OAGA 5FXMA 2DHCA 3R3UA 5ALTA 3D2CA 4ITVA 4Y2RA 1MX9A 3I2GA 3IDAA 1JJFA 3FAKA 2H9YA 2PUJA 4Q34A 5SYNA 4P9NA 5ALHA 2RONA 2V97A 5LKAA 3KDAA 3DYVA 4UBOA 4H7KA 1A7UA 2YH2A 3EBLA 3HI4A 5DNVA 4X90A 3R0VA 4K6GA 1CFJA 2B61A 2OCLA 2CMFA 3C45A 4AN0A 5AKHA 4YX9A 4B84A 3V9AA 4G8DA 5HCUA 1ZIYA 3DNMA 3GUUA 5A7FA 3OPMA 3WI7A 4OB6A 4XWGA 4CCWA 1GPLA 5D3ZA 4X6UA 5ALUA 2PM8A 4WJLA 1HPLA 3U1TA 3IIIA 1ZIXA 5HFAA 3AZPA 1NX9A 4ARBA 1WPRA 5AK5A 3WIBA 5BV7A 3STUA 2YXPX 2Z3WA 1LZKA 1QIKA 4G4JA 4LKOA 3I6MA 1VA4A 3WYNA 4LHEA 1UT6A 4I4CA 3BL8A 2Y2UA 5HK8A 1AURA 4MQMA 2VEOA 4DTCA 3FLBA 3AFIA 4FTWA 4QDTA 4AMYA 4I19A 4XJVA 3NGMA 3WJ2A 1IVYA 2AJLI 4B9AA 5LLSA 4EHBA 1GZ7A 4X3CA 4INZA 1MN6A 1GT6A 1WB6A 2AJCA 3D2AA 5DNWA 1FJ2A 3PUIA 1K6EA 4X97A 2WUEA 4EY4A 1XQYA 2VF2A 4NMWA 7YASA 5DYWA 4C01A 3DYIA 2PU7A 3G8YA 1JJBA 2QR5A 3RM3A 1E8MA 1B41A 4DMKA 4L0CA 4A23A 4BE9A 1UK9A 4HRYA 5CT8A 3OOSA 4DMHA 3IUNA 2QT9A 1CV2A 5A62A 1CUWA 5K3CA 3FCXA 2OGTA 5K3FB 1MU0A 3DKRA 5ALZA 4ETWA 5DLPA 4PW0A 3V48A 4GW3A 3H0CA 4LXIA 2CZQA 1HBJA 2QTBA 2WFLA 2H7CA 3JYHA 5A7HA 1XQVA 2JGMA 2B20A 4HTAA 3WWEA 3FWHA 1RP1A 3H2JA 4CI9A 3ESCA 3C43A 4J0JA 5LZ7A 3E4DA 3KWJA 2IITA 3H1AA 5D7BA 2WUGA 4OCZA 5ALIA 1ACLA 2JF0A 3K9BA 3FNBA 1A8SA 5ALXA 1U2EA 3UUEA 3YASA 4N5IX 4JEIA 4HXGA 1F8UA 1XZEA 1ETHA 2HIHA
chains in the Genus database with same CATH superfamily
4EUHA 3TBKA 4ZWNA 3AWIA 5GJCA 2Q1UA 3UN1A 3T15A 3PR1A 1AO3A 2ZR8A 2JLRA 3KWMA 3B52X 3ZU5A 1T2AA 2PZJA 4LQDA 2AOUB 3JQ8B 1YQTA 1WVGA 2FSUA 2QXUA 5KJEA 1M6HA 3Q8MA 5ALKA 2B1IA 1A3CA 1RLJA 1D5WA 2FNAA 2HJGA 5L3RA 3I28A 5C7LO 4MLPA 3UJCA 2VP9A 1W19A 2Q2NA 2V0NA 2BPOA 3O95A 3TOCA 4MRVA 2MYNA 4JIMA 2GB4A 2HQ1A 1MC1A 1Y63A 2NQ2C 2XUHA 4LVCA 5JTUA 1VZ3A 1KWKA 1V3TA 3GBSA 2MSLA 1A2BA 4UFPA 5DI3A 3GG2A 4EUNA 2BEJA 2QLFA 2UZ3A 3DVQX 2VTBA 3C4VA 2JGAA 4J2HA 3A2NA 1UBTS 5CB4F 3CZCA 2PKEA 3PI7A 2AFRA 3C8MA 4FI3C 1VKHA 4A1FA 5CUQA 3I1YA 3DV0A 1N4DA 5JC8A 1NSTA 4M36A 4PFQA 4NEQA 3W34A 1PNRA 4PZUA 3ZI0A 1QIGA 3QG1A 4AULA 4FYWA 1YUBA 3ZWNA 5B6JA 5JXJA 2QI9F 4AZTA 4MP8A 4TKVA 1D2RA 2J5XA 2X15A 3L7BA 2CB0A 1E1LA 4LJSA 4X62B 3SJAA 1A50B 1CQIA 1AKUA 1WDTA 3LMKA 3MJSA 3RVPA 1T0IA 4KPGA 3GNSA 4FEEA 4ADSG 4B0OA 4BDTA 1EFUA 3LKVA 2IZOA 4EELA 2D54A 1FMLA 2NXJA 1YQ9A 2AF4C 1MUUA 3KUDA 1PBNA 1XZGA 2PRYA 3QYJA 4ZCMA 4FFSA 1OPRA 1OX6A 2ZUCA 2YICA 4NU8X 2JLAA 1MENA 3RAFC 3TQTA 4KMSA 3R7LA 5KQPA 3LVBA 3RF6A 3LYLA 4CDNA 3FNIA 5CBKA 1S2NA 3D4OA 3FNFA 4C89A 2Q27A 5KINB 2G09A 2ZDHA 3LBHA 5F5LA 3KOOA 4ZRDA 1KFEB 1TXGA 2WZQA 2BRUC 5J2UA 3NH9A 3OT1A 1R2QA 2O06A 4O2BB 5K3AA 4QULA 1AKTA 1C8VB 2IIBA 2QLJA 3FR7A 3G8BA 1GTJ1 1E1QA 3OZCA 1VSQA 3RKSA 4BQRA 5CA0A 4RWEA 2UYYA 1O08A 3OM9A 1J8VA 1U3VA 2UYGA 3SHTA 3UFBA 3GA5A 4RHTA 8AT1A 4PX5A 2WMNB 3DE7X 4PG8A 3MJTA 2ZJBA 4EYGA 4ER6A 1S8OA 4YROA 3WNDA 4OHMA 1WTAA 3CLUC 4L57A 1XNQB 4XQ9A 4ZPJA 4ZCPA 4H7JA 1QIMA 1NXQA 2L17A 1WUIS 3T3NA 3P8ZA 3TF5A 3IEKA 2PZBA 3DMTC 4JYPA 5BWLA 1OYWA 1UZMA 4I6EA 2WPNA 5DVZA 1LC3A 2VS1A 5DE3A 3KLBA 1JLLB 1M2JA 2IHBA 4TZTA 4Q7KA 4V0LA 2GAAA 4N0EA 3DL7A 5REQA 3U0BA 1VJTA 4BVGA 1Z6XA 1Y1QA 1WZIA 2LZ0A 4M9UA 1Q0LA 4DLPA 2ZXFA 1SUPA 5K0LA 1WEHA 2Q62A 3HCBA 4GP7A 1YNOA 2FQYA 1G18A 1EZ1A 3DMDA 4RS3A 1VL0A 3JPYA 5C46F 1YDGA 3D8RA 3HO6A 1U2GA 3PYMA 4XUCA 5F3DA 5LCXA 3PE3A 1HORA 1USWA 3PEEA 4MMXB 5JAOA 2V6JA 1USGA 4F4JA 4CLHA 2OORC 4D8VA 3A3PA 5AK4A 1DRWA 5FUBA 1ISFA 3E2PA 1RKVA 3AL2A 1PX2A 1C9YA 4WMLA 4BVKA 5EQFA 2WYVA 4WUVA 3FPLA 1U81A 1W30A 1XTIA 2G77B 5J40A 3LBYA 4JBLA 5DYYA 4WCVA 4NP6A 4KXQA 4OMCA 4JROA 4BLOA 3OJXA 4KN5A 4XDGA 2A88A 4U02A 3NMUF 2GCOA 1X2BA 4PLCA 4LNUA 1SKUA 1F8GA 4KGZA 2J6CA 2LIVA 4P3PA 5J5AA 1P9RA 4CW7A 4Z7JA 2D0OB 5AVYA 3AEUA 3LP6A 4LE1A 3OFNA 1U8UA 4EO9A 3UGJA 3ZBQA 3I9FA 1YQWA 3PJRA 2FHSA 3HG7A 1O95A 3FPCA 1BE8A 3QNWA 3ZDQA 1KP2A 4OUDA 5B1SA 4QUKA 4U2GA 2G07A 3T5CA 1RAFA 3FZQA 3JARB 5FQOA 5G1NA 4IO1A 2GYWA 2YWGA 3IP7A 3V2IA 1SWVA 3AEXA 4LF6B 1PFQA 2G8NA 3IAM1 2OHFA 2H5IA 1JMKC 3SZOA 4BFXA 4D02A 1JDTA 3KK0A 1KXZA 4IZHA 4NZNA 2I91A 1O03A 2P7HA 3L4BA 1JS1X 3SQWA 1UAAA 4DV1B 2VAPA 2D13A 1C9NA 5IVKA 5CEJA 3UPTA 5ICGA 3CZ5A 3B5EA 1P2SA 2WJHA 3RC3A 5LQRA 5L40A 4Y6SA 5G0TA 3U26A 1EAMA 1KO5A 4K26A 5DT2A 1I01A 2AXEA 3Q7QA 4BFYA 1GAJA 3R2JA 1ZW1A 2NACA 4NPAA 4C78A 4MKHA 3G89A 1Z07A 2AOTA 3VOSA 4A8JA 4E6PA 821PA 3V7UA 1MZPA 1LGYA 4FHDA 3IDZA 1LBSA 1SXJB 4IIFA 4OJTA 4RZXA 4S05A 1C1XB 1GPNA 3WP0A 2PVCA 4N65A 5HBRA 2V7XA 3ZCPA 3Q40A 2CUKA 3LNTA 2P91A 1DLJA 4HBGA 5I6DA 1W5TA 3M1AA 5C5DA 3A1TA 3D8BA 4M1KA 4ENSA 5E1MA 1HTTA 4CIBA 2FEOA 1MPXA 2I6UA 4O33A 3LKBA 4YJ2F 1N1DA 5B4TA 2IEDA 3ZKWA 4QFDA 2QZJA 3LLMA 1UKVY 1GNLA 4OFBA 4QJ3A 4I2VA 2MOKA 1Z9BA 2ID9A 5CM8B 5IYZA 4OMFG 1XGKA 4E33A 5FH9A 1J0DA 1H9CA 4DZZA 5HKLA 1VPEA 1JKIA 4OMUA 1Z26A 1E7YA 4F4DA 1H42A 4U2BA 5IEBA 1ECLA 1AIPA 4HH0A 3NONA 2QW1A 3SP1A 5ED0A 1SBIA 4C0BA 1JU9A 2XZOA 4RGBA 3KVOA 3LLUA 4KPYA 3NZEA 3O4FA 1G7CA 3CISA 4WI1A 4ZA2A 4FYYA 4TV8F 4A0RA 4E4YA 4AY2A 3DDNA 3I5YA 1H2RS 4ZCSA 3ISJA 1YA8A 2JHGA 1QPBA 4BNHA 1JTFA 1C0KA 3UB3A 4MUMA 4AS1A 5JCJA 3AFHA 4P93A 5A4IS 4X65B 4M8NE 5EIOA 1TAQA 2II6A 2HBQA 2ZIVB 4G1VA 2HHCA 3K6JA 3LT2A 1Z0JA 5AKXA 2PJDA 4K6HA 2WUVA 1QR6A 1WEKA 4R1OA 1DJNA 2QSUA 2BONA 3G2PA 3HP1A 3NM5A 2RE8A 2W2MA 3QEAZ 2DTEA 2P2GA 3PNKA 1RI5A 1MA3A 1NJSA 1Q50A 2IPMA 2W11A 4FFVA 3TTUA 3V4SA 4H0NA 4FEGA 3WLIA 4NWIA 1ZD4A 5BWMA 5AHOA 5K3SA 1EAYA 3AHHA 3QHAA 4GMDA 4DVJA 5JATA 3K1TA 4EKEA 5CVTA 5LDDC 3GK3A 1V48A 4UNNA 3DEHA 4UBLA 3MS7A 1ZW6A 5A2GA 1S9DA 2C5EA 3VSAA 4ND2A 1DC4A 1KNQA 5AUOB 4MP3A 1AHHA 4XX1A 4TV9A 1PWZA 5AK0A 5T6BA 1GSAA 4FIZA 4K2AA 1Z47A 2EEZA 3KSZO 4HPWA 3RVMA 3WGNA 1NFRA 4R8LA 3ICEA 1YDHA 1YHZA 2Z95A 1HEYA 3ICCA 3TIGA 3H11B 4BQEA 3KTOA 1G21B 2JI7A 5JMPA 4P7FA 2GN1A 4ZEXA 3KJQA 1Y6FA 2FJUA 1J8YF 1QDLB 3GBVA 4HV4A 1GGVA 1TGVA 1O8CA 1L8QA 1KSHA 2X3UA 3C5EA 1C7RA 3HSYA 2FW9A 3PGXA 2HJ9A 5BSEA 1OH6A 4MJ7A 3LUPA 4MR9A 5DMHA 3U4GA 3LPNA 4I50F 2JVKA 2CVFA 3OBBA 4M53A 4JBYA 3ZHSA 1T5DX 4X1YB 1PBTA 2HPHA 2W2PA 4QQFA 2BM9A 4QDKA 4TXNA 4UDNA 1U7TA 1GNTA 2JEOA 1Y3CE 2RHHA 4X92A 2RGCA 5F4BA 1I32A 1M2OB 1K1EA 1ZI9A 2EKLA 3GLGA 4KMMA 2I80A 3CVUA 3A05A 2OGZA 2O5RA 4MV1A 3OZXA 3WWYA 3O4JA 4M0KA 1DCTA 1DRJA 2P6UA 2VP3A 3N5CA 1Q84A 1NLZA 4HZGA 1NYLA 1ZN9A 3Q8LA 4Y6RA 2JARA 1XAJA 2GN0A 1UEXC 2A1TR 4MEJA 1M7GA 4WLEA 2A9KA 1M2FA 3T7RA 1TNDA 4JR0A 1T6BY 1YR1A 3RFFA 721PA 1VCNA 2JFQA 9ATCA 3FJYA 3GFPA 4KX3A 3E9EA 4PV7A 5FPYA 3EPHA 1VMDA 1E4OA 4LJKA 4X6LA 5IDWA 5HKKD 1XTBA 2EU8A 2IDMA 2R7MA 2GPNA 4EGJA 1WY7A 3OF5A 4WLOA 2A0YA 3OEEA 4BV8A 3EIWA 3EXIA 1ADBA 2EXXA 3HB1A 3TEMA 1TO6A 4PINA 5EXXA 1FNBA 1RWOA 2IV3A 4ZI2A 3GPCA 5BMVA 4DB4A 1JEQB 1L2TA 4KXYA 4LRQA 3F8WA 4BAUA 4HVAA 4YUZA 2O1EA 3HO1A 3ZJ4A 1EGVB 3MELA 1C9KA 4E94A 1A88A 1H22A 1IIBA 2HU5A 3IBCA 3FKSA 5L7WA 1L5VA 4OQZA 2AE2A 2AMYA 4PRKA 3GLFA 3BGWA 4X7RA 4A2QA 3QPVA 2N3ZA 1T0JB 4I7EA 2V5UA 3D0RA 3HMKA 4KPFC 2OD7A 2X6QA 3IDOA 3ND6A 4HDKA 2RH4A 2Q29A 1Q3HA 2F64A 2PGLA 2XUIA 3JX9A 1BO6A 3BSSA 1A95A 1OOEA 3DDCA 2NYVA 4JLDA 3ZUGA 1UDAA 4GZLA 2P2ZA 3LC1O 2UYOA 4PR0A 1VCOA 4JQYA 3QU4A 4AZ3B 4A9AA 4CNQA 4IEIA 4R3UC 3FOWA 5HJ7A 3EYWA 3BDAA 2WM3A 4C0AC 3OLXA 4ENVA 4AJ2A 2FUKA 2RHDA 1QIIA 2ZVPX 3ZV3A 1DUIA 4M9SA 5J5VA 3L0YA 5AXDA 3QV1A 3TJRA 5GM1A 3WDSA 1PU2A 1W47A 1SPXA 1M8PA 4A0FA 4PBSA 2RD2A 1XVIA 1NF3A 4S3MA 3SHWA 1SKMA 1C3VA 2WVJA 4X3OA 1SBNE 3BE4A 4X95A 1ZLXA 1KDZA 2BGTA 5JJLA 1IVNA 1G3RA 2R6HA 2O2YA 4FS8A 5FP0A 3M5PA 1DTWA 4RZSA 4DJEC 1LRKA 2J9RA 2Z9DA 2ZIAA 4RBNA 1U2GC 1JHDA 1OFUA 3L0ZA 4X1OA 1K7SN 1QQ7A 3ZGLA 3TGPA 3D7NA 3WJ7A 1OGJA 3OC6A 3WMXA 2WKSA 2UUCB 1SBZA 5E9WA 4V1CB 4W1PA 5FWYA 3V6MA 3HVJA 5ED4A 4U7FA 5KVSA 3KJXA 1Z73A 2LRHA 3GFBA 5ECDA 3DULA 4NBLA 5H83A 1XUOA 4QUGA 1UWCA 3V1TC 3L6OO 3WAGA 5EZSA 2E9SA 5EWJB 4U2DA 4JJKA 2DHDA 2V7UA 3ASVA 4BX3A 2XAUA 2ECFA 2OZEA 2ORYA 4I9FA 4HNRA 5GONF 3AUYA 1A76A 1G63A 1PUJA 4MS1A 4XPIA 4CF7A 1QRTA 3HVIA 1EFTA 4Q47A 3CH4B 4BNNA 3L8FA 3QZUA 1KMMA 3R0IA 5BWOA 4BZXA 4FDLA 2H4YA 3WLHA 2CXXA 1XNGA 4EARA 3KOXA 1NWHA 3AYZB 5BN5A 4KITB 2Z8ZA 5J43A 2C7PA 3HK2A 1EA5A 3C7TA 1PG0A 3OZTA 3WISA 4AT1A 2ZXUA 1IN4A 5IHXA 4ECAA 4DRXB 4E3ZA 1V0JA 3M83A 3VDMA 4ZT3A 4ALIA 3K0AB 4YMTA 2IEBA 5KNCA 4XCQA 3K70C 2A0WA 1P7CA 1HT2E 3FLAA 2D1FA 4RTSA 1UFOA 1UM8A 3UH1A 1V5WA 3B2QA 2VNJA 4OYLA 4MGYR 1Y8CA 3DEJA 5TSDA 1UBUS 2RAVA 2XA2A 1PZGA 2ZYVX 1HE5A 1Q2XA 5D8DA 5AUNB 3L7AA 2WQ6A 4YN3A 4I55B 2B2XA 2ZVDA 2C0PA 4H4DA 3ZZMA 4YUWA 4N9QA 4Q4HA 4XYBA 3C7DB 3G0GA 5BW6B 5LU8A 4MW7A 2JDIA 1XV5A 2XF2A 4WOBA 1IBKB 1NUPA 5KVCA 2RKBA 4ZVRA 4F7WA 1LUAA 3W3AH 5E4JA 4BO9A 2R65A 5GY7A 3FI0A 2JD0A 5LYYA 3NT5A 4BCBA 1FTNA 2C42A 5EVCA 3ISTA 3ZJ5A 4BUCA 1DBSA 1YVEI 4R8VA 4FFMA 4O2RA 2Q99A 2VDOB 2O2ZA 4RHUA 4UQPA 1E69A 4XR9A 4PZPA 1SCUA 1G16A 2NG1A 2RGEA 4D9FA 5EGNA 2GKSA 1AG9A 5KNBH 1R4NA 1Z6AA 3VSBA 1Z45A 2VXYA 5IARA 4J1NA 3GC6A 1TJNA 5EWMA 2XB2A 3NBZC 1G8AA 3PHHA 3HKBA 1ZD3A 3H4TA 4K6OA 5GVRA 3PIDA 1SM4A 2V4ZA 1E6CA 1RWWA 2PKYX 4FX2A 4Q19A 4GSLA 2HQOA 3VYTB 3KEFA 3EISA 4JWTA 3Q2OA 13PKA 5DT9A 3PKIA 4QFMA 4XI9A 1ENYA 3QMPA 3OFKA 4V2IA 2DHQA 5B4VA 5IN4A 4RZ2A 1SC3A 5H8WA 2Z1DA 2POCA 4GOXA 2QD2A 2FPLA 2P1DA 1P2DA 4PLFA 1EBBA 4XQEA 1JDJA 1Q6YA 1R66A 2Q8QA 2BOVA 3ZHBA 4DMGA 3DXFA 1RR6A 4DS3A 3OSZA 1XEXB 4MB6A 1PTJA 4MRNA 2AQKA 4EKNB 1XZQA 2QTNA 4LX8A 2I7CA 4CKCB 4IEFB 2R1TB 1WA5A 2NAPA 3FLEA 3NETA 2WG2A 1PNTA 1PR5A 3NTQA 2PZ8A 1RJGA 3ZD6A 2ORED 2OWDA 3ZK9A 2EHJA 4KOAA 4W5OA 4WZBB 4WDRA 4DM7A 4A8PA 4MI1A 1X3SA 1PYDA 3P45A 3TW0A 3SR4A 3PFKA 2G1KA 4ZGWA 2OAQ1 4Y3UA 1CQXA 4FYKA 3LW7A 4UFOA 3K0HA 3ROMA 3TRHA 4TYMA 4PPGA 5C8XA 2I4MA 1FRNA 1G7SA 2OHJA 4ND7A 1FTQA 5CVJA 1T3GA 5DTEA 3CLTD 2HDNB 5D6NA 1I7DA 2IWRA 4RE6A 1M1UA 4M1YA 3WGTA 1HDEA 1TCCA 1SFRA 2QUHA 3MUOA 1C2YA 3ISVA 2VWGA 2QGNA 1RJWA 1P5RA 3MW8A 4RCVA 4X63A 3GVXA 3ZXYA 4DBLE 4Z3OA 3VPCA 2Z1MA 3N05A 3CW8X 5JJKA 3RFXA 2CF6A 3F5MA 2GETA 2WD8A 4KSCA 4FZ3A 2VXCA 1P3DA 3VU9B 5LZ5A 4F3TA 3PXAA 3GNTA 4KMOA 3RASA 5K99A 1FP7A 1SOAA 1N3LA 1PL7A 2MSCB 1TQDA 4YRCA 4R16A 4YXWA 3FYDA 2AZ4A 5LSAA 2H7YA 3LL7A 3OTOB 3NJ8A 1PJCA 1QYDA 4U0JA 3MIZA 2J0VA 4OQEA 3C14C 2AS0A 3K0CA 1HQKA 1P19A 1HRDA 5J1SB 2HCTA 2BKAA 1XCJA 5IEJA 1L5RA 2BISA 1EFRD 3GDWA 2GX6A 3SEAA 5T3UA 4N6GA 4FW9A 4A5SA 4CL3A 2CVZA 1UBCA 1JSLA 4IDBA 3T1QA 4GH5A 1NY6A 4DCMA 3D8NA 2H0AA 3B6EA 4KE6A 4M4SA 4CL8A 1YU6A 1M6EX 3QLUC 3WB0A 4CMIB 3ER8A 3AVWA 3WO0A 1PT9A 1T2CA 2DPHA 3F78A 3ZTTA 5B57C 4UHFA 4PHTA 2NSLA 2NT3A 3C6ZA 2B4YA 3IT3A 4MZDA 4O8CA 1FOEB 3O2NA 3FWKA 4Y2TA 6ABPA 3PFNA 2VHJA 5FI3A 3TLEA 1SA0A 1XQ9A 4EW6A 4F04A 2FV8A 1PO7A 3TOZA 2EATA 4QUDA 3OUZA 2VSXA 2PNFA 2EG5A 3E3NA 3LYUA 3MGBA 2YNMD 2OBLA 5P8WA 2YINC 1ZSNA 2P35A 5AK3A 5C4GB 2HJSA 4UTOA 3A1DA 4EECA 2XYVA 2UUAB 2QQEA 3LLCA 3T3GA 3DE6X 3X3HA 4ROSA 4QWWA 2EFEB 2WEKA 3RVDA 3UMYA 4FE7A 3WBBA 3ZHYA 1WRBA 1DBWA 2PGJA 4R2WA 3ZQKA 3ZGYA 4KQIA 2YWCA 2C97A 2X76A 3F8SA 3IBTA 4HGZA 3SZGA 1QH8B 1WB9A 3NTVA 3T7JA 3O4GA 3I9LA 5AHXA 1MQSA 2L0XA 1WKVA 1UQTA 2P6OA 2N47A 2W2XA 4Z9XA 1B73A 1PX0A 4D4GA 1ZK2A 1N8NA 1NFFA 3IURA 3KZ1E 3GRYA 1K6JA 2ZJ7A 4YRPA 5IJ0A 2ONZA 5JXGA 4IFTA 3LUHA 4W9MC 4R2XA 2O57A 1N2CE 1SD5A 4QUIA 2GTIA 2ISQA 4ARIA 4XRRA 2X8AA 2XH8A 3E2IA 4KO2S 4O4LA 4ZVLA 3OT5A 4IIYA 5DHQA 1ZH6A 3W8EA 4CQMD 2X13A 4YC7A 3I04M 3L0SA 2QR2A 5EZYB 1GKKA 3K0EA 4WNYA 1O6CA 3PHBE 1KIMA 2RI1A 4DOMA 2NTNA 3IIEA 5E1OA 1KQPA 2PKQP 4MVWA 3UTDA 4MICA 2AQIA 1JG6A 2IUTA 3ORYA 4DJFC 1Z25A 1S7CA 3ZZUA 4HNHA 4IGFA 2VBCA 3JYLA 2JLYA 4WXMA 1UKBA 5K4AA 4LPKA 3OCWA 4YA6A 4QUEA 3Q0EA 5CGZA 10MHA 3TE7A 3MJFA 2EKZA 1NT2A 4B76A 3HCRA 5K3BA 1XJWA 2B8JA 1XQWA 1OH8A 2AZTA 5CT6A 3D3NA 3GQBA 3MPUA 3IUYA 4JUDX 4A03A 5EJEA 1RE1A 1V5FA 3IELA 3WWCA 1ZONA 4GX0A 4HHEA 4LOJA 1L7RA 4ZN6A 1C9JA 5G0VA 1ODSA 3BGOS 4HMQA 3R75A 1TEHA 5COAA 1FRFS 1GCGA 2NUPA 5KX5A 4EQ6A 2ETVA 1GU0A 2F3RA 1AXGA 1P1KA 3BFXA 4FD2A 1Y7HA 3FPGA 3T5TA 3UT0A 1SU8A 2H6EA 3MYRA 4CMKA 1JHZA 1XKXA 1YVPA 2FPIA 3HY6A 1IHPA 3F7MA 5D2CA 2FPMA 2XUGA 4K1LA 4PXSA 4LYHA 3PQ2A 2PMWB 2RI6A 3I0MA 1JKMA 4QDJA 1Z0IA 1Z56C 3LXXA 3ROKA 1Q57A 5F98A 1AUXA 1IPFA 2E4AA 2WOOA 3LFHA 3N53A 3CVWA 2GXUA 2XKAA 1KH3A 4Y1RA 4RQAA 4IQ4A 4RVNA 1K27A 3D8SA 3N8KA 1ZM4A 4TTQA 4WUTA 4LGMA 1JH8A 3DKKA 2CL7X 3K6RA 5HS4A 3BTSA 1KK3A 2A8YA 3T1OA 3B6ZA 1T8PA 1ZEMA 4EW2A 5CFOA 4FGUA 4LYEA 2NPFA 2P6MA 1V6CA 1XG5A 1JF8A 2GCNA 1QVWA 1CLUA 1GSIA 2LW7A 2XWPA 3TJMA 1O87A 1ZBQA 4LSZA 3RE1A 2OZLB 3VAYA 1TRHA 2JH9A 3TDNA 3VO8A 1Q7TA 1W5AA 3FCYA 4M9QA 3EOBI 2QN3A 1KKMA 4WXEA 1PNVA 4TTIA 3VR2D 3DD1A 3FTCA 3M4JA 4DG9A 4RHXA 2Z4TA 1L4MA 5GJVC 4BLRA 5KYYB 4JAVC 4K03A 3C3YA 3I2IA 5BSGA 1E77A 1KTVA 1OBFO 1UXKA 4YGXB 3KAQA 2QZ4A 4C2TA 9GPBA 1YACA 2E82A 5JCZA 3H5AA 3UA3A 4KO8A 1R00A 1QRRA 2ZT6A 4GL2A 2HV8A 3NOXA 1U7UA 2HU2A 2XUJA 3GF4A 3QENA 4KCGA 3FGZA 3SR3A 2YN4A 3O47A 2Y3IA 3IPCA 4DWWA 3UGTA 4EFDA 4LMRA 2QPOA 4F3YA 2JGEA 4F7DA 4Z5XA 2KYRA 3T3PB 1SCIA 1NQUA 3I2JA 5ALNA 3FXAA 1ADCA 3T9CA 2O6HA 3IAFA 4BB0A 1CP2A 1DARA 4D9IA 1GFWA 1R8XA 4B3TB 3AFGA 2IPAB 4HS4A 4ASUD 3KHUA 1Z33A 2JFNA 1ESDA 1PK8A 2IQIA 2JZOA 2M6RA 3K2QA 3QMVA 1HI9A 1FP1D 1STOA 3RV4A 1MHTA 2WJIA 3BORA 5KYNA 1Y3BE 2Q3FA 2X0NA 4V0NA 1RCUA 1GV1A 5K9ZA 1E2QA 4Y30A 4DV5B 3BJIC 3NQ41 1M1YB 1ISIA 1UMCA 1K7YA 1DQRA 3P2JA 2PCJA 4JODA 3U60B 4NENB 3V2HA 4NE2A 3BXPA 1P44A 1I5RA 1W4RA 3MTGA 3M81A 3L46A 1U8EA 1Z36A 3IP9A 3L93A 2N9UA 2NU6A 1C2TA 1W88B 1MAHA 4RD2A 4ZIRA 5LZ8A 1NNLA 4EYSA 1OV6A 1GUAA 3PIIA 2FMUA 2HT1A 1XZ8A 3T0IA 3QTTA 4NEGA 4HN2A 4S04A 1FLNA 1B26A 4C43A 3BA1A 3F7TA 4GF5A 5CP8A 3JRNA 3ICOA 5KC8A 1ZXBA 2G0NA 3ZR4B 3H1EA 3H5RA 4K1XA 2FRDA 1DAEA 3MXTA 2P9GA 4WN3A 1LD3A 3LBFA 3WIEA 1M6VA 2QMOA 2R5NA 1A9PA 5HMMA 1CB7A 4G5HA 1RAAA 1BYUA 3MHTA 4PG6A 1F17A 1J24A 2POQX 1VLJA 4J0DA 3U3DA 3VZSA 1EFVB 1EQ2A 2ZEJA 1FQWA 3IYLW 5LP6B 2ILTA 3KKZA 4O6VA 5FNVA 1BHO1 3LG2A 4G89A 3PEVA 1FJHA 3D59A 1T2FA 3UH0A 3STWA 5JWRA 3VPAA 1RBZA 1U2QA 3OH8A 3PPYA 1ORTA 3WRYA 2VDJA 3IAXA 5IF3A 1GQFA 1G42A 2GEUA 1UOOA 1VE5A 2HK8A 2EBUA 5CFPA 2Q5HA 3KETA 3P4YA 4N5HX 2ZRKA 1EFPB 3D0OA 2WR8A 3PYLA 2ZW9A 4LSMA 4C1BA 2HRRA 1MPTA 2ZIEA 3AMVA 3H1GA 2ADFA 3LQ4A 4DT1A 4DQDA 2HREA 1WP4A 5CVVA 2IT1A 1F2TB 4PNPA 3F90A 1NQ5A 3FSRA 3A9RA 1KEPA 1JG1A 2QY6A 1GKLA 2AH5A 3BRWA 3MWDB 4F6RB 2I3ZA 4BN5A 3AETA 4KRFA 2N0SA 1W44A 1EFKA 2AG0A 2DFDA 2PQ0A 4KXMA 4Y9RA 3VPDA 1GA6A 2FSSA 3AW8A 4TT8A 5JISA 5I5EA 1NYTA 2XT0A 1YB4A 4JI2B 3P27A 3AVUA 4AMZA 1KJIA 1XE3A 3AEKA 3A3YA 3EUWA 1B6SA 3E82A 4I4TB 3ZLJA 1U8FO 3WA6A 1KPGA 4R83A 1X1SA 3O4RA 3KYCA 5KWIA 1QVVA 2J9FB 4W9NA 3ITEA 4HQNA 1JAHA 1ZK1A 1JLKA 4B5KA 1C9EA 3P32A 3HCDA 3G5MA 3PX7A 4AKHA 3MT9A 2GPBA 4DIUA 3MT7A 3OZ7A 3F5DA 3H2KA 1VJDA 3L8HA 1UM9B 5C3MA 4JJ4A 1DKPA 3QM1A 1NMXA 1XU4A 3CLUD 1KQOA 1I1OA 2YHSA 3GJYA 5B3JA 6ADHA 2XKKA 2ZULA 3OHMA 5EKUA 4COOA 3PTZA 2FDXA 2MYTA 5CXSA 4FX5A 1XYGA 521PA 3UATA 1ABFA 1LI4A 1M5TA 4O29A 2EBFX 1R5NA 1N8SA 2LCFA 1R6AA 1Y3DE 1EP3B 2GOYA 3S1AA 3VYUB 3P52A 2VPXA 1X86B 2RH8A 5BVHB 3HXMA 2PVSA 1THTA 4B4DA 1UXGA 2P79A 2W0SA 3UT5B 4A1OA 2BGKA 4CF4A 3E9CA 1G20E 2GPYA 2KX7A 1SVIA 3HUEA 2X9VA 4YRZA 4ZVMA 2VJPA 2Y0BA 3I6ZA 3TZCA 3DLTA 1TMYA 2EERA 1KIFA 1B8NA 1XMSA 2MMGA 2FX5A 3VVBA 1IL0A 2WP8J 4MH0R 2ZJOA 1IY9A 1MJFA 2I3DA 4X1KB 2LNDA 5BSTA 3ORHA 3QHQA 1W5FA 1ILWA 2D2XA 2NPIA 2QB5A 4NG5A 2I4OA 3LU1A 4TKUA 1CETA 1PGPA 3KXKA 3NIWA 2F8MA 3QU2A 2BI7A 4V0RA 5IUNC 5FBHA 5F77A 1QXSA 2PRIA 4L74A 2R6GA 1GHTA 1NG1A 2YIDA 3DMYA 3DWEX 3OP1A 3WYBA 2RGWA 2VWQA 4J0HA 3BJMA 3U44B 1W96A 2C2OA 2C2XA 3Q6MA 4NNJA 3S7ZA 4D9CA 3V4VB 4JLVA 3RRMA 3GV0A 2JZCA 3A9VA 1CSEE 1N5LA 1XRRA 4GWLA 1IJBA 1QIEA 2NM0A 2Q8PA 3HGQA 3KQPA 3IR7A 3RVOA 3L1UA 4QD3A 4AJEA 3OICA 4WDQA 4LCJA 1QQTA 2MT9A 3M6UA 2WQZA 4JSRA 4Q3EA 7REQA 1K5HA 2AEMA 1P2TA 5CJJA 1ESZA 1AGNA 3VZPA 3O93A 4QJ5A 4DSAA 2AUTA 4D4LA 2O19A 1KZHA 4H3HB 5EUBA 3TCXB 5CURA 3BZUA 3VU8A 6LDHA 5EJ9A 1KMHA 3X1XA 4YQEA 1G5HA 1CRWG 2PSJA 3T35A 3MWKA 4DQ0A 3ICQB 3FCCA 3SX4A 2QJOA 3TQIA 4GYJA 2FUEA 4ZZ0A 1NATA 2QPAA 3LPCA 2V8BA 4JUIA 4HKTA 3WKAA 3R6GA 1I2MA 5AOVA 1AM4D 2W42A 3D7MA 4E51A 1FBNA 2O8FB 2GQ0A 2AG1A 2NSDA 1T8YA 1E1NA 4TLLB 2PD4A 1CHNA 4JP2A 1F2DA 1SJ9A 3SQDA 4OH7A 5T4FA 1DS6A 3D43A 5I5GA 2AQHA 4HPXB 3ZE1B 2NZWA 4LYDA 3G1UA 4ZYUA 4HO1X 2ZRJA 2H4JA 4OUKX 4WLNA 1RJDA 2ZRHA 3WK6A 3UTCA 3RUPA 3JPWA 1NF9A 1QWOA 1FUIA 2MR5A 2FPPA 4UTPA 3L07A 1KF0A 3OOJA 4KDRA 3EGWA 2HQBA 2WJGA 2AFIB 3NAMA 4ISBA 1QB7A 2C29D 2FPKA 3RK0A 3V1NA 3U7QA 2AF3C 5J63A 3L1KA 1JI0A 2WIAA 4M55A 4NCKA 4MRAA 3F7NA 3OLCX 1I3LA 3HDYA 2FW8A 4CCSA 2O2SA 3QUAA 4CR6A 4DAEA 5LDGA 1R1DA 2HOQA 1EJ6A 1GR1A 4EKYA 1SHZA 2I1VB 3HB5X 3NM6B 4RFLA 4D9JA 3RUEA 3NFRA 3EIOA 4GWKA 3PT5A 3L6BA 4B34A 5ADUS 2HF2A 4HDAA 1OAOA 2FH5B 2ZSKA 3RTCA 3IFSA 5TMBA 3O2QB 2VG8A 2PWZA 2W6ZA 3SFZA 5AVQA 1DMRA 1RPZA 1T1GA 1EFDN 2WFZA 4N39A 3IE0A 4CM7A 2QE6A 2RH9B 4WESB 3CEAA 5HVNA 3OTIA 4IIBA 4EHJA 1G2IA 4PO1A 2BMWA 3PQ8A 1KDVA 4V0QA 2OXRA 3F9CA 1MFPA 3LBIA 4WBXC 2QI9C 5SZIA 4R1MA 3GT7A 3A6EA 3W5AA 2BZ0A 4DV4B 2JAHA 1SBHA 1RHMA 4L76A 2H7VA 3TKAA 4C6TA 5JEDA 5M2QA 4GOKA 3UPUA 3H7AA 1ORWA 1RPJA 4Y1FA 3ZWQA 4E1AA 3KVYA 1R8SA 2XUKA 3AVOA 4L3WA 4MYUA 1HO3A 4JX9A 4NNPA 4QPPA 4W6QA 5L7YA 2VSFA 4BTLA 5TIIA 1J6UA 4WY8A 5BR1A 1AB6A 1M2HA 4RA9A 2DFTA 5LA6B 2RSLA 1VXOA 1TVEA 2WAXA 1XP8A 1P1BA 4L0DA 5ESWA 4EMBA 4HNUA 2O2HA 2IS4A 5JNTA 2O7NA 4RTJA 1GCIA 3ZDAA 5FQNA 4OHUA 4FKBA 4XKJA 1PSDA 3ANTA 3O91A 5HF6A 3EZLA 2HMYB 5CXUA 2DETA 2P2SA 1A9RA 1NN1A 2XITA 4N9WA 5C37A 3AESA 2XB4A 3KU4A 3LF2A 4H6XA 4KAXA 1DIOB 5EE3A 3WLFA 4KN6A 4BEWA 5H9VA 4J76A 3GRRA 1NIJA 3A26A 1YBMA 4U7HA 4WKBA 1ZI8A 3IBYA 3KQOA 2JCYA 4BEBA 5AK6A 3Q2KA 1QG6A 1W0KA 5FV4A 3FZGA 4CLXA 2IDJA 3PFCA 1NLFA 1DTSA 2VHZA 3BZWA 1WZCA 2GN8A 4JFAA 4OQNA 3S5JA 4D26A 3MIIA 2IPXA 2QNRA 4IQGA 1F9EA 2ZTUA 5ALDA 5EHXA 1EGQA 3RVLA 4BJ6A 4BFWA 4CM5A 3Q15C 2XNCA 3DDSA 1NBAA 4GM0A 4DUGA 5KTKA 1QYIA 5E3JA 1FX1A 5E9AA 1Z5OA 1Y9ZA 2JAPA 2P6PA 3DQQA 4HAIA 4LRUA 5CAEA 4ZCQA 1EWTA 5HW0A 1X80A 1E9FA 5TE9A 3MAGA 1POWA 2JFWA 2R8RA 1HFJA 3D3EA 4B8ZA 3ZD7A 4CBVA 2NO9A 4ZMRA 2ORIA 1E9SA 4DQLA 3ODPA 3D8TA 2IZ6A 1UJNA 2GJ9A 2IZZA 4HVTA 3O3NB 5AJHA 5J2TF 4WXHA 2PAFA 3KYIB 2CMGA 1IOLA 1ZIOA 1D6JA 3LO8A 3VNQA 2O3JA 2BE9A 4W7HA 1TCAA 2B21A 2Y0CA 3QF4B 4AP5A 4JXKA 4TVBA 5T57A 2WY2D 5HIKA 4KDFA 3TR0A 1KQNA 3S44A 2F48A 3LX6A 1XSEA 3MZ0A 1ULUA 1ISMA 2BKEA 2X7JA 1ZAYA 3PXDA 4KLZA 7AT1A 2XMDA 2GSDA 3G2HA 2X6TA 2FU5C 2HADA 2R0QC 4RVSA 2M6LA 3PYXA 5GJWC 1M1NB 4HNQA 4DQVA 2WYOA 4RIGA 2PV7A 1SIWA 3DMNA 4Q3NA 3PUJA 3EY9A 1JHUA 2HIMA 2A9FA 3B20A 3CC8A 3G9XA 3DVSX 3QPDA 4KBFA 4PR3A 3TW8B 8LDHA 1WQ1R 5IC4A 2GVDC 4DSZA 4HJRA 1HDXA 1KC1A 1FP6A 2F4NA 1MNQA 1KGSA 3EBOA 1J1ZA 4GLJA 4RKQA 4WGGA 2I54A 5J4VA 1L7BA 1R12A 1JG7A 2IA5A 3L6RA 1CIVA 4BTVA 1JR3E 5GIPE 2PH1A 2C83A 3QFTA 3TD9A 4E7OA 4YCDA 4ARZB 4UXHA 4K8RB 2HJVA 2K6GA 3RG2A 1FFHA 5JQWA 4KYTA 3L5KA 3W1WA 4Q39A 2IGBA 1JILA 1HR0B 1WVIA 1HE8B 3N2IA 4JP5A 2Y0PA 4W9NC 5JCXA 2H18A 4CXMA 1H23A 5C7IO 4D9MA 1NOJA 3UUGA 2JJYA 5EJ4A 2BFCA 3FDXA 4WBSA 3WRXA 1R3DA 3RGGA 2PV0A 5A4AA 3UM9A 1WCYA 4O4IA 5JLJA 1GFZA 3E3MA 3BF8A 3RHSA 3NHPA 4G5XA 2CV2A 4RC9A 4WBNA 4WKPA 2VDVE 2PR7A 3QU9A 1UIRA 2WI8A 3AX6A 3GMSA 1JPUA 3OZSA 4CL0A 4ZP1A 4DQXA 4MDFA 2X2PA 2GZSA 2QTWB 1NE2A 5F51A 3WYCA 4M1OA 4BDSA 1DJMA 1CVIA 4C76A 2Z83A 2CUTA 1AC5A 1LVGA 2WJ3A 3U1VA 4NIMA 2IS6A 1Q0ZA 1X1EA 3DA8A 4CLRB 1YR7A 2QEQA 3CW9A 3H84A 5A9TA 1T13A 2WFMA 3NWJA 3B7WA 2I3AA 3ADDA 4YECA 1W2WB 4HGOA 1U4SA 4JC8A 1A5AB 3QJGA 4NMMA 2CNWA 4AYTA 2HRQA 1NV8A 5FRDA 4MQEA 3CRZA 1OGIA 4GMFA 4Y1EA 3V7FA 5B58C 4NK5A 3CG0A 5L3QB 1SU6A 4RTMA 3GY0A 4IPTA 2F17A 3OPQA 2W4QA 3B8EA 3GJ3A 2C2MA 1ZC3A 3OC0A 4AJLA 2X0IA 4MEAA 4RQUA 3OESA 1G8GA 1P6UA 3IJ5A 3CW2A 2ZVQX 3T12A 3VNAA 2Z2YA 1P1HA 3GNQA 4RJLA 3E05A 3WZLA 1AGXA 2B9VA 2OCAA 4KH1A 4WZBE 3Q6IA 3WC4A 1SG9A 3R24A 4C0XA 1NBEA 4GFDA 1AS0A 1QM5A 2OP0A 1I2CA 1M2EA 3N7TA 3N70A 4Y2QA 2WJ6A 4W5HA 3GEIA 1XXLA 2ZYAA 4FEAA 3K4QA 4QU5A 4AG6A 1KY3A 1OI2A 2Q6KA 2Y9PB 3D81A 4K7JA 1N4AA 2I9KA 1JTEA 2DYKA 1UWVA 5EKSA 4IEEA 2X3FA 4EZEA 5BRAA 3OFND 1GG9A 4RY0A 4URFA 4UUPA 5I7SA 2JGFA 4PAWA 3BMQB 5CLHA 1DV1A 1OYVA 3FW1A 3CT6A 5E6SA 3HY3A 4HGNA 2CMDA 4M0MA 2O2XA 1NR1A 3K70D 1F2UB 1CZNA 3CNHA 2NXWA 3BX1A 4WECA 3K32A 2H54A 4WKGA 1RHKA 1QO9A 4PEVA 4V0OA 2G9NA 5JMOA 3EAFA 3IAS1 1E5LA 1UBOS 5CU7A 2VHQA 1JFLA 1YASA 2P90A 3EXHB 5AO9A 4EYEA 5HZKA 1OUMA 3I8OA 2BF7A 4QLOA 5FYDA 1KJNA 4XARA 1WU7A 2IL1A 3B13B 3DZIA 2G9VA 3OD5A 4DC0A 2AWNA 3OTGA 1PNOA 1XWFA 4FOPA 4MQFB 2AK3A 3BWMA 3E53A 4M38A 4S1WA 4P4SA 3JWGA 2ZJZA 4P2BA 1C7FA 2QE7A 1EKXA 5KYWA 5BYAA 4TKLA 3A0UA 3SXUA 1E3WB 3I30X 3LP5A 4KB5A 4CM8B 4BTEA 3OMXA 3QKTA 4WY2A 2XCLA 3DDZX 2DE0X 3OU2A 3TFWA 1IQUA 5IKPA 2ZB3A 1NZDA 5ARBA 4O3MA 1ODFA 2IH4A 4G3XA 1JVSA 5BN4A 4IVNA 1XL0A 3EHEA 3G02A 2GSWA 1YWGO 4KQ9A 1T5TA 3FYUA 3K8ZA 3QITA 3QHPA 4I46A 3P2MA 3EPLA 1C4OA 1Y1SA 1X1BA 4OHCA 2D5LA 1N2IA 1OAKA 2FCAA 2GN6A 2VKQA 1UWLA 1V96A 2GK7A 5DNAA 1O8BA 3C4JA 2HWWA 2BKVA 1H1LB 4DLVA 1FS5A 3JQDA 2J4FA 3D6AA 5B2FA 1BW9B 2QG9A 3UXYA 2Y99A 4GGPA 5JUWA 3WLQA 2CXQA 1BCRB 1ELOA 2ICAA 2XDWA 3UJBA 4ZQGA 5BV2P 1CJSA 1D04A 5JR3A 4KWTA 4WXRA 4KUEA 4XB1A 2PUAA 4P4GA 2H2FA 2SNIE 2A35A 2X8LA 3BK1A 3HYSA 3TBFA 4F97A 1LPOA 1AQJA 1MB4A 4AJIA 1OB5A 3ZHCA 2PR2A 4XSHA 4ENTA 5ITWA 4Q9LA 5AJZA 4NR0A 4RPGA 1KZ1A 3SU8A 3GBPA 4RXTA 1FP4B 1L4LA 3ESDA 4B4VA 2BEWA 1RVV1 3ZDXB 4CFYA 4V0ME 4Q01A 1GTG1 2BI4A 3OTQA 4P7BA 1KO1A 1IZ0A 1RP7A 2ANBA 4YT5A 1YB5A 4AMGA 2XQKA 2E4ZA 1TYDE 2G0AA 2I2AA 2GFHA 2QX6A 3F97A 3QIAA 3WB2A 1FYWA 1UC5B 2FWAA 3H9UA 4N40A 1HEIA 5AP9A 4ZC8A 4AK9A 3D1JA 3ZHUA 4D5EA 2VPPA 2PG3A 4FMCF 2DUNA 4J1TC 2GHTA 5K0NA 3UBTA 2W2QA 3SC2A 2XKBA 5BSKA 4LI3X 4UCQA 4W6ZA 2Q4DA 4MIYA 4D8WA 1QHSA 5EHGA 6REQA 5FTLA 1Z12A 4GR5A 1ZWKA 5EYPB 5H7XA 3KD2A 2V7WA 1A98A 1MIHA 4BL5A 1HZJA 5JVDA 3I9KA 4P36A 4LHYA 2Y1KA 4NL4H 2CXUA 1M75A 4UPVA 4EATA 3W8DA 5JBQA 1ZP6A 1PJRA 1W5SA 1PW7A 5KOIA 1X7GA 1B4DA 2IXGA 3V8PA 3RC7A 4NCHA 4K3VA 1T3HA 2ZAYA 2VTKA 1EX7A 4UULA 3KDPA 4BATA 4B3FX 1OZFA 2VJOA 4F6LA 4TSFA 4AX8A 1UP4A 4INOA 4QNMA 4J0CA 3WSTA 4B6GA 5K3DA 3N86A 4JU9A 3UG6A 4DYHA 3MMPA 3D6JA 4ZHQA 5JZBA 4KN8A 1M2GA 2XOKA 3AT1A 2C3UA 2REOA 4EDHA 3WFZA 4KQ1A 2CBGA 3W9UA 5F76A 5FUQA 4HDMB 4F9FA 4WN9A 2BLLA 3HWRA 4DSNA 1A9YA 3JR7A 4BNWA 1EUYA 3WV4A 2P5SA 3EN0A 4X60A 4OVKA 1P75A 5T4EA 1QBKC 3U49A 3UENA 4DDHA 5JYCA 4B1FA 1E2HA 4S2EA 4QREA 2V45A 1Z8DA 3IMCA 3O9MA 5EIWA 4CE6A 4HRAA 2QWXA 4E15A 1FDVA 1BS9A 2MU1A 3GN2A 2WIJA 3G6KA 4NV1A 3RAEC 3OEWA 2OK7A 2VN8A 3KP1A 2PBLA 4TN5A 3DNPA 1M10A 3EGVA 2XT9A 1NXTA 3H2HA 4FC6A 1BKSB 4WNIA 2J31A 2JLCA 5UKDA 3RKUA 3UFXB 4AIIA 1V71A 2CBZA 4O59O 5B12A 4NCBA 4O0LA 5EIFA 1NBHA 3KSUA 5DDIP 2C9YA 2UZ1A 5IAEA 3O8QA 3VMMA 1FPMA 5F2NA 1I30A 2OHOA 2QDKA 3H75A 3HU5A 4U9UA 3RIHA 3W5HA 1E79D 3H8SA 1TEZA 2FY8A 3OKAA 1B8PA 1KK0A 1KZ6A 1TD9A 2H07A 3H0KA 1UZAA 1L7AA 3R3XA 1QF9A 2H9AA 1GILA 4FOSA 4UAVA 5BYKA 5LUAA 3PTAA 1SKBA 3FCOA 1L4HA 3GRUA 2PN1A 2YBDA 5IBRA 3B53X 3ZHRA 1H94A 2BN4A 3KQTA 3RG8A 1K8ZB 1XNHA 1E98A 2QT1A 1ENOA 1GVNB 3CZRA 1QO0A 1R16A 1L7MA 2JCBA 1JJAA 3FSGD 2QV7A 5EAIA 1T8TA 2EG9A 1DCMA 3EZNA 2WSLA 5K0TA 3I83A 5DGXA 4RMNA 2I2DA 3LQKA 1KJWA 4WFQA 3RUHA 1F8YA 1IXRC 3F73A 2IWHA 2J46A 3NHMA 1SHUX 2OESA 2IPOA 1M8GA 1PJQA 4HEHA 3EULA 2VRWA 2GCIA 3RUIA 3FKSD 4MRMA 2XZTA 3EPJA 1AQ6A 1DJOA 1KKLA 3RJTA 2RIRA 1E6LA 1H1TA 1O9BA 1ZJ4A 2RBGA 3R7FA 3RVQA 5KEIA 1GPMA 2IVFA 3H2YA 3FUWA 1JDBC 3EGXB 3UJDA 1JFFA 5LFAA 1GA4A 3N59A 3UHJA 5EJ5A 5KTOA 1O97C 2WIDA 4FGLA 3WRXC 1D2HA 1P2FA 2ZSAA 3JAMA 3C87A 3NHJA 4L0QA 4I66A 3DMFA 5DHTA 4XGKA 2GO1A 4DLRA 1P62B 2DQSA 1CJKC 5KZMB 4FILA 3IALA 3RROA 4FKZA 4JU8A 3JQBA 1LPAB 3OCCA 4LC0A 4PANA 1YUMA 3RUFA 3AY0A 1NGSA 5TC4A 4B81A 2N46A 1WLSA 3BEOA 4IVPA 3CLRC 3PFBA 1B2LA 3E27A 2WMDA 3CEJA 3LBAA 3F6BX 4IQ8A 2F8TA 1ML3A 3C97A 2QQGA 4X41A 2VLIA 1PT6A 2GUWA 4MZXA 2GWHA 1B8VA 1M1YE 2FW6A 3BXHA 3M5WA 4MVXA 1QAQA 4F8JA 4JI0B 2GZDA 4M76B 2WINI 3PGLA 5FLXA 1IN6A 1PGQA 2PRJA 4P84A 5TVKA 2NO7A 2JAWA 3FYTA 4DM3A 3FVRA 1K89A 4I9GA 2WQ7A 4BC1A 4FJ1A 4PBRA 2GTPA 1OKKA 5NULA 4LRSB 3DH0A 5A3JA 4IINA 2AKEA 1EZ4A 1RQLA 2CHUA 2ZFUA 1C41A 2Q3EA 1E66A 2YWBA 3LUDA 4HF7A 1QYWA 5DHSA 1YJBA 4UEKA 1SHTX 2VJDA 3NH6A 4GUAA 4X61A 4BFCA 5K45A 4Q9DA 1JDSA 4WCFB 4WPGA 4B47A 3I92A 3I8XA 2HLDD 3DBOB 3LUFA 4PFJA 4AB1A 2C2BA 4YFVA 1SOUA 2DBRA 2WWHA 2NZXA 1EBFA 1YXMA 1G0NA 3IAUA 4GO1A 1FC0A 2HJHA 1I3OA 5K05A 1BWPA 4C5BA 1EQUA 2WFLB 3WK8A 5HK9A 1RC8A 4NJEB 3TGWA 2WG0A 3F9RA 3OAAD 5KQLA 1II0A 2QPLA 2PX5A 1EWRA 5BSFA 1EUDB 1MCZA 2FYTA 1BSVA 2XWSA 1DQZA 2CJYA 2Q6TA 2VAMA 2ZXEA 3O83A 3STHA 4Z6KA 7GPBA 2B69A 3WLKX 3OX3A 3TLJA 4JOQA 3OZAA 1EEHA 2CVQA 3KAJA 4UFNA 5EJ6A 4AECA 1HLDA 3PC7A 1AGRA 1ZK0A 3D02A 3STYA 4FOLA 3QYAA 4W7IA 2H1LA 2GEKA 4MX8A 1PIWA 1CY2A 1COWA 2REBA 4IHJB 4KVGA 2CUZA 4HQ0A 5EMMA 4ZK6A 4MTCA 2ZYHA 3G8CA 3VKHA 5FOUA 4WFJA 2IELA 3T7KA 3X1JA 5DK4A 3UMFA 4C4YA 1EWYA 2TSYB 3NTLA 2OA0A 4NZYA 4MKRA 1RAIA 3GGPA 4AN1A 3VR5A 2EYUA 1UJ5A 1SCKA 1X1TA 1Z28A 3BMNB 3ND9A 5LJLA 5B1IA 2PZKA 2G70A 3RSSA 3P94A 1ACMA 4WW0A 4GPTA 2MTBA 2QX7A 5HKBA 2G9QA 1JU4A 2BZ1A 5JS1A 4LMPA 4OKSA 5IFLA 1NTOA 3EC7A 3GPDG 3B12A 1Z88A 3QKRA 5KWSA 1NNI1 4EFLA 5P21A 1TM5E 5E0OA 4UHDA 4CF6A 4L02A 2D1QA 4ZYWA 1DWOA 1FFWA 1Q44A 3K2IA 2C9DA 2I1QA 3SZLA 1R9NA 3AFMA 4GNRA 5BOVA 2JFFA 5A5EA 3O73A 4L9RA 4UE2A 5CLIA 5DN9A 1A8UA 1U8TA 2EEPA 2NO5A 3ESRA 3PFHA 5TR9A 3TXYA 1SIUA 1UPXA 1VDMA 1XCBA 2GT1A 4C7OB 2XDYA 5ERYA 3VKFA 4A2PA 4RH3A 2ZBVA 3BQMB 2AD1A 1JEOA 1SU4A 2NU9A 3ULKA 2V7GA 4JGBA 1IHOA 1N2GA 3FWPA 1KFJB 2BFOA 1WCIB 1WXWA 2PRKA 4OFXA 3L7YA 2GAOA 3IB3A 4XD7D 4YDRA 4KQHA 3FETA 5EJIA 1YZFA 3TTTA 3OLQA 5K8UA 2OXTA 2QXTA 3H4VA 1FJGB 4KACA 2LKDA 3AVYA 1N6IA 3H42B 2WWYA 3P9CA 3F6EX 3JWHA 4N5MA 1C3EA 4ZARA 1CY6A 1AUOA 1NUAA 2LE0A 3DW1X 3LQFA 4Q48A 4YONB 2BFAA 4ZQCB 2G1JA 1FS6A 4FWBA 5AOAA 2XA9A 3ANLA 2FUCA 1K9VF 3Q9LA 2NUTA 2VVTA 4B73A 1T8SA 3KOYA 4U9IS 1UJ6A 3HQ4O 5LN1A 4YPOA 5U4QA 2ZDGA 1VMIA 3QEKA 1NVUQ 1IXYA 2CLLB 2ATEA 4TRJA 4E4RA 4ZI7A 1CQZA 1V45E 2SCUB 5EZ5A 4KXLA 5AW7A 1MV5A 1P1RA 3BBPA 2OC4A 3IOYA 4PQGA 2PUVA 3HBLA 1LLDA 2DF8A 2IUEA 3L0OA 2VHEA 3NLLA 2OO7A 4BVBA 4B9EA 1WBDA 1FMFA 1BXKA 3QXXA 2YJ3A 4FFNA 4QQRA 3WZ2A 3LUJA 2X8WA 1T34A 2CFRA 2YWFA 3ORRA 3VRHA 1U3WA 4JVNA 4AJPA 4JYAB 4C7BA 1IY0A 3A6PC 4GI5A 3ZHTA 2JL1A 3GLHA 1ODLA 2BFBA 1AN0A 1Z0FA 3WYFA 1BTOA 5IM4A 1DKOA 1A7KA 2GAIA 3RVBA 3WGQA 5A1TA 2FMTA 2CYCA 1RC1A 3IE2A 1OFTA 2WLSA 4W5RA 4K9QA 4O2AB 4BO4A 1M8KA 3B1ZA 3ONDA 4TMVA 1FYXA 5JJ5A 1HDZA 3C3JA 4ZODA 4IDHA 3L7CA 3ZPXA 3N0TA 1FP2A 1KDTA 3T0GA 3HVUA 4EF5A 4MV3A 2WNHA 1QC5A 2QTAA 3GGDA 4JKIA 3WTBA 3W2IA 3CS3A 4RV9A 1OWOA 4QJIA 2YY6A 4G65A 4TM8A 2EDAA 3PDIA 5C9ZA 2AC2A 1L5ZA 1ECCA 3OQIB 3M8KA 2GCGA 4L8VA 1SD1A 4PLYA 2HA3A 2GBGA 2QVBA 2VNSA 1IWOA 2PL9A 3GPIA 1VB5A 4WZAB 2HEIA 1YMVA 3SIWA 2QJFA 3OQNA 1TLLA 2OBNA 1GP2A 4RK4A 1JJ7A 2PL1A 4ZOQI 1V5IA 2BKLA 5HUQA 4LAFA 4M8KA 3BH6A 3RNLA 2BFEB 3CKYA 3NM4A 4JR1A 1U8ZA 2O3UA 4YT8A 1J2YA 4Q3DA 1N0UA 5JRJA 2FXIA 3S8EA 3HDTA 3H9BA 3L1IA 1ZD9A 4CEHB 1OSNA 4JI3B 5KIAA 1U0EA 4PYRA 1K0FA 4ZOAA 2IS2A 2FG7C 3A1FA 2YL2A 4RVHA 3WXBA 3HPQA 2AIRA 4NECA 5DXAA 1WMSA 3K1YA 2WSSA 2YQ4A 4R7TA 5CIWA 3OCVA 2C5FA 1TA0A 1UP6A 3IIMA 1GZSA 3B82A 1E2FA 1BDHA 1WUKS 4EKDA 1XZDA 3ZBUA 3GUCA 3KTAA 3V8QA 2A4KA 1U0NA 3CSUA 3G8AA 3PV0A 3RWOA 3I9NA 3OQHA 4PGMA 4RIIA 1N9ZA 4II2A 4OJNA 4NI5A 4LPSA 4YMGA 3FCEA 2XXAB 2B5WA 3AF3A 4K46A 4LZZA 3ZU3A 1WZNA 2AFIE 3KZCA 1H9BA 1DJLA 3EVAA 1BQ4A 2VUIB 3O7MA 4PGHA 2RHMA 4ZU1X 5HMLA 3HSKA 2OTCA 5B53A 1XRNA 2BDUA 2OAP1 3OQ1A 4IIDA 4TQGA 1TCVA 2XUDA 4UNIA 4MDYA 4R71A 4S24A 5JSZA 2H1RA 4JENA 4M1WA 3NEPX 3U7HB 3AC0A 1DELA 3X2FA 1J42A 5KNDD 1CEYA 1MH9A 2PO7A 4W9RA 4ACAA 1KERA 4O1HA 2PDAA 3ADPA 3CEMA 3OWHA 4FFDA 4C7XA 3HBNA 3LFTA 4D3YA 3DT9A 1R0KA 5JY6A 3BG5A 1WNTA 4M46A 1ZD8A 2VK4A 1N2JA 3WK7A 1XJCA 4DW8A 2M98A 1ZC4A 1SZDA 1A4UA 2WF5A 2OCIA 2DR2A 2IBMA 2OV4A 4G01B 4BNFA 1BE6A 4GSYA 2A0FA 1IXZA 1OVMA 1AJEA 4JK3A 4AAYA 1ZBDA 3MJHA 2ABWA 3DC2A 3M4NA 2DT5A 1L5HA 5FX2A 4EHLA 4DIBA 4ITVA 1OLXB 3GCXA 4D46A 5CX1B 3CBGA 4R0MA 4BMNA 2PYZA 4LDPA 4NX2A 1I8TA 3FAKA 2GXSA 3FJ1A 2H9YA 4J1QA 4Q34A 4IXNA 4UTZA 4I6GA 1E3IA 4JJZA 3ZZNA 6AT1A 4JXZA 2B7BA 2PZGA 4FSDA 1M5UA 1IOZA 1I2DA 2GF0A 2X0KA 2I7VA 4RTKA 1M6YA 1RAEA 1E4VA 1HDYA 3DAGA 4OK5A 1M0TA 4C7VA 1G98A 3MA0A 1OA1A 5KYXA 1N7HA 3DFIA 2ZSFA 4H7KA 1WIWA 2I29A 1E1MA 5K6TA 1DKMA 3EBLA 1GRCA 2NU7B 1NVFA 2B7CA 1Y48E 4EB6A 2IDZA 1R4MA 2OMEA 1G9SA 2A5DA 5KCZA 1L1FA 3HKCB 4P33A 1LTQA 1TA4A 4F2GA 5EKDA 4PXAA 3C45A 5T3YA 4CQMB 3LSTA 4HUTA 4RTQA 4HQFA 5FR1A 2ONKA 4OTZA 4YX9A 1YFLA 1AE1A 3NVKI 1VKZA 3B3AA 4QSMA 3ZXSA 3WRVA 2DECA 1QP4A 2C78A 1KY5A 1ZD1A 2HMUA 3P7MA 4NZPA 4F3CA 1KKUA 5A7FA 2C61A 3C6KA 5BSRA 3KKOA 3TLCA 3MCWA 4FGKA 1YL6A 1SQFA 5JJCA 1UWKA 4Z9BA 1KIAA 2FRXA 4XWWA 4LXXA 3R3HA 4NOJA 1OQAA 3ZS9A 4CCWA 2JS7A 4OP2A 3JYPA 4X6UA 3G8DA 4CV0A 4OLBA 2PM8A 4GZ6A 2VAWA 5HJ2A 3WGHA 4DJTA 2GNOA 1E3SA 1QZZA 3IESA 3T8YA 2E5FA 5HFAA 2F1IA 4MV5A 3K1JA 5BN1A 3WL4A 1NX9A 1WD5A 5BV7A 3RRBA 1OLSA 2PMBA 4GICA 1JH9A 2O1XA 3IO3A 1Z08A 5B37A 2E48A 4FN5A 2P0YA 4UE6A 1NOIA 3UWMA 3OM0A 4IP0A 5HXAA 3MHPA 2ZIUB 2HLPA 4O3FA 1XCOA 4G4JA 4LKOA 4P6VF 2H8GA 4L78A 5KI6A 2GNPA 4MYHA 3I6MA 1V7CA 4F3NA 5DW3A 5KC9A 1NW9B 3WYNA 2ZJ1A 3WQRA 2BCJQ 1Z4NA 4LHEA 3K6SB 3CH5A 3BL8A 3HLTA 5BR7A 3KT0A 4LGCA 3PT9A 1ZNZA 2O5VA 3FFWA 1QTNA 4C03A 4DTCA 1IYZA 1V1MA 3FLBA 3GW8A 1N8TA 2CKDA 4PG5A 3RYCB 1L7EA 2E49A 4ALNA 1AQIA 1SKAA 2SICE 1OZHA 4CQJA 3UW3A 4EHNA 2Z30A 3FMVA 4N0MA 3L43A 3VOAA 4DANA 1NR7A 4QDTA 2FP3A 1VLMA 3NRCA 3TUIC 1BDIA 4I19A 3KIPA 3EA0A 2JJ2D 4TWJA 4XJVA 2PJRA 3COYA 1JAIA 5DXJA 1IVYA 1G9XA 2ZETA 2VF8A 2BFWA 3KOWA 5LLSA 1SQSA 2F90A 2OYCA 1P0FA 5SY6A 4FCTA 2QM8A 1GARA 5BR4A 4MW5A 2F67A 5G2OA 2BJVA 2AOVA 1RZRA 1KI6A 4EKIA 3FE2A 2EIXA 5JNVA 1G41A 2PBZA 2QROA 3NOVA 1ECBA 2FX3A 2AJCA 4BXOB 3BREA 3I0NA 3PEYA 4GU5A 1AQNA 5IM5A 3ECAA 5JHGB 3DZCA 3EQ6A 1BD4A 4Y9DA 1P7PA 2EAUA 5AXCA 4M8LA 3PUIA 3ZC3A 1E6WA 1FQOA 2PHZA 5SY4A 3JVIA 1XQYA 2X4GA 3QKSA 1HK7A 1ZUIA 4NMWA 4TT3D 3TTSA 4XIGS 1RI1A 3PVZA 4LDRA 4KXWA 4LDQA 3L06A 4R8SA 7YASA 1TMOA 3E5MA 3G8YA 3GCWA 4POAA 3ITDA 4QYIA 5DNDA 4MPPA 4DC1A 1IBLB 1E8MA 1O94A 4R40A 1VFPA 4TRRA 3HGMA 4ZO6A 4ND5A 3B1YA 4Z8XA 4B3SB 3F9IA 5DM1A 3R7WA 1UK9A 1RYZA 4HRYA 3RC8A 1SXPA 1G55A 1QUEA 5ILOA 1ZIDA 4YGYA 2QM3A 2AJTA 4EMUA 1SPBS 2RKOA 2OV8A 1GGMA 1PR9A 3KL4A 4MVJA 2A1UA 3X1MA 2C99A 1IDN1 4B35A 5HM6A 3K0FA 4KU4A 4RK7A 3FUXA 2FOXA 1VTKA 4I4NA 3TLXA 2AC7A 3PUVA 4JVSB 3EAQA 1DIGA 1DO0A 2OGTA 4IZOA 1KS9A 4QRIA 2AQ8A 1MU0A 1TE2A 1YGYA 3K9QO 2G4CA 3K9WA 4RK5A 1U8XX 1J2JA 5ALZA 2H08A 1FTGA 3WSWA 5B5SA 5DHRA 5AQEA 2IUUA 1LFAA 3V48A 5BN3A 3H0CA 4HNGA 1PQ4A 1YRQA 2CZQA 3WR5A 1WBJB 3TUZC 3SYKA 4JLUA 1UPAA 3RFTA 4MWGA 3I52A 5SYAA 2KBFA 1W85B 1Q1GA 2VZ0A 3JYHA 4IX9A 2KWIA 1E3DA 1SHJA 2JGNA 1NUUA 1NXPA 3LUGA 3R7BA 3MS2A 2IHYA 3TSCA 3A04A 3OLYA 3WWEA