3AIKA

Crystal structure of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
b'ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 303aa long hypothetical esterase
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 102
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aikA00
2BJHA 4UHCA 3UMJA 4H7KA 4HS9A 1VE7A 3E4DA 3F67A 4DNFA 2Q0XA 3H2JA 2WQZA 3W04A 2ONCA 5K3FB 3KSRA 2JBWA 2PSJA 2VAVA 1WCYA 3ANSA 4M0EA 1E8DA 1VA5A 2PSHA 5AO9A 2ZJ6A 2HHAA 2WKWA 4FKBA 4C87A 3SWWA 3M81A 1CUUA 2GYWA 4I4CA 3QMMA 4DTCA 3V1KA 4Y2RA 5DJ5A 4DYHA 5EHZA 1S8OA 5ALRA 4GWLA 1FFAA 5HKAA 2XMDA 3H1AA 5AK4A 4MYSA 4N8EA 1XZCA 1LBSA 3DOIA 1F0NA 1NX9A 1W6RA 4JNCA 4M0MA 3NGMA 3NUZA 4F5ZA 2WHRA 4HAIA 5CW2A 3ILSA 4E11A 5LKRA 2WJ3A 4AN1A 2DQYA 2WIDA 4DSZA 4UHHA 4BP8A 1FSSA 2QTBA 3AINA 3IB3A 4K6KA 1EA5A 4MXDA 1ZGBA 2PSDA 1CUAA 4X94A 2VT7A 4KAFA 5DNVA 2HIHA 4Q3OA 1DT3A 1BCSA 2XUHA 1BN7A 1ZI9A 2XLCA 1E8NA 4G8CA 4K6GA 1O6FA 4C4YA 3WKBA 1XFDA 2VJAA 2QKYA 1LPMA 4G4JA 1AC5A 3BDIA 1BS9A 1ISPA 3F8SA 4AN0A 3G02A 5YASA 3LIPA 2PUJA 4OU5A 3ZLUA 4LYEA 2H7XA 5ALLA 5LZ5A 3PI6A 3O95A 5FPPA 1R3DA 2WUDA 3LS2A 1MX5A 3LCRA 1TQHA 4H0CA 5H3HA 4Q3KA 4B9AA 5CH5A 1YB6A 4DMHA 1XZJA 3WJ2A 1QGED 1MTZA 3KWJA 1CLEA 4AXBA 2J4FA 5AK5A 5C81A 3GELA 1F8UA 1U8EA 1RWQA 1XRNA 4H7IA 4J0CA 3STUA 1TK3A 3I2JA 3TRDA 5DNWA 4BAUA 4KE7A 1R88A 1K5PA 3IBTA 1W52X 1XLVA 2Z8ZA 1WM1A 3K9BA 2GYUA 4MWTA 1ORWA 2QR5A 1XLWA 4O08A 3JWEA 4KR0A 2H7YA 3D2BA 2JGKA 2FUKA 1JT2A 4C01A 5FP0A 2GBGA 2JEYA 5A7HA 2CKMA 4D9JA 1UOPA 1P0MA 3CXUA 4QWWA 1A8UA 2HFKA 1KU6A 4FWBA 5CT6A 3CCCA 2P8SA 2Y6VA 5ALSA 3DYIA 2OQVA 4B0PA 5JZBA 2WIKA 2JGIA 3OM8A 5SYNA 4EY5A 5D7BA 5HFAA 4BCBA 1YAHA 4BVJA 4LHEA 1UK7A 2ZSIA 1N5RA 4GDMA 4LIPD 3NOXA 1XZBA 4AMYA 1F6WA 2XQJA 2XUKA 5EIEA 4C89A 2Z5GA 3DDUA 1DINA 1QONA 4TPKA 3WL8A 4M0FA 3DJYA 4UBKA 4BBZA 1DX6A 4KJXA 2VJCA 5ALKA 4GXNA 4C6HA 1CUFA 5KBYA 2OLEA 2XUGA 1TCAA 3BJRA 2XUDA 1B6GA 3Q8WA 1Y7HA 4QDTA 4P08A 1W75A 1LPSA 4GECA 2DFPA 5D3KA 2FJ0A 3HXKA 3IUJA 4H7EA 1DQYA 1Y7IA 2HA3A 1ZD4A 4L72A 3OTQA 5DNUA 3WMRA 3R40A 2D5LA 1FFCA 4B81A 4KYVA 3RK4A 1QTRA 1W76A 1ZOIA 1CRLA 4WFJA 2AXEA 1KU0A 4EA6A 1UKBA 2XT0A 3F9CA 1HL7A 2J3DA 1O6GA 1QLWA 4XX1A 3ESAA 1VE6A 2PKYX 5AKIA 4CCWA 1SCKA 3CCBA 2V97A 2HU8A 4UBMA 5K3AA 3I2GA 5K3CA 4QEKA 5IVHA 3I1YA 2VJDA 4BP9A 1IUPA 2WTNA 1EDEA 4CIBA 3WWOA 5AM5A 1K4YA 4UUQA 2WFLA 5JD4A 1JJBA 3O9VA 3FLAA 2XUQA 5ALFA 5SYMA 1PV1A 2Y2UA 4ZREA 1HKHA 3E0XA 1DU4A 3DKRA 5AOAA 3BIXA 2JEZA 3WWEA 4DIUA 4MQLA 1XRPA 4B0OA 2QMQA 3QPAA 3WK4A 2VQ6A 1BROA 4KRYA 2OCIA 1H22A 4B7ZA 2PL5A 2GZRA 1CUDA 5ALEA 4ZGBA 4P93A 5HCUA 5IVIA 1UWCA 2RAUA 5HZGA 4IH9A 3BF7A 5ALWA 2HFJA 1CUHA 4ARBA 5JAOA 4HXGA 4Y2TA 1UOQA 4Y2XA 1ZI8A 3H2IA 3R3YA 1UK6A 1HDEA 3EBLA 1BE0A 5DYTA 4QE3A 4F0JA 5A7FA 5AKHA 2QVBA 4BRSA 4B84A 5FRDA 3GROA 1BEZA 4H77A 2QXTA 4MQMA 4AZ0A 4AMZA 2IX9A 4FBMA 1D07A 1QZ3A 3C43A 3B3QA 4H7HA 3HLKA 2OQIA 1AUOA 1VA4A 2ES4A 2VT6A 1YR2A 1XZKA 4UFNA 4W63A 3VXKA 4B9EA 2C0PA 4BZWA 5HQ3A 1A8SA 3SX4A 2FJPA 3G0GA 2VAXA 5AKZA 5JATA 4B85A 1XZDA 3FYUA 1U65A 4BATA 4JEIA 2PSEA 5HF8A 2DHCA 2RI6A 2QOEA 2DSNA 2LIPA 5KWJA 4L9AA 4JUIA 4U2DA 4EY6A 1GXSA 3FBWA 4LYDA 3DOHA 3P2MA 3WI7A 2WHPA 5AM2A 1G42A 2JGJA 1DWPA 1YS1X 3DLTA 5AI8A 4PSUA 5E4TA 2G5TA 1P0QA 3C87A 3G0IA 3OOSA 2OCKA 5CXXA 1AMNA 5JD6A 2XUPA 5AH0A 5T4BA 4X6YA 2WG2A 1G4HA 1CQZA 4QNNA 2PPLA 3IDAA 4B83A 5AK6A 4J0KA 4X6UA 5A7GA 1OILA 1LNSA 1FJ2A 2JIDA 2JGLA 2R8BA 3G9ZA 2BGNA 1R50A 1CUVA 3QM1A 4FOLA 1EXWA 3VVMA 4F60A 1EB8A 3R41A 4KEAA 3WK9A 1XQXA 3AZPA 3CN9A 3IIIA 3WWPA 3D7RA 5FPQA 2C5FA 2OAEA 1B41A 5LZ9A 1QIKA 2VEOA 2PUHA 5K5EA 5F4ZA 1U2EA 2B20A 2O7RA 4DM7A 2BUBA 5AICA 3BJMA 3D3NA 3U1TA 4X85A 4BC1A 4GBGA 2BGRA 1YSCA 5LYYA 5JAPA 3C5VA 3STWA 2W22A 3ZPXA 1QJ4A 1JMKC 1MPXA 5AJHA 1ETHA 5ALMA 4MWSA 3DCNA 1SC9A 2CUTA 3L1JA 5ALYA 4E46A 5ALGA 1ZD2P 5ALOA 1H2WA 1XRLA 2ACEA 1WB5A 4BRZA 2HADA 4WY5A 5I9IA 4YX9A 3SK0A 2WFLB 4N5HX 1XZLA 4FBLA 3I6YA 3EF3A 1J2EA 1EB9A 2W6CX 3QYJA 1H2YA 2ZSHA 3C70A 1EX9A 2WG1A 3ESDA 2X76A 1LZKA 1JI3A 3V9AA 1WOMA 1JJFA 5JARA 4G8DA 1MT3A 2WILA 5AI6A 1VZ2A 5FDFA 3C6BA 3IA2A 2C7BA 3ZV7A 3ICVA 5ALUA 3Q0TA 3F98A 3S8YA 1AGYA 2I3DA 2JF0A 2CJPA 3PFBA 4Y7DA 5EIHA 2DR0A 3DEAA 4GW3A 1MNAA 1L7QA 4X7BA 1HPLA 4EB0A 1A8QA 3BIWA 2WUFA 4IH4A 1N8SA 5E2IA 2DHDA 4UHFA 4X6XA 1UKCA 5FKJA 1ZIYA 5IVDA 3UUFA 1W4LA 3STTA 1DX4A 3O4IA 2XQKA 2XQGA 2HDWA 2WLSA 4Q82A 3PF8A 3FAKA 5CT5A 1Z68A 1EH5A 4KACA 1NU8A 4X3CA 3R3UA 2OGTA 5HQ3B 2D0DA 4RPCA 2OAGA 4MJ3A 1NU6A 2OGSA 1CR6A 3WA6A 1SCQA 2PU5A 2B9VA 2GBFA 4PO3X 5ALJA 4W1QA 5EGNA 3FYUB 4EZIA 4Z49A 1QE3A 3R3WA 4GEGA 2WUGA 3VVLA 4E15A 2QUBA 1BU8A 5ALVA 4EY7A 1MNQA 1E89A 1VXOA 1R4ZA 4X00A 5ALDA 3VJKA 4KAAA 5LZ7A 2WHPB 4Y2JA 4P92A 1DT5A 1DWOA 2B61A 1GT6A 1QO7A 3M3DA 3WK8A 1MO2A 4J0GA 4N8SA 3H2HA 3PE6A 1H23A 4U2BA 1IZ7A 4OPMA 4I3FA 4PNZA 5JYCA 3D0KA 1ACLA 3C6YA 3WIOA 2PVSA 1CUBA 1XRMA 2XQIA 1E5TA 4INZA 5JD5A 4W1RA 2J3QA 2X5XA 1P0PA 1MX9A 4W1SA 3V1NA 3F96A 3D5EA 3WYNA 4X90A 4B6GA 1R1DA 4CG3A 5CH3A 1BCRA 1ACJA 4QLOA 4BE9A 3PUIA 4V2IA 2VATA 2ORYA 3LIIA 4QDOA 3C6ZA 5HK9A 3EIOA 1G66A 1QIJA 3H0CA 3WWCA 3WK7A 1ZGCA 3T52A 5AKGA 1VKHA 4IH1A 1GKLA 3ZLVA 4ZV9A 4AO7A 4CI9A 3C5WP 7YASA 3SC2A 1AX9A 4PSDA 1VJ5A 5IH7A 4BCCA 3WIBA 1CUZA 3DS8A 5AKEA 1JKMA 3H17A 3H19A 1YCDA 3BXPA 4YASA 2ZYIA 1XZAA 1ODCA 2BUCA 1K6EA 4H7JA 1ZJ5A 4OB7A 1KEZA 4HRXA 5T4EA 1UOOA 4DNQA 5K3BA 1R9NA 5BOVA 1CUGA 1MN6A 2JGMA 3YASA 1CQWA 1WPXA 2JGEA 1I6WA 4DNPA 3DKKA 1MAAA 4HXFB 3QMWA 2ZVDA 3WKAA 1ZD5A 4QDZA 2XUFA 4KRXA 3G0BA 3RARA 4EY4A 5KREA 2OXEA 2WJ4A 1ODTC 3QVMA 4BTLA 5K3DA 4BTVA 1XKLA 5T4FA 2VA9A 5HF6A 1XROA 2XMGA 2H9YA 3D4LA 2ZYRA 3AZQA 4NS4A 1E8MA 2EDAA 1C7JA 3WKDA 1QIEA 2O2HA 3HABA 5AI5A 5C8ZA 1LBTA 1TCCA 4AO8A 2PBLA 1XZGA 1T2NA 5ALIA 3DD5A 4C88A 1GPLA 1T4MA 5BWBA 1XQVA 1LPOA 1ORVA 3GFFA 1CUWA 3HSSA 2ROQA 2Z3WA 2XLBA 3HEAA 3G9TA 3B12A 2XI4A 5AI0A 1DWQA 4FDMA 5LZ8A 3S2ZA 4XIIA 3H04A 2XE4A 5CRIA 5HK8A 5D3ZA 3WJ1A 1LPPA 1XRQA 2WG0A 2DCMA 1AKNA 1N1MA 2WTMA 1XZEA 4UPDA 4Y2PA 5ISMA 4FLFA 1ZI6A 2GYVA 4MYDA 1Q84A 3T4UA 4AQDA 3AJAA 4BCDA 1YB7A 1EVEA 4FLMA 4OYLA 1VXRA 4U2GA 5FLKA 1RYYA 2C4HA 4Q3LA 5JAHA 2BUAA 3IULA 2ZJFA 5ESRA 2FX5A 1Q0ZA 4X97A 1EHYA 4HRYA 2V96A 4XVCA 3ZLTA 2YH2A 1QO9A 3QPDA 2HA4A 1DQZA 3WA7A 3TGLA 3D2CA 2WU3A 1IMJA 3BDVA 4MEAA 5E4YA 2O2GA 3WL7A 2WSLA 1XZFA 3DNMA 2HA5A 1XKTA 4BDSA 3W9BA 4CG1A 3G8YA 4KAJA 1MU0A 5AM0A 4BVKA 2XUAA 1QFSA 3H2KA 3WKCA 5AIAA 2Y6UA 3I28A 5C8XA 3W9UA 4OB6A 3D2AA 4PV7A 2PU7A 4B82A 1QIDA 1GPNA 2QJRA 3IUQA 4J03A 3N0TA 1W1IA 5ALNA 2XMZA 3BL8A 1UZAA 2C5GA 2I78A 3N2ZB 3FSGA 4FFWA 1P0IA 1EDDA 3V1MA 3R3VA 3AIKA 4B80A 1UT6A 1EDBA 5HKBA 3EQ8A 2WIFA 1WPRA 1QFMA 4FFVA 2AJCA 1GQSA 1LZLA 4LXHA 1ZIXA 4FMPA 1QIGA 4U2CA 3FOBA 1Q0RA 4K6HA 3HACA 5JASA 1ZICA 4HTAA 4BAGA 1CVLA 3OC0A 3H1BA 1BN6A 4AO6A 1QOZA 5AOBA 3M83A 3BF8A 3L1IA 4L3WA 1J1IA 3BWXA 4Y2VA 5CMLA 2C0QA 4AB1A 3NWOA 4NZZA 1FFDA 1XRRA 3DL7A 2QJWA 4ZV7A 3FVTA 1JU4A 3WZMA 4QDXA 3TJMA 4H7DA 4AZ3A 1UKAA 4Y2UA 4HZGA 2WHQA 5EI5A 3I2FA 4A23A 4JH0A 4RGYA 3FWHA 3ESCA 4WJLA 5CBKA 3M82A 4QZVA 2OG1A 2HU7A 4Y2QA 4A16A 4CG2A 2OCLA 3R0VA 2CZQA 2ACKA 1X70A 3A2MA 4W1PA 2XUJA 1JMYA 4G8BA 5LZ2A 2XB6A 4G4IA 3I6MA 2WFZA 3LLCA 4FNGA 5JAUA 5AKKA 5DYWA 4WY8A 4QDUA 4Y2YA 3DQZA 3STVA 2RGUA 1VLQA 3RKSA 3PICA 1MJ5A 2WUEA 1UK8A 1XLUA 3KXPA 4AX4A 3ED1A 2HA6A 2VJBA 3FYUC 2RONA 4TVKA 4G5XA 1FFEA 3I1IA 3IVMA 3MUNA 2QM0A 4EUSA 4TGLA 2PSFA 1SOMA 4X71A 3IUMA 2IIVA 1XZIA 4J0HA 4ZXFA 2BCEA 3TEJA 3WKEA 3ESBA 4IO0A 4BB0A 3OPMA 3X3HA 5FV4A 3KWFA 2RHTA 4RE5A 1UXOA 3QITA 2YASA 1IUOA 1F0PA 3WK6A 2G4LA 2JGFA 3VJMA 4W9RA 3GZJA 1G5FA 2WFMA 3ZWQA 5LZ4A 2ZYHA 2XDWA 5IKXA 3V48A 2UZ0A 3C8DA 4UBIA 5AM4A 3W2TA 3GA7A 4HXEB 5I7UA 1L7AA 3FCYA 4Y2SA 5CH8A 4K2AA 3OURA 1GPKA 3DL4A 3ANTA 1VOTA 3L1HA 4K5QA 2QS9A 3PDCA 2R11A 2XMCA 4BC0A 1QIHA 5CT4A 4UHBA 1SCIA 3U0VA 2C58A 3STXA 3UUEA 4JYMA 1N5MA 4PSCA 3I2IA 5ALZA 1LPBB 3ZI7A 5LP1A 1CUJA 3VJLA 5ALTA 3WQHA 1RP1A 2AJDA 1R9MA 5ALXA 4DLNA 3PF9A 3LP5A 1GKKA 3WL6A 4RE6A 1WB4A 1E66A 4WFIA 5AKYA 4CCYA 3EQ9A 4EY8A 1LLFA 4X92A 2HM7A 4HVTA 3KD2A 2XMBA 4WDRA 1E3QA 2AJ8A 3FCXA 1JU3A 4L0CA 3GBSA 5HFNA 4DNOA 5AKXA 2CEKA 2OPHA 1ZD3A 2H7CA 5CXUA 1HQDA 1MX1A 3WZLA 4UHEA 4KE9A 3G9UA 2XQFA 4UFPA 3AFIA 2HA7A 4KE8A 3WK5A 2I03A 2HA0A 5CURA 2V9ZA 4Q1VA 4A5SA 3HYSA 2ECFA 5ALQA 4J7AA 4ZWNA 2GBCA 4OU4A 5A71A 5AKJA 3CN7A 5KWIA 1QIIA 2QRUA 3AZOA 2PM8A 1THGA 1UK9A 4DGQA 5DWDA 3HC7A 2DHEA 5FUMA 4CIAA 2VTVA 3K2IA 2H1IA 3I2HA 3W06A 3RLIA 4BAZA 2PX6A 1LPAB 4J0JA 4G9GA 4OD0A 3HZOA 4FHZA 2RHWA 1C7IA 1QTIA 3H18A 5I8PA 4I19A 2Y1KA 3H2GA 1GZ7A 3KDAA 3O9MA 1H2ZA 2YYSA 4OUKX 1TCBA 5JADA 5AM3A 1CUIA 4U2FA 3AUKA 3C6XA 2X8BA 4LXGA 4X93A 1QIFA 3IUNA 1AQLA 5CT9A 2AJLI 2HL6A 4WDQA 2BAGA 1YAJA 5BWCA 4YK7A 1M33A 2V98A 5K3EA 5AM1A 2B4KA 2XMSA 2E3JA 1X2BA 1CUSA 4RNCA 4LXIA 2EDCA 3RM3A 5IVKA 1CUEA 5JZSA 3MUOA 4XWGA 4J0DA 5AKLA 5DLPA 3VDXA 1A88A 2K2QB 4ETWA 1CPYA 4Y9SA 3K6KA 4EHBA 3WWDA 4QLAA 2CBGA 4CFSA 5CT8A 5HF9A 1J07A 3JYHA 4PW0A 4QWMA 2Z8XA 4P9NA 5A2GA 4H18A 3V1LA 4ZRDA 3R3XA 1YASA 4GLBA 5EFZA 1THTA 1ZJ4A 3WYDA 4G9EA 5AK3A 1XQYA 4UBLA 5LIPA 1LGYA 5LLSA 1U4NA 3FLBA 1USWA 4LKOA 4N8DA 4C4ZA 5AOCA 5FOQA 2QZPA 4H35A 1H2XA 2GBIA 2ZYSA 1Q83A 1C4XA 4G4GA 1BRTA 5K3FA 4DMCA 1YS2X 4EBBA 1MAHA 4J3JA 3G7NA 2DQZA 4UBJA 1TRHA 3VKFA 1CFJA 2RIPA 1CUXA 4UHDA 3FSGD 5JANA 3ICWA 2O7VA 4F21A 3QPCA 4IQ4A 2QXUA 3EQ7A 1VZ3A 1IZ8A 4BDTA 5BV7A 6YASA 4QA9A 1DTEA 2IITA 3G9XA 3O4HA 1J06A 4FLEA 3MGAA 3O0DA 5DTJA 2XMRA 2I3ZA 4ARAA 3PUHA 2WM2A 4YPVA 4CCYB 2HRRA 2WU4A 3A6ZA 2WIGA 3HJUA 4MEBA 3F97A 5AI4A 5AIBA 3C8HA 1CIJA 3D59A 4ITVA 4KE6A 4WCVA 3WL5A 5T4HA 3HRHA 3QBJA 4C4XA 1ODSA 4DSAA 2O2IA 4DMKA 3HI4A 5DYYA 1TAHA 1JFRA 3B5EA 4XJVA 4ROTA 1BEEA 2Z3ZA 4OCZA 5FXMA 3OG9A 1YA4A 3VISA 3QH4A 2YXPX 4IHAA 4BE4A 3GUUA 5AHXA 4S0XA 2OGZA 3AIOA 1WHTA 4E14A 5JIBA 3FNBA 1GGVA 5C8VA 1FFBA 4UBNA 3IURA 4UBOA 3A2LA 2CMFA 4Q34A 5AI9A 1OXMA 4BVLA 1GQRA 4NVRA 3WLAA 2J4CA 4JYPA 5D6OA 1HBJA 1Y37A 3AIMA 3I6ZA 4BYMA 4H7FA 2QUAA 4ZI5A 3PFCA 1AZWA 1TIBA 5A62A 2NW6A 3FYTA 4FNMA 5J3JA 5C7YA 1XZHA 4GI1A 4BZZA 1SFRA 3JW8A 3BE8A 1CUYA 3O4JA 4FTWA 1X2EA 3R3ZA 4X91A 3KOOA 3E1GA 4NMWA 3STYA 3QZUA 4N5IX 3DYVA 2CB9A 2QT9A 4J0IA 1K63A 1CEXA 1AURA 5A6VA 4GHWA 1WB6A 3G0DA 5JZ9A 5CTAA 4WFKA 1WHSA 5DTIA 2EEPA 1LPNA 2BKLA 3FLEA 1IVYA 4PF1A 5ALHA 2AJBA 4OB8A 4G1FA 1TKRA 4OYYA 3FVRA 3W05A 1K8QA 3AILA 3A70A 5JALA 4Q05A 3E3AA 2OCGA 3I2KA 4U2EA 5HF5A 1QIMA 1A7UA 5EHQA 2HU5A 2VSQA 2G63A 2XUOA 1L7RA 2WIJA 2XMQA 5EHNA 1OCEA 2ZJ7A 2HA2A 3C45A 5E4JA 1IUNA 5ALPA 2GZSA 1PJAA 1UFOA 4PQEA 3MVEA 2HRQA 1CV2A 2G5PA 1YA8A 2WJ6A 3A2NA 1XZMA 3G0CA 4UFOA 1JJIA 1XQWA 1EK1A 5AP9A 4OSEA 1HLGA 1CUCA 1EVQA 2XUIA 2Y2VA 1PFQA 5EHXA 5EIAA 1EI9A 4X95A 2BFNA 1EK2A 5LKAA 3QMVA 4DMFA 3O4GA 1EINA 2VF2A
chains in the Genus database with same CATH superfamily
3QELA 3OCYA 4JOQA 3ZIAD 4JDPA 1G2PA 1R00A 1RYFA 3OTWA 3TPZA 1NNI1 2NU7A 3B2EA 3OIWA 3LV8A 2OQ2A 3PENA 3V1UA 3KUUA 2AKAB 4EB3A 5CA1B 1OF1A 4QXMA 2ZIWB 1VIMA 5K45A 2C5SA 4RW0A 4HS9A 1VE7A 3F67A 1BD3A 1ZONA 3IQWA 1KMMA 4DNFA 4I1YA 4BUZA 3W3AH 4OM8A 3GVPA 1GWNA 3OAAD 2FPLA 1YKSA 3PKIA 5EIWA 3ZDEA 4BO5A 3W04A 4EO9A 2WNHA 4C0BA 1PR5A 3PXCX 5F1PA 3AJ8A 2YHIA 1L5KA 3EYAA 2NLOA 4BNKA 4UUNA 3PDUA 2ZI5A 1PWXA 3KYBA 2TYSB 1YIAA 3AF3A 5CVEA 2NT3A 1Y8RA 4Y30A 3C5EA 3F3SA 2IHNA 3N07A 3KTDA 2K7ZA 3LD9A 4YAIA 1BQ3A 2F1IA 1PSWA 3ZCQA 4N6NA 4P32A 2JLZA 3LNCA 3F49S 2AOTA 1XDGA 3ASZA 1WV0A 4RD6A 3JYOA 2HHAA 3GD7A 1Y42X 2IGBA 4MA0A 3DL0A 1YUMA 3I0MA 3VO8A 2NWQA 1D1PA 3RWMB 2PWAA 2AYXA 2YV1A 2ZCVA 2OO7A 3P0EA 5EPEA 4I4CA 3QMMA 1YVPA 5FPKA 4DTCA 2Q4DA 4B6SA 5TJ9A 1SXGA 4RA6A 2FSPA 2B6NA 4ICIA 3KKMA 4OHWA 2DR2A 3RS4A 5IK2D 2QG9A 1KEVA 1M34A 2V6BA 1VE1A 3BFVA 1QAOA 3EFOA 4I1UA 4RKQA 5EHZA 2HTFA 4QQNA 5JSZA 3BUSA 5HKAA 2C92A 1OWMA 2Z95A 2Q50A 2XMDA 3EXIA 3FUTA 2IEYA 1IRIA 1M2JA 4H6XA 4MYSA 4RK7A 4PC7A 5AK4A 3T3GA 4PNEA 2BRUA 3OFVA 1BMFA 4JC0A 4RY0A 2HSJA 3DOIA 3OX3A 2ODNA 4O2BB 2QAGA 5KDDA 1IEVA 1HETA 3IBGA 4N3BA 4WLEA 4I9FA 4BGUA 2JAPA 2X0IA 3AEKB 2XT9A 2QD5A 1RWBA 4EPTA 3RVPA 4D9CA 4L57A 3FKJA 3ZCTA 4F5ZA 2BEWA 4B6RA 4HAIA 1LV8A 1Q15A 1JE0A 4E11A 2ONZA 5AP9A 1JQKA 3KYIB 5DF1A 3W79A 4B1FA 5LKRA 1VPWA 4D3YA 5C5IA 5FI5A 1A3CA 2EJWA 2WJ3A 2HZ7A 1JXAA 1XTTA 3OZIA 2B8TA 3G6WA 4PZUA 3AL3A 2IT1A 4ZDKA 1UC8A 3I8OA 3EE6A 2QZJA 5LOVF 1A82A 4M88A 2C88A 5I7AA 4YQEA 1KEKA 4UHHA 1QV6A 2ZS7A 2QTBA 2ORIA 4C4PA 1TIPA 3EULA 1WETA 1EJBA 2EX0A 4MVJG 4EFNA 3RT1A 2O8CB 4LDJA 1ZKMA 3MTGA 5JJ5A 2ZZMA 1QR2A 1E9CA 3Q7QA 4G67A 3FFXA 1NSYA 4H4EA 1T35A 3IP6A 4JU9A 1TGYA 2FSFA 4U02A 5FV7A 3QXHA 3K9GA 4EL5A 2HIHA 5IJ0B 2BBSA 2I1LA 5KQSA 8LDHA 3RSQA 2Z58A 1IPEA 4D80A 3EIUA 3LBHA 3SZUA 2W6JD 3T3EA 4JJAA 5LXTA 1XWWA 4UZEA 3OX1A 1D2NA 1EFAA 3GN2A 3PLAE 4K1XA 4WVLA 1UJ6A 3JQAD 4ZVUA 4BX8A 1ZI9A 4HMPA 3HCRA 1E8NA 2GPTA 5DEIA 1RT9A 3LFTA 4GZ5A 4K6GA 3EJWA 3PHBE 3QTLA 1ISRA 4MO2A 4XGKA 4NBWA 3WWZA 4B3BA 2BMAA 2R6FA 1JFFB 2I6FA 4E4RA 3DFFA 5K1ZA 2BJVA 2YHSA 3R09A 4IDOA 4Z3KA 1ZN8A 1VG8A 1I2ZA 3F47A 3GPCA 4FD2A 1HYBA 4AN0A 1IDOA 1MB0A 4FYPA 3GCWA 4XWWA 1ORDA 5JDIA 3CKKA 5YASA 3HJFA 5KQMA 3HQ4O 3CLRC 2XBLA 3QKWA 1U0EA 3HYNA 4JQYA 1FX0B 3PJFA 1R0WA 4FCTA 1Y6GA 1KP3A 1SUPA 3AHIA 3LWZA 3LYLA 3PI6A 2QN1A 5DLDA 4DVJA 3JD2A 3S4YA 2DCUA 1TLFA 2HCFA 5HGXA 2WUDA 3LS2A 2C8VA 2QRHA 2KW5A 4DARA 5A1TA 1EESA 3ZCXA 4E5NA 1QG2A 3CX8A 5BSHA 2GETA 2XOEA 1T91A 4LJ5A 2F7SA 3I05A 4EW1A 1W46A 2NPOA 3BIJA 5F64A 5JS2A 1NDHA 3NBQA 1H2HA 2LKCA 3BAZA 3GRCA 4TXNA 1YK1A 1ZRMA 4ZDIA 3N0WA 1ISJA 3COWA 1XA0A 3HI6A 4V1CA 2IS6A 2Y0DA 3LJKA 1U9JA 3WJ2A 3GLFE 2ZRLA 2QPOA 1Y1QA 3JYQA 5J2UF 4EZEA 1H6DA 1V5GA 3PQ7A 1CLEA 2C99A 3AVPA 5BQ5A 1AV7A 3B6MA 4I5FA 5C81A 3IHLA 2RJOA 3ESXA 5K8LA 4CQNA 1F8UA 1AN9A 1U8EA 1MAVA 2QE7A 3JCZA 1EIZA 1BJRE 4H7IA 1RWWA 4KGZA 3ZY3A 1TK3A 4BNFA 3WSTA 3ZY6A 1D6JA 3AERB 2G0AA 4OXNA 4YRCA 5DNWA 3NIGB 3ZDRA 2AXPA 3H2ZA 2QL5A 4LRWA 3I23A 4CEIB 1TYCA 1UPXA 1WHSB 3Q87B 3IBTA 2DWQA 2Q5QA 2GK4A 3FCEA 3T54A 4IX9A 2NTJA 4O4HB 2ZPUA 1V8FA 3CCFA 1WM1A 4D3ZA 1XMQB 1GU7A 1GEEA 1TA0A 3BWMA 3C6QA 2GCIA 3K53A 1O9HA 4MWDA 2NSHA 5KTYA 3NTVA 2BH9A 1NHWA 1ORWA 2QR5A 1XLWA 2R8OA 2YQ5A 3LKDA 3UKJA 4P34A 1R6AA 3N86A 3THXA 2BBOA 3WL3A 1P5RA 3DONA 2VPQA 4MAAA 3L4EA 4LJ8A 4CM4A 4DPMA 3QEAZ 1N9GB 2CVOA 3IERA 4MIEA 2QB5A 1QYWA 4GE3A 1RNLA 4Q9KA 1KOFA 1K6MA 1CFZA 1JPUA 2IL1A 1V4VA 3MPUA 4OV6B 1Y4DE 2JEYA 3NRBA 3TNJA 5CIQA 4B40A 2CKMA 1GUYA 5DNCA 2CLMB 1NT2A 1P0MA 1UOPA 3CXUA 5BQOA 1BE8A 3PD7A 1VC2A 3E5MA 1BC5A 4N5DA 4P5DA 1M2GA 2XB2A 3COVA 5T57A 4EMTA 3HH8A 4PLTA 1J90A 1KRHA 3M4JA 2I2AA 1U0BB 4AMGA 1B26A 2OZVA 3FUCA 3DCIA 3DZJA 1BW9B 2F1RA 3NHMA 4G24A 5A3VA 5CDFA 3UAYA 5BQFA 1RPZA 1MPTA 1CBUA 4OJQA 2ETXA 1OZHA 4FHDA 2Q9BA 3KJGA 1IM2A 3PHHA 1WXGA 4TXLA 2HI0A 2P77A 4KLCA 2OO5A 3SQDA 4KUGA 2R6DA 2G82A 3L4SO 4XFJA 4XIYA 5IC6A 1D8AA 3VU9A 4G81A 4EKDA 4EY5A 5LYJB 3A6PC 1JNXX 4J2OA 3VHQA 2QAGC 2M9MA 3LDUA 3DE5X 2QY9A 4K6CA 5AVWA 4PG6A 3E3MA 2LP4Y 2D1TA 1N5RA 2GN0A 1VRVA 2YJ5A 3P97A 4GDMA 4YRRA 1OWNA 1PWZA 2XCTB 1XJ5A 4RELA 3FOEC 1XZBA 3TSOA 1AN0A 4EM6A 3CZAA 1U8ZA 1F4LA 1F6WA 2JW5A 2XQJA 4HQFA 3T7SA 3VH1A 1L5WA 4PCAA 4CYMA 4ENWA 5K4GA 3T5PA 1J99A 2BI7A 1PR4A 3QBDA 5EIEA 3L7BA 5EE5B 1L7DA 1L7MA 2P5TB 2X1LA 2HIAA 1Z26A 2UXCB 4YJ3A 1KOGA 4DV2B 4JK3A 2HZBA 4Q15A 3Q7PA 4LDQA 4KHPB 4IILA 1W5EA 4O5AA 3DDUA 4X54A 3RSZA 3SE7A 2VVTA 5KHOC 4Y8VA 2D7DA 1UXHA 3BKWA 4TPKA 4UTOA 4M0FA 3SAJA 3WL8A 5L3QB 4R4JA 4NK5A 4KC0A 5K9ZA 4TKMA 3IHKA 1C3EA 5TQ0A 1DX6A 5B58T 2DBQA 3L7CA 3P2IA 3FDZB 4Y6RA 1U6JA 2VJCA 4RVGA 5HCIA 5L4LA 3S0JA 4GXNA 3NC0C 4V38A 4I99A 1MB4A 2UVDA 3AI3A 4EVRA 5HMMA 4B5KA 4F72A 2AYYA 2OSVA 4I4TA 2COUA 5BSGA 5IU6A 3E9DA 2ORWA 3BJRA 3ZVKA 2XUDA 3AF6A 1B6GA 3T5GA 1RCUA 2WEKA 3Q8WA 3L6EA 1H6CA 3CNHA 2AMYA 5FOUA 2BEVA 4QDTA 4WMLA 5HBRA 1YIDA 3WQRA 4TKLA 3R75A 3NG1A 1N4AA 2D1RA 5BUCA 4GECA 4F3YA 2H54A 2IYRA 5KSYA 1A2KC 5D3KA 2HX1A 2QZZA 3HXKA 4L1KA 1PDOA 5TS2A 1P81A 3V42A 2AI1A 2NXJA 3MSXA 4BV2A 4CDNA 1JWLA 1AOXA 5LD2C 3F1KA 2ZSAA 4FMDF 3RTAA 2HA3A 4FI3C 4Z8YA 3R6DA 3W5DA 1E9FA 1YS7A 5JDIC 1JB9A 1FFWA 2YZ2A 2QI9C 3DTVB 1F51E 1UKYA 5BW4A 4KK4A 3RB8A 5U9CA 2IXBA 3ECCA 4GZ3A 4XFDA 4IEFB 5T6BA 3WMRA 4BQFA 1IXYA 1SOAA 4CFZA 1MUUA 1KVTA 2OCAA 1Y1TA 1PK9A 4RL6A 5JSHA 2R8RA 4I8XA 1M1YA 3BULA 1RWMA 3D4BA 4HDAA 1W8DA 2F9LA 4Y0AA 4B81A 2VPWA 1J9ZA 2A5LA 1UJBA 3DW3X 3CS3A 1EHIA 1QTRA 4K7JA 2J6BA 3VNSA 3KSZO 1W76A 3G0OA 4MV5A 4ZRMA 1WQ4A 3WOHA 1GG8A 3T0GA 1F1BA 4QHTA 4X64B 4AG6A 1CRLA 1NN5A 4R05A 4M86A 4WFJA 5KVSA 4RULA 3H13A 3IMKA 3UGKA 1T2CA 3A36A 3ZVRA 4G0WA 4M8NE 1KU0A 1OTYA 1PT5A 1Z7WA 2EL9A 4RZSA 3EBPA 1YTLA 5FBRB 3F9CA 5FL7A 1MC8A 3R6LA 3T7RA 3CHYA 2A14A 3O8LA 4ZIRB 5L6MB 1VE6A 3FF4A 3W78A 3IPAA 3MJTA 1U6IA 1ZVKA 2P2YA 2PKYX 1KGDA 4IHJF 5AKIA 3VKWA 5EMLA 2PGDA 1XWIA 3PEEA 5JJCA 1IXKA 4MUKA 5JD3A 2V97A 4MULA 1ZM2A 1WLYA 4JN6B 2OQRA 3T1TA 2JA1A 4M9ZA 1QGYA 3I2GA 3W6ZA 4IJVA 3X2EA 2Q07A 5CA1A 3O8RA 5IVHA 3A1WA 4P3PA 3R3HA 3M3HA 1T29A 1IUPA 2DH5A 3A3YA 3G2NA 1XXLA 1SWVA 1K5HA 2HPZA 2VCEA 4UTZA 5HNKA 1U8FO 1QP7A 3M70A 1PSZA 3ZE7A 5A4MS 4MWBA 4L4UA 2F1OA 2XITA 4FP9A 4KXVA 3URMA 4AX8A 5IX8A 1SM4A 1T10A 2VNSA 2W48A 2IZOA 2PZ8A 3FLAA 4FD3A 5ALFA 4DCOA 1PZNA 5SYMA 3T9AA 1P18A 2X1HA 1PV1A 2Y2UA 2O20A 2ZB3A 3RVJA 1YCFA 5FOWA 3LI2A 3PNPA 2ZZNA 1T2VA 1LS6A 4D92A 1FYFA 3K1ZA 5ITWA 4P81A 2G76A 2JKVA 4C21A 1DAKA 2K2WA 3DDHA 4I7EA 4A10A 3KTAA 4I6GA 3OPQA 4KNYA 4KLNA 3P9RA 3BIXA 4FT4A 2WVHA 4RAOA 4Y9TA 1SHUX 3GU3A 5DK4A 2PMEA 4PTYA 3OESA 3EHDA 1N6NA 1PGPA 3ESYA 3IVAA 3WP0A 4BECA 5DLEA 2NZ8A 1TYAE 2LIVA 2OPBA 4GPZA 2CLHB 1G63A 1H22A 4MKHA 4J91A 5FAXA 4XB2A 4RF5A 5B4UA 2ZANA 2X0EA 3ENVA 3HM2A 5IF3A 4QOFA 3ROFA 4R1QA 5ALEA 2XJ9A 3WS7A 1A27A 3N74A 1D2GA 2TMGA 4ZGBA 2OHVA 1EFVA 4BMSA 1G8JA 1LBQA 3JZFA 5B7GA 1C0LA 3IHTA 3SMVA 4DL9A 5IBCA 3DV9A 4AKGA 4QBHA 4ML3A 2GR9A 3D1JA 4WX2B 3KPJA 5JCJD 4LFBB 3AR4A 4GKAA 3BRSA 3L7KA 1CRPA 1ZW1A 3ABRB 3AL0C 2G80A 4O2BA 1R27A 4QG3A 4MW0A 3NKVA 3HP4A 1J1ZA 3W1VA 5JC8A 1QXSA 3DXZA 1CUHA 4UREA 4YRKA 3DEZA 2QRGA 4D6XA 3FA2A 4XDGA 4OUDB 5KCMA 1JG7A 2WUVA 5IJWA 4PLZA 1H6AA 2Q7OE 4ALJA 1GARA 4X45A 4Y2XA 1WSDA 1XXHA 3TNLA 3BQNB 3QLVA 1Z7EA 2NQ2C 3R3YA 1ZM4A 4KRGA 2CXNA 4OSOA 2FX3A 4RFSB 1UK6A 3RSGA 4CLEA 4Z53A 1N92A 5ELLA 3A1DA 5K0NA 3KYJB 3STHA 3V8MA 4DCCA 3IAM6 3KZCA 4ZFNA 1BE0A 5TQJA 3DEHA 4Q39A 4QODA 5E9QA 3EQ2A 5KUTA 4IS2A 4KDCA 2FE1A 4ZOBA 4RLSA 2ZT6A 4RMNA 2ZFUA 3C48A 1G20E 1RTTA 2P3SA 3ABOB 3IVXA 4NNPA 4H77A 2ECQA 1S4QA 3N5KA 3BZBA 1Q50A 4JLOA 5CX1B 4CGZA 2C20A 1LVHA 3KKKA 1V9CA 3OM9A 3CEHA 3B9QA 4DRZA 1P72A 1PJQA 2EQAA 4P4UA 1D07A 3C43A 3JVEA 3L06A 3P9PA 1K0UA 4H7HA 1AS2A 2WTXA 5F21A 1AUOA 1DZ3A 1VA4A 1QVWA 2B3TA 2LDBA 4P4SB 1F5NA 4E1AA 5LNK1 2X9QA 1YR2A 1KYYA 3UWOA 2OFWA 3TZ6A 3FDIA 2OGWA 1FX1A 2XT6A 4W63A 4DY4A 3Q3IA 4F96A 5JDCC 4M99A 5BMVB 1A50B 2W6QA 4TLCA 4NDZA 4B9EA 10MHA 2IOFK 3TNFA 2IDMA 3Q0EA 4EHJA 5DI3A 1SXJC 2BEUB 5HQ3A 1KDOA 4D3FA 4DG8A 2CJFA 3B52X 4ZYTA 3MYRA 5HM8A 1THMA 1Z8FA 5H16A 2VTKA 1PJ8A 2WZCA 3FWYA 2O57A 4LF8B 1X74A 2VAXA 3P19A 4B44A 3P52A 3LDGA 4L28A 3IIJA 1OV4A 3ZWAA 2RAPA 2JLWA 1FMFA 1PTJA 3TJRA 3A7DA 1DJNA 1NJ8A 4JS0A 5LQUA 3RC3A 3OFKA 1SBCA 5JATA 4ETIA 1LF0A 2BZSA 2V8OA 3CG4A 3GF4A 4G0MA 1N25A 3A1VA 3RGGA 3QXSA 3VR0A 1OZ0A 2IY7A 1HF3A 1TQ8A 2Z5VA 3I5UA 3P0RA 4AN4A 3BCUA 4E07A 1Q0LA 2G36A 3NEYA 2F1JA 4PBRA 4GZLA 2DHCA 2PLNA 5HF8A 1X94A 2R8YA 4IKOA 1LW7A 2ANBA 1TXGA 3OZFA 4LZOA 4HFNA 1HFWA 4XFKA 4B46A 2W42A 3SBXA 5LU9A 3WLIA 2C31A 2WYHA 3NFRA 2WT8A 3EVCA 2LIPA 2WMDA 3WNVA 4F71A 4RVUA 2QU8A 5C8YF 5ED4A 3R23A 4JUIA 3R9WA 1M2VB 1QVVA 3W9SA 1PFVA 5H9WA 1KS9A 3DOHA 3KT6A 3P2MA 2DBVO 3D4NA 4IXMA 3RW9A 1XL0A 4DMLA 4MR7B 1VLZA 2J07A 3GMSA 1LF5A 4PYNA 3AJRA 3AERA 1DWPA 3DLTA 4J16A 3GP8A 1YB5A 1CRWG 2WSYB 3DM5A 1ZVJA 4DJFC 5DI9A 1QGUB 4FOPA 3VMMA 1O95D 1SHZA 3C87A 4ZRNA 3OOSA 3VR4A 1H0HA 1YC5A 1JJVA 2GPYA 2DY1A 3NETA 1O96B 1CKEA 1P77A 1PRYA 4RH1A 3ZEIA 1HX7A 3UWMA 2C00A 2G0TA 2IUFA 2VF4X 1T3ZA 3LOPA 2IVZA 5AH0A 1K66A 2J3EA 3D6JA 4YCAA 4Z2YA 3U3JA 1YFKA 3GZNA 3WBBA 2FP4A 2KX7A 3EFBA 4MUAA 1YU9A 1KI7A 3M6IA 4NLLA 3UBTA 2WG2A 1ZL0A 2DMRA 2Q4RA 1CQZA 2F3UA 5F1OA 5KTKA 4QNNA 1RWNA 3KZ1E 3IDAA 4PLPA 2OWEA 5JE8A 5AK6A 1GGJA 3V33A 4X6UA 2YWHA 4TTVA 4AYWA 2QW8A 2RDMA 4W8GA 3RE1A 1Y3FE 1EMDA 1OILA 4QTYA 2H16A 2EC5A 1K27A 3WBJA 1GDTA 2HK6A 4A8PA 5BWOA 3QQ5A 1DO0A 4Y6LA 5EAIA 1JLLB 4ZD6A 1W5SA 5BR1A 2NO9A 3G9ZA 1R50A 4NZOA 3AM3A 5GZ6A 3ULKA 1U7WA 3ROQA 1QHFA 4M49A 4QXPA 4XX0B 2ZRJA 3VR5D 2C61A 2QN6A 5I9SA 5EJ4A 3UFBA 5E0OA 3VVMA 4EWLA 2ZUCA 4KEAA 1U90A 2G09A 2GWHA 2VNAA 1IC6A 1JQAA 1NI3A 2VP3A 2XIQA 1ESMA 3AZPA 3BIOA 3MWJA 4LDZA 4MNTA 2EJCA 2JL1A 3IUPA 1ONPA 5FPQA 1N0HA 2N1BA 4NPHA 2OBXA 1X7GA 4J6FA 4AYTA 3GW8A 4RGBA 2P4EA 1ZCFA 3G68A 4YXWD 1QBGA 2QLFA 4FFMA 5JFOA 5JS7A 5F4ZA 1U2EA 4IMJB 2C7OA 2B20A 5AW0A 5KTPA 2I4RA 2GFIA 2P4UA 4JC4A 4LDAA 2ZIZA 4D0LB 2GXQA 3RUDA 3UPDA 1QANA 1SKYB 2EKBA 2W58A 2WP8J 2YWFA 4RACA 4LDNA 3BS4A 4QX6A 2O4UX 3LUDA 4KKVA 2Q29A 1FSZA 2RH5A 3JQGA 3UK2A 4G85A 3D8NA 4GBGA 1AO3A 4JBGA 4KWCA 3KFLA 3VM6A 3BRQA 5LMZA 3QLVC 1NONA 2ASVA 2HTEA 2VKQA 1VG9B 4PNHA 5F5NA 5LYYA 4AW9A 5JAPA 5IRCD 2Z56A 1N2XA 3C5VA 3L0IB 4BLRA 1E9EA 1QZXA 2VF8A 3N8KA 2IX3A 2D13A 1TT5B 2NSJA 2CJYA 3ILXA 3F7NA 4BX3A 2BGTA 3JWIA 4RK0A 1DTSA 2GB4A 1MPXA 2JAOA 2WKPA 3Q5EA 1S8FA 3PIDA 4P7KA 4GKBA 1U7OA 4FCVA 5M3BA 1AHNA 3HDQA 4QGSA 2CUTA 1G6HA 2C9OA 3NIDB 4KO1S 5ALYA 3CRQA 7REQA 2IYOA 1WOYA 3O1LA 3CRRA 2IYSA 2REQA 1ZQ9A 2ACEA 2WWFA 3EXHB 3PQ8A 3ZWCA 4BLPA 4CCSA 2HADA 2AN5A 1Z0KA 1KEEA 2Y0EA 1Y5IA 1LTQA 5DBEX 4YX9A 3VKVA 3IIKA 5DNYB 2BPOA 4MO9A 1MGOA 2PFSA 3HCCA 2WFLB 3PXUA 3A9RA 4M9CA 4N5HX 1RYBA 1Q19A 5LL6P 3RJMA 2PCJA 1LSOA 2P9HA 2VSXA 1TD9A 2G4CA 3I6YA 3HG7A 5FJIA 4GI3A 5J23A 1GUAA 1QYXA 2YOGA 1W25A 3FR8A 3SF8A 4RCYA 2OVFA 1EB9A 2GILA 4ZVVA 1KJQA 1QBKC 5CFRA 1FP1D 1P2BA 5EESA 3NT5A 2J3KA 1H2YA 2IS1A 1T0PA 2QORA 4C0HA 4LK2A 2QTGA 1P1HA 1VL6A 2A9OA 4FSHA 4G5RA 1KMNA 1ZJ6A 3H1FA 3O92A 4GM4A 3RU9A 5JCOC 1TYEB 3K9NA 5C2JB 1XU4A 3MS4A 3G82C 2ZJZA 3HDHA 3KL2A 1KDVA 3KM0A 4HLQB 1PJBA 1QH8A 4PHFA 2GUWA 1JI3A 4Z6KA 5JQGA 4JBNA 3V9AA 4CL2A 3F6RA 1R16A 2XTAA 1WOMA 3WB1A 1V3UA 5CYGA 4G8DA 1GPAA 3R7FA 1KYZA 1MT3A 4I9HA 3FOCA 2EG9A 4D0SA 1H5QA 2VZLA 3TZLA 1QPBA 1TVMA 1Z13A 2GDJA 2YX1A 2R8PA 3EMBA 3F9RA 3KPUA 3I61A 3MD0A 4F4UA 5JXIA 6NULA 2QWXA 4EA8A 2EEZA 1KZ9A 2P4QA 2WC1A 4KSCA 3SHTA 1J0AA 2PKRA 4MGZR 1K4KA 1XD2B 2IE8A 2PJRA 3ICVA 1BMDA 3F98A 4C2AA 3QE0A 2ZPTX 5CLQA 3S8YA 2E4UA 2I3DA 5F9MA 3ZJ5A 5A9SA 4TLDA 1NQUA 1I0IA 3R4CA 5FR1A 3PEVA 2A67A 1KQFA 4JSRA 4YRGA 3WGJA 3OOWA 1KFEB 1JDZA 1VPLA 3DO8A 4RMIA 5FX2A 5K7SA 4DCJA 2GAIA 3OJLA 2YRXA 3FNEA 2GBLA 1E7RA 3N3AC 1PG5A 3ROPA 3L5KA 2VWHA 4GOKA 1MNAA 1SVSA 1Z7BA 2AUMA 2DJIA 3IOEA 4RA9B 5NLLA 5J4VA 1N7JA 2D2IA 3TTYA 1L7QA 3RU3A 2IYLD 4B3XA 1RXCA 3C3CA 2WKQA 3RK1A 1DKQA 2YHAA 4JYZA 5JI2E 4FI3F 5IBQA 1QX4A 2WUFA 2X86A 3BIWA 1JR2A 4ZO9A 3W8EA 4Q03A 2HREA 4E1VA 5IKMA 1G41A 4J7XA 3I09A 1E9VA 1XV5A 16PKA 2PZLA 2YS7A 3F8WA 2D54A 1Q6YA 2P5UA 3REGA 5I9MA 2B21A 2DHDA 2G7MC 3H83A 3MB8A 1REQB 5AUOB 1Q16A 3QG5A 2IOHA 3L7IA 1JHUA 2VDRB 1DKNA 3ICQB 1EFTA 3JQCA 2XQKA 5HVNA 2BHTA 3B8HA 4JASB 3WWYA 1CB7A 2XEXA 5CA0A 3T5BA 4DLXA 2YV4A 1W29A 1C2TA 3PF8A 1S9HA 5D5QA 2AFHB 4CRWB 5FLYA 2JZOA 1Q57A 5ILGA 1TUBA 4G5HA 2I4TA 2IPAB 5HKKD 1LI4A 4YCSA 5K05A 5K0GA 2GK3A 1KERA 4S1TA 3TL6A 4UNIA 2Z6VA 4JBLA 4OIFA 2Z8YM 1LRLA 4TMFA 3UICA 2D0DA 4Z0PA 1FNDA 1YGPA 1Q7CA 3O03A 2RHHA 4HK4A 2BFAA 4RPCA 4S2UA 2NPIA 2Q6OA 3KAKA 2E85A 4FMCF 4PIPA 5CR9A 5AUPB 1Q14A 1M3SA 1MHTA 2XOKA 2XTMA 4AS3A 1WRBA 2CVQA 2PAFA 4LV8B 2H4HA 1MVLA 1T8YA 3EZ7A 4RHTA 2QX9A 3DXXA 4QYTA 1CR6A 1GZ3A 3GHYA 3U4IA 3WA6A 5B36A 1VTKA 1Y8QB 2B9VA 3UYLA 1DQSA 5CIYA 3E7FA 1RJWA 3GC6A 1GILA 3KSAC 4DLPA 1FSGA 1MZVA 4DJDC 3RIMA 4JX8A 3QXXA 1W88B 2EGHA 4RFSA 4TOIA 2CZGA 4YB8A 3TPCA 5KPJA 3ZQKA 3PKZA 4JMPA 4GEGA 3IBYA 1QCCA 2XGGA 4ZAZA 1KC1A 3VVLA 1XDBA 4E15A 1H1DA 1DV1A 1E63A 2XKJE 2AMVA 4HL6A 4ZCSA 2WJZB 2N3ZA 2A94A 1V4NA 2ZAOA 4AKEA 1FYEA 1R64A 2LW7A 4EB6B 3GPLA 1D2HA 3LKBA 4DDMA 4F56A 1A4RA 1Y3HA 3HXOA 2JRCA 2YMQA 2M1XA 1Z2EA 4HNGA 3VJKA 1ZN2A 4I50B 4KGVA 3SZRA 4ARCA 2ODPA 4X8HA 5CX1A 3H11B 2AOUB 5T5QA 3IQDB 1XMPA 5J2TB 4D6YA 3ZW9A 2IV2X 4A5OA 4P92A 3K9FC 3KKEA 5IKEA 1FUKA 5FFFA 1NLMA 1DWOA 2B61A 1E3LA 1GT6A 2QRVB 4KIWA 3WK8A 3NDRA 2IUUA 1RRGA 2GK7A 3PE6A 1O5TA 2AF3C 5B55A 5B1EA 5IC5A 5LU8A 1P73A 1GPWB 1W0KD 1ETUA 1SD1A 4OQZA 4PNZA 4CIWA 1OKKA 1FTWA 2FLKA 2M6RA 2W6MA 3PWZA 4LMPA 1Z74A 1YQ9A 3RT9A 3S55A 3W7VA 5F2OA 4BQOA 2AN3A 1D6NA 5EIBD 5EUCA 1XRMA 5KWEA 4CETA 1X7YB 4UVGA 1JHXA 1O94D 2BEUA 1RBZA 4OP3A 3FGOA 1EAMA 3WB9A 3HGMA 1GPBA 2A1UA 3EW7A 1TZBA 1R4NA 1U3FA 2I99A 2Q6IA 1G1MA 1NMXA 2FEXA 2UUCB 3K6JA 2C04A 5DXJA 2AC2A 1RHQA 2B4AA 2J3QA 3B1KA 2C2GA 4ZT4A 1RRCA 4D25A 5DIFA 3PEWA 2J46A 1J8MF 2WIAA 3TMKA 1YT5A 3PVCA 2EW2A 4IVRA 3GG2A 5TARA 5DLQC 2M2IA 3HBJA 3I01A 5P8WA 2IYXA 2QL9A 2PRIA 1MORA 4ZHQA 5JMTA 2B1RA 2MT9A 1R1DA 4XD7D 1Z8NA 1VBMA 2CBXA 4OJTA 4YJ3F 2W6OA 1E96A 2JHGA 1PNTA 1BJKA 1W0JA 4QLOA 2P27A 1ADYA 3MBKA 2AN4A 2IHJA 3L7MA 3X1XA 4S1VA 2JFVA 5B7NA 1XD9A 3C6ZA 2QX4A 1BKYA 3ZHQA 1APBA 4GX5A 1XPRA 4GC9A 4ADSG 2AFRA 3RVRA 2ON6A 2VRCD 4MR7A 4PZ0A 3UHOA 4NTZA 4FYHA 1GSAA 2YS6A 3A32A 3R5SA 5TGZA 4PG8A 4G5SA 3WWCA 5K8CA 3WLHA 4I55F 4MP3A 4W9MC 1UMKA 4I4TF 1Q1QA 1E4VA 2ZWIA 3KFXA 4TTAA 4TX1A 4BVHA 3TAXA 4FT2A 4PWZA 1SZDA 3SHWA 1ZISA 3ABQB 1BVHA 4I1PA 1IOVA 4CI9A 3C5WP 3Q40A 1WCIA 4MB0A 4QEDA 3T9EA 4CR7A 7YASA 2OHJA 3JWGA 2NG1A 4TSRA 2NUAB 4CUZA 5J1SB 3SC2A 1NJ2A 3QKSB 5ARBA 3DLIA 4R2WA 1SQ6A 1Y63A 1E3MA 1UBHS 4BCCA 5AVXA 4DUYB 3CB4A 1IHYA 2P7HA 3DS8A 4ND4A 4RIIA 2YZGA 2LCQA 3VPHA 1WW2A 2CN1A 4G1BA 1YCDA 2VQ3A 2Q2WA 4ZAYA 1T5SA 1P60A 2HMYB 4GC5A 2ZRCA 2ZYIA 1IQPA 1JB1A 5KCZA 4EH1A 3TH5A 2YZMA 3NUGA 1KE2A 3TD2A 4DV1B 2FN8A 4QU5A 3ND6A 1ZJ5A 2KB0A 4HUJA 4X20B 4CEJB 4X7RA 4E94A 3QOWA 1QP4A 2HCJB 3HWRA 3RUEA 4OB7A 1KEZA 4HRXA 3L1UA 1NVKA 4HPXB 5T4EA 3TN7A 2V7VA 3AF1A 1U6KA 2WVAA 3KHSA 1UOOA 2O1SA 3UC5A 3UJHA 3VDNB 4ZOQI 5K3BA 1MJFA 3VI4B 2PNFA 2RHRA 3OCZA 3GEPA 5K3SA 4V1CI 1V3TA 1MAUA 2YFQA 1YB2A 3HR8A 3O47A 4CHTA 1WPXA 4UE2A 6GPBA 2Q5IA 4MRMA 1V8OA 1AQNA 4DNPA 5JFTA 1NAHA 3NBKA 3DKKA 4MUJA 4OLJA 1OB5A 3KEMA 3BWYA 1MAAA 2OV2A 1IXRC 1JEJA 2HBYA 2QQ5A 1ECBA 2F1KA 3BOSA 3GRKA 4ZVQA 1J8QA 2EZ9A 5AW8A 1IH8A 1Z4LA 2YXEA 5KEIA 1SRQA 2Q3EA 3QVKA 3TSZA 2RD2A 4QOSA 4AMVA 2B2XA 4BNZA 5GWXA 1NVMB 4RVOA 1BSVA 5EZ6B 3N87A 2ESRA 3G0BA 2B3DA 1VB5A 2QX8A 3O8BA 4LXQA 3VOTA 4C3ZA 3K2QA 5CA1F 3FTFA 1UEXC 1EVKA 3LZDA 5AJVB 1SBNE 3OA2A 5ENDA 3DMPA 3RARA 3R7LA 4BVBA 4EY4A 5KREA 3EXFB 1ULBA 3FVWA 4PZEA 3ST7A 1UR5A 4NU5A 2IHYA 3QVMA 5BRJA 3AUFA 1V3VA 3IAM1 4UVDA 4YFVA 4BTVA 2PUTA 4RTSA 3P2OA 2HQBA 1IXZA 5HF6A 1Z38A 1XROA 2VJLA 3KHUA 4EG7A 4MH0R 2H9YA 3G23A 3NDBB 5P21A 2R4QA 4QICA 4EHLA 2CNOA 3PNLA 2P6UA 2ZIGA 1GSOA 1FP4A 4NS4A 4RD3A 1E8MA 4L7QA 3GVIA 2RCYA 1P2TA 4B7UA 2YIJA 4BYGA 4Y2HA 5JRDS 2UUBB 3ETLA 3GDFA 3WKDA 1ZU5A 3HCDA 3K0AA 5TIIA 1YS9A 2AZDA 2YJ6A 4UJ5A 3KOUA 1U7XA 1GL6A 2BEJA 3HCAA 2ZBDA 2OK7A 1XTBA 3NHPA 2AJTA 4AO8A 4A4DA 3IP3A 4AJ4A 4D42A 2ET6A 3ERCA 1C9DB 1DAPA 4GPTA 4ZC8A 2CDRA 5EVJA 2ZE8A 4CL8A 1OBHA 2Q3JA 3K0FA 1B15A 5K8UA 3GRZA 4KU4A 3RRJA 2A9VA 1NQAO 2DFDA 3ZBQA 3AVWA 5KWVA 2FFQA 1NMQA 3HVRA 4JJIA 5A02A 1A9ZA 1OAOA 3OJOA 1T4MA 1Z29A 3RRMA 3ZU2A 2P41A 4P58A 3CPSA 4YO8A 3JQFA 1LPOA 1ORVA 1V1RA 3GDOA 4IW3B 5J40A 3GJ0A 5KHLB 1ESNA 1R8YA 5WRFA 4EJFA 3BRWA 1DELA 4O2BF 4KLRA 3HUEA 4Q3AA 4J9VA 5DN6D 5LMNB 1DJMA 3O8QA 3W4KA 4HDQB 4OHCA 4XVQA 1FDOA 2QD3A 4MK4A 2XNKA 1YVUA 4TL6A 4BO0A 3CRMA 3L8FA 4X8OA 4XCVA 3PP8A 3WX0A 3RJZA 3UK6A 2V0NA 3HB9A 4KOAA 1DXOA 4YCLA 1K1EA 1QB7A 2Y71A 4XW2A 1FUYB 3UTDA 3FIJA 3A7EA 5LZ8A 3S2ZA 4XIIA 5JNRA 2GXAA 1E6UA 4GOND 4Q7QA 2AD5A 1SC1A 8ATCA 1T9KA 5IUNC 5CUQA 4FN5A 1ST3A 2CFRA 1VBKA 3JXEA 4YJFB 5K0TA 4Q01A 2J0VA 4JC5A 3EYWA 4O1IA 1XRQA 3IT0A 2ZSEA 1AKNA 1H3FA 1R5JA 4PGMA 1S01A 2OESA 4KNVA 4EMUA 4FX5A 3WADA 1Y7PA 1SQSA 4DREA 2NXNA 2WTMA 4MUFA 1MR3F 1X7HA 2QN9A 1HC7A 8ADHA 4NS1A 5G1PA 4UPDA 3ILHA 3RFVA 4Y2PA 1TM5E 4P31A 2E5WA 4BB6A 2RC6A 3TLMA 1IG3A 2NZVG 3WGHA 5I47A 3LP8A 4JLVA 1GUDA 2FOLA 3AJAA 3TOCA 5CVJA 4NBNA 2VDJA 4XRGA 3PG5A 4K9NA 3OI7A 1O97C 4L08A 1DCFA 1H1TA 1EVEA 2W98A 1LTHR 3VBEA 1M6NA 4M55A 4J1TC 1WR8A 3LY5A 4L50A 2CF6A 4RA9A 3RRNA 3WGLA 4J1SA 5IULC 1ODLA 1KO1A 1M6YA 1MQ9A 4FE4A 3RIXA 1Y6ZA 2C5LA 1SU6A 3TRIA 2C3YA 3U3MA 4EABA 2C9BA 2FX5A 3PL1A 3H8WA 4NWIA 4QPNA 3V2UA 1N5OX 1XDWA 4QGBA 4TRNA 4Y1RB 4B79A 1YONA 1EHYA 4CF6A 2BR3A 5KVVA 2QRKA 4X8LA 2HN9A 3LOUA 2V7BA 4YT8A 1E1CA 3TW8B 3IEUA 4GQBA 5DGDA 2C7PA 1UWLA 3HVHA 2B1IA 3S29A 1QTNA 1ID1A 2F6RA 3W90A 4BUCA 2GH1A 2EP7A 2O5CA 5IDYA 2VJYA 2O3RA 1GFZA 2WTBA 3QPDA 2HA4A 2XYGA 1H94A 2JK0A 3ZTYA 4CIDA 3KJEA 3TGLA 2UYHA 5EZYB 1TM7E 4E2YA 2Q46A 4EA9A 3KKNA 3ILVA 4G0QA 3KZVA 4OXYA 4G0ZA 1B1CA 3FGZA 4DGSA 2BC9A 4E2XA 1JQ3A 3G8AA 1E0SA 3OIDA 3IA7A 5FWDA 2FG7C 5BN1A 3DNMA 3IUYA 1H3EA 3L92A 1DIHA 4FGWA 1TFRA 3A9TA 3AGQA 4JJ4A 2OXTA 2LVBA 3W9BA 1M5UA 3NTXA 4BDSA 3EVBA 3CZ5A 1HE5A 2A9RA 3VPGA 4AS2A 3DYBA 2I4LA 3JVDA 4E5UA 5G40A 3WGGA 3B6JA 4WLVA 1UXGA 4WNCA 1NVUQ 3L18A 3W5VA 1CXZA 2IYVA 3HR7A 4IOLA 3BTOA 5C8XA 4OB6A 2VYNA 3HVUA 1Y8QA 2OAP1 5BSRA 3EEBA 4PV7A 2DFNA 3EGDB 2X5NA 3R24A 3GJTA 4LBWA 4KQ1A 4FYWA 1J9EA 5KAMA 3WQQA 1W88A 3P9QA 5FBZA 2OZEA 4O4HF 5IABA 1U3WA 2Q2NA 3R6TA 3RAGA 2QEQA 3ME5A 4FGKA 4R2LA 5B7QA 4MVJE 4O4LA 5BNWA 3BL8A 1UZAA 2C5GA 3CF4G 1AXGA 4GBED 3UMFA 4CL3A 3CYFA 3O0TA 4YMGA 3ZDBA 1IWOA 2GLXA 3EG5A 4EB6A 2YXDA 4IFBA 5LA6A 3SLKA 5AVUA 1M2OB 1E1RD 1EDDA 3L93A 3EQZA 1E5VA 4J7CA 3PQEA 4LNUB 3N2YA 4FCCA 4XE5A 3TF5A 3H11A 2B5OA 2GKOA 4LCEA 9LDTA 5J2TA 4FWIB 2ZQ5A 1OXKB 1EDBA 2V3CC 4N03A 4F3TA 2J9FB 2PD4A 2ZUWA 3VR4H 3EXHC 2QRVA 3EF0A 1UQUA 1YE5A 4BX0A 3TIXB 3NGLA 1QUFA 1M2WA 1WPRA 3ZE1B 1QFMA 1XT6A 2OCYC 2EZ8A 3SX2A 5KC9A 3BSSA 4JJZA 3FPCA 1U0OC 1WUHS 1XKQA 2PK3A 1RZ3A 4N9QA 4EYEA 1DVRA 2X5JO 1WABA 4U00A 3H1TA 4NABA 3OJXA 3W6UA 3AFNA 3RDPA 3VSEA 1JIXA 1AD2A 3BK7A 3N59A 3TLEA 5EINA 1UUFA 5JFGA 4YHHB 1OLSA 1HE2A 4ERXA 5DT9A 3UW1A 1QIGA 2H29A 4P5EA 1C1DB 3FKQA 1PWHA 3FOBA 4FFDA 4L8VA 4RF3A 2VPYA 1HTBA 1GOTA 4M9QA 3FVQA 3C6MA 2VXYA 5BRNA 4IGAA 3H1EA 3O9ZA 4JBHA 5JASA 4M0UA 5LYJF 1P9NA 1ZICA 5IHPA 4WBNB 3DBLB 3IT3A 2QRPA 1X7ZB 2JIOA 3WNZA 3H1BA 1BN6A 4NJEB 3ZNQA 4NYJQ 4CLXA 4LJ4A 1RQGA 4EDFA 4UCXA 5BWMA 3VVBA 1FQJA 1QOZA 4L2IB 2ZUFA 3NALA 3JQ7B 2V6FA 3BF8A 1LC3A 4ZJYA 1SHKA 2F4NA 5CP8A 1G2OA 1JXMA 2O1EA 1J1IA 1WSWA 3Q5DA 4FUQA 3IEPA 1NP7A 3NIFB 5AXCA 2Z0MA 4ALIA 2ENUA 4N5NA 1U8TA 2NOAA 2P3QA 3OZUA 1BDBA 3PUYA 3H5RA 4CFYA 5I7VA 2AD1A 3GFSA 4CODB 1MGPA 3ICCA 4FFOA 3FVTA 4NCIA 4QXOA 4RV9A 3RTDA 3ZKWB 2JLVA 3G89A 3KOWA 3WZMA 2VZEA 3QBEA 5DYGA 2R6GA 1IU9A 2BM1A 1A8IA 2CFIA 1TZ2A 1RE0A 4QOHA 5EWMB 1DUVG 2WHQA 1WX1A 5EI5A 1C1XB 2YZ7A 3CR7A 1P7WA 1ITZA 1ZLYA 4RTNA 2QM7A 3HDVA 3EXAA 3OJWA 4H1VA 1ZEMA 3DZIA 4LZNA 3D6MA 4DZZA 2IOYA 4LC0A 3OU2A 4NMHA 1L1EA 4ZGGA 3FWHA 1YFZA 2YYYA 3ESCA 1T24A 1XLTC 3CRW1 2HMVA 4MUIA 2C84A 3FDFA 4OY3A 5CBKA 1TMYA 3MT9A 3VR6H 1XTZA 2HT6A 4A8JB 4JUDX 5C3UA 2A33A 1XL1A 4R9VA 2ZXFA 2AE2A 1CZUA 3CZ4A 3B3FA 5DN9A 2REOA 5MHTA 1EJ2A 3AU8A 4Y2QA 2X41A 2F43A 4JCOA 3KSDO 1GAJA 4Q66C 4ZEWA 2OCLA 3CLSC 3R0VA 4FS8A 4MAFA 4YJGA 3MWDB 1ZMTA 5TT1A 5LDHA 5LMUB 1VKNA 1U5BA 4DOMA 2CZQA 2IFTA 1PU2A 3W4JA 4FC7A 1D4ZA 4S1NA 2JI4A 3R7BA 4W8HA 1GZSA 3W5JA 2AHRA 1F14A 1JHQA 1OLUB 1OOEA 1AKYA 1USKA 3OH8A 3R4VA 4HQ6A 1L4MA 1S8NA 4KFCA 1E7YA 1VSTA 3KOZA 3C74A 4DA6A 2I67A 2R1VA 1D9ZA 1G8KA 4CN9A 3DXYA 3TLGA 2A9KA 1IOZA 3VH2A 3BMXA 5LR6A 1X1RA 4FEEA 3K72B 3DH0A 4HZUA 3ELUA 1CJUC 4XXHA 4A0QA 2E1RA 1K7FB 1KTVA 2PT7A 2QD4A 3C1OA 4E5KA 5JAUA 1QHHB 1I3KA 1JAHA 2GFHA 1M0EA 4GS5A 1T1SA 1EYZA 4GO1A 4WY8A 3VZSA 5LIRA 4L8GA 1YHYA 1N9KA 2R7AA 2IHZA 3HN7A 4BXOB 1EPUA 3G2MA 4ILKA 3G88A 4JB3A 2EHJA 1S3FA 2H0AA 1FYVA 4JZYA 4NJMB 2BFWA 1ZEJA 1WVIA 5TPWB 3B20A 1LJ8A 1N2CE 2FETA 1VFPA 1QO0D 3TG2A 5BVHA 3WRYA 5TGTA 2O54A 3UB3A 3HUTA 4F2GA 1UZUA 1DFHA 3PGVA 4HGNA 1TVCA 4CKYA 4KFSA 1T9HA 3CGWA 2EBHX 4HH3C 4KX5A 4FYXA 3I6IA 3IRUA 2ZTMA 3GO4A 3AX6A 2BGUA 1MD9A 4ZT5A 1YJCA 3MTDA 2RONA 1GNSA 5KTTA 4HNAB 4K9DA 1E3SA 5MGNA 3K71B 2CGEA 2JCYA 2JI9A 2RGWA 5GQSA 2A9QA 2ICAA 3GJQA 4LMAA 4DUGA 5CB6A 4KXWA 4TXMA 3MUNA 2VDLB 4IWNA 1RQ2A 2QM0A 2Z98A 1Z6PA 4TGLA 1HDIA 1Z36A 1WTCA 3GRVA 1AK1A 4MS1A 2F3TA 2XWPA 3ND9A 2A8YA 2VNJA 4B3JA 1SOMA 721PA 2NYAA 2P75A 2P91A 1P9WA 2XKAA 2ATIA 3HCBA 1XZIA 2RK4A 3IUMA 3JZIA 4JAVC 1TA9A 4JWTA 3NAGA 4MMZB 5F3RA 3GGCA 3V8BA 5EL0A 3H5VA 3AB7A 3L02A 1K6XA 5JPCA 3TI9A 3GLKA 4W5TA 5ELXA 3P4XA 1DXYA 1P9OA 2C2HA 3ZH9B 3QE4A 4FB4A 2CF5A 5CA0F 3M5CA 4IO0A 1IY2A 4K6FA 1JH8A 2ZRHA 4EUFA 1ZMRA 5AW5A 1S0UA 5JPIA 3G2QA 5FV4A 3CEAA 5COAA 4CE6A 3KWFA 1JA1A 1UQRA 1W47A 3RBZA 1XHEA 4RE5A 5E4FA 3VBCA 2ECPA 2GN8A 4RK1A 1G3UA 4ZANA 4AIRA 4AUKA 4C2UA 5EEHA 2W2KA 2WWHA 1DAIA 1IUOA 2CNKA 4MV9A 5J5VA 4NL4H 4Q48A 1L4GA 2PIAA 3UQYS 2JH3A 3ORYA 4YRAA 3NEPX 2BJWA 1RQPA 1T6NA 1RYHA 2QGZA 1YZHA 1VI5A 4NE7A 4KPFC 4RIFA 2J5KA 4F7WA 2QRZA 2IXGA 3LXUX 4DMUB 4C6TA 3ZWQA 2VEDA 4G5QA 3TXYA 1SC4A 5DX0A 3U3ZA 2RGNC 1NP3A 2MWMA 3ZXYA 5LZ4A 3KUCA 4WK6A 1YFLA 1YJXA 4UBIA 5AXDA 3GA7A 1YMVA 1GL7A 1NXSA 3GRYA 2XV1A 1WU8A 1L7AA 2CL5A 3G5MA 4BL5A 4HWPA 2XZLA 3HYLA 2QUIA 2CLFB 4YJFA 4KQFA 5CH8A 1GLNA 2UAGA 1NJFA 2GEJA 2RGGA 4G56A 1QU2A 1TF5A 1TDJA 3EARA 1FQWA 4MW2A 4Y67A 1Q21A 1ECPA 1MVNA 1WHTB 2GQ0A 3RUPA 3DFUA 2R11A 2NVBA 3HN6A 2P6OA 3IOMA 3LO5A 3QWIA 4TTJA 3T94A 1E4YA 4E5PA 2ONJA 2O3JA 5CT4A 3HKDA 5PGMA 4DEXA 4JELA 1IATA 2V7UA 1JR3A 4M0LA 4FZVA 5E8JA 2UVQA 1N2JA 2W0SA 3KG2A 4WTOA 5D7NA 1N34B 1WKCA 4UNSA 5A3SA 4F45A 3QX8A 1FU4A 2OM6A 2OCPA 3VNQA 1LI5A 3STXA 3UUEA 3FGPA 5CU7A 1EVJA 2XCOA 4HDRA 5JECA 1X1CA 4MUBA 2WWIA 5ALZA 3K1TA 1LPBB 3SSOA 2MSLA 3F5FA 3I3SR 4KZKA 4Q5IA 5ALTA 3TCNA 2AQHA 4TWBA 2AIRA 1RP1A 4H9GA 1R9MA 2WR8A 3DKIA 5BMVF 3GJRA 3PF9A 2ZBUA 3AB3A 3GEMA 4RMHA 3BG5A 3ZWOA 1P2DA 2CD9A 1SBIA 3HK2A 4F04A 1WB4A 1KVUA 4F5EA 4Z54A 3VPDA 4AY5A 1E66A 1SULA 4HDCA 3EQ9A 3MWGA 3OMWA 3T5TA 1GU1A 4HLDA 4IDPA 1OFUA 2FR0A 1S2DA 3RTGA 1OWLA 1QUEA 2HXGA 2IOFA 1G21B 2VJKA 3VUEA 2JLYA 2O3UA 1AQJA 1JPNA 1TF2A 3M5PA 5E6UA 3RK0A 2AJ8A 4DV4B 2IRWA 2EKLA 1CR2A 2G9RA 1WXIA 1E1KA 3UJDA 4DLAA 5EZYA 4DNOA 2TS1A 1DC3A 3EWNA 5AKXA 3P9CA 1N75A 3A6DA 3ZE2B 4F3KA 3UPTA 2VP5A 3MT8A 2H7CA 4J0QA 1XPOA 1EDOA 4MUGA 5CXUA 2HXSA 1JLRA 2O5EA 1GG5A 2O5VA 5JVDB 4UHEA 3R5JA 3VGJA 5BOSB 4DV6B 2BDTA 1E79A 1AHIA 2A3NA 2VSNA 1HNXB 3WK5A 1O2DA 3DOJA 3HBLA 3P0JA 1WNTA 1RZVA 2Y4OA 4QPZA 4H15A 4GR4A 5CURA 2YZNA 3AFHA 1Q6ZA 5F7JA 3WK9A 2V9ZA 3PEUA 4TT8A 3L49A 4HGQA 2CFTA 3LH5A 2FFHA 1NFQA 3SMQA 4EW3A 3IKTA 1T6YA 3BE5A 3EGDA 3C7CB 5DHRA 1VHQA 2VUHB 4XSHA 5A71A 1GYQA 2A78A 5AKJA 5LQRA 3AL2A 4GFDA 5JHHB 4IV8A 2CC2A 4IDGA 1UK9A 3EZ2A 4DGQA 1HEIA 1TJNA 1TYBE 4WECA 5DWDA 2D2EA 3TZEA 2V1XA 1GAEO 2LNDA 2GSWA 4N4AA 3TO5A 1H5NA 2DHEA 1UBCA 1Y5LA 2WI8A 4MWEA 4CIAA 3K35A 5LB2A 1LQ2A 1LWNA 2EWMA 3SEFA 4J76A 4D45A 1P5JA 4PAOA 1DV2A 2VYFA 2FUNB 3FB1A 4DLSA 1M2OA 4Z4GA 1WAMA 4LW8A 4IJUA 2R68A 4I5GA 3B85A 5D3QA 2PQ2A 2XWBF 3FB4A 3I9V6 3MLEA 1AGRA 4YAWA 4D82A 1LPAB 4QTTB 4C43A 1MCZA 3SY8A 4CQMA 2J9FA 1M72A 2YNMD 5AJTA 3THWB 2XJ4A 4RY8A 1BH6A 1BYIA 1ZG3A 2EKQA 3HZOA 4L6CA 4LKRA 3V4FA 3PV0A 4IIDA 1DBQA 5DGHA 1FNBA 3UFXB 2QTVA 1ISGA 5CHYA 1PSDA 3S70A 2A7XA 3VR6D 1NUUA 1E9SA 3ZTTA 4DCMA 2K5UA 1II8B 2PN1A 3I9JA 1JDJA 3C41J 3CNLA 2YWGA 2AYZA 4ZU1X 3JVIA 1JFTA 3TRJA 1Y4AE 2H7VA 1C1DA 2LWIA 4DCNA 4UDYX 1E2LA 4GLLA 3D31A 3DQPA 1ZW6A 6Q21A 1Z4QA 2QDXA 4KXXA 2C1EA 3LG2A 4EKIA 5DTMA 5JADA 5AM3A 5A5GA 1CUIA 1M7GA 3DBLA 3A11A 4CJXA 1X7ZA 3K4PA 4EF4A 3C6XA 3B9BA 4MQ4A 4Z4CA 1E3IA 2B4RO 3QNUA 4LOLA 4LXGA 4CNBA 2AW3A 4GOLD 1VSQA 2FSSA 4X93A 5B2ZA 3ZD9A 4WLOA 4LWQA 3AY7A 3UKDA 2HL6A 4AJHA 1KQ3A 2BP7B 2IY9A 821PA 1D6SA 2J3HA 3OF3A 3VO9A 2FW0A 1YAJA 2AI3A 3AR2A 4W8OA 4YK7A 1M33A 1X1EA 2FCRA 2ILTA 3OOJA 4TZKA 3TAUA 4DIEA 5K3EA 3S81A 3SYTA 3S2IA 1ZOOA 1QCYA 3EC7A 5HJ2A 4J2HA 1DTWA 2B4KA 2J87A 1UBLS 1XWFA 1X2BA 3HA3A 3QOXA 1DPGA 4MW5A 4LXIA 4RNCA 3ABSB 3A0RB 3EG9B 4P0QB 2GCNA 3HNOA 1DRVA 3A9WA 4UEKA 4Z9YA 4YV0A 3HP1A 4DXDA 5TMBA 1JHOA 1NJ1A 4U9IS 1JX6A 5CLJA 4JDUA 1HUQA 2G1UA 4ISBA 4C0WA 5L51A 3LPMA 1SB8A 1JLSA 1QQ6A 3DT9A 3HJTA 4XWGA 5EMHA 1PR3A 2VTEA 3JTMA 3D6NB 4KGXA 1Q3KA 1FXSA 3Q1LA 9LDBA 3S2SA 1UDWA 1NJGA 5DLPA 3KQHA 4BPBA 3ZQ4A 4J2TA 3U5TA 1SVOA 1XSEA 3QEMA 3MGBA 1PNRA 3Q5GA 4NZPA 5CCEA 4PAWA 3VU8A 1PZEA 1N1DA 4CF7A 4BKUA 2JVIA 1YL5A 2ZK7A 3HJNA 2HNBA 3T9BA 1BVYF 2FR8A 1WUKS 2JIMA 3K6KA 1RMTA 2KS6A 1SCUA 2DEUA 1FVHA 3FI9A 1YKGA 4QLAA 4L02A 3GLIB 4TN1A 2CBGA 4ZP1A 3FPLA 2MR6A 5CT8A 1SG9A 2FZGA 4PO8A 1K06A 3EAFA 3QKIA 4WBNA 2FW1A 4HB2A 4CKBB 4Q12A 1C1HA 1XAGA 2R5FA 3AHFA 4CMJA 3SZOA 4CM3A 1NE7A 5KOHA 1B74A 1E4EB 1FXWA 3KB2A 4G37A 4Y1EA 5CFMA 4GKKB 4MKXA 3LLUA 3INRA 4MR8B 1KQOA 3DZGA 2D1YA 5SY9A 5EFZA 3RTBA 2H3HA 2R86A 3Q10A 2WZBA 1L5YA 2WW8A 2GCPA 2HHHB 1V1MA 3IPXA 3SXPA 3P71T 2H52A 4YUZA 2V65A 2C2ZA 5AK3A 3EGWA 1XQYA 4R51A 2XEDA 4WKNA 3GQBB 1CZKA 3W8NA 1PBNA 3TCXB 4PAQA 4EPVA 1UWKA 4CDMA 2C98A 3P9YA 4JP3A 2Q3CA 1OASA 2WPDA 4DDKA 4Z9BA 2EERA 3FI0A 2H5EA 4C0QC 5JJBA 5AOCA 2NSYA 3W6NA 4AYXA 1OC2A 4JQSA 4H16A 5CDYA 1A1SA 2DOKA 1XEXA 2WYVA 1H2XA 3GRPA 3QEKA 4H35A 3RRYA 4TRJA 1E9RA 2GAAA 2ZDGA 4RDIA 2W0MA 5LJLA 5TPWA 4YJ2B 3S40A 5HHTA 1V26A 1GKUB 4HDNA 3SHVA 3WYCA 3U61B 3LC2O 5KNCH 3L6RA 2P1ZA 3N7AA 1CNEA 1XMOB 1DADA 4MJXA 4K8OA 3DV2A 5EXTA 1KK2A 3RODA 3QY0A 3U17A 3NHYA 5DH9A 4L73A 1TRHA 2YUTA 1J24A 1H0KA 1D3AA 1RI4A 3CLTC 4MRRA 2DWPA 3NEJA 5JSFA 3A1FA 2XNSA 4HNAA 3FSGD 1T5HX 3SFTA 3HBAA 1V7QA 3H9UA 4J4BA 1J8VA 2VTDA 4OLHA 3CUVA 5KSZA 3ICWA 3ZHUA 4BJ5A 2YFYA 2CLDX 1WQ1R 1IPHA 3H4IA 2ZB7A 5KYGA 1KSJA 2HDHA 4CG0A 1CIPA 3W34A 3KVOA 1N78A 3GCDA 3BXFA 1V39A 2V4MA 4Q3NA 1IZ8A 1FOEB 5EP2A 1T9GS 5BV7A 3RU7A 2O2JA 3J7TA 3JV7A 4G2TA 4C06A 3BL6A 3RFTA 3MPOA 1YO6A 2I76A 3DQQA 2C7GA 2PYIA 5EP1A 5HR5A 4AKIA 2F3SA 4FLEA 2IEGA 1X80B 1JSLA 3RG8A 1U1DA 3H9GA 4BZPA 2R66A 1VRWA 2CB0A 2XQVA 1H4SA 4MARA 5FFMA 2XMRA 4ARAA 1P2GA 5E3HA 2NSLA 5JCZA 4RZQA 1ZR2A 2ZYVX 4NQRA 4CUKA 5CPBA 2CV1A 3T5MA 1I2AA 3KVVA 2X9VA 1AU9A 4KH0A 4Z7NB 4N1AA 4M1YA 1JH9A 1NMYA 1RTKA 3UF0A 3DLHA 2HOQA 2FKAA 4CMHA 3A6ZA 3EX7C 1IOWA 4NBVA 1G7TA 4MEBA 4I3GA 4IPTA 5AI4A 3FJOA 4GSYA 3E82A 4M1TA 1XK7A 3C8HA 4P4LA 4UDNA 3KOYA 4D4LA 1RM0A 5LLDA 4F38A 2HD4A 3FMGA 4WUVA 4WCVA 2H1RA 1SJ9A 2Q6TA 4ARZB 3HRHA 4WESA 1I3NA 3QBJA 3R5FA 3LDAA 1UP6A 1X1SA 4ZDWA 3V8QA 5EWLB 4DSAA 3JQBC 4C4AA 4DMKA 3UAOA 4BKQA 2JA2A 2ZS8A 3QXJA 1Z5VA 4UPVA 4XCQA 5B5SA 3B5EA 1WMAA 1RWPA 3O8OB 1M2KA 1N2IA 2Z3ZA 1YBMA 4HNSA 1WMEA 3OG9A 2EX1A 1TA4A 1UBGA 5DOVA 3WTBA 2PA0A 4DWOA 3U3KA 4ENUA 2P40A 1RJFA 3CUSA 3U39A 5A03A 4IHAA 3AVVA 2RG7A 3RVQA 4LA4A 3CM0A 3C24A 2JASA 1XVUA 1Z62A 4HGOA 3SI7A 3UHJA 4P1ZA 1FTGA 1WHTA 1T1EA 3ZHXA 2HWWA 3N9IA 1NVVQ 1F2DA 2RHLA 1BOFA 4I50F 2QBYA 4DY6A 2HWUA 2HDNB 4H4DA 1QKKA 4KR7A 2QSUA 3HEMA 4B3GA 1GGVA 4BVFA 5J2TF 3ZHZA 5C8VA 3K6SB 1QQAA 1OE0A 3RS2A 3ET5A 4NOLA 4V0SA 1C3OB 3L9WA 4HLNA 1L6RA 3LX6A 3T06B 3T41A 1NN3A 1FDWA 5EJAA 2PA3A 5AI9A 4MHOA 4PG7A 2KMLA 3IJPA 1OXMA 2ZW9A 4CTKA 1P4GA 4NVRA 2QYTA 1C4WA 2ZETA 1TUIA 4Z5XA 1A72A 3K9LA 2CXHA 2EATA 4XIJA 4A8JC 1X7WB 3HXQA 3PPWA 4PYOA 3L01A 4JKIA 2XRFA 4BYMA 2R84A 4JJ8A 3BJIC 4H7FA 3QNMA 3Q85A 4ZI5A 3SE0A 2C2BA 2H8KA 3HNRA 1JMVA 2J7KA 4TS3A 1TIBA 4OQNA 4PZPA 4LGYA 4DC0A 2NW6A 5A62A 1NLFA 2ODQA 2QR3A 1YJ5A 3FWPA 3D7SA 4FNMA 5EE3A 5B2FA 4Q6WA 1GR1A 3GLHA 3OZRA 4GI1A 4AJIA 1ONNA 1PUIA 1VIVA 2Q5OA 3LM8A 1SFRA 2BF7A 4HYEA 3N8HA 2ZYUX 3IAEA 3O4JA 4KPUB 1V8ZA 2UVPA 2BGLA 3IEKA 2H2WA 1TYZA 4FTWA 4DJAA 2XGJA 3H2SA 4C7JA 3HBMA 5F2KA 1IAQA 1XRSB 4L8LA 5CCXA 3F2VA 4ES6A 2WD8A 2EFDB 3O73A 2NX2A 3LT5A 4MIYA 4YMHA 3P2EA 2BZGA 4JENA 1JFVA 1E6KA 1PS8A 3CG0A 3ZDYB 2A5GA 2QT9A 1I7LA 3QVOA 1H6BA 2X58A 5JVDA 4TYNA 1QS0B 2RIRA 2Q5FA 4A1FA 1RKVA 2RHOA 3CW8X 1DKPA 3HMQA 2JAWA 1U1CA 1V11B 2O1WA 5A05A 1MH9A 2NYUA 2EEPA 2I7CA 2BKLA 1BKDR 1BRMA 2VAMA 4QOEA 3RAEC 4MCAA 4MYUA 2Z4SA 1HT0A 2M6SA 4PF1A 3QE2A 4DSOA 4ZI3A 3DNFA 1E32A 3H9CA 4S04A 2ZQZA 1HOTA 1N3YA 2IHKA 4JZKA 2G6BA 4DE5A 5FWNA 3ZVMA 3WMXA 1I9GA 1ZYUA 5C4GB 1GTG1 2EFHB 1K8QA 3KQMA 3U7FB 2DERA 3N0XA 3P9KA 1K8RA 2X6RA 1GZDA 1U7PA 3MMXA 4I8DA 4OFBA 4Q05A 4RC9A 5JALA 3H7AA