3AILA

Crystal structure of a hsl-like carboxylesterase from sulfolobus tokodaii complexed with paraoxon
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
molecule keywords 303aa long hypothetical esterase
total genus 101
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ailA00
1YSCA 1BEEA 1YAHA 3KDAA 4BE4A 4DMKA 1P0QA 1QTRA 2JEZA 5C81A 1QIMA 4C87A 1BN7A 5KWJA 2BAGA 2C5GA 5CW2A 3FSGA 1G42A 1XRQA 1XZBA 1ZIXA 1EA5A 3JW8A 2HRRA 5AKZA 1TRHA 5EIEA 5CT9A 2HA5A 3D4LA 5HFNA 4FNMA 1G66A 4LXIA 1ODSA 4CG1A 1EH5A 4DIUA 1K5PA 3IA2A 3W2TA 2XMSA 3NGMA 5CT8A 4ZWNA 5JIBA 4G8DA 2W22A 3RARA 5ALHA 2WG1A 3WWOA 1DU4A 2BUAA 2XMBA 3DKKA 1CV2A 2Z3ZA 1J1IA 5AK5A 3WK4A 3ZLVA 3DKRA 5ALIA 4C88A 3VVLA 4L72A 4TVKA 1K8QA 3WWPA 2AJBA 1XZDA 2G63A 2ZJ7A 4J0DA 1A8SA 5D3ZA 5ALRA 4J03A 3DNMA 3FSGD 2HA3A 2OXEA 4B9EA 4EY6A 4P08A 3OPMA 1LZKA 1H2XA 1UKCA 4BAGA 5JAUA 5AM5A 4EBBA 4S0XA 4MXDA 4OB8A 2ZSIA 2C0QA 2WFLA 1OCEA 5ALFA 1BN6A 1XKLA 5BWCA 2PVSA 4INZA 2PSFA 4IHAA 4Y2XA 3C5WP 3C8HA 2CB9A 3C6BA 3DOIA 2O2GA 3CN7A 2VA9A 5AI0A 5YASA 2XUFA 1WOMA 4UBOA 5JD5A 1W1IA 3O9VA 1MNQA 1U4NA 1DWQA 2IX9A 3EF3A 1KEZA 3AFIA 1O6FA 4ARAA 2X8BA 1L7AA 1IZ8A 1AKNA 3AZQA 2QT9A 1YS2X 4IQ4A 2V9ZA 4ZREA 1UT6A 2AXEA 1P0IA 2QUAA 4G1FA 5AI6A 4BZWA 1R9NA 4WFJA 4X7BA 4DLNA 2YYSA 1FFBA 5AI8A 1F0PA 4A16A 3AZOA 3G0IA 3I2HA 3ILSA 1VLQA 2AJDA 3R3ZA 3PF9A 4QNNA 3G0BA 5LYYA 2WHPB 4BDSA 5AKKA 4FKBA 4QA9A 2DHCA 3VXKA 1Y7IA 3IBTA 3ESAA 4J0IA 5JZ9A 4BTVA 3DLTA 4QLAA 1VA4A 2XUKA 1WB4A 2Z5GA 5CT6A 4Y2QA 4DMFA 3PUHA 4BRSA 3QZUA 5ALXA 5CXXA 4G4GA 2GZSA 4FBLA 1LPOA 2CZQA 2VAXA 4ETWA 1XZGA 1LPNA 3V1NA 4EHBA 4KYVA 1QIJA 2HU7A 2D5LA 3SK0A 2XMQA 4ZI5A 2XMRA 5LLSA 2RAUA 3EBLA 3FLEA 4HVTA 5EHZA 4N8SA 3S8YA 2Z8ZA 1H2ZA 4LYEA 5JALA 3WIOA 4E46A 3TJMA 5AKEA 3HSSA 1YR2A 1N5MA 5AKGA 3DL7A 2I3ZA 2GYVA 5AKYA 4U2DA 3FYUB 4QWMA 2WILA 2QM0A 5FPPA 1IMJA 2WKWA 2UZ0A 1BROA 5K3AA 4ZRDA 5T4HA 2HA7A 1MTZA 1GPNA 3F97A 4W1RA 3G9ZA 1XLVA 1WB6A 1EVQA 1BS9A 3G02A 4G5XA 3JWEA 4Y2JA 4G8CA 4X3CA 1FFCA 4K5QA 2J3DA 2G5TA 4X6XA 4DSZA 2H1IA 4FDMA 5LIPA 2VATA 3SX4A 5ALSA 5HF9A 1VXOA 5JAPA 4B83A 5AM2A 4F0JA 4Y9SA 2CUTA 3M3DA 3RM3A 4U2BA 3QPAA 5AOAA 4Y2SA 1XQVA 3C6YA 4N8EA 1UXOA 4V2IA 1EINA 1W52X 4YX9A 3B12A 5DTJA 5ALTA 1UK6A 4PV7A 3G9XA 2AJCA 3P2MA 2WQZA 3WK7A 3GBSA 2HHAA 4AN0A 4BAZA 5ALZA 1GKLA 2QJRA 4ZV9A 1JU3A 2QR5A 5A7HA 1G5FA 2VJAA 4WFKA 4JNCA 1FJ2A 1E5TA 5ALOA 3R3YA 3DOHA 1NX9A 5J3JA 3I6MA 4KAJA 3LP5A 4IO0A 4LIPD 3DEAA 1UOOA 3FWHA 4BVKA 2C0PA 3A2NA 5K3FA 2HA2A 3WKEA 1BCSA 1UWCA 1CQWA 3VJLA 5EHQA 4L0CA 4FFWA 4X91A 4N5IX 1CFJA 5K5EA 1UKBA 4GLBA 1ETHA 1ORWA 4G9GA 5DYTA 1T4MA 1MX5A 1EK2A 1YB6A 2O7VA 2OCKA 3LLCA 4BCBA 5AP9A 4X97A 2WTNA 1Z68A 5EIHA 3C8DA 2WU4A 1OILA 2OGTA 3WZMA 1ZIYA 1XZLA 1CQZA 3FYUC 1JFRA 4CI9A 3W06A 2RI6A 2C7BA 5A7FA 5CH3A 2ZJ6A 3LS2A 2PPLA 2YASA 5CTAA 3F96A 3DYVA 3CCBA 2EEPA 3LIPA 1RWQA 3AIKA 4W63A 2I78A 3G9TA 4Q1VA 4KR0A 2GBGA 3TEJA 3IIIA 2OCGA 4TPKA 4C4ZA 2BGRA 4IH9A 1FFDA 1BRTA 2QXTA 4BDTA 1GKKA 1TCBA 1ZICA 2XLBA 3DL4A 5AI9A 2VQ6A 1XZCA 5JD6A 3ZWQA 1PJAA 5DNWA 1W4LA 5E4JA 3WK8A 2VJBA 4BE9A 4MJ3A 3ZLUA 5IVKA 2WFZA 2XMDA 3WYDA 4EY7A 1R3DA 3VJKA 2XUGA 4BTLA 1N5RA 2ONCA 5DJ5A 5JAHA 3STXA 1M33A 1VXRA 1Q83A 4HAIA 2LIPA 3STTA 1QGED 4Y2YA 3OG9A 2WHPA 4DGQA 2VF2A 1J2EA 1KU0A 3MGAA 2QUBA 3GA7A 1CUWA 1I6WA 2QTBA 5KREA 3BDIA 1QFSA 2QXUA 2HU5A 2XUDA 3PF8A 5AO9A 2XQFA 1ZI6A 4H7FA 2CKMA 3D59A 3HC7A 5DYWA 2G4LA 4QEKA 3R0VA 2X76A 3C87A 4YK7A 1TQHA 3AJAA 4QDXA 1DTEA 4B7ZA 4WDRA 3OOSA 3V1KA 2WTMA 2WIGA 1QIGA 4EZIA 2W6CX 3ZV7A 3OTQA 5HKAA 2PSHA 4W1PA 5AKHA 1GQRA 5AM3A 2WG0A 4FLMA 4KJXA 2BUBA 4BVJA 5A2GA 4L9AA 3NOXA 2DQYA 4DNQA 3DD5A 3PICA 5FDFA 1RP1A 2BFNA 3D2AA 1QIDA 1CUUA 4DNFA 4RNCA 4A23A 4WJLA 2PU5A 2XUIA 1BE0A 1CLEA 3D2BA 4IH1A 5FPQA 4TGLA 3H04A 4BBZA 5JAOA 3KWJA 3HI4A 3DDUA 2J4CA 3QBJA 4OB7A 3U0VA 2CBGA 2OAGA 3GFFA 4U2CA 1MX1A 3K2IA 4GWLA 4LHEA 1L7RA 3N0TA 5HCUA 4MYDA 1NU6A 3WQHA 4Y2TA 1SFRA 1DINA 3MUOA 1VZ3A 1QZ3A 3WKBA 3T52A 3H17A 4NZZA 3GUUA 2C4HA 5ALGA 5AK4A 3O9MA 3UUFA 5ISMA 4GI1A 4FBMA 4HZGA 2G5PA 4CCWA 4B6GA 3FOBA 4X00A 4BYMA 5I8PA 3HEAA 4FLEA 1CUAA 1QFMA 5LKRA 3H1BA 3RLIA 4PNZA 2HFKA 2XQGA 3IB3A 3C70A 4K6GA 4HXFB 1HKHA 5JADA 4X71A 1G4HA 4FFVA 3H2GA 3WWEA 5K3FB 1C4XA 2H7XA 1IUOA 5FOQA 5AICA 2HFJA 2VTVA 5AKIA 3O0DA 2QJWA 1SCKA 2DFPA 4BC1A 4LYDA 2B9VA 4BB0A 1YA8A 4KACA 2WUDA 4HTAA 4CCYB 3EQ9A 4KAFA 3F67A 4QLOA 1S8OA 1XQYA 4GBGA 1QOZA 1BEZA 1CUYA 3RKSA 2QOEA 3N2ZB 1P0MA 5SYNA 5T4BA 1CUZA 3WJ2A 1BCRA 1TIBA 2BGNA 1E8MA 2PKYX 1JKMA 3D2CA 4P9NA 2X5XA 5AI4A 2JGEA 3EQ8A 4LXHA 3I6YA 5AKLA 4N8DA 2YXPX 4DSAA 3BWXA 4DNPA 1XQWA 1WCYA 2GZRA 3QMMA 5JZBA 2XMCA 2AJ8A 3T4UA 1LPSA 2BJHA 1GT6A 3O4JA 1MX9A 2FJPA 4Q34A 2DHEA 4WFIA 1A8QA 2K2QB 2PSDA 3A2MA 2OGSA 1UK7A 4BZZA 2VT7A 5HQ3A 4UHHA 2RHTA 4AO8A 3FYUA 1IUNA 4KE8A 1H2WA 3GZJA 5A7GA 4M0EA 1THGA 2IIVA 1DT3A 2O7RA 4J0KA 1YS1X 1ZJ4A 2JGMA 5HF6A 4NVRA 3F8SA 3WKDA 4AX4A 1ODCA 4F60A 1HL7A 2XQKA 3L1IA 4W1SA 1PFQA 4H7JA 3H19A 4M0MA 4QDZA 3JYHA 4EA6A 1DX6A 3FCYA 1ZOIA 4P92A 5CXUA 1BU8A 2OPHA 1MT3A 1XRRA 1N8SA 5FV4A 2WJ6A 4ZGBA 2Y6UA 5EHNA 4EY8A 3NWOA 1B41A 1CUIA 1ZGBA 1OXMA 1UK9A 2H7YA 3ZPXA 4U2EA 1QO7A 1XZFA 1CVLA 4J7AA 2XMZA 5HF8A 1YASA 4GHWA 4MQLA 3OC0A 4ITVA 1ACLA 3OM8A 4X95A 4QE3A 5K3CA 4CG2A 5LZ9A 1SCIA 1CR6A 3R3VA 4OD0A 3E0XA 5FRDA 4UBIA 1EDEA 2Y2VA 1E3QA 3WL6A 4AN1A 5CBKA 3Q8WA 4W9RA 2J3QA 2QRUA 2XUJA 4KEAA 3TRDA 3WL7A 3BIWA 4X92A 1CUVA 5FUMA 4HXGA 5IVIA 4LKOA 2ZJFA 2P8SA 2XUAA 2HU8A 3W05A 1X70A 4DNOA 4CIBA 1JJFA 4UHDA 2WUFA 1EDBA 2H7CA 1UOQA 2WJ4A 4GECA 2OQVA 5HQ3B 1XZAA 2JIDA 4H18A 4XVCA 2WM2A 1MNAA 3G9UA 2WG2A 1MO2A 1YAJA 5IVDA 2QKYA 5HK9A 1EDDA 4A5SA 3HZOA 1Q0ZA 2Y1KA 1Y7HA 3VVMA 5IVHA 1R50A 3KSRA 1CUGA 2I3DA 2V97A 1TCAA 3H18A 3UUEA 4D9JA 1J06A 5BOVA 1H2YA 3WKCA 4QDUA 1LBSA 4MEBA 5LZ7A 4J0GA 1XLWA 1ZD4A 4FLFA 5IH7A 1CUCA 4U2FA 3STWA 3I2GA 5HZGA 3V1MA 4CFSA 3G8YA 4KRXA 4EUSA 5BWBA 4RPCA 5AOBA 5DTIA 3UMJA 2CEKA 1W6RA 4P93A 5AK6A 3CN9A 3E3AA 1A8UA 5JARA 5AOCA 1E8NA 4B80A 4RE5A 5KBYA 3O4IA 5ALQA 5AIBA 2C58A 3WKAA 4PW0A 3STUA 5T4EA 2GBIA 4F21A 5LZ2A 2VJCA 3E4DA 4Q3OA 2H9YA 1LZLA 2OCLA 3HJUA 4GDMA 4HRYA 3WA7A 1VE7A 1K4YA 4WY8A 2VEOA 4X6YA 3HLKA 4X6UA 1SOMA 3FLBA 3R3UA 3A70A 2HA6A 2OG1A 1K63A 3ESDA 2JGKA 1UFOA 1AMNA 1CUFA 4G9EA 5AKXA 2Y2UA 5A6VA 3B5EA 5A71A 5H3HA 5CMLA 3W04A 4BP9A 3M81A 2ZYRA 3DCNA 1LNSA 1HPLA 3QM1A 1LPPA 3TGLA 4FNGA 1VJ5A 1IVYA 3AILA 1QIKA 3AIOA 4C4YA 1QE3A 3GELA 5ALJA 4Y2PA 2YH2A 3W9BA 4PSUA 4UHFA 4UBJA 1XZMA 2E3JA 5DNUA 4J3JA 2HDWA 2HM7A 2FJ0A 1GPKA 1EI9A 4OYLA 5SYMA 4OPMA 5AM1A 1SCQA 5DYYA 1R88A 3ANTA 4PSDA 1EK1A 2XMGA 3MVEA 1WPRA 3KXPA 2O2IA 4OB6A 2PSJA 1HQDA 5DNVA 2ACKA 4OU4A 3EQ7A 4QZVA 4HS9A 4G4IA 1ZI8A 1GGVA 3C6XA 4UBKA 4BAUA 2AJLI 3IUNA 3G7NA 1XRPA 2GYWA 2R11A 2PU7A 3FAKA 3PDCA 3PI6A 3C6ZA 4BVLA 5K3EA 3FVRA 2ZSHA 5HK8A 2XUOA 1EB8A 1WHTA 1E89A 4FMPA 2PUJA 3I2IA 1LGYA 1IZ7A 3WLAA 2GBCA 1JI3A 3H1AA 3D7RA 3EIOA 1O6GA 3C45A 4FWBA 1CIJA 6YASA 3QPCA 3U1TA 3SC2A 4Q82A 2WFMA 1EHYA 3DYIA 1ISPA 2FUKA 5E2IA 1H23A 3RK4A 2Z3WA 1SC9A 4KE9A 3DJYA 1ODTC 2JF0A 2C5FA 4EB0A 3DS8A 5AHXA 4AZ3A 4CIAA 1HBJA 5DLPA 3IURA 2JBWA 1AZWA 1DX4A 2QVBA 3BIXA 4H7IA 3I2FA 3WMRA 4OCZA 5ALEA 3I1YA 2XUPA 1QO9A 3A6ZA 3FBWA 3CCCA 3YASA 3WL5A 5D7BA 2Y6VA 4I19A 1AX9A 3H2JA 3O4HA 4U2GA 3QMWA 4I3FA 1T2NA 4BP8A 2PX6A 3R3XA 2HRQA 4Y2RA 3FCXA 1ZD5A 3H2KA 3BXPA 2RIPA 3HACA 2XDWA 1UOPA 2J4FA 1DQYA 1AQLA 2WUGA 5CRIA 4L3WA 2XI4A 4UHEA 1A7UA 1QONA 1AC5A 5BV7A 2RGUA 3X3HA 1ZD3A 3HYSA 4DTCA 4OU5A 3WA6A 5KWIA 5C8ZA 2V98A 3H2HA 2Z8XA 1PV1A 5ALPA 1U65A 2OCIA 1QJ4A 3QYJA 2XUHA 5CH5A 1CUJA 4UBLA 4M0FA 4X93A 3QMVA 2XB6A 1U2EA 5CT4A 2WJ3A 2B20A 2ECFA 5AI5A 3G0GA 2BCEA 4YPVA 2XT0A 2PL5A 1HLGA 3R40A 5E4YA 3S2ZA 2HA4A 4I4CA 4H77A 4RGYA 3ED1A 3IDAA 4UFNA 4QDTA 1QIFA 2PBLA 1E66A 2VT6A 3D0KA 5LP1A 1VA5A 3HRHA 4E15A 4NMWA 4JYPA 3LIIA 3PFCA 5LKAA 1LPMA 4LXGA 4X90A 4QWWA 4G4JA 1MJ5A 2B61A 3I2KA 4WCVA 4AMZA 3V9AA 2HADA 5ALKA 2BKLA 2WLSA 1MAAA 2CJPA 5FKJA 2XE4A 4E11A 2WHQA 1EX9A 4UBNA 2VAVA 1D07A 5EFZA 3AZPA 4JUIA 4HXEB 4UHBA 1CUBA 2ROQA 3IUJA 1DT5A 4B82A 1W75A 1X2BA 3LCRA 1U8EA 4B81A 2DCMA 3W9UA 5HFAA 4WDQA 3L1JA 3R41A 4BC0A 2NW6A 1C7JA 2ES4A 4K6HA 4XWGA 3WYNA 1QTIA 1Q84A 2WHRA 1AURA 4PSCA 3I28A 1WHSA 5A62A 3IULA 3HXKA 3QITA 1LPAB 2RONA 3ANSA 3ZI7A 4ZXFA 3PE6A 1IUPA 2WIKA 5K3DA 1ZD2P 2XQIA 1XFDA 4KAAA 5ALYA 3STVA 3A2LA 4OUKX 2B4KA 5CT5A 4XIIA 4UFOA 4YASA 1R9MA 5JYCA 1F8UA 1THTA 5I7UA 2DSNA 1XLUA 2WSLA 4UBMA 4GXNA 3WI7A 4AXBA 4OYYA 2O2HA 3IUMA 1EVEA 3C43A 4EY4A 3WIBA 1GZ7A 3WWDA 3ICWA 5AM0A 3WWCA 4DMHA 4BCCA 3KOOA 3SWWA 3WK9A 4C4XA 1F0NA 1XZKA 5IKXA 2PM8A 4X85A 5FXMA 1ORVA 4J0JA 1AUOA 4C01A 1JMYA 4UFPA 4B85A 3B3QA 5ALUA 2CMFA 1XRLA 3H2IA 4AO7A 1DWOA 1XROA 4GW3A 5LZ5A 3D3NA 5AKJA 3VJMA 3V48A 1FFEA 1XRMA 4Q05A 5JANA 4Y7DA 4JYMA 1CUHA 4JEIA 1QLWA 5D3KA 4FHZA 5D6OA 1VKHA 2DQZA 2EDAA 5K3BA 2XQJA 5F4ZA 1KU6A 4DM7A 4K2AA 3IUQA 1MAHA 3MUNA 2VJDA 1JJBA 4H0CA 4MQMA 5C7YA 1W76A 3QH4A 5ESRA 3G0DA 3WZLA 2BUCA 2Q0XA 1CUXA 2GBFA 5AIAA 1P0PA 3O4GA 4N5HX 1QIEA 2JGFA 2ZYHA 4UPDA 4MWSA 1MPXA 2JGLA 7YASA 3ZLTA 1CRLA 3M82A 4DMCA 1EB9A 1LBTA 4ARBA 5AM4A 2VSQA 5DWDA 1RYYA 5E4TA 2JGIA 2WFLB 1FFAA 1WPXA 3FNBA 1B6GA 1Q0RA 1F6WA 4H7DA 2OAEA 2DR0A 4H7KA 3AINA 5T4FA 1JJIA 2I03A 4KE7A 4KE6A 5EI5A 3QVMA 3R3WA 5ALWA 3L1HA 4KRYA 4NS4A 3FLAA 1XZEA 5CH8A 1YB7A 4MEAA 2FX5A 3OURA 4Y2VA 1GXSA 4X94A 2EDCA 1EXWA 4FOLA 1VZ2A 1NU8A 2WIDA 4Q3KA 3VDXA 1TK3A 3ICVA 4B9AA 5JZSA 1R1DA 1MU0A 3V1LA 2HA0A 1A88A 4MWTA 4F5ZA 3O95A 1TCCA 4QDOA 4BRZA 3BDVA 5CURA 4C6HA 3VKFA 4JH0A 1XZJA 2JGJA 2QS9A 1AGYA 4ROTA 4G8BA 1USWA 3KD2A 4XX1A 4O08A 2ZYSA 4J0CA 3VISA 4UHCA 3BL8A 1HDEA 4CG3A 4H7HA 4Y2UA 3BF7A 4H7EA 1TAHA 1N1MA 3BJMA 3BF8A 3BE8A 3DQZA 1XQXA 4FTWA 4W1QA 1GPLA 3QPDA 1H22A 4CCYA 5EHXA 4B0PA 1K6EA 4BCDA 1WB5A 2ZVDA 1UKAA 5LZ4A 1UZAA 4ZV7A 1VOTA 4MYSA 1XKTA 3WL8A 3I1IA 3KWFA 2WIJA 5JATA 2WIFA 1QIIA 1XZHA 1ZI9A 1L7QA 2RHWA 1LPBB 3FVTA 2ORYA 1GQSA 2QMQA 1JU4A 2OGZA 3NUZA 1CUSA 4IH4A 1UK8A 1FSSA 1ZGCA 3M83A 5ALMA 1LLFA 3K9BA 1VE6A 4XJVA 1TKRA 3WK5A 5ALNA 4B0OA 3WJ1A 4AB1A 4J0HA 3GROA 5C8XA 2R8BA 2V96A 3STYA 1X2EA 2GYUA 1YA4A 3K6KA 2QZPA 3C5VA 1DQZA 5EGNA 5HKBA 5AJHA 4K6KA 4PF1A 1CUEA 2ZYIA 1JMKC 3CXUA 4AZ0A 3IVMA 1CPYA 5FP0A 4AO6A 2HL6A 2PUHA 1QIHA 2ACEA 3PUIA 3FYTA 5HF5A 1XZIA 5ALVA 3ESCA 4PQEA 1YCDA 5JD4A 4OSEA 4H35A 5JASA 1JT2A 3H0CA 2D0DA 1R4ZA 3WK6A 1Y37A 3I6ZA 2OQIA 2WUEA 1DWPA 5LZ8A 2XLCA 3I2JA 3F9CA 4WY5A 1WM1A 3Q0TA 3PFBA 4AMYA 4C89A 3D5EA 1XRNA 3BJRA 4RE6A 1CEXA 2HIHA 4EY5A 1E8DA 4E14A 2WU3A 4BATA 4Q3LA 3G0CA 5ALLA 4AQDA 4PO3X 1J07A 5AH0A 4B84A 3ESBA 1CUDA 2IITA 2DHDA 3F98A 5AK3A 1C7IA 1MN6A 2PSEA 2XUQA 5I9IA 4DYHA 1ACJA 5FLKA 5ALDA 3AUKA 3AIMA 4Z49A 2OLEA 5C8VA 3HABA 4GEGA 4UUQA 2JEYA 1ZJ5A 5EIAA 4HRXA 3E1GA
chains in the Genus database with same CATH superfamily
3EW7A 2PGIA 1DZ3A 1CJUC 3COYA 4RD4A 2FWRA 4HATA 2GF2A 4DY6A 1BEEA 2EGHA 4TWAA 1M8GA 1LJ8A 3LQ1A 4IGAA 3DMGA 2AN5A 4PGGA 4Q1EA 3UJBA 3VPXA 4DMKA 1P0QA 1QTRA 2WHEA 5C81A 3F6SA 2B3TA 4GYYA 5LUBA 4KQXA 3AVXA 2BFWA 3COWA 2GI4A 2BAGA 2C5GA 5CW2A 4GMDA 5FPKA 2XJ9A 1E3JA 1K9SA 1Q1GA 2XAAA 3FRIA 3AW9A 4JEMA 1XRQA 1XZBA 5EY5B 5C31A 5HILA 5LD2B 3QF7A 3MCUA 3DBLA 4ZCRA 6REQA 1G5PA 3EVEA 1ORIA 1YB1A 1B26A 1G63A 4J7UA 3ZDBA 1ZKDA 2NQ2C 1BSVA 2C5LA 3LLSA 3PPXA 1JFSA 2NYRA 1H3NA 8ATCA 1L4GA 3LUCA 2JFYA 3AUSA 4IDFA 4CG1A 4ZMBA 3U9TA 4M0LA 1K5PA 4EF4A 4JI8B 1EFPA 3NBZC 4YJ2B 3AC0A 1W36C 3N74A 3TNYA 3ZIDA 4OO3A 3PQ7A 5JIBA 1GGJA 1SR8A 2B5WA 3NQ41 3T5DA 4HPJB 3CNLA 3O5AA 4CUZA 2FVYA 3THXA 4I1UA 1E58A 2WG1A 3QLEA 1CY4A 4HX5A 3C1OA 3KJQA 2HB6A 2WU8A 3VR2D 2IZ7A 2XMBA 1NVTA 3ASZA 1AN9A 521PA 2ZRAA 1N6OA 2AOXA 5ITVA 1TADA 1NZJA 3IQGX 1TIKA 4FGJA 2VK8A 4Q4JA 2Y1EA 4QASA 5HBRA 3VNUA 1QTNA 4IHJF 3V7NA 2JZNA 1B6TA 4RZQA 3WK4A 2UYOA 3GA0A 4Z54A 2ANBA 2XADA 3PDJA 4BBPA 1OAOA 1XCOA 5CGQB 5FPHA 4NFYA 4X1KA 2C29D 2FXVA 1U2RA 3KG2A 3VVLA 4L72A 4TVKA 3SS9X 1J25A 4UTZA 5BSWA 2CJWA 3DBRA 4H1WA 2EGUA 2A4KA 2QX8A 1U3WA 3ZYCA 3WLKX 4BC1A 4QGGA 1DB3A 4J0DA 4XQCA 4ES6A 4A6XA 3LHDA 4EI8A 2QP3A 4M6WB 4R6WA 1NN3A 3I1JA 4AUKA 2B35A 3ANMA 2ZTSA 5B1HA 2R1VA 2WT9A 2A3RA 2I29A 4RQAA 2OXEA 3DFZA 3ETJA 3L9WA 4CRWB 4EYOA 4RELA 3E8MA 2DQSA 3LJKA 1QWOA 3W8DA 3JZMA 1OWPA 3UCEA 5JSQA 1UKCA 4L51A 1BW9B 1TE2A 2ZJZA 1XI2A 1E7WA 4NDZA 2YS6A 3W1EA 2NUPA 4ZK6A 1N78A 3LXMA 5J4LA 3OU7A 4HN2A 1XTUA 4A10A 1ULTA 4JVNA 3K1ZA 4WQMA 1DKNA 1M8KA 1OXUA 4M88A 4ZI7F 3F6RA 3JARA 4UXJA 3QE2A 1CVRA 3PGLA 4CMCA 1VG8A 1U4OA 1TD1A 3FOAA 4Q47A 3USZA 1OBCA 5GMOA 4EBFA 5HA5A 1IXZA 3OZIA 1W44A 2H51A 2NTYC 5FAXA 1TF7A 2CWDA 1IPHA 1ZXBA 2I3AA 2R6GA 3BIFA 3E81A 3IDFA 3ZCTA 5KQPA 1B4DA 2RBEA 5D3MA 1JSLA 2IJGX 3HA7A 1IPFA 2X6RA 4D97A 2B1IA 2C57A 2B2XA 1T6NA 3OEWA 4KU4A 4IHAA 2QUKA 3FMFA 4I55B 1LA2A 2BMVA 5TGTA 3OA2A 3URMA 1SCJA 1PGQA 2B5OA 1T4CB 3C8HA 3C6BA 3SZUA 4CKEA 2QQ0A 2O2GA 3RVQA 2B8TA 4YCAA 4ENQA 5HJ5A 1PR5A 3CN7A 1ORHA 2QEQA 2YHIA 1PFWA 1WXGA 3IPLA 5LDDC 5DYGA 3L7KA 1GPUA 5IJ9B 5CVVA 1NXQA 2REOA 3D3WB 3PFKA 2BHTA 2O3JA 2Q0QA 4DR2B 4YFYA 4TS1A 2IEIA 4LJLA 3V1UA 4RK5A 1JEEA 3O9VA 3NTLA 3MWFA 3KHTA 1JFFA 1MNQA 4YRRA 1Y1PA 4ITUA 4DSTA 1DWQA 2XGSA 3AUJB 4ARAA 3R24A 3IAEA 2X8BA 5A05A 4CMEA 1OAOC 3VOSA 3KYBA 2Q3DA 1GFZA 5ERYA 4DPKA 5HKKD 1DG3A 4N5LA 2FPRA 2E49A 1NA5A 4LAFA 4RSRA 3DV0B 5D1NA 1OXVA 4D4JA 3QX8A 3R7WA 3NTVA 4Q3CA 4RA6B 3S81A 3MLEA 2ORWA 5EQFA 3RNOA 3ETEA 4ZREA 3VZSA 3VC7A 5A9RA 3OM0A 1H0KA 1KPGA 4F1KA 5A4IS 2YMQA 1IY1A 2AXEA 5CLFA 1NN0A 3RU2A 4RD6A 2QUAA 3EFHA 5FF9A 4A4DA 4HWKA 1ZRSA 1W0KD 4G1FA 5IRCD 4B4UA 1R9NA 2W58A 1M1YE 3F6EX 4UAUA 4X7BA 2W2OA 1PBNA 4KI7A 4IICA 1TEHA 1UJ4A 4MR8A 1OTHA 4LDRA 1WX1A 3QU7A 5KQSA 3K8YA 1MB2A 3ZQUA 1VMIA 5LQSA 3ILSA 1U0BB 2A67A 1DC8A 1LI4A 3VC2A 3H6HA 4CKCB 3ST7A 2TRSB 1M7GA 1MRZA 1P2UA 5EXSA 5G1OA 2V7TA 2FDRA 9LDTA 1WSAA 3RQSA 1U8FO 2NUAB 1JFLA 5LYYA 5FNVF 4BDSA 1AD2A 1GSOA 4TTQA 4PR3A 1C1DB 2KS6A 3SYNA 3VXKA 4CYMA 1T5DX 1EZ1A 1N8NA 1ZJ6A 5BW8A 2EQBA 3PX3A 4JA2A 3VO2A 1J2JA 3C39A 3H1PA 3M6MD 1SIUA 2OP0A 5JZ9A 2CE7A 1YV9A 3BMOA 5FBWB 4XASA 4LTNA 4CHTA 2XUKA 2UXDB 1NLMA 1NMQA 2NAPA 3TEMA 3RWMB 1OFUX 4JS0A 2HQBA 2VP0A 4DMFA 3UAXA 4E31A 4YBRA 4MS4B 4KJZA 2J6CA 1DZIA 2P9BA 3A10A 5AJTA 5CXXA 4X54A 1ICEA 2GLXA 1K1EA 4PYOA 5ALXA 5HPYB 1JDTA 2HLPA 1N92A 2EKDA 1BGWA 4R41A 4ETWA 2NV6A 2I7XA 2GAOA 1F2TA 3HVKA 4UNNA 4AKSA 3KQHA 4PZYA 4LVNA 5CVEA 1T26A 1O57A 5JAIA 2PEYA 5DWVA 1BXGB 2C78A 7GPBA 1PWXA 3PTZA 3CUUA 3LCCA 3RYFA 2A1UB 2Q5FA 2JAUA 1VFNA 5KJFA 4N6GA 4QXAA 3FBTA 1E1MA 3GCWA 3HXPA 1L9KA 3VC1A 1Z2AA 3VI3B 1QG2A 4UTNA 4TZ6A 1A1SA 5LLSA 5GONF 4O2BF 4EB6A 3PC8C 4PC6A 2HMSA 1EHIA 3GVPA 4CR7A 1UPXA 5B3JC 1GL7A 1VPLA 1V6SA 1L7OA 3EGVA 4G85A 4YGYA 2UDPA 5I8ZA 5ITSA 2BSAA 1WZEA 1T29A 1OZFA 4GQBA 3DZJA 1YJ8A 5LP6C 5KYNA 4QT0A 4CVNA 1IIBA 2D7JA 5KWEA 3MMXA 1M10A 3DE0X 3PIRA 3EN0A 4LYEA 2EIXA 1XF1A 2K6GA 4P34A 3SMQA 1VMDA 4NABA 3ZTWA 1KI4A 2BFPA 5JALA 1OC2A 3G9QA 4UTXA 3ZZTA 3JQ8A 1ZZEA 1OZ0A 2B0JA 1KEUA 2CCKA 4MMZB 1P7YA 3RS5A 5EJ5A 4BRUA 1N5MA 3OPXA 2HYIC 4DR6B 1AVTA 1V16A 1AZSC 5AKGA 5HKKA 3QHPA 2QZSA 1OLXB 3AW8A 1U63A 3PEVA 3RTGA 4E32A 3EQ6A 4J1TC 1HSZA 1SK9A 4AKEA 2GEKA 4ZEXA 5EPOA 1OKKD 1VHQA 2NOAA 3V9PA 3OFKA 2C9MA 5KVCA 1YZFA 2K7ZA 5FPPA 5IF3A 1IMJA 3FPJA 3GEEA 4L57A 1O6BA 2VZ9A 4ZRDA 5EEGA 3K0CC 3DUWA 1DPFA 3A9TA 5EE9A 4YCLA 3ZQ4A 4JP1A 1AQ6A 1MJNA 1GPNA 4ZT2A 2IXEA 4GM0A 3KBOA 1PKXA 4ILKA 3TOZA 3ROQA 2Q07A 4UMFA 5C1BA 2GVZC 1IEVA 1KR5A 3HNRA 3G02A 1E2GA 4DCJA 2E18A 4UAJA 4RS4A 1CSEE 4G2NA 2ZPTX 4P53A 3V3TA 5JC8A 3JWEA 2EQAA 4EG8A 4G0OA 4D43A 4K5QA 1J00A 1XG5A 3A6KA 4V39A 4B3HA 3I01A 4TKUB 2ZI3A 1UC4B 2BELA 3FAZA 2QYSA 4GZMA 1VE3A 1OC4A 1R15A 2BONA 4MVJI 2FY8A 1DAGA 3PTLA 3W1VA 1S2IA 3M9LA 4I4TA 1HOXA 5LIPA 1KHHA 3KZVA 2GF0A 2IEGA 3SX4A 2YX1A 4ZZ0A 5HRUA 4QVIA 1GU0A 2PTHA 1OIWA 4C2AA 2P6RA 1DKOA 5HF9A 4RNDB 1Q7TA 4RSMA 2GEUA 1RP7A 4FYYA 1OYWA 2EFEB 4OI4A 3ETDA 1IJKA 5SZJA 2NZVG 1IPEA 4R9SA 4F0JA 4C21A 5M2QA 1FY2A 2M1XA 1Z4NA 4Y1FA 3QU5A 2F55A 4YUVA 4KGDA 3EGXB 1FJHA 5GZ1A 1H0RA 1SXPA 3T12A 4CM8B 2BFCB 1NW9B 2YZMA 1G1MA 3AI1A 3RVSA 3TNFA 2I2CA 1D6SA 1CC1S 5FI0B 5KTKA 3NHRA 1C7FA 1OZHA 2IEYA 2HEGA 3OZGA 3GWZA 3PQ8A 2GTHA 1Z8HA 2J41A 3D5QA 2Q4BA 1VKOA 3EH1A 4RDCA 1AQNA 3WAJA 4Y98A 4C2UA 3BSSA 3CX7A 4XX0A 3SMVA 3JVVA 4J07A 1J33A 5F3DA 4N8EA 1E5LA 5FUVA 3WNQA 1V45E 3WGNA 2OUIA 4NTZA 5CEFA 4N82A 3HYTA 2WSMA 1PZGA 2X19A 1XP5A 3LZDA 4MKZA 3SY8A 1D1SA 2H1HA 2Z3VA 3ILHA 4V2IA 5FOVA 2FPXA 3U19A 1W52X 1N2OA 4YX9A 2ZROA 3I2YX 1BE8A 1UK6A 4G1BA 4RD3A 1SRRA 1E2LA 2VH5R 3I6QA 1M6WA 4Q1CA 3SYTA 4C4RA 4RVDA 2GXAA 2NWQA 4MRMB 2I34A 2X2OA 2IE0A 1VC2A 2A1TS 4URFA 5E9QA 1L1FA 5JTTA 4QM6A 1JZSA 4XQ0A 4FYWA 3W5VA 5KX5F 2NLOA 1FXSA 3IHLA 2J87A 3K32A 2JVJA 3NP7A 1QP7A 4NEQA 5IULC 3ECCA 5CDSA 4OBWA 4M0KA 1I2CA 2VJAA 2IW3A 4D26A 3NH9A 1V3VA 1P2BA 3IX7A 3K8OE 3SBEA 2XR1A 5HKOA 3EXHA 1XBTA 2R7KA 1P2DA 4HD8A 1Y82A 3PC2A 3Q2OA 3HCDA 4ZAZA 3PITA 4F3KA 1QC5A 1ISGA 2WKPA 4G26A 4NBWA 3GN2A 2L17A 1LVUA 1JEOA 1QOPB 2B8WA 4J4BA 3I6MA 4F2GA 1JIXA 4OLBA 2YL2A 4TLLB 4IO0A 3DDHA 1SD5A 4LHSA 4KR6A 3JX9A 4FYKA 2Q4EA 1JU9A 4UEKA 1NHGA 4KVZA 1T5IA 2GEFA 1V8ZA 3DEAA 5H8WA 1PVDA 1A5SB 5K3FA 1P5FA 3MW8A 1D6NA 4JGIA 4M9QA 4HL6A 4ESEA 1QZZA 2ZATA 3CLTD 1X1SA 3H4MA 3K5PA 3T8YA 4ALJA 5EHQA 3X43A 1M2GA 4FINA 2A35A 1UBOS 4FI3F 4MB0A 4WZZA 4TYNA 1ZQ9A 2BPOA 2O5CA 3JR7A 2C03A 2EFHB 2CMGA 2XWBF 3P0FA 3A06A 3SE0A 2KLHA 4X91A 2GN2A 2OORA 4N5IX 2A84A 1CFJA 2J4DA 2OGWA 2GD2A 1K4MA 2VJNA 3ZD8A 2G6BA 1NLYA 2D5IA 2DP4E 4PLVA 2JGDA 8LDHA 4G9GA 5FD8A 1NXPA 1T4MA 1ZU4A 2QU8A 4JR1A 1G6OA 2ZPAA 1HORA 1JXQA 2ZZKA 3RVKA 1B15A 4G5YA 1NVUQ 1JEQB 1PK8A 1Z68A 2HXSA 3P0JA 4DIOA 4YCNA 2WU4A 4YUXA 2NYVA 3KZCA 1CWUA 5FWXA 4JP3A 2OZLA 3N70A 3WZMA 1RXEA 3KVVA 3MMNA 4HDRA 4NU5A 2NO9A 1CQZA 3FYUC 3MYYA 4CM4A 1P77A 2Y1OA 1G8SA 4NBVA 4ZVMA 1DE0A 2H92A 2X0JA 2P9TA 2ZULA 3D8NA 5C34B 1C3JA 3PCTA 2ZIXA 5BR7A 5CH3A 3LS2A 2HPVA 1MO4A 1Z5UA 4R8VA 2WQ7A 3T9CA 2DC1A 2QSUA 3CCBA 1U8UA 3ZJ4A 4UAGA 4D44A 4XLZA 3UFXB 2AX4A 4OBBA 5GJVC 2FP4B 2JLRA 3ACCA 1M5TA 3HMKA 3S70A 3SBXA 1H42A 4WA7A 3JRWA 8AT1A 3E3LA 2XGMA 3AIKA 4R83A 3TB6A 2QMHA 4O02B 2I78A 1NSTA 5CJ2A 3C1TA 3G9TA 4KR0A 4IQ8A 2ISSD 4MVJP 3I01M 5LMCA 4Y7CA 3VPCA 3HFGA 2POCA 4M0PA 1FXWF 1NASA 2VC2B 2FOIA 3BQNB 1N6IA 3JTEA 3L7IA 5CFLA 3TSWA 1PGOA 4PAQA 2UUCB 1B0UA 2W8BA 4QKQA 1Z47A 5EERA 2BGIA 5JVDF 3QWHA 1THZA 4O1MA 4ZO4A 1E9EA 1KK2A 1N7GA 1ZH4A 2I99A 2PPVA 3QLTA 3DL4A 4CF5A 3OWOA 4L6IA 4HDCA 5AI9A 5KQGA 3VR2A 1HA3A 2FN4A 4TROA 5DNWA 3RRXA 1G18A 4O3FA 3AR2A 5E4JA 3TR0A 1DL5A 2FQQA 1T0BA 4RMNA 2E4VA 4WKNA 3FTPA 1GY8A 4IMPA 2RKOA 2QX6A 1PWHA 4RS3A 4DB2A 5J5VA 3B8EA 3MHPA 1PZXA 1NR1A 2XMDA 3EXIB 4YY3B 3HXQA 3T1QA 3FFXA 1KEVA 1Y1SA 4UHKA 3KUXA 4JXXA 1CZRA 2R00C 5FO1A 4FYHA 3WYDA 1R3DA 3P9ZA 3R5KA 4IL5A 5CVDA 1FPQA 1DOZA 2PWYA 4KQHA 3FNQA 4QJBA 4U0JA 4B7XA 3PEWA 1N25A 1RIIA 5MGNA 3Q8LA 3O74A 1PK9A 4YAFA 2JFNA 4DUPA 3R5SA 2WQ6A 1NSFA 3VZDA 3WGGA 2CDNA 2QGFA 1EVZA 13PKA 4AZ3B 2D13A 3QTBA 5HX7A 1T0IA 1T0JB 3UHJA 3RT9A 2MWMA 3TLBA 1JEYA 5LP6A 1NMXA 3RTAA 4YRIA 2EYQA 4HO1X 4B6RA 2EKLA 2RGCA 3STTA 3T9EA 2GCEA 2R8XA 2QNBA 3PE3A 1SCAA 1QHNA 4UVHA 3HV0A 3OG9A 1GUAA 3PHGA 4BZQA 1WBBA 3WYAA 4RW0A 3WZ2A 1U0GA 2FFJA 2VF2A 1J2EA 3GV0A 4FGLA 2ISCA 3LWNA 1JLMA 4WKOA 1KU0A 1VJDA 4HKTA 1X1AA 3R7NA 4Z2AA 4UD6A 2ZB3A 4JU9A 4OLAA 3AO0B 3NYRA 4MR7A 4WLEA 4YMWA 2AC2A 1DRKA 5BVHB 2ZRLA 2XYQA 1QFSA 2UZAA 1PQPA 2H4ZA 2XUDA 3PF8A 5AO9A 3NBUA 4DJEC 1YJ5A 3NM5A 3PWKA 3ROMA 1CHDA 3BWYA 2GCIA 3NONA 4H7FA 2JNWA 3AP2A 3PG5A 4TVSA 3IBFA 4I3GA 2RGGA 3W5HA 2F1RA 3KU4A 3ZHRA 4OJMX 1AB5A 5T8KA 2HXGA 2CHFA 1DDOA 1XC7A 3PA6A 3RYFB 3C87A 2JL1A 4H08A 4ZO6A 1LXCA 2ADFA 4C08A 1PJLA 4PX3A 1DDIA 3PPYA 3W2IA 2ZIEA 2I76A 3OOSA 4BPBA 1Z6GA 2J7KA 4L4RA 3K8ZA 3R4VA 2R44A 2DPHA 3ZH2A 1TYAE 1P74A 1XYVA 2EL7A 3BRCA 1DIAA 1ECFA 2AH5A 1MBZA 2W2VA 4PY2A 3OTQA 5HKAA 5FOUA 4O4HF 1TCUA 3KP1A 4ND3A 1TM7E 2B7BA 4GQIA 1Q1BA 5DMHA 1U98A 4HUQA 5EJ2A 2GUGA 2WU0A 1I0IA 4D0NA 1H2FA 4FLMA 1U2TA 2CJWB 4WOBA 3RJ5A 3RWOA 3BAFA 3HPRA 3TUJC 1ESCA 1MZVA 3DE2X 3GFOA 4QXRA 3T7CA 3K73O 2A5DA 4OAOA 1JQ3A 2CHEA 3WLHA 1SOVA 3GFRA 4N5DA 5ARDA 2DQYA 3PICA 2FMUA 3OQBA 4NJEB 1ZO8A 3HVUA 1FBTA 3BMCA 2Q2NA 2PYIA 2BFNA 4BV8A 3Q7PA 3U4IA 2DTXA 1OMOA 3ORHA 1C2TA 4KL8S 3M1YA 4TTJA 3W7VA 3WLFA 1OFHA 7MDHA 2LE0A 3OY7A 1BQEA 2D0PB 2O7QA 1OAKA 4XI9A 1TM3E 1AN0A 1UPTA 2FPOA 3B51X 4MUNA 4C4PA 1U7TA 1ZW6A 1F6DA 3BD6A 4GMHA 4KPYA 1BE0A 2P3OA 1PWEA 4Y6QA 4LK3A 4UUNA 2TMDA 6LDHA 1PJ8A 5DDIP 5FPQA 5DT2A 3SJ7A 1X80A 5BYBA 2GCNA 4UOQA 1G9XA 4R7GA 5A3QA 2PL9A 1CR1A 4LBZA 1XTIA 2CHUA 3KWJA 4NNOA 4D8WA 3HI4A 3GFBA 2O9JA 5F98A 1TMGE 2RGXA 5LXTF 2J4CA 3QBJA 2CSUA 4QIHA 1ESZA 3GYBA 1QAMA 1OVGA 2A57A 5A3JA 2VDOB 4OB7A 1KXZA 4CN8A 5FT9A 2C31A 1E6MA 4F5DA 1E9CA 1WXIA 1KBOA 1MX1A 2GPTA 2HMWA 3K2IA 4HAVA 3CINA 4O4LF 5JS1A 4LHEA 3BE5A 4HG2A 4EWLA 1IWOA 1JR2A 4BO4A 2VJPA 2ZCUA 3U7RA 3D4NA 1I14A 1RWXA 4Y2TA 3EA4A 2WF8A 5CM9C 5C3MA 4TLDA 1JG4A 3CR3C 1VZ3A 3AHDA 2GFIA 1ZEJA 3BTSA 1GLGA 3NWJA 4K9PA 3H5NA 1XXLA 1Z4KA 4H4EA 2OBLA 3P19A 3RIMA 1U7DA 3QVUA 1DPGA 2PZBA 1A27A 3AMVA 3QOXA 1E9VA 3GUUA 2QMZA 3BRWA 3Q6IA 1Z13A 4BB9A 1KDOA 1Q21A 5DBFA 5JBQA 2C4HA 5ALGA 2BP7A 3A9VA 3ILXA 3O9MA 3CISA 2BISA 2BGWA 1KPIA 3PR2B 1V11B 1T9AA 4R71A 3ZUPA 3HYCA 2AEMA 1VHTA 3DL0A 4DJTA 3IALA 2FGKA 5BW4A 3MUEA 4NDAA 4GI1A 4FBMA 1RJWA 4HZGA 1XEXA 2G5PA 4HT3B 4YH1A 3L2OB 4B6GA 3HQ4O 2GS9A 4MO9A 1HUQA 4NMHA 1CHNA 3AYXB 2O8DA 4PLPA 1CUAA 1KR2A 1L4HA 1NTRA 1K88A 1QFMA 4JELA 3A1DA 3U9SA 3ZTYA 1C9KA 3RFFA 2YZGA 2IRWA 1C9DB 2OUKA 3RODA 2XQGA 4GSKA 3IB3A 4O4IA 3QE4A 3U1VA 1I7SB 1HKHA 1WZIA 2QMUA 3F3KA 1F1BA 3GUCA 3OY2A 4M54A 4Q7KA 1HURA 4RL4A 4EJSA 4W5QA 3LFUA 1ZNQO 2AXNA 3HKEA 4A1OA 4UDOA 2PA0A 1FU4A 3BFKA 3WWEA 1XEWY 1KVSA 1FMCA 1D9XA 5FOQA 1JPNA 2EW1A 1WSDA 3QFFA 4A8JB 4YQFA 2GDJA 1O0SA 3C3EA 3M2PA 1T1EA 4GPAA 4CLOB 1O95A 2YBDA 4E13A 3DOFA 1ENOA 4Q1AA 5EEHA 3UG6A 2JFPA 4CLHA 4M36A 4FDLA 1RAHA 4IKOA 4DV3B 1GR0A 3AKYA 1FNCA 4KACA 5AW0A 3LPDA 4CCYB 5JFGA 5BPFA 5HM6A 1I0ZA 3E7FA 3EQ9A 1B23P 1KBZA 3RADC 2QBYB 4RSGA 4BHTA 4E0BA 1U1CA 1T3SA 2YQ4A 4MPTA 4BGIA 4IOKA 3MBOA 7REQA 3ZWKA 1XQYA 1VI5A 3B3GA 2HJGA 4PR0A 2K7FA 4NC9A 1H69A 4ZARA 4LJAA 1BEZA 1CUYA 5HG0A 3VZCA 4K9KA 4QFMA 5CEEA 4YT2A 1VP9A 1ADCA 4DFDA 1P2FA 1P0MA 1L3IA 1KQOA 5SYNA 5T4BA 4KR3A 1WMFA 3B1ZA 4YRTA 4XTCS 2N46A 1GTRA 1Z4PX 4IJ6A 3X2EA 4I5DA 1E8MA 1R12A 3KFXA 4Z9FA 1SCUB 3D2CA 3H1TA 3G8BA 3JZFA 3VAAA 2GEBA 2JGEA 2PMBA 2EOAA 2NXWA 3BCUA 3EQ8A 4V1CB 2CFCA 3GJ8A 4N5MA 1X7DA 4E6EA 8ADHA 3I34X 1U9CA 5FQNA 3BWXA 4RHYA 3U3DA 2BZSA 4DNPA 1CF2O 2QAJA 3N7AA 1RKQA 2P6UA 5I9BA 4O1IA 3TCKA 1V3TA 4JYCA 1WVGA 1SUSA 3IO3A 2VUIB 4TRRA 1V1RA 5LDHA 1CLUA 1B6SA 2Y1WA 1E3DA 1AXRA 3LHSA 2XE8A 4LWPA 1LPSA 5B7NA 4JQYA 4D56A 1V8PA 1BMQA 4PEVA 3O3NB 5G0SA 3GMSA 2Q27A 1T9GS 4OKSA 5H4HA 5F7JA 4JI6B 3SC3A 4Q34A 2QMEA 3U4DA 3NV7A 1KYYA 1PTJA 2GN0A 2AA3A 5DW0A 3BM5A 4G0UA 2K2QB 4TYMA 1FP4A 2EC5A 4DSUA 3GLIE 2OGSA 5B4UA 4DDTA 3L18A 3OTGA 1JB9A 2C61A 3AJ8A 1F5SA 4HRAA 3RC7A 4Z49A 3CWCA 3F7OA 2EKPA 3QELB 2G71A 3MTDA 1ZZGA 1QBGA 1XRJA 1ZA2A 3FYUA 4Y6LA 2VPZA 1C1XA 5DNEA 1VSVA 2C3MA 4K88A 4ZHSA 4IZOA 1L6RA 2O2XA 2Z1DA 2BZ1A 4B3MB 1Y1LA 5DCWA 3VBEA 1X14A 1NT2A 1OX5A 2F43A 2H29A 1THGA 2QX9A 3CW9A 2FTKE 4FI3C 4RFSB 4LV5B 1PQWA 3F6PA 2O7RA 4OHMA 5ERXA 1F12A 3W9YA 3MELA 4RPLA 2AFVA 2PVCA 3GUHA 2JGMA 4JBGA 5GJWC 4KUGA 1JG1A 4ABYA 3V8BA 4TOIA 4ZI2A 4EPVA 2ZB7A 2I91A 1BH2A 2AQHA 2QN8A 4CEJA 3CLUC 4BX3A 1T2DA 2A30A 3WS7A 4MKXA 4DRXA 4N3GA 3ROEA 5K8JB 1J5EB 4HPWA 1VRWA 4M53A 3FHJA 3D7NA 3F5FA 3LP8A 5TMEA 3S44A 4LE2A 3EJWA 3C1UA 4H31A 2XGGA 3GF4A 1DOHA 1JQJC 1MABA 2I5PO 2JKZA 4I4TB 3FW1A 2COKA 1IM5A 2YVKA 1X92A 3H19A 1KJZA 3L79A 4M0MA 4QDZA 2XGJA 1S8FA 2WU1A 2AOUB 2VPTA 3F5MA 3GVHA 1Q1EA 1Y8AA 4EA6A 2QUIA 3I58A 3RVNA 3C3MA 2HJWA 3KYIB 3DO5A 2ZTMA 2GN9A 3I76A 4I1YA 4WZBE 1Y9AA 1DARA 2VZLA 1ZOIA 3QPVA 4LOAA 4U4AA 4OMUA 3GJRA 4P92A 4UASA 4HFNA 5CXUA 1VGRA 4WBNA 3EVDA 3IEMA 1YR6A 2C3OA 3S28A 4DR3B 4GL2A 2GBPA 3MPUA 3NORA 3UENA 3VGPA 1W0JA 1JQDA 4G5GA 2WAYA 1GL3A 1HZZA 4GLOA 4L8VA 1YIDA 3ONDA 4HB3A 1U7PA 2C9OA 3TOSA 2OPHA 1MB4A 1NJFA 2IP4A 2CDBA 2L19A 2ZIFA 2QHXA 5KYTA 1XRRA 2C9BA 4PHCA 1SM4A 3BPSA 5FV4A 1ILEA 3GLFE 2WAAA 5IBRA 5BNFA 1DELA 1NWHA 2QPTA 4JOCA 2Y6UA 2XHEA 4KGXA 1JSCA 2IYSA 3TK1A 1ZN2A 4HCJA 4GIBA 5DXAA 3QWBA 4I66A 1B41A 1JILA 2WF9A 3IUYA 4CM7A 3WRYC 4C1NA 1N77A 3I23A 2IDKA 2RGAA 3N0VA 3ICPA 1T24A 4Q4CA 1ZRMA 3GIWA 4PSKA 3ZPXA 4UC0A 1O96B 1NJGA 4V38A 4CMAA 5EP4A 4F12A 3CWQA 2VAPA 4LJ5A 3IR5A 1ADYA 1XVUA 1EFHA 1VSTA 3MJCA 4ZU3A 4Q48A 1SQ6A 4EJ0A 2FPIB 4MNTA 2IGBA 4XPIA 5CYPA 1R0KA 3SZMA 5CB4A 1YASA 1J0DA 4I1RA 1VECA 2VHXA 3V7UA 1Q44A 4MQLA 1VLLA 3ETNA 4QYIA 4ITVA 2D4AA 1TLLA 4LG1A 1Q2XA 2GNAA 4G0XA 4R1PA 1O5IA 1OWMA 4QTXA 4IF6A 4J90A 1YQXA 3IQEA 5K3CA 1PEYA 1EESA 3T1YB 3RAGA 2XYRA 1EKXA 4EGJA 5LZ9A 1YDFA 2PWZA 1X42A 2R85A 3R3VA 1MB9A 1OY1A 4OD0A 4OHKA 4RD1A 5IC5A 3T1VA 1ZKMA 3FKSA 3NIBA 4R9UC 3R74A 3U4AA 3LPNA 3PRKE 2J5QA 3QXJA 2H3HA 3ML1A 4HGRA 3TIVA 3VOAA 3GK3A 3H84A 3WL6A 4AN1A 3GQBB 4W7HA 5JI3E 2ZRDA 4W9RA 3ZKAA 3FYHA 5DBHX 5KX5A 2QRUA 1M72A 3DOUA 5J43A 3WO0A 3D4OA 2XUJA 3ED5A 4YWJA 5BP7A 1KKLA 3RDPA 4YMTA 1IN7A 2ZS9A 3LOQA 3TRDA 4WH0A 2NTJA 4EY3A 2RI0A 4LFAB 5B1YA 4LFBB 1ADJA 2RFLA 4FDTA 5K99A 2VPPA 3DZFA 4UUBA 5FUMA 3BILA 4HWTA 1GG9A 3T7SA 4FBGA 1GPAA 2JD2A 4LKOA 2P8SA 4C0LA 3C4VA 2AC7A 5BR8B 4ICIA 4RO0A 1FMJA 1X70A 3ZDCA 3F4BA 1ORRA 4HGYA 1EUCA 3N2YA 4L1KA 4PTZA 2HCJB 3GZNA 4CLRA 3RSGA 2X7HA 2J9GA 1FL9A 2X0RA 3MJTA 2XNDD 3JAKA 4UU7A 3H2YA 4ESOA 1GYRA 1AMOA 3M70A 1E7SA 1R7RA 1TFRA 1Z7BA 3JYNA 1XZAA 4INPA 4BO5A 4HSEA 4OHCA 4WEQA 1I10A 2AE2A 1Q0TA 3G9UA 2V7WA 4ZGGA 1XA4A 2QLMA 3BN3A 4DR4B 5HCNA 2N47A 4IDPA 4GOOD 1CB0A 3PX2A 3R8FA 2CUNA 3HZOA 1HO3A 2QAGC 2WPDD 3FKQA 4R2MA 3WHPA 1EHCA 5L7YA 1X7YA 3RS9A 4BQRA 2FSVC 5L51A 2Y1KA 1Y7HA 3ZKWA 1KI1A 5AYVA 3RF6A 5IVHA 2Y1XA 3N1UA 3AU8A 5E4FA 2IY8A 2V97A 4QTUB 1FU8A 4ZGWA 1V48A 4OY3A 3TTXA 4YRDA 2V1UA 3OM1A 1CZLA 4R8KA 3T0FA 1I7LA 1IBKB 1EJ0A 3IGFA 4P81A 3CUVA 4D9JA 3EDMA 1XT6A 1ONOA 4OHRA 3MAGA 2MYUA 1G16A 4QDUA 3T7IA 4NP6A 2UUBB 3BICA 2Y9MB 4FHFA 1SUFA 2DOKA 3EGIA 4CW7A 1I30A 2R1UA 4FM9A 3HJFA 1RM4A 2C9ZA 1N2BA 4J0GA 4B3TB 3VQTA 4KG7A 1XLWA 4GRIA 1HFWA 2P1DA 1KVTA 5FX2A 2YJ4A 3B6IA 4OL9A 4H0NA 3GJXC 4ADSG 3N7UA 1UOEA 5KSYA 3S1AA 4UQPA 4TM8A 2JFVA 3ZU5A 3STWA 4EL0A 5HMLA 5HZGA 3EWNA 4J0FA 2Q46A 3IXMA 3NP9A 4PONA 4RPGA 4CFSA 2FLVA 2LVBA 1T9BA 4WN3A 5JWOA 5EUQB 1WWKA 5KKCA 4KRXA 2W48A 3RKRA 1BFKA 5U1PA 5I9NA 3EISA 5DTIA 1YS7A 4AG3A 4JB3A 1Y4ZA 2BD0A 3UMJA 4AZWA 3ENZA 2GHTA 1W6RA 1RLIA 1A8UA 3LT0A 4DIEA 3KUKA 2XUZA 3HSKA 4GKAA 4DG5A 3BSFA 4R3UC 3OQPA 4RMJA 2FHPA 4B80A 3FPKA 1C29B 1RAGA 1RXVA 3VH1A 4MP3A 4ZAWA 1QRDA 1JG2A 1L3CA 2XH8A 4DJAA 1DUIA 2RH8A 2AK3A 2IT1A 3V2IA 1ZC3A 2OHGA 3OQHA 2DBZA 1L5FA 4PW0A 4M2LA 1R6UA 4NYJR 1HDIA 4L4UA 2GBIA 5LZ2A 4KXXA 5K03A 2JH8A 1L5ZA 1O96A 4PAOA 3BTUA 1TA4A 2GT1A 2IZ5A 4DDUA 4L5IA 1M8PA 1QR2A 3TQFA 1FNBA 3ZCVA 1E0SA 2O2YA 1Z18A 3FPAA 4BV2A 5KTPA 1C9JA 3V6LA 3QVVA 3RH0A 2DHQA 2XCTB 1KZ6A 2P6NA 2OCBA 3SKYA 2ZETA 1F2UB 4RTJA 4BMDA 3GGCA 3S27A 1J0CA 3FLBA 3NYQA 3GIDA 3UVEA 2P7IA 3VYWA 4QU8A 3AU9A 1GKUB 3G7UA 1ZMXA 5TV2A 2WE7A 1TQ2A 2WD7B 3A70A 1DBRA 1ZD8A 2HA6A 3V8VA 3L7NA 3TOXA 4D3YA 4H9GA 5L40A 3L4JA 2D7CA 1GHTA 3KKQA 5KJ1A 3L77A 2XXJA 1LQUA 5T5QA 4E5VA 1AMNA 1CDDA 4IOMA 4YJKA 3CNHA 2Y2UA 3GOHA 1IRXA 3OFNA 2EG9A 3EQ2A 3P9NA 5TVGA 3TZ6A 3WGKA 4PM4A 3SF8B 4RADA 1P5HA 2YVUA 1U2ZA 3EEBA 3EXHB 2G25A 1XCLA 3H9JA 4KQMA 4AULA 2R8OA 4RF5A 2A1UA 2JIPA 3GJ3A 4L76A 4BFYA 4ZO8A 2YYAA 2XAUA 4LY3A 1QB8A 4QPJC 2BI8A 2BSQA 1BXRB 2OMEA 2QJTA 4NOLA 3ZBPA 1N2GA 4U7JA 4GXRA 3DDOA 1NI3A 4LN1A 1ZWKA 3I9V1 3N75A 5AJWA 3EIXA 2Y93A 3UEOA 4FNGA 3WTCA 4JDPA 5C35A 1HYBA 1PR9A 1VJ5A 3UH0A 1JR4A 2WJGA 4KOAA 2PLNA 4L0QA 3VU0A 1M0SA 3AILA 3WB9A 3L7MA 4OG2A 2XZLA 3GC6A 4BGUA 1Z6PA 1RYBA 4HDRB 4JC8A 3RC9A 2X9QA 4UU1A 5DF1A 4RQBA 4JYAB 1N7JA 2BDUA 2IU4A 2J6IA 3KAKA 1FNSA 2ATCA 4EYGA 2JIRA 4E1BA 2ZVJA 2XITA 3OKAA 2YH2A 5CHYA 4TLMB 3GLFB 3FKJA 4EZEA 1Y6FA 2AZDA 3CV3A 4J1NA 1R4AA 2Z43A 4UBJA 5HIJA 1DJQA 3L5KA 1M6YA 1TA9A 1MC1A 2E3JA 1JIQA 3D4PA 3K1AA 1BCRB 5BW6B 2JKVA 2V9CA 4G25A 4PG7A 5EXXA 3JASB 1XPOA 1UJNA 2I67A 3T1OA 2PX2A 4XYBA 1OU0A 1WA5A 3TNLA 2A14A 5FOTA 4FK8A 4BNGA 4ZT3A 1PJBA 1K7EB 4ZRNA 5D01A 1MD9A 4TL6A 3G8AA 2HDWA 1XDSA 2UVPA 2HM7A 1BKDR 1SC1A 3AOGA 4DKXA 1S8AA 4YPFA 4FC7A 2WNIA 1NT4A 4OYLA 2WSIA 5K0CA 4LVUA 1HE3A 3KOUA 4WLNA 5FLYA 4FPXA 5K45A 1SQSA 1H3EA 2F1HA 3NCHA 5CLLA 2FRVA 2XMGA 4RHTA 2PZ8A 2E82A 2C0CA 1WPRA 1YZQA 2E6UX 4R05A 2JFZA 3KHKA 1BHO1 3ZY2A 2O2IA 3C4QA 1LSOA 2RK3A 4RENA 4MUYA 4WY2A 1X7ZA 1XAHA 2Q49A 1UKZA 5JH7A 3MFYA 3V4RA 1GUFA 2DJ5A 4MGYR 4EMSA 4F3CA 5L3SB 1YMUA 1JAIA 4D2IA 1HQDA 1V16B 4OU4A 3ZE6A 4BFTA 4F9TA 5BW5A 3JQ9C 3AVYA 1VLJA 2VO1A 4NAVA 1ULSA 1ZH0A 2ZGVA 4IXNA 1WXXA 2VLBA 2VF7A 1AM4D 3DDWA 2XZDA 2JBAB 1JQ5A 2AJLI 3GN1A 4QO8A 1LLDA 1RJ9A 2R65A 3IUNA 4QHTA 1FK8A 3RRFA 5LOVB 3DMYA 3MCVA 4Q1BA 1T1RA 2V8BA 4J4HA 4N4AA 4IS3A 1XRPA 1YZUA 2CZCA 3EZYA 5HMMA 3C0KA 3S8MA 2PZGA 4M1TA 4UNPA 3WRYA 2YCLA 1M6VB 4WESB 1W4RA 1AKUA 3C6ZA 1E4VA 1EX7A 2RHHA 5LSAA 4BVLA 1CYEA 3RVDA 1V25A 4KQ6A 4XD2A 2XUOA 5A06A 2P4QA 5IUJC 1OF1A 3UF0A 1DX9A 1T8SA 4FFBA 3LVBA 2RC6A 1WHTA 4LXYA 1FRFS 3BBLA 3H9CA 3RU3A 5IT9A 4P0QB 1NW5A 4ZIRB 4P4SA 1RVDA 4AIRA 3I2IA 3C7KA 3P9QA 4WD3A 3BL5A 3SR0A 3ORQA 1GEEA 1WQ1R 1XTBA 3IP7A 1K66A 4CU5A 2HAEA 4CF7A 3O4VA 1ZXLA 3OX4A 4PC3A 4KBFA 1O6GA 3MS4A 3ZDEA 2O59A 2X9LA 3IESA 3P9PA 1Z3CA 4I14A 3HA3A 4ACBA 4DLPA 2FPIA 5B6IA 2EBUA 1CULC 3IMFA 2FOLA 4JBHA 4DV1B 2FCAA 4WA8A 3NIGB 4B3BA 4TMKA 3WQBA 3WDSA 4BNIA 3T1TA 3OICA 3R5JA 4YJ3B 4NI5A 5CG1A 2B30A 1M8FA 2D2EA 4QATA 3M1AA 1ZCJA 3VTAA 3TS1A 4RD0A 2RHLA 4X24A 1MO6A 4MW6A 4UREA 4F4JA 1OTXA 5HYVA 4AUNA 1SC9A 4JWKA 4BKMA 1A9OA 4E33A 3E22B 3OIFA 5B1EA 5HGJA 1EUYA 1QK3A 4MI9A 2IS6A 3ND6A 1G291 1DBPA 1YUNA 2XTNA 3NVKI 2QD3A 1UKEA 1X7WA 3NT2A 4P3XA 2J07A 2HHJA 1AE1A 1RLOA 1XL0A 1WEHA 4HNRA 1RPNA 3LQRA 4F06A 1Z0KA 5FL7A 3AIIA 4MDFA 2O8CB 4U7TB 1XMXA 1E0AA 1HBJA 2IYNA 4D9HA 1FW6A 5IDWA 2CN1A 2Y0BA 1ATIA 2ZJYA 3L43A 5A5VA 3G59A 5JTUA 4M7WA 1ZJYA 2GK6A 4KWCA 4MIKA 4GXTA 2FHSA 2O7NA 1KEEB 3OPYB 1C81A 1TQ8A 3OIWA 4I4NA 2W2LD 3KEFA 3T7TA 4AT1A 3AHJA 4P84A 3ZKWB 2A2ZA 1GGFA 1TAGA 1Y3HA 1Y5IA 4OA8A 1UDAA 3C3KA 4B8ZA 1JDUA 2PUBA 4C06A 3TLYA 3MCAA 3KJFA 2HT1A 1AX9A 3TSAA 5EJ6A 2DUMA 2XQVA 4MHSA 2XRYA 5JDIC 3O4FA 4PHTA 1T2NA 4TSFA 2PUVA 5CBPA 1T6ZA 2FGJA 3U81A 4IRMA 3UAZA 1FTYA 4WKBA 2PX6A 3SBDA 4BNVA 2G09A 2RBKA 3ACBA 4ZYWA 3HNOA 5E3IA 4PO8A 4DRYA 4K46A 5C5DA 2BC9A 4RCVA 4RIFA 1EFPB 2QN2A 4YJ2A 3TEFA 2XCIA 3TE6A 2BMAA 3BH7A 2CV2A 2W4QA 5IPFA 3LGAA 4KQWA 1WZNA 1XTQA 3HACA 5EWLB 4C20A 2CFOA 1PR4A 3KKMA 2IHBA 3MWYW 4FFSA 4BQNA 3I37X 2QTVB 3HB7A 2NV0A 2HGSA 3ZWVA 1Z5VA 1IAVA 5KQLA 2XI4A 2A0FA 4UHEA 1KY4A 3JRXA 1A7UA 5AXDA 5IK2D 4Z4HA 3COJA 5EP3A 2QRQA 4G23A 5I5GA 2QG9A 2EKZA 2BFBA 3G5AA 3GGJA 3THWA 2N42A 3PKZA 1JHOA 4L5CA 4ZHQB 3U7HB 4M76B 4S1NA 4Z7NB 5JCOC 1R10A 1I94B 1KO5A 2AFRA 4BNWA 1AC5A 2O8VA 2P4HX 1T3TA 3KETA 1KI6B 3MTQA 3U4QB 1VL5A 1GSIA 3HYSA 2Q3MA 2VSYA 2XIJA 3EPPA 1TECE 4OU5A 2VWQA 5F77A 4D9IA 4DTCA 1KYIA 2R86A 3LDGA 1YE3A 4GP9A 1YIAA 4JXKA 1K0UA 5G02A 3TR6A 4ZDKA 3FCAA 4YEDA 4QBFA 5LLDA 3Q8MA 3FOCA 1N0VC 1RMYA 3PQ5A 2B7LA 4KO1S 3A1CA 4DB4A 1H9BA 3H2HA 2RARA 3HCWA 5J58A 1O3YA 3JRNA 1E69A 4EKYA 2EF1A 3SE7A 3RBXA 4MJLA 1JWBB 5DV9A 2FEWB 5F3RA 3RVRA 3TZBA 4BVAA 4ZN6A 1GN8A 4RJJA 5HS4A 2B6NA 4RX1A 2YFHA 2XUHA 2R7AA 1T4CA 1XCGB 2BEKA 4PNHA 2AB0A 2GD0A 4MUGA 1OYYA 1ZJWA 1ZCFA 2G4VA 4N6NA 3I9NA 1SKBA 1K0FA 2WUVA 2IIQA 3OEEA 3TD9A 4AP6A 1D2AA 2H5EA 2VXBA 2XT6A 3H2BA 4LPSA 4QPZA 2JVKA 1KE1A 3RHFA 3VZRA 1U2EA 4M7OA 1JYFA 5CT4A 5KWVA 1CZNA 1PJQA 4F04A 2ID7A 3KWMA 3TM4A 3DO8A 5LP6F 1GYPA 2WWFA 1DV1A 4GT1A 5M29A 5AI5A 1CDZA 3IPRA 2VF5X 4POOA 2XCQA 4GZ5A 3GZTB 3DE6X 1C7QA 3OZRA 4EFMA 1L5SA 3ZHVA 3KXLA 5B1SA 1N57A 1ZJJA 4YJGA 4MGZR 1HLGA 1JHQA 4O8ZA 4TRMA 4V0KA 4DBLC 2NXCA 1JA9A 2HA4A 1EEHA 4MVXA 2II6A 4OJYA 1YE8A 4B6SA 4HQKA 4H77A 3U1BA 2FR0A 2WDZA 3IP3A 4RGYA 3OETA 1X39A 2VK2A 3KKPA 5G0TA 1XDZA 3WLTA 3E4CA 2GWRA 1Y3AA 5LXTB 4A2PA 1LWNA 5C4MA 3ZZUA 2EAUA 1CRZA 3PNYA 4ROSA 2BMEA 1YJQA 4NFSA 5EKXA 2I1WA 3GT4A 3ZYZA 3FPBA 3F6CA 3IJ5A 2ZWPA 5CYFA 5EJIA 3PIDA 3SM3A 3Q5GA 3QFRA 5EE1A 2F00A 1MB3A 1TYEB 2D06A 4OBEA 3EPHA 4ZZ3A 4KZKA 4DS3A 4WBNF 3STHA 4F45A 5LKAA 1YA6A 2P4EA 1L8AA 2O4UX 2RHOA 4KTVE 3C48A 4LX8A 5TRTA 1LPMA 2EZ8A 4Q7MB 5IM4A 1LNQA 1FIUA 1VL6A 3JZIA 4G4JA 2GZAA 4B3CA 4WCVA 2G67A 1F2UA 4G84A 1KVQA 4I1OA 3RK0A 3V9AA 4AMZA 3Q7RA 1MH9A 2L0XA 5H0IA 2BKLA 2C97A 2IV2X 4ZV4A 2X0KA 1GVNB 4KAXA 4TTTS 4ZAGA 3A4TA 4CMKA 1QFJA 4IMJB 3NHUA 1D7AA 4E11A 4ALLA 4N6OA 2DWCA 4CEIB 1RQPA 1VLZA 4E1AA 2BTEA 4NYIQ 2BBTA 4YAWA 2ZUFA 3K2EA 1L5HA 3OZCA 2VF4X 2QLLA 2VAVA 2WJPA 4GD3Q 4RDIA 4TMWA 5EFZA 4OH7A 3UJHA 1SBYA 1M0EA 3U44B 2DBQA 1KGSA 4O4HB 4EMUA 1CP3A 3GEGA 3F6BX 4D9EA 1TQDA 1KPHA 1XXHE 1DT5A 1LC0A 1M8JA 4R6XA 2M6KA 4LFCB 4RJKA 3SG0A 5C1OA 4KDEA 4A9AA 3VR1A 1GYQA 4RKYA 2YICA 5AJYA 3NUGA 1X2BA 1YI1A 2A9FA 5LQRA 2OK8A 1KDPA 2W6JD 4KV9A 5IKEA 1QYDA 2W5UA 4B81A 3UH1A 3NDIA 1NKSA 4YREA 3BG5A 3W9UA 1T35A 2VDLB 3EIWA 3PPVA 4WDQA 5T3YA 3UCXA 1WVMA 3CH4B 2QVLA 2ZB2A 5DISB 3R41A 1BFDA 2FB9A 1XD2B 4ENPA 4C0HA 1C1HA 1WTAA 4UUAA 1TF5A 4MV0A 3UAVA 3UMFA 2GB4A 4HNQA 1YHNA 3H6GA 3ZNNA 2OFXA 4PLFA 4B47A 2WHXA 3KVOA 1R0RE 1KNXA 1KP9A 4M1EA 4XWGA 4ZAXA 3FYCA 3WLEA 1D3AA 1P8JA 1XN4A 3HM2A 3PDIB 1KAMA 4Q4DA 1QTIA 3S1AB 3WGZA 1JAYA 1IBRA 1TW2A 4PSCA 2C7OA 1A9PA 2ZXUA 4KFUA 1IBSA 3DKIA 2GM4A 5AQEA 4LNUB 1B8NA 2G9QA 3EZLA 2Q4DA 2FAXA 1A2OA 2JLUA 3OC6A 3R20A 2RONA 3ANSA 4BO1A 1T10A 3KLMX 3PDUA 4ER0A 2XYVA 1SHUX 4ZQFA 1W94A 1EWVA 4MPDA 1CERA 5K3DA 3ICOA 1G60A 5A9TA 1A76A 1R4MA 4KAAA 5JNUA 5JMPA 5ALYA 1NLZA 2P7HA 1G21A 4C7OA 3A2LA 5KKAA 1VSBA 2JAQA 4OMDA 2YC4C 1J97A 5CT5A 2VBCA 5HQTA 1PTKA 5DHFA 3U3XA 3H42B 2GWHA 2J5RA 3HZRA 5FTNA 4OHYA 4J3FA 3N76A 3RVPA 4XIIA 3T3GA 3ZJVA 2Z1NA 4A8TA 1DJNA 2V5AA 4NENA 3OIDA 4AS1A 2REBA 4YASA 1R9MA 1A7KA 3MT9A 4XOIA 2Q3EA 5KO2A 2NYUA 4JX8A 5BMVA 3TXYA 3GZ4A 1BD4A 1QKIA 3E9YA 4PTYA 3ZWPA 1ZH8A 2VKTA 4LDQA 1L5LA 5EIXA 2DSNA 2I2FA 2JFHA 1XLUA 4FNAA 2PRJA 3IKJA 1NE2A 2FEOA 3OIGA 4KXUA 2NU8A 3UYLA 1QLHA 3TAUA 4MCJA 4WEOA 3GRPA 4KSBA 3T94A 2QW1A 3K6SA 3E9MA 3N86A 3V8PA 5BVHA 3JPYA 1KWKA 3IAM6 2XODA 4CIDA 2VHQA 3IUMA 3TVYA 1EVEA 1FLNA 4M8IA 5A5FA 3WIBA 2JZCA 4MRSA 1QYXA 2QTRA 3SQXA 5DKFA 2G3YA 4ZAYA 1IH8A 3G5UA 3LBYA 1F8GA 2PUWA 4NY1A 1I9CA 3MIIA 3TSOA 3OJXA 4YP9A 3KOOA 5KMGA 2LIVA 1ID8A 3GCXA 3AF5A 1E1CB 4P86A 1X77A 1EAMA 4KTTE 4JOQA 5DBEX 1Z45A 3N58A 2C5EA 2HQOA 5JJ5A 1GU1A 3RU7A 2PM8A 1DG9A 2EW8A 5CD9A 3ITEA 3ETHA 5AJXA 3L6BA 2ZBQA 2V8OA 3I8SA 4O1HA 4X85A 5ARBA 3HR4A 4EITA 2XKKA 1KMCA 4OGFA 4BLVA 5F5LA 1L8OA 4UFPA 4YR9A 4B85A 5K51A 4O2AB 4U1RA 2MINA 4HVAA 1UKYA 5JS7A 2WMYA 5ALUA 4NONA 3LPLA 3P9KA 3GQBA 1DWOA 3IODA 1UXJA 1VBKA 2JGNA 1JWAB 2I7DA 4RYLA 4LZOA 4MKGA 3HDJA 3IP9A 2ZXEA 2I4OA 5EKSA 1XZQA 5LZ5A 4ZCLA 4GPEA 1ZN9A 16PKA 2PBZA 3GRVA 4JLKA 5JYBA 5A0VA 1PD1A 5E7QA 2P41A 2D00A 4QPPA 3OIUA 2PZFA 2H4WA 3QKTA 4GR5A 2CV0A 4GMGA 4Q9HA 1V11A 1QUFA 1S7CA 1WS6A 1M0WA 3Q5EA 4JEIA 3WMGA 1KZYC 3UJ6A 1NMEA 4DLLA 4JFRA 1CR2A 2ZYAA 1H4SA 4WFQA 2ZBUA 2ZUBA 4HNVA 5BNTA 4K87A 3ER8A 1Y34E 2C4TA 2KPOA 4LNAA 2QWXA 2IS1A 3I45A 3TMKA 1MAHA 2X4DA 3NPMA 4RZIA 1JJBA 4HLUC 4ZQBA 3Q9LA 4OQ4A 2EARA 1JJ7A 4JL8A 4MQMA 4QOFA 5CYGA 4Q6BA 4LYFA 1D0VA 4EHHA 1JDJA 3QH4A 2G28A 3QVWA 1AKVA 3I52A 4FN4A 4OLHA 5ESRA 1L4BA 3NEYA 5G4KB 1NMZA 2N0SA 2ZRQA 3U7IA 1DUVG 5BN3B 2FSUA 4GUDA 1FU7A 4NARA 4F4IA 4XYLA 4JA0A 2RGEA 2HEIA 1Z7WA 1Y6GA 1GTSA 2BUCA 2ZAIA 2J45A 2IBSA 2VHCA 2Y0DA 2GBFA 3GDFA 4G1VA 1DQNA 1SVUA 3HLYA 4N5HX 4ON9A 3L0BA 4BUJA 1WZ2A 2A86A 4IXMA 2A4MA 3AV3A 4P33A 3PUVA 4R84A 3AY6A 5ESWA 2DFTA 2PZAA 2C3YA 5K0GA 3CA8A 4JBIA 4MWSA 2REXB 1MPXA 2QX4A 3W2FA 4QXQA 1W73A 2HK8A 3B6EA 4QXOA 3TNDA 5BUCA 3CH7A 3ZHYA 3TRKA 4MRAA 3M82A 1D04A 2J9ZB 3G1WA 4JDUA 4E2FA 1LBTA 4URWR 2FDXA 1QQ7A 3W3AA 4BL5A 4ZMSA 2NO7A 4Y67A 4WKCA 3SOPA 4ARBA 3H5OA 5AM4A 1N2XA 2VSQA 1USVA 1TZJA 2ZI4A 3OEHA 5DWDA 2AOUA 4FD3A 1Q11A 5E4TA 4N3NA 4A0SA 3E3NA 4F71A 1WPXA 3FNBA 1SPXA 2YOHA 3HJTA 1RPZA 2BKXA 2ISQA 1F6WA 2Z95A 1QYCA 3O73A 4ID9A 4ZOCA 3U9LA 3TW6A 3WE7A 9MHTA 3AUAA 1HF3A 2OE2A 5EG5A 1Z35A 3U0BA 2DR0A 3AHCA 1ECJA 1MIHA 1ULHA 2OBFA 2BEUA 5EZYA 2LW7A 4LDPA 5K8LA 4ZYLA 1XNRB 4H7KA 4W9NA 5T4FA 1YL5A 3NRBA 2I03A 2PCLA 4KE7A 2ZI9A 3C3YA 1EE9A 2JCGA 2YHSA 3A9UA 2PKCA 4NH4A 3L1HA 4E08A 5T7BA 1A1VA 1QCYA 4NS4A 2W6ZA 4BLSA 1I3LA 2C82A 4Q00A 4M1OA 1W1UA 5DU2A 5TMBA 4YHBA 4FFDA 1WPQA 3JWIA 4NYMQ 1RPAA 2AI1A 2I22A 3UYKA 1L5VA 1ZU5A 3PXEA 4MEAA 3X1WA 5JMTA 2MOKA 5JLJA 4Y2VA 1GRNA 1GXSA 1X7HA 1GGHA 1KRWA 1P7ZA 2EDCA 1SIBE 1SULA 4FJ1A 1YE5A 5B36A 1IN1A 1T2CA 2H08A 1GPDG 1OI7A 1YQQA 1QCZA 2RGNA 1ZIDA 3K0FB 2VP9A 3EVNA 1H9CA 1PGPA 4YAKA 5DM60 4C0XA 4JUDX 3SQDA 1MDFA 1YDGA 1E7MA 2PHZA 3UT5B 4FYPA 3SEFA 1OLUB 1GTVA 1QZTA 1TK3A 1ZBDA 3ORYA 1FP4B 4I5FA 4ID3A 4PINA 5LM3A 2C2YA 2ERXA 4D3ZA 1Z5NA 2JLWA 5A6SB 2CFIA 4HDMB 3IEIA 4KP7A 4R31A 4E5YA 3TPZA 5JZSA 3VX4A 3TFOA 3AJRA 1ZXXA 5LQUA 1SU7A 4HWGA 1RJGA 3OLYA 3HCRA 3P4XA 3PU6A 1VYUA 3LO5A 2DY1A 3P9CA 4JL5A 4XD7A 1GAJA 2BEVA 4A1FA 5DULA 1FRQA 1A88A 4MWTA 4MVJH 1W36B 3KQOA 2J5XA 4F5ZA 5C53B 2ZRJA 3O4RA 4PNPA 4B2LA 1NQ5A 5EPUA 2W2LA 3E82A 3NHWA 4EHKA 4RAOA 1NFRA 2AN3A 3HVJA 4FUQA 5CAEB 2IHYA 4D3DA 3E9CA 1HNNA 1FDTA 1U7OA 1FW8A 1TCCA 5CURA 4COOA 3CLUD 1T9KA 5KDOA 3HKCA 1V39A 1NATA 1D2NA 1V6CA 2R5FA 3KKZA 1AUPA 4QU5A 2NO0A 5I6DA 2GPYA 4AJNA 1AGYA 2QAGB 2V7EA 2PDAA 2WZQA 3BH0A 4WWHA 2PH7A 3VYUB 3NTQA 4O08A 4H59A 4UMVA 4CE6A 4LDJA 4CMIA 2JCYA 4JGBA 2XECA 1VCIA 3THYA 3L0OA 3VYSB 3SJUA 3OOWA 3BL8A 4K2HA 5KOHB 2ZXFA 4TWIA 3NTOA 1YVDA 3R6DA 1IDOA 1GEGA 3A32A 4KGZA 1Z15A 2P68A 2DG2A 2XVAA 4BO9A 2H1VA 4H3VA 1S5PA 1E59A 2YWCA 4RGVA 4GZ6A 3BJMA 3BF8A 1YBMA 3DQZA 3L7JA 4JP8A 4DCOA 2Z83A 4FTWA 4PAWA 2DM6A 4ZVPA 3TVDA 1SEPA 3QPDA 4HYQA 1RTTA 1H22A 4XR9A 3ZXIA 4J43A 4CCYA 4ZI3A 2H2FA 1Q1AA 2C7GA 1EFRD 2D54A 2ODNA 1RBYA 4B0PA 3AUXA 4OXRA 1WB5A 3BQ9A 1RWNA 2BGTA 2O5RA 3ZY3A 1OBHA 4JT9A 1JB1A 4IFIA 1DQRA 1UBRS 3I64A 1GA6A 3K16A 1SXGA 3I1IA 3PRYA 3WL8A 1QX3A 2WIJA 4KLNA 4WLUA 2AFIB 2HQ1A 5H80A 4CG0A 5GONB 5LU9A 2OD9A 1RHJA 5B3KA 3U4HA 5CX4A 3G88A 4LY0A 4M1MA 1U5BA 4YP0A 3N2KB 1NIJA 5TJ9A 2WWVD 3RS3A 1V1JA 5BV8A 3KZMA 3IL2A 3SEQA 4AJ9A 1LPBB 2P0YA 3LAWA 2Z6VA 5I4BA 1B8OA 3WLJA 1U9JA 2LDXA 5D85A 3ZQKA 1X1EA 1XDWA 3AR9A 5H1YA 5TQ0B 1C3LA 1D4FA 2DAPA 1ZNYA 1ZNXA 1DDGA 3COSA 4RK7A 4AI6A 2ZE5A 4L27A 5T8KC 1FSSA 1K5HA 1IY9A 1ZGCA 3D0RA 1BJRE 2FPMA 1SXJC 2R7LA 3DF9A 4XWAA 1LLFA 4L9WA 1VE6A 1BJTA 1TKRA 2PJZA 3AT1A 3QU4A 1CW2B 4E51A 2BMDA 2IOHA 1N9GB 3EZ2A 5ALNA 2OKCA 1LQ2A 4NMXB 3P52A 2P79A 3WBJA 5HJ2A 3AFHA 4MKRA 1NBMA 1HGXA 1ZK4A 6AT1A 1KJNA 2PD4A 5DK6A 1YJAA 2POQX 3EYAA 3X1KA 3WP0A 5IYZA 4H0FA 3K4PA 4BBAA 2P5UA 5JT1A 2V96A 4N7BA 1WEKA 3W7BA 1X2EA 3MGKA 4Z1MA 1NKTA 4U8HA 1WXHA 1YB5A 3IQDB 5FNVB 4Q7EA 1VYTA 2PT5A 4XGIA 3TDKA 2ZUUA 5KTMA 1TT7A 1Z3IX 1MO5A 3GPLA 2GEJA 1F2VA 1YVEI 4JVOA 1P73A 4D6YA 2O05A 4EYEA 2G82A 3DMHA 1DJPA 1QPGA 4U3JB 3AM4A 2GAIA 2R6CA 1E6UA 2VDKB 1G8PA 4KO2S 5C46F 4D6PA 2C20A 1E1DA 3D6VA 3ZXYA 3IMEA 3LUKA 1ZBQA 5ERGB 1CPYA 4DIMA 1S0UA 5FP0A 4QT4A 4CNBA 4BNMA 1RQ2A 1RC1A 3BFJA 3E7XA 1KH2A 1ZM7A 3FZGA 3PNPA 4LRSB 2AMFA 2PUHA 1QIHA 2CBXA 4FCVA 4BMPB 3FOEC 4S3MA 4W5NA 2P5SA 1GXSB 4L0DA 4CKXA 3F7MA 3KSDO 2JK0A 5JADA 1R3UA 5ALVA 1X3LA 4AMBA 3ESCA 3Q2IA 1JDBC 4PQEA 4TRJA 5AVQA 4L5YA 3B7WA 1FX0A 3F90A 1X80B 2XA2A 1JTFA 1AO0A 1P1KA 4H35A 1KEEA 3HR7A 3F0TA 4JCOA 1HY3A 3FSRA 1R4ZA 3TBHA 3ZGXA 4JEUA 2ONJA 3WHLA 3OAAA 1Y37A 2HXYA 5JZVA 3RJZA 2B8EA 2BEJA 2G7ZA 4JASB 3B1JA 1Q7CA 4ZDWA 1E1QA 4EEXA 5BURA 1IN4A 3WGHA 3FOWA 4I9GA 1FMLA 5LZ8A 2A94A 2XLCA 3HWSA 3UWOA 2WSYB 1L7NA 3I2JA 3Q0TA 1C1DA 1I2DA 1NF2A 1G20E 1IHPA 2QIOA 3DXZA 3PFBA 1BKSB 2VP3A 1PDVA 3D5EA 4JWTA 3S1LA 3QP9A 2QE7D 4UZEA 3THOA 4ZC1A 4HEHA 5F4BA 3VSEA 4NJEA 1CEXA 4K6FA 3P96A 5M04A 4DLAA 3L40A 4DM4A 3UJNA 3T7JA 2JVIA 1CIVA 1NRWA 2WU3A 3GJZA 1WV1A 2ILVA 4WTOA 2CFSA 4UCXA 4PRLA 1DCKA 2V7XA 4A0QA 3LY7A 4GYJA 2Z4SA 1QKKA 4I99A 5I3ZA 3Q72A 2ZSDA 3A0UA 1D2HA 1JKJA 3O7MA 4I55F 3U40A 5F73A </