3AJAA

Crystal structure of msmeg_6394
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
264
structure length
260
Chain Sequence
ADCPDVMMVSIPGTWESSPTDDPFNPTQFPLSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEGMRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDLVLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPRPGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSGPVHALYNTPQFWVENGQTATQWTLEWARNLVENAPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional characterisation of a lipase essential for mycobacterial viability
rcsb
source organism Mycobacterium smegmatis
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
total genus 84
structure length 260
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ajaA00
4OPMA 4Q3OA 1LPSA 3R3YA 3G9TA 5DNWA 1XKTA 5LKRA 1UKAA 4X00A 5AM3A 3IBTA 2HA5A 3VJMA 2Y2VA 3ZWQA 4TVKA 2VTVA 2DCMA 4GEGA 2QUBA 1GPNA 4JYPA 4HXGA 4Q3KA 5AKYA 3N0TA 3L1JA 3PUIA 3STXA 1MO2A 5AI5A 3BIXA 4ARBA 2XUHA 2QRUA 3WWCA 4G8DA 3MUOA 3WWPA 4E11A 2WG0A 1IUOA 5C8VA 4M0EA 2XLCA 3WIBA 1VOTA 3E1GA 4ZGBA 5FPPA 1XZMA 4C87A 4BRSA 2BKLA 5JZBA 2HA6A 3PUHA 3KWJA 4INZA 1W4LA 1AGYA 2JGIA 4DTCA 3EQ7A 1HDEA 5AI0A 2C0QA 1XFDA 1DTEA 1J06A 3QPCA 4J03A 2AXEA 1MN6A 4J0JA 3LS2A 4V2IA 4P92A 1MAHA 3M3DA 4A23A 1DU4A 2OGTA 1VKHA 1VJ5A 2I78A 2XUOA 1XRPA 2WJ6A 1QIDA 1LPBB 1CUJA 1RP1A 3FAKA 3GFFA 5EHQA 1XROA 1R9MA 1WHTA 3ZLVA 3O4GA 3W2TA 1ZI8A 2H9YA 3AZQA 5FUMA 4LXHA 2PX6A 3U1TA 3FLAA 1QE3A 2G5TA 4PNZA 4A5SA 2XMZA 1X70A 5JD4A 3EBLA 3OURA 4QNNA 5AI4A 4FOLA 3FVRA 5CW2A 5DNUA 3STUA 2JEZA 3AFIA 3DCNA 1AZWA 3I2FA 4CG1A 1GQRA 2O2HA 3O95A 1Q84A 4AXBA 3JW8A 5I8PA 1QLWA 1AX9A 4WCVA 1CQZA 4HZGA 1QFSA 4WJLA 4X95A 2OGZA 1UT6A 4U2BA 4E46A 5AKJA 1XZGA 1TCCA 3X3HA 1K63A 1C7IA 3FBWA 4FFWA 1K8QA 1YB7A 3AJAA 3G02A 3VDXA 1XZCA 4HRXA 1YA4A 1R50A 3W05A 2JGJA 3BE8A 3IUMA 5JAOA 1LPAB 1Y7HA 2BUBA 4J7AA 1CUHA 2BJHA 4MEBA 1CUCA 2BAGA 5ALFA 4UHFA 1H22A 1U65A 5HK9A 4MYSA 1QGED 3PICA 1ORWA 2D0DA 4MWSA 1CPYA 4AN0A 4IQ4A 1FJ2A 4AX4A 3PF9A 1H2XA 1GT6A 3VJLA 5AM2A 2JGMA 1CUWA 4ZV9A 2ZYRA 4MQLA 1F8UA 4KAAA 5HQ3B 5ALEA 4W1PA 2OQIA 3W04A 3WK4A 1XLWA 1UOPA 3H17A 3HSSA 3BXPA 3ED1A 2QR5A 1XRMA 4OYYA 3GROA 1JJBA 3QPAA 2JBWA 3W06A 2HU5A 4M0FA 1TCBA 2O7RA 2GYVA 2ZYIA 5LZ7A 2Y6UA 1R3DA 4KR0A 4J0HA 3SC2A 2DSNA 4N5IX 2WJ3A 2CMFA 4EB0A 2HDWA 4Z49A 4HRYA 5D3KA 3STYA 2O2IA 1VE7A 1XQVA 3WK8A 4EUSA 1JT2A 1QIEA 3TEJA 4OUKX 3NOXA 4X91A 3AILA 1GXSA 1Q83A 3LIPA 4GI1A 2RHWA 2K2QB 4UHEA 1JKMA 2DQZA 4UUQA 3WQHA 3I6ZA 1K6EA 2HL6A 5D7BA 4G5XA 5AIBA 4J0KA 1ZJ5A 5KBYA 3VVLA 4BZWA 4E14A 4PV7A 1BN6A 2HU8A 3AIOA 5ALWA 5ALJA 5JZSA 5I7UA 5ALHA 2ACEA 3D5EA 2ROQA 2WG1A 1TCAA 2V9ZA 5AICA 3WYDA 1XRLA 1JU4A 3D2BA 1DT3A 4RPCA 4UHBA 1JFRA 4PQEA 2PBLA 3FSGD 5CRIA 1OXMA 4X90A 2NW6A 3NUZA 4C4ZA 4ZRDA 3WK9A 3PFCA 3IUQA 5JYCA 1BU8A 2HRQA 4FKBA 4ARAA 3TRDA 5YASA 4EA6A 2VJAA 3M82A 3WLAA 3D0KA 4QDOA 5AI6A 4OU5A 5AI8A 1EX9A 1X2EA 3A6ZA 2FJ0A 5HK8A 4WY8A 4QZVA 4OD0A 3WL7A 4DNFA 1BS9A 3H2GA 3GBSA 5A62A 4IO0A 4B82A 1S8OA 3Q8WA 3FYUC 2V97A 2Z3ZA 1QIHA 2ZVDA 3H1BA 4N8DA 5K3AA 1TKRA 4F60A 1TIBA 2ORYA 4KJXA 5I9IA 1NU8A 1FFBA 5BOVA 2QZPA 3R3UA 4PF1A 5A7HA 4AO6A 4Y2TA 1HLGA 3WWEA 2PU5A 3C43A 3C45A 4BVKA 3CCCA 3DD5A 4JYMA 1CLEA 4WFIA 4X94A 1CUFA 3QMWA 2D5LA 2ZYSA 1F0PA 2I3ZA 2XB6A 3AINA 2VSQA 2WTNA 5IH7A 1W76A 5HF6A 3KDAA 3GUUA 4OB7A 2XQKA 5FLKA 1QFMA 3WKBA 1ETHA 4CFSA 3BJRA 1H23A 3TGLA 1DQZA 2HA7A 3WZLA 1EVQA 3BF8A 5FKJA 3K6KA 4BCCA 5T4BA 4X3CA 4AZ3A 5ALMA 4PO3X 4AQDA 1TK3A 4N5HX 3SX4A 3G9XA 3OOSA 2JGFA 2HA3A 4L0CA 2CB9A 1IVYA 1WB4A 2XMSA 1SCQA 3HXKA 1QONA 4MQMA 2CKMA 3C5VA 2ES4A 4X92A 5JADA 4EZIA 4UHCA 1DX4A 3A2LA 2XQIA 1EI9A 2QXUA 4A16A 1EDEA 3FLEA 1E8DA 2VEOA 4Y2JA 5FP0A 1MJ5A 5LP1A 1DQYA 4FMPA 4CI9A 1P0QA 3FYUA 5ALVA 1H2ZA 3O4JA 3WL5A 3HC7A 3H04A 3B3QA 1PV1A 2XUIA 2VATA 4FDMA 5HF8A 3RLIA 5CT8A 1CUYA 3T52A 3S2ZA 3CN7A 1VA5A 1P0PA 4QDZA 3IVMA 5CXUA 3VJKA 4BBZA 1KU0A 1CRLA 5AM5A 5BWCA 2PKYX 5ISMA 4W9RA 5ALYA 2DQYA 5JD5A 2IX9A 1IUPA 1CUZA 3DS8A 5ESRA 4RE5A 1MNQA 1B6GA 3WL6A 2C5GA 3G9UA 4U2EA 5ALKA 5SYNA 2VT6A 5ALXA 4F21A 5AI9A 1DX6A 1A88A 1CUUA 1XQYA 3O9MA 3QM1A 4Y2SA 1QTRA 3ESAA 5AIAA 2WHQA 2XMRA 2WQZA 2B4KA 4W1RA 5DYYA 3EQ9A 1QIIA 5A7FA 1DWOA 4Q1VA 1CQWA 3DLTA 2HA4A 3C8DA 5AH0A 1BEEA 3IA2A 4J0IA 3HRHA 4NMWA 5F4ZA 4K2AA 3H2JA 3V9AA 1L7QA 5HFAA 3H2KA 3F98A 1TQHA 3WKDA 1F6WA 3QITA 4NZZA 1SCKA 3DOHA 4MWTA 1NX9A 3I2JA 5D3ZA 4DSZA 1N5RA 1SC9A 5CH5A 2XMQA 4X6XA 5ALLA 2PU7A 4RGYA 3O9VA 5LIPA 1BCRA 5HQ3A 2WM2A 1JU3A 4H7JA 3C6ZA 2VF2A 1ZGBA 1EB8A 2ECFA 2OCIA 3LIIA 2GBGA 4JNCA 4DM7A 3QBJA 1G5FA 3V48A 3E4DA 2C4HA 4YX9A 2Y1KA 4BCBA 5LZ9A 4K6HA 4JH0A 2WTMA 5JARA 4PW0A 1WB6A 2H7XA 4FLEA 2XT0A 3R3WA 3L1HA 1XZKA 3QH4A 3WJ2A 1UZAA 4UBIA 1BRTA 2PL5A 1BEZA 3G0GA 1EB9A 4BAGA 1MX1A 4AMYA 3I2GA 4EY4A 4B80A 2ZYHA 3O4IA 3WYNA 2J3DA 4BE4A 3CCBA 4UBKA 4D9JA 3FSGA 4KYVA 5AK6A 1XZDA 4QLOA 1HPLA 3E3AA 2OAEA 1U2EA 2CJPA 2XUFA 2QKYA 1K4YA 4HTAA 4KEAA 4QDUA 3A70A 3JYHA 1QZ3A 1G4HA 3EQ8A 4Y2PA 4ZV7A 2JGLA 1EVEA 2WJ4A 4PSDA 5C7YA 2ZSIA 2XUDA 5JASA 2E3JA 3ANSA 5JIBA 3WMRA 4BC1A 2VJDA 5JANA 3DKRA 2G4LA 2XLBA 5JALA 1U4NA 3G0DA 4HXFB 3OPMA 3VVMA 1O6GA 1ISPA 2Y6VA 4GHWA 5LZ2A 5AKEA 5AM4A 1E66A 4FTWA 2WFZA 4I3FA 3I28A 4G9EA 2VJCA 4X97A 4Y9SA 7YASA 2HA2A 1HKHA 3QPDA 1HQDA 5IVDA 2QUAA 1WPXA 3MUNA 1GQSA 4X71A 2VJBA 4H7DA 5CT5A 2CZQA 3R41A 5D6OA 5T4HA 4BRZA 1BN7A 1CV2A 5LZ4A 3WK5A 4KE7A 5CT4A 1W75A 5AM0A 1L7RA 5HFNA 3FNBA 5BV7A 5ALRA 4DNQA 5LZ5A 2VQ6A 3DDUA 4WDRA 5E2IA 2WFLB 3JWEA 1WB5A 5CURA 3GZJA 1VZ2A 1ACLA 1J07A 2QOEA 2WG2A 4IH9A 1LGYA 4GW3A 4S0XA 1R88A 3G0IA 5AKLA 4P93A 4TGLA 4QE3A 4UFOA 3QZUA 2R8BA 2GBFA 3D2CA 2AJDA 1QO7A 2PM8A 1YA8A 2Z8XA 5LZ8A 1AUOA 2WKWA 2AJBA 2XQFA 3G0CA 1RWQA 5AK3A 4MYDA 3O4HA 1VE6A 1E8NA 4G4IA 4FBMA 4EBBA 1XRQA 2VA9A 5IVKA 4AB1A 5FV4A 5CT9A 1BROA 3G0BA 4FNMA 5LLSA 2JEYA 1GKKA 3WI7A 1Q0RA 1UFOA 5AKKA 5DJ5A 1ODCA 1R4ZA 3C6XA 3GELA 3R40A 1UK8A 1ORVA 2Q0XA 5DYTA 4X85A 4DNOA 4LKOA 3H19A 5AKGA 3BJMA 3KWFA 3ZI7A 4DYHA 3IUJA 2PUHA 5AKXA 3HLKA 4F0JA 1GPLA 4L9AA 1LLFA 4OU4A 1W52X 2H1IA 1WOMA 2OQVA 1W6RA 4O08A 5T4FA 2Z8ZA 4FFVA 1H2YA 2WFLA 3OG9A 4EHBA 3BIWA 1DT5A 2OCKA 1XZAA 3ICVA 1CUEA 4FLMA 2QTBA 4RE6A 4ROTA 4DLNA 2Z5GA 2ZJFA 4OB8A 3IDAA 2OG1A 4DMCA 2XUQA 4AZ0A 1QIKA 3PE6A 1UWCA 2YXPX 4K6KA 2VT7A 3WWDA 2P8SA 4UFNA 5JAUA 4B84A 1YSCA 4FBLA 3FYUB 4DMHA 1SCIA 4U2DA 3D4LA 5EIEA 1UKCA 2OGSA 4Y2RA 1FFCA 1XRRA 4XX1A 3PF8A 2XMBA 1XQWA 1PFQA 1EDBA 3UUEA 2LIPA 3WK7A 2WUGA 5ALQA 3F96A 4C4XA 2X76A 2AJLI 1EXWA 4KACA 1E8MA 2GZSA 4B81A 4J0GA 5EIHA 2AJCA 1DWQA 2WUFA 4KRYA 5C81A 4LXGA 4ZREA 1LZLA 1QO9A 4XVCA 4Y2UA 4AN1A 5KWIA 4C89A 5DLPA 4H0CA 2DHDA 1MX9A 1PJAA 1Q0ZA 5ALPA 2ZJ7A 2BGNA 1CUVA 1UXOA 1EH5A 1TRHA 2V96A 1J2EA 4E15A 2EEPA 5AOCA 4GBGA 2GBIA 4Y2XA 4PSUA 1LNSA 3OM8A 4MEAA 3WJ1A 3ZLUA 2WIGA 4M0MA 4KE9A 2C0PA 3LLCA 5FXMA 2J4CA 1OILA 4IH4A 4FNGA 4G8CA 5EHXA 4CCYB 4OYLA 4H7KA 2XUAA 5C8XA 3B12A 4X93A 3I1IA 3SK0A 1HL7A 1EK1A 2I03A 1K5PA 4CG3A 4P08A 2QM0A 1ZD3A 2OAGA 1SOMA 2CUTA 1ZD2P 1UOOA 3MGAA 1G66A 4Y7DA 4H7FA 4BC0A 5EGNA 3CXUA 1I6WA 3A2NA 3NGMA 2BUAA 2W22A 3D2AA 1M33A 1CFJA 2AJ8A 2WIJA 3IUNA 5K3BA 1VXOA 1GZ7A 5JZ9A 1YCDA 3ESBA 3I6YA 3Q0TA 3ZPXA 1Y7IA 1A8SA 1VLQA 2HFJA 1CR6A 4B6GA 5J3JA 4BAUA 4Q3LA 1AMNA 2PSHA 2I3DA 3KXPA 4QDTA 2IITA 1UKBA 2HADA 2WFMA 1NU6A 2XMCA 1QIJA 1YAJA 2XQJA 3I2HA 2OXEA 3IURA 1YS2X 5A71A 5FRDA 4UBJA 2XMDA 3R3XA 3NWOA 1JMYA 3R0VA 3DKKA 1JJFA 4LHEA 2DHEA 5CMLA 2BCEA 3AIKA 2GYUA 4Q82A 3VKFA 1CIJA 1GPKA 2VAXA 2Z3WA 1USWA 4HS9A 4EY5A 4C01A 2EDAA 2HRRA 4XWGA 3B5EA 1SFRA 4DMKA 1ZI9A 3MVEA 3E0XA 5HKBA 2X8BA 1J1IA 5CXXA 4YK7A 1X2BA 3H2IA 4J0CA 4B0PA 4BZZA 2HHAA 2G5PA 1XZHA 5HF9A 4WFKA 2GYWA 4BE9A 4BATA 1ODSA 2QMQA 3WKEA 3BDIA 2XUGA 4IH1A 4OB6A 3AZOA 1XZFA 5DWDA 1FFAA 1JI3A 3WKAA 3G7NA 5T4EA 5AOBA 1LPNA 4B83A 1F0NA 3FWHA 3BWXA 2JGKA 1MX5A 2WU3A 5K3EA 1UK6A 2UZ0A 3K9BA 1THGA 1XLVA 4BTVA 3DNMA 3C6YA 4QEKA 5AKZA 4Y2VA 1P0MA 4XIIA 2C5FA 4LIPD 5EFZA 4AO7A 5BWBA 4MJ3A 4KAFA 4OCZA 1BE0A 1EHYA 4AMZA 1ACJA 2B9VA 3D59A 4C88A 1ZD5A 1VA4A 2OCGA 3ZLTA 2J3QA 3DJYA 2DHCA 2WIKA 1ZOIA 3F9CA 1JMKC 1Y37A 2WSLA 3DYIA 4FLFA 4DNPA 3C70A 3P2MA 3YASA 4UBLA 5AKHA 2ZJ6A 3LP5A 1IMJA 4ETWA 1VZ3A 2PUJA 5ALDA 5C8ZA 4FHZA 1CUBA 1YASA 3I2KA 4GLBA 3H1AA 2QJWA 4G4GA 1XZLA 3RM3A 4KE8A 4GWLA 3OC0A 3D3NA 4BP9A 4QDXA 3C6BA 3OTQA 1UK7A 5JAPA 4BAZA 1HBJA 1MU0A 4ITVA 2RIPA 1LBSA 3G9ZA 3V1NA 1CUGA 3I6MA 2JF0A 4N8EA 1YAHA 1ZD4A 4K6GA 1Z68A 4B85A 1C4XA 1DINA 5K3DA 3DEAA 3F97A 1N1MA 2X5XA 2HU7A 5K3FB 4DMFA 3EF3A 3I1YA 2BFNA 3C8HA 4BCDA 2WLSA 4X6UA 3ZV7A 1CUSA 1YB6A 5ALGA 1N5MA 4G9GA 1UOQA 1CUXA 3HYSA 5AHXA 4H18A 4P9NA 5DNVA 5AK4A 2QXTA 5EIAA 2IIVA 4K5QA 1LZKA 3STWA 1MAAA 4I19A 2WIDA 1E89A 2EDCA 3EIOA 3HJUA 4X7BA 1THTA 5AJHA 2QVBA 5LKAA 2O7VA 1IUNA 3F8SA 4JUIA 1WCYA 1A8UA 4OSEA 3ILSA 2HIHA 3KD2A 4HVTA 3WZMA 5FDFA 5A7GA 5ALIA 1UK9A 1CVLA 1W1IA 1TAHA 2C7BA 1U8EA 4ZWNA 5FPQA 5ALSA 3KOOA 2CEKA 4UFPA 1O6FA 2RHTA 4KE6A 4BB0A 3QVMA 3BF7A 1LPMA 4QWWA 5CH8A 3C87A 2WU4A 1XZBA 4GDMA 4LYDA 4Q34A 3QMVA 3IIIA 5A2GA 3FYTA 4EY6A 5IKXA 1AKNA 1ZIYA 4B0OA 1L7AA 5CBKA 3WL8A 4DIUA 2RI6A 2G63A 4C4YA 2ZSHA 3TJMA 2VAVA 2GBCA 3UMJA 4B9EA 4F5ZA 2J4FA 2XI4A 1DWPA 4QLAA 2PPLA 2O2GA 1ODTC 1XZEA 3WA6A 1FSSA 4BDSA 1E5TA 4WY5A 2HM7A 5IVIA 4H35A 5DYWA 3I2IA 1QOZA 1T2NA 4TPKA 4GECA 1CUAA 3WA7A 1D07A 5E4JA 1LPPA 2WHRA 5AOAA 2ACKA 1KU6A 4J3JA 3DL4A 2XUJA 2PSJA 2ONCA 4RNCA 2FX5A 5EHNA 3QYJA 5DTIA 2XMGA 4J0DA 3HI4A 5JD6A 4BDTA 1ZI6A 2CBGA 1MNAA 1C7JA 3V1MA 1XZIA 4NS4A 1ZGCA 4XJVA 1QTIA 4L72A 1WHSA 5ALOA 5E4YA 3AIMA 3G8YA 2QJRA 4W1SA 2H7CA 2PSFA 4NVRA 3VISA 3HZOA 3RKSA 4H77A 3RK4A 2PSDA 1LBTA 3RARA 1WPRA 2HA0A 4Q05A 1OCEA 3U0VA 3PDCA 3ESCA 2OCLA 3FCXA 2B61A 2QS9A 4CIAA 3R3VA 2WHPA 3DYVA 1XQXA 4H7IA 1QIGA 1YR2A 2RONA 1JJIA 3T4UA 2FJPA 4U2GA 1FFDA 4W63A 5CTAA 1AQLA 3BDVA 3HABA 4CG2A 4QA9A 3W9BA 4HXEB 4MXDA 3WK6A 5ALNA 1H2WA 5ALTA 4KAJA 2WIFA 4PSCA 2WUEA 1MTZA 5HKAA 4JEIA 2R11A 4I4CA 3BL8A 5ALZA 4LXIA 3A2MA 3WIOA 1RYYA 3K2IA 5K3CA 2W6CX 1GGVA 4UPDA 2DR0A 4UBNA 4G4JA 4UHHA 4CIBA 3O0DA 3IB3A 4GXNA 5K3FA 3VXKA 4YPVA 3GA7A 1A7UA 3H0CA 3STVA 4WFJA 3R3ZA 4DSAA 2RGUA 3HEAA 4HAIA 4BTLA 1EA5A 4UBMA 2B20A 3PFBA 5KWJA 1R9NA 3C5WP 2PVSA 1XZJA 1IZ8A 2Y2UA 4B7ZA 3V1LA 1XRNA 1EINA 5A6VA 4W1QA 2V98A 1GKLA 4BVLA 4C6HA 2GZRA 3UUFA 5CT6A 1CUDA 2JIDA 5K5EA 1WM1A 5AKIA 2BGRA 1T4MA 5CH3A 3DOIA 1XLUA 1XKLA 3ANTA 1E3QA 1ZICA 2YH2A 3FOBA 1QIFA 4AO8A 1EDDA 4ZXFA 1B41A 3SWWA 3PI6A 3AZPA 3DQZA 2OPHA 2JGEA 5IVHA 5KREA 1BCSA 3HACA 5HF5A 2WUDA 3AUKA 2H7YA 2XQGA 1R1DA 1CUIA 4DGQA 5ALUA 3LCRA 5EI5A 5HCUA 3H18A 3FCYA 2WILA 3M83A 3STTA 2XUPA 4ZI5A 4CCYA 4BYMA 3KSRA 4Y2QA 5AK5A 2QT9A 1AURA 4UHDA 4G1FA 2DFPA 3FLBA 3ICWA 2PSEA 5AM1A 5FOQA 3M81A 1LPOA 3H2HA 3ESDA 1IZ7A 2HFKA 4YASA 3DL7A 3L1IA 4WDQA 4U2FA 1AC5A 3F67A 4G8BA 6YASA 2XDWA 1YS1X 4Y2YA 4EY7A 2BUCA 1CEXA 1MPXA 4KRXA 4H7EA 4CCWA 4FWBA 2C58A 4BP8A 1ZIXA 4U2CA 2RAUA 5LYYA 4BVJA 3S8YA 1QIMA 1VXRA 5HZGA 5JAHA 3IULA 4QWMA 2YYSA 5EHZA 5H3HA 1P0IA 5E4TA 4L3WA 5AO9A 5SYMA 4IHAA 3FVTA 5AP9A 1ZJ4A 4N8SA 1MT3A 4UBOA 3N2ZB 2XUKA 3QMMA 4LYEA 3W9UA 1KEZA 2YASA 4H7HA 4X6YA 3WWOA 1FFEA 1A8QA 2XE4A 1G42A 2WHPB 5DTJA 1QJ4A 3CN9A 3D7RA 3WKCA 3V1KA 4EY8A 5JATA 1EK2A 1N8SA 2FUKA 4B9AA 2OLEA
chains in the Genus database with same CATH superfamily
4ZHSA 1LSJA 1Q0TA 5IAEA 5JNWA 1UWVA 3OQ6A 1AQ6A 3D8SA 1R0KA 2VA8A 2POCA 3BRSA 1Q7TA 5KHOC 3A1NA 2OYRA 4YDHB 4QXMA 1DTWA 4IX1A 3JYLA 3NHLA 2RH8A 1U94A 4WRRA 2OVBA 3ANNA 3UH0A 4RPIA 5SZHB 4LJAA 5DULA 1GG5A 1SA0A 2C5EA 4NG5A 3E5HA 4KQ2A 2PH1A 3FPCA 1QRRA 4UU8A 4D44A 1C8BA 1AS3A 1TJYA 1KTIA 4WV3A 3JVVA 3NBXX 3OEHD 4QELA 2AKAB 3A4YA 3H11B 4GKJB 1PZMA 1AQYA 1GPNA 2JRLA 1DKLA 1Z3IX 2Y76A 3BB4A 3KJFA 3F2VA 3AOEC 3PHLA 3I8SA 5F3DA 2OYCA 1OB2A 1ZRHA 4M3NA 1K75A 3ZKWB 2JIPA 4HO1X 4HXGA 1GA4A 1INLA 4QO7A 4X1YA 1JF8A 1M1NA 2BL4A 3B60A 4Q3KA 3LKBA 5AKYA 3ETGA 4AICA 1NBMA 3ESYA 1N6KA 3N75A 3OJCA 4KQKA 2ZQ5A 4IQ8A 4GZ5A 5AI5A 1UIRA 4Q7KA 3OOWA 3LQYA 3K6SA 1ISMA 3BIXA 3DWEX 2JCXA 1XBTA 2QRUA 3E22B 2MYPA 3OO0A 4NMLA 2QUIA 2QLTA 4RA6A 1DE0A 4XI9A 4ZANA 3AOGA 3CE6A 3R6LA 2WJGA 3VNRA 5KQRA 2FZCA 2OAP1 3KSMA 4G8DA 1QH8B 2ZRPA 3MUOA 4UATA 5CX4A 3WWPA 4D4HA 2Y0PA 4GMKA 4DA6A 4DV2B 1NRIA 3HKEA 4S0ZA 5EE5B 1TM4E 2FQYA 4C4AA 5J23A 4E5NA 3OT4A 1L5KA 2X6QA 3FUVA 2GEJA 2H59A 3C3JA 1TW3A 4Y1FA 1W88A 3F6CA 3LWNA 1ZESA 4LVUA 3E8XA 2C57A 4PPGA 2G06A 2X5OA 1Z26A 1QH8A 3FN4A 3NAZA 4GYWA 4KDEA 3JWJA 4OH7A 2FEMA 2X1HA 2P2YA 1AGYA 1JG2A 2X40A 4MYCA 4OIFA 3ZU5A 2EGHA 2JGIA 4NYJQ 4Q9AA 3T1TA 1EUDA 4MA0A 4FGWA 4CIYA 4NC9A 4TS9A 1ZS9A 3CZ9A 3GK3A 4L5BA 4QRHA 2FR8C 5K4AA 4NMXB 4LF6B 2NPOA 3PC3A 1GGEA 4JHXA 4LECA 3HKDB 4IVNA 1FW6A 1K7FB 4MO2A 2OT3B 2Y67A 3AEUA 3QV1A 4GMHA 3K9HA 2FWIA 3NBAA 3ZY2A 4BASA 3THXA 4F7WA 5AW7A 1JZQA 2RGYA 3F7TA 1FQKA 5SYAA 3M3DA 1HLPA 1JVBA 1W8IA 4C4OA 1KI1A 5LQDA 2UU9B 1JU9A 3WXBA 1AA9A 1KJZA 1IRIA 5CYPA 2OGTA 3VZCA 2NSLA 4CN8A 4B6OA 2Q6OA 3E0QA 1WLYA 4X8HA 4BX9A 4K87A 4EKEA 1N2CE 4XPIB 1S0UA 1XRPA 1DUSA 2WJ6A 3I6IA 1LPBB 2D7JA 3EWIA 3MPOA 1WVMA 4G25A 3WFZA 4P1ZA 4CEHA 4ZHQB 1RP1A 1AZTA 1IB0A 2A5JA 2FV8A 1TTHA 3UWPA 1R9MA 3T94A 3GFSA 2FZVA 5FOUA 1IEVA 2E4ZA 4ER3A 4K1LA 2DB3A 1PJLA 1B43A 3G8CA 5IBCA 3ZLVA 5HG0A 3QIAA 4US1R 3A31A 5B1DA 2TECE 1JEOA 4PZ0A 1MBZA 3BMCA 4IWXA 1YR7A 2PX6A 1ZC3A 2MYTA 2V5UA 5DN6D 3BIJA 1ZHOA 5ES4B 5EYPA 1I0ZA 2I6SA 3C3XA 4XYMA 3M5WA 3RJTA 1KC3A 5FUXA 4DV3B 4DRZA 2AK2A 4JEHA 4Y8VA 4U2KA 1F06A 2X3FA 2RG1A 2AG1A 4ENSA 1LD3A 3EMDA 1G6Q1 1SPXA 3NH6A 3PPWA 4Q9LA 2XGOA 4YYZA 2X0RA 2GLXA 1QO0A 1PZEA 4MARA 4XXHA 1H6CA 4QXPA 4E5KA 3JAWA 3NR2A 1NFFA 3PFKA 3TE6A 2F7SA 2YIDA 3OFJA 3OLYA 3B48A 3OIWA 5A3VA 2I2XB 3EJWA 5CW2A 1I4EB 4DC9A 4YQEA 2B6NA 2LCIA 2QW1A 3EA0A 3G82C 1JB1A 1BCSB 4QRDA 1SU6A 2W70A 4FZ5A 2JEZA 3UF0A 3N2KA 3QEBZ 2Y4NA 5P21A 2GH1A 1C3JA 1ZGZA 4TLCA 5KYYB 4B7ZA 1QAQA 4B40A 3SI7A 1YVPA 5K05A 2AKEA 3GMTA 1RQPA 5GJVC 2GDJA 2BDUA 4H31A 3P52A 3C48A 4IS2A 4K8RB 1Y8ZA 1AZWA 3ICQB 4CG1A 3T6KA 2WMOB 2HMYB 4CMAA 3UGKA 4BNIA 1QZUA 3ZHYA 4O2BA 1Q84A 5ICMA 5F5XA 3V00A 1DAPA 4OJQA 1U2TA 3EPPA 4PFQA 3VC1A 1LK0A 5IF3A 2PXHA 4WCVA 4HZGA 3A6FA 3IE2A 2C2MA 1QFSA 1ZH4A 2DOKA 3CQ9A 1L0BA 1UT6A 4ND4A 4U2BA 5GAJA 4KYUA 4O2BB 4ZVPA 1BJRE 5G1PA 3L7MA 5FI1B 2H08A 4EL0A 3HS3A 1FVFA 4LSGA 1C7IA 4L0MA 4OXNA 4PZYA 4FFNA 2WKQA 3C74A 3EUAA 2CZGA 5JG7A 4WFQA 5CVCA 5K2MA 1MUUA 1FZTA 4YCJA 5EJ2A 3DOUA 1K8QA 1P1BA 2GD2A 4PPYA 3ER8A 3K0EA 1CDDA 1UWKA 4Z2YA 4CT4B 4EGAA 3COYA 1OHHD 3RRBA 1VKZA 4E7PA 2VYVD 2ZBRA 1E9FA 3JALB 1CQJB 4HRXA 4ND1A 2C3PA 4WLNA 3UANA 5K03A 2JGJA 4QOJA 1X0VA 3ZIAD 3F6RA 4BNFA 3BE8A 4AX8A 3JS5A 1VYUA 3VNQA 1KJJA 2FR8A 3N0RA 3GL9A 3R6GA 2W0SA 5EP1A 3TOZA 1LPAB 4CLOA 4J7AA 1OB5A 2QRVA 4X66B 3QKRA 1CUHA 4P38A 5ED4A 3L4SO 1CUCA 5ALFA 3GGOA 4O5AA 4QJ5A 4MIEA 3FOZA 3Q8KA 3KT0A 1LCIA 3ROEA 3ERCA 3BE4A 1E2LA 4MYSA 1DV2A 2RSLA 1U0EA 2AMVA 1G2PA 1YZVA 4PAWA 5K6RA 2FPPB 3BUSA 1YL5A 1L3IA 1UXKA 4DHWA 2EGUA 1DV1A 1J9ZA 2OV3A 3F4LA 3PL5A 3F1LA 5TPWB 4KKXB 3TOXA 2D1FA 3AJRA 1ICEA 3W5VA 1QH0A 1YR6A 3ZWNA 2OUKA 3RRFA 3EQ2A 1K7XB 1A82A 2X5KO 3NVMB 1H2XA 4WCFB 3AB3A 3EQZA 1GT6A 4LF4B 1P5RA 2JGMA 4LW8A 1TVKB 1DIHA 2JAUA 1GRQA 2DBVO 3ENKA 4ZRMA 2HDOA 4Z9XA 3RYFA 3KQLA 3W5CA 4RKWA 4OI4A 3DAYA 4Z0HO 4HH4A 3DLBA 4AF6A 3CJTA 4RVOA 5ENZA 3I53A 3NRJA 1ZK0A 1IEWA 1IHPA 3DMTA 3WGTA 2H85A 3PJEA 1JA9A 1VRVA 4IMIB 1UOPA 4Y98A 5I6DA 5HNKA 4IO1A 3HSSA 1G20E 4OVKA 1MENA 1Z4MA 1XRMA 2BM9A 3FIJA 4YCMA 1G2OA 5AW6A 3V8RA 2O07A 1LDMA 1QNFA 2ZJ1A 1IC6A 3CTMA 3EUWA 3Q3VA 1Y6JA 4N49A 1ZY2A 3ICOA 2XEDA 2XH8A 3IIEA 3ZGLA 3IUPA 4GGPA 3QPAA 3ZHZA 5CDSA 3ANMA 3HBFA 3W06A 3VJRA 3PUZA 4KSYA 3D7MA 5DLQC 4WVFA 2Q5HA 4MRMA 3F5DA 2O7RA 5JJ5A 2OHOA 3JCZA 3K35A 1GKUB 3PNOA 3SNHA 3O2NA 3OZAA 2V7EA 3O7MA 3RU2A 1P73A 4X8LA 4KR0A 1RXSA 4N5IX 4YAWA 2WJ3A 1R9JA 3RE1A 1Q57A 1UXJA 5B64A 1XMSA 2VDQB 2CMFA 2D8AA 3CURA 5DCLA 3EDMA 4JT9A 1Q21A 4OGFA 4P7KA 1GZUA 4B3SB 2BI8A 2UVPB 3ORFA 1U5CA 4U3JB 2IT1A 5JSKA 3A10A 4A2PA 2O2IA 3HDTA 4W5RA 5LA6B 5TB5A 3WK8A 4OYRA 4M1SA 1P2UA 4P5DA 2FUG6 4YGYA 2R7AA 3TSWA 3ZY6A 3SY8A 4DMGA 5I9BA 4PTLA 2D2VA 5SY4A 4DDWA 5JCZA 4OUKX 5G40A 4DEXA 2NU9A 3KBBA 1G3MA 3D64A 4FHGA 1Q83A 1L4EA 3HL0A 1Z9BA 2FXIA 1FRQA 4GI1A 1KQNA 5LYJF 3U7HB 1D8AA 1T91A 4UHEA 3HZZA 2BI7A 4WXEA 3MQ4A 3ILXA 4DPMA 3R24A 1R16A 1NASA 3C3AA 5FUWA 2GF0A 1XZ8A 3UKJA 2F48A 1K6EA 5EIWA 3ROZA 4BN4A 2BGUA 2NU9B 1EFRA 1NVXQ 1U2PA 4FYIA 4G09A 4B7CA 2IKQA 3ME5A 5A5FA 3DDZX 2WSMA 2GEUA 4FPXA 1ZJ5A 1M10A 4M9CA 4MMYB 2YWRA 3T7RA 3OPYA 3VPXA 3ZDQA 1SR8A 1ZMOA 3L7LA 4N0QA 5C5EA 1KJWA 4IJUA 3R7SA 1SZPA 1QGUA 1WZIA 2RBKA 3CIFA 1R4MA 1ZH2A 2CY0A 4ZDJA 5MHTA 2YJGA 1M73E 4MVJF 3RTEA 2PK3A 1IN1A 4C7OA 1DJMA 4YMLA 4AKSA 2P4QA 3TMYA 3WSWA 1JWBB 5IDWA 5CVDA 5EP3A 4MHTA 2ROQA 5GOZA 4N3AA 1VG8A 2R8PA 3LMKA 4TRNA 4MW0A 5AICA 5FTMA 4P0PB 2O8EB 5KAMA 4MINA 3FSRA 1YHNA 4HWOA 3A9CA 2V0CA 1WMDA 3AT1A 1XRLA 5EXTA 4D79A 4FOSA 1FJGB 1E2MA 2HBYA 3ZW8A 3D2BA 3GFTA 4F4UA 2VHYA 1DT3A 1KQOA 1M74A 2C9CA 3WYFA 2C7OA 2OZEA 3N8HA 4UHBA 1DKRA 3F74A 1B8NA 1JHOA 1FXWA 1FS4A 1P7PA 3NC1C 5CLHA 2O05A 3FSGD 4PXAA 2J41A 5CRIA 1VHTA 3RIEA 3N70A 5D3QA 1X0XA 3ER6A 3WLMA 3MHTA 4ZVKA 4C4ZA 4FWTA 1ARZA 1CFZA 1N1GA 3PFCA 4LYAA 3IUQA 2A30A 4R2HA 1ISSA 5H81A 1BU8A 1TT7A 4FKBA 3OTHA 1JLLA 2ADFA 3ND9A 4ARAA 2D06A 5EJ5A 1UC9A 4JR2A 5FBZA 1KQPA 2VF8A 3B5IA 2V8BA 5HA5A 2VJAA 2WVGA 1BG6A 4JX9A 5BW8A 2D6FA 1WDWB 2MINB 2WB4A 2CVOA 5G4KA 1SPBS 2EJUA 1F8GA 3EEBA 3UHOA 2NVBA 1IBKB 2NXEA 1NR1A 3FCCA 4O2BF 3FHJA 3GJQA 3UOAB 621PA 3AL0C 1KOJA 2FJ0A 3IHWA 3B9QA 4WHMA 2RB4A 3IKVA 1ONSA 5HK8A 1ADFA 2BFPA 2G9RA 2XVXA 1BE8A 4HDRB 1XDUA 4OK6A 2WZDA 2C9DA 4JKOA 1U4OA 2DBZA 2H2IA 3G88A 3LPMA 3MS7A 4IO0A 1E7SA 4MQEA 1OX4B 4V0MA 4B82A 2GTPA 2WT4A 4NE2A 4WZBE 2HGZA 3SCZA 4UNQA 1EGAA 2AL7A 3G59A 5EP4A 5HJ2A 1NULA 1SURA 2ERXA 1JQ5A 5L95A 3JQGB 1FVXA 3UJ8A 1DQSA 2YKGA 3UVEA 3Q7IA 1TKRA 4F60A 1Q0HA 1TIBA 2IQ5A 2N47A 1PGQA 1NBEA 4CCAA 1U3UA 4TKLA 3Q11A 1FFBA 1L7OA 5TDHA 4P3XA 2JD1A 4Q9KA 1W5EA 4E21A 1MFPA 1S3FA 2OV1A 1IZZA 3BRCA 5J9FA 4PF1A 1E2QA 3M4ZA 4OP1A 4AO6A 5AUPB 2P9BA 1QAMA 4Y2TA 2J3JA 2BFAA 2PU5A 2CF5A 1RM0A 3EXHC 3P9PA 5U4QA 3QKIA 1OZFA 4ZQEA 3TR6A 3ZV5A 1EYZA 1QGDA 2FXVA 5CVEA 2RHOA 4FYMA 4JYMA 3S8MA 2E48A 1N2XA 1KR2A 4WKCA 3CR8A 3U3ZA 4P7GA 4CDRA 1ZAYA 4X94A 3IKLA 5IARA 1J1UA 1BS1A 4TMVA 3QMWA 3HPQA 1F8FA 4KMSA 4E88A 1XTJA 1HA3A 4II3A 2VYFA 2Q3CA 1DXYA 2BZ1A 2VSOA 3AINA 4TV9B 2KLHA 1KS2A 1LH0A 2ZJ4A 3IP7A 2IXGA 1YCFA 3K4PA 4RWEA 1NXQA 4EF6A 3FZYA 5KJ6A 1HDOA 4LJ6A 4BV8A 3GLSA 2WTNA 2BEWA 3U40A 3GJYA 4BJHB 3PD0A 3HNRA 3HKDA 1W76A 4DCUA 5HF6A 3VC3A 3DUFA 3CVOA 3HO1A 3HO6A 3U09A 4MUXA 2AQKA 2JLQA 4OB7A 4RFSB 4WA8A 2G82A 5IJAA 3P4XA 4HGPA 4NFYA 5HTOA 2XTMA 3TLYA 2PG3A 4H1TA 3QVUA 3UHAA 1N5JA 2HGSA 3DZCA 1FF9A 3WKBA 3ADBA 5IMSA 4L74A 2IZOA 5TY0A 2BSQA 3CINA 2GKSA 1FFYA 2GRUA 2FSSA 3CLRC 1H23A 4XM2A 2NX2A 4C2BA 4A73A 2AMLA 2Q3HA 1R8YA 4ERXA 2HA7A 2NXNA 3CZCA 4HYEA 4W6QA 5A5GA 5ARDA 1FU4A 3A3KA 4YJHA 4B9AA 1WXGA 4EHAA 3R9KA 4ALJA 5H80A 1QVRA 4MLCA 1GAWA 1TYAE 4X3CA 1OKKA 3C0KA 1FDTA 5F3WB 1K0FA 1NIJA 1PK9A 5EUMA 4AQDA 5D5HA 1ISFA 1YR1A 5I7WA 3TW0A 1DAIA 2Z8YM 5L8VA 4G41A 3FUUA 2NO7A 3OOSA 1ST3A 1G8JA 4EJ6A 5B4VA 2NU8A 5E9AA 2JAOA 4GYKA 4MQMA 4P58A 3MBOA 4JFAA 4X92A 5IEBA 5JADA 2NSHA 1H9AA 4HH0A 3FRJA 4WXHA 1IHXA 1O77A 1ZMXA 5HUHA 4DA0A 1HO3A 1EDEA 1QQ5A 3JQDA 1PU2A 3HY4A 4FC6A 1NW3A 2HPVA 4H17A 4ZT3A 3FLEA 4HR7A 4P4SB 3CR3C 3OP1A 1E8DA 4TXMA 1PWHA 1ZG3A 3CH5A 4Y2JA 2RHLA 1F2TB 1VRWA 3DLHA 3LK7A 5AJTA 1MJ5A 3PXCX 4FMPA 2A3RA 3NW9A 4PCLA 1KAMA 4M38A 1ZA1A 2P9FA 4M0PA 2OXTA 1PHPA 2VPTA 2Y66A 4AY5A 1IQPA 4ROSA 2H2GA 4CMCA 2ZRNA 2WU8A 3N2KB 2RH4A 3I9JA 4F4FA 1YRBA 4TKUB 3NYRA 1PT6A 1G7CA 2X86A 4IMRA 3DF9A 1ZHFA 4GOND 1G3QA 3O38A 1TK9A 1P62B 4MVJH 4JSYA 1VM6A 1V1RB 2H52A 3EJ6A 4WOCA 4Z8XA 1YOVA 1XAGA 2FPRA 3MTDA 3IVGA 1U6IA 2QL5A 3GLIE 2AXNA 3RLIA 3ENWA 5CT8A 3RFUA 3T52A 4PNPA 3S2ZA 3V4ZA 3NDBB 3T41A 4QDZA 4WACA 3DMDA 1ODKA 4D9IA 1C0EA 2RHHA 2AR9A 2ZRDA 3MTBA 2BELA 4N6NA 4IHJA 5EXPA 1F6DA 3VSEA 3BFVA 1C1DB 4M1TA 1KMHA 4FW8A 3OKCA 5IABA 1QC5B 4P86A 2Q3EA 3FNRA 4DNXA 1W36D 1W4RA 2H29A 4LYFA 1D6JA 2DQYA 3OKPA 3X43A 3VYSB 3DV9A 4NF2A 5BXQC 1XTRA 5E6RA 3PGKA 3KALA 1N0WA 3H86A 1CNEA 1CUZA 4YRJA 4C05A 5BVHA 3JRNA 3ESQA 3NM6B 5KC9A 3VZQA 4OO3A 2VWHA 3D0QA 3QLEA 1NI3A 2G5GX 2ECPA 4RO0A 3AC0A 5CLGA 4CTJA 3MELA 1GPYA 2C5GA 2XZPA 2YCLA 2L18A 1F5SA 3D7SA 3MWGA 5DHPA 2JD2A 2DUNA 2CDRA 4B4DA 4DLYA 4FEGA 2MSCB 2VT6A 3EFEA 4DJAA 5E6RB 2JFXA 3BREA 1XI2A 3LVRE 4WK0B 3E23A 4W5QA 2K2WA 3O9MA 3T35A 2ZZNA 3ANLA 3U4HA 1I7PA 3TGPA 2C7RA 1C14A 2YZMA 2IV3A 5KYXA 2YZKA 4N5DA 3KAKA 1OH6A 2WD8A 4ENVA 2QQEA 5UKDA 2P5SA 4HP8A 2WHQA 4TTPA 5MFPA 2C54A 2XMRA 5DGCA 4KWEA 1FUYB 3W78A 3BE5A 1PT7A 2CGEA 3RTAA 2E5WA 4BJ3A 4F46A 3CBQA 4ARZB 4EAAA 1NVEA 4HKTA 1FBTA 1OPXA 2WJHA 2K4MA 2F9FA 4MIYA 5CXSA 3WDKA 4CL2A 2X14A 3EQ9A 4OJMX 3UMGA 3LBAA 3EAQA 1U1EA 1TC2A 4L4RA 5BMVA 1G63A 3B3FA 3CSSA 4HYYA 4GG1A 3FNIA 4I1YA 2NYUA 2VNIA 2GK6A 1GUYA 3OQOA 3A06A 3EQ6A 3F4KA 4MDFA 1IG0A 4C0AC 3SBXA 3O1JC 2PLFA 3SJUA 4BQOA 2EQ5A 4X7MA 1C7ZA 3FOAA 1E60A 2FW0A 4JEUA 3L4EA 4D4LA 3EGXA 4GEKA 3MCTA 3DLAA 3IOYA 4M83A 5ANRB 1LDNA 1Q15A 1EWKA 4CHTA 4YV1A 1HT0A 4WBXC 1V6SA 1IH8A 4NMWA 1SBQA 3OIFA 1KZ1A 3Q15C 4M53A 3TAHA 4ATNA 4Q3NA 4K2AA 5BY2A 2IFTA 1J2UA 2G7ZA 1GNLA 4WERA 5HFAA 1YHZA 3BFXA 1L7NA 2OA0A 2W6MA 2Q27A 1XV5A 1Y5MA 4LY9A 1T8RA 1TT5A 3WKDA 1Y82A 4C0SA 2XVYA 5DWVA 3HMQA 3QUTA 4HAUA 5KSPA 3HA5A 3OAAD 1GTRA 2HV9A 3P2KA 5AOVA 3GRRA 3E9RA 5DXJA 4INAA 9LDBA 4D6XA 5I3CA 1NX9A 2GEKA 3F9RA 3PC8A 3WLNA 1L5HA 1GPH1 4IOKA 1EG7A 1V3VA 3Q8LA 4LDQA 1KAOA 3GRCA 1G41A 2VEDA 2IA5A 2XMQA 1VHLA 3ZIDA 5HKKD 5DOVA 1B8VA 3I04M 2PGJA 4O4JB 4WSOA 1U7OA 2FQQA 3NORA 1D4FA 5LIPA 1M2GA 1G17A 2R8RA 4X84A 1Q0PA 3LGXA 4BV3A 5DI3A 1Q1EA 2GXAA 5HQ3A 5GZ1A 1UQUA 1TPYA 1GXSB 3ADPA 3BKXA 1JU3A 4TZKA 5DSZA 4NYIQ 2ZYWX 1QHHB 4UPVA 3R7DA 4NCJA 4TQUS 5KOIA 1JS1X 2YBDA 2AOTA 3OU6A 1EB8A 4DCNA 3SZMA 1R0LA 1E20A 4OP3A 4TTQA 2ZP1A 4IOJA 1ZGHA 2LV8A 3B3GA 3S55A 3PZBA 2VCHA 1TF7A 13PKA 4RYLA 3TSCA 1VJ0A 1L1RA 4Y6GB 1DAGA 3QBJA 4EGCB 1GPMA 4CUKA 4F3YA 1G5FA 1U28A 1D8TA 2V7UA 3A4LA 4NWIA 3W8NA 4BEWA 3GUCA 3V48A 4YX9A 5DISB 5EIBC 4C03A 1HDYA 2Y1KA 2JLZA 3K09C 2OVFA 1KSJA 4LCBA 1KZGB 2ZUWA 4IL5A 5ULLA 3IA7A 4EF5A 2VDPB 5LZ9A 3A7EA 2UYQA 2P9YA 4YECA 3QJYA 2P77A 5HS4A 4JH0A 1QYWA 5H16A 5DE3A 3DHNA 2BGMA 5JARA 1D2GA 4A0RA 3ZOKA 1D0SA 1OIXA 3KOYA 4C3VA 4D80A 1WB6A 4AJ1A 2VSYA 3NHWA 1YJAA 2H7XA 2ZRIA 1A71A 4L8GA 2GWHA 5TC4A 1U7XA 5D51S 5ERGB 4CUZA 4DWVA 4IJQA 4LJKA 1RXIA 1T2EA 2Q9BA 1PSDA 2Z4TA 2QX9A 4RH0A 5FQOA 5BSKA 1NSFA 2W6NA 2L69A 1MC1A 1SOVA 4XUCA 4ZT2A 4AJ4A 3W0LB 1GOTA 1X1CA 4RHCA 2XWSA 3IJRA 4HTFB 1D2RA 3B20A 4LRQA 5BT8A 8MHTA 1BYUA 1NL3A 1XN1A 4KDFA 4KWHA 4NU8X 4AMYA 1QE5A 4B80A 3JQAA 1JR3E 4DBLC 3ZVKA 2YJ5A 4WQMA 3JD1A 5JJCA 4OJKA 3JQAD 4J7UA 4PTZA 4QTYA 4JBNA 4HQNA 1W5FA 4C1NA 3OT1A 4LJSA 4DR4B 1QK4A 4HX9A 4KBYA 4PANA 1O54A 4N1AA 2J5QA 5CVJA 5J4HA 1Q17A 5IC4A 3GDHA 5E7MA 3WBJA 4Y9RA 4L7VA 2HF2A 4A5OA 5LL6P 3RAEC 3OZEA 1T8WA 1YQUA 1IN5A 3M7IA 3P9KA 4FUTA 1FRZA 4KYVA 3B51X 3VDNB 1WBDA 3BICA 1XZDA 4OLFA 1DPGA 1OFTA 1RKUA 3HJRA 3LH5A 1HPLA 2R7LA 4OHWA 4C04A 3GLHE 2UUOA 3E3AA 2OAEA 1VYHA 4CBVA 2BP7A 1QX4A 5C8YB 1JUDA 1M8JA 1U2EA 4ML3A 2W6JD 3Q7SA 2QKYA 4KR7A 5TXGA 1EXNA 2C3UA 3GGDA 5A9SB 3VGJA 1KEEA 2H4HA 1W35A 2N1MA 2ETXA 4KEAA 3O9ZA 2P1ZA 3T7DA 1BH6A 1ECJA 1TFUA 1LY1A 3AW9A 2FMUA 4G5YA 1D2NA 4TMYA 3DDHA 2P5YA 3V4OA 3IEUA 5DYNA 4HLUA 2JJQA 1XL1A 3VDQA 1XEWX 1XNJA 1M34B 3OH8A 2XCIA 3ODPA 4BNVA 1LK5A 4MW9A 1PO7A 3EZGA 3FTCA 3JYNA 1EVLA 3U26A 2JGLA 2WJ4A 3EGVA 2X0EA 2XUDA 2I4IA 1RYDA 2QYTA 3WO1A 4Q1EA 3AR8A 5LBIA 1JEQA 2O2CA 3WMRA 1KERA 5JAQA 3WADA 1U9YA 2VUIB 1IM5A 3GC6A 2GEBA 3LY9A 4OQPA 5LB2A 1DRVA 3OOEA 3V1TC 2LKCA 2ZSJA 2CVPA 3JZMA 1OH7A 4ZVLA 3E3OA 1CS4C 2G1JA 4NMHA 2R4UA 4ZI7F 3KT6A 2J3KA 4JLOA 5J2TB 3NWEA 4CIVA 4NBLA 2ZBFA 1WXDA 3QWIA 2ZAYA 3X1DA 4EFMA 2O0LA 3TJZA 2GCGA 1RVV1 2PYIA 3TUIC 1CZLA 3UBMA 2WYOA 4CM8B 2QN9A 3HA2A 2WFZA 2FEWB 1TCVA 3OFKA 2X9NA 2VJCA 2IYOA 5ESWA 3H5AA 3AEUB 4HY3A 2ZBEA 4D2IA 4YT4A 2AOUA 2B8JA 3A32A 3IHLA 1HKHA 2ZB2A 4R1QA 2I2AA 3PGJA 3V8PA 1WPQA 2OCDA 3QPDA 3ZJVA 3K1YA 4WZAE 1Q2XA 2VZLA 1PT9A 4KO2S 1FTYA 1W94A 4BEVA 2QUAA 3AR9A 1KVRA 3EGWA 4Y9DA 3TM5A 4OQZA 2A88A 1YZKA 1GQSA 1P39A 1X15A 2B1GA 2BFEA 2YUTA 3I1FA 2ZUCA 2H63A 3QSYA 2JHFA 4FT4A 2I22A 3R6DA 4BFXA 4C0QC 1X19A 4F4CA 2ZE6A 3UO8B 4HZUB 1QSGA 3BQNB 4KQIA 4QIHA 1C7RA 3P9XA 1W47A 5D6OA 3PXBA 3R6TA 4UULA 5T4HA 3ROFA 1E77A 2KLBA 3PEYA 2B4AA 3EVZA 2KWIA 3PR3A 4GOOD 2JLUA 1GQFA 2BEUA 4BRZA 1QV6A 2YMPA 4BEJA 1L6RA 3MFQA 4IR7A 5K3SA 4AROA 4M0DA 1CV2A 1JEAA 3COPA 3SEFA 5E1DA 1NNLA 2PZGA 3BGOS 4FZJA 1Z63A 4BZPA 1XRJA 2J30A 1K92A 1W75A 5AM0A 3DEHA 4EKYA 1L7RA 2B82A 2VAPA 3D54D 4DSUA 3D6HA 3LRTA 5FI5A 4RD1A 1AO0A 2RGXA 3MWDA 1BTOA 2PAFA 4O2AF 3KJEA 4N5LA 3RJZA 4ZMBA 3OCJA 5ALRA 721PA 2QZJA 4A0GA 4AS1A 1G2QA 2BWJA 4RKYA 4IDEA 1II9A 2FWBA 1KQFA 1C8KA 1ISJA 3HVKA 3R5SA 5DIZA 1P0CA 3SJCA 3DZDA 4AMBA 3JAWB 2ZM5A 3TD9A 2FN4A 4P4SA 4X64B 1FFXB 3MJTA 4GP9A 3PGA1 4IF6A 3EW7A 3QF4A 4JL8A 1HOXA 1DP4A 3HLYA 5GM2A 1AQIA 3LI2A 5T6BA 1VJGA 1NP3A 1J07A 2WG2A 1C0KA 1E4OA 1QR2A 3NGLA 1WTAA 2X2FA 3MS4A 3RW9A 2WQ6A 3CLTD 3GZ4A 4NHOA 2RK6A 1KO5A 3B2QA 5D5PA 4DWWA 4IQ0A 1KH3A 3NTXA 5DHAA 3CVXA 2A33A 3WMWA 5ILGA 1E6LA 2CCGA 2KJQA 5FUQA 3A2KA 4FDLA 1JE1A 3H2YA 4HRVA 1KI9A 3I5YA 4PLHA 2VF7A 2FPOA 3L8FA 2CYAA 3L1VA 1CG6A 1I9CA 3TFQA 3HWRA 2I1WA 3G0IA 3OZTA 5GTDA 2REQB 2D5IA 3FAZA 2IPOA 4P93A 1P7VA 1ZL0A 1IM8A 3UUGA 4MO9A 4WBNA 5LSAA 4DQKA 4E4RA 1NMQA 2NZ2A 3JQEA 1SUCA 1E6WA 2R8BA 3CPSA 3COSA 4V0OA 2DEUA 2XXAB 1GO2A 2AJDA 3T3IA 2ZUTA 4RZSA 1QBGA 3U6KA 1YA8A 5CEEA 2JDID 3WNQA 2Z8XA 4M7RA 2R65A 2ADOA 5LZ8A 2V1UA 1C0IA 1J42A 2Q8NA 1RWXA 5K8IA 1Z2OX 2OMKA 1XMQB 1WY7A 2WKWA 4JBWA 1S7CA 1DX9A 1L2TA 1P3DA 3I9V1 3LBIA 3TLEA 3O4HA 4AP9A 5CITA 4G4IA 3OI7A 1NMSA 4FBMA 4AUNA 4EBBA 5C7IO 4IFEA 1K88A 5E7IA 5A1JA 4CNQA 3MLEA 3HP1A 4R51A 3I62A 3C16C 2E49A 3ZQKA 3LPNA 3FZQA 3AVXA 1KSHA 1BROA 4HPJB 3AEQB 4ZQIA 4FNMA 3M6LA 2IKSA 1HNNA 4CM4B 3O8CA 5LLSA 1U3CA 1QGAA 4PYMA 1LEHA 3W3ZB 1QYCA 4GQIA 5B58C 5HR5A 4Y18A 4A27A 1YKFA 2AOVA 4M0LA 4OQYA 4AWXA 3G8DA 1KWGA 1G20B 3H4MA 3BN3A 1R4ZA 1XD2B 2VVTA 2YN4A 4NBVA 3Q3GE 5JOQA 4ETMA 1RQ7A 4FGZA 3R40A 3UV7A 1QYRA 2IUFA 4P5EA 2Q1XA 4RTKA 3AH8A 4NECA 3GJ8A 5IDVA 3ADKA 1XA3A 4INPA 1LW6E 1AKVA 4J07A 5HUQA 4X85A 2H1OA 4DDHA 1YR9A 2FEKA 2AUNA 1FYVA 2X4DA 5FPSA 5A03A 1XVAA 1J5XA 4PM4A 4GYJA 1YK0A 4F2DA 1OUMA 3KWFA 4LX8A 3ZI7A 3RTGA 3ZVMA 2XD4A 4DYHA 2HR1A 5AJXA 3ORRA 3CB4A 2PUHA 4BZXA 4JY7A 3PLNA 2DX7A 3HLKA 4R3NA 5AKXA 3FZEA 3CR7A 4MHOA 2RB5A 3FXAA 1UBJS 5CFLA 1W52X 1YU9A 2A0YA 2CFRA 2PTHA 3AL2A 3KBOA 5NULA 1R15A 3NRCA 1E3LA 2IYXA 2TRSB 3CWCA 4AJJA 1ADCA 1LKZA 2PFSA 2PV0A 3W3AA 1P2TA 2Q5LA 2Z8ZA 4O08A 5FTJA 2O2EA 3DO5A 5DEOA 5ECYA 3T7TA 3ZDZB 3BH7A 1Y0BA 3KV3O 3QTBA 1JEYA 2C42A 3OY2A 4ITUA 1BX3A 1IG3A 1WVIA 3A8TA 1VLVA 2OCKA 3ICVA 4LNAA 1DKMA 1JPUA 2F8LA 2QTBA 2R84A 3OLQA 4PR0A 1IXRC 5HEKA 3WRYC 3IDAA 5C5CA 5EJ9A 4XH9B 3G7UA 3PC8C 4MRAA 5BQ3A 5MN5A 4QUJA 3BWEA 2OG1A 3ELWA 2XUQA 3ENNA 3S29A 1OKKD 3GY0A 2QIOA 3ZK9A 1SVUA 2FR0A 3U56A 2VI5A 1O0CA 5DMHA 5THQA 3QGMA 1MC4A 3W5DA 5BSGA 5ILQA 5F2KA 1UPFA 1G8KA 3GN2A 4K6KA 3NYQA 3ZXUB 1BYIA 1DBPA 3PEUA 1GUAA 5ENVA 3SBDA 3ELDA 3DPUA 3MAJA 1X9GA 1ZSYA 4IXTA 5F9FA 4O63O 3CLRD 1OLXA 3WGLA 2HYDA 2PCLA 2GF2A 4FBLA 2C77A 6NULA 2EARA 2D5AA 3EIQA 4RMJA 1S2OA 4XE5A 2PL1A 2EF0A 2HIAA 4QX6A 1KVSA 1T0JB 4JP1A 4LVCA 1V3QE 1XXHB 5A3SA 4KVAA 5LP6A 3ZBUA 4LY0A 4R9SA 3M2PA 1PG0A 4BMVA 1XRRA 1YK1A 3RJ5A 1M7GA 2FMIA 2WHXA 1P5FA 5D1HA 3VBCA 2HQOA 3U9TA 4MV4A 1O94D 3QU9A 3TOCA 2COKA 3NWBA 4J9VA 4JA0A 3KLOA 1ZD9A 2CJXA 4R81A 5DGIA 4BFCA 1J2RA 2BTEA 3LT4A 3BB3A 2CJYA 1BQ3A 2WKRA 3U4GA 4AIRA 2LIPA 3E8SA 2AXPA 3BMOA 4ZO6A 4XVRA 2QRKA 2QGFA 2P2SA 1F20A 2DPMA 3BZUA 3F96A 4DR3B 2Z1MA 1Y1KE 1SIWA 4EHIA 2AJLI 3EDCA 4CXMA 4E03A 1NPTO 1DGQA 4B81A 1IOLA 1PZFA 4IILA 4LBZA 3RGWS 4QG3A 1D1PA 4F6RA 2ZYGA 1SUDA 1O94C 1DWQA 1XYGA 2AJCA 2WUFA 3BM5A 2X42A 4J1QA 3UGJA 5NLLA 1HYEA 1P8JA 3AY7A 1G0OA 1EUCA 1P1IA 3QHQA 3WRWA 2MSEB 4PWYA 2DERA 1E1QA 2JKZA 1TEZA 1ES9A 1VJTA 1SVWA 1SCJA 4JV5B 1BGXT 4S24A 3UAWA 4EUHA 4LXGA 4ZREA 1JSLA 4UASA 4UZEA 3COVA 4XVCA 1E64A 1TOAA 4Y2UA 16PKA 1FC0A 2NYAA 2YRFA 1PJ8A 2GMWA 5LXTF 5KWIA 2PUAA 1VG9B 2R7MA 2XZTA 2XW6A 1U7UA 3LC0A 3N74A 5FT9A 5K0EA 1BGVA 2IZ6A 4H0CA 3ZXXA 3E82A 4GVPA 4Q02A 5BP7A 4P0QB 1C1XB 1MX9A 3T4XA 2CVHA 2VAMA 5WRFA 3M49A 2QM3A 2YNMD 4A0QA 5IT0A 1PJAA 1SVNA 2ZROA 4ZEVA 2C2GA 2ZJ7A 1VIVA 4HFRA 1BQEA 2GXSA 4NV3A 4QUHA 3A9RA 3ZGZA 3ZD6A 3P26A 1AN0A 1MA3A 4M9UA 3U60B 2GZAA 3A4TA 4ICIA 2BFBA 4X1IA 2XRMA 4F8JA 2OO5C 4TVOA 2X4LA 1FXWF 1HQKA 1R8QA 2GI4A 2KBFA 3AY0A 3M3HA 4Z86A 3T5GA 3VTFA 4E15A 2EEPA 5AOCA 1O57A 1Q50A 4WZAA 3HKBB 4Y2XA 5L7TA 4IGKA 3JWHA 1E9DA 1XFAA 3IPRA 3ZLUA 4LTDA 1Z4PX 4Q93A 4OGKA 1H0RA 3WNVA 1Z5UA 2BGJA 4GE0A 1H2BA 3LLCA 2PD6A 5FXMA 4NOLA 1NWHA 2D54A 3AETA 2GB4A 2I6FA 4U4AA 2ORED 4OBXA 4Q7MB 4MS3A 1TGYA 4JLNA 1W2WB 2WF7A 4OHYA 1B42A 1P4HA 4XYBA 3KCQA 1JH8A 4HEJA 1OD6A 4H7KA 3RRXA 4F5DA 2DPHA 3E9YA 3ZD8A 2V7QD 3KDSE 4IDFA 4FYJA 2PT6A 1BXZA 1R0YA 2LGJA 3PJRA 4F97A 1SH7A 1CJVC 3ZV3A 2B94A 2HPAA 3ONDA 2FJUA 4X93A 3SF8A 4B3IA 1DEKA 4FX2A 4XQ9A 3LA8A 4QPJC 1RCTE 1UBSB 4W9NC 1KK3A 1TYEB 4DL9A 1FYWA 2I03A 2QQGA 5FBRB 5I9LA 2ZXUA 2EW8A 2AB0A 4D5GA 2R8YA 1EJBA 1VSTA 2WD7B 4DT1A 1RLIA 1ZD3A 4GLOA 5CX1B 3CONA 2UUAB 4JXZA 1U0OC 2HJ9A 2I66A 3IBGA 3LO8A 3GLQA 1FXUA 3MGKA 3IR6A 2BKAA 3OZRA 2O1WA 4B44A 4QEDA 2NU7A 4M9QA 4M1KA 1UMBA 2A5FA 3KSBC 1XNRB 1MRNA 2XCLA 4BC0A 4LTNA 3DVQX 1QF7A 3FETA 3AVYA 2EOAA 3RBZA 1XK6A 2QTGA 1JEDA 3QE3A 4YA6A 4MVJG 3TWOA 3FTNA 3CCFA 2OKCA 3L6RA 1YJXA 2YTZA 1FP1D 2W22A 4RDIA 5JVDF 4BMYA 3D2AA 4YRLA 4KH1A 3K31A 4RANA 4UNPA 1Y6FA 1DUVG 2HCRA 2K7ZA 1GM5A 2F8SA 5JSUA 4P3OA 3ZKAA 1HMPA 4DVGA 2J5XA 3TDKA 4FIDA 1DFGA 5JZ9A 2QTAA 2EFYA 2RDMA 3ESBA 3I6YA 3S3TA 2XWQA 5A4JA 3Q0TA 4HVAA 1A77A 4D3YA 4M7WA 2BGTA 1L5QA 3C7TA 5FO0A 2Y1WA 1U31A 2IVZA 4E7OA 3UMCA 3O8BA 2EBHX 5F21A 1ECLA 2IF2A 2ZB7A 4DLSA 2KB0A 3QYFA 4DRYA 2HFJA 1PN3A 3EIXA 1ZFNA 2ZREA 4G24A 3SFZA 4G1MB 3WRYA 3M1IA 3FJYA 4B6GA 2PUCA 1MEJA 1M1YE 3E8MA 1SHJA 3LG2A 2B7BA 4YR7A 3NFYA 3ASVA 3PQCA 4PLFA 5I7SA 5A02A 3AHCA 3JXEA 4LYHA 2GCPA 2CXXA 2FPGB 3F5QA 3LUPA 2O2ZA 1XKXA 4OK5A 4RL6A 1UPUA 4URVR 4MV1A 2GTHA 2JI4A 1V8PA 5I47A 1HX7A 2VTBB 3QHAA 4MVWA 1UKBA 3T9DA 2HADA 2ZI5A 1QVVA 4QQ8A 1SUWA 2C2BA 4ZT5A 5CDUA 5K9ZA 1V4VA 4E70A 3AVOA 4Z51A 4ZYYA 1UPTA 3T9BA 2JLXA 4YXFA 4ZO4A 1XVLA 2Z43A 4WKBA 3BYZA 2K87A 1PV2A 1XALA 3I2HA 1NI5A 3RSSA 2PKEA 4AYTA 2EGGA 1N6LA 2OXEA 2EFCB 2WPDA 2ZTLA 3KP1A 1NQ5A 2G88A 3HB4X 5EPEA 5FRDA 5A71A 4E5SA 1L9XA 4ZDKA 2DG2A 1M8GA 1YF3A 1YS9A 3J7AC 1NG1A 1ZJJA 1ZN8A 2IXAA 2AUTA 2R751 1LWOA 1NN0A 4RS4A 5FJIA 3WWYA 2ZB3A 1T1EA 4LHEA 3EVAA 4G0UA 2DHEA 5CMLA 5JLAA 4D25A 3KEQA 4NAVA 5DHTA 4N3CA 1Z4IA 4JB0A 2AHRA 2NZXA 1B0PA 1JIJA 1O2DA 2VAXA 2Z3WA 2O0JA 4D4GA 2PO5A 1KGDA 3NYWA 3ZUPA 3JQ9C 4JEMA 1S8NA 2B1IA 2XNSA 2Q1WA 4HV4A 4AI6A 4X62B 1XHLA 2GPJA 3B7GA 4UE3S 4EG1A 2OBXA 2AWNA 3DZBA 4EFKA 5AUQA 1GCIA 2ZIFA 2FETA 3OZUA 2CWWA 2Z2IA 1V48A 5JWRA 4NCKA 5HKBA 3JWGA 4AG5A 4FCTA 4HB3A 4MIOA 3DMPA 4YK7A 3H2IA 4BZZA 2PT7A 4RVFA 2HCJB 1XZHA 3O8DA 4IOLA 5CNMA 2WV9A 4FHEA 2ZUFA 3I64A 1FDSA 4PBRA 1E5LA 4QD3A 4JELA 2VYVA 4BX3A 3QG5A 1NJGA 3R0ZA 3RRZA 1ZVQA 4U1RA 4V0RA 1JP7A 4I2VA 3T9EA 3KUDA 4FR0A 1B8UA 3GVCA 2GKOA 1KP9A 3LCUA 2IJGX 4M36A 2VWGA 2R86A 4EA8A 5LMNB 1PYGA 2H1HA 4OL9A 3RIXA 4YPOA 1NNI1 3KQOA 1FFAA 5HKKA 2AJTA 3WKAA 4CKXA 4CKYA 4P4NA 3DAHA 3CUTA 1AKYA 4RQUA 1BXGB 3EFHA 2AF4C 4UUBA 1F0NA 3FWHA 4EFLA 5CLFA 1FCJA 4RK1A 3JAMA 3KK0A 1MX5A 1Y9EA 4IRMA 4LDJA 2UZ0A 1WW8A 1K6XA 3OWOA 3SNKA 5C1BA 2HMAA 4XM0A 4EVIA 5JFOA 5LJLA 4PS1A 4NQZA 3PR2B 4PICA 4D42A 8ATCA 1FL9A 2ZYTX 3A1TA 4BTVA 3GEGA 4ZEWA 1KK0A 2DKNA 5FWDA 2QR3A 2QRLA 5CDTA 4C3ZA 4NENB 3DNMA 4XAQA 2P27A 3VSCA 1P91A 1P80A 4QU5A 3F5FA 1ZEMA 2H2DA 2Q1UA 4PIPA 4YI3A 2A6PA 1PS9A 4XIIA 1R0ZA 2MT9A 5TJHA 2JKYA 2LRHA 4V03A 4WZ6A 2IEZA 5IKOA 4BNTA 3LBFA 2BJWA 1HNWB 5EFZA 1I80A 4YDQA 4EO4A 4ZAVA 3SSOA 1NW5A 1QCCA 4FFSA 3JR7A 3FMIA 4XTRA 3RS0A 2X7JA 3UC5A 1M0EA 1X7WB 3R0IA 2N75A 4DMRA 4IV0A 1YC5A 2GILA 4OCZA 5E9QA 5C7OO 3AFMA 1PV4A 1KHTA 1ZOLA 4G1VA 1VI2A 5C8DA 1XDZA 3RHTA 1DJNA 1T8SA 1ZD5A 1W49A 2MMGA 2XA1A 5DTRA 4D9FA 4EX6A 3HU2A 2C29D 4WASA 1CRWG 3IT2A 3GQBA 3RUCA 4DLXA 5FBWB 5JROA 1RWOA 1MKYA 2WSLA 1XXHE 1H4QA 2JLVA 4PYOA 1US8B 4JXJA 2QROA 1GCOA 4GXRA 1ZOSA 4LOAA 4NDZA 3AG6A 4P3KA 2JVJA 2Q4OA 2V6JA 2AYYA 1E58A 3A0UA 3P2MA 4FNOA 4KH0A 1E5QA 1KMMA 4MQFA 4ZO7A 5D6NA 5AKHA 1QCDA 1NR5A 5DTMA 4JJ7A 2PUJA 4RVHA 2H1FA 4EW2A 3EOBI 4K9LA 5BW5A 1K9SA 5ALDA 4B43A 3BWDD 4FHZA 2HSJA 2D5CA 3CMMA 2M1XA 3CTPA 3DE1X 4LZOA 4PC2A 5DW0A 1RYEA 1YASA 3I2KA 3PQDA 4G86A 4GLBA 4AULA 4D9MA 5E3JA 3SVZA 1QHYA 1N8KA 2X0JA 3MJVA 1ADJA 1NUPA 1AZSC 4G4GA 4ZU6X 1S3IA 5ICFA 2H1LA 3K5WA 5H1YA 4QPPA 3EA4A 3FKQA 4PYJA 3ZVNA 4I14A 1C3OB 2IYPA 3B1JA 3TQHA 3D3NA 4BP9A 4H08A 5A06A 2C78A 3K5IA 1YDHA 4O33A 4QDXA 2VDRB 3P9IA 4F6LA 2FZGA 3R8XA 3H0EA 4F3TA 2QD1A 3V6LA 2I7XA 1PS8A 3OE4A 2OK7A 3C6BA 3OTQA 4DYDA 3Q3IA 5K0TA 5L3SA 4DV1B 1Q0QA 1UK7A 1ECPA 1ZQ9A 4J3FA 3EGDB 2EG9A 1PW5A 1YE8A 1PR0A 1HBJA 4PO8A 4Z7JA 1LTQA 4KO8A 4HFMA 3EX7C 2B2CA 2RIPA 4Q9DA 4WK6A 5AYVA 4C4RA 2WTEA 3PTAA 4XUEA 4TWZA 1U3DA 4I1PA 1UXHA 3EXHA 1SXGA 4PLZA 3GX1A 1N4AA 4QT0A 3FTEA 3P9ZA 3IO3A 5H7XA 1YCGA 4LFBB 1G19A 2JF0A 3B5JA 1ZD4A 3PV0A 3M89A 3L6EA 2B78A 1JLKA 5TV2A 3MM4A 1C4XA 3MOSA 2IIBA 4W7SA 4EZEA 3EEOA 3QFCA 2G28A 3DEAA 3F97A 1GZDA 2OV4A 1UQTA 2EFJA 1QKJA 5EEHA 3TB6A 1NOIA 4BRWA 4IVRA 4ZCRA 3EF3A 3I1YA 3H9UA 1D0IA 3NOVA 3IRVA 4KFCA 2AZMA 3DV0B 4KSCA 2V6GA 3C8HA 3SF0A 4UTPA 5DHFA 1FMCA 2P5TB 2UUPA 4HGRA 4ZU3A 3MTJA 3HYLA 1NC3A 4OH1A 4CE6A 4F8EA 1A2QA 3UXMA 4YB8A 1I6LA 1YZQA 1Z18A 2FHSA 2VPYA 5FCDA 2GHTA 2D0OB 1YB6A 2QYOA 3KLPX 2I34A 3P20A 3UMFA 3FM9A 1VFPA 1DTWB 1V8ZA 4I4LA 4PZPA 1F2UA 2EV9A 3DV0A 1N5MA 5E1MA 5IN4A 3MMSA 4G9GA 1MHPA 1ZJZA 1UOQA 4JDUA 3QLVA 3NZEA 3MGBA 3TTUA 2W90A 2P3LA 3MCVA 8LDHA 1XD8A 3MOGA 2R6FA 4Y9TA 5TPZA 3RC1A 4CF6A 1PGNA 3RRYA 1SAYA 4W99A 1JTEA 2OORC 1DZ3A 2J7PA 2FFRA 1Z7GA 1J8FA 3MWEB 4CLRA 5HILA 2VJNA 4MGKR 1OGIA 1M0WA 1VP3A 1SIBE 1MAAA 4NNJA 4ZQGA 3D5QA 4QQKA 4MMZB 4GT1A 4I19A 2WWHA 3IB6A 1W36C 4LV8B 1KAHA 1E89A 2W6IA 2WINI 2RGCA 3AI3A 3BXOA 3EG9B 3N59A 4R4JA 5K8JB 3EBOA 2O7NA 4LS3A 4I9HA 4LYJA 4NU6A 5KI6A 5LQMA 2OBFA 5TF0A 2YOHA 1WUKS 4MB2A 4J0FA 1THTA 2O1XA 3JARB 5H0IA 1S5PA 2PUFA 1G6KA 2O7VA 1IUNA 2XZLA 3F8SA 4JUIA 4REQA 2B8EA 1WCYA 2AMYA 2O6HA 4Z99A 1ZR4A 4OSEA 2FF7A 3FTFA 3T4PA 5AR1A 1IJEA 2FK8A 2IVFA 3C3WA 2PIAA 2WWTA 3H2ZA 5D87A 2EVWX 3WNDA 3WZMA 2CEAA 4XYLA 2J48A 3QBEA 3KLNA 2X8LA 1MVNA 5A0TA 2G83A 3TO5A 1C9EA 1GYQA 2DC1A 3OT5A 4S1NA 1RWBA 1UK9A 4RX1A 2YNMA 4L5IA 4I4TA 2ZYDA 5BMVF 1I1NA 3GMDA 4NNOA 4RVSA 4XDGA 3ZQ4A 3ROGA 3CISA 1CULC 1IQUA 3KOOA 5E95A 3S2FA 3V9PA 5JU6A 1OXKB 1JDSA 4YRZA 1RI1A 1EUCB 5CHEA 5IM4F 3CX4A 5E9JA 2DR2A 4ESEA 2QENA 1LWNA 2COUA 1KYTA 3KAJA 1K3FA 5HJ7A 1IAQA 3QU2A 2GDZA 2GZMA 2GFIA 2G7MC 1Z82A 2FMXA 3GUYA 3PQFA 1GLNA 4UMDA 4JN6B 1XZBA 4Q34A 5TT1A 4CM8A 1UZLA 3IIIA 4CN9A 1IXSB 4M1ZA 3N5KA 4QJIA 1HTBA 3B1FA 3DM9B 1E18A 2KYRA 3L0DA 4BUZA 4EY6A 3OUZA 2M9MA 4B3MB 4BO0A 1AKNA 2PMKA 3IT3A 4QYXA 2PLRA 5JXHA 1RXEA 2DTEA 2FE4A 2OO5A 4QNRA 4LWOA 3NMUF 5CBKA 4TV9A 4FMDB 3ONVA 4Q18A 4QYIB 3JQBA 4BJ5A 1II8A 4L22A 4Y1EA 1Z8NA 3ANXA 1AF7A 1RD4A 2ZSHA 3KQTA 1JNXX 2B69A 2GJSA 4LJ7A 4Y30A 3DMFA 2CXTA 4NR0A 5IXJA 4URUR 5FOTA 5L3RA 1ANKA 2HCBA 1N6RA 1YQXA 2QTFA 3NC4A 3NHPA 4N6GA 4RFSA 4LCJA 3ZZMA 2VWQA 4I9NA 3RR2A 2GN9A 1VMDA 1JL3A 1T1RA 1PLKA 2PPLA 2O2GA 2VJLA 4QLAA 4D98A 1SXJE 1KDOA 4LHXA 4BWYA 3UFXA 3HFSA 1OXTA 3NDJA 3N05A 3CZPA 1UPCA 3OM9A 1E5TA 4BDSA 5C7LO 3Q9NA 2VJYA 4WY5A 1U98A 4RY8A 5IVIA 1Y3IA 3LFTA 1BMFD 5CHYA 1CNMA 2VDUE 2BPOA 1FRFS 2PGAA 4HS4A 4WMLA 2AA3A 1D07A 1I5RA 2C3OA 3ROKA 1ZO8A 5ITZA 3BXZA 3J81k 5DCWA 1A0OA 2WHRA 3L0CA 1RDFA 1F14A 1VB3A 1XRSB 2ZCUA 3EEFA 3NI2A 3VYWA 1G1MA 2R9VA 1TFRA 2X3UA 3I01A 4H6VA 4UHKA 4YP7A 1BFKA 4A3SA 6Q21A 3GCXA 4O02B 2I4LA 4RADA 1OI2A 2PSJA 2ONCA 4RNCA 3RBVA 4YP5A 2F1KA 2DT8A 4FJ1A 1LV7A 2CKDA 2A57A 1MO5A 5DTIA 4EW6A 2WD9A 2XTJA 5GADl 5A6SA 1Z39A 1ZK1A 3B1KA 5LNK1 3CVVA 2P65A 5HFJA 3FMFA 3I01M 4EYEA 3DEZA 3WBFA 2F43A 2QBYA 3JPWA 1Z0JA 1A04A 2NU7B 3WLEA 1V71A 1N4DA 1CVIA 1MNAA 1WY5A 3VZRA 3LCCA 1C7JA 2QJTA 4FI3C 4C7MA 2Q7XA 1VPWA 3RT1A 3RVJA 3COZA 4NS4A 3E61A 5DLYA 3NLLA 2UXBB 4L72A 1JKFA 3RHZA 1LF5A 1K5HA 2XCUA 2R2AA 4CUJA 1WHSA 5C1OA 5TVKA 4EIWA 5E4YA 1PW7A 1VGVA 4O4IF 4R1SA 4J16A 1JRLA 2I67A 2NTEA 1K7EB 4UEQA 3ZUGA 1USIA 1W87A 2ONYA 3EXFB 4D0SA 4JLUA 1Y4ZA 2QPAA 1YZLA 1TF2A 4NYMR 4YRDA 2DP4E 4U0KA 3VISA 4G07A 2DRIA 1JA1A 2FEOA 4D26A 5LMCA 1GTJ1 3QUQA 1AJEA 1PD0A 1WPRA 3GV0A 1KDVA 2PANA 3GLRA 2VCYA 3ICEA 1T4DA 4YBZA 4BFUA 5ADUS 4YPFA 3U0VA 2YQ5A 4BXOB 4HGYA 1DG1G 1UDRA 4L5JA 4UOZA 4JLVA 1UAGA 1GN8A 4G2NA 1TZCA 3KDPA 4R3UC 3U3KA 1NLMA 2Q1YA 9ABPA 2YOFA 2YX1A 5JC1A 3ZK8A 2H5JA 3N6VA 3R3VA 4JD5A 3B1WA 2H3HA 1IEXA 3DTVD 1XQXA 3QI2A 1S9HA 1EP9A 3CY6A 4AZSA 1Z2EA 5BSUA 1Z5WA 2GERA 2DWCA 4XB6B 1PJTA 2YWFA 1QIGA 4ZDIA 1YR2A 3I9LA 4M7PA 2HTEA 1E6EA 2AVDA 1DOZA 2FJPA 4U2GA 4FFLA 4W63A 3IH5A 5CTAA 3SYLA 4EW3A 1AQLA 1FTWA 3HABA 5HZHA 3KETA 4BO4A 3Q5EA 3GJ7A 5E1OA 4IRUB 1JHMA 3W9BA 5HCIA 2FWAA 4K03A 2YN2A 4HXEB 4FKMA 5ITVA 2XVZA 1LDGA 1TX4B 2GR9A 2H00A 4O4IB 5CR9A 1E3WA 2WU1A 3WK6A 4EA7A 2QD2A 1QG2A 1UDCA 3KOMA 4RLFA 2C8VA 1P2SA 3AGQA 4BNDA 4KAJA 1ENYA 4M1WA 3NIFB 3V3KA 1ULSA 2DUUA 2YR0A 1QFZA 4PEVA 3ESZA 3DE6X 4OLBA 3FYDA 3KJNA 2QHXA 3KLMX 1MTZA 2FSVC 3S1AA 1XC7A 2GJ8A 4JEIA 2Q1TA 1D6MA 2FFBA 4I4CA 4M98A 4S2UA 4D8VA 3NBYC 3FUTA 1J9EA 3HDQA 1Z4KA 2E1RA 5ALZA 3WLTA 3IALA 2YFKA 2G9NA 1G20A 1EFTA 3A7DA 3GAAA 1OWMA 5KYWA 3PNVA 2H4FA 4IDBA 5CM8B 4CQMB 2HT6A 1PUIA 2CFTA 3KR9A 4NV0A 3GGGA 1TU0A 3LNTA 5ENDA 1SXJD 1UQRA 4P7FA 1SWWA 2DR0A 3MD9A 3OZVA 5GIOE 1JIXA 1WZEA 4G4JA 3V1UA 1FQJA 4FN5A 1EFKA 4RAOA 2C7GA 1KZ7B 4EB8A 5E1BA 3IS3A 4L4UA 5K3FA 3VXKA 1MJGM 3E7WA 2I9PA 4N7RA 4BB9A 2PZJA 1U6JA 2UZIR 1I3NA 3ZH2A 1CSEE 1ZH6A 2R68A 1KYIA 3CUEF 3STVA 3GA0A 3R3ZA 1O6ZA 1XEAA 3AVTA 1M0TA 4R01A 1YZ3A 1RXUA 3SS7X 1EA5A 1BXRB 3LVBA 3PEEA 4HX2A 2OXCA 4MYRA 3JU3A 4UBMA 5D1NA 5LNK6 1W0KD 3NWJA 5JFTA 1EIZA 4TLAA 5BT9A 5LQUA 3VSAA 4AZ3B 3KOWA 3C5WP 3MWJA 4PR3A 3PU6A 2ZTVA 1IZ8A 1NUHA 3JQFC 1STOA 3VSBA 5JT1A 5A6VA 4GQAA 5KOHB 3IOCA 2P2CA 2VUTA 3IEXA 2D1SA 4W1QA 1PR3A 3KQHA 3ZZTA 1UMDB 1AE1A 3B36A 3BRWD 1NW6A 3PNYA 1M2FA 4HSGA 1S2DA 3W2EA 3CVYA 2C9OA 4FHFA 4C6HA 1NXPA 5DF1A 3SEQA 4ZXPA 1KFCB 3ZI4A 5CT6A 4BQQA 2EFHB 4G01B 4X5OA 3NHJA 1NXTA 5IF9A 1CS0B 2JLRA 3HCRA 1WM1A 2WJJA 2WRZA 4AD8A 1T2DA 4HJRA 1NLYA 4URWR 1P9RA 4N39A 4PN3A 3A4VA 1B8OA 3ZNNA 1BIFA 3DOIA 3SQNA 1YL7A 4EWLA 1EFUA 1MEOA 1XMJA 2P9EA 4MV0A 2IUTA 2X7XA 3IFSA 3ANTA 2ZEJA 2FCRA 4LA4A 5EZSA 3CM0A 3HUTA 1NN5A 3RVKA 3K4HA 4CVNA 4YMWA 2HNAA 1U2GC 1V11A 5H68A 4F91B 2HBQA 1EKXA 2V45A 3V4PB 4B45A 4AO8A 2JI9A 3VZBA 2B83A 2FU5C 5C8YA 1CBUA 4ZXFA 3R8CA 1B41A 4PHCA 5C2JB 1KY2A 3SWWA 3FGZA 4O4HA 4GE3A 4G2TA 2LIVA 4Z9AA 3ZHRA 4KWTA 1RLJA 1CD5A 3TSAA 3BILA 1JE0A 3PWKA 1H3NA 5ECWA 4E4YA 5HP4A 5BQXA 1TZKA 1QB7A 2CNNA 5BV1A 1FEZA 4MVJA 5KQPA 5IAGA 1VPDA 2B8TA 4B3DA 2ID8A 2J6HA 1RQGA 2DBYA 1W4AA 4DIOA 4XJXA 3VV3A 3AP1A 5JAMA 2ENUA 4UUNA 3AFOA 2A9KA 5A5EA 5JC8A 4IUCS 4MW1A 3L7AA 4Q15A 5E38A 3IDQA 2PZ8A 3IL2A 4O25A 1LLUA 5FTKA 1VCIA 2W11A 3BK7A 3FHOA 1NKVA 5L7WA 4YLEA 2WICA 5H9VA 4IHKA 3C98A 4KLNA 1C7EA 2NG1A 4EFDA 3M83A 1K7YA 2NP7A 3TLCA 2UAGA 1Z5ZA 5CNKA 3PCXA 5KWEA 1MA0A 1DJQA 1IN6A 1JSZA 4D7AA 4NXNB 2PZAA 2BISA 4ND8B 5SY9A 3BWCA 4BYMA 4FB4A 1E1NA 4XTCS 3KSRA 5AK5A 4IM7A 4ZZ0A 1L5HB 2LP4Y 3UTDA 3E9EA 3J81A 2NUPB 3DE2X 5BYJA 4ZYUA 2P30A 4JJZA 3QYAA 4J7CA 4JQZA 4HAXA 3NBUA 3UA3A 4K2HA 2Q4EA 3GEHA 5KHLB 3ICWA 5FOSA 4B6FA 3N2NA 5J63A 1LPOA 1IPEA 2BDTA 3M6IA 2TMYA 4C43A 3H2HA 3ESDA 1GKIA 4HN9A 5TJ9A 4BL5A 2OXRA 3G2NA 4N40A 4BX0A 3CW2A 4FN4A 5BNFA 2Z08A 1U63A 4B47A 2XPCA 2BFBB 3K9WA 1MDFA 1RWNA 4PX5A 1CDEA 4AECA 4LCEA 1L4FA 3L46A 3TE7A 1AC5A 4B3TB 4EQ6B 1H4VB 3WBBA 1J39A 1XB2A 3LK6A 3PUWA 4ZCQA 1YMQA 4QSHA 4TTRA 1GPUA 4OQMA 5JSYA 1C9JA 4Y6OA 3UAZA 3ZEAA 4BNWA 2D7DA 1EEHA 4P4TA 4Y2YA 2CZCA 4IICA 4CMEA 1CEXA 3NETA 2I5PO 4EJFA 3U16A 2C58A 1GLGA 3C4QA 3LTEA 1H93A 5KS2A 1YQQA 1ZIXA 2B9EA 2CXPA 3KQYA 4U2CA 1CHDA 1B6SA 4UVGA 1AHHA 3TMAA 5I48A 1W5SA 2AXQA 2ISCA 2I4RA 3HYTA 2CLCX 3WIDA 1WZCA 3PFWO 1K1EA 2B3DA 2IZ7A 3LKZA 3GLFB 3TN7A 4EUEA 2V6BA 4AURA 4D56A 5CA0F 3UPUA 1TEXA 1LBIA 4HGOA 4B7XA 1PQPA 2E85A 2ZR9A 3B6JA 4QWMA 4ENTA 3QLJA 2IHZA 1YVUA 3BJIC 1GSHA 3OZXA 4BMCA 3T3OA 1PK8A 2VKTA 4NESA 1VYVA 3BCUA 1B4DA