3AJAA

Crystal structure of msmeg_6394
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
264
structure length
260
Chain Sequence
ADCPDVMMVSIPGTWESSPTDDPFNPTQFPLSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEGMRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDLVLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPRPGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSGPVHALYNTPQFWVENGQTATQWTLEWARNLVENAPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Functional characterisation of a lipase essential for mycobacterial viability
rcsb
source organism Mycobacterium smegmatis
molecule tags Hydrolase
total genus 84
structure length 260
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ajaA00
1XZIA 3QYJA 3I6MA 1W75A 5ALUA 5K3CA 2WHQA 4FHZA 3BF8A 5ALRA 1QJ4A 4EB0A 3QZUA 1SCIA 1Y7IA 3GBSA 1XZLA 1F0PA 3IIIA 3RM3A 4B82A 4DNOA 5FPQA 1Y7HA 1EH5A 5AIAA 5LP1A 3ILSA 4HXGA 1E8DA 1XQVA 2OAGA 4UPDA 4Z49A 3D3NA 3W9BA 3RKSA 1W6RA 2XUGA 5CH3A 2DHDA 1VKHA 2BUCA 1GPKA 5AKIA 1E5TA 3WWOA 3L1JA 3D0KA 1QE3A 5ALSA 1FSSA 2XMGA 2DHEA 2XMQA 1KEZA 3IBTA 3TRDA 3UUEA 1CRLA 4Q34A 4QWMA 4PW0A 3K9BA 1BCSA 4AXBA 2OLEA 2J3DA 1JU4A 1ZGBA 4MQLA 3K6KA 3WZMA 4OD0A 2JIDA 3PDCA 2PSJA 4YASA 5D3ZA 5DNUA 1ORWA 1VZ3A 3WA7A 2AJCA 5AKYA 3PF9A 1LBSA 5AI0A 2VJCA 1P0QA 3MUOA 1U2EA 5F4ZA 4QDTA 3R3UA 2O7VA 2HA0A 2QOEA 3WYNA 5FP0A 4B9EA 3I6YA 2PBLA 3JW8A 2X76A 2HIHA 1N5MA 2XUFA 4BE4A 1ETHA 4Y2UA 1U65A 3FVRA 3PFBA 4ARBA 2CKMA 1VZ2A 5A7GA 4B85A 4W63A 3I1IA 2D5LA 3WJ1A 4WFJA 3U1TA 4H18A 2RGUA 1XRMA 2FX5A 5EIAA 3D7RA 3WIBA 3V1MA 1MAAA 3VJKA 4GEGA 2WFZA 4Y2VA 1DWOA 5JATA 3WK8A 2PSHA 4ETWA 1N5RA 4LHEA 5I8PA 2XUOA 4EBBA 1CUXA 2FJ0A 1TIBA 2VEOA 4QLOA 1H2ZA 5LKRA 1CUWA 4Q05A 3C8HA 5ALTA 1G5FA 4CIAA 1TRHA 5CRIA 3D59A 2OGTA 3M81A 4XVCA 3H2JA 3QPDA 4KAJA 3Q0TA 2DQYA 1EK2A 3X3HA 3HACA 1QONA 4OYLA 3BDIA 2QXTA 4X71A 4JEIA 4YPVA 3PUIA 2QJRA 2QMQA 1L7AA 1DQZA 4Y2TA 2HU8A 3KXPA 3QMVA 5AM3A 4MYDA 3FYUB 3H2HA 2ZJFA 2BAGA 5HQ3B 3WK7A 5HK9A 5ESRA 4F21A 4J0CA 5HCUA 1K6EA 3FVTA 4BAGA 3FAKA 1EDBA 4GDMA 5CT4A 5AM2A 3V1LA 2EDAA 2Z3ZA 3NUZA 1QGED 2Y1KA 1RP1A 4DNFA 1EX9A 3VKFA 4H7KA 4IHAA 2JGMA 1XLUA 2WJ3A 1A7UA 3CN9A 5AM1A 3DYIA 2AXEA 3SX4A 4QA9A 1RYYA 1CPYA 3IURA 3WKDA 5DNWA 5ISMA 1XLWA 3FLAA 3YASA 5C7YA 2RI6A 1GQRA 3GZJA 2RHTA 2PSFA 1XZGA 1D07A 2XUPA 1THGA 5AICA 2YXPX 5IH7A 3EBLA 1ORVA 4TGLA 4Y2PA 1MT3A 1NX9A 2OGZA 1CUEA 4ZREA 2HADA 2GBGA 2PM8A 1MNQA 5E4TA 5E4YA 1QIMA 1MNAA 3LCRA 4BC1A 2XMDA 1BRTA 2HRQA 1W52X 4C88A 2Z8XA 3O4JA 2O7RA 4V2IA 1CUBA 1E3QA 2Q0XA 4OB8A 2GZRA 4UHCA 5FPPA 1J2EA 4B9AA 1BE0A 1UK9A 5ALOA 2BCEA 1DX6A 5EHXA 3L1HA 4W1SA 4X94A 4IH1A 2VA9A 1GXSA 5K3BA 1JJFA 1OILA 2G5TA 4NZZA 3R3XA 2HA2A 2XUHA 4K6HA 1GGVA 1YB6A 1BEEA 3G0BA 4BVJA 4JYPA 1TQHA 3QM1A 4EY4A 2BUAA 1M33A 4NVRA 5LLSA 3BJMA 1H2YA 5FUMA 3QH4A 4FBLA 2GBFA 4U2GA 3FYUA 5IVKA 5HQ3A 1B41A 1JMYA 4FFWA 5CT6A 4F60A 5ALEA 5T4HA 4ZWNA 4KE6A 4DLNA 1VOTA 3BJRA 1G42A 1W76A 2VJDA 3F8SA 3E3AA 4EZIA 1T4MA 1P0MA 4B6GA 2CZQA 1DX4A 4N8EA 4Y2QA 4O08A 2PUJA 1J1IA 1CVLA 3AZPA 4OCZA 3I2FA 1XZBA 3AIOA 3GELA 3G0GA 3G9XA 1N8SA 5JANA 2PSEA 4Q3LA 1A88A 1FFDA 4BP8A 5AK3A 4Y2JA 3ESBA 4BDSA 1W4LA 5EI5A 1AURA 4UBMA 2PVSA 2ZYSA 2DCMA 3STTA 1HLGA 3DCNA 1F8UA 4G8CA 2HHAA 1XRQA 4DMCA 1OCEA 1YB7A 1MO2A 4GECA 2OXEA 3I6ZA 4AZ0A 5K3AA 3C87A 3ANSA 4UBIA 1AUOA 3WYDA 3HYSA 4H77A 2WIFA 4X6YA 3ZI7A 1CUAA 1UOPA 1C4XA 4BZWA 2VTVA 1VA5A 1VXRA 3WA6A 1ZD2P 4FFVA 3WL5A 4BRZA 5DTJA 1BCRA 5JAOA 1XRNA 1QTRA 5IVDA 1JI3A 4DIUA 2WG1A 1G4HA 3FCYA 1UXOA 3MGAA 2XLBA 4RE5A 2LIPA 1A8SA 5A7HA 4KE7A 3ZLVA 3E1GA 3M3DA 5HF8A 2C5FA 2XMSA 3STYA 1H2XA 2C4HA 2XLCA 3RARA 3MUNA 1QLWA 3A70A 3I2GA 3O4IA 2XMRA 4X6UA 1DWPA 2JBWA 4RNCA 2H7YA 1L7QA 3I28A 4INZA 1Q84A 1QOZA 2OQVA 2WU4A 2R11A 3O4HA 3O0DA 1TCAA 4KE8A 1JJIA 4QDXA 3PE6A 1SC9A 6YASA 4LXIA 5CH8A 1QIIA 1DU4A 5K5EA 5JARA 2GYUA 3WK9A 4H7FA 4PF1A 5LIPA 1QIDA 3G7NA 1JFRA 4B0OA 5JYCA 1K5PA 3OTQA 4QEKA 2ECFA 5AK5A 3DKKA 4QLAA 5IVIA 3FSGD 1QFSA 3B12A 1ZD3A 3ZWQA 4MYSA 5HF9A 2HA3A 5E2IA 4BTVA 2I3ZA 3OOSA 3ZLUA 2XUQA 1XZMA 3OG9A 1BU8A 4WFIA 4X3CA 5D3KA 4IO0A 5AM0A 3L1IA 4Y7DA 3H0CA 4EUSA 2J4FA 1P0IA 3GFFA 1EHYA 5ALXA 4B80A 1YSCA 1FFBA 4LYDA 3WMRA 4JYMA 3HC7A 5ALJA 3CCBA 1MX9A 5HKAA 1N1MA 5KWIA 4U2DA 3H2IA 1TAHA 3S8YA 1TCCA 1XLVA 4G9EA 2WILA 4HS9A 4ITVA 1WOMA 1CUYA 4UHBA 5JASA 2O2HA 2UZ0A 5JAUA 5EHQA 3ED1A 1R9NA 2C7BA 1R9MA 3F96A 3QVMA 3AZOA 1LPBB 1FFCA 5AKLA 2ZYIA 2OCGA 3I2HA 1CQZA 3STXA 2ONCA 4FNMA 1CUJA 3C43A 2OCIA 1LPNA 1EK1A 4N8SA 2H7XA 1ODCA 1PJAA 3HJUA 5AIBA 4J3JA 1CUSA 4DMKA 1RWQA 4K5QA 2BGNA 1DTEA 4K2AA 5DTIA 1QIGA 2FJPA 4UFNA 2BGRA 1X2BA 2BJHA 3C6ZA 4PSUA 3H19A 3DL4A 4X92A 2ZJ7A 3P2MA 2IIVA 3WWCA 1ZD5A 4W1RA 1HBJA 1WPXA 4CIBA 1JJBA 1QIJA 5EIEA 2H9YA 5H3HA 1DQYA 4J0GA 4CI9A 3WJ2A 3VDXA 1XZJA 1ODTC 3G02A 1PFQA 4HRYA 4UHEA 3UUFA 3HLKA 3TGLA 4HAIA 2WM2A 4JH0A 4F0JA 2WFLB 1GQSA 4YK7A 5HFNA 1WHSA 3D2CA 4W1QA 2D0DA 2ES4A 4CCYA 5JZ9A 3QPCA 1PV1A 2HA6A 4FWBA 4OPMA 2FUKA 5AOCA 1KU6A 4OUKX 1T2NA 1TK3A 2PKYX 4QDOA 1BN7A 4XJVA 4QZVA 4L9AA 4K6KA 5JZSA 3FSGA 5AOAA 1AMNA 2YASA 1A8UA 2XMBA 3F98A 4DTCA 5LZ4A 1LPMA 1VJ5A 4H0CA 3V48A 3VXKA 5KWJA 4U2CA 3ZLTA 2GYWA 1CUHA 2WJ4A 2VAXA 1E89A 5LZ7A 2GBIA 2G4LA 4Q1VA 3R3YA 3ESCA 4HXEB 3LS2A 4AQDA 4BP9A 3AILA 3GROA 3T52A 4H7IA 4I4CA 4I3FA 3F9CA 3G9UA 3C6YA 1GPNA 1CUZA 2V9ZA 3IDAA 1OXMA 2BFNA 2PX6A 4A16A 2OPHA 1CUUA 3WL6A 3D5EA 2VJBA 2JGFA 2WKWA 4N8DA 5A2GA 4I19A 2O2GA 2P8SA 4KAFA 4A5SA 3A2LA 2RIPA 4L0CA 1YASA 1F6WA 3IVMA 4LXHA 1EINA 4Y2RA 2WIGA 2WHRA 4BRSA 3D2BA 5AI6A 5FV4A 4U2BA 1QIEA 3STWA 4EY7A 5EFZA 4OB7A 1CUDA 4DNPA 1QO9A 1ZI8A 3M82A 2AJDA 2O2IA 4EA6A 2XI4A 5CMLA 2VQ6A 4BCCA 1IZ7A 3ICVA 4UBOA 1QFMA 4FLEA 1UOOA 1CFJA 1UZAA 3O9MA 4L3WA 4G4JA 1ZICA 1ZI9A 1ZD4A 4KRYA 5AKJA 2WFLA 3N2ZB 4AX4A 1MPXA 4OSEA 2WSLA 5CXXA 5E4JA 7YASA 2OQIA 3WQHA 3BF7A 4BCDA 1XKTA 2B4KA 3N0TA 2H7CA 5ALWA 3O9VA 2ZJ6A 3G9TA 3FYTA 1LBTA 5ALQA 5ALKA 5AKHA 1S8OA 4B83A 2Y2VA 3OC0A 4FTWA 2WIKA 5ALDA 3G8YA 4AB1A 1SCQA 2JGLA 2Y2UA 3H04A 1IUNA 5AK4A 1P0PA 4JUIA 4DMFA 4U2FA 4X93A 2Z5GA 3BIWA 3EQ7A 4OYYA 1CR6A 1UWCA 3I2IA 4FLFA 4B81A 4CCWA 1XQXA 5A62A 4Q3KA 1ZOIA 1E8NA 3H2KA 3ESAA 3DNMA 1QIHA 4DSAA 2CUTA 1CUIA 3VISA 1FJ2A 4PQEA 5ALVA 1AC5A 2VF2A 3V1KA 4Y2XA 4GLBA 1U4NA 1XZFA 3HEAA 4ZV7A 4N5HX 1LPSA 5LZ9A 2EDCA 3WZLA 3DYVA 2IITA 2QUAA 4WY5A 4EY8A 5CT9A 1IUOA 1UKAA 4C6HA 1LZKA 3AZQA 1GT6A 3F97A 1HDEA 5T4EA 3IUMA 2VT7A 3G9ZA 3WI7A 3WWDA 4C4XA 3WKEA 3C6BA 3DOHA 4KRXA 2JGIA 4M0EA 4H7HA 5A6VA 1ZIXA 2B61A 3R3VA 3WK6A 4EY5A 4J03A 2JGJA 2QZPA 3U0VA 4MEBA 1Q0ZA 1K8QA 2WG0A 4DNQA 5HZGA 1MJ5A 2Y6VA 3K2IA 3EQ9A 4G8DA 3IA2A 2QT9A 5HF6A 1Y37A 2XMZA 3AUKA 4MJ3A 4BAZA 3MVEA 5DJ5A 4BATA 4LIPD 5T4FA 5AH0A 1EA5A 5LKAA 1UK7A 4HTAA 4ZV9A 4FMPA 5I9IA 4FBMA 4J0KA 4P08A 4YX9A 2Z8ZA 1CLEA 2QJWA 4DYHA 1IMJA 4MEAA 2YH2A 4MXDA 1SCKA 1UOQA 1XRPA 2I03A 4L72A 3W05A 1UK6A 3AINA 4Y9SA 3W06A 2WUEA 1WPRA 5CH5A 5FRDA 2IX9A 5BOVA 2HFJA 1GKKA 1VE6A 1H2WA 3B3QA 3NOXA 2WU3A 4JNCA 5FLKA 3H1AA 4QNNA 3IB3A 4J7AA 5DNVA 1E66A 5CT5A 5EHZA 1IVYA 5DLPA 4HVTA 4BVLA 2RAUA 2PU5A 1R1DA 2Z3WA 2HL6A 1LPOA 4PSDA 1G66A 1LPAB 3AFIA 1MN6A 3PI6A 5AJHA 3GA7A 2WUDA 5HK8A 3C70A 1VE7A 5JALA 1DT3A 1ZJ4A 2E3JA 2XUIA 1FFEA 4C4YA 1GZ7A 4WFKA 4HRXA 4CG3A 2ZYHA 5YASA 2DR0A 4KAAA 2V98A 2ZSIA 3W04A 4RPCA 2VAVA 3RK4A 3I1YA 2HFKA 2DQZA 3CCCA 2HU7A 4AN1A 3WLAA 1AZWA 1HPLA 5AM5A 3WL8A 1QTIA 5AKZA 4BCBA 2XQFA 4H7JA 4CCYB 2RHWA 1CQWA 3STVA 2DSNA 4E11A 1EVQA 1ZI6A 2WQZA 5LYYA 4W9RA 4ZXFA 4WY8A 5AKEA 4B0PA 3SC2A 1Q83A 3E4DA 4KE9A 1Z68A 2JEYA 3R3ZA 5CTAA 1R88A 4AN0A 3ZV7A 5CXUA 1XZKA 2PL5A 3C45A 5IVHA 5FKJA 3PICA 5A71A 4WJLA 4C4ZA 3V9AA 3KWFA 1XRLA 3I2KA 5JD5A 1EDEA 1X70A 4WDRA 3FCXA 4EHBA 2DFPA 3KSRA 4BZZA 1YA8A 1AGYA 2XUJA 2WLSA 5SYNA 2PUHA 1IZ8A 2QUBA 1NU6A 4RGYA 3R41A 3KWJA 4KEAA 4QE3A 3WWEA 1QIFA 1XZAA 4M0FA 3PF8A 4Y2YA 4BTLA 4AO7A 3H18A 2QM0A 5ALMA 1K63A 5AI4A 1HQDA 1EDDA 2I3DA 5FXMA 1QIKA 2PU7A 5JD6A 4J0DA 3FLEA 2X5XA 3G0CA 1QZ3A 2XUAA 1KU0A 4DMHA 1QO7A 1CEXA 4MQMA 4AZ3A 2QKYA 3FBWA 4WCVA 3VJMA 2NW6A 4AO8A 2XQGA 3DS8A 4IH9A 3OPMA 2HRRA 1R4ZA 3HSSA 4DM7A 1AKNA 4BYMA 1DINA 3IUNA 2HM7A 4E46A 3WWPA 5A7FA 2QR5A 3ESDA 3WIOA 2QVBA 2AJ8A 4KJXA 5FDFA 5LZ2A 1LNSA 4BE9A 2ROQA 2HA5A 1ZJ5A 5C81A 1JU3A 3I2JA 2ZYRA 4X6XA 4X97A 2ACEA 2XT0A 3BWXA 5K3DA 3SWWA 3FOBA 3R40A 2X8BA 2GZSA 2OG1A 2XUKA 3DKRA 4X00A 1W1IA 1WB4A 1UT6A 4XWGA 2K2QB 3DQZA 2XDWA 4H35A 4X95A 2WTNA 3BIXA 4IH4A 1BS9A 1L7RA 3VJLA 4UFOA 4NS4A 1F0NA 1WB5A 1HL7A 1LGYA 2DHCA 1XZCA 2XQIA 1EB9A 2CMFA 1LZLA 3KDAA 1O6GA 5C8ZA 1AQLA 2OGSA 3NGMA 5KBYA 3D2AA 1WHTA 2J3QA 4QDUA 1THTA 3AIKA 5ALFA 1A8QA 3UMJA 4G5XA 1SFRA 2B20A 5ALGA 2CB9A 2W22A 3FNBA 1EB8A 1YR2A 4CG1A 1CIJA 2C0PA 1YAHA 3GUUA 2C58A 2ACKA 1AX9A 2XMCA 4C87A 3LIPA 5LZ8A 2VATA 1XKLA 3DD5A 4BB0A 3WL7A 5AP9A 1YS2X 2WUGA 4EY6A 2WTMA 1CUGA 2HA7A 5DYTA 1MU0A 4J0JA 1H22A 4TVKA 3VVMA 4PNZA 4C01A 4NMWA 1XZEA 3HRHA 1DT5A 2WUFA 3DOIA 4E14A 4E15A 2WJ6A 4FLMA 1USWA 4TPKA 1FFAA 3C6XA 2QS9A 1NU8A 2HDWA 3HI4A 1MX5A 1XROA 4G4GA 4UUQA 1XRRA 5I7UA 4MWTA 4G8BA 1YAJA 3BDVA 4FNGA 3OURA 2ZSHA 3QITA 4KR0A 3W2TA 4A23A 4UFPA 1O6FA 5JIBA 1BROA 5K3FB 4DSZA 3A2MA 2G63A 3E0XA 3HXKA 3WKAA 2YYSA 4G1FA 4UHHA 4XX1A 2WIDA 2B9VA 4UBJA 2AJLI 4AMYA 4FOLA 1MX1A 2OCKA 5EGNA 3ZPXA 2VJAA 2OAEA 2Y6UA 5BWBA 2JEZA 3QMWA 2WFMA 5DYYA 4BC0A 3S2ZA 1UK8A 5AOBA 1XZHA 3TJMA 4Q3OA 4B7ZA 2PPLA 4B84A 3DDUA 3WK5A 5ALNA 2JGKA 1JMKC 1ZGCA 4PO3X 3F67A 2JF0A 1IUPA 1ZIYA 2WG2A 4W1PA 2BKLA 3OM8A 1B6GA 1CUVA 2H1IA 4GXNA 5AHXA 5D6OA 5CBKA 2XQJA 3PUHA 1ACJA 3DEAA 5ALIA 1Q0RA 1C7IA 5CURA 4BBZA 3HABA 1H23A 2OCLA 4U2EA 4GI1A 4OB6A 3DJYA 2G5PA 2V97A 4X91A 3BXPA 4DGQA 5J3JA 1C7JA 5AM4A 1K4YA 3H17A 3DLTA 1UKBA 2AJBA 1VLQA 1SOMA 1ODSA 5IKXA 4IQ4A 2R8BA 3RLIA 4WDQA 4OU4A 3NWOA 4CG2A 5FOQA 4HXFB 4CFSA 5HFAA 1YA4A 3AIMA 1LPPA 3ICWA 1XFDA 4H7DA 4QWWA 3EIOA 4ZI5A 3FYUC 2QXUA 3IULA 5ALLA 5BWCA 2I78A 1UKCA 4S0XA 5K3EA 1LLFA 2CBGA 2GBCA 2XE4A 2VSQA 3LIIA 4UBNA 5C8VA 3STUA 4C89A 4ZGBA 1CUFA 3R3WA 1EXWA 4ROTA 2CJPA 4KYVA 5SYMA 3QPAA 4PV7A 3B5EA 3JWEA 1ACLA 3FWHA 5AI8A 5K3FA 2RONA 3H1BA 4UBKA 1EI9A 5AI5A 5KREA 1WM1A 2WIJA 4UBLA 3LP5A 3QBJA 3H2GA 4UHDA 4F5ZA 4GW3A 5JADA 4P92A 2QTBA 3IUJA 5AO9A 3FLBA 5EHNA 2J4CA 1MTZA 1TCBA 4H7EA 2HU5A 5JAPA 4N5IX 5ALPA 4Q82A 2WHPB 1X2EA 3BL8A 3KD2A 2ORYA 1JKMA 5AK6A 4J0IA 2XQKA 5JD4A 1GKLA 3G0IA 1R50A 1R3DA 4P93A 3V1NA 3AJAA 5EIHA 1WCYA 1BN6A 1TKRA 4UHFA 5AI9A 4GWLA 1BEZA 3CXUA 3DL7A 4ARAA 4FKBA 2C0QA 2C5GA 4BVKA 3C5VA 1GPLA 4FDMA 4LKOA 1I6WA 3JYHA 5AKKA 4OU5A 1DWQA 1JT2A 4RE6A 5ALYA 4ZRDA 3VVLA 2CEKA 3BE8A 3EQ8A 5AKGA 5BV7A 5DWDA 3O95A 3WK4A 3EF3A 3O4GA 1XQWA 4X7BA 4GBGA 3TEJA 4QDZA 1E8MA 5LZ5A 4G9GA 3A6ZA 4LXGA 4HZGA 1UFOA 5HKBA 1EVEA 1HKHA 4G4IA 3CN7A 5CT8A 3C5WP 3WKBA 3KOOA 1VA4A 2PSDA 1CUCA 4K6GA 3QMMA 3C8DA 3Q8WA 5T4BA 5AKXA 1XQYA 4Y2SA 3SK0A 1ISPA 2HA4A 5JZBA 2GYVA 3W9UA 4M0MA 4AO6A 3WKCA 3T4UA 4AMZA 2QRUA 3LLCA 2XB6A 4X90A 4MWSA 4LYEA 2EEPA 3PFCA 3ANTA 1MAHA 5D7BA 1YCDA 5ALZA 4D9JA 1VXOA 2V96A 4P9NA 1YS1X 4BAUA 1J07A 2ZVDA 5JAHA 3G0DA 3M83A 2VT6A 5C8XA 1U8EA 5CW2A 4BDTA 5HF5A 2W6CX 4J0HA 1WB6A 5ALHA 4GHWA 2XUDA 1J06A 5DYWA 4X85A 3HZOA 3IUQA 3R0VA 2JGEA 4PSCA 2WHPA 1CV2A 4XIIA 2BUBA 3A2NA 4KACA 1XZDA 3D4LA
chains in the Genus database with same CATH superfamily
1ZYUA 5HKLA 1P60A 3MHPA 1YZHA 3QYJA 3RVQA 3OETA 3AWIA 4JX9A 4LF7B 5ALUA 2C61A 1ZM3A 1DADA 2WHQA 4PLVA 5K3CA 4Y3UA 3GGOA 4IDBA 3AIIA 4UEKA 4MAFA 4YRQA 4JP5A 3EIWA 4C4AA 3HHEA 1T4GA 2FWMX 3CEAA 1Q15A 5H4GA 5EWLB 1NQ5A 4WUTA 5AESA 7AT1A 1RT9A 4AF6A 1TUBB 4YPFA 2IEZA 5DGDA 4JMPA 5J2TA 4TM7A 3L4BA 1M0EA 4D6YA 4PBSA 4B82A 4QEZA 1ZJYA 3V7UA 3HBNA 1YRHA 3PC6A 2A4KA 2NM0A 1HDIA 3B6JA 2ZWIA 4BFCA 5LP1A 1MF7A 4Q18A 5HS4A 4KQ1A 1DKUA 1E8DA 2EZTA 4NP6A 4PX9A 5JPIA 3WHKA 4IIHA 1Q12A 4FYXA 4CMIB 2GDZA 1DOZA 2OAGA 1ZXXA 2AMLA 3HJRA 3L8ZA 1SXJD 5LOVB 1IG0A 5AXDA 2FFRA 1QS0B 3E4CA 1BJKA 4OYRA 4Q4JA 3J80A 2C5AA 3MUFA 1SXQA 2GXQA 4P4SA 2XUGA 1OJ7A 3AGPA 2WIAA 3CY6A 3CZCA 4IO1A 4BNVA 3HPRA 1UC4B 3L0OA 3LRTA 1IBMB 5HIIA 2BUCA 2K2WA 1VE3A 2F48A 4BFZA 5AKIA 2AEEA 3BGDA 2F67A 3KVOA 4C2AA 3TTSA 2VUIB 4EHFA 1KI3A 5EIOA 3GJ4A 4ZI7B 5TQ2B 3ZHQA 5AW2A 1PEDA 2C7OA 3KZVA 1FU8A 2PRKA 3W9YA 5JFOA 1L8LA 1PR9A 2BDEA 3L79A 3VKHA 3LZCA 1YIOA 2JB9A 4U5QA 4LDQA 2CGEA 3U39A 1IN6A 3TRDA 1W9MA 3K5PA 3H8VA 4UVGA 4CHTA 1J25A 5K09A 1A2QA 1T8PA 1TPYA 2Q50A 1CRLA 2XCQA 4MA0A 4ZQCB 2ZOSA 2JLVA 1N5IA 2YWDA 2R79A 1XDWA 5K8CA 1AHPA 3AERB 2R1UA 4Q4DA 2ASEA 2W70A 2JJ1A 3TL2A 4JXXA 3DV2A 3K1TA 4Q34A 5TSDA 1LU9A 5AXAA 4NIMA 4ZYYA 2XGSA 5F2EA 1T15A 1HRDA 3FMOB 3A04A 2V54A 3F73A 2OO3A 2ZZMA 1NW5A 1ORRA 2HC9A 3HO8A 1S3SA 1LRJA 3VGJA 2O8CA 5MGBA 2IXFA 2J3DA 1LQTA 2CDBA 3RFVA 3WZMA 2JIDA 3MWEA 1BG6A 3HJBA 4H6VA 3THRA 4DCGA 2H4JA 2BKUA 3NHFA 4RHTA 5D86A 3TZEA 2YFQA 4ZEOA 3UXEA 5KO2A 2ORED 2PWAA 5H81A 1USKA 2VJPA 3HHPA 3PF9A 4K1LA 4ZPXA 4K88A 1A2BA 3M34A 3KS9A 2WYOA 4OGFA 3E15A 1LJ8A 1P0QA 4DRXA 5F4ZA 3F6RA 2CXSA 3QEBZ 5DF1A 2PYDA 2BFAA 4RA9B 3EULA 5CDUA 4RVCA 5FP0A 4B9EA 4AF8A 4AJNA 1Z4OA 3LUDA 1TK2A 5EZQA 1V16B 3LUFA 1T8UA 3H3FA 2X76A 1USUA 1QSGA 4Y98A 4E2XA 1SBZA 4YRDA 4BKQA 3T1TA 1J8YF 3CNNA 4Y0AA 4TWJA 4UE6A 1OD6A 3MRVA 4GYYA 2VNJA 1KOJA 2QB5A 1XEXA 3FGNA 4P38A 1ZMOA 3GA5A 2GAJA 3OCWA 3P2EA 3PG5A 4NY1A 4PFKA 4REQB 4XB1A 1M2NA 3TUJC 4ARBA 4B46A 1T5LA 2W6MA 4H1HA 5A7GA 2HT1A 1XMSA 1EJBA 3LPLA 1Q21A 3PQ2A 3NAQA 2ZJ4A 4E5YA 3KIPA 4PYKA 1ZRSA 1AGNA 3E7PA 3KM0A 4QU5A 4W63A 1APBA 2WWGA 2AHOA 2J46A 2XYQA 5EE1A 3TDNA 3WJ1A 4EG7A 2ZQ5A 4ILKA 1ZAKA 4H18A 1DC4A 3BA1A 3MINB 2YXNA 1ECFA 2HRDA 3KSMA 1Z56C 5CVDA 3D7RA 1YT5A 1OPRA 2RAPA 1MVLA 1AUPA 1QHHA 2F3PA 5H68A 3DEHA 3S81A 3JASB 2HHHB 3ND6A 2C4NA 4YAUA 4YHBA 3C3XA 2H65A 5EMHA 4UEJA 3GJ7A 2OOKA 1O9GA 4IDNA 2MWMA 4WBNA 1EFHA 3M5DA 1K7SN 4ALLA 1WCWA 3VYUB 3ZDRA 1MLDA 1K89A 1SKAA 2VBFA 3NHUA 1N5RA 4GOOD 5C0OE 3RS8A 3RDPA 1XNRB 3EF1A 5BSWA 3AR4A 3W5DA 3HR7A 1Z63A 3COPA 2IRWA 3HGMA 4X8HA 4P2GA 2JFYA 1BDHA 1TIBA 4MUGA 1LX7A 2ST1A 3WAKA 4EHIA 2A9FA 3LGXA 5JH7A 1K3TA 2QN8A 4QTTB 4CT4B 4KQ9A 2HLNA 3RIGA 3SNKA 1ELOA 4TQUS 4TLMB 1N5DA 4CIAA 5DK6A 4CKBB 1P91A 2Z2JA 5EWLA 3D59A 3U3MA 2LWIA 3M81A 1G7TA 2EIHA 3IS3A 1TUBA 1T3TA 3DVLA 1YTLA 1NJ1A 3AHEA 3PA6A 4YUVA 5IT5A 1A98A 4GWGA 2V5VA 2VUTA 3NTQA 3Q0TA 4HYTA 5JCJA 5IS2A 5KVAA 2DQYA 3KJNA 2ZE6A 2QP9X 5C8YA 3PX7A 1WTCA 1OYOA 3ZVNA 1JDPA 2QRQA 3KVNA 1ZJ6A 4Y1RB 4Y2GA 1C81A 4O4JB 3VPAA 621PA 4OHYA 1PP4A 2BR3A 2QT0A 3BWEA 4H1TA 2UUCB 5ECDA 3RS7A 4NEQA 1KDTA 1LLCA 1R6TA 3NT5A 4UXIA 2J3JA 3QLVA 3OKFA 1QGAA 3LBHA 4TRNA 4YPVA 2HB6A 4CMIA 1FFXA 1RLIA 1WQ1R 5BNFA 4AJOA 3DPIA 1PEKE 2B1QA 1BKYA 4NJEA 1NPDA 5E4FA 2VJYA 4ZVNA 3P0RA 5LOVA 4MP8A 4EO4A 1QS0A 3RS4A 2QMQA 5DM60 4Y2TA 4D0GA 2P7IA 1ZN9A 2HU8A 2CYCA 2PGDA 5ELXA 2CVQA 5GOZA 3WDMA 2EIXA 2VSXA 1ISSA 1A50B 2GILA 4MYDA 4RKQA 2C83A 3RRMA 3UAWA 2J8ZA 2X0IA 2X9QA 3H2HA 2ZJFA 3NBZC 1OYWA 3CPSA 2OC9A 4PAMA 4EITA 1IQRA 3LV8A 2Q8QA 5ESRA 1M6NA 2XMPA 1UWLA 1YZUA 3KDSE 4J7XA 4BZXA 3COJA 4ZI7A 5TQ2A 1Z5OA 3KB8A 1PEAA 5KYWB 3AO0B 2AOVA 1W96A 4NOJA 3S44A 1YB1A 2JHCA 3KPWA 4JLBA 1H05A 5I9TA 2VF4X 3FWZA 4XQCA 2VYND 4ZT3A 4WMLA 4OIMA 5M3BA 1EDBA 1UQTA 4GDMA 5CX1A 2PX0A 1M2EA 1TC2A 3EVZA 3ILVA 4HYEA 3E35A 3SOZA 1KP3A 4B6SA 5C52B 3AR3A 1JR3D 4RXMA 3AERA 4UEOA 1ZK3A 4YWHA 2ZIFA 1OHHA 4WOBA 5CB6A 2WMNB 2Z3ZA 4Q3AA 1QGED 2ISCA 2Y1KA 3HJGA 1ONSA 2JFXA 4YVFA 1TGVA 4ZT6A 1JDUA 5AOVA 5FTNA 4GOLD 4DNFA 3JQAA 1EX9A 2XVAA 4FFSA 3JYPA 3HVUA 4G1CA 1ZH2A 2R44A 3JQBA 4IJUA 1IXYA 4N0MA 3KQLA 4EP1A 1FTGA 1BWQA 2Q5IA 1VBNA 4WT7A 5K6RA 1AKEA 2JK1A 3IP1A 4F6RB 1XU9A 5FAXA 1KNXA 2VUSA 2GZDA 3IAXA 5JXJA 1V5IA 2OHIA 1VCIA 3DYIA 5J63A 4QA9A 3T7JA 3IQIX 4LJ7A 4EG1A 4EW2A 3OF3A 5JNRA 1QHEA 1RYYA 1ZH4A 2ZI5A 1Z8NA 4B2IA 4RA9A 1CPYA 3IURA 2QG4A 2C07A 2Q6KA 2Z4TA 2ZE5A 2HIGA 5CIWA 1W4AA 4QXAA 3U37A 3U7EB 3H5VA 3FTNA 3HV2A 4D3FA 2I67A 3V8PA 1ZHOA 2HWKA 1LFDB 1V16A 4GRDA 4MGKR 3AY7A 2GBLC 1EFPA 4C6SA 2O2XA 2H4WA 3FLMA 4JVMA 2C8VA 2JFUA 3HBAA 3GEEA 1Y82A 1CP2A 1DEXA 1LI4A 2PG3A 1D07A 1E96A 2P0EA 4FXPA 3P2JA 1ODKA 3CF0A 5AICA 5G2OA 3U62A 2VHVA 5A03A 1ZUD1 3RV3A 5KSOA 4YAFA 1FE8A 3DO8A 2X13A 3ZE8A 5JMWA 1OXUA 4TGLA 2L0XA 1NJFA 2QD4A 1YI8A 1NYRA 4UHKA 3FMFA 3VR5A 3DJFA 4P1ZA 2BISA 4ZZIA 1I4OA 1H3FA 1OT5A 4ISCA 2WA2A 1P4HA 3M6FA 4WKGA 4YT2A 1WV0A 2CJWB 3IJPA 3M4JA 1PT5A 3FB4A 4WQMA 4G1MB 2A9PA 2RB4A 2ZR0A 3CKLA 3RT9A 2OGZA 3MINA 4EQZA 2ISSD 4I55F 3L93A 1GN8A 4R1LA 4AI6A 2GLUA 2I62A 5B1DA 4F9EA 1VP9A 3D4NA 1FRVA 2CUKA 3IEVA 3SM9A 2IPOA 3C3AA 1W9HA 4ABTA 1GEEA 3I01A 2XIQA 3A9RA 1G8HA 4OBEA 1QQ6A 2ZJOA 4AJ9A 3D7NA 3EGEA 3U4HA 3OE5A 4FS8A 3W2FA 3WFIA 1DQSA 3P9XA 4OKSA 2J3MA 1CQIB 1OBVA 4F8YA 3OZEA 1NOKA 3L01A 5JI3E 1EZZA 1QOPB 1Y5MA 2IODA 1LI7A 3TIGA 2QD2A 4OGGA 1T1SA 3WRVA 3EPLA 3NIGB 2E4YA 3GDHA 2FSGA 4IDPA 5I4BA 1N7HA 1T9DA 1Z2NX 3KYIB 3CM0A 4OB8A 1I3LA 4RD0A 3AHDA 1NW6A 4CIWA 1HFEL 4EARA 4EI2A 2RC5A 1UK9A 3IX7A 1WOYA 3BYZA 4MQUA 1I3OA 3SLGA 4DMUB 2RGBA 1NE7A 4DEYA 4CKBA 2ZU6A 3AUJB 4C0WA 3L1HA 4I36A 1OWPA 1W7AA 5T7BA 2WSMA 3AEKB 1EVIA 4IH1A 2G9ZA 3K8YA 1N2IA 4NZPA 1XZ8A 2F3RA 1O5OA 3LXRA 1PUXA 1RKUA 3MD9A 5TS2A 1T0HB 3ECAA 1IEWA 4DV4B 1VBMA 3CSDA 4B2LA 3HCAA 3A4IA 5D6NA 3BL6A 5HR5A 4Y1RA 1AHNA 3VHLB 3R8FA 5ECYA 5EEHA 1U9CA 2VP9A 4GLOA 3URKA 4L0QA 3A37A 2AN4A 1F4LA 2O8EB 2CJXA 1AS2A 3LQQA 5DM4A 4BVJA 4IJVA 4DUPA 3A7EA 1Z38A 1M33A 3AQIA 2X6RA 2E18A 3JTEA 3AESB 5JO9A 3D3KA 3G17A 4YQEA 2O59A 4LV6A 3MTQA 4MV1A 5COAA 2QAJA 2RAVA 4FBLA 3DAYA 2W42A 1GPBA 2NNLD 2Q4EA 2UVQA 4IGAA 5IVKA 5FOSA 2H85A 2R85A 1BO6A 1B41A 1M6YA 2WE8A 3FUCA 3M3HA 4FFWA 1R6BX 3GRZA 4IQ0A 4Q9LA 5CT6A 1SZJG 2WK1A 3UAXA 3ZCQA 5CB4B 3VZSA 4IFEA 2A58A 4IIXA 5KYWA 1KKLA 1DEHA 1VHWA 4B2PA 6REQB 1ILWA 2QRMA 4S05A 3OFKA 4AD8A 1E5QA 1W76A 2AYXA 4RVNA 1F4VA 1L0BA 2VJDA 4LF6B 1UJCA 1K08A 1GTRA 2R1VB 1ZR2A 3F8SA 3UC5A 1C3XA 2QRKA 3EASA 2CMDA 3N7TA 2ZRDA 1P0MA 4WZAE 1TJPB 3MAGA 4RYLA 3NHBA 1G16A 4PM4A 3KWMA 4N8EA 2GEUA 1N78A 2IW1A 1H8ED 2FHSA 3Q87B 1E9VA 1X7DA 2J5BA 3NDRA 4UM5A 2HDHA 3QI2A 2HI0A 1TZCA 4NCBA 2BFWA 3D02A 4RO0A 4YLGA 4Q66C 3SKYA 2ZT8A 4QSMA 3LA6A 5JNLA 3N28A 3NTOA 1EFRA 4RVSA 4MKGA 2ZTLA 4B4VA 4ESOA 1KSJA 3K6JA 5KNCD 1E2GA 3D9QX 4LRQA 3CJQA 1ZJJA 1D1TA 5F1YA 1G6KA 2VF7A 2ZVQX 2IU4A 3UJ7A 5BVHB 1Y7LA 2VS1A 5H4HA 4F6RA 2ZUCA 1P62B 3FFXA 3M3PA 4GD3Q 3L7AA 4MGEA 1DELA 4LJ5A 2WJAA 1CRPA 2RBGA 6YASA 3G9XA 4TV8F 3IDZA 4DT1B 3EBOA 5K8JB 4NBSA 5HJ2A 4G0MA 1IM8A 3QX7A 4AS1A 2EGHA 2RHOA 4OMCA 2NV6A 2H11A 1JSZA 4HD8A 2HBQA 4KIFA 4KYUA 1A88A 2BW0A 4MS1B 4WKPA 5KC9A 3DWGA 1SKBA 1HG1A 2B25A 2EWMA 3FB1A 4J2HA 5AK3A 5DNAA 3UAYA 5F5XA 1VJ1A 4A92A 1XP5A 1SHLA 4BDSA 1W4LA 5F2OA 1IEXA 2QPLA 4R2HA 4UBMA 4WW0A 2OP0A 3SYMA 5IYZB 2QTVB 2IV2X 5KYGA 3TSWA 1CULC 5KQPA 4RK4A 3DTNA 1DIOB 3ETDA 3LFHA 5JWHA 4F3RA 2XVXA 3K1JA 4EUFA 2BEJA 1CZNA 4G8CA 1HQYE 4F5YA 3OMXA 1XRQA 1OV4A 3BWBA 3H6KA 4DMCA 3D31A 1KKUA 2ZUDA 1JQJC 1MO2A 5KQSA 4OXYA 4C4PA 1YDWA 3NRBA 4KW7A 4C3VA 4E33A 4FSXA 4H4CA 2CJWA 3W7VA 1HH4A 5KS2A 1ADGA 3H2SA 1NJ2A 2P91A 3D3JA 4GWKA 5FBZA 1W5EA 2BWJA 3DF7A 4FJ2A 4IZ6A 4DR2B 3KAPA 3KFLA 2P11A 3VDMA 3O5AA 4CR6A 3QKTA 2PRZA 1OLUB 1SRRA 3HPQA 1IAQA 1BXRB 2R6GA 2WAMA 2CMHA 3FE2A 3KVYA 4DLSA 2ZI4A 1Q22A 2PXAA 1K0UA 4X7PA 4MX8A 5TIIA 3GP8A 2I7TA 3RTCA 4FMDB 2YZ7A 1UOPA 4UU7A 1D8AA 2VTVA 2WVJA 3OY7A 4DIOA 4MVYA 1VA5A 3ABRB 1ZD2P 5DCWA 1TIKA 1QR2A 2FK7A 4FFVA 3WL5A 3CKYA 3W8FA 1IOVA 3KKKA 4Z0HO 1E58A 4PLHA 1JXOA 1H66A 1M8PA 3LT2A 4DYDA 4LQLA 3GMTA 5JR3A 4YWJA 2F59A 1PJ3A 1XRNA 2XYGA 4NH0A 4UMVA 4DVGA 3DZKA 1NLUA 5CA0B 1JI3A 2G1AA 3PC2A 3NRJA 1CY8A 5GP1A 2Z30A 4FE7A 1E2MA 3FCYA 4YDSA 5FUBA 4Y6PA 1ECGA 4R8LA 2XLBA 4RF3A 4RE5A 1HLFA 3AEKA 4R9RA 4C0AC 4R9VA 4K6CA 5CNJA 5TB5A 4ZYLA 4LWQA 3QRWA 1T5BA 4KV7A 4MYUA 4MIEA 4NZOA 4PAGA 1B16A 3RRNA 1QCDA 3EGCA 4HKTA 2BR5A 3VVCA 1XTVA 3O2JA 1X7GA 4NPHA 3RYCB 1HKUA 2G0AA 1A4IA 2BZSA 4JWTA 5DLYA 3GXBA 3M3DA 1YQXA 2X0KA 3PNOA 4I50A 2VYVD 2L2QA 2V7VA 5IARA 2HMUA 2YS7A 2P69A 1GGMA 1TMKA 2C57A 3PNSA 4PCUA 1GGJA 4RA6B 1OBFO 1DFHA 3ZGLA 1QHSA 5JROA 4JDPA 4OOFA 2COKA 1ZNQO 1SD1A 3MBKA 4RHXA 3MUNA 1K97A 1QLWA 3AESA 3JARB 1QE5A 1MV8A 4X54A 3IMEA 1FY2A 3U09A 4EMUA 1A7JA 1CNEA 5FFNA 1DRUA 4RNCA 4FCVA 1IG3A 5HE9A 1EUCB 2J1LA 3JWPA 4A6EA 4B3BA 2AEJA 1G1MA 1QFXA 1WULS 4GMKA 4PZUA 5CGZA 3LRPA 4B5LA 4BKPA 2YC4C 4JVLA 1N34B 1Q84A 1QOZA 4AP9A 1KH2A 3OZUA 4DM3A 1XT6A 3BQ9A 3CXRA 1K7YA 1FL9A 1FYEA 3F8TA 3O4HA 2X2EA 4O2BB 1TCAA 4R2MA 5T41A 3O8RA 1JJIA 3JVIA 3SYRA 2X14A 1N3YA 3QU9A 6REQA 3VAAA 3R0ZA 1FTNA 4U00A 5CH8A 4ZD6A 1VMKA 1CYDA 1QIIA 1YV9A 1DU4A 4K6OA 3KE8A 1AKYA 3ZHUA 4C29A 5LIPA 4MV4A 2GYUA 4EPRA 1Z0DA 1FK8A 3FCSB 4O5OA 2XA2A 3WB9A 1U31A 2ADOA 4CMJA 2FFHA 1Y1RA 3PV0A 3A25A 4K9MA 3OE7A 4H7FA 4CWAA 4EG5A 3S1SA 5IT9A 1QVAA 3GK3A 2ADMA 2N3ZA 1QIDA 1ULSA 2CZGA 3EQ2A 1SK9A 2NX2A 4DIDA 5J4VA 4F4IA 5HBGA 4DQLA 5ICCA 3CLRC 4QEKA 2ECFA 4XIFA 1O6CA 3CW8X 3U4AA 2R6CA 3QFFA 3ZU2A 3ZWDA 1JLKA 5JOQA 5IVIA 2Z09A 3LPCA 1NTRA 2PA0A 2YW2A 3FCUB 3HEMA 1QFSA 3B12A 4NZYA 1M7BA 2QX8A 3AVYA 1GM5A 3ZD6A 2C5SA 2F3QA 4ER7A 4ZMSA 4BO7A 3AUYA 1DZIA 1NMQA 4GOXA 5BVHA 5JZOA 4BTVA 1FBNA 1KJZA 2WOOA 4DV7B 2IUUA 1E2BA 4IIBA 3Q41A 1OKKD 4FDVA 3QV2A 3TW0A 3TZKA 4AZTA 4HGPA 3N5KA 2IS1A 2J3LA 3LO5A 4DT1A 5BN3A 4X3CA 1TLLA 3AJDA 2NXWA 5AM0A 2JRCA 4ZVRA 4EUEA 2Q29A 3S6JA 4B45A 5JG7A 4CIYA 1CX9B 4IGKA 5DMHA 3TG8A 1ZEMA 3WP0A 4EELA 1AHHA 3L1IA 3T5CA 5HG0A 4MS1A 3DMRA 3SFTA 3WYEA 2YDXA 3KT8A 4EUSA 4WKBA 4NX2A 2J4FA 5CD1A 3DFZA 1YR8A 5I7EA 1GA4A 4KQ2A 4BUJA 4U4AA 5A0TA 5IYZA 1YSCA 1ZW6A 1U3FA 3JD3A 3O4VA 5B37A 2JJMA 2F55A 4GE3A 2NVBA 1JTFA 2PXCA 5IZ4A 2UV8A 4JR0A 2CLCX 3UKOA 4CCAA 3THYB 4LF9B 1VHJA 1Q7CA 3A6GA 3FPSA 5CVEA 2GT1A 1UPCA 1QRDA 4R2LA 5JJ5A 2YR0A 5ALJA 3G3EA 5G02A 3N75A 5GONF 1AQUA 2JDID 1ID1A 2WZDA 3FPCA 4DDVA 4JB3A 9ABPA 5KWIA 2RJNA 3VPSA 4BGDA 1L4UA 1XLTC 4DDWA 5CA0F 3M4XA 2DY0A 1YR3A 3A05A 3DM9B 3H2IA 5DP2A 4BN4A 5FNVB 1E4EB 1B43A 2P1RA 3IUPA 3PXCX 5AVYA 1GT91 2VPYA 2EOAA 5BOSB 4WINA 5D7NA 4EHKA 1KO7A 1F8YA 1XHFA 4G9EA 2HEGA 1VG1A 3H5LA 5H5JA 1OLUA 2V55B 4WNCA 2JHFA 4QQRA 4ZZ2A 3RTGA 3T5DA 4EDFA 4OGLA 2C7QA 4MUNA 1MB4A 3BGWA 3U3JA 5B64A 2EYUA 5K03A 5H0IA 5JASA 3LU1A 1C29B 1JPUA 1SJ9A 4MKZA 3ZZUA 3Q3VA 2H6EA 2UZ0A 1PKEA 3GGJA 4HF7A 1ZH6A 4XZ3A 4UVIA 3DAOA 4RX1A 4L08A 5JAUA 5KDDA 2WOJA 4LDZA 5FV7A 1CE8A 4HGOA 3ELDA 1PQ4A 3HA2A 3DLCA 3HVJA 3CRVA 1YS7A 5L6MB 1E9FA 3QVMA 3FW1A 5BQ5A 4NYMQ 2I3AA 1FFCA 1GU7A 1SXJB 2XRZA 1J39A 2J0EA 2BGMA 1HC7A 2WDZA 1GEGA 2ONCA 3WNQA 1KXJA 1VLZA 1OROA 2OUKA 3IEKA 4P82A 5LMZA 3TQHA 1IXSB 1L5WA 1B3RA 2E5WA 4TKZA 4BNKA 1GN9A 1NQXA 2MMGA 1O87A 2WT9A 3F90A 5ULLA 4FNMA 2A78A 1G8JA 3AEZA 4YQYA 1JHRA 2NXEA 2OCIA 5THKA 1DSSG 3QHAA 4MCAA 5B58C 3KOMA 5A0FA 1NDQA 4U3JB 2FCRA 3FRJA 4G89A 4J7CA 5BURA 4EOGA 2AWOA 3HJUA 4OGWA 2G9QA 4I1SA 2FW1A 4I6GA 3AMVA 1C9JA 3CVJA 1U3WA 2QL7A 3FMPB 3RD5A 1ZH8A 5AT1A 3ZJUA 3Q8XB 2BHNA 2D13A 4DMKA 4ECEA 5IASA 4RA6A 2REQB 2FPOA 2XKJE 2BGNA 3OA0A 3IUBA 1DTEA 5DTIA 4Q3NA 1QIGA 3R5FA 1NLZA 1X2BA 1RI1A 1X9IA 2BJHA 3UJBA 3JARA 1OFHA 2HJHA 4LYGA 1X0VA 4PSUA 4AZVA 3H19A 2GK6A 3DL4A 3H5IA 4EPTA 1X1CA 2IDMA 5REQA 2LXNA 2UUOA 1EUCA 3KXIA 1GOTA 1NR1A 1SXHA 2IYRA 3A4MA 2WMYA 1HE1C 3L04A 3OCZA 5BPFA 1SB9A 2XW6A 3PRKE 1DQRA 3EQ6A 5J4HA 5ADHA 2OBLA 2QYOA 4MR8B 3E9CA 1GUAA 4BMNA 4I2NA 2B37A 1DQNA 1JLSA 2P4SA 1QIJA 1RS0A 1V25A 4O2BA 1YU9A 4K28A 2C42A 1UDRA 2NNWB 5EZ6B 1WZCA 1ZMBA 2P9HA 1DQYA 2PUAA 2R2AA 5C3UA 3RREA 4YO7A 1JYEA 4MV6A 3SFZA 4D8YA 1GGFA 3ENKA 5B2EA 1WABA 4L7VA 2XDYA 4HVAA 2UYOA 4JBWA 5KVCA 4P80A 1WSBA 4KH0A 3WGZA 4RTKA 5ICEA 3NIDB 4MQ6A 4CQMD 3JALB 3EGXB 2WM2A 3TGLA 4ALJA 2DPXA 4BIMA 3ZV6A 4QT4A 4F0JA 3GPCA 2ZBGA 4ICIA 3A1WA 2WFLB 2DCUA 4RL4A 1XMXA 5FBVB 3FNGA 2XTJA 4LYYA 1G5HA 3OZGA 1QUEA 3BWVA 5G0WA 3DV9A 5GGYA 5DZSA 4W1QA 3S3TA 2ES4A 1NONA 5LP6C 1L7DA 5TVKA 5BN1A 2QENA 4L6AA 1ZNYA 4ZTBA 5JZ9A 1TADA 1TECE 2F8SA 3HZRA 5FT9A 1P2FA 4ZVUA 3T3HA 4CLEA 5KTPA 3ANYB 3QPCA 1B74A 1LNZA 1PV1A 2OZPA 3RE1A 1P18A 2Q7DA 1RYHA 4PG5A 4OPMA 1LC3A 1OFTA 4QXQA 5AOCA 3T4EA 3Q3CA 1P7CA 1QJCA 1L1EA 1TK3A 8OHMA 5E6UA 1USGA 1BN7A 2QVZX 2G0TA 3TLEA 4CKWA 3NCHA 5IJ0B 3AETB 1EZ1A 1DG3A 3AHHA 3T7KA 1HT3A 1XMPA 2IHYA 2P2ZA 4Z4HA 5JZSA 3PXAA 3ZUGA 4BO4A 4N9WA 1PBTA 2ASVA 5IN4A 5EHGA 2VBIA 3TPZA 1EE9A 1AMNA 4CUKA 1A8UA 1E7WA 2A6PA 2GXUA 1QB7A 1FP1D 2CL6X 2QRVA 3BEOA 3QTBA 2NYRA 3Q7TA 4DTCA 2G7MC 4C5AA 5JLAA 5AVKA 1TT5B 1ZVVA 3DEFA 4EW1A 4K0RA 4DR4B 3S1AB 1FX0B 2B36A 5BSVA 3UQZA 1Q74A 2GYWA 3E58A 2IHBA 3JWHA 4RSHA 2R66A 3SDZA 3THYA 1X15A 3NALA 4RORA 2OFXA 3EVTA 1VRWA 1SUIA 2WJ4A 1JR4A 1PZEA 4UPEA 4YUWA 4X66B 3DXXA 4D4JA 3HVRA 1ZD9A 2BMFA 4OUDA 5KVQA 4G0WA 2UXDB 1XN1A 5ITZA 2GAOA 2G4LA 1XN4A 4BV9A 1M1UA 1DAHA 1PX0A 1TM4E 2FEAA 2OXCA 3EHEA 4ZU3A 3NKLA 5BOSA 3H1EA 3SHFA 1W4ZA 3UPDA 1BNCA 2O57A 3ROZA 1WO8A 1HOTA 1GZVA 4S12A 2AZMA 2BGUA 3BRWD 3DHVA 4HXEB 4Y1EA 3NJRA 4LGYA 1P1JA 1TAGA 1MBZA 1AUVA 3GROA 4YFYA 1P5JA 2DT8A 3OPVA 5A04A 1QP7A 1RADA 3UK1A 3K0CA 3C6YA 2V9ZA 3RSOA 4BX2A 4BFUA 3EVEA 2QV7A 2XOXA 4NV3A 2BZ0A 3LWNA 4RPGA 2PX6A 5FUQA 3ZDAA 3C39A 3VV3A 2A5GA 1UKZA 1MO5A 4JXZA 3D5EA 4DDMA 3O8CA 1U7PA 1E7QA 1SOAA 2BKVA 2O4CA 2QRNA 1M1ZA 5FI5A 5A5DA 1IN5A 4ZYVA 2OBMA 3W7BA 1VSBA 2IZ7A 2JGFA 3PHJA 4BJHB 2BV3A 4YAJA 4YRBA 1UP7A 4G97A 4CIVA 3BIFA 2WJPA 5A2GA 4I19A 2EQAA 5BSGA 4PC6A 4Z9FA 4Q3BA 3D8BA 4BKOA 2J33A 4U3JA 1OI7A 2HJ9A 1TZ2A 1SULA 2RIPA 5CEJA 3ZWWA 2QIOA 1F6WA 4LXHA 1RR6A 1NE2A 4F4CA 2Q0HA 1PJCA 4YS6A 1U2TA 3HV0A 2BGKA 1JIJA 2OB1A 4HEA1 3ZBUA 2VZ8A 1TU4A 4DG8A 4BRSA 1P73A 3D2BA 3N58A 3SXUB 1EFLA 1G5IA 1LDYA 3AJRA 3ON5A 4OHWA 3ZZTA 1WP4A 1FFYA 3NP9A 4P54A 1XJ5A 1R8YA 4ZCQA 3KUDA 3PYLA 4D3DA 5BMVF 3D1VA 2OQRA 4JGBA 4IV5A 2SCUA 4EY7A 1P2BA 3NVKI 4WZBB 1W4BA 2JCYA 1F7UA 4OB7A 1CUDA 1N1GA 1RW4A 1UWVA 4JLAA 1RBZA 1ZVJA 1PWYE 3OO0A 1UBCA 4EFKA 1U2QA 4MR8A 5IUNC 3B7WA 4HB0A 1SO8A 3GRAA 5E1BA 1D3AA 4ETNA 5CD9A 1JHMA 5CLLA 2OK7A 2IWHA 2HRCA 2ZQYA 2O2IA 4EA6A 1E64A 2GEDA 3DYBA 1HQCA 4WJKB 1LTQA 4RXTA 1FZTA 1Q3TA 4AS3A 3EXG1 1H2AS 5FOUA 5EMKA 1P45A 1EFVB 4UBOA 3V7YA 3TQFA 2MU1A 2QLFA 3DQPA 4JUFA 1FMFA 1CFJA 1VHLA 1UZAA 4UZSA 2MYUA 2I2WA 3LUKA 5DM0A 3ENVA 1PD0A 3WGNA 5C7OO 3HTXA 4LHYA 3JALA 3EGXA 4QBKA 4UU1A 1G9TA 1M34E 1GGNA 4KRYA 4LSZA 3HQ4O 4PHFA 4X61A 2WFLA 1Q6ZA 3N2ZB 4RIIA 4PIVA 4CDRA 1FNBA 4BZQA 1Z5NA 2W6ZA 2WSLA 1PJ4A 2Q99A 4HRAA 2GBLA 1U04A 4J6EA 4AZ0B 5CFZA 1YQGA 1WSDA 1UFVA 3IOCA 1CFZA 1U1GA 2PVCA 2X6QA 3VNRA 7YASA 3VNUA 3UH0A 1WE2A 2OQIA 1X14A 1NQTA 4B40A 2F8TA 3D43A 3MA0A 3P96A 1TQ6A 1QP0A 4ZZ1A 1B2RA 1SMKA 1QTNA 2FP4B 4KX3A 3R6WA 2RHLA 3GCDA 2H7CA 3N0TA 1NP3A 1M9NA 4JB2A 1U2RA 1I0ZA 2TMDA 3V1UA 1WRBA 5IJ0A 3AETA 4CCSA 3A6JA 5C32A 1FLAA 2R4UA 3QOFA 4U7PB 2H48A 3ROPA 2J7KA 3TEMA 5JQWA 3FYTA 4X41A 3REQA 5K3OA 2W6JA 5ALQA 1WP9A 4RD6A 3MWDB 1S8OA 1DBQA 2B0CA 2OO5C 3NEYA 2GTHA 5JCXA 4RV9A 2YDYA 3KKEA 1CZRA 2Y2VA 3HS3A 4I4NA 4B83A 5JISA 5K0SA 2MDTA 2AN1A 5ALDA 4Q6BA 1BCRB 2AV6A 3BTSA 4YMHA 3IEUA 1EGHA 1I6LA 3SQWA 1FBTA 2Y2UA 1IUNA 1ND6A 3S1AA 2HNAA 3I5XA 3C5EA 1LVGA 1FX0A 4O2RA 1WQ4A 2Z5GA 3FJYA 2AS0A 1UF9A 4OYYA 1CR6A 3Q88A 5D5PA 3DDNA 2RKOA 5C34B 4TRJA 2ZYUX 4FLFA 1YJCA 2IGBA 1EFAA 3OCJA 1KDZA 1PVDA 3W3AH 1TI7A 3FKSA 4ZVVA 3HK2A 4O59O 2HWWA 3GJ3A 3F5SA 3PR2B 4DC9A 4M22A 4PQGA 3S55A 1ZOIA 3LO8A 2E4WA 2X8LA 1TF2A 1UIMA 1T2VA 1EEHA 1E8NA 3GR6A 3L8EA 4PYNA 2CT8A 1ZKMA 3MYRA 2EJTA 3PHLA 3EPRA 2H51A 2ZRKA 4HQOA 4DSAA 3FTPA 1TFRA 3BCSA 5AVOA 2G1PA 3UGTA 1Q91A 3FJOA 3VISA 3M4ZA 3AM4A 3A3NA 4XD7D 1WXWA 4F6CA 5JU6A 1O08A 1EBUA 4W9MC 3A9SA 3MT0A 1HT0A 4ISBA 1MJGM 1GWNA 2REOA 5KNBD 3JTMA 5ALVA 2UUBB 3EAGA 3E0QA 3PRHA 3HGTA 2VKQA 3OM9A 4MUBA 4N82A 1H0HA 2NZYA 3V1KA 1VPWA 1BWRA 4EPWA 1DDOA 2UZ1B 1N4DA 3FCAA 1QCCA 5TDHA 4JP1A 4QEDA 3LRXA 3OU7A 1D2MA 3VU0A 1LPSA 1QMGA 1KYTA 2GN2A 1EG2A 3AUUA 4KTTE 3D8UA 5DGCA 4HH3C 1RAGA 3WZLA 3EVAA 3NTXA 3Q7EA 3DHNA 2YVAA 3L2OB 1A3CA 3QXSA 3CB2A 4CDMA 3SVZA 1IULA 1MOQA 4AJ2A 3OD5A 4WY5A 3QVLA 4FS3A 1SUAA 3KAJA 4I9GA 3BD6A 3OZIA 2LNDA 3P97A 5AVSA 2VJOA 4KXFB 2HV8A 3U1BA 3JXEA 2C9YA 3AV0B 1YJQA 3CUWA 2GPYA 2EX4A 3DBIA 1U28C 2YCLA 3EEIA 3Q2KA 4QUKA 1WXXA 3LCUA 3WKEA 2QVGA 4UQOA 2VRCD 5KTTA 4M0EA 5AUNB 1VIVA 2VXYA 3G1UA 4M1MA 3UJCA 4PLTA 4ND6A 2GJ4A 3SXUA 1C9KA 4BQRA 1E77A 4G24A 4DJAA 1W85B 3ZWBA 5BQXA 3NC4A 4OF4A 3PD7A 3WYCA 2D0PB 3RFFA 3OC6A 4BPRA 2QU7A 3E7DA 3IR6A 3NR2A 4WZBA 4MEBA 3RT1A 3MJEA 3SIXA 4E21A 1EX6A 1P5FA 2C9BA 1CIVA 1WJGA 2W8ZA 3TLGB 2F1HA 4WK2B 1K3UB 2QMZA 5HXAA 2MINB 3MAJA 1CDOA 1NPTO 3MIIA 2WVGA 3NP7A 3MN1A 1EP2B 2RMKA 4UNNA 4MUFA 5HZGA 2VDPB 3EPKA 1YRWA 2Y6VA 4ZAFA 1QHNA 1SIBE 2P2NA 2VBGA 3L1UA 1GAQA 4DR1B 4ZOQI 1YQQA 2XWJI 1UMDB 1E6CA 1SBQA 2QT9A 3KE9A 1Y37A 2FCAA 4G8DA 2MT9A 3O6VA 3QTTA 3RSZA 5JCOC 4X8MA 2EQ5A 2HZBA 3LGAA 2WHEA 4BAZA 1FRFS 4GBJA 1N6IA 2OOSA 1C4OA 3A1TA 2QJTA 2PX2A 4BATA 1FUYB 4KFCA 2VUHB 3QW4B 4HZUB 5AH0A 1EA5A 1W0KA 4C0BA 1SOWA 4AY5A 3WAGA 4H0NA 3PD1A 4QTXA 4D41A 4D6PA 4N3AA 5ICMA 3T3DA 1XCGB 4Z3KA 4L8GA 4P08A 3TLAA 1DDIA 4AXXA 2QTWB 1T5IA 4BVHA 2I4MA 5EPEA 1R6VA 4YX9A 4KAXA 1SELA 3KHKA 5FFMA 1EG7A 4D4IA 2QJWA 1E5DA 3EXIB 4DYHA 2P5UA 2VDRB 4EUKA 4LTMA 1IMJA 2YH2A 2FP4A 3U19A 4BKMA 3VPXA 1VJDA 2BONA 1S01A 3RTBA 4YV1A 1Y9AA 3CW2A 4TMTA 1UOQA 1JG7A 3W05A 4YONB 2ZKIA 2GSWA 1KF0A 3ZHTA 4AIIA 4COOA 3W5BA 1J5PA 3AINA 2J67A 3C3DA 1ZRMA 4B7UA 1N1EA 3MBIA 3PKIA 3TI7A 3TOSA 3OLQA 1WPRA 3MWDA 2J07A 5FRDA 2IX9A 3I42A 2GDJA 4UD2A 3UAZA 2FWNA 2JKZA 2ODEA 3SIPA 1VE6A 1XXHB 3GJ8A 3PGMA 4BMXA 4C5CA 4OLAA 2A1UB 1DPGA 1JDVA 3DLHA 1IPFA 3OQVA 3KG2A 3PE4A 3GD7A 5FLKA 5JAIA 1ATZA 1W4CA 2A7XA 4CFYA 1OH5A 1Y7TA 2ANBA 4LWZA 3W5SA 4ZEMA 2R8RA 3L3BA 3PPWA 3LPDA 1VCHA 1ZL0A 3PFIA 5DNVA 4J94A 1E66A 3B52X 4BO6A 4DQUA 3T5PA 5ARBA 1NIJA 1OV6A 2ZE8A 4HVTA 4ZN6A 3I12A 3OHSX 2RAUA 1OVGA 2B3TA 3N8GA 4OH1A 5HFJA 3VUFA 1CZKA 2Z3WA 4ARCA 3DEYX 4J16C 1NLYA 1XTKA 1T0UA 3EZ6A 3WMXA 1FTWA 1KQ3A 1P7WA 4YJ2F 4ER5A 4ZCTA 3HDHA 4C05A 2E9SA 5CLGA 3C3YA 5JSZB 3OQMA 3AFIA 1BEUB 2FPXA 4X0EA 4EMSA 1DKOA 1VG0B 1AKTA 2VSNA 2WUDA 3ZDZB 2AKEA 5LL6P 3NBUA 2OXIA 5A3QA 1A69A 3O82A 2UZ1A 5DYIA 2DPMA 3IJEB 3N8NA 1ZJ4A 1URPA 4BP9A 3SLRA 2J6HA 4KK3A 1JKXA 1EKXA 3T9AA 2BN4A 1Q0PA 4LK2A 3BK2A 1GZ7A 2PRIA 4WFKA 4YJFB 3ELWA 1AB5A 1KERA 3RAPR 4AX8A 5HTOA 4GRAA 1YR6A 4ON9A 1KNQA 2HQSA 4KN9S 4X1YB 1E3JA 4TS1A 4FGWA 5YASA 4IBOA 1K0FA 3UO8B 3QQPA 2DR0A 1WY7A 4KUGA 3PQEA 3K9QO 3OZRA 1L5VA 1X8LA 2R6DA 1I30A 2ZSIA 4V0QA 3H4IA 2X6TA 2VAVA 3LLUA 1SKYE 4COKA 1RPZA 3EUWA 3PNKA 3RVPA 3V8BA 2J32A 4TQGA 1VSVA 3P9IA 4MR7B 5G3YA 1JWBB 1RACA 1M5UA 1UP6A 2HU7A 3DKPA 5H9VA 3DAPA 3WGTA 2QTFA 1QUFA 1LB1B 4RW0A 1ZN8A 2MYPA 3HYCA 4GM0A 3WLHA 2TMYA 5UKDA 3IVRA 2PQ2A 4BCBA 5GTDA 1XYVA 4UCQA 4A82A 1I7NA 3STVA 2H7VA 1G1AA 3RAFC 2Q0QA 1GQFA 1W85A 2VHCA 5DISB 4US2R 5LLDA 2J41A 5CNIA 4NAHA 5FTKA 4BFWA 1RCUA 1ZI6A 5FA6A 5L8VA 3AR9A 1J8FA 5C51B 4CUJA 2FPPB 2P68A 1H8EA 2WQZA 3JAKB 4PNHA 4V03A 2CXNA 3WB2A 3QE9Y 1JBEA 3N70A 3U7JA 4I4TF 5AKEA 4NZNA 1U11A 2IZ6A 2PFSA 3CT6A 3HB5X 3TLGA 1VP3A 4BJ1A 3HM9A 2MINA 2Q41A 1M8JA 3CTMA 1D0IA 3QW2A 3OJ0A 3ZV7A 1BMDA 3KOYA 3PGJA 4JQYA 5KNCA 5LP6B 2PL5A 2V1UA 2DR3A 2FPGA 3OZCA 5IVHA 4L02A 3HADA 1VSUA 2VTKA 1UMDA 3P2IA 1AKVA 2V7QD 1AA6A 2HOQA 4BE7B 4BNLA 4WJLA 2OCBA 1CDEA 4C4ZA 1PGNA 3VBCA 2GAIA 2AB0A 1BC5A 4EHAA 4KREA 4MULA 5JD5A 1YHYA 1X70A 3L41A 4WA7A 4BN0A 1EBBA 1Q7RA 2EFEB 1GADO 5IUKC 4BZZA 2RJOA 4ESVA 1A76A 3ICEA 4OATA 2O3UA 2J08A 3BERA 5EIFA 1M1NB 2XUJA 3UA4A 4RTRA 2J87A 2XKAA 2ZYAA 5JD3A 1FDVA 1IZ8A 5EKXA 2V45A 4KKVA 3D7SA 1RYEA 3LDAA 3OOHA 3KWJA 1YNOA 3LY5A 4I6EA 4RVDA 1NBOA 2AD1A 2ZSJA 3EXIA 3PUYA 3PDJA 4AJKA 5AW5A 4Q39A 3BMNB 4B3IA 4UUPA 1U9IC 2QN3A 2Y1XA 3BILA 3IEXA 1EEXB 4XM1A 4G1BA 4B8WA 5KTMA 3B89A 2NSHA 4DLBA 1ZP6A 4NSNA 4KPGA 1G4UR 4UVDA 2ZANA 1ZCJA 3D3EA 4JT9A 4EJFA 3H18A 1XE3A 2X4IA 4G65A 4ATNA 3CVWA 1TJ4A 4YAWA 1XLTA 3ETCA 2IY7A 4R68A 5A05A 3ZHZA 1MABB 3IIKA 2NTJA 1U81A 3WLRA 1Y4SA 3RUHA 1C3LA 1XK7A 4QLBA 2C03A 3MQFA 5FXMA 2CXOA 4KTVE 1R27A 5IK2A 5JD6A 2IHJA 4RLSA 3LNCA 3Q3HA 4ZYUA 1NRJB 4O63O 2OT3B 3MJHA 4M1YA 1NP6A 2JLUA 1CY0A 4BEWA 4PPNA 1M2GA 1J8DA 1E1RA 1JIVA 3DE2X 4F5DA 5LXTB 4KR3A 2NOAA 3T7EA 3LPMA 1NVAA 3B6MA 2GJAA 3N39C 4DMHA 5IDWA 1QO7A 3OOYA 4RM3A 1UIRA 2NQTA 3SZRA 1KFBB 1AZLA 2HRZA 2ZBFA 4QOIA 3L9XA 1SKQA 1GU0A 2HF8A 2QKYA 4WCVA 5EZ5A 4D8XA 3U0BA 1EXNA 4IVNA 4CYMA 5C7LO 3TCKA 5IULC 3R0QA 4AO8A 1NOJA 2R1ZA 3GBPA 4BWYA 3DS8A 4ALMA 4ZYXA 1BVRA 1JEYB 1TC1A 3P9QA 5LCXA 3KR9A 1Z2PX 3OPMA 4J9VA 1A5TA 3HSSA 5DPMA 3OZFA 3RC7A 4L22A 1CF9A 1XKQA 5JSZA 2HM7A 3INRA 4E46A 3ZXIA 3W2EA 5L3QB 1N5OX 4UOZA 1UJBA 1ZUNB 2JL1A 3LDGA 3WWPA 5JRJA 1K7XB 4S1NA 1EAMA 1G41A 2YHUA 4C7BA 4D0SA 2EKLA 3ESDA 3LX5A 3RU7A 3V34A 3CH7A 3F4LA 3K0BA 4CF4A 4ARSA 4QUHA 4LISA 3DW3X 1SPXA 1V45E 1XB2A 1C4KA 1JEEA 1KI9A 2C99A 2QI9F 2Y1DA 5CX4A 4CHGA 3OP4A 2ET6A 3EY4A 1A4UA 4YJFA 2P9YA 3ZWYA 1ZY2A 1ZBQA 3ISTA 3KXKA 5IX8A 3NOQA 3OZXA 4OTZA 4IXMA 1KJQA 4X97A 4X1YA 2FMKA 1WDKA 2QZSA 2ACEA 3JVDA 3QIAA 4GU5A 1VHTA 1JIXA 1YMQA 4O25A 4WERA 5G1OA 1NT2A 3WFJA 1NQWA 2O2ZA 1E4OA 2YHBA 3IAM6 2JPDA 4MLDA 1EX7A 4TVSA 5EESA 2IPAB 3F3SA 4YECA 2AI1A 5FPSA 3ILHA 1JXAA 3C3PA 3DKRA 3RWOA 4WVLA 4E3ZA 2XCRB 4HOYA 1M8KA 2ZUBA 1VL5A 4GGOA 3KL2A 4NQZA 3CZ9A 4RJKA 1UDAA 4IWNA 4TOIA 2Z0MA 1RM5A 2XDWA 2O3RA 4LZWA 5TGTA 4H35A 1G8MA 3ILYA 4X95A 3CEJA 2NAPA 1AKUA 1OYVA 1WA5A 1C5KA 1R5JA 1YR9A 5LNK1 3ZW8A 4UAUA 3REFA 3B38A 3ZY3A 3JD4A 3Q7PA 1J5EB 1F0NA 1TCVA 2FPPA 3JAKA 2YBDA 2ZT5A 2XADA 1M7GA 2YUIA 3K15A 5KIAA 2EFJA 1KTIA 1JQ3A 1T34A 2D06A 1EB9A 2PKQP 2WP0A 2XB9A 4WBXC 3U80A 3NANA 5LQCA 3KDAA 3PXEA 1XVVA 2O52A 4UM9D 2X3YA 1P9WA 4F96A 3R24A 4QASA 5L3SB 5G53C 5BYAA 1MJGA 3T38A 4MHTA 1JL3A 1Z37A 2WNHA 5LP6A 1K7EB 4OBWA 3NGMA 4AJ1A 1RXVA 1NBMD 4ML3A 5D85A 1O97C 1U8ZA 1FTYA 2RK3A 2UDPA 3GJXC 3Q7SA 5KEIA 3LHFA 1R9GA 1KVRA 1N5JA 2ONKA 1MH1A 4OJKA 5G4KB 2VUUA 1OKKA 3CZQA 4BNGA 1GNQA 2EFCB 3PC8C 2YNMC 1QAMA 2ZYGA 3UXMA 4EK9A 2QMEA 2V1XA 2JAWA 2Q4TA 3MWYW 2A0WA 1DPFA 1N25A 3L6RA 3L7BA 4MMYB 1YR2A 4CG1A 2C0PA 1MFZA 4J7UA 4QOFA 5DRTA 1VCNA 2AFIB 2GRJA 2VH5R 3GUUA 1HZZC 4JY7A 5FEUA 1PFGA 5IDQA 4D45A 4JHLA 3VR1A 2XMCA 1M1NA 3WSWA 5CLFA 1PTKA 5LZ8A 1PNTA 2CK3D 3JVEA 3UJHA 1S9DA 2ID9A 4P7JA 2X40A 1QHIA 2BZGA 2IHTA 1ILEA 2H5EA 3T41A 1L8QA 2B8EA 5K1ZA 1JHPA 1V3VA 3B6EA 2I9PA 4MDEA 1PGPA 2HPHA 1J7JA 2VXCA 5P21A 3GLGB 2V0NA 3BMNA 1FDOA 1WXIA 2WTMA 3QE4A 5FLYA 5E1DA 1CUGA 2HA7A 2LR0A 3PU6A 1JFSA 1NBHA 2VKTA 5AJTA 3A26A 2JDIA 4BB9A 3PWTA 2ZWOA 2XZLA 5LA6B 4XDYA 4D9EA 5JLJA 1MU0A 1ENPA 4FYPA 1H22A 3HUUA 4TVKA 2Y0CA 4XRRA 1T10A 1MABA 1OTYA 4PTLA 1ZVQA 4NMWA 4RD2A 3MC1A 4PGFA 4Q00A 1MO6A 1DT5A 4Z9YA 4AYTA 5HEKA 3G5TA 3VNQA 3SC3A 5BP7A 4ZEWA 3U3KA 3VPCA 4BLSA 2X4DA 1NVTA 2XAUA 4CR8A 1EESA 1KO5A 4DR7B 2Q2VA 5KMGB 5LXTA 1FFAA 4FDUA 1HV8A 5GJVC 1ESMA 2HSGA 1JH9A 4QGAA 4MJXA 4ZHQB 4RPIA 1NU8A 4W8HA 4WEQA 3CO5A 1PU2A 3H5RA 4BNHA 2O19A 3SMVA 3IQXA 4OHUA 3K9CA 3EUFA 5KHAA 4QARA 5I48A 3UTCA 4A9AA 1E2JA 3WLKX 1KAGA 3MTJA 4O4HB 1RJFA 4ZO6A 3HA7A 5I8ZA 4RTLA 4KR6A 1KGDA 2QYHA 4J3FA 3LA8A 5IXSA 1Z4QA 3HXLA 5I7UA 4FGLA 4JR1A 4R1UA 4DCPA 3I5AA 1PEYA 4WRRA 4FMCF 1VBKA 2JZCA 4PZYA 1T4DA 4LYFA 4QPDA 2JARA 2QSYA 4LA4A 2OZLB 3E9NA 4DNXA 5KJFA 2IBSA 1B23P 4U02A 2GCIA 1CK4A 1XDSA 3D6UA 4I6JA 4KR0A 1ZUNA 1ISJA 2P9GA 3EBPA 4JODA 5AQ1A 2PMCA 1N8TA 3E7WA 1BIFA 4Z8XA 5K3FB 1AKWA 5K7SA 1QDEA 2XTMA 2VPZA 3WKAA 1PR6A 5DSZA 4I3HA 3U56A 3BC1A 3TOVA 2IC5A 2XNSA 3FGOA 5ITVA 2R48A 1DS6A 3OIVA 3BHIA 1Z0SA 3RFTA 1PR4A 4UHHA 5K20A 1BDJA 1TGYA 2QRJA 4LG1A 3COSA 1EFUA 4LJRA 4MOWA 3GLSA 2OZEA 4TLBA 2B9VA 1U0OC 4UBJA 4D44A 1PX2A 1KTVA 4H4DA 3M49A 3O8QB 1MO4A 3CWZA 1UINA 2OCKA 4WNIA 4Z7NB 5EGNA 4RSRA 4WWHA 3ZPXA 1C1XB 2OAEA 1ZFNA 4FI3C 4TWRA 3GVCA 4M1TA 2E89A 2V74B 4KZKA 4AROA 5B7QA 3ZWXA 4TX1A 5ILOA 1NTOA 2JEZA 3TS1A 5J1SB 2V65A 4GOJA 3QMWA 2WFMA 4MPDA 3EDMA 3V2UA 3BOSA 2H4HA 3FYSA 4BC0A 5KWEA 4KPUA 3PENA 3GCZA 3GFVA 3L07A 3FM9A 2Q1SA 2QVCA 5AOBA 4F46A 1CTQA 3HR4A 3KQQA 1NWCA 2XJ4A 5B53A 3TW6A 4BO5A 1RAHA 2X9VA 4ZTZB 1P1KA 5EWMB 5JQGF 2E55A 1Y0BA 1CYEA 4IQGA 3TJMA 1THMA 1Y9DA 3NLLA 4UE3S 4CM5A 1GQYA 2A5FA 4Q3OA 4C6RA 2PPLA 4BUCA 5K4AA 1ML4A 3DE7X 4NWIA 3N7AA 4B84A 3DBHB 5SYAA 1IU9A 2OV1A 2JGKA 5A4MS 2QTHA 3EDYA 1LJLA 1KAEA 1XIVA 4FC7A 4WLUA 1PK8A 3GUHA 3PFGA 3TE6A 4CQNA 3VSAA 3NOOA 4PVCA 3T6KA 4RF4A 2C1ZA 1GRVA 4FP9A 5L3SA 1EGMB 3EN0A 3WDKA 4IX1A 1U6JA 1GR1A 4G5FA 3KZNA 4BLTA 3K9WA 1GPYA 3QYFA 1OWNA 2E49A 1S8AA 1S4MA 4YRTA 3TE7A 2H1IA 5DBFA 3K94A 4GXNA 1VE1A 3WGLA 5G4KA 2PGAA 1Q6YA 3F1LA 4MB2A 4M8IA 4JEHA 4XRGA 4II3A 1IHDA 5ALIA 3DEAA 1V8DA 1Q0RA 3FWPA 5DN6D 1OAAA 1I0LA 4N54A 1MRNA 1A1SA 2JVKA 3UQYS 4GI1A 4LTNA 4OB6A 3X1WA 4A3SA 1GHTA 3QJGA 5EZYF 4BYGA 3P0FA 2OHJA 4N65A 4ZMRA 1JVNA 1XPRA 1RKXA 1T1GA 1A9SA 2AFIA 2V97A 4JVNA 1RJEA 4ZC8A 1DG1G 1Z35A 3ZU3A 3CMMA 5SZIA 1I5OA 1T5DX 3UXHA 1BHJA 2XNKA 5DASA 3G79A 1XELA 1C7JA 4H15A 1K4YA 4JUCA 1M6WA 4BEJA 4A36A 1FVXA 3AF1A 3DLTA 1SR8A 2AJBA 2NZXA 2VEDA 2VPQA 3H17A 4XPIA 1YZYA 2BL4A 2KI5A 3EK2A 4XB2A 1C1YA 3CKKA 3CGGA 2J4DA 1ODSA 3N8DA 3GLGA 1Z0AA 3OZDA 5BYBA 4J3NA 4P36A 2ATVA 1V9LA 2YWHA 3NWJA 3UGQA 2Z8YM 5JS6A 3L8CA 4GQBA 4OU4A 1U2DC 4C22A 3ET4A 4JEMA 1T0PA 4M60A 1Q16A 4X5OA 4IS2A 2M6KA 3O73A 3A31A 4PGAA 5FOQA 5LA6A 5F7XA 1N57A 4WXRA 4FEEA 1KC1A 3RGGA 1KOFA 4KQWA 4TV8B 2WU1A 3QNMA 2V9PA 2HMTA 1YA4A 1NXXA 3CUKA 3JQRA 3QX9A 3H9GA 1XFDA 2J5RA 1RAAA 3MFQA 4H7DA 3WTCA 5F3WB 4DR6B 2H5IA 2WWVD 5KYUB 1SCBA 1V6SA 2Q1XA 2ZT7A 4AF7A 1ZHFA 5F7OA 1A82A 4LZNA 3OSZA 4N41A 5LMNB 2PLAA 3GAFA 4PZ0A 2XQVA 5A4FS 5INTA 4NATA 4RMNA 3F5QA 1ZO8A 3UMSA 1V1RB 2AG8A 2I78A 5KMGA 4LF8B 4EI8A 2IOHA 4S0XA 4RCZA 2HH9A 1TM7E 1E2DA 3H6HA 4FYMA 5BRNA 3RVKA 5D1HA 3VAYA 5CK5A 2BFCB 3ETEA 2IEYA 3BXZA 4ZHQA 3FFTA 3TIFA 3NYQA 2P6MA 1CEYA 5ESDA 1W8DA 4FE3A 1B8VA 2WHYA 4AM8A 4ZGBA 4O4HA 1UEXC 2X5NA 4EIWA 1XWFA 3CRQA 3DC2A 3WGKA 4ROTA 2FNAA 2VL7A 1ODJA 2Z56A 4K03A 1C7ZA 5DSTA 1Z28A 5AVJA 4KBGA 4G5YA 3WB0A 1AKRA 1PL7A 1RWNA 5C18A 4KYVA 3ROQA 5SYMA 4Q19A 3BK1A 3QPAA 5D00A 3PKZA 3FUTA 3KSUA 1SD2A 4I1PA 4N0PA 3FWHA 4NU8X 3CIFA 1E7SA 4P7BA 3QXXA 1Y3AA 1FYVA 5K3FA 3UH1A 3P9RA 1H4VB 1H42A 2NAFA 2X5OA 3IDSA 3PITA 4KHZA 1EI9A 4MW7A 1GFIA 4UBKA 4HAUA 3UJ9A 3WX0A 1WB9A 1CR2A 2JI8A 2QRGA 1L8XA 1XGKA 1QFYA 2YBEA 4F84A 1NN1A 3LP5A 1U28A 1OC2A 1ZD8A 1H85A 3I4CA 2VYFA 3NBXX 3T54A 4Z9XA 1F2UB 2QVXX 4BBAA 1I14A 4GDFA 3CZ4A 2IYEA 3R3HA 3EGIA 3VR3A 2F90A 3UJPA 4OQDA 2PUCA 2LV8A 3F78A 1B7GO 3TJZA 4QTZA 4AY3A 1S2DA 2PR2A 2VDUE 1JKJB 3I9V1 3O8QA 4WJZA 2CXHA 1KAOA 4MUMA 1C1XA 3SGLA 4KFSA 1JR2A 3PC3A 3NO4A 4C3ZA 1KZHA 5LWQA 2QDKA 4GPD1 5DWQA 5FL3A 4NJMB 3AFGA 1Z3IX 1QRAA 2QV0A 1LS6A 4R8RA 5FI1B 1AU9A 4MWEA 2Y0PA 4Q82A 5CM2Z 2WHPB 3P7MA 1UM9B 3V4LA 4CKEA 4ZOEA 3LQKA 5C3MA 3RSFA 3I52A 2AG5A 3KD2A 2NPOA 3IP7A 4GZMA 2FMFA 3WQRA 3F7NA 3OPNA 2GUGA 1XHLA 3TQOA 1XR3A 2C4MA 1KH1A 4J0IA 1U5BB 4PZEA 2P9QA 5EWMA 2NU8B 1OY1A 3A9WA 4TXNA 2XYRA 3O7MA 1PV2A 1GKLA 3G0IA 3G8DA 3H1GA 5A4IS 3QVSA 5DW0A 4MDHA 5T6BA 4P93A 4BU0A 3ND8A 1OA0A 3AJAA 3H9CA 5EIHA 3IAS1 3V1NA 5IU6A 1KI2A 3DBHA 3K92A 4RHYA 2VPTA 1KBQA 2D3WA 4YH1A 2BFDB 4HDOB 4TUYB 5DNEA 2ZAGA 4IKEA 5FD8A 4M8LA 2FUCA 4PICA 9ATCA 1C7FA 1IEVA 4LE1A 4DCNA 5DBOA 4GWLA 1H4TA 1NL3A 3F2IA 4GXRA 4D9BA 5E38A 3JD0A 3ABQB 1WNFA 3EIFA 3WLOA 5DHFA 1JIQA 1WZIA 4JZYA 3ZGXA 4BO1A 4MUEA 4GNKA 1HX7A 3I09A 2G1KA 1M2FA 3KDPA 2FHPA 2O6HA 4B6FA 4BVKA 5FX2A 2C2ZA 2OESA 1F38A 3M6WA 2FPRA 3T3NA 4C6TB 4LKOA 5BSEA 2XNDA 1XNHA 3IQEA 1D2NA 1ESNA 4CM3A 1L5FA 3QFSA 1CF2O 2YIJA 2AF3C 4OHFA 1CVIA 8GPBA 5JECA 4PO9A 3TECE 1S96A 4W5OA 3EDRA 3NHPA 4RLHA 4TTPA 3TR0A 2QR3A 3QELA 3IRVA 4ZDJA 3VVLA 4X84A 1FU7A 4HGQA 1RWWA 1HGXA 3IJRA 4BQQA 2C2KA 5K51A 2HK8A 2M9MA 5JJBA 1RAFA 2YYAA 2WU8A 5AKGA 5BV7A 1AMUA 1YC2A 1I1OA 4IWYA 4KUHA 4LGCA 5DWDA 1RJ9B 3SEQA 1NXSA 5JMTA 2W7TA 1VJCA 3ODPA 2R9VA 3ABIA 5GINE 3DONA 2VJMA 3O8LA 1E0AA 1EM8A 1J21A 4U7TB 1D4OA 3QKSB 2XE8A 2E4AA 2I71A 4KN6A 4QDZA 2UYHA 4IG9A 1CBUA 1WF6A 1WXDA 2CLSA 1T3ZA 3LF2A 4R41A 2XJ9A 3IHTA 3EZNA 3KZMA 2II6A 3JU3A 4IYJA 2UYGA 3WKBA 1FDIA 2HJWA 5ILQA 4ACBA 3RCBA 2VFAA 5KYUA 1O9BA 1JQAA 4HNGA 1KI6B 2JJ2D 3FMIA 4J16A 4QFMA 1N2CB 4XD7A 5FF9A 3QMMA 4U0JA 3U4CA 3UTDA 2ZKLA 3WGMA 1TZJA 3GQBB 1N3LA 3B6ZA 3PT5A 5T4BA 5KNBA 2OWDA 1GPAA 2OBBA 4F04A 3I0ZA 3NT4A 1XQYA 3IH5A 2YV3A 5FA8A 4Y2SA 3TDMA 1F7VA 3WFZA 4KDFA 3RAGA 5K8TA 1CT9A 2HHCA 5F51A 5GJWC 3B2NA 2WF9A 4JBLA 3U3DA 3W9UA 4D3XA 5K3SA 3GJ0A 1WDTA 2Z1DA 2RCYA 3HEBA 3AOEC 1MB9A 4BKUA 3HY3A 2XB6A 3P1JA 4KWCA 2VQ3A 4X90A 4EI7A 2ZSUA 1Z82A 2EEPA 3M6XA 1MXFA 5JFGA 4OQQA 1MAHA 5EXDA 4TRRA 1CJCA 4C2TA 4X20B 2D54A 2XVZA 2FKNA 3DT9A 3GJQA 2AUNA 3LVQE 1DEAA 4FCTA 4QO8A 3QLJA 3I62A 5FJJA 3AVPA 4QPPA 4DS3A 4H3VA 5FWXB 4NH4A 4OA5A 4P9NA 3DMFA 5DI3B 2R6AA 3R1IA 3WWYA 4ER0A 1FMJA 1W73A 3CLUC 4ZGWA 1LEHA 1KMHA 2IS6A 2FZEA 4V38A 1T8RA 2UAGA 3GARA 1R0WA 3G0DA 2FJUA 2VC2B 4JQCA 4RTPA 3NU1A 2ZIGA