3AJIB

Structure of gankyrin-s6atpase photo-cross-linked site-specifically, and incoporated by genetic code expansion
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic study of a site-specifically cross-linked protein complex with a genetically incorporated photoreactive amino acid
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone/protein binding
molecule keywords 26S proteasome non-ATPase regulatory subunit 10
total genus 25
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ajiB00
1JR3D 4QNRA 5EXSA 4KO8A 4D82A 1HT2E 4LZZA 1OFHA 3GLFA 1IN4A 2X8AA 2BJWA 1QVRA 5EXTA 1D2NA 4EIWA 3GLFB 3GLIB 2CHQA 2V1UA 4LJ6A 2VIIA 2QBYA 3EIHA 2C9CA 4QHTA 5C18A 1SXJE 3K1JA 1IQPA 4FD2A 1SXJD 2Z4RA 1IY0A 2CE7A 1IXZA 1S3SA 2KRKA 1SXJB 4FCWA 1E32A 3CF0A 3M0EA 5EP2A 1SXJA 3HU3A 5FTMA 4D80A 3R8FA 2FNAA 1NY5A 3KW6A 1NVMA 1W5SA 2CEAA 3KDSE 4FWDA 4KLNA 3PVSA 4Z8XA 1G4AE 3GLGA 1NJGA 4I4LA 1E94E 1KSFX 1W5TA 2R62A 2QP9X 1UM8A 2XSZA 2C9OA 2C98A 5FTJA 5FTNA 2R65A 3SYLA 5JI2E 5EP1A 1IY2A 1IN8A 4FWGA 3GLHA 4LCBA 1X37A 2DZOB 2BJVA 3MHVC 1JR3A 1HQCA 1R7RA 3PFIA 5EQTA 5EXXA 5JI3E 4D81A 2C96A 3VLFB 1IXSB 1OJLA 3VFDA 1XWIA 2DVWB 1IXRC 2QBYB 4LGMA 4L16A 3WHKA 5EXPA 3AJIB 4LY6A 2ZAOA 1KYIA 5DYIA 1C1KA 4A3VB 3GLHB 1NY6A 4LJ7A 2ZAMA 4I81A 1JQJC 1HT1E 4LJAA 3UK6A 3M6AA 5FTLA 2QPAA 4FW9A 4LJ4A 4LJ8A 3U61B 4ZPXA 3H4MA 1G41A 4LJ9A 1IN6A 2ZANA 1IN5A 1G3IA 3HU2A 3HWSA 5EP3A 1OFIA 3U60B 4FCVA 2RKOA 4QHSA 2HCBA 3BOSA 5EP4A 2CHGA 1IN7A 2V6ZM 4WW0A 1J7KA 1DO2A 1XXHB 3GLIA 1IY1A 3ZH9B 4FWHA 1XXHA 1L8QA 1NJFA 1SXJC 1IM2A 2DZNB 3U5ZB 2Z4SA 3B9PA 2XSZD 4KODA 5DYGA 5FTKA 4QOSA 3DZDA 4L15A 3EIEA 2QENA 3PXGA 4JN6A 1LV7A 4FCTA 2C99A 4LRTA 1HQYE 3GLGB 3D8BA 2DWZB 3HU1A 1QZMA 2QZ4A 3SYKA 4L4UA 1R6BX 4LRSA 1FNNA 1DO0A 3CF2A 3WHLA 4LJ5A 4QNMA 4GITA 2DHRA 3SC3A 1NSFA 2CHVA 5C1BA
chains in the Genus database with same CATH superfamily
1ZMWA 1DGGA 4QNRA 5EXSA 3HX3A 2NQ8C 4JI1M 3U60A 4QOZC 3T1HM 2R6FA 1XMOM 3J27B 4LZZA 1OIPA 1OFHA 2LVOC 3OTOM 3A45A 1QVRA 2P5TA 1D2NA 3L2AA 4GEWA 4EIWA 7CATA 3GLFB 3L26A 2M5ZA 4LJ6A 5KO3A 2QBYA 2C9CA 2UUAM 1SXJE 3GLFE 4CIZA 4OVZA 2F5NA 1SXJD 3HY5A 3W68A 1XXHE 2YR0A 4M0WA 1Z5BA 4DV3M 1I94M 4LF5M 1YUBA 1S3SA 3LCUA 1SXJB 2UUCM 3VK8A 4MGKE 2O25A 5BR8M 2Y21A 2Z8YM 3AOGA 3HU3A 4NL4H 2V1UA 4X62M 1NY5A 3KXEC 1NVMA 1W5SA 3DOAA 3TWMA 3FE3A 5ITRA 2B3TA 4Z8XA 4OW0A 3QYEA 1YSYA 1PJIA 1EIJA 1IXSA 2XEPA 1E94E 3CGWA 2R62A 3KP1E 3IG5A 1TH3A 2K9DA 2C9OA 2C98A 2L4EA 4B7HA 3C58A 5FTNA 3RGSA 3SMSA 3E21A 4FWGA 3GLHA 3KOXE 4W5WA 2OPFA 1IBKM 1UFZA 2Y0QA 3MHVC 2DAGA 1HQCA 2KNAA 2APLA 1OJLA 1GLNA 3FUUA 5KPZA 2G8LA 5EXPA 2L6OA 2ZBKB 2ZAOA 3FD9A 4I8OA 3FUVA 3LCVB 2LNHC 4LZJA 2MR9A 5DYIA 4JV5M 4MGYE 1NY6A 4GIPA 5BPVA 2XF3A 1PM5A 1JQJC 1Z5AA 1TDZA 4L8RC 5IWAM 4ANRA 3HZJA 3FRIA 3HHWA 3M6AA 2J5YA 2QPAA 4FW9A 1L2CA 4LJ4A 5F3WA 1EE8A 4OVZB 1MJGM 3Q8XA 1V92A 4DV5M 2D7GA 2L4FA 2UU9M 1NHWC 1IBLM 3J7AS 1AUAA 3R9XB 2JZ0A 2LH0A 1TTEA 4IIWA 3GPXA 3GLIE 2MROB 2VQEM 2DXIA 3C3EA 3QWLA 3GO8A 2HCBA 1OQYA 2K0BX 3AFHA 4AQYM 2W82A 4OX9M 2CHGA 3I04M 3VDUA 2V6ZM 3B7QA 5KQDA 2L2DA 1ORYB 3GLIA 2KHHA 4HLQA 3A46A 1IY1A 3AL0C 1VEGA 1DGFA 4AG5A 4B7GA 5ITTA 2R18A 3SAUA 1XC8A 4MGIE 4DR7M 1IM2A 3U5ZB 3B74A 2JWSA 5DYGA 2JNHA 2X49A 3UJNA 4JI3M 4DBGB 1G59A 1MU5A 4L78A 4YHHM 1DV0A 4DV2M 5KQ8A 3FYCA 2WSCF 4M9ZA 2I7NA 2DWZB 3U5ZA 1QZMA 5LMNM 4P16A 1I4WA 4KT0F 2XLJA 2LHCA 2DAMA 3AV0A 1FNNA 4F1IA 4JI0M 1V33A 2K47A 3WHLA 4LJ5A 1GO5A 2CP8A 1ZAEA 1SG9A 1QAMA 1ZMVA 1OAOC 2DHRA 3RE8A 3GPYA 2J7NA 1Q3BA 2VF7A 4IBCA 5C1BA 1JR3D 4D82A 1AIPC 1QDTA 3K9PA 4PDGA 4NXMM 3I4YA 3TWLA 1RU3A 3KOYE 3B7ZA 2X8AA 1VEJA 4X66M 4IBKA 1L1TA 2R44A 1WJ7A 4IJEA 1DGBA 4R3DA 4DUYM 4RKUF 2CV2A 3EIHA 4PDIA 1J5EM 2LVPC 1MX0A 2JY7A 2JY6B 5H37D 2KZUA 1L2BA 2BWEA 2Z4RA 2QQ8A 1IXZA 3W67A 3HHXA 2KRKA 3KFUG 3M0EA 4R7GA 2WSFF 4B08A 4NSRA 3KW6A 1L1ZA 3PVSA 4MB7A 1HR0M 2E5LM 1WR1B 4NC6A 2Z7JA 4DV6M 1KSFX 1W5TA 2DZLA 5GKNA 2QP9X 1NV9A 1UM8A 1ZMUA 2XSZA 2Q2EB 3E9SA 4G3OA 3K92A 4NOOB 3FTCA 1QUTA 1QAQA 1QYRA 3SYLA 5JI2E 3KSJA 1IY2A 4NSOB 3CF6E 1X37A 2MH8A 3U6CA 2D7EA 1NO1A 4II7A 3H4JA 3PFIA 4AKIA 3J2PB 1T43A 1IXSB 3VLFB 3FTFA 2EO2A 3VFDA 5FSWA 1XWIA 4PCZA 1GKIA 1PJSA 1E9RA 3L29A 4LGMA 4R71A 1VQ1A 2Y0TA 4B3TM 4AI6A 3L27A 3PNYA 2DWMA 3GLHB 4LJ7A 2F5SA 2ZAMA 5L8RF 4MGZE 2LXEA 4P17A 3I4VA 3UK6A 1PJTA 1Z6TA 4WP2A 2L09A 4LJ8A 3U6MA 3U61B 3HHZA 3SBJA 1D0KA 3C3DA 1Q02A 3H4MA 2WZJA 4LJ9A 2ZANA 1KFVA 1G3IA 1J09A 3ILKA 3U60B 4FCVA 3J80S 4B3SM 3BOSA 4XBOA 2UUBM 3KSXA 2CRUA 1ZQ9A 4IBJA 3ZCBB 1J7KA 2BNKA 1XXHB 1D0MA 4GC9A 3ZH9B 3TE6A 4G4RA 1XMQM 2QSFX 4FWHA 4RNAA 1L8QA 1SXJC 2DZNB 1PJJA 4IBEA 2XZFA 2XSZD 4DV0M 3U6SA 4B3MM 3PXGA 3VDPA 2R4EA 1R2YA 2KRUA 5ITXA 3HJ8A 4CGYB 3B89A 3B7NA 1HQYE 3GLGB 3UGJA 1K82A 1PGYA 3BXWA 3J81S 1OIZA 2YNMD 3FUTA 4I5SA 2ERCA 4HEOA 1V34A 4MGHA 2OOAA 1CUKA 3KOWE 1IFYA 4PT5A 2F4VM 2UXCM 2DHYA 2QHOB 2QNJA 2H1RA 3I01M 3U6QA 4ITQA 4DR3M 3F92A 4Z6YA 3LW5F 4DV7M 4M0DA 4A3VB 4G4QA 1HJPA 2O5RA 2RGOA 2ZTDA 4JI6M 3LMMA 3C9PA 1WHCA 3SHGB 4XGIA 3VK7A 1QAOA 4JXJA 4CHTB 3GLFA 1IN4A 1R2ZA 3LQQA 4L6V6 1MN3A 1N78A 1K3WA 2BJWA 5EXTA 3W0FA 4DR1M 2L7HA 3A42A 3HGIA 2CHQA 4GH9A 4IJFA 4DR4M 3E46A 2FOIC 3SASA 4BB9A 2VF8A 3K2LA 4GRIA 3LQRA 3K8ZA 4KHPM 1EFUB 1QANA 1VDLA 3K1JA 1IQPA 2FH0A 3V76A 1XHBA 4FD2A 4LFCM 3TL4X 1OAIA 2YQZA 3IECA 1IY0A 4M9SA 4LF7M 4DR6M 2CE7A 2LVAA 2UXBM 5FLXS 3BBZA 1K3XA 2XZUA 3HJSA 1E32A 2DKLA 1GL7A 3FUWA 1SXJA 4D80A 3R8FA 1PJQA 2JA2A 2Z3XA 2CEAA 2KNZA 2K6BA 3KDSE 2OOBA 4FWDA 4IBFA 4IBBA 4DR2M 2AHMA 3KS4A 1G4AE 4HL4A 1NNJA 4UN2B 3GLGA 4I4LA 1G8PA 2X4AA 3VKGA 2KDLA 5FTJA 2DNAA 1JR3E 2KEBA 4B7FA 3AKZA 3U6PA 5EP1A 2VQFM 3TPZA 4LCBA 4MH0E 1WIVA 2R4JA 2DZOB 2BJVA 1JR3A 2JZ1A 3HJQA 5EQTA 5EXXA 5JI3E 3GPPA 3JR4A 4TUWA 3KVWA 4G4OA 2R46A 3U6EA 4XK8F 3MMPA 1N34M 3CTWB 1IXRC 3SAWA 3MK6A 2QBYB 3K9OA 4L16A 3WHKA 3KOZE 2HHHM 1VDDA 1KYIA 1WXQA 1C1KA 4PD2A 1HNXM 2LTUA 4LF4M 4JYAM 3QAUA 4I81A 1Q3CA 4LFAM 2DWLA 2D7HA 3NWLA 4BBAA 1XB2B 1HT1E 1TH2A 4LJAA 2G3QA 2LBCA 2HAKA 4F2LA 2YFQA 1QDRA 3LVVA 1TH4A 4ZPXA 3DA1A 4FVMA 2RGHA 1G41A 2MJ5B 2HKJA 4IBDA 3U6DA 4CJ6A 1Q39A 1H6UA 3HU2A 4DUZM 1TF0B 3SATA 2XH9A 2RKOA 4WURA 2VDBB 3THGA 5EP4A 1IN7A 1XNRM 1DO2A 3FTDA 3KS8A 4LF9M 2XGNA 4NXNM 4YY3M 3RFWA 3SARA 1NJFA 2OO9A 4Y28F 1A5TA 3B9PA 3GRYA 4LF6M 4KODA 5IREB 5FTKA 3VKHA 3LVWA 3GQ4A 4DR5M 1TDHA 2DI0A 2XFTA 3D8LA 3DFZA 4IBIA 4L15A 1D0LA 3RGPA 3TQSA 5ITQA 3GP1A 1VEKA 1LV7A 4FCTA 4JI4M 2C99A 2MGWA 4LRTA 4X65M 3D8BA 3HU1A 3U6OA 1P3QQ 4L4UA 2EJSA 1R6BX 4LRSA 1BVSA 2JUJA 2R0IA 3ZQJA 5ITUA 2L7IA 1GL6A 2J7OA 1T6OA 3FYDA 5ITYA 1YE9A 1QZEA 2KNVA 4QNMA 4RF0A 4X64M 4B3RM 1E9SA 1OTRA 2UXDM 4GMQA 1NJGA 1HNZM 5DFLA 1FJGM 4BLCA 4KO8A 2C5RA 3GQ5A 1HT2E 2CV0A 3T15A 4JI8M 3T6PA 2XFSA 3ZC7B 1GABA 3W0LB 1N33M 1GJTA 4AZFA 3GRVA 3GLIB 4Q7JA 1T3TA 4RF1A 4CISA 2VIIA 3GRRA 2V1CA 3NBXX 1WGNA 2F5PA 1NHGC 2HL7A 4S12A 4QHTA 5C18A 1R4GA 2A5YB 2DAEA 4G4NA 3IG8A 1Z59A 2EKFA 4FCWA 3CF0A 5EP2A 4GHLA 1QQWA 5FTMA 4OU7A 2FNAA 2CFOA 2GQFA 1F4IA 2EA0A 3HKPA 4AG6A 4KLNA 1C7YA 3KP0E 2M60A 3GQ3A 3SMPA 3QYBA 4M9XA 5E26A 3UMMA 4AKHA 3SC3A 3SFZA 1LTMA 1L2DA 3UZUA 2EKKA 2LVNC 3HHYA 4REZA 3T1YM 2R65A 3M7GA 3FTEA 1IN8A 4DV1M 3SHFA 3PNVA 2N35A 4NRWA 1R7RA 5LMUM 2BWBA 2JP7A 3U6LA 4LG2A 4D81A 2C96A 3GLGE 2F5OA 4K0KM 1DGHA 5IT9S 2DVWB 1R5LA 2EUCA 1VG5A 1NV8A 3FUXA 4GC5A 1N75A 4LGYA 4LFBM 3AOEC 3AJIB 4LY6A 2ZM6M 4GKJM 4DV4M 3FKEA 3L28A 3Q8GA 1GVNA 2RRUA 5E6JA 2KW0A 2O01F 3E4RA 3FRHA 4GKKM 1JB0F 1YLAA 3GLHE 5FTLA 4AKGA 2DAKA 2DAIA 3IHPA 3GPUA 3GRUA 4GHAA 1PRBA 2Y20A 3U61A 2HWJA 2CUZA 3JAMS 1IBMM 8CATA 1Z5CA 2LVQD 1IN6A 2QCUA 2LHGA 2CV1A 1IN5A 1ZV1A 2G5GX 3HWSA 5EP3A 1OFIA 1TGUA 2JY8A 4JI7M 4QHSA 3TWKA 1N77A 3JR5A 5KPTA 2JY5A 5DNYA 2R45A 2DENA 4WW0A 4IBGA 3J7BA 2OQ4A 2H5XA 3A98B 2KZSA 2FS1A 2GNOA 1XNQM 3T38A 1XXHA 2ZTCA 3MJ5A 2FE8A 4JI2M 3SAVA 1OKSA 2Z4SA 5EJCA 1N36M 1N32M 4QOSA 4G6ZA 3DZDA 5KPRA 4LF8M 5A2QS 3EIEA 2QENA 5IZ7D 3L25A 4JN6A 3I51A 1DGHB 2KA6B 1HNWM 1QUSA 2F5QA 5ITXE 2QZ4A 3SYKA 2FFJA 3AOEA 1G71A 4AW4A 1DO0A 2I7PA 2CWBA 1WGLA 3CF2A 2JXNA 2WSEF 1GJSA 2KXEA 4JI5M 4GITA 4NRVA 1Y8GA 4MM3B 1NNUC 2DWNA 1TR8A 1NSFA 3NBIA 2LWXA 2CHVA
chains in the Genus database with same CATH topology
1DGGA 4QNRA 5EXSA 2NQ8C 4JI1M 3U60A 4QOZC 3T1HM 1XMOM 3J27B 4LZZA 1OFHA 3OTOM 3A45A 1QVRA 2P5TA 1D2NA 3L2AA 4EIWA 7CATA 3GLFB 3L26A 2M5ZA 4LJ6A 5KO3A 2QBYA 2C9CA 2UUAM 1SXJE 4OVZA 2F5NA 1SXJD 4LF5M 2YR0A 4M0WA 4DV3M 1Z5BA 1I94M 1YUBA 1S3SA 1SXJB 2UUCM 3VK8A 4MGKE 5BR8M 2Y21A 3AOGA 3HU3A 4NL4H 2V1UA 4X62M 1NY5A 3KXEC 1NVMA 1W5SA 3DOAA 3TWMA 5ITRA 4Z8XA 4OW0A 1YSYA 1PJIA 2XEPA 1E94E 2R62A 3KP1E 3IG5A 1TH3A 2C9OA 2C98A 4B7HA 3C58A 5FTNA 3RGSA 3SMSA 4FWGA 3GLHA 3KOXE 4W5WA 2OPFA 1IBKM 2Y0QA 3MHVC 1HQCA 1OJLA 1GLNA 3FUUA 5KPZA 2G8LA 5EXPA 2L6OA 2ZBKB 2ZAOA 3FD9A 4I8OA 3FUVA 4LZJA 2LNHC 5DYIA 4JV5M 4MGYE 1NY6A 4GIPA 5BPVA 2XF3A 1PM5A 1JQJC 1Z5AA 1TDZA 4L8RC 5IWAM 3HHWA 3M6AA 1L2CA 2QPAA 4FW9A 4LJ4A 5F3WA 1EE8A 4OVZB 3Q8XA 4DV5M 2D7GA 2UU9M 1NHWC 1IBLM 3J7AS 3R9XB 2LH0A 3GPXA 4IIWA 2DXIA 2VQEM 3QWLA 3GO8A 2HCBA 3AFHA 4AQYM 2W82A 4OX9M 2CHGA 3VDUA 2V6ZM 5KQDA 1ORYB 3GLIA 4HLQA 3A46A 1IY1A 3AL0C 1DGFA 4AG5A 4B7GA 5ITTA 2R18A 3SAUA 1XC8A 4MGIE 4DR7M 1IM2A 3U5ZB 5DYGA 2X49A 3UJNA 4JI3M 1G59A 1MU5A 4L78A 4YHHM 4DV2M 5KQ8A 3FYCA 4M9ZA 2I7NA 2DWZB 3U5ZA 1QZMA 5LMNM 4P16A 1I4WA 2XLJA 3AV0A 1FNNA 4JI0M 2K47A 3WHLA 4LJ5A 1ZAEA 1QAMA 3RE8A 2DHRA 3GPYA 2J7NA 1Q3BA 4IBCA 5C1BA 1JR3D 4D82A 4PDGA 4NXMM 3I4YA 3TWLA 3KOYE 2X8AA 4X66M 4IBKA 1L1TA 4IJEA 1DGBA 4R3DA 4DUYM 2CV2A 3EIHA 4PDIA 1J5EM 1MX0A 5H37D 2KZUA 1L2BA 2Z4RA 1IXZA 3HHXA 2KRKA 3KFUG 3M0EA 4R7GA 4B08A 4NSRA 3KW6A 1L1ZA 3PVSA 4MB7A 1HR0M 2E5LM 2Z7JA 4DV6M 1KSFX 1W5TA 5GKNA 2QP9X 1UM8A 2XSZA 2Q2EB 3E9SA 3K92A 4NOOB 3FTCA 1QYRA 1QAQA 3SYLA 5JI2E 3KSJA 1IY2A 4NSOB 3CF6E 1X37A 3U6CA 2D7EA 4II7A 3PFIA 4AKIA 3J2PB 3VLFB 1IXSB 3FTFA 2EO2A 3VFDA 5FSWA 1XWIA 4PCZA 1GKIA 1E9RA 3L29A 4LGMA 2Y0TA 4B3TM 4AI6A 3L27A 3PNYA 2DWMA 3GLHB 4LJ7A 2F5SA 2ZAMA 4MGZE 2LXEA 3I4VA 3UK6A 1Z6TA 2L09A 4LJ8A 3U6MA 3U61B 3HHZA 3SBJA 3H4MA 4LJ9A 2ZANA 1KFVA 1G3IA 1J09A 3ILKA 3U60B 4FCVA 3J80S 4B3SM 3BOSA 4XBOA 2UUBM 3KSXA 1ZQ9A 4IBJA 3ZCBB 1J7KA 2BNKA 1XXHB 4GC9A 3ZH9B 3TE6A 4G4RA 1XMQM 4RNAA 4FWHA 1L8QA 1SXJC 2DZNB 1PJJA 4IBEA 2XZFA 2XSZD 4DV0M 3U6SA 4B3MM 3PXGA 3VDPA 2R4EA 1R2YA 2KRUA 5ITXA 3HJ8A 4CGYB 1HQYE 3GLGB 3UGJA 1K82A 3J81S 2YNMD 3FUTA 4I5SA 2ERCA 4MGHA 3KOWE 4PT5A 2F4VM 2UXCM 2H1RA 3U6QA 4ITQA 4DR3M 4Z6YA 4DV7M 4M0DA 4A3VB 4G4QA 2O5RA 2RGOA 4JI6M 3LMMA 3SHGB 4XGIA 3VK7A 1QAOA 4JXJA 4CHTB 3GLFA 1IN4A 1R2ZA 3LQQA 1N78A 1K3WA 2BJWA 5EXTA 3W0FA 4DR1M 2L7HA 3A42A 3HGIA 2CHQA 4GH9A 4IJFA 4DR4M 2FOIC 3SASA 4BB9A 3K2LA 4GRIA 3LQRA 3K8ZA 4KHPM 1QANA 3K1JA 1IQPA 1XHBA 4FD2A 4LFCM 3TL4X 2YQZA 4M9SA 4DR6M 1IY0A 4LF7M 2UXBM 2CE7A 5FLXS 1K3XA 2XZUA 3HJSA 1E32A 1GL7A 3FUWA 1SXJA 4D80A 3R8FA 2JA2A 2Z3XA 2CEAA 3KDSE 4FWDA 4IBFA 4IBBA 4DR2M 2AHMA 3KS4A 1G4AE 4HL4A 1NNJA 3GLGA 4I4LA 1G8PA 2X4AA 3VKGA 5FTJA 2KEBA 4B7FA 3AKZA 3U6PA 5EP1A 2VQFM 3TPZA 4LCBA 4MH0E 2DZOB 2BJVA 2R4JA 1JR3A 3HJQA 5EQTA 5EXXA 5JI3E 3GPPA 3JR4A 4TUWA 3KVWA 4G4OA 2R46A 3U6EA 1N34M 3CTWB 1IXRC 3SAWA 3MK6A 2QBYB 4L16A 3WHKA 3KOZE 2HHHM 1VDDA 1KYIA 1WXQA 1C1KA 4PD2A 1HNXM 4LF4M 4JYAM 3QAUA 4I81A 1Q3CA 4LFAM 2DWLA 2D7HA 3NWLA 4BBAA 1HT1E 1TH2A 4LJAA 2YFQA 3LVVA 1TH4A 4ZPXA 3DA1A 4FVMA 2RGHA 1G41A 2HKJA 4IBDA 3U6DA 1Q39A 1H6UA 3HU2A 4DUZM 3SATA 2XH9A 2RKOA 4WURA 3THGA 5EP4A 1IN7A 1XNRM 1DO2A 3FTDA 3KS8A 4LF9M 2XGNA 4NXNM 4YY3M 3RFWA 3SARA 1NJFA 3B9PA 3GRYA 4LF6M 4KODA 5IREB 5FTKA 3VKHA 3LVWA 3GQ4A 4DR5M 1TDHA 2XFTA 3D8LA 3DFZA 4IBIA 4L15A 3RGPA 3TQSA 5ITQA 3GP1A 1LV7A 4FCTA 4JI4M 2C99A 4LRTA 4X65M 3D8BA 3HU1A 3U6OA 4L4UA 1R6BX 4LRSA 5ITUA 1GL6A 2L7IA 2J7OA 5ITYA 3FYDA 4X64M 1YE9A 4QNMA 4RF0A 4B3RM 1E9SA 2UXDM 4GMQA 1NJGA 1HNZM 1FJGM 4BLCA 4KO8A 2C5RA 3GQ5A 1HT2E 2CV0A 3T15A 4JI8M 2XFSA 3ZC7B 3W0LB 1N33M 4AZFA 3GRVA 3GLIB 1T3TA 4RF1A 4CISA 2VIIA 3GRRA 2V1CA 2F5PA 1NHGC 2HL7A 4S12A 4QHTA 5C18A 2A5YB 4G4NA 3IG8A 1Z59A 4FCWA 3CF0A 5EP2A 4GHLA 1QQWA 5FTMA 4OU7A 2FNAA 2CFOA 2EA0A 3HKPA 4AG6A 4KLNA 3KP0E 2M60A 3GQ3A 3SMPA 5E26A 4M9XA 3UMMA 4AKHA 3SFZA 1L2DA 3UZUA 3HHYA 3T1YM 4REZA 2R65A 3M7GA 3FTEA 1IN8A 4DV1M 3SHFA 3PNVA 4NRWA 1R7RA 5LMUM 4LG2A 3U6LA 4D81A 2C96A 2F5OA 4K0KM 5IT9S 1DGHA 2DVWB 2EUCA 3FUXA 4GC5A 1N75A 4LGYA 4LFBM 3AOEC 3AJIB 4LY6A 2ZM6M 4GKJM 4DV4M 3FKEA 3L28A 1GVNA 5E6JA 2KW0A 3E4RA 4GKKM 5FTLA 4AKGA 3GPUA 3GRUA 4GHAA 2Y20A 3U61A 1IBMM 2CUZA 3JAMS 8CATA 1Z5CA 1IN6A 2QCUA 2CV1A 1IN5A 2G5GX 3HWSA 5EP3A 1OFIA 1TGUA 4JI7M 4QHSA 3TWKA 1N77A 3JR5A 5KPTA 5DNYA 2R45A 4WW0A 4IBGA 3J7BA 2OQ4A 3A98B 2KZSA 1XNQM 3T38A 1XXHA 3MJ5A 2FE8A 4JI2M 3SAVA 2Z4SA 5EJCA 1N36M 1N32M 4QOSA 4G6ZA 3DZDA 5KPRA 4LF8M 5A2QS 3EIEA 2QENA 5IZ7D 3L25A 4JN6A 3I51A 1DGHB 2KA6B 1HNWM 2F5QA 5ITXE 2QZ4A 3SYKA 2FFJA 3AOEA 4AW4A 1DO0A 2I7PA 3CF2A 2KXEA 4JI5M 4GITA 4NRVA 4MM3B 1NNUC 2DWNA 3SC3A 1NSFA 3NBIA 2LWXA 2CHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR3 D;  4QNR A;  5EXS A;  4KO8 A;  4D82 A;  1HT2 E;  4LZZ A;  1OFH A;  3GLF A;  1IN4 A;  2X8A A;  2BJW A;  1QVR A;  5EXT A;  1D2N A;  4EIW A;  3GLF B;  3GLI B;  2CHQ A;  2V1U A;  4LJ6 A;  2VII A;  2QBY A;  3EIH A;  2C9C A;  4QHT A;  5C18 A;  1SXJ E;  3K1J A;  1IQP A;  4FD2 A;  1SXJ D;  2Z4R A;  1IY0 A;  2CE7 A;  1IXZ A;  1S3S A;  2KRK A;  1SXJ B;  4FCW A;  1E32 A;  3CF0 A;  3M0E A;  5EP2 A;  1SXJ A;  3HU3 A;  5FTM A;  4D80 A;  3R8F A;  2FNA A;  1NY5 A;  3KW6 A;  1NVM A;  1W5S A;  2CEA A;  3KDS E;  4FWD A;  4KLN A;  3PVS A;  4Z8X A;  1G4A E;  3GLG A;  1NJG A;  4I4L A;  1E94 E;  1KSF X;  1W5T A;  2R62 A;  2QP9 X;  1UM8 A;  2XSZ A;  2C9O A;  2C98 A;  5FTJ A;  5FTN A;  2R65 A;  3SYL A;  5JI2 E;  5EP1 A;  1IY2 A;  1IN8 A;  4FWG A;  3GLH A;  4LCB A;  1X37 A;  2DZO B;  2BJV A;  3MHV C;  1JR3 A;  1HQC A;  1R7R A;  3PFI A;  5EQT A;  5EXX A;  5JI3 E;  4D81 A;  2C96 A;  3VLF B;  1IXS B;  1OJL A;  3VFD A;  1XWI A;  2DVW B;  1IXR C;  2QBY B;  4LGM A;  4L16 A;  3WHK A;  5EXP A;  3AJI B;  4LY6 A;  2ZAO A;  1KYI A;  5DYI A;  1C1K A;  4A3V B;  3GLH B;  1NY6 A;  4LJ7 A;  2ZAM A;  4I81 A;  1JQJ C;  1HT1 E;  4LJA A;  3UK6 A;  3M6A A;  5FTL A;  2QPA A;  4FW9 A;  4LJ4 A;  4LJ8 A;  3U61 B;  4ZPX A;  3H4M A;  1G41 A;  4LJ9 A;  1IN6 A;  2ZAN A;  1IN5 A;  1G3I A;  3HU2 A;  3HWS A;  5EP3 A;  1OFI A;  3U60 B;  4FCV A;  2RKO A;  4QHS A;  2HCB A;  3BOS A;  5EP4 A;  2CHG A;  1IN7 A;  2V6Z M;  4WW0 A;  1J7K A;  1DO2 A;  1XXH B;  3GLI A;  1IY1 A;  3ZH9 B;  4FWH A;  1XXH A;  1L8Q A;  1NJF A;  1SXJ C;  1IM2 A;  2DZN B;  3U5Z B;  2Z4S A;  3B9P A;  2XSZ D;  4KOD A;  5DYG A;  5FTK A;  4QOS A;  3DZD A;  4L15 A;  3EIE A;  2QEN A;  3PXG A;  4JN6 A;  1LV7 A;  4FCT A;  2C99 A;  4LRT A;  1HQY E;  3GLG B;  3D8B A;  2DWZ B;  3HU1 A;  1QZM A;  2QZ4 A;  3SYK A;  4L4U A;  1R6B X;  4LRS A;  1FNN A;  1DO0 A;  3CF2 A;  3WHL A;  4LJ5 A;  4QNM A;  4GIT A;  2DHR A;  3SC3 A;  1NSF A;  2CHV A;  5C1B A; 
#chains in the Genus database with same CATH topology
 1ZMW A;  1DGG A;  4QNR A;  5EXS A;  3HX3 A;  2NQ8 C;  4JI1 M;  3U60 A;  4QOZ C;  3T1H M;  2R6F A;  1XMO M;  3J27 B;  4LZZ A;  1OIP A;  1OFH A;  2LVO C;  3OTO M;  3A45 A;  1QVR A;  2P5T A;  1D2N A;  3L2A A;  4GEW A;  4EIW A;  7CAT A;  3GLF B;  3L26 A;  2M5Z A;  4LJ6 A;  5KO3 A;  2QBY A;  2C9C A;  2UUA M;  1SXJ E;  3GLF E;  4CIZ A;  4OVZ A;  2F5N A;  1SXJ D;  3HY5 A;  3W68 A;  1XXH E;  2YR0 A;  4M0W A;  1Z5B A;  4DV3 M;  1I94 M;  4LF5 M;  1YUB A;  1S3S A;  3LCU A;  1SXJ B;  2UUC M;  3VK8 A;  4MGK E;  2O25 A;  5BR8 M;  2Y21 A;  2Z8Y M;  3AOG A;  3HU3 A;  4NL4 H;  2V1U A;  4X62 M;  1NY5 A;  3KXE C;  1NVM A;  1W5S A;  3DOA A;  3TWM A;  3FE3 A;  5ITR A;  2B3T A;  4Z8X A;  4OW0 A;  3QYE A;  1YSY A;  1PJI A;  1EIJ A;  1IXS A;  2XEP A;  1E94 E;  3CGW A;  2R62 A;  3KP1 E;  3IG5 A;  1TH3 A;  2K9D A;  2C9O A;  2C98 A;  2L4E A;  4B7H A;  3C58 A;  5FTN A;  3RGS A;  3SMS A;  3E21 A;  4FWG A;  3GLH A;  3KOX E;  4W5W A;  2OPF A;  1IBK M;  1UFZ A;  2Y0Q A;  3MHV C;  2DAG A;  1HQC A;  2KNA A;  2APL A;  1OJL A;  1GLN A;  3FUU A;  5KPZ A;  2G8L A;  5EXP A;  2L6O A;  2ZBK B;  2ZAO A;  3FD9 A;  4I8O A;  3FUV A;  3LCV B;  2LNH C;  4LZJ A;  2MR9 A;  5DYI A;  4JV5 M;  4MGY E;  1NY6 A;  4GIP A;  5BPV A;  2XF3 A;  1PM5 A;  1JQJ C;  1Z5A A;  1TDZ A;  4L8R C;  5IWA M;  4ANR A;  3HZJ A;  3FRI A;  3HHW A;  3M6A A;  2J5Y A;  2QPA A;  4FW9 A;  1L2C A;  4LJ4 A;  5F3W A;  1EE8 A;  4OVZ B;  1MJG M;  3Q8X A;  1V92 A;  4DV5 M;  2D7G A;  2L4F A;  2UU9 M;  1NHW C;  1IBL M;  3J7A S;  1AUA A;  3R9X B;  2JZ0 A;  2LH0 A;  1TTE A;  4IIW A;  3GPX A;  3GLI E;  2MRO B;  2VQE M;  2DXI A;  3C3E A;  3QWL A;  3GO8 A;  2HCB A;  1OQY A;  2K0B X;  3AFH A;  4AQY M;  2W82 A;  4OX9 M;  2CHG A;  3I04 M;  3VDU A;  2V6Z M;  3B7Q A;  5KQD A;  2L2D A;  1ORY B;  3GLI A;  2KHH A;  4HLQ A;  3A46 A;  1IY1 A;  3AL0 C;  1VEG A;  1DGF A;  4AG5 A;  4B7G A;  5ITT A;  2R18 A;  3SAU A;  1XC8 A;  4MGI E;  4DR7 M;  1IM2 A;  3U5Z B;  3B74 A;  2JWS A;  5DYG A;  2JNH A;  2X49 A;  3UJN A;  4JI3 M;  4DBG B;  1G59 A;  1MU5 A;  4L78 A;  4YHH M;  1DV0 A;  4DV2 M;  5KQ8 A;  3FYC A;  2WSC F;  4M9Z A;  2I7N A;  2DWZ B;  3U5Z A;  1QZM A;  5LMN M;  4P16 A;  1I4W A;  4KT0 F;  2XLJ A;  2LHC A;  2DAM A;  3AV0 A;  1FNN A;  4F1I A;  4JI0 M;  1V33 A;  2K47 A;  3WHL A;  4LJ5 A;  1GO5 A;  2CP8 A;  1ZAE A;  1SG9 A;  1QAM A;  1ZMV A;  1OAO C;  2DHR A;  3RE8 A;  3GPY A;  2J7N A;  1Q3B A;  2VF7 A;  4IBC A;  5C1B A;  1JR3 D;  4D82 A;  1AIP C;  1QDT A;  3K9P A;  4PDG A;  4NXM M;  3I4Y A;  3TWL A;  1RU3 A;  3KOY E;  3B7Z A;  2X8A A;  1VEJ A;  4X66 M;  4IBK A;  1L1T A;  2R44 A;  1WJ7 A;  4IJE A;  1DGB A;  4R3D A;  4DUY M;  4RKU F;  2CV2 A;  3EIH A;  4PDI A;  1J5E M;  2LVP C;  1MX0 A;  2JY7 A;  2JY6 B;  5H37 D;  2KZU A;  1L2B A;  2BWE A;  2Z4R A;  2QQ8 A;  1IXZ A;  3W67 A;  3HHX A;  2KRK A;  3KFU G;  3M0E A;  4R7G A;  2WSF F;  4B08 A;  4NSR A;  3KW6 A;  1L1Z A;  3PVS A;  4MB7 A;  1HR0 M;  2E5L M;  1WR1 B;  4NC6 A;  2Z7J A;  4DV6 M;  1KSF X;  1W5T A;  2DZL A;  5GKN A;  2QP9 X;  1NV9 A;  1UM8 A;  1ZMU A;  2XSZ A;  2Q2E B;  3E9S A;  4G3O A;  3K92 A;  4NOO B;  3FTC A;  1QUT A;  1QAQ A;  1QYR A;  3SYL A;  5JI2 E;  3KSJ A;  1IY2 A;  4NSO B;  3CF6 E;  1X37 A;  2MH8 A;  3U6C A;  2D7E A;  1NO1 A;  4II7 A;  3H4J A;  3PFI A;  4AKI A;  3J2P B;  1T43 A;  1IXS B;  3VLF B;  3FTF A;  2EO2 A;  3VFD A;  5FSW A;  1XWI A;  4PCZ A;  1GKI A;  1PJS A;  1E9R A;  3L29 A;  4LGM A;  4R71 A;  1VQ1 A;  2Y0T A;  4B3T M;  4AI6 A;  3L27 A;  3PNY A;  2DWM A;  3GLH B;  4LJ7 A;  2F5S A;  2ZAM A;  5L8R F;  4MGZ E;  2LXE A;  4P17 A;  3I4V A;  3UK6 A;  1PJT A;  1Z6T A;  4WP2 A;  2L09 A;  4LJ8 A;  3U6M A;  3U61 B;  3HHZ A;  3SBJ A;  1D0K A;  3C3D A;  1Q02 A;  3H4M A;  2WZJ A;  4LJ9 A;  2ZAN A;  1KFV A;  1G3I A;  1J09 A;  3ILK A;  3U60 B;  4FCV A;  3J80 S;  4B3S M;  3BOS A;  4XBO A;  2UUB M;  3KSX A;  2CRU A;  1ZQ9 A;  4IBJ A;  3ZCB B;  1J7K A;  2BNK A;  1XXH B;  1D0M A;  4GC9 A;  3ZH9 B;  3TE6 A;  4G4R A;  1XMQ M;  2QSF X;  4FWH A;  4RNA A;  1L8Q A;  1SXJ C;  2DZN B;  1PJJ A;  4IBE A;  2XZF A;  2XSZ D;  4DV0 M;  3U6S A;  4B3M M;  3PXG A;  3VDP A;  2R4E A;  1R2Y A;  2KRU A;  5ITX A;  3HJ8 A;  4CGY B;  3B89 A;  3B7N A;  1HQY E;  3GLG B;  3UGJ A;  1K82 A;  1PGY A;  3BXW A;  3J81 S;  1OIZ A;  2YNM D;  3FUT A;  4I5S A;  2ERC A;  4HEO A;  1V34 A;  4MGH A;  2OOA A;  1CUK A;  3KOW E;  1IFY A;  4PT5 A;  2F4V M;  2UXC M;  2DHY A;  2QHO B;  2QNJ A;  2H1R A;  3I01 M;  3U6Q A;  4ITQ A;  4DR3 M;  3F92 A;  4Z6Y A;  3LW5 F;  4DV7 M;  4M0D A;  4A3V B;  4G4Q A;  1HJP A;  2O5R A;  2RGO A;  2ZTD A;  4JI6 M;  3LMM A;  3C9P A;  1WHC A;  3SHG B;  4XGI A;  3VK7 A;  1QAO A;  4JXJ A;  4CHT B;  3GLF A;  1IN4 A;  1R2Z A;  3LQQ A;  4L6V 6;  1MN3 A;  1N78 A;  1K3W A;  2BJW A;  5EXT A;  3W0F A;  4DR1 M;  2L7H A;  3A42 A;  3HGI A;  2CHQ A;  4GH9 A;  4IJF A;  4DR4 M;  3E46 A;  2FOI C;  3SAS A;  4BB9 A;  2VF8 A;  3K2L A;  4GRI A;  3LQR A;  3K8Z A;  4KHP M;  1EFU B;  1QAN A;  1VDL A;  3K1J A;  1IQP A;  2FH0 A;  3V76 A;  1XHB A;  4FD2 A;  4LFC M;  3TL4 X;  1OAI A;  2YQZ A;  3IEC A;  1IY0 A;  4M9S A;  4LF7 M;  4DR6 M;  2CE7 A;  2LVA A;  2UXB M;  5FLX S;  3BBZ A;  1K3X A;  2XZU A;  3HJS A;  1E32 A;  2DKL A;  1GL7 A;  3FUW A;  1SXJ A;  4D80 A;  3R8F A;  1PJQ A;  2JA2 A;  2Z3X A;  2CEA A;  2KNZ A;  2K6B A;  3KDS E;  2OOB A;  4FWD A;  4IBF A;  4IBB A;  4DR2 M;  2AHM A;  3KS4 A;  1G4A E;  4HL4 A;  1NNJ A;  4UN2 B;  3GLG A;  4I4L A;  1G8P A;  2X4A A;  3VKG A;  2KDL A;  5FTJ A;  2DNA A;  1JR3 E;  2KEB A;  4B7F A;  3AKZ A;  3U6P A;  5EP1 A;  2VQF M;  3TPZ A;  4LCB A;  4MH0 E;  1WIV A;  2R4J A;  2DZO B;  2BJV A;  1JR3 A;  2JZ1 A;  3HJQ A;  5EQT A;  5EXX A;  5JI3 E;  3GPP A;  3JR4 A;  4TUW A;  3KVW A;  4G4O A;  2R46 A;  3U6E A;  4XK8 F;  3MMP A;  1N34 M;  3CTW B;  1IXR C;  3SAW A;  3MK6 A;  2QBY B;  3K9O A;  4L16 A;  3WHK A;  3KOZ E;  2HHH M;  1VDD A;  1KYI A;  1WXQ A;  1C1K A;  4PD2 A;  1HNX M;  2LTU A;  4LF4 M;  4JYA M;  3QAU A;  4I81 A;  1Q3C A;  4LFA M;  2DWL A;  2D7H A;  3NWL A;  4BBA A;  1XB2 B;  1HT1 E;  1TH2 A;  4LJA A;  2G3Q A;  2LBC A;  2HAK A;  4F2L A;  2YFQ A;  1QDR A;  3LVV A;  1TH4 A;  4ZPX A;  3DA1 A;  4FVM A;  2RGH A;  1G41 A;  2MJ5 B;  2HKJ A;  4IBD A;  3U6D A;  4CJ6 A;  1Q39 A;  1H6U A;  3HU2 A;  4DUZ M;  1TF0 B;  3SAT A;  2XH9 A;  2RKO A;  4WUR A;  2VDB B;  3THG A;  5EP4 A;  1IN7 A;  1XNR M;  1DO2 A;  3FTD A;  3KS8 A;  4LF9 M;  2XGN A;  4NXN M;  4YY3 M;  3RFW A;  3SAR A;  1NJF A;  2OO9 A;  4Y28 F;  1A5T A;  3B9P A;  3GRY A;  4LF6 M;  4KOD A;  5IRE B;  5FTK A;  3VKH A;  3LVW A;  3GQ4 A;  4DR5 M;  1TDH A;  2DI0 A;  2XFT A;  3D8L A;  3DFZ A;  4IBI A;  4L15 A;  1D0L A;  3RGP A;  3TQS A;  5ITQ A;  3GP1 A;  1VEK A;  1LV7 A;  4FCT A;  4JI4 M;  2C99 A;  2MGW A;  4LRT A;  4X65 M;  3D8B A;  3HU1 A;  3U6O A;  1P3Q Q;  4L4U A;  2EJS A;  1R6B X;  4LRS A;  1BVS A;  2JUJ A;  2R0I A;  3ZQJ A;  5ITU A;  2L7I A;  1GL6 A;  2J7O A;  1T6O A;  3FYD A;  5ITY A;  1YE9 A;  1QZE A;  2KNV A;  4QNM A;  4RF0 A;  4X64 M;  4B3R M;  1E9S A;  1OTR A;  2UXD M;  4GMQ A;  1NJG A;  1HNZ M;  5DFL A;  1FJG M;  4BLC A;  4KO8 A;  2C5R A;  3GQ5 A;  1HT2 E;  2CV0 A;  3T15 A;  4JI8 M;  3T6P A;  2XFS A;  3ZC7 B;  1GAB A;  3W0L B;  1N33 M;  1GJT A;  4AZF A;  3GRV A;  3GLI B;  4Q7J A;  1T3T A;  4RF1 A;  4CIS A;  2VII A;  3GRR A;  2V1C A;  3NBX X;  1WGN A;  2F5P A;  1NHG C;  2HL7 A;  4S12 A;  4QHT A;  5C18 A;  1R4G A;  2A5Y B;  2DAE A;  4G4N A;  3IG8 A;  1Z59 A;  2EKF A;  4FCW A;  3CF0 A;  5EP2 A;  4GHL A;  1QQW A;  5FTM A;  4OU7 A;  2FNA A;  2CFO A;  2GQF A;  1F4I A;  2EA0 A;  3HKP A;  4AG6 A;  4KLN A;  1C7Y A;  3KP0 E;  2M60 A;  3GQ3 A;  3SMP A;  3QYB A;  4M9X A;  5E26 A;  3UMM A;  4AKH A;  3SC3 A;  3SFZ A;  1LTM A;  1L2D A;  3UZU A;  2EKK A;  2LVN C;  3HHY A;  4REZ A;  3T1Y M;  2R65 A;  3M7G A;  3FTE A;  1IN8 A;  4DV1 M;  3SHF A;  3PNV A;  2N35 A;  4NRW A;  1R7R A;  5LMU M;  2BWB A;  2JP7 A;  3U6L A;  4LG2 A;  4D81 A;  2C96 A;  3GLG E;  2F5O A;  4K0K M;  1DGH A;  5IT9 S;  2DVW B;  1R5L A;  2EUC A;  1VG5 A;  1NV8 A;  3FUX A;  4GC5 A;  1N75 A;  4LGY A;  4LFB M;  3AOE C;  3AJI B;  4LY6 A;  2ZM6 M;  4GKJ M;  4DV4 M;  3FKE A;  3L28 A;  3Q8G A;  1GVN A;  2RRU A;  5E6J A;  2KW0 A;  2O01 F;  3E4R A;  3FRH A;  4GKK M;  1JB0 F;  1YLA A;  3GLH E;  5FTL A;  4AKG A;  2DAK A;  2DAI A;  3IHP A;  3GPU A;  3GRU A;  4GHA A;  1PRB A;  2Y20 A;  3U61 A;  2HWJ A;  2CUZ A;  3JAM S;  1IBM M;  8CAT A;  1Z5C A;  2LVQ D;  1IN6 A;  2QCU A;  2LHG A;  2CV1 A;  1IN5 A;  1ZV1 A;  2G5G X;  3HWS A;  5EP3 A;  1OFI A;  1TGU A;  2JY8 A;  4JI7 M;  4QHS A;  3TWK A;  1N77 A;  3JR5 A;  5KPT A;  2JY5 A;  5DNY A;  2R45 A;  2DEN A;  4WW0 A;  4IBG A;  3J7B A;  2OQ4 A;  2H5X A;  3A98 B;  2KZS A;  2FS1 A;  2GNO A;  1XNQ M;  3T38 A;  1XXH A;  2ZTC A;  3MJ5 A;  2FE8 A;  4JI2 M;  3SAV A;  1OKS A;  2Z4S A;  5EJC A;  1N36 M;  1N32 M;  4QOS A;  4G6Z A;  3DZD A;  5KPR A;  4LF8 M;  5A2Q S;  3EIE A;  2QEN A;  5IZ7 D;  3L25 A;  4JN6 A;  3I51 A;  1DGH B;  2KA6 B;  1HNW M;  1QUS A;  2F5Q A;  5ITX E;  2QZ4 A;  3SYK A;  2FFJ A;  3AOE A;  1G71 A;  4AW4 A;  1DO0 A;  2I7P A;  2CWB A;  1WGL A;  3CF2 A;  2JXN A;  2WSE F;  1GJS A;  2KXE A;  4JI5 M;  4GIT A;  4NRV A;  1Y8G A;  4MM3 B;  1NNU C;  2DWN A;  1TR8 A;  1NSF A;  3NBI A;  2LWX A;  2CHV A; 
#chains in the Genus database with same CATH homology
 1DGG A;  4QNR A;  5EXS A;  2NQ8 C;  4JI1 M;  3U60 A;  4QOZ C;  3T1H M;  1XMO M;  3J27 B;  4LZZ A;  1OFH A;  3OTO M;  3A45 A;  1QVR A;  2P5T A;  1D2N A;  3L2A A;  4EIW A;  7CAT A;  3GLF B;  3L26 A;  2M5Z A;  4LJ6 A;  5KO3 A;  2QBY A;  2C9C A;  2UUA M;  1SXJ E;  4OVZ A;  2F5N A;  1SXJ D;  4LF5 M;  2YR0 A;  4M0W A;  4DV3 M;  1Z5B A;  1I94 M;  1YUB A;  1S3S A;  1SXJ B;  2UUC M;  3VK8 A;  4MGK E;  5BR8 M;  2Y21 A;  3AOG A;  3HU3 A;  4NL4 H;  2V1U A;  4X62 M;  1NY5 A;  3KXE C;  1NVM A;  1W5S A;  3DOA A;  3TWM A;  5ITR A;  4Z8X A;  4OW0 A;  1YSY A;  1PJI A;  2XEP A;  1E94 E;  2R62 A;  3KP1 E;  3IG5 A;  1TH3 A;  2C9O A;  2C98 A;  4B7H A;  3C58 A;  5FTN A;  3RGS A;  3SMS A;  4FWG A;  3GLH A;  3KOX E;  4W5W A;  2OPF A;  1IBK M;  2Y0Q A;  3MHV C;  1HQC A;  1OJL A;  1GLN A;  3FUU A;  5KPZ A;  2G8L A;  5EXP A;  2L6O A;  2ZBK B;  2ZAO A;  3FD9 A;  4I8O A;  3FUV A;  4LZJ A;  2LNH C;  5DYI A;  4JV5 M;  4MGY E;  1NY6 A;  4GIP A;  5BPV A;  2XF3 A;  1PM5 A;  1JQJ C;  1Z5A A;  1TDZ A;  4L8R C;  5IWA M;  3HHW A;  3M6A A;  1L2C A;  2QPA A;  4FW9 A;  4LJ4 A;  5F3W A;  1EE8 A;  4OVZ B;  3Q8X A;  4DV5 M;  2D7G A;  2UU9 M;  1NHW C;  1IBL M;  3J7A S;  3R9X B;  2LH0 A;  3GPX A;  4IIW A;  2DXI A;  2VQE M;  3QWL A;  3GO8 A;  2HCB A;  3AFH A;  4AQY M;  2W82 A;  4OX9 M;  2CHG A;  3VDU A;  2V6Z M;  5KQD A;  1ORY B;  3GLI A;  4HLQ A;  3A46 A;  1IY1 A;  3AL0 C;  1DGF A;  4AG5 A;  4B7G A;  5ITT A;  2R18 A;  3SAU A;  1XC8 A;  4MGI E;  4DR7 M;  1IM2 A;  3U5Z B;  5DYG A;  2X49 A;  3UJN A;  4JI3 M;  1G59 A;  1MU5 A;  4L78 A;  4YHH M;  4DV2 M;  5KQ8 A;  3FYC A;  4M9Z A;  2I7N A;  2DWZ B;  3U5Z A;  1QZM A;  5LMN M;  4P16 A;  1I4W A;  2XLJ A;  3AV0 A;  1FNN A;  4JI0 M;  2K47 A;  3WHL A;  4LJ5 A;  1ZAE A;  1QAM A;  3RE8 A;  2DHR A;  3GPY A;  2J7N A;  1Q3B A;  4IBC A;  5C1B A;  1JR3 D;  4D82 A;  4PDG A;  4NXM M;  3I4Y A;  3TWL A;  3KOY E;  2X8A A;  4X66 M;  4IBK A;  1L1T A;  4IJE A;  1DGB A;  4R3D A;  4DUY M;  2CV2 A;  3EIH A;  4PDI A;  1J5E M;  1MX0 A;  5H37 D;  2KZU A;  1L2B A;  2Z4R A;  1IXZ A;  3HHX A;  2KRK A;  3KFU G;  3M0E A;  4R7G A;  4B08 A;  4NSR A;  3KW6 A;  1L1Z A;  3PVS A;  4MB7 A;  1HR0 M;  2E5L M;  2Z7J A;  4DV6 M;  1KSF X;  1W5T A;  5GKN A;  2QP9 X;  1UM8 A;  2XSZ A;  2Q2E B;  3E9S A;  3K92 A;  4NOO B;  3FTC A;  1QYR A;  1QAQ A;  3SYL A;  5JI2 E;  3KSJ A;  1IY2 A;  4NSO B;  3CF6 E;  1X37 A;  3U6C A;  2D7E A;  4II7 A;  3PFI A;  4AKI A;  3J2P B;  3VLF B;  1IXS B;  3FTF A;  2EO2 A;  3VFD A;  5FSW A;  1XWI A;  4PCZ A;  1GKI A;  1E9R A;  3L29 A;  4LGM A;  2Y0T A;  4B3T M;  4AI6 A;  3L27 A;  3PNY A;  2DWM A;  3GLH B;  4LJ7 A;  2F5S A;  2ZAM A;  4MGZ E;  2LXE A;  3I4V A;  3UK6 A;  1Z6T A;  2L09 A;  4LJ8 A;  3U6M A;  3U61 B;  3HHZ A;  3SBJ A;  3H4M A;  4LJ9 A;  2ZAN A;  1KFV A;  1G3I A;  1J09 A;  3ILK A;  3U60 B;  4FCV A;  3J80 S;  4B3S M;  3BOS A;  4XBO A;  2UUB M;  3KSX A;  1ZQ9 A;  4IBJ A;  3ZCB B;  1J7K A;  2BNK A;  1XXH B;  4GC9 A;  3ZH9 B;  3TE6 A;  4G4R A;  1XMQ M;  4RNA A;  4FWH A;  1L8Q A;  1SXJ C;  2DZN B;  1PJJ A;  4IBE A;  2XZF A;  2XSZ D;  4DV0 M;  3U6S A;  4B3M M;  3PXG A;  3VDP A;  2R4E A;  1R2Y A;  2KRU A;  5ITX A;  3HJ8 A;  4CGY B;  1HQY E;  3GLG B;  3UGJ A;  1K82 A;  3J81 S;  2YNM D;  3FUT A;  4I5S A;  2ERC A;  4MGH A;  3KOW E;  4PT5 A;  2F4V M;  2UXC M;  2H1R A;  3U6Q A;  4ITQ A;  4DR3 M;  4Z6Y A;  4DV7 M;  4M0D A;  4A3V B;  4G4Q A;  2O5R A;  2RGO A;  4JI6 M;  3LMM A;  3SHG B;  4XGI A;  3VK7 A;  1QAO A;  4JXJ A;  4CHT B;  3GLF A;  1IN4 A;  1R2Z A;  3LQQ A;  1N78 A;  1K3W A;  2BJW A;  5EXT A;  3W0F A;  4DR1 M;  2L7H A;  3A42 A;  3HGI A;  2CHQ A;  4GH9 A;  4IJF A;  4DR4 M;  2FOI C;  3SAS A;  4BB9 A;  3K2L A;  4GRI A;  3LQR A;  3K8Z A;  4KHP M;  1QAN A;  3K1J A;  1IQP A;  1XHB A;  4FD2 A;  4LFC M;  3TL4 X;  2YQZ A;  4M9S A;  4DR6 M;  1IY0 A;  4LF7 M;  2UXB M;  2CE7 A;  5FLX S;  1K3X A;  2XZU A;  3HJS A;  1E32 A;  1GL7 A;  3FUW A;  1SXJ A;  4D80 A;  3R8F A;  2JA2 A;  2Z3X A;  2CEA A;  3KDS E;  4FWD A;  4IBF A;  4IBB A;  4DR2 M;  2AHM A;  3KS4 A;  1G4A E;  4HL4 A;  1NNJ A;  3GLG A;  4I4L A;  1G8P A;  2X4A A;  3VKG A;  5FTJ A;  2KEB A;  4B7F A;  3AKZ A;  3U6P A;  5EP1 A;  2VQF M;  3TPZ A;  4LCB A;  4MH0 E;  2DZO B;  2BJV A;  2R4J A;  1JR3 A;  3HJQ A;  5EQT A;  5EXX A;  5JI3 E;  3GPP A;  3JR4 A;  4TUW A;  3KVW A;  4G4O A;  2R46 A;  3U6E A;  1N34 M;  3CTW B;  1IXR C;  3SAW A;  3MK6 A;  2QBY B;  4L16 A;  3WHK A;  3KOZ E;  2HHH M;  1VDD A;  1KYI A;  1WXQ A;  1C1K A;  4PD2 A;  1HNX M;  4LF4 M;  4JYA M;  3QAU A;  4I81 A;  1Q3C A;  4LFA M;  2DWL A;  2D7H A;  3NWL A;  4BBA A;  1HT1 E;  1TH2 A;  4LJA A;  2YFQ A;  3LVV A;  1TH4 A;  4ZPX A;  3DA1 A;  4FVM A;  2RGH A;  1G41 A;  2HKJ A;  4IBD A;  3U6D A;  1Q39 A;  1H6U A;  3HU2 A;  4DUZ M;  3SAT A;  2XH9 A;  2RKO A;  4WUR A;  3THG A;  5EP4 A;  1IN7 A;  1XNR M;  1DO2 A;  3FTD A;  3KS8 A;  4LF9 M;  2XGN A;  4NXN M;  4YY3 M;  3RFW A;  3SAR A;  1NJF A;  3B9P A;  3GRY A;  4LF6 M;  4KOD A;  5IRE B;  5FTK A;  3VKH A;  3LVW A;  3GQ4 A;  4DR5 M;  1TDH A;  2XFT A;  3D8L A;  3DFZ A;  4IBI A;  4L15 A;  3RGP A;  3TQS A;  5ITQ A;  3GP1 A;  1LV7 A;  4FCT A;  4JI4 M;  2C99 A;  4LRT A;  4X65 M;  3D8B A;  3HU1 A;  3U6O A;  4L4U A;  1R6B X;  4LRS A;  5ITU A;  1GL6 A;  2L7I A;  2J7O A;  5ITY A;  3FYD A;  4X64 M;  1YE9 A;  4QNM A;  4RF0 A;  4B3R M;  1E9S A;  2UXD M;  4GMQ A;  1NJG A;  1HNZ M;  1FJG M;  4BLC A;  4KO8 A;  2C5R A;  3GQ5 A;  1HT2 E;  2CV0 A;  3T15 A;  4JI8 M;  2XFS A;  3ZC7 B;  3W0L B;  1N33 M;  4AZF A;  3GRV A;  3GLI B;  1T3T A;  4RF1 A;  4CIS A;  2VII A;  3GRR A;  2V1C A;  2F5P A;  1NHG C;  2HL7 A;  4S12 A;  4QHT A;  5C18 A;  2A5Y B;  4G4N A;  3IG8 A;  1Z59 A;  4FCW A;  3CF0 A;  5EP2 A;  4GHL A;  1QQW A;  5FTM A;  4OU7 A;  2FNA A;  2CFO A;  2EA0 A;  3HKP A;  4AG6 A;  4KLN A;  3KP0 E;  2M60 A;  3GQ3 A;  3SMP A;  5E26 A;  4M9X A;  3UMM A;  4AKH A;  3SFZ A;  1L2D A;  3UZU A;  3HHY A;  3T1Y M;  4REZ A;  2R65 A;  3M7G A;  3FTE A;  1IN8 A;  4DV1 M;  3SHF A;  3PNV A;  4NRW A;  1R7R A;  5LMU M;  4LG2 A;  3U6L A;  4D81 A;  2C96 A;  2F5O A;  4K0K M;  5IT9 S;  1DGH A;  2DVW B;  2EUC A;  3FUX A;  4GC5 A;  1N75 A;  4LGY A;  4LFB M;  3AOE C;  3AJI B;  4LY6 A;  2ZM6 M;  4GKJ M;  4DV4 M;  3FKE A;  3L28 A;  1GVN A;  5E6J A;  2KW0 A;  3E4R A;  4GKK M;  5FTL A;  4AKG A;  3GPU A;  3GRU A;  4GHA A;  2Y20 A;  3U61 A;  1IBM M;  2CUZ A;  3JAM S;  8CAT A;  1Z5C A;  1IN6 A;  2QCU A;  2CV1 A;  1IN5 A;  2G5G X;  3HWS A;  5EP3 A;  1OFI A;  1TGU A;  4JI7 M;  4QHS A;  3TWK A;  1N77 A;  3JR5 A;  5KPT A;  5DNY A;  2R45 A;  4WW0 A;  4IBG A;  3J7B A;  2OQ4 A;  3A98 B;  2KZS A;  1XNQ M;  3T38 A;  1XXH A;  3MJ5 A;  2FE8 A;  4JI2 M;  3SAV A;  2Z4S A;  5EJC A;  1N36 M;  1N32 M;  4QOS A;  4G6Z A;  3DZD A;  5KPR A;  4LF8 M;  5A2Q S;  3EIE A;  2QEN A;  5IZ7 D;  3L25 A;  4JN6 A;  3I51 A;  1DGH B;  2KA6 B;  1HNW M;  2F5Q A;  5ITX E;  2QZ4 A;  3SYK A;  2FFJ A;  3AOE A;  4AW4 A;  1DO0 A;  2I7P A;  3CF2 A;  2KXE A;  4JI5 M;  4GIT A;  4NRV A;  4MM3 B;  1NNU C;  2DWN A;  3SC3 A;  1NSF A;  3NBI A;  2LWX A;  2CHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...