3AJIB

Structure of gankyrin-s6atpase photo-cross-linked site-specifically, and incoporated by genetic code expansion
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 26S proteasome non-ATPase regulatory subunit 10
publication title Crystallographic study of a site-specifically cross-linked protein complex with a genetically incorporated photoreactive amino acid
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone/protein binding
total genus 25
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ajiB00
3GLHA 3HU1A 3PVSA 4LRSA 1D2NA 1DO2A 2DZOB 5FTJA 1OFIA 4L16A 4QHSA 3VFDA 3PFIA 1IN6A 2XSZD 3PXGA 2CHQA 2ZAMA 4LJ5A 4LRTA 1IN4A 1IY2A 1SXJB 3U5ZB 1E32A 1J7KA 3MHVC 2FNAA 1OJLA 5EP2A 4KODA 5EXPA 1DO0A 1QVRA 4QNRA 5JI3E 2Z4SA 3GLIB 2DHRA 5EP1A 3SC3A 3EIEA 5EXXA 5FTKA 1G41A 3ZH9B 5FTNA 2CHGA 1NY6A 1IQPA 3SYLA 2KRKA 3GLHB 2BJVA 4GITA 2V6ZM 3HU2A 5FTMA 3U61B 1IN5A 1SXJD 1KYIA 1W5TA 1G3IA 1R6BX 1E94E 1KSFX 3WHLA 2CE7A 4ZPXA 2R62A 5DYGA 4FWGA 4LJAA 1G4AE 4QOSA 1NJFA 4FCTA 4LJ7A 4LZZA 5EP4A 4L4UA 4LGMA 4LJ9A 3KDSE 1W5SA 1R7RA 4L15A 1IM2A 3K1JA 4D81A 1C1KA 1NJGA 3VLFB 5EXTA 1XWIA 4FCWA 3R8FA 4LJ6A 3M0EA 3GLFA 5JI2E 2QBYA 1SXJE 3BOSA 4D80A 1L8QA 2R65A 4LJ4A 3UK6A 1JR3A 3GLGB 3CF0A 1HT2E 4KO8A 3EIHA 5EQTA 4QHTA 1JQJC 1QZMA 3U60B 1HQCA 2VIIA 4LCBA 4Z8XA 2HCBA 2XSZA 5C1BA 2ZANA 3KW6A 4I4LA 2CEAA 2V1UA 3B9PA 4D82A 2C9OA 3SYKA 1IXSB 1FNNA 1IN8A 2QZ4A 2X8AA 4JN6A 2Z4RA 4FWDA 2QPAA 1LV7A 1S3SA 4A3VB 5FTLA 2C96A 1XXHA 5EP3A 1X37A 3GLFB 1NSFA 1UM8A 2DVWB 5EXSA 1NY5A 4FW9A 2QBYB 2ZAOA 3M6AA 3H4MA 2BJWA 2C98A 4QNMA 5C18A 3D8BA 1SXJA 2CHVA 4LJ8A 4WW0A 4KLNA 4FD2A 1IXZA 3HU3A 1IY1A 1NVMA 1IXRC 2DWZB 3DZDA 1SXJC 3CF2A 2C9CA 3HWSA 1HT1E 5DYIA 2QP9X 3WHKA 3GLIA 1OFHA 2DZNB 4FCVA 3AJIB 4LY6A 1HQYE 2RKOA 2QENA 4FWHA 4EIWA 1JR3D 3GLGA 1XXHB 4I81A 1IN7A 2C99A 1IY0A
chains in the Genus database with same CATH superfamily
5ITUA 3GLHA 1R2ZA 3GRYA 2MR9A 2M60A 1OFIA 4QHSA 3SHFA 3PXGA 1IN6A 2XSZD 4Q7JA 1N75A 1IN4A 1SXJB 5IZ7D 3VDPA 3GQ5A 1A5TA 3FTDA 3MHVC 1XHBA 1YSYA 3SASA 3TE6A 1PRBA 2UUBM 4QNRA 2Z4SA 3HHXA 1N77A 3FYDA 5EP1A 2Z8YM 3CGWA 3SC3A 4IBKA 3KS8A 3A98B 3IG5A 5FTKA 2CP8A 4R7GA 2KHHA 3AL0C 2QHOB 3CF6E 3J2PB 1NY6A 5E6JA 1IQPA 4GH9A 3UZUA 3SYLA 2KDLA 4GITA 2BWEA 2V6ZM 2L2DA 2R46A 3K92A 4JI3M 1VDLA 4BB9A 1DV0A 1FJGM 3NBXX 3KFUG 1E94E 1Z5BA 3WHLA 3AOEC 2CE7A 5DFLA 4Z6YA 5ITXE 1ZAEA 2DNAA 2FOIC 3FE3A 2DWLA 2CUZA 4FWGA 4GC5A 1JB0F 4QOSA 2F5PA 4OVZB 5EP4A 4LF5M 4BBAA 4XBOA 3JAMS 1DGGA 2XH9A 3E4RA 3K1JA 4D81A 1C1KA 4GIPA 5F3WA 1QANA 4L6V6 3R8FA 5KQDA 1GABA 3RFWA 4WP2A 4D80A 2LVNC 3VDUA 3SHGB 5EJCA 4X65M 2QBYA 1L8QA 2V1CA 1I4WA 1L1ZA 2EA0A 3FUXA 1NO1A 1C7YA 2F5QA 3CF0A 3LQRA 4B3RM 2JXNA 1G8PA 4LF7M 4QHTA 4W5WA 5BPVA 3Q8XA 3GLIE 1QZMA 2VIIA 1ZMVA 5C1BA 2J7NA 2ZANA 4I4LA 4PDIA 2JZ0A 2CEAA 3B9PA 5IWAM 3SYKA 3W0FA 1IBKM 1IXSB 2FFJA 3W68A 2EO2A 1OAOC 2QZ4A 5ITXA 3U6OA 4HEOA 3FTFA 1QYRA 1YUBA 3E46A 2BWBA 1X37A 2R0IA 1E9SA 4F1IA 1GJTA 4IBJA 1NSFA 2FH0A 1J09A 3W67A 2QSFX 1QUTA 2RGOA 2HAKA 2Y0TA 3J7BA 3LQQA 3MMPA 4II7A 2JWSA 3DA1A 4PD2A 5L8RF 1Z5AA 2XZUA 2C98A 4DV3M 2O25A 2EUCA 2RRUA 3D8BA 3GO8A 4K0KM 1V92A 1WXQA 4HL4A 4JV5M 3U5ZA 2KEBA 4FD2A 2CFOA 1NV8A 3AV0A 3J7AS 3KXEC 3SAUA 2D7HA 1EE8A 2KRUA 3PNVA 4JI8M 2CV1A 3WHKA 3ZCBB 3GLIA 2DZNB 4G3OA 1Y8GA 3K2LA 2DZLA 1TDHA 4LY6A 1GKIA 3KS4A 1CUKA 1XNQM 1YE9A 2K0BX 2RKOA 4P17A 1XMQM 2UXCM 2QENA 2Y20A 1HNZM 1HJPA 1IN7A 3NWLA 2C99A 3KP0E 3IECA 2LNHC 3HJ8A 3U61A 1DO2A 4LF6M 5FTJA 1GL7A 1L2CA 1I94M 4JI7M 2R18A 2CRUA 3E21A 3PFIA 4LFAM 4G4OA 4RNAA 4DV7M 2ZAMA 4LJ5A 1T43A 4LRTA 3HHYA 3GPUA 1IY2A 1Z6TA 4AQYM 4JI4M 3J81S 3LCVB 1QAQA 2N35A 2UUCM 2FNAA 2OQ4A 1OJLA 3GQ3A 4KODA 5EXPA 4B7GA 1DO0A 4DR5M 4NRVA 2LTUA 1WGNA 2DHRA 2Z3XA 2XZFA 4HLQA 2MH8A 3E9SA 3UJNA 3PNYA 3KSXA 3OTOM 2P5TA 1GO5A 1QDRA 2JNHA 4X66M 2CHGA 1DGBA 2KZSA 3SMPA 1QZEA 3FRIA 2KRKA 1PJSA 3GLHB 4Y28F 3AOEA 2DI0A 3TWKA 5FTMA 1NHWC 3U6LA 1KYIA 4LG2A 1GVNA 3BBZA 4DV1M 3SAVA 5H37D 2ZM6M 2LH0A 3KVWA 1OIPA 3FUVA 4IBBA 1XXHE 4GMQA 4LJAA 4LGYA 1VG5A 4WURA 5ITRA 4LGMA 4LJ9A 1W5SA 1XNRM 2VF7A 3J80S 1Q3CA 1R2YA 1NJGA 3HHWA 3VLFB 4FCWA 2RGHA 3KSJA 1TF0B 2KNAA 2X49A 3M0EA 4PDGA 2WSEF 3IHPA 1AUAA 3ZC7B 7CATA 3U6EA 3VKHA 4DR7M 3GLGB 2KZUA 3L27A 1NV9A 5EQTA 4B08A 1UFZA 4MB7A 3T15A 1LTMA 4G6ZA 1IFYA 1R4GA 1JQJC 4CIZA 4DV2M 1HQCA 4ITQA 2HCBA 3KOXE 1NNJA 1MU5A 4UN2B 4LF9M 3W0LB 3KW6A 2JY5A 1PGYA 2FS1A 1N36M 2JY8A 4D82A 3RGSA 1PM5A 1K3WA 4DV4M 2C9OA 1FNNA 3T6PA 1L2BA 3SMSA 3JR5A 4IJEA 4DV0M 4R3DA 2Z4RA 3B7QA 8CATA 1LV7A 1S3SA 3T38A 3GPPA 2LVPC 1BVSA 5EP3A 1XXHA 5GKNA 4AG5A 1XB2B 4M0WA 2F4VM 4LZJA 1ZMUA 5EXSA 3U6CA 1PJJA 2GNOA 2QBYB 3FD9A 3M6AA 4YHHM 1QAMA 2BJWA 4DUZM 2JP7A 5C18A 2CV2A 1G71A 1WIVA 2MGWA 2F5SA 4LF8M 4GHAA 1PJQA 1N78A 4WW0A 4LJ8A 4NOOB 4NSRA 1T6OA 2VQFM 4KLNA 4OVZA 2G8LA 3CTWB 1OTRA 3HWSA 1IXRC 3DZDA 4IBIA 1SXJC 3QYEA 2C9CA 1DGHB 5ITQA 1Z59A 3SAWA 1HT1E 4FCVA 2OPFA 1EFUB 2XGNA 3LVWA 3AJIB 4S12A 4JI2M 3FUTA 4DUYM 1K82A 1HQYE 2K9DA 3H4JA 4B3SM 4BLCA 3ILKA 1N32M 2LVOC 3RE8A 4EIWA 3TWLA 3QWLA 3VK8A 3HU1A 4LRSA 1D2NA 1V33A 2DZOB 4RKUF 2HWJA 4L16A 4IBEA 3TPZA 2CHQA 4IBDA 2R44A 3FTCA 5E26A 2M5ZA 4TUWA 5IT9S 2L4EA 3U5ZB 1J7KA 2JA2A 2DAIA 3I01M 3KOWE 3GLFE 1TGUA 2H1RA 5KPRA 2KW0A 4GC9A 2F5NA 3J27B 4MGYE 1QVRA 1JR3E 2R4EA 3IG8A 1T3TA 5JI3E 3HHZA 3GLIB 4L8RC 4DR2M 3KOZE 1MJGM 1GL6A 3HGIA 3AFHA 3C58A 2L7IA 3U6DA 4M0DA 3EIEA 5EXXA 4DV5M 1G41A 2LHCA 3L25A 1ZMWA 4IIWA 2OO9A 3A46A 1N33M 3SFZA 2Y0QA 3U6SA 2G5GX 1V34A 4I5SA 2LVQD 3HU2A 5ITTA 3U61B 2ERCA 3U60A 2F5OA 1W5TA 3HJSA 1D0MA 1G3IA 1R6BX 2QQ8A 3LMMA 2A5YB 2XEPA 3TWMA 1QQWA 3LCUA 4GKJM 4FCTA 1D0KA 3LVVA 4LZZA 2B3TA 2WSCF 3SATA 3KDSE 2KNVA 5DNYA 1R7RA 1WGLA 4XK8F 3FTEA 2O5RA 3K8ZA 2J7OA 2YR0A 1XWIA 2JUJA 1PJTA 2Z7JA 3D8LA 1VDDA 3GPYA 3GLFA 5JI2E 1D0LA 2CWBA 3HX3A 1SXJE 4LJ4A 2XF3A 1JR3A 2GQFA 4NL4H 4CJ6A 3GPXA 2CV0A 2R45A 1GLNA 3C9PA 4OW0A 2YFQA 2I7NA 3F92A 3QAUA 1ZQ9A 1E9RA 1AIPC 2OOBA 3HJQA 2ZBKB 4LCBA 4L78A 4Z8XA 1TTEA 4I8OA 3GRUA 4OX9M 3I4YA 2O01F 3QYBA 1QAOA 2V1UA 1SG9A 2D7GA 2JY6B 4GRIA 1L1TA 4AKGA 3A42A 1R5LA 3DOAA 1KFVA 2WSFF 3KP1E 3AKZA 1IN8A 3BXWA 3VK7A 1N34M 4FWDA 3JR4A 3FKEA 2QPAA 3B89A 3FRHA 3FUWA 4JI0M 4A3VB 2XFSA 5FTLA 1Q3BA 2LVAA 2VF8A 2C96A 4IBCA 4REZA 3GQ4A 1NNUC 5LMUM 1TDZA 1UM8A 2DHYA 1OKSA 1NY5A 2FE8A 1IBLM 4FVMA 1XMOM 2LWXA 2UUAM 3T1YM 2ZAOA 1Z5CA 3H4MA 3C3DA 2ZTCA 3B74A 1HR0M 4G4NA 2UU9M 3C3EA 4QNMA 2L09A 2DAGA 5FSWA 3SARA 2QNJA 3HY5A 1SXJA 2CHVA 2I7PA 4AZFA 3B7ZA 4IBGA 3UGJA 1XC8A 2Q2EB 3M7GA 4X62M 4JYAM 1NVMA 3CF2A 4GEWA 3KOYE 4LF4M 4R71A 4DV6M 1OQYA 3LW5F 3K9OA 3I04M 2EJSA 4KHPM 4M9SA 1K3XA 2H5XA 4MGKE 3L28A 3RGPA 1QUSA 3R9XB 5KO3A 1DGFA 3MJ5A 1JR3D 3GLGA 1XXHB 4I81A 2OOAA 3L26A 4X64M 4M9ZA 3VKGA 3PVSA 4NXMM 2D7EA 2HKJA 1HNXM 2HL7A 2KA6B 3VFDA 4G4RA 1TH4A 5KQ8A 2DAKA 2DWNA 2NQ8C 2YQZA 1J5EM 1E32A 4B7FA 2LHGA 3U6PA 2LBCA 2X4AA 4AKIA 4DR6M 3TQSA 4QOZC 4CGYB 1NHGC 4CISA 2R4JA 5EP2A 3T1HM 1VEJA 3TL4X 1IBMM 2DAMA 2VDBB 3GRVA 3L2AA 4M9XA 4DBGB 2XLJA 3L29A 1VEKA 3ZH9B 4DR1M 5FTNA 5A2QS 4YY3M 2BJVA 2JZ1A 1IN5A 1SXJD 3I51A 3V76A 2L6OA 2EKKA 3Q8GA 2WZJA 4NC6A 1HNWM 2R6FA 1KSFX 5KPZA 2DWMA 2YNMD 1DGHA 4ZPXA 4CHTB 2R62A 5DYGA 2UXDM 1WR1B 3B7NA 1G4AE 1NJFA 1IXSA 4LJ7A 4PCZA 4L4UA 2L4FA 4NSOB 5ITYA 2K47A 4L15A 4MH0E 1IM2A 1OIZA 1EIJA 2JY7A 5EXTA 2KNZA 4JXJA 4G4QA 4LJ6A 1H6UA 4AKHA 4MM3B 3GRRA 4RF0A 2E5LM 4JI1M 3BOSA 5BR8M 2J5YA 2R65A 4RF1A 1Q39A 2KXEA 3UK6A 1F4IA 1MN3A 1ZV1A 4KO8A 1HT2E 3EIHA 2MROB 5FLXS 4NRWA 2XFTA 3U60B 1L2DA 1P3QQ 3K9PA 4JI5M 2XSZA 4MGIE 1OAIA 2L7HA 3SBJA 4MGHA 2DXIA 2BNKA 1TH3A 2LXEA 1TH2A 1GJSA 3FUUA 1QDTA 3U6MA 2ZTDA 4OU7A 2G3QA 4B3TM 4AI6A 2X8AA 4P16A 3GLHE 4JN6A 3U6QA 1YLAA 4F2LA 2C5RA 2DKLA 2VQEM 4LFBM 1Q02A 3ZQJA 3AOGA 3UMMA 3GLFB 2DVWB 1VEGA 2DENA 3A45A 1VQ1A 3NBIA 4FW9A 1G59A 4ANRA 5LMNM 4IBFA 1MX0A 1WHCA 2AHMA 1ORYB 4MGZE 3HZJA 3MK6A 4PT5A 4GKKM 1RU3A 2Y21A 2EKFA 4JI6M 5IREB 2UXBM 2MJ5B 1WJ7A 1IXZA 3HU3A 4XGIA 3I4VA 1IY1A 2DWZB 4B3MM 3HKPA 2QCUA 5DYIA 2QP9X 1TR8A 2DAEA 1OFHA 2K6BA 4LFCM 3GLGE 4IJFA 4AG6A 5KPTA 4DR4M 3DFZA 2HHHM 3GP1A 4DR3M 2W82A 1PJIA 4FWHA 4NXNM 3FYCA 4B7HA 2APLA 4GHLA 3THGA 4KT0F 4AW4A 1IY0A
chains in the Genus database with same CATH topology
5ITUA 3GLHA 1R2ZA 3GRYA 2M60A 1OFIA 4QHSA 3SHFA 3PXGA 1IN6A 2XSZD 1N75A 1IN4A 1SXJB 5IZ7D 3VDPA 3GQ5A 3FTDA 3MHVC 1XHBA 1YSYA 3SASA 3TE6A 2UUBM 4QNRA 2Z4SA 3HHXA 1N77A 3FYDA 5EP1A 3SC3A 3KS8A 4IBKA 3A98B 3IG5A 5FTKA 4R7GA 3AL0C 3CF6E 3J2PB 1NY6A 5E6JA 1IQPA 4GH9A 3UZUA 3SYLA 4GITA 2V6ZM 4JI3M 2R46A 3K92A 4BB9A 1FJGM 3KFUG 1E94E 1Z5BA 3WHLA 3AOEC 2CE7A 4Z6YA 5ITXE 1ZAEA 2FOIC 2DWLA 2CUZA 4FWGA 4GC5A 2F5PA 4QOSA 4OVZB 5EP4A 4LF5M 4BBAA 4XBOA 3JAMS 1DGGA 2XH9A 3E4RA 3K1JA 4D81A 1C1KA 4GIPA 5F3WA 1QANA 3R8FA 5KQDA 3RFWA 2QBYA 4D80A 3VDUA 3SHGB 5EJCA 4X65M 1L8QA 2V1CA 1I4WA 1L1ZA 2EA0A 3FUXA 2F5QA 3CF0A 3LQRA 4B3RM 1G8PA 4LF7M 4QHTA 4W5WA 5BPVA 3Q8XA 1QZMA 2VIIA 5C1BA 2J7NA 2ZANA 4I4LA 4PDIA 2CEAA 3B9PA 5IWAM 3SYKA 3W0FA 1IBKM 1IXSB 2FFJA 2EO2A 2QZ4A 5ITXA 3U6OA 3FTFA 1QYRA 1YUBA 1X37A 1E9SA 4IBJA 1NSFA 1J09A 2RGOA 3J7BA 2Y0TA 3LQQA 4II7A 5IT9S 4PD2A 3DA1A 2XZUA 1Z5AA 2C98A 4DV3M 2EUCA 3D8BA 3GO8A 4K0KM 1WXQA 4HL4A 4JV5M 3U5ZA 2KEBA 4FD2A 2CFOA 3AV0A 3J7AS 3KXEC 3SAUA 2D7HA 1EE8A 2KRUA 3PNVA 4JI8M 2CV1A 3WHKA 3ZCBB 3GLIA 2DZNB 3K2LA 4LY6A 1TDHA 1GKIA 3KS4A 1XNQM 1YE9A 2RKOA 1XMQM 2UXCM 2QENA 2Y20A 1HNZM 1IN7A 3NWLA 2C99A 3KP0E 2LNHC 3HJ8A 3U61A 1DO2A 4LF6M 5FTJA 1GL7A 1L2CA 1I94M 4JI7M 2R18A 3PFIA 4LFAM 4G4OA 4RNAA 4DV7M 2ZAMA 4LJ5A 4LRTA 3HHYA 3GPUA 1IY2A 1Z6TA 4AQYM 4JI4M 3J81S 1QAQA 2UUCM 2FNAA 2OQ4A 1OJLA 3GQ3A 4KODA 5EXPA 4B7GA 1DO0A 4DR5M 4NRVA 2DHRA 2Z3XA 2XZFA 4HLQA 3E9SA 3UJNA 3PNYA 3KSXA 3OTOM 2P5TA 4X66M 2CHGA 1DGBA 2KZSA 3SMPA 2KRKA 3GLHB 3AOEA 3TWKA 5FTMA 1NHWC 3U6LA 1KYIA 4LG2A 1GVNA 4DV1M 3SAVA 5H37D 2ZM6M 2LH0A 3KVWA 4IBBA 3FUVA 4LJAA 4LGYA 4GMQA 5ITRA 5A2QS 4WURA 4LGMA 4LJ9A 1W5SA 1XNRM 3J80S 1Q3CA 1R2YA 1NJGA 3HHWA 3VLFB 4FCWA 2RGHA 3KSJA 2X49A 3M0EA 4PDGA 3ZC7B 7CATA 3U6EA 3VKHA 4DR7M 3GLGB 2KZUA 3L27A 5EQTA 4B08A 4MB7A 3T15A 4G6ZA 1JQJC 4DV2M 1HQCA 4ITQA 2HCBA 3KOXE 1NNJA 1MU5A 4LF9M 3W0LB 3KW6A 1N36M 4D82A 3RGSA 1PM5A 1K3WA 4DV4M 2C9OA 1FNNA 1L2BA 3SMSA 3JR5A 4IJEA 4DV0M 4R3DA 2Z4RA 8CATA 1LV7A 1S3SA 3T38A 3GPPA 5EP3A 1XXHA 5GKNA 4AG5A 4M0WA 2F4VM 4LZJA 3U6CA 5EXSA 1PJJA 2QBYB 3FD9A 3M6AA 4YHHM 1QAMA 2BJWA 4DUZM 5C18A 2CV2A 4GHAA 2F5SA 4LF8M 1N78A 4WW0A 4LJ8A 4NOOB 4NSRA 2VQFM 4KLNA 4OVZA 2G8LA 3CTWB 3HWSA 4IBIA 1IXRC 3DZDA 4LFCM 1SXJC 2C9CA 1DGHB 5ITQA 1Z59A 3SAWA 1HT1E 4FCVA 2OPFA 2XGNA 3LVWA 3AJIB 4S12A 4JI2M 3FUTA 4DUYM 1K82A 1HQYE 4B3SM 4BLCA 3ILKA 1N32M 3RE8A 4EIWA 3TWLA 3QWLA 3VK8A 3HU1A 4LRSA 1D2NA 2DZOB 4L16A 4IBEA 3TPZA 2CHQA 4IBDA 3FTCA 5E26A 2M5ZA 4TUWA 3U5ZB 1J7KA 2JA2A 3KOWE 1TGUA 2H1RA 5KPRA 2KW0A 4GC9A 2F5NA 3J27B 4MGYE 1QVRA 2R4EA 3IG8A 5JI3E 1T3TA 3GLIB 3HHZA 4L8RC 4DR2M 3KOZE 3U6DA 1GL6A 3HGIA 3AFHA 3C58A 2L7IA 4M0DA 3EIEA 5EXXA 4DV5M 1G41A 3L25A 4IIWA 3A46A 1N33M 3SFZA 2Y0QA 3U6SA 2G5GX 4I5SA 3HU2A 5ITTA 3U61B 2ERCA 3U60A 2F5OA 1W5TA 3HJSA 1G3IA 1R6BX 3LMMA 2A5YB 2XEPA 3TWMA 1QQWA 4GKJM 4FCTA 3LVVA 4LZZA 3SATA 3KDSE 5DNYA 1R7RA 3FTEA 2O5RA 3K8ZA 2J7OA 2YR0A 1XWIA 2Z7JA 3D8LA 1VDDA 3GPYA 3GLFA 5JI2E 1SXJE 4LJ4A 2XF3A 1JR3A 4NL4H 3GPXA 2CV0A 2R45A 1GLNA 4OW0A 2YFQA 2I7NA 3QAUA 1ZQ9A 1E9RA 4L78A 3HJQA 2ZBKB 4LCBA 4Z8XA 4I8OA 3GRUA 4OX9M 3I4YA 1QAOA 2V1UA 2D7GA 4GRIA 1L1TA 4AKGA 3A42A 3DOAA 1KFVA 3KP1E 3AKZA 1IN8A 3VK7A 1N34M 4FWDA 3JR4A 3FKEA 2QPAA 3FUWA 4JI0M 4A3VB 2XFSA 5FTLA 1Q3BA 2C96A 4IBCA 4REZA 3GQ4A 1NNUC 5LMUM 1TDZA 1UM8A 1NY5A 2FE8A 1IBLM 4FVMA 1XMOM 2LWXA 2UUAM 3T1YM 2ZAOA 1Z5CA 3H4MA 1HR0M 4G4NA 2UU9M 4QNMA 2L09A 5FSWA 3SARA 1SXJA 2CHVA 2I7PA 4AZFA 4IBGA 3UGJA 1XC8A 2Q2EB 3M7GA 4X62M 4JYAM 1NVMA 3CF2A 4LF4M 3KOYE 4DV6M 4KHPM 4M9SA 1K3XA 4MGKE 3L28A 3RGPA 3R9XB 5KO3A 1DGFA 3MJ5A 1JR3D 3GLGA 1XXHB 4I81A 3L26A 4X64M 4M9ZA 3VKGA 3PVSA 4NXMM 2D7EA 2HKJA 1HNXM 2HL7A 2KA6B 3VFDA 4G4RA 1TH4A 5KQ8A 2DWNA 2NQ8C 2YQZA 1J5EM 1E32A 4B7FA 3U6PA 2X4AA 4AKIA 4DR6M 3TQSA 4QOZC 4CGYB 1NHGC 4CISA 2R4JA 5EP2A 3T1HM 3TL4X 1IBMM 3GRVA 3L2AA 4M9XA 2XLJA 3L29A 3ZH9B 4DR1M 5FTNA 4YY3M 2BJVA 1IN5A 1SXJD 3I51A 2L6OA 1HNWM 5KPZA 1KSFX 2DWMA 2YNMD 1DGHA 4ZPXA 4CHTB 2R62A 5DYGA 2UXDM 1G4AE 1NJFA 4LJ7A 4PCZA 4L4UA 4NSOB 5ITYA 2K47A 4L15A 4MH0E 1IM2A 5EXTA 4JXJA 4G4QA 4LJ6A 1H6UA 4AKHA 4MM3B 3GRRA 4RF0A 2E5LM 4JI1M 3BOSA 5BR8M 2R65A 4RF1A 1Q39A 2KXEA 3UK6A 4KO8A 1HT2E 3EIHA 5FLXS 4NRWA 2XFTA 3U60B 1L2DA 4JI5M 2XSZA 4MGIE 2L7HA 3SBJA 4MGHA 2DXIA 2BNKA 1TH3A 2LXEA 1TH2A 3FUUA 3U6MA 4OU7A 4B3TM 4AI6A 2X8AA 4P16A 4JN6A 3U6QA 2C5RA 2VQEM 4LFBM 3AOGA 3UMMA 3GLFB 2DVWB 3A45A 4FW9A 3NBIA 1G59A 5LMNM 4IBFA 1MX0A 2AHMA 1ORYB 4MGZE 3MK6A 4PT5A 4GKKM 2Y21A 4JI6M 5IREB 2UXBM 1IXZA 3HU3A 4XGIA 3I4VA 1IY1A 2DWZB 4B3MM 3HKPA 2QCUA 5DYIA 2QP9X 1OFHA 4IJFA 4AG6A 5KPTA 4DR4M 3DFZA 2HHHM 3GP1A 4DR3M 2W82A 1PJIA 4FWHA 4NXNM 3FYCA 4B7HA 4GHLA 3THGA 4AW4A 1IY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLH A;  3HU1 A;  3PVS A;  4LRS A;  1D2N A;  1DO2 A;  2DZO B;  5FTJ A;  1OFI A;  4L16 A;  4QHS A;  3VFD A;  3PFI A;  1IN6 A;  2XSZ D;  3PXG A;  2CHQ A;  2ZAM A;  4LJ5 A;  4LRT A;  1IN4 A;  1IY2 A;  1SXJ B;  3U5Z B;  1E32 A;  1J7K A;  3MHV C;  2FNA A;  1OJL A;  5EP2 A;  4KOD A;  5EXP A;  1DO0 A;  1QVR A;  4QNR A;  5JI3 E;  2Z4S A;  3GLI B;  2DHR A;  5EP1 A;  3SC3 A;  3EIE A;  5EXX A;  5FTK A;  1G41 A;  3ZH9 B;  5FTN A;  2CHG A;  1NY6 A;  1IQP A;  3SYL A;  2KRK A;  3GLH B;  2BJV A;  4GIT A;  2V6Z M;  3HU2 A;  5FTM A;  3U61 B;  1IN5 A;  1SXJ D;  1KYI A;  1W5T A;  1G3I A;  1R6B X;  1E94 E;  1KSF X;  3WHL A;  2CE7 A;  4ZPX A;  2R62 A;  5DYG A;  4FWG A;  4LJA A;  1G4A E;  4QOS A;  1NJF A;  4FCT A;  4LJ7 A;  4LZZ A;  5EP4 A;  4L4U A;  4LGM A;  4LJ9 A;  3KDS E;  1W5S A;  1R7R A;  4L15 A;  1IM2 A;  3K1J A;  4D81 A;  1C1K A;  1NJG A;  3VLF B;  5EXT A;  1XWI A;  4FCW A;  3R8F A;  4LJ6 A;  3M0E A;  3GLF A;  5JI2 E;  2QBY A;  1SXJ E;  3BOS A;  4D80 A;  1L8Q A;  2R65 A;  4LJ4 A;  3UK6 A;  1JR3 A;  3GLG B;  3CF0 A;  1HT2 E;  4KO8 A;  3EIH A;  5EQT A;  4QHT A;  1JQJ C;  1QZM A;  3U60 B;  1HQC A;  2VII A;  4LCB A;  4Z8X A;  2HCB A;  2XSZ A;  5C1B A;  2ZAN A;  3KW6 A;  4I4L A;  2CEA A;  2V1U A;  3B9P A;  4D82 A;  2C9O A;  3SYK A;  1IXS B;  1FNN A;  1IN8 A;  2QZ4 A;  2X8A A;  4JN6 A;  2Z4R A;  4FWD A;  2QPA A;  1LV7 A;  1S3S A;  4A3V B;  5FTL A;  2C96 A;  1XXH A;  5EP3 A;  1X37 A;  3GLF B;  1NSF A;  1UM8 A;  2DVW B;  5EXS A;  1NY5 A;  4FW9 A;  2QBY B;  2ZAO A;  3M6A A;  3H4M A;  2BJW A;  2C98 A;  4QNM A;  5C18 A;  3D8B A;  1SXJ A;  2CHV A;  4LJ8 A;  4WW0 A;  4KLN A;  4FD2 A;  1IXZ A;  3HU3 A;  1IY1 A;  1NVM A;  1IXR C;  2DWZ B;  3DZD A;  1SXJ C;  3CF2 A;  2C9C A;  3HWS A;  1HT1 E;  5DYI A;  2QP9 X;  3WHK A;  3GLI A;  1OFH A;  2DZN B;  4FCV A;  3AJI B;  4LY6 A;  1HQY E;  2RKO A;  2QEN A;  4FWH A;  4EIW A;  1JR3 D;  3GLG A;  1XXH B;  4I81 A;  1IN7 A;  2C99 A;  1IY0 A; 
#chains in the Genus database with same CATH topology
 5ITU A;  3GLH A;  1R2Z A;  3GRY A;  2MR9 A;  2M60 A;  1OFI A;  4QHS A;  3SHF A;  3PXG A;  1IN6 A;  2XSZ D;  4Q7J A;  1N75 A;  1IN4 A;  1SXJ B;  5IZ7 D;  3VDP A;  3GQ5 A;  1A5T A;  3FTD A;  3MHV C;  1XHB A;  1YSY A;  3SAS A;  3TE6 A;  1PRB A;  2UUB M;  4QNR A;  2Z4S A;  3HHX A;  1N77 A;  3FYD A;  5EP1 A;  2Z8Y M;  3CGW A;  3SC3 A;  4IBK A;  3KS8 A;  3A98 B;  3IG5 A;  5FTK A;  2CP8 A;  4R7G A;  2KHH A;  3AL0 C;  2QHO B;  3CF6 E;  3J2P B;  1NY6 A;  5E6J A;  1IQP A;  4GH9 A;  3UZU A;  3SYL A;  2KDL A;  4GIT A;  2BWE A;  2V6Z M;  2L2D A;  2R46 A;  3K92 A;  4JI3 M;  1VDL A;  4BB9 A;  1DV0 A;  1FJG M;  3NBX X;  3KFU G;  1E94 E;  1Z5B A;  3WHL A;  3AOE C;  2CE7 A;  5DFL A;  4Z6Y A;  5ITX E;  1ZAE A;  2DNA A;  2FOI C;  3FE3 A;  2DWL A;  2CUZ A;  4FWG A;  4GC5 A;  1JB0 F;  4QOS A;  2F5P A;  4OVZ B;  5EP4 A;  4LF5 M;  4BBA A;  4XBO A;  3JAM S;  1DGG A;  2XH9 A;  3E4R A;  3K1J A;  4D81 A;  1C1K A;  4GIP A;  5F3W A;  1QAN A;  4L6V 6;  3R8F A;  5KQD A;  1GAB A;  3RFW A;  4WP2 A;  4D80 A;  2LVN C;  3VDU A;  3SHG B;  5EJC A;  4X65 M;  2QBY A;  1L8Q A;  2V1C A;  1I4W A;  1L1Z A;  2EA0 A;  3FUX A;  1NO1 A;  1C7Y A;  2F5Q A;  3CF0 A;  3LQR A;  4B3R M;  2JXN A;  1G8P A;  4LF7 M;  4QHT A;  4W5W A;  5BPV A;  3Q8X A;  3GLI E;  1QZM A;  2VII A;  1ZMV A;  5C1B A;  2J7N A;  2ZAN A;  4I4L A;  4PDI A;  2JZ0 A;  2CEA A;  3B9P A;  5IWA M;  3SYK A;  3W0F A;  1IBK M;  1IXS B;  2FFJ A;  3W68 A;  2EO2 A;  1OAO C;  2QZ4 A;  5ITX A;  3U6O A;  4HEO A;  3FTF A;  1QYR A;  1YUB A;  3E46 A;  2BWB A;  1X37 A;  2R0I A;  1E9S A;  4F1I A;  1GJT A;  4IBJ A;  1NSF A;  2FH0 A;  1J09 A;  3W67 A;  2QSF X;  1QUT A;  2RGO A;  2HAK A;  2Y0T A;  3J7B A;  3LQQ A;  3MMP A;  4II7 A;  2JWS A;  3DA1 A;  4PD2 A;  5L8R F;  1Z5A A;  2XZU A;  2C98 A;  4DV3 M;  2O25 A;  2EUC A;  2RRU A;  3D8B A;  3GO8 A;  4K0K M;  1V92 A;  1WXQ A;  4HL4 A;  4JV5 M;  3U5Z A;  2KEB A;  4FD2 A;  2CFO A;  1NV8 A;  3AV0 A;  3J7A S;  3KXE C;  3SAU A;  2D7H A;  1EE8 A;  2KRU A;  3PNV A;  4JI8 M;  2CV1 A;  3WHK A;  3ZCB B;  3GLI A;  2DZN B;  4G3O A;  1Y8G A;  3K2L A;  2DZL A;  1TDH A;  4LY6 A;  1GKI A;  3KS4 A;  1CUK A;  1XNQ M;  1YE9 A;  2K0B X;  2RKO A;  4P17 A;  1XMQ M;  2UXC M;  2QEN A;  2Y20 A;  1HNZ M;  1HJP A;  1IN7 A;  3NWL A;  2C99 A;  3KP0 E;  3IEC A;  2LNH C;  3HJ8 A;  3U61 A;  1DO2 A;  4LF6 M;  5FTJ A;  1GL7 A;  1L2C A;  1I94 M;  4JI7 M;  2R18 A;  2CRU A;  3E21 A;  3PFI A;  4LFA M;  4G4O A;  4RNA A;  4DV7 M;  2ZAM A;  4LJ5 A;  1T43 A;  4LRT A;  3HHY A;  3GPU A;  1IY2 A;  1Z6T A;  4AQY M;  4JI4 M;  3J81 S;  3LCV B;  1QAQ A;  2N35 A;  2UUC M;  2FNA A;  2OQ4 A;  1OJL A;  3GQ3 A;  4KOD A;  5EXP A;  4B7G A;  1DO0 A;  4DR5 M;  4NRV A;  2LTU A;  1WGN A;  2DHR A;  2Z3X A;  2XZF A;  4HLQ A;  2MH8 A;  3E9S A;  3UJN A;  3PNY A;  3KSX A;  3OTO M;  2P5T A;  1GO5 A;  1QDR A;  2JNH A;  4X66 M;  2CHG A;  1DGB A;  2KZS A;  3SMP A;  1QZE A;  3FRI A;  2KRK A;  1PJS A;  3GLH B;  4Y28 F;  3AOE A;  2DI0 A;  3TWK A;  5FTM A;  1NHW C;  3U6L A;  1KYI A;  4LG2 A;  1GVN A;  3BBZ A;  4DV1 M;  3SAV A;  5H37 D;  2ZM6 M;  2LH0 A;  3KVW A;  1OIP A;  3FUV A;  4IBB A;  1XXH E;  4GMQ A;  4LJA A;  4LGY A;  1VG5 A;  4WUR A;  5ITR A;  4LGM A;  4LJ9 A;  1W5S A;  1XNR M;  2VF7 A;  3J80 S;  1Q3C A;  1R2Y A;  1NJG A;  3HHW A;  3VLF B;  4FCW A;  2RGH A;  3KSJ A;  1TF0 B;  2KNA A;  2X49 A;  3M0E A;  4PDG A;  2WSE F;  3IHP A;  1AUA A;  3ZC7 B;  7CAT A;  3U6E A;  3VKH A;  4DR7 M;  3GLG B;  2KZU A;  3L27 A;  1NV9 A;  5EQT A;  4B08 A;  1UFZ A;  4MB7 A;  3T15 A;  1LTM A;  4G6Z A;  1IFY A;  1R4G A;  1JQJ C;  4CIZ A;  4DV2 M;  1HQC A;  4ITQ A;  2HCB A;  3KOX E;  1NNJ A;  1MU5 A;  4UN2 B;  4LF9 M;  3W0L B;  3KW6 A;  2JY5 A;  1PGY A;  2FS1 A;  1N36 M;  2JY8 A;  4D82 A;  3RGS A;  1PM5 A;  1K3W A;  4DV4 M;  2C9O A;  1FNN A;  3T6P A;  1L2B A;  3SMS A;  3JR5 A;  4IJE A;  4DV0 M;  4R3D A;  2Z4R A;  3B7Q A;  8CAT A;  1LV7 A;  1S3S A;  3T38 A;  3GPP A;  2LVP C;  1BVS A;  5EP3 A;  1XXH A;  5GKN A;  4AG5 A;  1XB2 B;  4M0W A;  2F4V M;  4LZJ A;  1ZMU A;  5EXS A;  3U6C A;  1PJJ A;  2GNO A;  2QBY B;  3FD9 A;  3M6A A;  4YHH M;  1QAM A;  2BJW A;  4DUZ M;  2JP7 A;  5C18 A;  2CV2 A;  1G71 A;  1WIV A;  2MGW A;  2F5S A;  4LF8 M;  4GHA A;  1PJQ A;  1N78 A;  4WW0 A;  4LJ8 A;  4NOO B;  4NSR A;  1T6O A;  2VQF M;  4KLN A;  4OVZ A;  2G8L A;  3CTW B;  1OTR A;  3HWS A;  1IXR C;  3DZD A;  4IBI A;  1SXJ C;  3QYE A;  2C9C A;  1DGH B;  5ITQ A;  1Z59 A;  3SAW A;  1HT1 E;  4FCV A;  2OPF A;  1EFU B;  2XGN A;  3LVW A;  3AJI B;  4S12 A;  4JI2 M;  3FUT A;  4DUY M;  1K82 A;  1HQY E;  2K9D A;  3H4J A;  4B3S M;  4BLC A;  3ILK A;  1N32 M;  2LVO C;  3RE8 A;  4EIW A;  3TWL A;  3QWL A;  3VK8 A;  3HU1 A;  4LRS A;  1D2N A;  1V33 A;  2DZO B;  4RKU F;  2HWJ A;  4L16 A;  4IBE A;  3TPZ A;  2CHQ A;  4IBD A;  2R44 A;  3FTC A;  5E26 A;  2M5Z A;  4TUW A;  5IT9 S;  2L4E A;  3U5Z B;  1J7K A;  2JA2 A;  2DAI A;  3I01 M;  3KOW E;  3GLF E;  1TGU A;  2H1R A;  5KPR A;  2KW0 A;  4GC9 A;  2F5N A;  3J27 B;  4MGY E;  1QVR A;  1JR3 E;  2R4E A;  3IG8 A;  1T3T A;  5JI3 E;  3HHZ A;  3GLI B;  4L8R C;  4DR2 M;  3KOZ E;  1MJG M;  1GL6 A;  3HGI A;  3AFH A;  3C58 A;  2L7I A;  3U6D A;  4M0D A;  3EIE A;  5EXX A;  4DV5 M;  1G41 A;  2LHC A;  3L25 A;  1ZMW A;  4IIW A;  2OO9 A;  3A46 A;  1N33 M;  3SFZ A;  2Y0Q A;  3U6S A;  2G5G X;  1V34 A;  4I5S A;  2LVQ D;  3HU2 A;  5ITT A;  3U61 B;  2ERC A;  3U60 A;  2F5O A;  1W5T A;  3HJS A;  1D0M A;  1G3I A;  1R6B X;  2QQ8 A;  3LMM A;  2A5Y B;  2XEP A;  3TWM A;  1QQW A;  3LCU A;  4GKJ M;  4FCT A;  1D0K A;  3LVV A;  4LZZ A;  2B3T A;  2WSC F;  3SAT A;  3KDS E;  2KNV A;  5DNY A;  1R7R A;  1WGL A;  4XK8 F;  3FTE A;  2O5R A;  3K8Z A;  2J7O A;  2YR0 A;  1XWI A;  2JUJ A;  1PJT A;  2Z7J A;  3D8L A;  1VDD A;  3GPY A;  3GLF A;  5JI2 E;  1D0L A;  2CWB A;  3HX3 A;  1SXJ E;  4LJ4 A;  2XF3 A;  1JR3 A;  2GQF A;  4NL4 H;  4CJ6 A;  3GPX A;  2CV0 A;  2R45 A;  1GLN A;  3C9P A;  4OW0 A;  2YFQ A;  2I7N A;  3F92 A;  3QAU A;  1ZQ9 A;  1E9R A;  1AIP C;  2OOB A;  3HJQ A;  2ZBK B;  4LCB A;  4L78 A;  4Z8X A;  1TTE A;  4I8O A;  3GRU A;  4OX9 M;  3I4Y A;  2O01 F;  3QYB A;  1QAO A;  2V1U A;  1SG9 A;  2D7G A;  2JY6 B;  4GRI A;  1L1T A;  4AKG A;  3A42 A;  1R5L A;  3DOA A;  1KFV A;  2WSF F;  3KP1 E;  3AKZ A;  1IN8 A;  3BXW A;  3VK7 A;  1N34 M;  4FWD A;  3JR4 A;  3FKE A;  2QPA A;  3B89 A;  3FRH A;  3FUW A;  4JI0 M;  4A3V B;  2XFS A;  5FTL A;  1Q3B A;  2LVA A;  2VF8 A;  2C96 A;  4IBC A;  4REZ A;  3GQ4 A;  1NNU C;  5LMU M;  1TDZ A;  1UM8 A;  2DHY A;  1OKS A;  1NY5 A;  2FE8 A;  1IBL M;  4FVM A;  1XMO M;  2LWX A;  2UUA M;  3T1Y M;  2ZAO A;  1Z5C A;  3H4M A;  3C3D A;  2ZTC A;  3B74 A;  1HR0 M;  4G4N A;  2UU9 M;  3C3E A;  4QNM A;  2L09 A;  2DAG A;  5FSW A;  3SAR A;  2QNJ A;  3HY5 A;  1SXJ A;  2CHV A;  2I7P A;  4AZF A;  3B7Z A;  4IBG A;  3UGJ A;  1XC8 A;  2Q2E B;  3M7G A;  4X62 M;  4JYA M;  1NVM A;  3CF2 A;  4GEW A;  3KOY E;  4LF4 M;  4R71 A;  4DV6 M;  1OQY A;  3LW5 F;  3K9O A;  3I04 M;  2EJS A;  4KHP M;  4M9S A;  1K3X A;  2H5X A;  4MGK E;  3L28 A;  3RGP A;  1QUS A;  3R9X B;  5KO3 A;  1DGF A;  3MJ5 A;  1JR3 D;  3GLG A;  1XXH B;  4I81 A;  2OOA A;  3L26 A;  4X64 M;  4M9Z A;  3VKG A;  3PVS A;  4NXM M;  2D7E A;  2HKJ A;  1HNX M;  2HL7 A;  2KA6 B;  3VFD A;  4G4R A;  1TH4 A;  5KQ8 A;  2DAK A;  2DWN A;  2NQ8 C;  2YQZ A;  1J5E M;  1E32 A;  4B7F A;  2LHG A;  3U6P A;  2LBC A;  2X4A A;  4AKI A;  4DR6 M;  3TQS A;  4QOZ C;  4CGY B;  1NHG C;  4CIS A;  2R4J A;  5EP2 A;  3T1H M;  1VEJ A;  3TL4 X;  1IBM M;  2DAM A;  2VDB B;  3GRV A;  3L2A A;  4M9X A;  4DBG B;  2XLJ A;  3L29 A;  1VEK A;  3ZH9 B;  4DR1 M;  5FTN A;  5A2Q S;  4YY3 M;  2BJV A;  2JZ1 A;  1IN5 A;  1SXJ D;  3I51 A;  3V76 A;  2L6O A;  2EKK A;  3Q8G A;  2WZJ A;  4NC6 A;  1HNW M;  2R6F A;  1KSF X;  5KPZ A;  2DWM A;  2YNM D;  1DGH A;  4ZPX A;  4CHT B;  2R62 A;  5DYG A;  2UXD M;  1WR1 B;  3B7N A;  1G4A E;  1NJF A;  1IXS A;  4LJ7 A;  4PCZ A;  4L4U A;  2L4F A;  4NSO B;  5ITY A;  2K47 A;  4L15 A;  4MH0 E;  1IM2 A;  1OIZ A;  1EIJ A;  2JY7 A;  5EXT A;  2KNZ A;  4JXJ A;  4G4Q A;  4LJ6 A;  1H6U A;  4AKH A;  4MM3 B;  3GRR A;  4RF0 A;  2E5L M;  4JI1 M;  3BOS A;  5BR8 M;  2J5Y A;  2R65 A;  4RF1 A;  1Q39 A;  2KXE A;  3UK6 A;  1F4I A;  1MN3 A;  1ZV1 A;  4KO8 A;  1HT2 E;  3EIH A;  2MRO B;  5FLX S;  4NRW A;  2XFT A;  3U60 B;  1L2D A;  1P3Q Q;  3K9P A;  4JI5 M;  2XSZ A;  4MGI E;  1OAI A;  2L7H A;  3SBJ A;  4MGH A;  2DXI A;  2BNK A;  1TH3 A;  2LXE A;  1TH2 A;  1GJS A;  3FUU A;  1QDT A;  3U6M A;  2ZTD A;  4OU7 A;  2G3Q A;  4B3T M;  4AI6 A;  2X8A A;  4P16 A;  3GLH E;  4JN6 A;  3U6Q A;  1YLA A;  4F2L A;  2C5R A;  2DKL A;  2VQE M;  4LFB M;  1Q02 A;  3ZQJ A;  3AOG A;  3UMM A;  3GLF B;  2DVW B;  1VEG A;  2DEN A;  3A45 A;  1VQ1 A;  3NBI A;  4FW9 A;  1G59 A;  4ANR A;  5LMN M;  4IBF A;  1MX0 A;  1WHC A;  2AHM A;  1ORY B;  4MGZ E;  3HZJ A;  3MK6 A;  4PT5 A;  4GKK M;  1RU3 A;  2Y21 A;  2EKF A;  4JI6 M;  5IRE B;  2UXB M;  2MJ5 B;  1WJ7 A;  1IXZ A;  3HU3 A;  4XGI A;  3I4V A;  1IY1 A;  2DWZ B;  4B3M M;  3HKP A;  2QCU A;  5DYI A;  2QP9 X;  1TR8 A;  2DAE A;  1OFH A;  2K6B A;  4LFC M;  3GLG E;  4IJF A;  4AG6 A;  5KPT A;  4DR4 M;  3DFZ A;  2HHH M;  3GP1 A;  4DR3 M;  2W82 A;  1PJI A;  4FWH A;  4NXN M;  3FYC A;  4B7H A;  2APL A;  4GHL A;  3THG A;  4KT0 F;  4AW4 A;  1IY0 A; 
#chains in the Genus database with same CATH homology
 5ITU A;  3GLH A;  1R2Z A;  3GRY A;  2M60 A;  1OFI A;  4QHS A;  3SHF A;  3PXG A;  1IN6 A;  2XSZ D;  1N75 A;  1IN4 A;  1SXJ B;  5IZ7 D;  3VDP A;  3GQ5 A;  3FTD A;  3MHV C;  1XHB A;  1YSY A;  3SAS A;  3TE6 A;  2UUB M;  4QNR A;  2Z4S A;  3HHX A;  1N77 A;  3FYD A;  5EP1 A;  3SC3 A;  3KS8 A;  4IBK A;  3A98 B;  3IG5 A;  5FTK A;  4R7G A;  3AL0 C;  3CF6 E;  3J2P B;  1NY6 A;  5E6J A;  1IQP A;  4GH9 A;  3UZU A;  3SYL A;  4GIT A;  2V6Z M;  4JI3 M;  2R46 A;  3K92 A;  4BB9 A;  1FJG M;  3KFU G;  1E94 E;  1Z5B A;  3WHL A;  3AOE C;  2CE7 A;  4Z6Y A;  5ITX E;  1ZAE A;  2FOI C;  2DWL A;  2CUZ A;  4FWG A;  4GC5 A;  2F5P A;  4QOS A;  4OVZ B;  5EP4 A;  4LF5 M;  4BBA A;  4XBO A;  3JAM S;  1DGG A;  2XH9 A;  3E4R A;  3K1J A;  4D81 A;  1C1K A;  4GIP A;  5F3W A;  1QAN A;  3R8F A;  5KQD A;  3RFW A;  2QBY A;  4D80 A;  3VDU A;  3SHG B;  5EJC A;  4X65 M;  1L8Q A;  2V1C A;  1I4W A;  1L1Z A;  2EA0 A;  3FUX A;  2F5Q A;  3CF0 A;  3LQR A;  4B3R M;  1G8P A;  4LF7 M;  4QHT A;  4W5W A;  5BPV A;  3Q8X A;  1QZM A;  2VII A;  5C1B A;  2J7N A;  2ZAN A;  4I4L A;  4PDI A;  2CEA A;  3B9P A;  5IWA M;  3SYK A;  3W0F A;  1IBK M;  1IXS B;  2FFJ A;  2EO2 A;  2QZ4 A;  5ITX A;  3U6O A;  3FTF A;  1QYR A;  1YUB A;  1X37 A;  1E9S A;  4IBJ A;  1NSF A;  1J09 A;  2RGO A;  3J7B A;  2Y0T A;  3LQQ A;  4II7 A;  5IT9 S;  4PD2 A;  3DA1 A;  2XZU A;  1Z5A A;  2C98 A;  4DV3 M;  2EUC A;  3D8B A;  3GO8 A;  4K0K M;  1WXQ A;  4HL4 A;  4JV5 M;  3U5Z A;  2KEB A;  4FD2 A;  2CFO A;  3AV0 A;  3J7A S;  3KXE C;  3SAU A;  2D7H A;  1EE8 A;  2KRU A;  3PNV A;  4JI8 M;  2CV1 A;  3WHK A;  3ZCB B;  3GLI A;  2DZN B;  3K2L A;  4LY6 A;  1TDH A;  1GKI A;  3KS4 A;  1XNQ M;  1YE9 A;  2RKO A;  1XMQ M;  2UXC M;  2QEN A;  2Y20 A;  1HNZ M;  1IN7 A;  3NWL A;  2C99 A;  3KP0 E;  2LNH C;  3HJ8 A;  3U61 A;  1DO2 A;  4LF6 M;  5FTJ A;  1GL7 A;  1L2C A;  1I94 M;  4JI7 M;  2R18 A;  3PFI A;  4LFA M;  4G4O A;  4RNA A;  4DV7 M;  2ZAM A;  4LJ5 A;  4LRT A;  3HHY A;  3GPU A;  1IY2 A;  1Z6T A;  4AQY M;  4JI4 M;  3J81 S;  1QAQ A;  2UUC M;  2FNA A;  2OQ4 A;  1OJL A;  3GQ3 A;  4KOD A;  5EXP A;  4B7G A;  1DO0 A;  4DR5 M;  4NRV A;  2DHR A;  2Z3X A;  2XZF A;  4HLQ A;  3E9S A;  3UJN A;  3PNY A;  3KSX A;  3OTO M;  2P5T A;  4X66 M;  2CHG A;  1DGB A;  2KZS A;  3SMP A;  2KRK A;  3GLH B;  3AOE A;  3TWK A;  5FTM A;  1NHW C;  3U6L A;  1KYI A;  4LG2 A;  1GVN A;  4DV1 M;  3SAV A;  5H37 D;  2ZM6 M;  2LH0 A;  3KVW A;  4IBB A;  3FUV A;  4LJA A;  4LGY A;  4GMQ A;  5ITR A;  5A2Q S;  4WUR A;  4LGM A;  4LJ9 A;  1W5S A;  1XNR M;  3J80 S;  1Q3C A;  1R2Y A;  1NJG A;  3HHW A;  3VLF B;  4FCW A;  2RGH A;  3KSJ A;  2X49 A;  3M0E A;  4PDG A;  3ZC7 B;  7CAT A;  3U6E A;  3VKH A;  4DR7 M;  3GLG B;  2KZU A;  3L27 A;  5EQT A;  4B08 A;  4MB7 A;  3T15 A;  4G6Z A;  1JQJ C;  4DV2 M;  1HQC A;  4ITQ A;  2HCB A;  3KOX E;  1NNJ A;  1MU5 A;  4LF9 M;  3W0L B;  3KW6 A;  1N36 M;  4D82 A;  3RGS A;  1PM5 A;  1K3W A;  4DV4 M;  2C9O A;  1FNN A;  1L2B A;  3SMS A;  3JR5 A;  4IJE A;  4DV0 M;  4R3D A;  2Z4R A;  8CAT A;  1LV7 A;  1S3S A;  3T38 A;  3GPP A;  5EP3 A;  1XXH A;  5GKN A;  4AG5 A;  4M0W A;  2F4V M;  4LZJ A;  3U6C A;  5EXS A;  1PJJ A;  2QBY B;  3FD9 A;  3M6A A;  4YHH M;  1QAM A;  2BJW A;  4DUZ M;  5C18 A;  2CV2 A;  4GHA A;  2F5S A;  4LF8 M;  1N78 A;  4WW0 A;  4LJ8 A;  4NOO B;  4NSR A;  2VQF M;  4KLN A;  4OVZ A;  2G8L A;  3CTW B;  3HWS A;  4IBI A;  1IXR C;  3DZD A;  4LFC M;  1SXJ C;  2C9C A;  1DGH B;  5ITQ A;  1Z59 A;  3SAW A;  1HT1 E;  4FCV A;  2OPF A;  2XGN A;  3LVW A;  3AJI B;  4S12 A;  4JI2 M;  3FUT A;  4DUY M;  1K82 A;  1HQY E;  4B3S M;  4BLC A;  3ILK A;  1N32 M;  3RE8 A;  4EIW A;  3TWL A;  3QWL A;  3VK8 A;  3HU1 A;  4LRS A;  1D2N A;  2DZO B;  4L16 A;  4IBE A;  3TPZ A;  2CHQ A;  4IBD A;  3FTC A;  5E26 A;  2M5Z A;  4TUW A;  3U5Z B;  1J7K A;  2JA2 A;  3KOW E;  1TGU A;  2H1R A;  5KPR A;  2KW0 A;  4GC9 A;  2F5N A;  3J27 B;  4MGY E;  1QVR A;  2R4E A;  3IG8 A;  5JI3 E;  1T3T A;  3GLI B;  3HHZ A;  4L8R C;  4DR2 M;  3KOZ E;  3U6D A;  1GL6 A;  3HGI A;  3AFH A;  3C58 A;  2L7I A;  4M0D A;  3EIE A;  5EXX A;  4DV5 M;  1G41 A;  3L25 A;  4IIW A;  3A46 A;  1N33 M;  3SFZ A;  2Y0Q A;  3U6S A;  2G5G X;  4I5S A;  3HU2 A;  5ITT A;  3U61 B;  2ERC A;  3U60 A;  2F5O A;  1W5T A;  3HJS A;  1G3I A;  1R6B X;  3LMM A;  2A5Y B;  2XEP A;  3TWM A;  1QQW A;  4GKJ M;  4FCT A;  3LVV A;  4LZZ A;  3SAT A;  3KDS E;  5DNY A;  1R7R A;  3FTE A;  2O5R A;  3K8Z A;  2J7O A;  2YR0 A;  1XWI A;  2Z7J A;  3D8L A;  1VDD A;  3GPY A;  3GLF A;  5JI2 E;  1SXJ E;  4LJ4 A;  2XF3 A;  1JR3 A;  4NL4 H;  3GPX A;  2CV0 A;  2R45 A;  1GLN A;  4OW0 A;  2YFQ A;  2I7N A;  3QAU A;  1ZQ9 A;  1E9R A;  4L78 A;  3HJQ A;  2ZBK B;  4LCB A;  4Z8X A;  4I8O A;  3GRU A;  4OX9 M;  3I4Y A;  1QAO A;  2V1U A;  2D7G A;  4GRI A;  1L1T A;  4AKG A;  3A42 A;  3DOA A;  1KFV A;  3KP1 E;  3AKZ A;  1IN8 A;  3VK7 A;  1N34 M;  4FWD A;  3JR4 A;  3FKE A;  2QPA A;  3FUW A;  4JI0 M;  4A3V B;  2XFS A;  5FTL A;  1Q3B A;  2C96 A;  4IBC A;  4REZ A;  3GQ4 A;  1NNU C;  5LMU M;  1TDZ A;  1UM8 A;  1NY5 A;  2FE8 A;  1IBL M;  4FVM A;  1XMO M;  2LWX A;  2UUA M;  3T1Y M;  2ZAO A;  1Z5C A;  3H4M A;  1HR0 M;  4G4N A;  2UU9 M;  4QNM A;  2L09 A;  5FSW A;  3SAR A;  1SXJ A;  2CHV A;  2I7P A;  4AZF A;  4IBG A;  3UGJ A;  1XC8 A;  2Q2E B;  3M7G A;  4X62 M;  4JYA M;  1NVM A;  3CF2 A;  4LF4 M;  3KOY E;  4DV6 M;  4KHP M;  4M9S A;  1K3X A;  4MGK E;  3L28 A;  3RGP A;  3R9X B;  5KO3 A;  1DGF A;  3MJ5 A;  1JR3 D;  3GLG A;  1XXH B;  4I81 A;  3L26 A;  4X64 M;  4M9Z A;  3VKG A;  3PVS A;  4NXM M;  2D7E A;  2HKJ A;  1HNX M;  2HL7 A;  2KA6 B;  3VFD A;  4G4R A;  1TH4 A;  5KQ8 A;  2DWN A;  2NQ8 C;  2YQZ A;  1J5E M;  1E32 A;  4B7F A;  3U6P A;  2X4A A;  4AKI A;  4DR6 M;  3TQS A;  4QOZ C;  4CGY B;  1NHG C;  4CIS A;  2R4J A;  5EP2 A;  3T1H M;  3TL4 X;  1IBM M;  3GRV A;  3L2A A;  4M9X A;  2XLJ A;  3L29 A;  3ZH9 B;  4DR1 M;  5FTN A;  4YY3 M;  2BJV A;  1IN5 A;  1SXJ D;  3I51 A;  2L6O A;  1HNW M;  5KPZ A;  1KSF X;  2DWM A;  2YNM D;  1DGH A;  4ZPX A;  4CHT B;  2R62 A;  5DYG A;  2UXD M;  1G4A E;  1NJF A;  4LJ7 A;  4PCZ A;  4L4U A;  4NSO B;  5ITY A;  2K47 A;  4L15 A;  4MH0 E;  1IM2 A;  5EXT A;  4JXJ A;  4G4Q A;  4LJ6 A;  1H6U A;  4AKH A;  4MM3 B;  3GRR A;  4RF0 A;  2E5L M;  4JI1 M;  3BOS A;  5BR8 M;  2R65 A;  4RF1 A;  1Q39 A;  2KXE A;  3UK6 A;  4KO8 A;  1HT2 E;  3EIH A;  5FLX S;  4NRW A;  2XFT A;  3U60 B;  1L2D A;  4JI5 M;  2XSZ A;  4MGI E;  2L7H A;  3SBJ A;  4MGH A;  2DXI A;  2BNK A;  1TH3 A;  2LXE A;  1TH2 A;  3FUU A;  3U6M A;  4OU7 A;  4B3T M;  4AI6 A;  2X8A A;  4P16 A;  4JN6 A;  3U6Q A;  2C5R A;  2VQE M;  4LFB M;  3AOG A;  3UMM A;  3GLF B;  2DVW B;  3A45 A;  4FW9 A;  3NBI A;  1G59 A;  5LMN M;  4IBF A;  1MX0 A;  2AHM A;  1ORY B;  4MGZ E;  3MK6 A;  4PT5 A;  4GKK M;  2Y21 A;  4JI6 M;  5IRE B;  2UXB M;  1IXZ A;  3HU3 A;  4XGI A;  3I4V A;  1IY1 A;  2DWZ B;  4B3M M;  3HKP A;  2QCU A;  5DYI A;  2QP9 X;  1OFH A;  4IJF A;  4AG6 A;  5KPT A;  4DR4 M;  3DFZ A;  2HHH M;  3GP1 A;  4DR3 M;  2W82 A;  1PJI A;  4FWH A;  4NXN M;  3FYC A;  4B7H A;  4GHL A;  3THG A;  4AW4 A;  1IY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...