3AJXA

Crystal structure of 3-hexulose-6-phosphate synthase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
207
structure length
207
Chain Sequence
MKLQVAIDLLSTEAALELAGKVAEYVDIIELGTPLIKAEGLSVITAVKKAHPDKIVFADMKTMDAGELEADIAFKAGADLVTVLGSADDSTIAGAVKAAQAHNKGVVVDLIGIEDKATRAQEVRALGAKFVEMHAGLDEQAKPGFDLNGLLAAGEKARVPFSVAGGVKVATIPAVQKAGAEVAVAGGAIYGAADPAAAAKELRAAIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of 3-hexulose-6-phosphate synthase, a member of the orotidine 5'-monophosphate decarboxylase suprafamily
pubmed doi rcsb
source organism Mycobacterium gastri
molecule tags Lyase
molecule keywords 3-hexulose-6-phosphate synthase
total genus 81
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.43: 3-hexulose-6-phosphate synthase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ajxA00
1LTDA 1OFBA 1SU5A 1XDMA 2FLIA 3W70A 4OV4A 1XL9A 5CZTA 2JBMA 3S5ZA 2BZNA 2Z1BA 3NL2A 5CPOA 1CW2A 2Y7GA 1W5MA 3NZRA 4LOCA 1DJNA 4O52A 2QR6A 1O95A 4JTLA 4NXSA 1KV8A 5KITA 2BXVA 3U2OA 4A2RA 1LYXA 2DJLA 1JQXA 4JTKA 1T99A 3NQFA 1SW3A 4LVFA 2FIQA 1WXJA 1X6UA 2NWRA 6TIMA 5D2TA 1GZGA 2NX1A 4QISA 5LGZA 4FX6M 4HN4A 2EF9A 3FKRA 2Z0IA 3S1UA 5LGXA 4FO4A 1O94A 3DHDA 1S3HA 1KW1A 5L9FA 3W1RA 1VLIA 1IXPA 1NVMA 1QAPA 5HJLA 1ZY9A 3L68A 1OF6A 5DCEA 2ZRUA 3EKZA 3EX6A 2HS8A 1DJQA 3GDMA 3NM3A 3G1YA 4UMBA 1QWGA 1XCFA 3TJXA 3LHZA 3NQ6A 4UTUA 3OVPA 4XTDA 4M5PA 4BI7A 1SFLA 1UUMA 4WXYA 3O1NA 5AHFA 3ZR4A 5F4XA 2H8ZA 3I7QA 3G8RA 2Y7EA 1D3HA 1OFOA 1LRNA 3UXAA 1TJRA 4LV4A 5GVJA 2QAFA 2VFGA 5T26A 4JTTA 4LRSA 2TPSA 2YYUA 3N9RA 3ABQA 3GDRA 1TPEA 1WQ5A 3SFKA 2VOMA 4GJ1A 1W31A 5CZ0A 2B7OA 1VR6A 4O53A 3LRMA 4L4MA 4CCDA 3NL5A 1TB3A 3W7DA 3G3DA 3SZ8A 3G22A 4Y90A 2Y63A 3CQ0A 3N19B 2A0NA 2TRSA 3E49A 2B7PA 3STCA 3HPZA 2EHHA 4ADTA 3H54A 3W7LA 2E5DA 1I2QA 4RJEA 3W1NA 1M7OA 2NUWA 4YWIA 3MYPA 5DXXA 1VLWA 1EUNA 2CW6A 3W75A 3GDTA 4RLIA 3SGZA 5HMSA 2DZXA 3JRKA 2EGZA 4UFHA 5A8GA 1B3OA 1JCYA 3G0SA 3W2NA 3M7WA 4JTSA 1VJIA 1VS1A 4JTUA 2Z2UA 5G5IA 3UNDA 2KZHA 1VQTA 1DBTA 5KZEA 4MZYA 4RKAA 3W2UA 1NAL1 1O5XA 3PG8A 1J2WA 1I2OA 2G96A 4WY0F 1XBVA 2C19A 4UTJA 1QCWA 3EXRA 3WJYA 1IXOA 2CZ5A 4M19A 4JX4A 3Q94A 4ZQOA 4TIMA 1SO3A 2YW4A 4PA8A 1K03A 1QO2A 3IVSA 3L67A 3LCLA 3OIXA 3TC6A 4OE7A 3VKJA 2A7PA 1BEUA 1DL3A 5J5DA 3EX3A 1Q6RA 1LLZA 1U83A 1BKSA 5D2WA 1B4KA 8TIMA 3M5YA 3B0UX 4G1KA 4PC8A 1ZALA 3E02A 2A1YA 2QJHA 3NO5A 3AO0A 1IXNA 3LTYA 1TQJA 2P0OA 3TSDA 2O7QA 2QCGA 3O07A 2FPYA 3L0KA 2NLIA 3KFTA 2RDWA 3TH6A 2J24A 4IPJA 2VEMA 3HGSA 4JS3A 4BR1A 5DN1A 3O05A 1SW7A 2G5WA 4X9SA 3W87A 1GVSA 3W85A 2ABBA 3GKAA 2O7SA 3LM7A 4Z1CA 1J5TA 1DKWA 1HL2A 5E93A 3KVJA 1H62A 2BWGA 3MW7A 1SPQA 2VFIA 3UWZA 2NUXA 3VE7A 3W83A 4IXXA 1W54A 2PE4A 2WSYA 3CU2A 3CEUA 4EF8A 3W6YA 1NF0A 2ATMA 2Y7DA 4OQVA 1HO4A 4ZL1A 4X2RA 3MHUA 4OBTA 3L21A 1TO3A 2CLKA 1KM5A 2XN2A 5CZJA 2JKPA 1FWWA 2QCDA 3HO8A 2EAWA 1OFQA 2NX9A 4DF0A 1BTMA 3TU9A 4NNAA 1BWLA 2YZRA 3GB6A 3I6RA 4KWVA 4TX9A 5TIMA 3W7NA 4BI6A 4DEFA 3PB2A 1FDJA 4NJGA 4ZQCA 1KFCA 4YXGA 1XBZA 2DZVA 1H5YA 5EYWA 3I7SA 1QOPA 3HBLA 4ALDA 3NM1A 1ICPA 3UZ5A 4MYAA 2OT0A 1TJPA 3VNDA 3S5NA 1JCNA 3GR8A 4FHAA 5DBUA 1RR2A 3TR2A 1ZAJA 1JCXA 2G97A 1OF8A 4LNYA 3BG3A 3S1XA 2W0UA 1TPFA 3BLIA 5FF0A 4RK8A 1VZWA 3A5VA 1GOXA 5HWJA 4O1BA 4GE8A 3NGJA 1QPRA 3N34A 1AL8A 3HGOA 3ELFA 4AAJA 4ZQMA 3TAKA 4E2BA 2CLFA 2BSLA 4MOZA 2ABAA 3NQDA 4O0KA 4UNKA 4GFSA 3EWXA 2FB2A 4MJZA 3A23A 3P62A 4Z1AA 4LS2A 1H51A 4FB7A 1N7KA 3TV8A 3HJZA 5K9XA 2W79A 5HNRA 1WX0A 3G1FA 3TQKA 4UMCA 3NL3A 3LHTA 3QPYA 4AMAA 1W3NA 5DY3A 3P80A 3KRSA 1K8XA 4OT7A 5LNWA 4QNWA 1K7EA 5F1VA 1MO0A 4NT0A 3PR2A 4LVBA 4O18A 1DHPA 4ZQRA 5AHNA 5K7JA 1L2UA 3KHJA 2J27A 3M41A 3C2OA 3M5XA 3R5EA 3BARA 4I7UA 4QJ1A 4UFLA 4XZ9A 1A5BA 4NJIA 3QH2A 3GAYA 3EX2A 3HPXA 1F6PA 5I3IA 4I7WA 4LS1A 4ADUA 4I7VA 4M7TA 4O1CA 1SQ7A 4OU1A 3NOEA 1EP3A 3CHVA 1W5PA 4JDBA 4DO4A 4KWWA 2CLOA 4WY0A 2B7QA 2QJGA 2ZYFA 2YXGA 1RQBA 3NA8A 3IIOA 3W74A 1SO6A 4WX2A 2DZUA 4Y9AA 3BGJA 2GVLA 2BTMA 1KM1A 4UTTA 3A24A 2QCDB 3A9IA 3BW2A 3UPWA 1EUAA 1ZFJA 3UWYA 1AW1A 1FX6A 3W7QA 4IGHA 4O57A 4XQ6A 2BLEA 5AC7A 1D9EA 1LCOA 3TW7A 3IVUA 4S1FA 5KTLA 2NXIA 5AHEA 1GG1A 4JICA 4JN6A 2BX7A 3SJ3A 3LV6A 5EL1A 4TR9A 3S6DA 4MZ8A 4P2VA 3E12A 3W7RA 4LVDA 1A50A 4O50A 1Z42A 2AQWA 2QJIA 2CFFA 3W2KA 3KRUA 4AHPA 5LNSA 1EIXA 4R34A 4WOQA 1ICSA 3QYQA 5FEPA 1Q3NA 2RKXA 4AWUA 2A4AA 1K8ZA 3P74A 3P7YA 3S5OA 1T0OA 3LHYA 1XDLA 3OBKA 3NR0A 1A5AA 3LBCA 3Q58A 3TSBA 3DI1A 1TV7A 1I2NA 3WJZA 1SO4A 2WNZA 1MZHA 4GUJA 4UTWC 2CZEA 3TIMA 3S9YA 4IMGA 2NXHA 1TPB1 3PAJA 4O54A 4QIUA 1FWSA 3G1HA 4UIOA 3N2XA 3BK0A 4HHPA 5AYXA 2YFOA 1ZNNA 1OFDA 4Y6GA 3W3OA 3BVJA 5IBXC 1I4NA 4PCFA 5IBXA 2E1DA 3F1QA 2ALDA 5FF7A 5K4ZA 2NZLA 3GNNA 1KM4A 4S2CA 3MI2A 2E6YA 4MLJA 1Q6OA 2TYSA 1FBAA 4N4PA 4IMCA 4P61A 1K02A 3S0CA 1GG0A 2V2CA 4UTWA 3HG5A 2R14A 4DPQA 4C1KA 2DORA 5DXYA 2QUUA 3TAOA 1F2JA 2Y70A 3SIZA 3TXZA 1RZMA 4CQAA 2WQPA 3W71A 3B4UA 1OJXA 3W7OA 3LXCA 1WDWA 1TSIA 4Q32A 4DO6A 4BK9A 5D38A 2R8WA 5E1QA 2A7NA 3N2MA 3QJAA 3LI0A 4RXFA 4AB4A 1F76A 3PBWA 2RFGA 2YX0A 3K30A 3W76A 4IMDA 3MP3A 4LC8A 4XTIA 4H6KA 1YDVA 3SECA 1W3IA 5K3VA 1OK4A 3SI9A 5LZLA 3QMRA 2ISWA 2OX1A 3HG3A 1HFBA 1SSGA 2VFEA 2WNNA 3MWAA 3W1UA 3O16A 4WUIA 3MYOA 1O60A 1WA3A 1A53A 3UYCA 4JTHA 4UR8A 3KX6A 5AC6A 4GWEA 3DI0A 4GUGA 1JQVA 1XKYA 1ICQA 1KA9F 4MJMA 4R33A 4O15A 1D3GA 4A21A 5F2GA 4GXMA 1ZHAA 3L0NA 1X1OA 2WKJA 1ZENA 5EKYA 3NYZA 1TTPA 3C0JA 3CWNA 4GUHA 4O1AA 1WOAA 4CCCA 3FYOA 1WV2A 2ZZ5A 3PSVA 3B04A 5AC8A 1GVFA 4JTEA 4JTIA 3LTSA 4KFOA 5DCDA 5D33A 5I3HA 1XFBA 5I3FA 1LDCA 2P10A 4OGZA 4NNCA 4X3ZA 3IIPA 1BWKA 4K39A 2GQ8A 4XUGA 4BWLA 3FJ6A 4N2YA 3T55A 3INPA 2AGKA 4WXZA 3H55A 4O17A 4LY8A 4EVZA 3W7GA 4DO5A 2GUUA 3CB8A 4QAIA 4KFNA 3T4CA 3BGGA 3UWWA 3N9SA 3BLFA 3F4NA 4FEZA 3HGRA 4YCOA 1FWRA 2QEZA 2CZFA 3USBA 1PS9A 4JDYA 4GRSA 3W7JA 4K8EA 2PCQA 4DQWA 5I3JA 3MBDA 2GVGA 4RR4A 1YADA 4UFMA 1F73A 4IJBA 3ABSA 3NVTA 5DCBA 4MIMA 4N4QA 1TTJA 4LT9A 4NQ1A 3IGUA 3OEXA 3O6YX 2Q3RA 3QEZA 1F5ZA 1YXDA 3GR7A 3WFAA 1CX9A 2GJNA 3LGEA 3GZ3A 4E0CA 3LV5A 5HUOA 3VE9A 4MFEA 2ZZ6A 4ORIA 4FNRA 1KTNA 1FXPA 1WAUA 3W7KA 3EWYA 3EX4A 4LVGA 4BWLC 2B0MA 1GTHA 1UCWA 2YW3A 1WBHA 1YXYA 3P5YA 2R94A 1W37A 3MJYA 5C5YA 4AWSA 3NPUA 1LBFA 3ZWTA 2VFHA 1M7PA 2LLEA 3QZEA 4ZZ9A 1L6SA 3P60A 3RLVA 1DQWA 4LC6A 3TW6A 2RDTA 1LRTA 4JYEA 3O15A 4NJJA 1LROA 1HUVA 2HTMA 4CNOA 5EA9A 2A85A 4WD0A 4XKYA 2QDGA 3DXIA 1G4PA 4JYFA 4HPJA 3G1DA 3TK7A 3C2VA 1THFD 3PSWA 3UZJA 3LRLA 3S8HA 3W2JA 3CPRA 4NZFA 4ICNA 4WZHA 4AF0A 3B06A 1UB3A 4LV9A 3UPBA 2CLLA 2PRLA 4DXVA 3SW6A 1S5TA 1P4CA 3A22A 2A6LA 2OCZA 3W2LA 3I68A 1VHNA 4XWUA 3LCFA 2QAPA 2ZZ1A 4ZQPA 5U7SA 5AHLA 1TPC1 3W9ZA 3UD6A 2Y89A 3LHVA 1KFJA 3TMLA 4O11A 5K2ZA 3M5VA 4D2JA 2G95A 1W1ZA 5F2MA 5DLCA 3GK0A 2ZZ4A 4UTIA 2EKCA 1Z41A 2ZTKA 1H60A 3CEPA 3QW3A 3L2IA 3W73A 2QF7A 3BO9A 1FWNA 3TE9A 4O16A 4E2DA 1LOLA 5ABTA 1QFEA 3TUUA 5D2VA 1OYCA 3STFA 1WYIA 4HT3A 2OJPA 4YCPA 2HSAA 1XC4A 5C6MA 1YXCA 4TO8A 5MHBA 3M43A 1MSSA 2YCEA 4JGDA 2XN1A 1DVJA 1OABA 3NPXA 1T96A 4JXCA 3WJXA 1ME9A 3QC3A 2E68A 5D03A 4MPQA 2CLEA 3PVFA 2D73A 2Y7FA 3LI1A 3TKFA 2VC6A 5G4EA 3W7CA 3PWAA 1X1ZA 1SSDA 5EMUA 3H53A 4RZ5A 1E51A 3W1LA 4AHQA 1QDSA 3PF3A 5H91A 3W22A 3Q2DA 4K7YA 3VFLA 4WY0B 3KXQA 4UC5A 1L6YA 2A21A 1PL9A 3OA3A 4E38A 1TV5A 4M7SA 1VYSX 1SFJA 3SSJA 3LX9A 4K38A 1SW0A 2GVJA 2EPHA 2Y6ZA 4HIBA 2PURA 1KTCA 1HTIA 2Q8ZA 3TSMA 1KBIA 3NQVA 3QQ0A 3TQ0A 4OHQA 1O5KA 1G7UA 4AXKA 3L65A 1AW2A 2E5CA 5AHMA 4DF1A 2R91A 3BPWA 1W56A 4J9JA 4MZ1A 1G4TA 3B8DA 3G24A 4GUFA 3QM3A 4XBKA 3B05A 3GXNA 4NNBA 3C61A 2H3DA 5H2ZA 1Q6QA 3NZ1A 1LRQA 5AYYA 2Y61A 3DBPA 3OVQA 3G1AA 4JIQA 1ALDA 3P82A 3DFTA 1RQHA 4CQ9A 1PIIA 3NQEA 5TQLA 1JUEA 1Q45A 2ZFAA 5HWNA 5EY5A 4NU7A 4AWTA 3S1WA 3E96A 1JCLA 4CNNA 4MY8A 2VENA 3WK1A 1VCFA 4K36A 1AG1O 3W7PA 2NXGA 2C3ZA 5E0KA 4IPIA 1Y0EA 4JYDA 1F6KA 2ZCGA 1FQ0A 1G7VA 1TPUA 2WJZA 2QDHA 1KBJA 3M47A 1RV8A 4H4IA 3IVTA 5CSSA 4HNUA 2DZTA 3DU0A 3TC7A 3LERA 5BRBA 3HGJA 3MP5A 1QOQA 2J9ZA 5D02A 3WK2A 3QMTA 3R8RA 3C2EA 3CIXA 4R53A 4FXRA 2C16A 2UV8G 4XBSA 3PS7A 2J9YA 3ZWSA 1R2TA 4MYXA 1ONRA 1YTEA 2V0TA 3C8FA 2C15A 4DF2A 4O19A 4X22A 3W1MA 1H7RA 4JD4A 3N3MA 2ZDRA 5D37A 1G4EA 1G69A 5C54A 7TIMA 1VCVA 4JEQA 3MI3A 2H3BA 4FIRA 4O13A 3DFOA 4UFJA 5BNKA 3NQ8A 1P0NA 1JUBA 3FJLA 3W1TA 5KINA 3D0CA 3OG3A 2NUYA 3W2MA 3TFXA 2ZRWA 3NQCA 2CLHA 5BMXA 1EPXA 3ANYA 2WOQA 4HPXA 4EIVA 1NEYA 5FF4A 3GX9A 2VEIA 1W0MA 3DHFA 4WJEA 4NXKA 2JGQA 4H3DA 4NVTA 3E0IA 3A21A 4MUZA 4RV8A 5L6UA 5K9DA 2J9XA 1TPWA 4N6EA 4FNSA 2DZPA 5J5RA 3DH7A 1YYAA 2NX3A 3W7MA 1QO5A 4NX5A 2A6NA 2WSRA 4Y8FA 1M5WA 4O4WA 1JCJA 2X16A 4UTKA 5C2XA 1CI1A 1MEWA 1YTKA 2OT1A 4O1DA 2QCFA 3AJXA 2V81A 4ONVA 1F74A 1GVOA 3STEA 3DFPA 3RLUA 4MKNA 1R47A 3QSRA 4HNVA 1I2RA 3WK0A 2ZZ7A 5BOOA 1QMLA 5F2IA 3W72A 2Z6JA 1GTEA 3WK3A 1FCUA 1OX6A 2F7FA 5G1YA 5U4NA 5F4WA 3O8AA 3P61A 4O10A 2FPVA 3C2RA 4U4MA 1OK6A 5AOUA 3BV4A 1R46A 3HPSA 5FI8A 1PHWA 4O0ZA 3KOFA 1JCMP 3RK8A 5D05A 2YFNA 4LVAA 5TBOA 2JK2A 4DELA 4U28A 2Y85A 1WBJA 3PG9A 2Q8LA 3CWOX 4ORMA 4KFPA 1GWJA 1A5SA 5CGQA 2DJXA 3SR7A 1SO5A 4IQLA 3P8IA 4NZJA 4ADSA 2V2HA 4LW7A 3W88A 4CQ8A 4IUOA 5FESA 2OZ0A 1SR9A 2DZWA 3LTPA 2HMCA 1NSJA 2VFDA 2VFFA 1YLVA 1IXQA 2E6DA 1TQXA 2OMAA 3UWUA 3EWUA 3EWZA 4IMFA 3ZFHA 3W7HA 1VYRA 4IOTA 2QUVA 2XFWA 3EKLA 1F05A 4DBDA 1EP1A 1QNVA 1VPXA 2ZA3A 2Y62A 4A3UA 3P67A 3EB2A 1M6JA 5CPMA 2VXNA 4BF9A 3O06A 2FFCA 4AVFA 3C56A 5SWUA 2V9DA 1FDZA 1H61A 4UFIA 3LCIA 4MY9A 2CZDA 4JIPA 4RXGA 3A5FA 1J4EA 2WSQA 1KM0A 4UTTC 4PL1A 3FOKA 4JY8A 1L9WA 4ZVJA 4UMAA 5G2WA 2NV1A 3ATZA 3RU6A 1AW5A 4HNNA 1R2RA 1NF7A 3QFEA 4FXSA 1ME7A 3NEVA 5D2YA 1LZOA 4JX6A 1H7WA 1GJPA 5HUPA 1V7YA 3MMTA 3KVLA 3U6WA 1H7OA 2FJKA 1V5XA 2NV2A 3NQ2A 3ABOA 4TMCA 1K8YA 4LUIA 4Z0SA 3NAVA 5HQEA 5CPNA 3M1ZA 1B57A 3L9CA 3LHUA 1MEIA 1TYGA 5C55A 1L6WA 1TV8A 3B03A 3UQNA 4TU1A 5KMYA 1HG3A 2C14A 1AMKA 1MEHA 3JR2A 3VCRA 4LU0A 1T8XA 5FEZA 2PC4A 4IX0A 3RNDA 3LXAA 4FNUA 3DAQA 1JUKA 1FY6A 3THAA 4PODA 1GQNA 4JY9A 4QITA 3M44A 1JJKA 5FEXA 4N9BA 3EWBX 3R13A 2QCCA 2IQTA 1IIGA 1XM3A 2B7NA 1H63A 3GIYA 1FCBA 2ZTJA 3EEGA 1QPNA 2I14A 3C4UA 3PBVA 1OX5A 4CCEA 2CLMA 1PE1A 3KAOA 1OYAA 3U8GA 3P5ZA 1YDOA 3M0ZA 3NQAA 1XXXA 1K3UA 5CSRA 4EWND 4A22A 3G18A 1C9DA 3PBYA 5CG7A 1ZCOA 1JRBA 1PHQA 2VEKA 1KV5A 3R12A 1C8VA 3DGRA 2GJLA 3L0GA 1H7PA 3TA6A 5HR6A 3P81A 2W6RA 2C13A 3EWWA 4C1LA 2F84A 1DV7A 1OFRA 4NJKA 3KVKA 3PM6A 4DBEA 4QSHA 1K7FA 3CT7A 1R30A 2C18A 3NPVA 2DP3A 1ME8A 4K37A 1VYPX 3M6YA 1PV8A 1GVRA 3THQA 2RH9A 5EBUA 1KFKA 3LCGA 3DFNA 4HNTA 4LUJA 3GVGA 4FNQA 1KTBA 2X1SA 1VC4A 1OX4B 2JKAA 3I7RA 1KLYA 1GVQA 3N73A 4YLWA 3DFQA 2X30A 4GUIA 3RF9A 3P8JA 3NL6A 4O8RA 3FKKA 2AAMA 3HG4A 1Z44A 2V5BA 2VKZG 1GEQA 3TFCA 2X2GA 3PUDA 2X1TA 1W3TA 4JTJA 5LHEA 1JRCA 3LCHA 3V75A 3CIWA 2E6AA 4NJHA 4A2SA 5D09A 4K8HA 3JS3A 1RD5A 1KM6A 2GOUA 2QKFA 3W84A 4I9AA 1EX5A 2QCLA 1H1ZA 3T78A 2E77A 2P1FA 3QF0A 5G1TA 3QMSA 4IX2A 2ZRVA 1Q6LA 2ZRXA 4Q33A 2CLIA 3UY8A 3QPZA 3SY5A 5K9CA 3W23A 3R89A 1N8FA 1G67A 3LDVA 3UWVA 3YPIA 1EWDA 1TRDA 2X1UA 3DKLA 2ISVA 1GT8A 4GBUA 4K7VA 1WOBA 1FCVA 2FQIA 3O63A 1KLZA 3NG3A 2TSYA 4O28A 2J88A 2QCHA 4O14A 4UTHA 3FYPA 2QCEA 1W5QA 3FEMA 4Y96A 5AHIA 3C3NA 2WNQA 3TROA 5DY2A 2E5BA 2YPIA 4MVAA 3NDOA 3HOJA 1DQXA 4FIQA 2X1RA 3GLCA 3WJSA 2C0AA 1P1XA 1Z48A 5LNVA 2FPTA 3S5YA 1UBSA 1LOSA 3MI6A 2I9EA 4OV9A 4M6QA 1JR1A 4AHOA 1P0KA 4NUWA 4AH7A 5AFDA 5HULA 4Z1DA 5KSWA 4Z1BA 3TCEA 2ZBTA 3F03K 3IRDA 3NQGA 1RVGA 1ML1A 3PC0A 1I45A 3NNTA 3N14A 4NX0A 1A5CA 1OG0A 3IGSA 5KZDA 3MBFA 1P5BA 4R7JA 3L5MA 2GPTA 3OVRA 5D32A 4B5NA 4LTSA 4KKXA 4Z0JA 4JR5A 4QQ3A 1ZAHA 2J6XA 1LBLA 2H6RA 3L5LA 2A2IA 2GQ9A 5CKSA 1XUUA 3CC1A 4HSNA 3I65A 1XBYA 3LCWA 1KFEA 1VCGA 2NWSA 4PH6A 4EOUA 1MXSA 4OWGA 3QRHA 3HG2A 3LLFA 4M6VA 5HWMA 3EXSA 3G1XA 1TPVA 4UNLA 3R2GA 4Q4KA 2JKEA 2HS6A 1VGAA 1QPQA 3C52A 2ZQ0A 2V8ZA 3BLEA 4HSOA 4M6PA 3FFSA 3KVMA 3G3MA 3LB0A 1IGSA 3CLMA 4IMEA 4TMBA 3KRZA 1I8JA 3LHWA 4UFKA 3EX1A 3G0XA 3PUEA 1GYNA 1DORA 1FCQA 3IIXA 2YR1A 1VHCA 3W86A 3IV3A 3UXDA 3IIVA 4PEKA 1G6CA 1UUOA 3O6DA 2VELA 1S5WA 4XKYB 5AYZA 3SGUA 5G4WA 4LS0A 1LLWA 1S5VA 5FF2A 5LNUA 1XI3A 2ZA1A 3M9YA 3IGXA 4O12A 1TMHA 2V30A 1QR7A 3GYEA 6ALDA 1LORA 1NFBA 3C6CA 3OHIA 2A7RA 5KZMA 1I2PA 1YPIA 4N9CA 2B4GA 4FNTA 5IM51 2GQAA 1ADOA 3MHGA 4PFMA 4Z08A 3T44A 3GXTA 1SUXA 1XBXA 1K7XA 2TMDA 1EWEA 1H7XA 4LWWA 1JVNA 3GDLA 1KM3A 4UCGA 3CTLA 5D30A 5DELA 3NXFA 4JX5A 1LM1A 2ZZ3A 4IWWA 1QPOA 1ZJIA 3S1VA 4FF7A 4N9EA 3TJLA 3MHFA 5AN7A 3IIZA 3LBMA 2CU0A 4JTGA 2H8XA 2E09A 3GDKA 1GYLA 4GC4A 1XUZA 2YSWA 3FIGA 1UASA 3TMQA 2JGYA 3VI2A 3PBUA 1LBMA 1HO1A 4IXHA 4RCXA 5FEWA 4W9TA 1VH7A 4WQ6A 3GNDA 1RPXA 1AL7A 5LKYA 2ZRZA 2DZSA 3TQVA 1G4SA 1VRDA 4PL2A 5FF3A 3T40A 1EP2A 3DKJA 3G8EA 1PCKA 2V82A 3EXTA 2DU2A 3LCXA 5F4SA 1C29A 3LRKA 3CM4A 4AEOA 4MFDA 4UXDA 2ATSA 4HKPA 2PRMA 4AF0B 3LLDA 2QUTA 3GKFA 1O4UA 2C1HA 3PB0A 2V5LA 4N02A 2A5HA 3RMJA 1H50A 2C6QA 2YDAA 3T7VA 4O4VA 1OHLA 3W07A 4QNEA 3C2FA 1FUYA 1FXQA 3WJWA 1DOSA 1U5JA 5I3GA 3ATYA 3PY2A 1PCWA 1W5NA 4UUIA 1GPWA 4EF9A 2CWNA 5HINA 4FX8A 3G1SA 3M5ZA 1EB3A 3UWQA 5F2LA 4ZMGA 4GNJA 1EA0A 1TPDA 2FTPA 3P84A 3QQ1A 1W5OA 3FS2A 4MLRA 3W7IA 1B9BA 4L4LA 3W1QA 4UTLA 2Y88A 4UTMA 1TREA 4K6AA 1OVDA 3MO7A 3HMJG 1X8FA 4YL2A 3G0UA 3F4WA 2FB3A 5DBTA 3DZ1A 1N55A 3W1AA 1H7NA 1KM2A 3W1XA 2E6FA 2ZA2A 3HQ1A 1FDYA 5CZSA 1OFEA 3NQMA 1YPFA 3RFAA 3W7EA 1TTQA 2V2DA 4DPPA 2WV8A 4JTFA 1B4EA 5A5WA 1LP6A 4BI5A 5BW6A 4ML9A 3TNOA 5G2IA 4FX7A 1JULA 3QW4B 2PRHA 3PUOA 4LRTA 4RX0A 4MY1A 1TIMA 5AB3A 5LNRA 3HB9A 3ABRA 4RZ6A 5CPLA 2WPBA 2RHGA 3GXPA 5F1UA 3GAKA 3G1VA 3TDFA 1KFBA 1LOQA 1PVNA 4PTNA 3MP4A 4CNPA 3NPWA 3E9AA 2WO5A 3STGA 2I1OA 3LXBA 1OYBA 2ZRYA 3L5AA 3UY7A 4FNPA 3L66A 2QCNA 1IIHA 2FDSA 1KFLA 1YDNA 1IF2A 5LHFA 1W8SA 1TTIA 5LSMA 4ZQNA 1ZAIA 1YTDA 5BMWA 4WOZA 4BFAA 2QCMA 3TX9A 1SZEA 3HIJA 5I3KA 3PULA 1SZFA 3BW3A 4JNMA 3Q37A 1R2SA 1AK5A 1OFAA 4A29A 2ISSA 3TXVA 3BG5A 3ZS4A 1TRIA 5EPDA 1F7BA 1RQEA 3BG9A 4RZ4A 4QM1A 3QSTA 1SZGA 1OFPA 4POCA 1TCDA 4UR7A 1FWTA 4S2BA 3LOTA 2Q3OA 3DFSA 1OX4A 5G2HA 3B0PA 2Z6IA 3NQ7A 4N6FA 2XN0A 1X7FA 5HR7A 3BW4A 2VEPA 3DENA 2RDUA 2YYTA 3HF3A 4CLMA 1UJPA 3O6CA 5D2XA 5K4XA 3M16A 1H1YA 5D04C 1TPH1 2ZZ2A 2YGYA 3FLUA 3IEBA 3W1PA 1SZNA 3S42A 4N9DA 3V1PA 1EEPA 3FA5A 2H90A 3B0VC 4YMZA 3MUXA
chains in the Genus database with same CATH superfamily
3MVIA 3BSGA 5EMLA 3AHTA 3W70A 2PGRA 4S3GA 2XVKA 2QXWA 5C9WA 3F2BA 3WQOA 1CW2A 4FAMA 2Y7GA 4LOCA 4GCXA 5IHSA 4ZOCA 2BXVA 4A2RA 1T99A 3NQFA 1SW3A 4DWSD 4MDPA 1QBAA 3WH5A 5LGZA 4ZFCA 3PFMA 5ECVA 2EF9A 5LGXA 3DHDA 3W1RA 5D9NA 2QQ6A 4ROQA 7PTDA 1QAPA 5HJLA 1X7IA 2WZMA 1M03A 4PUNA 2ZRUA 1OB0A 3EKZA 3EX6A 2MANA 1VENA 3HJEA 1QWGA 3WBYA 1V4YA 1LUCA 4CVWA 4UTUA 2VX5A 4I5RA 4P7OA 2PWVA 4DJDD 2OODA 1F61A 2PPGA 3O1NA 4QAWA 5F4XA 3VMOA 1R9YA 2E4TA 1OFOA 3SCOA 2XIMA 2WZHA 1TJRA 2V5KA 2QAFA 4W7UA 3TZNA 4X2PA 2NQJA 2R1LA 2VFGA 5T26A 4LRSA 3RGTA 3ABQA 3GDRA 4ASTA 3THCA 1DWFM 1WQ5A 3SFKA 4CU7A 1GOWA 1W31A 3IACA 2I56A 1FOBA 4LX4A 1BG4A 3M64A 3NL5A 3W7DA 1BPLB 3W38A 4ZE4A 3G22A 3RG6A 3N19B 2A0NA 1QI3A 3E49A 5CLWA 3TWBA 5AZ1A 2VDGA 2GJXB 2XIJA 3W7LA 4NAFA 1US3A 1M7OA 1NARA 4YWIA 3K13A 4RLIA 3UJEA 5HMSA 2DZXA 1WDDA 3I3BA 3JRKA 1JCYA 2J78A 3AHVA 3M7WA 3UNDA 5GNZA 1L8NA 4MZYA 1XYLA 4A35A 1EXPA 4GA8A 4LCQA 3W2UA 4WY0F 1XBVA 2PFHA 3ZZ1A 2DH3A 2DUZA 3VGDA 2F2KA 1WDQA 3R25A 4JX4A 3Q94A 4TIMA 1SO3A 2YW4A 1K03A 3IVSA 3VKCA 4H1ZA 3DG6A 4OE7A 4M24A 5J5DA 3EX3A 4AC7C 1Q6RA 3ERPA 1BKSA 1J0JA 3EBVA 1BQGA 2IS7A 1AFSA 1ZALA 4MKSA 3V5FA 3EOOA 3NO5A 4RDVA 1IXNA 3CHCA 4DXKA 1TQJA 3H4XA 2NLIA 4V28A 3PZGA 4JNYA 2J24A 1Q66A 5DN1A 4GNKB 2XVGA 1JZ6A 1GJUA 2NQLA 3GSMA 3TJ4A 1WKDA 3GVRA 3PFRA 4JHZA 3KVJA 3HPAA 3N13A 3FNDA 3MUCA 1AZ2A 3MW7A 1SPQA 4J5NA 2BS9A 2HXTA 1DQUA 2PE4A 3WLOA 1MQPA 3CAQA 2WSYA 3CK5A 3CAKA 2IPFA 2BASA 2BMBA 2XM1A 1NDWA 4X2RA 1E6XM 2CLKA 2D0FA 3L21A 2JKPA 2QULA 1FWWA 3F7JA 2XUCA 2X05A 3LA4A 1BTMA 3VC6A 4NNAA 2ZX5A 3I6RA 4BI6A 1FDJA 1KFCA 4DZIA 4HQVA 4CQDA 3A6OA 1EPVA 3I7SA 2J47A 1KKRA 3FA4A 2V69A 1ICPA 3W4RA 3N1AA 5ABEA 2MUCA 2XG9A 4JN8A 1XWYA 3R11A 1JCNA 1CXFA 1Y65A 3BAXA 3BG3A 3RX2A 5FF0A 1TPFA 1AVAA 4RK8A 4XSMA 1GOXA 2QLYA 2OZ3A 3WBXA 3BAJA 4GE8A 3N34A 4H2CA 3TAKA 1SVDA 2WAGA 2CLFA 1JZ5A 1TE6A 3OZYA 3THUA 3H26A 3CQJA 1B54A 3A23A 4GQBA 4O0QA 1H51A 4H83A 3EA2A 1N7KA 4AVNA 5HNRA 2BB0A 3TQKA 3VU2A 1V03A 4AMAA 1VBRA 1W3NA 3P80A 3FDGA 1K8XA 4UZUA 2PODA 4OT7A 4QNWA 2VR5A 4L1GA 4MGGA 2VX4A 3AMLA 4IIBA 4XZWA 3L7RA 4WDXA 1PTAA 4LVBA 4JN7A 1DHPA 3FGCB 2HBVA 4G5DA 4MF4A 3KHJA 3C2OA 3R5EA 4I7UA 1VFTA 2PTZA 2WZTA 4UFLA 2DQXA 4XZ9A 3RITA 2OEJA 1A5BA 4HNLA 3GAYA 3KBVA 3F4VA 2OWXA 1P7TB 1XRVA 2VD8A 5A8OA 4I7WA 4LS1A 4BF7A 2HK0A 4OU1A 3WH8A 4Q8UA 4Y7EA 2QJGA 2YXGA 1RQBA 3BGJA 2BTMA 5IFPA 1LF1A 1ELSA 1XRFA 2WMJA 3CZKA 3U4AA 4AZ5A 3URNA 3WQGA 1UA3A 1XYMA 4LGXA 1JDAA 3MA8A 3W7QA 4JQ4A 1XRSA 4O57A 4XQ6A 2FHFA 2WWCA 4PUWA 5AC7A 3WLPA 3TW7A 5GJMA 3IVUA 5KTLA 4UB9A 2A3EA 5BOFA 1W1PA 4B4HA 1XH2A 3S6DA 3C2YA 3E12A 3W7RA 1OIFA 3BCFA 1R3TA 1YE4A 3E5BA 1CNVA 2KX9A 1KCLA 3KRUA 3DYPA 5DANA 4JIIX 4WOQA 3QYQA 4UBPC 3S5OA 1XFCA 4DLFA 3NR0A 1A5AA 1TR1A 3LNMA 3TSBA 1TV7A 4IFKB 3WJZA 4UTWC 4GUJA 2PDWA 2NXHA 4QIUA 4XIMA 3BLKA 1ZBCA 5HQLA 4HHPA 4ZBCA 2YFOA 1H5VA 3QOKA 2QYGA 4AC1X 3N12A 1HVXA 1NU5A 1DE6A 1I4NA 2E1DA 2XGBA 3T81A 2ALDA 5I77A 3UG4A 5A6SA 4XO6A 2J7DA 3B8SA 4MLJA 4MB5A 1U22A 2TYSA 2W61A 5I06A 4DJFD 3AIBA 3VCCA 1GG0A 1GZ1A 3S4TA 1V0MA 5DXYA 2QUUA 3QBUA 2Y70A 4ERIA 1RZMA 2YDQA 4CQAA 1HZYA 2WQPA 3W7OA 4KT2A 1WDWA 4L4PA 3E3HA 3QHMA 3SJNA 1ZP3A 5ABFA 2ODOA 3U2ZA 3VNJA 5CC7A 1IR2A 3NUKA 4NKCA 4IMDA 2XWEA 2GK1A 2HROA 3ARUA 2DGAA 4L6OA 1BLIA 4GIAA 1W3IA 2ZX9A 2V6AA 3CZEA 4F0LA 1XIDA 5T9BG 4Z2GA 2YIHA 2ISWA 1U5VA 1UWSA 2WNNA 5A6TC 4PBEA 2IXUA 3K8LA 2YCLB 3CO8A 4PMYA 5AVNA 1OC6A 3LZ3A 1KRBC 1J0IA 4DJFC 4H6RA 3EGJA 2BOEX 3DOPA 2X40A 4R33A 4MKVA 4XD3A 1P6BA 2BGQA 4PUEA 2L5HA 2PGEA 1ZENA 4C6CA 3ALGA 4WEVX 5BRPA 2HCVA 3CWNA 4W93A 1V3KA 1X6LA 1XIGA 2WNWA 3A47A 4O1AA 5C9UA 1JDCA 3ARRA 5FCZA 2PTWA 3FYOA 3LM3A 1JD7A 3ARPA 3UYIA 5EMYA 2OQHA 3UG5A 4KFOA 1XFBA 4PUKA 2XWDA 1LDCA 4R3UA 3DYOA 4NNCA 3WFZA 3L4ZA 2GWGA 2VNCA 3AXKA 1BWKA 1XINA 1YQ2A 4PEEA 1R6WA 2INEA 3CV6A 3R0DA 4D6IA 2AGKA 4A3YA 4H9UA 1GUVA 4DWSA 1X97A 2GUUA 3KUMA 3CB8A 3L4UA 4AD3A 3T4CA 1DWGM 1Y7VA 3BGGA 3UWWA 1FWRA 2CZFA 3USBA 3T05A 4QE1A 2O4MA 3GO2A 4K8EA 1XYZA 2VC5A 4IHCA 5I3JA 4EE9A 1V7AA 3IGHX 3HN3A 3WUGA 4MIMA 2HDJA 1TTJA 3IGUA 4PMOA 4YTUA 3T09A 3VOIA 1CX9A 5GNYA 4P7QA 3FDKA 3COTA 3ZR5A 3M46A 1VKFA 5FJRA 3XISA 5M3WA 3EWYA 3EX4A 4Q4RA 4LVGA 3GVWA 2VM8A 3W01A 1WBHA 1YXYA 3P5YA 2HE5A 3MJYA 3EMQA 2CKSA 4UQEA 1M7PA 2LLEA 1L6SA 1FHLA 2XFRA 3MDWA 1TR9A 2RDTA 4JYEA 2EG6A 3O15A 1LROA 3RPMA 2VX7A 5EA9A 1UR3M 1E55A 3DXIA 4P7LA 1G5AA 4HB7A 4JYFA 3TK7A 3C2VA 4NAEB 3WF2A 1A5LC 1UD8A 2VZVA 4TQTA 5EFFA 1EC8A 4AF0A 4M6UA 3B06A 1UWIA 4HD5A 3SO7A 2CLLA 4DXVA 2PA6A 4O1EA 3P3BA 1R7AA 8A3HA 3ZJ7A 3LCFA 1GKPA 1VAHA 1PTDA 5U7SA 3SQMA 3JUGA 4WSHA 4XZBA 2YCJA 3MZNA 3S6OA 3M5VA 1A3WA 5DLCA 4AEEA 1Z41A 2XHYA 3CEPA 3QW3A 1RY8A 2A79A 4XKMA 4IIEA 2I5IA 4O16A 4E2DA 4YTQA 5ABTA 1QFEA 3TUUA 5A8QA 2J4GA 4DUXA 4UQCA 1R3VA 4D8AA 3C0QA 2HSAA 1Q7QA 4C6DA 4AEFA 1M7XA 2WM1A 5JIPA 3QXBA 4B2DD 1ZS2A 3QC0A 1DVJA 3UVAA 3DYMA 2XISA 2Y7FA 4IP4A 2J7BA 1D8WA 1RVKA 3EDKA 3GXMA 3GDBA 4HHMA 4AHQA 4QDWA 2F6XA 4HA4A 4UC5A 2A21A 1M3UA 1VYSX 3LX9A 4OJYA 3F2DA 3A3WA 2OG9A 2DSZA 3EDDA 3FYYA 4Q8OA 1F8MA 2CCRA 4QX4A 4CQBA 3O2LA 5AHMA 1FH9A 4DF1A 2R91A 2ACQA 1W3HA 4J9JA 4AD5A 4MZ1A 3UBPC 3BH4A 4GUFA 4YTTA 1XJBA 3WMSA 1W1VA 1SJCA 3S2LA 3B05A 4NNBA 4B5VA 4EWJA 3UWEA 5H2ZA 4NZ3A 4WR3A 5E0FA 4PUJA 3CPGA 1YNPA 4CQ9A 2GGHA 3NQEA 5TQLA 4K1WA 1RJRA 3QYSA 4QHRA 3HV8A 1XPGA 4NU7A 5JH2A 3MTWA 3UETA 2F9RA 1UYQA 2HVOA 2FZMA 4Y9NA 2W62A 3UZXA 3W7PA 2C3ZA 3WNNA 4IPIA 3C8NA 4JYDA 1G7VA 1KBJA 5CSSA 1JYXA 3TC7A 3BOLA 1QOQA 3K8MA 4U3CA 2PF0A 1KCZA 3H4GA 5CAKA 4FXRA 2CHOA 2J9YA 3ZWSA 1KO0A 3WEOA 1I1WA 4MYXA 4X60A 4HMCA 2CWXA 2V0TA 5A8PA 4CU8A 1H7RA 1HKKA 1UR0A 1XLMA 3MQTA 2ADAA 3RN6A 2ZDRA 1CLVA 3GBEA 2Z25A 2OKTA 3O3RA 1G69A 1GCYA 5FL1A 3BICA 1VCVA 4JEQA 4J40A 2H3BA 4IT1A 3WH9A 3BXWA 3CUGA 1LQAA 4WJXA 3OG3A 1QOXA 3JZUA 4DWSB 3TFXA 1PIGA 2ZRWA 4AISA 2CLHA 1V02A 4KPLA 5BMXA 1EPXA 3A3HA 4UQBA 3APGA 3WDJA 3CHDA 5FF4A 1FVPA 4G6CA 1W0MA 3G77A 5AC4A 2VL4A 4PUUA 1CGYA 4H3DA 4ES4A 3U57A 1YBQB 5K9DA 1B9ZA 1TPWA 1VPYA 4HZ8A 4RL3A 2YDSA 2NX3A 4O4WA 1TV3A 1XCXA 2X16A 4UTKA 1UP2A 3KL5A 1R85A 4KWOA 2VEGA 1F74A 1EQPA 1EBHA 3DFPA 1XQKA 4M1BA 3QSRA 3WK0A 2ZZ7A 5BOOA 5F2IA 2P3ZA 3WK3A 4OBSA 5G1YA 5F4WA 3MUIA 5AOUA 1U1JA 5F7UA 2I9UA 3KOFA 1JCMP 4LVAA 2OLAA 4G2DA 2Q8LA 3CWOX 3WQWA 5IDIA 2GUBA 1IHIA 2DJXA 3NTYA 1SO5A 3BSMA 4NZJA 4Q8WA 4LBSA 4LW7A 4TV5A 1B31A 5FESA 2DZWA 1MUMA 2HMCA 4J2PA 4CVUA 3AHYA 3MMUA 3VOCA 2E6DA 1WNOA 3N04A 1K9FA 3M0YA 3EWUA 3FCPA 2XFWA 3Q67A 1QNPA 2ZE3A 4DBDA 4Q7IA 2BFGA 1QNVA 1VPXA 2DIJA 3AMKA 1E6ZA 2Y62A 4AZBA 1DEDA 4GYPA 3GC4A 1TUXA 4AY1A 2D0GA 5CPMA 2B31A 2VRJA 2DSWA 1V3MA 1GPFA 3I6EA 5CSYA 1QTWA 3CUZA 3LCIA 4QP0A 3M0VA 1KM0A 2HPMA 3HQOA 1RBAA 1GVEA 4AD4A 5H8MA 1F3TA 2ZXQA 2NV1A 3ATZA 4QG6A 4GOAA 1Q85A 4LBRA 5LIKX 4HNNA 1O7AA 4RE0A 4FXSA 4C6KA 1H7WA 3MUZ1 1EJTC 3U5UA 1EGVA 2YL6A 3WL1A 3NAVA 5HQEA 4B4FA 3TYZA 1B57A 1UWAA 2DPEA 1TYGA 4PYSA 4IL2A 3KLLA 2EG7A 3PK7A 5C8BB 4IX0A 1PAMA 4QITA 1YBQA 4JY9A 1HKIA 2Z7GA 3DCPA 1MDRA 4FLQA 3EWBX 2ZUVA 2QCCA 1HP4A 4LAMA 2B7NA 2YXXA 3GC2A 3C4UA 2XSBA 3KAOA 1HJXA 4EWND 4MTVA 4J3UA 1GVIA 4A22A 1UR1A 1XGDA 5CG7A 5LIXX 1JRBA 3CO4A 4Q8VA 3GXFA 4KRTA 3K1DA 5IFTA 1MZRA 2FZ9A 3L0GA 3ZXWA 4TTGA 3P6LA 2W91A 2OXNA 3TVAA 5HR6A 3MKKA 3ZLFA 1R9ZA 5D4YA 2C13A 4KRUA 1E6QM 3FXGA 4C1LA 2Y8VA 2BDQA 3WKZA 3KVKA 3WLJA 4QSHA 3CT7A 2C18A 3NPVA 3RJYA 4IF2A 4F9DA 4K37A 3GVVA 2JF7A 3M6YA 2BV9A 5EBUA 3LCGA 1KTBA 2X1SA 5CGMA 2Z27A 3B0XA 3LSBA 3BWWA 3SUUA 5IRPA 1GONA 1JI1A 1S2TA 1BF6A 2AAMA 3BMWA 1AJZA 2PGFA 1K9EA 3VGBA 2ICSA 1GEQA 1DWHM 4JL1A 1WB0A 3CWHA 2Z29A 3PWGA 1JIBA 3KOZA 4GKLA 1X39A 3PJUA 1KM6A 3W84A 2QCLA 3QF0A 2UY2A 3QMSA 4IX2A 4HK5A 3GTNA 4Q33A 1CGUA 2XZ7A 3R89A 4XD5A 3GW3A 1WZAA 2BGSA 3KTXA 1EWDA 1TRDA 2X1UA 3DKLA 2XGIA 3EOEA 3CAVA 4K7VA 4GBUA 4WKAA 3UA4A 3MSYA 2D22A 2W4XA 1WOBA 1FCVA 3WLKX 3RDKA 1L6FA 3KRBA 1O12A 1LG2A 2J88A 2QCHA 4UTHA 1F9CA 3FYPA 4ZOAA 4ATLA 3FEMA 4PTMA 4Y96A 4F2UA 1A0EA 2WHLA 4Z1YA 3E2RA 1AA1B 2YPIA 1CB2A 3VGHA 1ODUA 3NDOA 1TWWA 4FIQA 3N9KA 3WJSA 2OSWA 3WL0A 1HKWA 2Y0FA 1W2VA 3S5YA 1LOSA 3PPHA 3IJ7A 1BXNA 1MRAA 2GSEA 4AHOA 5A2CA 5AFDA 1V51A 5CZKA 3IRDA 1RVGA 3QV6A 1UUQA 1OG0A 3IGSA 4ERGA 1BQCA 3GW0A 3N3TA 3OVRA 1DYSA 4J2MA 4PN2A 1TWDA 1FP8A 4KKXA 1XF0A 1W17A 4JZ5A 4JR5A 4ACZA 1V93A 3L5LA 1W2PA 1QI2A 5AECA 2EXOA 3FK4A 3AOFA 2XH7A 1XUUA 2AKZA 3RLHA 3CC1A 1J12A 3I65A 4EOUA 1MXSA 3T0CA 1SMAA 1JYWA 3ZMRA 3WG6A 3U3HA 5HWMA 3K46A 3AMCA 1MNSA 1QPQA 1Q8AA 3C52A 5EMJA 4HSOA 3KVMA 1DXEA 3LB0A 1IGSA 4K3ZA 4DB7A 3LHWA 2OLSA 3EX1A 2DUXA 3PUEA 1GYNA 2VRQA 1SFTA 2PD9A 4PEKA 1G6CA 4Q6JA 1S5WA 1P43A 4XKYB 5AYZA 3LK6A 1ZBKA 2O56A 4A3HA 3GQYA 1MMFA 1S5VA 1NFGA 3VIFA 1CPUA 3AU2A 4JNZA 3P0XA 3GRIA 2V30A 1QR7A 3C6CA 2A7RA 4KH2A 2WCAA 3PHAA 3TTYA 2C0HA 4W4QA 3CBWA 3M6DA 1ADOA 3T44A 4F2BA 5BCAA 3GXTA 1XBXA 2FZBA 2TMDA 1H7XA 3ENLA 2QNEA 3HQPA 5D30A 5DELA 4AU0A 3U9IA 3OA5A 5LA1A 4HNCA 4AYGA 1QPOA 4P8VA 4WSKA 4FF5A 4BS0A 3S1VA 2RJGA 5AN7A 1J2BA 2VC7A 4L9XA 4GD0A 3OB8A 2H9AB 3MANA 3FIGA 5A94A 1UASA 3OBEA 3VI2A 4GPNA 3PBUA 1E71M 1HO1A 2OLHA 4RCXA 2Q02A 3OODA 1VH7A 1ZL1A 1RJPA 5LKYA 1B5TA 1JYVA 1G4SA 1VRDA 3E2QA 4PL2A 5HMDA 2VCAA 3VABA 1RCOB 2V82A 1IEWA 3LRKA 2R1MA 3CM4A 3BL3A 4H04A 4UXDA 5HMEA 2VUYA 3R94A 4FS9A 1O4UA 3PB0A 4N02A 1FWJC 3RMJA 3U7BA 1HKJA 4C65A 3BAYA 3BSHA 2C6QA 1M04A 4O4VA 3KOXA 3WJWA 4XZNX 3PY2A 3HURA 3CL7A 1JFHA 1XH0A 4JTQA 3WLRA 4AD1A 3QHNA 3GFYA 3M5ZA 1EB3A 1E40A 2FGZA 1RY0A 3OLDA 1GZJA 1X98A 5JBFA 2PWDA 3W1QA 5MKGB 1GYMA 3UF9A 4CD7A 4DJDA 1E5NA 5JIWA 4DX3A 4YL2A 4OFCA 5DBTA 1ITCA 1CECA 3W1XA 1NOWA 1BYAA 2VJXA 1XQLA 3AIUA 4JAWA 1YPFA 2Q01A 4F40A 3W7EA 1EO7A 2V2DA 1XSIA 4DPPA 4BI5A 4ML9A 3QR0A 5LIYX 2R1NA 3KCJA 3MT1A 3ZOAA 1CXEA 4RX0A 2Y1HA 3PBMA 3ABRA 3CIVA 4M29A 4GI4A 1E4IA 3PUGA 5I2UA 5I0DA 3CV7A 2BVDA 3VTRA 3KBWA 1MVYA 4DJDC 2OVLA 4P8UA 3NPWA 1M01A 2WO5A 3LXBA 1OYBA 2ZRYA 4AXNA 3GU9A 2QCNA 3L66A 4GLEA 3AZTA 4W5UA 4DHGA 3VAVA 4ZQNA 1YTDA 3GH7A 3CH9A 2PDGA 1C8XA 2I16A 2G3NA 3BW3A 3FAXA 1AK5A 4A29A 2ISSA 3ECQA 3MUY1 3TXVA 4GXPA 4PCNA 4OKDA 3LY0A 4KGJA 4ACYA 4QM1A 3RMEA 3BQ5A 2QPSA 4UR7A 3W53A 4C6IA 3DFSA 1OX4A 3WEZA 4GMEA 3WMLA 4BZYA 4JEJA 1AH4A 3N2BA 1X7FA 1RSCA 3DENA 2XTKA 1H1NA 3O6CA 3M16A 2PDPA 2ZZ2A 4AZCA 3LPGA 4N9DA 1MQRA 1AQHA 5B7ZA 1GEHA 4LUYA 3URQA 3B0VC 3TCSA 3MUXA 4GVHA 1LTDA 2BY2A 1OFBA 1SJDA 5CZTA 2JBMA 2YZ5A 3S5ZA 1G94A 2Z1BA 2V3EA 4ZOBA 3OJGA 4O52A 2QR6A 1O95A 2CZVA 1F07A 4FP1A 7A3HA 1KV8A 4RPPA 4XUYA 5DFAA 1D3CA 1Y5VA 2CBUA 1JQXA 3WDHA 1ZU8A 1XIEA 4DBUA 2DIEA 5D2TA 4A8RA 2YBVA 1UZ1A 4J1OA 2WBKA 3GTXA 4GG9A 1DJIA 1DXIA 4HN4A 4LBUA 3FKRA 4FO4A 4PCTA 4C6MA 1KR0A 1C90A 2RGLA 2DVTA 1VLIA 3AIWA 1REQB 6A3HA 1K6AA 3T2OA 4QJ4B 1ZBVA 3L68A 3ZVHB 2OWCA 5DCEA 2PP3A 2HNEA 3B8UA 2WCSA 3NM3A 3TA9A 1EKOA 1HW6A 4QCEA 2PD5A 3H22A 1LUCB 1E1CB 4FR1A 1RA0A 5G4HC 5HNTA 1A3XA 1I0DA 3N2CA 3R0KA 3E1F1 2BOGX 5AHFA 4HTBA 4MUPA 4GO8A 4TXEA 3SCWA 1EOKA 5BU9A 3KCLA 4CNTA 1EJSC 1OCJA 4LV4A 4XIAA 4AX7A 5GVJA 1OT1A 1T8QA 3ABZA 1GOIA 2WK2A 4I6VA 1PKMA 3RJXA 2OYLA 3VIHA 3T0AA 4B3KA 1E0VA 1XPYA 4GH1A 2WXDM 3CYVA 1VFUA 1BRLA 1VR6A 2B7OA 4GYFA 3G6MA 4L4MA 2UWFA 1TB3A 4XG1A 4BQ4A 2V5JA 1XLHA 1QNSA 3SZ8A 1A80A 3CQKA 1JEZA 2TRSA 4A4AA 2B7PA 3R10A 1R3SA 2QDDA 4ADTA 3N4EA 3VKBA 2FJUB 1I2QA 3H2AA 4PBFA 1EDQA 1VFLA 3W1NA 3MYPA 3BOFA 4MB3A 1EUNA 1QW7A 2CW6A 4I5UA 3GDTA 4DNHA 3VGEA 1EGZA 5E5CA 1UKOA 4UFHA 5A8GA 1B3OA 3G0SA 2XYLA 1VFFA 4Q8PA 3W2NA 1VS1A 5G5IA 2BHUA 4S39A 1DBTA 3KHDA 1PZ1A 1O5XA 2J13A 3VX0A 1J2WA 3AIVA 2PWEA 1I2OA 5A8NA 5BXPA 2C19A 2WJFA 2VI0A 3EXRA 4S3EA 3WJYA 2CZ5A 4BQ2A 5DRCA 3EEZA 1V6TA 2P0IA 4IJCA 5J8LA 2QVNA 3VKJA 2A7PA 1BEUA 5LIWX 4D6FA 2WSKA 3GNRA 8TIMA 3M5YA 1EH9A 1O1ZA 2QJHA 3OTRA 3CQHA 3T8QA 3T42A 3O7UA 4B3ZA 3LTYA 2O7QA 2QCGA 4US5D 2FPYA 3L0KA 3TH6A 1N2VA 2X0SA 1ZZMA 2VEMA 4JS3A 4BR1A 3RHGA 3S9IA 4CUCA 2G5WA 3LMZA 3GKAA 3LM7A 4B5SA 4MADA 2AMXA 3RAOA 1HL2A 3VKAA 4U5KA 5CCZA 2BWGA 3BURA 2OELA 2NUXA 2Q8XA 1W54A 1OT2A 2QJMA 4HZ6A 3CEUA 1NF0A 2ATMA 2Y7DA 4GI8A 4HYWA 3VINA 3TTEA 1E9IA 3W6LA 4KCWA 1XG4A 1KM5A 3KZSA 5D9OA 4J35A 3VKKA 1F3EA 4DF0A 4F9JA 4G7EB 2GGIA 3TU9A 1CXHA 2YZRA 2Z2BA 2YA1A 3W7NA 3WCZA 4WDWA 4NJGA 4QS6A 2DZVA 1M41A 3KBNA 1H5YA 4CCZA 5HBFA 2MNRA 1QOPA 1ECQA 3EB4A 1EIBA 3NM1A 4ALDA 3QOMA 3ITTA 3UZ5A 1IZKA 1ZBWA 1V3HA 3NDZA 3GR8A 2EQDA 1V6UA 3O6AA 1RR2A 2C8NA 1ZAJA 1HL8A 4F0SA 2W0UA 4DI9A 4AZIA 3A5VA 1H3GA 2Q71A 4HBKA 1QPRA 3TN5A 3L4YA 3GHTA 2QIWA 1LT7A 4IMAA 4FA3A 2ABAA 4O0KA 4UNKA 4GFSA 4I90A 3ARSA 3P62A 4Z1AA 2W66A 4FB7A 5I24A 5CC6A 3TV8A 5BROA 4DWSC 1WX0A 3D5HA 3GTIA 3VOFA 1DJHA 4RDYA 2OEMA 3KRSA 2ZUWA 3OYXA 3WUEA 3ZT7A 2XH4A 1K7EA 3ITYA 2O9PA 1UKSA 3PR2A 3H21A 1UR2A 3PZMA 2J7EA 1L2UA 1W3KA 2DVXA 3BARA 1T40A 2Z4GA 3QH2A 3ONCA 1AJ0A 1F6PA 3OLEA 4PMJA 4I7VA 4O1CA 3TTQA 1ZLPA 3CHVA 3B8WA 1W5PA 4JDBA 1EJXC 4KWWA 2VVNA 2B7QA 3OLIA 4HCHA 1TJ0A 3NA8A 3IIOA 3W74A 4E4UA 4QTGA 4DJFA 3A24A 2QCDB 4QR6A 3UPWA 3R0UA 1EUAA 1ZFJA 3UWYA 3RXZA 1AW1A 3ARQA 3K4WA 4MB4A 3EA3A 1IZJA 3UZYA 2DT2A 1D9EA 1WAWA 3PZQA 2Z1VA 4NSBA 4XV0A 5AHEA 2VEFA 3N4FA 2OYMA 3L23A 3WSUA 1BYBA 2EPOA 3U4FA 5EL1A 1IQ8A 3WF0A 4BEQA 2WKLA 2PLMA 2G50A 3ZO9A 4MZ8A 3CB3A 3POHA 1NP2A 2GJRA 2XVLA 3CZ8A 3GM8A 4PZVA 4KETA 2CLPA 4AHPA 2RKXA 3RM9A 4AWUA 2BY3A 4YVXA 1QRQA 4XZLX 3P7YA 3LHYA 3D6NA 2VHLA 1XLBA 1EDGA 2WC3A 1O68A 3DI1A 2WVVB 1T5AA 1F6YA 1MZHA 3NJ3A 2CZEA 4IMGA 5JBDA 4TVUA 5AKQA 1TPB1 4O54A 1YRRA 4UIOA 3BK0A 3NZGA 4KQNA 1ONWA 1IEQA 5CG0A 1OFDA 5ENLA 4G1NA 3W3OA 3BLPX 5IBXC 4Q8QA 3UCCA 5HA7A 9XIMA 3F1QA 5FF7A 2NZLA 1KM4A 1R3WA 1CXLA 2WHMA 3Q45A 2HXUA 2E6YA 2VDHA 4HP5A 2C1GA 1FBAA 4IMCA 3NDYA 1K02A 3S0CA 4C1KA 2DORA 3TAOA 3VUPA 1EJUC 1ESWA 2WWDA 2WYSA 3ITCA 3TYDA 2AL2B 3LXCA 4D6JA 3N6QA 4W84A 3K8KA 4CNSA 1XICA 1N8WA 3EAUA 1QXLA 2A7NA 5E1QA 5EU9A 2GWNA 3I6TA 2FZNA 3LI0A 4AB4A 2RFGA 1QI4A 3AXXA 3K30A 1W9XA 5A6KA 4IG2A 4FALA 4LC8A 1JDFA 3WEMA 1EC7A 1LL7A 4CGTA 1IWAA 1US0A 4XTIA 3NOYA 4RV3A 2WBGA 3PN8A 2UBPC 3SI9A 4CEXC 2ZWZA 1HN1A 3CZLA 4LNCA 2OX1A 3GHRA 3VZYA 1HFBA 3MUAA 5M17A 3W1UA 2V3FA 5AY7A 1TELA 1A53A 1RPKA 3A64A 2BG5A 4GWEA 3DI0A 4GUGA 2V5CA 1HIZA 4V1XA 1S2WA 2E7FA 1W9BM 1J79A 1RHCA 2VD9A 3KBJA 4B5WA 4MAVA 1XG3A 1W91A 3C0JA 3DEQA 2JIWA 2Z7KA 4D1IA 5XINA 4GY7A 3LPPA 4EAYA 3CHEA 2HE8A 2ISFA 4GO9A 1E1CA 3L4TA 4OGZA 4BKNA 1E4NA 4C1NA 3CZGA 4ILSA 2GOKA 5CGTA 4LYPA 4N2YA 3WMCA 2R82A 3BJFA 4F0KA 4QAIA 1XDJA 4J3TA 3WX7A 4QROA 2VWTA 3BLFA 4DJEC 4FEZA 3HGRA 1FHDA 2F61A 3T6CA 4XB3A 2XU2A 1CZ1A 1PZ3A 3W7JA 4M81A 4CU6A 4NG3A 2IQ0A 3MBDA 1YADA 4UFMA 4IJBA 4FLOA 1SZRA 1CENA 4JIHA 2NQZA 2Q3RA 1XLAA 4F3HA 3MPGA 3VXGA 1RH9A 4DJEA 3WFAA 4MB1A 4E0CA 1H2JA 3XINA 3PJTA 3VE9A 4WDUA 4A8LA 1SJAA 2GFTA 1KTNA 3ID7A 1V3JA 1WAUA 3M4HA 1K6WA 3RILA 3FW6A 4BWLC 2B0MA 2DT3A 4HOXA 1GTHA 4PRTA 1UCWA 3H24A 1W37A 1E1FA 5C5YA 4AWSA 1K4HA 1IEIA 1FWIC 3DERA 1QNRA 2R6OA 1VP5A 1E4LA 3J7HA 1DQWA 2PSNA 1XGZA 3H7UA 1UBPC 1W32A 3AZSA 3UCQA 1LRTA 3BMVA 4NJJA 4LAZA 4DJED 2HTMA 4CNOA 3MV01 5A3HA 2QDGA 2VX6A 3BAKA 5DF0A 1M1BA 4WKHA 3SDOA 5H6HA 3UZJA 1Q65A 3LRLA 4UQAA 3W2JA 3ORWA 1UD3A 3BZJA 4WZHA 1XCWA 3DX5A 4WJ8A 1RBOB 8RUCA 4AW7A 2PRLA 1Q5MA 1P4CA 3W2LA 1TVLA 4ZQPA 4A3QA 3IJDA 3UD6A 1R3YA 2Y89A 3HM7A 3LHVA 1XSJA 4W7VA 4O11A 4ZENA 4PMQA 5K2ZA 1E0WA 1AH0A 2ZTKA 3UFYA 1H60A 4PBGA 3A13A 4IFRA 3CMFA 1AQFA 3T0TA 3UG3A 4B9YA 3BO9A 5BXTA 1PX3A 1FWNA 3TE9A 1SGJA 3UZWA 4C90A 3T07A 3ZLGA 4HT3A 2OJPA 2BHZA 5C6MA 3UXLA 2YCEA 3AWNA 1G01A 1V3LA 3AZRA 1T96A 4JXCA 3WJXA 3N4AA 1I75A 3QC3A 2E68A 3IAPA 4MPQA 1OZQA 4AD2A 3LI1A 3SGGA 2ACRA 1SSDA 5EMUA 1OD0A 1E51A 2KAUC 4GJIA 3W1LA 4YYFA 1KCKA 2FMOA 4IGSA 3R8GA 5H91A 3W22A 3Q2DA 5AYBA 6XIAA 3F5LA 3VFLA 3SCPA 3F4CA 2AL2A 1PL9A 3MO4A 4K1GA 4YHGA 2PF8A 3PP7A 1SW0A 5EGRA 1KTCA 1HTIA 3KE0A 1KBIA 1TWZA 4DN1A 2PDHA 4GYJA 4F2TA 1AW2A 3L65A 2E5CA 1KBLA 3AJ7A 1G4TA 5DO8A 3QM3A 2WVVA 4XBKA 1Q7ZA 4TV6A 3NVDA 4H9TA 1KBBA 2J7CA 3KWSA 1LRQA 5AYYA 1WKYA 3DBPA 3OVQA 3GH5A 3G1AA 3UJSA 3SM0A 2HVMA 4D9PA 4C6EA 1QT1A 1PIIA 1SMDA 4PMRA 1FRBA 2ZFAA 5HWNA 5T91A 5EY5A 1JL8A 1WUEA 1PPIA 3IS4A 3PPGA 2WLYA 3V35A 1Z8AA 2NXGA 1CGWA 1Y0EA 4UQ9A 2ZCGA 2Y8KA 1TPUA 2BBFA 1GOOA 2CETA 3SCTA 1ISYA 1RV8A 2CHNA 4E5TA 2DZTA 2BP1A 3DU0A 5BRBA 3HGJA 3MP5A 1HT6A 4AQLA 1UZ4A 1QHPA 4PULA 1CBGA 4XISA 3R8RA 1ISWA 3CIXA 1C3FA 4DO7A 4M3PA 1EF3A 3PS7A 1ONRA 4QG9A 1YTEA 1AQMA 3W25A 3EKGA 3C8FA 2PS2A 2C15A 4TUFA 5D9PA 3W1MA 4U2ZA 3CL6A 3N3MA 2QPXA 5D37A 3HV9A 2E25A 1QJWA 3OGVA 3KM8A 1HNYA 7TIMA 2QPUA 4S38A 2R9RA 4FIRA 4O13A 3NQ8A 3ZR6A 4WGXA 4GYKA 4JL2A 4BCEA 4OOZA 1P6CA 4KCUA 3L12A 4NRRA 3ANYA 1OM0A 4EIVA 3OP2A 2NVAA 3MCNA 3DHFA 1OD8A 4NXKA 3FHQA 4H19A 4NVTA 4MUZA 1WXYA 5L6UA 1UIPA 3NXLA 4FNSA 2DZPA 4ZEPA 5J5RA 3SUSA 3VD9A 1W1YA 2WSRA 4Y8FA 1M5WA 2O9RA 3DESA 4EPDC 1MEWA 2F8QA 4FLRA 4DVOA 2NSXA 1RLCL 3STEA 1R47A 4HNVA 3W72A 2Z6JA 1FCUA 2F7FA 4PRRA 3P61A 2PDUA 3WMBA 1R46A 1HKMA 4M51A 1R5YA 3VGGA 1PX4A 3RK8A 4MWAD 2JK2A 4XD6A 3OYZA 1WDPA 1WBJA 4KCTA 3VD3A 4ORMA 1PKNA 4PGLA 3RCYA 1GKQA 1HL9A 4PCPA 2CBJA 3LPFA 1BAGA 3KBMA 3KLKA 4ADSA 5FJUA 4CQ8A 4GX9A 2OZ0A 1LT8A 1VBGA 1E72M 1ZJBA 2VFFA 3TTSA 3WD0A 4GVGA 3UWUA 3APTA 1MWOA 4D71A 2W9MA 3ZFHA 1F05A 1KBKA 1IT8A 3MSRA 5GQBA 1MUCA 5BWAA 5A69A 4G7EA 4AVFA 2PDCA 3C56A 1E3XA 2CZDA 2W92A 4ATWA 4AY7A 3A5FA 1J4EA 4PL1A 3FOKA 3SY8A 4QG8A 4JY8A 4NHVA 4WK9A 4ZVJA 4R88A 5M1TA 2XIQA 4HMEA 1AD4A 4HYVA 1AQ0A 3RU6A 1NF7A 4L1WA 4JX6A 2NT0A 1XLJA 3MMTA 2VZSA 1RP8A 3U6WA 5E9XA 3S2NA 4INFA 2NV2A 1V5XA 4FSAA 1D2KA 4LUIA 4AFYA 3REQA 3NO3A 1U33A 3NZPA 1M53A 4KEUA 1FWDC 4FOUA 5C55A 3B03A 2TODA 4TU1A 5KMYA 2Y8UA 4Q4PA 3T1GA 1AMKA 3JR2A 3OU8A 1T8XA 1FH7A 4HNOA 1NQKA 4ICCX 4OVXA 2REQA 3LXAA 3DAQA 1JUKA 1FY6A 4P8XA 4HZ7A 2VCCA 3M44A 4F79A 4N9BA 3MKVA 2OX4A 3CZJA 4D8ZA 1PYMA 4IFKA 5HATA 1BVZA 4A05A 3ARTA 1ISZA 1MI3A 3GIYA 2ZTJA 1NWRA 3WNPA 4CCEA 1OYAA 2I5QA 4JFVA 3P5ZA 3NQAA 4NP7A 2WMHA 5GNXA 1C9DA 3QY8A 3PBYA 1E6RA 1ZCOA 5DX7A 4H8UA 3HFYA 3FJ4A 1BXBA 5HPOA 4DM1A 5I7GA 4PFHA 2F2HA 3P81A 3UR5A 4I6KA 1B30A 1Q4WA 1E6PA 3EPMA 3L4XA 3PZNA 2F84A 1DV7A 1OY0A 3KBSA 3F4DA 1CLKA 1VFHA 3PM6A 2XSXA 1H11A 4E4FA 2IMRA 1TVNA 3THDA 1PV8A 4ZTXA 1KFKA 1GHRA 2UY3A 1JPDX 5I23A 1PKYA 1FFQA 3DFNA 1R7OA 3GVGA 4FNQA 2REQB 3I7RA 1KLYA 3N2OA 1GVQA 3TTOA 1E6NA 2PWGA 3V4BA 2X30A 2FZ8A 1L8PA 1Y5WA 2O9TA 3ITGA 2QJNA 3HG4A 1OWQA 3UR8A 1TJ2A 4ZFMA 3TFCA 2X2GA 3PUDA 1JRCA 3V75A 2E6AA 5D09A 4K8HA 3JS3A 1US2A 2GOUA 3LQLA 1H09A 2QUNA 4HMDA 3S1GA 3E38A 1JZ7A 1H1ZA 3IARA 4K2SA 3UA3A 2E77A 4FXJA 1QUMA 5G1TA 4EANA 3IK2A 4I8YA 3E5PA 2CLIA 3VOHA 5K9CA 3UU0A 1WKEA 1N8FA 3LDVA 3CPUA 2NW0A 2FKPA 2ISVA 3EWDA 1NM9A 1YDYA 3O63A 5A2BA 3MZ2A 1KLZA 4J7RA 1EXBA 7TAAA 3NG3A 4BQ3A 1KGWA 3MDUA 2NQ9A 2ZUTA 2QCEA 1W5QA 3RM8A 4WRHA 3C3NA 3A4WA 3H2CA 4ZO6A 5DY2A 2E5BA 1SJBA 3HOJA 3DC8A 3OIHA 5FAJA 4O1FA 1P1XA 3LGDA 3AS0A 1J96A 3GUWA 3CXOA 2ZICA 4QDPA 3WQPA 1YKWA 2WJDA 2ONEA 1Q13A 4J3WA 4R5EA 1P0KA 4NUWA 4CN6A 4AH7A 2GL5A 4Z1DA 5KSWA 3TCEA 2ZBTA 1AD1A 3MB9A 2ZOXA 2WMKA 1ML1A 1MFUA 4NX0A 1A5CA 4HJFA 3UNTA 3MBFA 4Z2IA 4E2VA 2GPTA 1AMYA 2XDFA 4KERA 2VCBA 1LBLA 2H6RA 3VOGA 2OYKA 3WFLA 1UP3A 4UWMA 1EX1A 5TD4A 5CKSA 2DSUA 1EYEA 4M82A 1XBYA 3LCWA 3LPOA 2RDXA 4H00A 1KFEA 2NWSA 4ZA0A 4OWGA 2WSPA 1YX1A 3G1XA 2P8CA 3ARXA 2P53A 3KL0A 1VGAA 1S1RA 3II1A 4OUIA 1XSKA 3CLWA 3GIPA 4M6PA 2EPLX 1XIBA 3FFSA 1LWHA 1POKA 4TMBA 4HMNA 4UFKA 3G0XA 3KP0A 4XSLA 1BTCA 2OO6A 1QU4A 1VHCA 5LA2A 1NY1A 3UXDA 3RRXA 3IIVA 1UUOA 1EHAA 2Y24A 4REQA 4HK6A 3URAA 2YOCA 1DXFA 1J93A 3LN3A 4PMVA 1GJWA 5LNUA 1LL6A 2VP8A 2ZA1A 3HMCA 1UD4A 1Z32X 3GYEA 1R86A 1LORA 1TE1A 5KZMA 4WVXA 4XAFA 2DVUA 4FNTA 2DDXA 4NL1A 1VD6A 4RNFA 3FSUA 2ZVIA 4EP8C 3AAMA 5CSUA 1WDRA 2J6VA 2VR2A 3R7MA 3VZZA 2PTXA 4IQJA 4IWWA 4H2HA 3PTMA 3SFWA 5I6SA 1W9VA 1XGEA 3R43A 4FF7A 3C86A 4N9EA 4LF1A 3LBMA 2HEJA 2H8XA 1ITXA 1TVPA 1GYLA 1XUZA 2YSWA 4GC4A 5A1AA 3TMQA 4W8BA 3QGKC 4U5IA 2DT0A 1GORA 3KS5A 5I03A 1KXQA 1LBMA 1C8YA 3MVTA 1Z7AA 3GNDA 3SAZA 3S2CA 3AYSA 2GVEA 1UPMB 4J3ZA 4J27A 3DKJA 1PCKA 3EXTA 2DU2A 1E56A 3UG8A 3RIKA 3LCXA 1J6PA 2PDYA 4QDMA 2OPJA 4HKPA 3N17A 3H6OA 2PRMA 4B5UA 4AF0B 1M68A 3WD4A 1BFNA 5I5RA 4KBXA 5C7HA 3RM4A 1V6WA 2DIKA 3W07A 4JKMA 1X38A 1FXQA 1U5JA 2A3BA 3ATYA 1P0EA 3IJQA 1PCWA 2G0WA 3TZFA 4EF9A 1BG9A 2CKRA 1I60A 5C70A 3G1SA 5F2LA 3TN4A 2FH6A 4MJ2A 3QQ1A 1C7SA 2AMGA 4MLRA 2G3FA 4L4LA 3U2CA 1XLIA 2JIEA 2P76A 4UTMA 5FSEC 1OVDA 2FB3A 2FYMA 3DZ1A 3GBDA 1C9WA 1GKRA 3VDHA 1FDYA 4X0VA 3VM7A 3NQMA 2BNJA 1Q7MA 1TTQA 4B15A 1B4EA 2WHKA 1ZQ5A 5BW6A 4Z2KA 3TNOA 4NZ1A 2PEVA 1IGWA 4EK7A 1JULA 3QW4B 3PUOA 4LRTA 3VILA 4MY1A 4ECLA 3HB9A 4RZ6A 5CPLA 3DHUA 1NDVA 1XLGA 1KD0A 3O0KA 3GXPA 3JW7A 3W37A 1CB7B 3GAKA 1UZHA 1KFBA 3RRAA 1LOQA 4PTNA 4Z2HA 4CNPA 4RUBA 3CL8A 1GGOA 4UOZA 1KFLA 1YDNA 1UW9A 1W8SA 1TTIA 1RK6A 5LSMA 4QSFA 1XIMA 4WOZA 2FVLA 1TWSA 5LXEA 3TX9A 1SR0A 1EFZA 1BWVA 4JNMA 1OFAA 1ENUA 5C71A 1VEOA 1EZ2A 1XD1A 2AOSA 4QS5A 3TN3A 1F7BA 1RQEA 4C7GA 3GG8A 1UWUA 1OFPA 4POCA 1A3HA 4PCSA 4JHOA 1RALA 3JVAA 1FWTA 4S2BA 3LOTA 3TLLA 4NIRA 4JCLA 3SURA 1U2YA 5G2HA 3B0PA 3ITXA 3NQ7A 2RDUA 4CLMA 5HAOA 3B3DA 1IZCA 1S5NA 5JQ9A 3IEBA 3W1PA 1SZNA 3V1PA 3KDOA 3FA5A 4G9PA 2AAAA 1DIEA 2YXOA 1SU5A 3H70A 1XL9A 3M7SA 2BZNA 3QV9A 3A4JA 1QK0A 3NL2A 3EDEA 5A6MA 2EJAA 3NZRA 5E6ZA 3GY1A 2VZTA 3BCDA 4JTLA 4NXSA 4NZ5A 4HOZA 2HRWA 3U2OA 1DE5A 3UGRA 4JTKA 2NV9A 4LVFA 2CERA 4KWUA 1X6UA 4H41A 6TIMA 3F5KA 1GZGA 1PEZA 3SB0A 4ZB2A 1WZMA 1Q6EA 3S1UA 1E9LA 4REQB 3U48A 3ZSTA 1KW1A 2YL8A 6XIMA 1W9UA 2POZA 1NVMA 5GJNA 4CN4A 4FOJA 4ZGYA 4LQ1A 1R8LA 2CHRA 2WMIB 4DXXA 3GDMA 2J25A 3MS8A 3H2EA 1S5MA 4RE3A 1XCFA 4GACA 3LHZA 3NQ6A 3DHPA 3T2PA 3WUBA 3CUFA 3OVPA 4BI7A 1SFLA 4HU4A 4WXYA 2IPGA 1GK8A 1IYXA 4C6FA 1NQ6A 3NWRA 3UXAA 2ZIDA 2G3IA 4DYKA 1UG6A 3HZ3A 2A3AA 4JTTA 2TPSA 2NT1A 3ICJA 1TPEA 2VOMA 2ZDSA 5DMNA 4GJ1A 5CZ0A 1JF5A 1X96A 4ZODA 3DIPA 3P93A 4CCDA 4P8WA 3OGRA 3BLLA 4NI3A 3AC0A 4Y90A 1H49A 2OOFA 2Y63A 1I1XA 1A47A 3GNXA 4H7CA 1XIIA 2OOGA 3STCA 3IJ9A 4MSSA 4DRSA 1B3XA 4JFUA 2NUWA 2GUYA 3WDRA 3SGZA 4H6QA 2EGZA 2YA0A 2JQXA 1BD0A 4PTDA 3CHFA 4JTUA 3B97A 1Q6DA 2KZHA 1VQTA 5REQB 5KZEA 3WNMA 1U30A 1NAL1 4PTXA 3ZQ9A 3PG8A 2G96A 4UTJA 3NFUA 3E74A 2QJJA 4ZR8A 4MDOA 4MJ4A 4U3AA 4PA8A 3SBFA 1U1HA 3L67A 3LCLA 3OIXA 3TC6A 4GCAA 1DL3A 1ITQA 4GZIA 2C91A 3MY9A 5FIPA 4NRSA 3UP8A 3B0UX 3SY1A 4G1KA 2Z1KA 5IHRA 1WP6A 3W6MA 3B8VA 4PB3A 3AO0A 2OKOA 2DSVA 3EDFA 1UA7A 2P0OA 4KEVA 4W87A 3O07A 4MPKA 3LLXA 4OUEA 4IFOA 2RDWA 5HANA 3HGSA 3RYSA 3ZM8A 1ZB5A 3IJIA 3O05A 1SW7A 4PB4A 3FHAA 1GQIA 4X9SA 3W87A 3TYUA 3W85A 4JQAA 2O7SA 2V3DA 4Z1CA 1J5TA 1DKWA 3TR9A 1QK2A 2D2HA 3QFWA 3UWZA 1OINA 1PB0A 3W83A 4IXXA 2PDNA 1DJGA 3VFCA 3CU2A 1P48A 2A3HA 2D20A 3I3EA 4MNMA 3VNKA 4OQVA 2G3JA 3MHUA 1X6NA 3TW9A 1AUSL 4OBTA 1TO3A 2X2YA 3HO8A 5CBIA 1D7FA 5TIMA 1BWLA 3GB6A 4KWVA 5ECUA 4ZQCA 4YXGA 3P2VA 1XBZA 3PAOA 4A3RA 2V5DA 4AZCB 4C60A 3BUVA 2VT0A 2P3EA 4A6GA 4MYAA 2OT0A 5REQA 1V08A 2PDIA 1TZ7A 1OADA 1TJPA 5DBUA 3VUSA 3OW1A 2J8FA 3TR2A 5AVHA 1JCXA 2G97A 1OF8A 3H23A 3OZPA 5HWJA 4O1BA 4LSBA 1FWAC 2J77A 1AL8A 3HGOA 3AQUA 3NZQA 2VTFA 4C6JA 3NQDA 3EWXA 3E0VA 3GS6A 4MJZA 1UQZA 3K4AA 3HJZA 3ARYA 3G1FA 1FFRA 3LHTA 3WNLA 1XLFA 1P1MA 4IGMA 1IT0A 2IQDA 3M0JA 2R1KA 4NT0A 3W0KA 4J3XA 4O18A 1NDZA 3PBGA 2J27A 1FH8A 3M5XA 4AYSA 2VRKA 1JF6A 5H1WA 3K5XA 4NJIA 3HPXA 5I3IA 4ADUA 2DZAA 3NIYA 4NYUA 1EP3A 1VFMA 4G7FA 4PE8A 2WQDA 1HJVA 4DO4A 2G4JA 2ZYFA 1VB9A 1SO6A 1XYCA 2DZUA 4Y9AA 1EOMA 2GVLA 1DIKA 1KM1A 3BJSA 4UTTA 2WMIA 1HP5A 2QT3A 3BW2A 4GBDA 1KXTA 4FMVA 2ZVRA 3TYCA 4DZ5A 1TIWA 2FTYA 3WIJA 5AYIA 4MNJA 1LCOA 4FR6A 4HPHA 1TMQA 4CD6A 1EO5A 1ISVA 4S1FA 4JICA 3ITLA 5A6AA 4JN6A 5DMYA 3B8TA 2DSKA 5HPCA 4DUWA 1AJ2A 1JGMA 1QPKA 1OGBA 8XIAA 4P2VA 3GHUA 4LVDA 4B90A 4LB4A 1Z42A 1C8QA 1OC5A 3TONA 2CFFA 4DWDA 1YW1A 5LNSA 3MSGA 2ZXAA 3T9PA 1OZMA 4KEMA 5EMKA 1W8GA 1Q3NA 3P74A 4URIA 2VO5A 1T0OA 3OBKA 3WQ4A 3HPFA 2CC0A 1L6GA 5A6BD 2QVHA 1I2NA 1SO4A 2WNZA 3V0UA 3TIMA 3S9YA 2WW5A 4LPCA 1FWSA 3G1HA 3N2XA 3AS3A 1ZNNA 5KEZA 3UJ2A 4HYRA 5EB8A 3BVJA 4PCFA 5IBXA 1X1NA 5K4ZA 3GNNA 2CPUA 5LA0A 4GK8A 4IIFA 4S2CA 3WLQA 4S3KA 1Q6OA 1GHSA 4N4PA 4P61A 2G8ZA 2WKGA 2V2CA 1JXKA 4UTWA 3HG5A 2R14A 4DPQA 3TYEA 4ZSTA 1F2JA 3TXZA 4ENLA 3W71A 3PTQA 2FMNA 1YNYA 1OJXA 4ACZB 2X7VA 1TSIA 4Q32A 4PMUA 4DO6A 2R8WA 1UC5A 3FSTA 1Y8BA 3N2MA 3GG7A 3P0WA 3QJAA 7XIMA 4RXFA 2YX0A 1ZGDA 3MP3A 3BLDA 1VPQA 3W27A 2X0YA 4TOQA 2QGYA 3GU2A 1UMLA 3QHOA 1B0IA 2XH2A 3QN3A 2OB3A 5K3VA 3KEHA 1LL4A 3HG3A 2WB5A 3ES7A 2VFEA 3RPDA 1WCGA 2YKKA 1ADDA 3O16A 1CGTA 3SCNA 3WLMA 3GNOA 2ISDA 2XGZA 4WUIA 1WA3A 4KF1A 4U31A 5GPRA 3LBOA 3UYCA 4JTHA 4RDZA 4UR8A 3KX6A 5AC6A 1JQVA 1XKYA 2YCIX 1MYRA 3ZLHA 4JQ3A 1UOZA 1KA9F 4MJMA 4ZCWA 2PGWA 5F2GA 4NZ4A 1X1OA 5EKYA 3FVMA 2OFJA 3NYZA 2PUZA 2GDVA 2ZUUA 1EJWC 3KZPA 4XAZA 1WKFA 4GUHA 1WOAA 1FTXA 1PWLA 1R38A 4CCCA 1EA9C 1PWMA 1DJXA 4JTEA 5D33A 5I3HA 3UXIA 1PZ0A 2G41A 1XLCA 2P10A 2ZX7A 1XC6A 4LUSA 3IIPA 3VM5A 3GUGA 3ANVA 4K39A 4JFSA 4XUGA 4H8VA 4BWLA 3FJ6A 4IISA 3T55A 2H9AA 3H55A 4O17A 1RD6A 2VYOA 4LY8A 4DO5A 1L2QA 3VC5A 3QV8A 2Q09A 1RCXB 2D69A 3POCA 3FA3A 1OGGA 3F4NA 4LB3A 4YCOA 4PMZA 2E9BA 2B81A 2QEZA 5BXRA 5FJOA 1FHUA 4LJ3A 4OIFA 4QJ5B 1Q8JA 1XHGA 4GRSA 2VVSA 1HGYA 1E3ZA 3AICA 1VBUA 2XVNA 2EG8A 3ABSA 1B3WA 5DCBA 4DZHA 4ICMA 4LT9A 4LY4A 4AMCA 3O6YX 3SN4A 1UD5A 4JTRA 3V0SA 3GR7A 3IUHA 4JTCA 3C0LA 4QE5A 2GJNA 4GQGA 3GZ3A 2DQWA 4MFEA 1NELA 1ITUA 3E2SA 1FXPA 3W7KA 1ONEA 3C3UA 2GGEA 2YW3A 5XIAA 4PRWA 2A3LA 3NPUA 2YBTA 1J5SA 2IUZA 5PTDA 1LBFA 4HGXA 3ZWTA 2VFHA 2Q6ZA 4ZZ9A 5M2FX 3RLVA 6REQA 3URBA 4B3LA 4B9ZA 2DEPA 2BXZA 1FKWA 1GQJA 2RGMA 2Z00A 3VGFA 2PWUA 3IPWA 3F2CA 2A85A 5BOEA 4J4KA 1ONXA 4LEQA 1G4PA 5CBBA 4HPJA 3G1DA 3VMNA 3PSWA 3S8HA 1XX1A 3RCNA 3CPRA 4NZFA 1BF2A 1Y5XA 2E9MA 3GXIA 2WM0A 1UB3A 4LV9A 1PTGA 4G56A 3UPBA 4ROPA 3IANA 1O66A 3A22A 2OCZA 4KIRA 4PUDA 3CH0A 4B91A 3I68A 4TTUA 1VHNA 2QAPA 2ZZ1A 1QNQA 3H7RA 5AHLA 1TPC1 3W9ZA 3STPA 1KFJA 1ECEA 2CXEA 4Y9OA 2G95A 3VIJA 3GK0A 2ZZ4A 4B92A 5B80A 2QF7A 5D2VA 2X1IA 1OYCA 3STFA 3WLHA 4YCPA 1V79A 2UY5A 1CDGA 3EOLA 3QZAA 3VIGA 1KR1A 1YXCA 1TWIA 5MHBA 3RO6A 3M43A 1MSSA 2EJ1A 2XN1A 1TX0A 3KWXA 1OSEA 3CGTA 3BOXA 2PMQA 3PJXA 2CLEA 3BANA 3TKFA 4DUVA 1G0CA 1MXGA 3PWAA 3UJFA 1X1ZA 4RZ5A 4NAFB 1QDSA 5FACA 4XZIA 3PF3A 3GG0A 4IIHA 4WY0B 3KXQA 5FSDC 1L6YA 5T8GA 1K9DA 3FJNA 3OA3A 3MCMA 1TV5A 4M7SA 3SSJA 1SFJA 3AISA 1W9DM 2CEQA 4K38A 2EPHA 3TQPA 2Y6ZA 3EMCA 2Q8ZA 3NQVA 3TQ0A 4OHQA 1O5KA 3WLNA 4JBRA 4AXKA 3GHSA 2NVCA 4L4OA 3BPWA 1W56A 1XIFA 1AH3A 4KRZA 3B8DA 1W9PA 1XR2A 5I02A 3G24A 1B3ZA 3T0BA 2J74A 3GXNA 3MKCA 1WDSA 3TP4A 1Q6QA 2UZ9A 5M5DA 2GZXA 3NZ1A 3SCSA 5HOSA 2Y61A 3PTKA 3QLDA 3P82A 3CQIA 4E8CA 3OGSA 1RQHA 3RR1A 2J8GA 1W1A1 1JUEA 4KW2A