3AJXA

Crystal structure of 3-hexulose-6-phosphate synthase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
207
structure length
207
Chain Sequence
MKLQVAIDLLSTEAALELAGKVAEYVDIIELGTPLIKAEGLSVITAVKKAHPDKIVFADMKTMDAGELEADIAFKAGADLVTVLGSADDSTIAGAVKAAQAHNKGVVVDLIGIEDKATRAQEVRALGAKFVEMHAGLDEQAKPGFDLNGLLAAGEKARVPFSVAGGVKVATIPAVQKAGAEVAVAGGAIYGAADPAAAAKELRAAIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-hexulose-6-phosphate synthase
publication title Crystal structure of 3-hexulose-6-phosphate synthase, a member of the orotidine 5'-monophosphate decarboxylase suprafamily
pubmed doi rcsb
source organism Mycobacterium gastri
molecule tags Lyase
total genus 81
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.43: 3-hexulose-6-phosphate synthase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ajxA00
1XBXA 4NZJA 5CKSA 3IGSA 5D32A 3BG9A 5C54A 1M7OA 5C5YA 1JCYA 3PAJA 5D37A 3LXCA 1B3OA 1W0MA 4JTJA 3QSTA 4D2JA 1K7FA 4XTDA 1TQXA 2EPHA 1JQVA 4Y6GA 4E0CA 2Q8LA 5AYYA 3UWQA 4JIQA 4IX0A 3W74A 4FIQA 3NG3A 4E2BA 4GNJA 3M44A 3W2LA 3CT7A 4NX5A 4RXFA 5AHEA 3DKLA 4LVBA 1I8JA 1EEPA 1W5MA 2J24A 3HQ1A 3NQVA 1KM5A 3G8RA 1ZCOA 3W86A 3NEVA 3CIXA 2Y7GA 2NV2A 1XBZA 2B7OA 3HJZA 2GOUA 3EXTA 1W8SA 4ZQRA 1OJXA 2ZZ3A 4Y90A 3CB8A 4LV9A 3STFA 3P67A 2WV8A 1GOXA 1Q6RA 1UUOA 3ABQA 4WD0A 5FF0A 1JCMP 3W73A 5AC6A 1DORA 1TPFA 2E5DA 2RDTA 4UFLA 3T44A 2W79A 1L6YA 3HBLA 2CLEA 2ZRUA 4IMGA 1ALDA 2VELA 1KFLA 4KFPA 2RDWA 3EWUA 3EWBX 5LNUA 2JBMA 3GX9A 1T8XA 1B4EA 3GR7A 4FB7A 5HMSA 3W7GA 4UIOA 3EX6A 3I7QA 1VGAA 4O28A 1OFQA 3W87A 4ZQNA 1EWDA 4AHOA 3W76A 4JX6A 1A5CA 3G18A 4JYEA 3RFAA 1VRDA 2V8ZA 2YW4A 4K7YA 5AFDA 3UY8A 4Z08A 1VPXA 3G22A 1TTPA 2WSRA 5G1TA 4N02A 3W07A 1RQEA 1ME9A 2YFNA 1G69A 3L0NA 3TSBA 4LRTA 4N9DA 3PVFA 1UB3A 4UXDA 4DF2A 1L2UA 4CLMA 2GJNA 1M5WA 3DHFA 1RZMA 1G7VA 4FNRA 3T78A 1FX6A 1R46A 3UY7A 1YDNA 4XBKA 3O6YX 1SW0A 2WJZA 3DHDA 5G2IA 2H8XA 3UQNA 3MUXA 5C2XA 2R91A 1JUKA 4YMZA 1LBFA 3TMQA 4BI7A 2Z6JA 1RPXA 4K8HA 1VH7A 4LRSA 2PRHA 3W1QA 5DXYA 2DP3A 3SFKA 4O18A 4N9BA 3IVSA 5DCEA 4DF0A 2ZDRA 5F4WA 4Z0JA 4AMAA 3KFTA 1UJPA 2WNZA 3LRLA 3S5ZA 3NXFA 4NJIA 1OFAA 3NQFA 4Y9AA 3NOEA 4GRSA 4A3UA 1XUZA 1K8XA 4JDBA 3INPA 3TFCA 4PFMA 4UFIA 3LB0A 4UTKA 1JCJA 3TDFA 1QAPA 3SSJA 2DU2A 1VHCA 1JVNA 5DBTA 4ZQMA 2CLLA 1S5TA 1QFEA 3PR2A 4ZQPA 4CQ9A 2QCCA 1OFOA 2BSLA 3IIXA 2NUWA 1CW2A 3PM6A 3W7IA 3MHGA 1SSGA 5AB3A 1DJNA 5AYXA 5D09A 2RFGA 1TPWA 4IXXA 3CLMA 2FB3A 3LTPA 5LGZA 2ZRWA 2E6YA 3HG2A 1LCOA 2NLIA 1Q6OA 5AOUA 2BX7A 2GVJA 3W7MA 3C6CA 1HG3A 5AHLA 4RLIA 1TJRA 1SW7A 3C8FA 4M7SA 1K02A 4Q33A 4CCDA 3LGEA 4UFKA 4AEOA 3W2UA 1BEUA 4RZ4A 1H1YA 2WNNA 1AL7A 3W7HA 2I9EA 3QEZA 4ZQOA 3PUDA 3A24A 4O16A 3MMTA 1GWJA 1RQBA 3PC0A 4RXGA 2A2IA 2FPYA 5J5RA 1NF0A 1GQNA 5LZLA 3HOJA 4RKAA 4KFNA 3WK3A 3M1ZA 1VHNA 2RDUA 4JEQA 3KOFA 2Y7FA 5DY2A 3GXNA 5CSRA 5FEXA 3VCRA 4JN6A 2GVLA 2ZZ6A 3MO7A 3GKFA 1GYNA 4K8EA 3TXZA 3DENA 4N2YA 4PL2A 4BI6A 5LSMA 1TPB1 3TE9A 5C55A 1H61A 2O7SA 4IXHA 1H7OA 1NEYA 4JTKA 3M16A 3JS3A 1R2SA 4A2SA 4I9AA 2YFOA 3M47A 2BXVA 2V5LA 1WDWA 4S2CA 2AGKA 3PBWA 1OFEA 3P8JA 3DGRA 1VQTA 2AQWA 2VC6A 4EVZA 4QITA 1QDSA 2QUUA 3P82A 1SO5A 1DJQA 3KRSA 4KWVA 4AVFA 1LTDA 3C3NA 3GLCA 3TJXA 1DBTA 3DI1A 2VFEA 5TQLA 1EX5A 1W5NA 1ONRA 3WFAA 1IGSA 1WXJA 3H53A 3K30A 2J9ZA 5T26A 1H7XA 3BPWA 3W7CA 4XUGA 4JTEA 4XKYB 4CNNA 2WNQA 1Y0EA 1AMKA 3GAYA 4PODA 3TX9A 4WZHA 1SFJA 3M0ZA 5BRBA 1N8FA 1P1XA 3ATYA 1H50A 1G4EA 3EB2A 4O0KA 2ZTKA 1JUEA 2V2HA 1FWRA 3U8GA 3KX6A 4S1FA 4H4IA 3V75A 2AAMA 4FX6M 4AXKA 3M5ZA 1F7BA 3B04A 2XFWA 2I1OA 3LM7A 3TH6A 3W6YA 2A6NA 5KTLA 3KVLA 1GPWA 1TPUA 2JGQA 4JNMA 3GDLA 5F2IA 4ADUA 3IIVA 1QO5A 2X1UA 5FEPA 3W22A 1MXSA 3WJXA 1U5JA 3QPYA 4R34A 2WSYA 3L68A 4Y96A 5LNVA 4LWWA 4JY8A 5D2WA 3NAVA 2OMAA 3P8IA 2ABAA 3TFXA 3MBFA 4MZ1A 2PCQA 4QAIA 3DH7A 2EF9A 1LYXA 4RX0A 2Y63A 4ZL1A 4R53A 5FF4A 3VKJA 2CLIA 2J9XA 3RU6A 4JYDA 1LM1A 1Z41A 4MLRA 2VKZG 1OFRA 3DFTA 4JDYA 4UTJA 2CLKA 3BW2A 2NXGA 5D03A 4Z1DA 1H62A 2OCZA 1TYGA 1TO3A 5J5DA 1LRNA 2VENA 3W2JA 3M5VA 4FF7A 2H90A 2FDSA 2C0AA 4FX8A 4GUFA 1S3HA 3NQ6A 4IQLA 5DBUA 5AN7A 5K3VA 4HSOA 1K7XA 1ZENA 1XDLA 3N19B 1SU5A 5FI8A 1GJPA 1XDMA 1VCGA 2QDHA 1ZHAA 3NVTA 1BTMA 3GAKA 3G0UA 3HPSA 2WKJA 3NYZA 3M43A 5KZMA 4RZ6A 1NSJA 2C19A 3SGZA 2QCDB 2P0OA 1DV7A 2CZ5A 3QW3A 4MJMA 2ISWA 3EX4A 4N4PA 4OU1A 3EKZA 4AAJA 1OFPA 3D0CA 4MIMA 5D33A 1Q45A 3LCHA 4JTLA 4J9JA 3N2MA 4JICA 2TRSA 1C29A 4YCPA 4QNEA 3LHVA 5F2GA 5HWJA 4EIVA 4NU7A 1TPEA 2A7RA 3EXSA 4FO4A 1EP1A 4O4WA 3NPWA 1NFBA 2RH9A 3CWNA 3HIJA 5K4ZA 4UNKA 4JGDA 4JR5A 3NQAA 5A5WA 2QCNA 3DAQA 3G24A 3R89A 4NT0A 3E96A 3O05A 3PS7A 3BVJA 3LHWA 2Q3OA 5U4NA 3S1WA 4TMBA 3T4CA 3W2NA 1HO1A 1FCVA 2Z0IA 4GBUA 3MBDA 3G1XA 1Z48A 4KWWA 3I7RA 1C9DA 4O4VA 1G67A 1K03A 1UASA 1TQJA 1MZHA 4IPIA 2BTMA 2ZZ7A 3EXRA 1XM3A 3NZRA 3W85A 2CLMA 2TPSA 3PSVA 4WX2A 3BLFA 1QPQA 1YTEA 3QQ1A 3G1FA 4KKXA 4ZQCA 5L9FA 1HFBA 4PH6A 2G5WA 2Q8ZA 5HULA 5LKYA 5DCDA 1QPRA 1TSIA 1VCFA 2ZQ0A 5FF3A 3TW7A 4MVAA 2C1HA 3SW6A 1KM0A 1EPXA 1LBLA 4B5NA 1WX0A 3W7LA 1XKYA 3BW4A 4MPQA 1PHWA 3HGRA 1W3NA 1A53A 4O1DA 6TIMA 3B03A 2CZFA 1PCKA 2NX3A 1G4SA 4XZ9A 1D3HA 1DOSA 4DELA 1LROA 2E68A 3L5AA 4GUJA 1F5ZA 3QQ0A 1EP3A 3KRUA 3G1HA 4TU1A 1WAUA 3LLFA 4X9SA 4O12A 1EIXA 5K9DA 3LBCA 3NQMA 3LTYA 5D2VA 3CHVA 4RCXA 1ADOA 1J2WA 2QAPA 3HG5A 4U28A 3GXTA 1W1ZA 2LLEA 3LCGA 3GK0A 1IIGA 2FJKA 1J5TA 2Z1BA 3W7QA 1UBSA 3E12A 3P80A 4NNCA 2OJPA 4IJBA 4PC8A 1OG0A 3PBVA 1B9BA 3S6DA 3MHUA 3W1NA 4FNUA 1KA9F 4OQVA 3B05A 2V2DA 4U4MA 5DY3A 5HR7A 3GNDA 1YPFA 3RK8A 1LOQA 2VXNA 3NZ1A 3G0XA 1JJKA 4NX0A 2ZYFA 3G3MA 3GVGA 5D2YA 4LUJA 1KM3A 2GVGA 2NX1A 3W7KA 1QR7A 3LLDA 1TPVA 3IIZA 4FNTA 2ISSA 2C6QA 4GE8A 3L65A 5IM51 4O1CA 1ZAJA 1X6UA 1LLZA 2DZTA 1K3UA 4E38A 4MUZA 1LRQA 5KINA 3ZWTA 1SO4A 3W1UA 5D05A 1GYLA 3C2OA 3TSDA 2QCMA 4BK9A 4LOCA 2HTMA 3A5VA 3W3OA 3GDMA 3L5LA 1H63A 1ICPA 4YWIA 4JY9A 3PY2A 2PURA 5FESA 1TTJA 4ALDA 2JKAA 5EKYA 4MYXA 4O17A 3FYOA 1V7YA 1VR6A 3Q2DA 4AWSA 3IGXA 1HO4A 1DVJA 2WO5A 2Z2UA 2F84A 3MW7A 1FDZA 4UC5A 2ZRZA 3U2OA 4DO4A 3W1XA 3QYQA 3UYCA 5LHFA 2DJXA 3LCWA 4ZMGA 3LI0A 2TSYA 5CPNA 3NA8A 4Z1CA 2PRLA 1GVFA 4BR1A 1ZAIA 1PS9A 3E02A 2QJGA 4HNNA 3TSMA 3MP3A 5EPDA 3IIOA 3PBUA 1FDYA 3I65A 1NVMA 3DZ1A 3MHFA 4R33A 2VEKA 3LHUA 4HN4A 5DELA 1A5AA 1YXDA 1F05A 1EA0A 4ICNA 4RR4A 3P5ZA 1KTBA 3QSRA 1OF6A 3GR8A 5HUOA 2QDGA 1TTQA 3QPZA 1FCBA 5AHIA 2YZRA 3QM3A 3TUUA 4AF0B 3UWWA 1KM6A 4UTWC 4IMEA 1VYSX 2DJLA 5I3KA 2EGZA 3TAOA 2PC4A 3F4NA 4QIUA 2TYSA 3VI2A 4EOUA 2CFFA 3CEUA 1TPC1 3LTSA 1TCDA 1I4NA 3GYEA 1SZGA 2NXHA 3WJYA 2ALDA 1J4EA 3W71A 1KBJA 5F1UA 4I7VA 4ZZ9A 2NUXA 3TC7A 1W3IA 3UXAA 5L6UA 5G4EA 4BFAA 2E6FA 3HG4A 4LVFA 2V82A 1I2NA 1YDOA 3BG3A 1T99A 3DFQA 3DFSA 1JRBA 3B8DA 4QJ1A 1X1OA 3N2XA 4LTSA 1KV5A 2NWRA 1PL9A 1KFJA 2Y70A 1TV5A 4O50A 1O5XA 1DHPA 2DZWA 5AC8A 4O52A 2XN1A 1EUAA 3RLVA 3G1DA 4GJ1A 1VS1A 4FNSA 2P1FA 3QF0A 1SFLA 1FXQA 3GDRA 4P61A 4MY9A 1D3GA 3CM4A 2R8WA 1K8YA 1H7RA 4OWGA 3G8EA 2J88A 1H5YA 1JUBA 4N9CA 1RR2A 4FXSA 4UTLA 3OVPA 5CZ0A 1HTIA 1PE1A 2DORA 2EAWA 4Y8FA 3WK1A 4UMBA 2TMDA 4WY0B 4PTNA 3TU9A 5CGQA 4JS3A 3P60A 4LV4A 5E1QA 2J27A 3NQ7A 4GWEA 3W7RA 4A2RA 1TTIA 4BWLC 4TO8A 5SWUA 1JQXA 1GT8A 5I3IA 1H7NA 3BW3A 3N14A 4XKYA 5FF7A 3W7NA 3DU0A 4L4MA 2Y62A 3PWAA 4FX7A 3W1RA 3KHJA 1VYRA 2Y7EA 1SZEA 1VYPX 3NL5A 4UNLA 5CPMA 3SGUA 4N4QA 3JRKA 3P84A 3LHYA 3LRMA 1YADA 1XFBA 1EWEA 3UD6A 1W3TA 2XN2A 2QR6A 1LZOA 4TIMA 4FNQA 3O15A 3PUOA 3NL2A 4JTGA 5EY5A 1DKWA 3IVUA 3KAOA 1JRCA 3C0JA 2JKPA 3M5YA 2A7PA 4NZFA 3UPWA 3PF3A 2V0TA 5EYWA 4WY0F 3HF3A 3NM3A 2YSWA 2VFIA 4UTWA 3CQ0A 1ME8A 3G1AA 1TIMA 1TV7A 5IBXC 3DFOA 3W2MA 2WOQA 3CEPA 2Y88A 2CLFA 1A5SA 1KBIA 3CIWA 5KITA 3WJWA 2YDAA 5D38A 4LS1A 3STEA 3H54A 1I2PA 3TV8A 3STCA 1XBVA 3NL3A 3OG3A 3NO5A 3TQVA 1QO2A 3VNDA 4UTTC 1ME7A 1TB3A 3O16A 3H55A 4MOZA 1W5OA 3SY5A 2NUYA 3MP4A 1AW5A 1XL9A 2X1SA 3F03K 3B4UA 2J6XA 4BF9A 5MHBA 3LDVA 1GEQA 1X8FA 1AW2A 1I45A 3AO0A 1CI1A 2HMCA 1WOAA 4WUIA 4E2DA 5HQEA 2B0MA 3SIZA 1QPOA 1ICQA 3GKAA 1OK4A 2QCDA 4BI5A 1OX4B 3A5FA 2GQ9A 3N3MA 1LBMA 1SSDA 1JCLA 1RV8A 3U6WA 5I3JA 5EBUA 3S9YA 3HGSA 3GDTA 4LS2A 3BLEA 2YYTA 5D2TA 1R2RA 4LU0A 4ADTA 4DPQA 2CZDA 2KZHA 3SR7A 3G3DA 1FCQA 3THQA 2VEPA 3OBKA 1KFBA 2R14A 4WOQA 4JTIA 4UTUA 5HWMA 2QKFA 3GIYA 1XUUA 2YX0A 2CWNA 2QCFA 3DXIA 5FEWA 4PEKA 1UCWA 1XCFA 3R2GA 4O0ZA 3W1AA 2H3BA 4QSHA 4G1KA 5I3FA 3IGUA 3A9IA 1QOQA 5HJLA 5F4XA 2ABBA 3I7SA 2E5BA 3MJYA 4HNTA 2Q3RA 3EX2A 2E1DA 5LGXA 2FPTA 4CCCA 2ZA3A 1NAL1 4TX9A 3PBYA 4AB4A 3EWYA 3THAA 2A85A 4O8RA 3V1PA 1GG0A 4XWUA 3WK2A 2G97A 2BLEA 3NQGA 1FY6A 2ZFAA 4IPJA 4I7WA 1EB3A 3DFNA 1R2TA 3GXPA 5K9CA 3P74A 1VCVA 1OABA 2A1YA 1P5BA 5G1YA 3TC6A 3HB9A 2Z6IA 3L21A 2QUTA 3S1XA 3N9RA 3UPBA 3LHZA 1C8VA 5IBXA 4NNBA 3W9ZA 2BZNA 1F74A 1FWTA 3CPRA 1UUMA 3FYPA 3FLUA 3HG3A 1OF8A 3FJLA 1OX5A 1GVRA 3WJZA 5LHEA 2HS6A 1RQHA 2YW3A 4UFJA 1RD5A 2VFHA 1V5XA 4UMAA 4UTTA 2DZPA 4LNYA 1Q6LA 5G2WA 3UXDA 3DKJA 2ZTJA 1YTKA 4HHPA 4GUGA 4DO5A 1B4KA 3GB6A 4GXMA 3W1MA 3R13A 2VOMA 3UZJA 3FS2A 4OE7A 1DL3A 2E6DA 3C2VA 4O1BA 3NDOA 2PE4A 4JTUA 2DZSA 2HS8A 2E77A 3ELFA 1AW1A 1JCNA 3N34A 4YCOA 4NXSA 2EHHA 4ONVA 3TQ0A 5FEZA 3I6RA 4MFDA 4M6VA 2G95A 3Q58A 3NL6A 4QQ3A 2B7NA 1YDVA 5EA9A 3FOKA 3HPZA 3PG9A 1SUXA 1ZNNA 4L4LA 3HGOA 1QCWA 3QJAA 4UFMA 3LOTA 5TBOA 1O60A 3TROA 2C16A 1F6PA 5CG7A 1JULA 3NR0A 4XBSA 3GDKA 2QAFA 3S8HA 1FWSA 3ABOA 2FQIA 5F4SA 4AWUA 3PB0A 5G5IA 3M6YA 4HIBA 4DF1A 1QWGA 5CPOA 1QPNA 2PRMA 2W0UA 4IOTA 4O19A 3QW4B 1T96A 1CX9A 4IUOA 3S1UA 1I2QA 4JXCA 1EP2A 5H2ZA 5FF2A 3LCFA 2Y85A 4CQ8A 4CQAA 3Q94A 5DXXA 3S42A 4WQ6A 5E0KA 2ZCGA 3OEXA 3UZ5A 5D02A 2E6AA 3G1YA 3QMTA 1N55A 5DLCA 1TPDA 5F2MA 3QMRA 5CPLA 1WA3A 3KVJA 4N9EA 3PSWA 1DQXA 1R30A 3WK0A 3M5XA 5LNSA 3C56A 4M5PA 5CSSA 1H51A 1MEIA 3LV6A 4R7JA 3EX1A 5AHFA 1AL8A 1W5PA 3OIXA 3ANYA 2NXIA 4MY8A 4X2RA 4HNVA 2NZLA 1X1ZA 3RMJA 2H3DA 3FKKA 4Q32A 2FFCA 2Y7DA 2ZRVA 1MEHA 4K36A 4K37A 4S2BA 3S0CA 4UTHA 1IIHA 2OX1A 3LV5A 1KV8A 3W1PA 4O15A 3TKFA 4C1LA 1OHLA 4H6KA 4Q4KA 1PCWA 2A0NA 2RKXA 3W70A 1Z42A 5BOOA 4LS0A 4ORIA 3MYOA 3WJSA 4DPPA 2GPTA 1Q6QA 1F73A 2B7QA 2NX9A 4Z0SA 3YPIA 4AF0A 3IRDA 5BW6A 1WBJA 3LERA 3KVKA 4AHPA 1LDCA 2YXGA 4QM1A 3SECA 3LBMA 2QF7A 1ML1A 5KSWA 1GVSA 3MI3A 2BWGA 1W31A 4DBEA 1LRTA 3CWOX 1EUNA 3M9YA 1B57A 3TXVA 5D30A 4M19A 1H7PA 3S5OA 4FIRA 1ZJIA 3LCLA 3KRZA 2H6RA 3BLIA 1FWWA 2Y89A 4W9TA 4WOZA 3F1QA 2P10A 4XTIA 3IEBA 4A21A 4N6EA 3SI9A 1H60A 3QFEA 2WPBA 2R94A 5G2HA 3SJ3A 4NJJA 2YR1A 3C52A 4MFEA 3QMSA 4JD4A 2JKEA 1VLIA 1VC4A 3P81A 1P0NA 3FKRA 4POCA 1OFDA 4X22A 4MKNA 4DBDA 4AHQA 2QEZA 4JTSA 1AK5A 1KFCA 2YPIA 4HT3A 4O13A 3DFPA 1M6JA 4RJEA 1IF2A 3W75A 3UWZA 3DI0A 3LHTA 3O07A 2OZ0A 4O54A 4X3ZA 4NJKA 4N6FA 5A8GA 1P0KA 5K9XA 4EWND 4HNUA 2ZZ4A 4WY0A 2DZVA 3CC1A 2E5CA 1SQ7A 1VZWA 4GUHA 4NVTA 2A6LA 4PCFA 4M6PA 2ZZ5A 3TJLA 2NWSA 4ZVJA 3O63A 1N7KA 3BG5A 3W72A 3W23A 1DQWA 1A50A 1F76A 3E49A 6ALDA 3W7JA 2ISVA 2WQPA 3L9CA 4LVGA 7TIMA 4HSNA 1XI3A 1A5BA 3M41A 4O57A 2GQ8A 2B4GA 3AJXA 4Z1AA 1H7WA 1OFBA 5AC7A 1IXQA 1TV8A 2ZA2A 1BWLA 3HPXA 2J9YA 3S1VA 3L67A 1YYAA 3CTLA 1W54A 3BGJA 1SO3A 1XXXA 1GTHA 1BWKA 5ABTA 4JTFA 1FQ0A 1LOLA 3FIGA 1LP6A 1WOBA 4UTIA 3NQDA 3P5YA 4OV9A 1P4CA 1QOPA 4JYFA 4MYAA 1KM1A 5BMWA 1KLYA 3F4WA 3FFSA 1XC4A 3HMJG 1KFKA 1KM2A 3BK0A 4LW7A 4GFSA 1JCXA 2A7NA 3N73A 3O06A 3C61A 4C1KA 3OA3A 1PHQA 4NQ1A 2GJLA 1NF7A 2DZUA 3LRKA 3P7YA 1SR9A 3O8AA 3N9SA 1ICSA 1KLZA 1OYBA 1IXPA 1GG1A 1ZY9A 4MZYA 4LY8A 2QCHA 3SZ8A 2CZEA 4M6QA 4FHAA 3L5MA 3O1NA 3Q37A 3RLUA 1PV8A 4I7UA 4P2VA 1KW1A 4WJEA 1MO0A 3TA6A 3W83A 1ZALA 3W7EA 2QCLA 1T0OA 1OK6A 2YCEA 3EWXA 3R8RA 3G0SA 1HUVA 1R47A 1OX4A 1SO6A 4TMCA 1SW3A 1E51A 3ATZA 3L66A 4DEFA 3HGJA 3IIPA 5D2XA 3T40A 3BV4A 4OBTA 4LC8A 3S5YA 1VJIA 5EL1A 1G4PA 1HL2A 2FTPA 3LI1A 4AH7A 1L6SA 4NJHA 1Q3NA 4FNPA 1W37A 4IWWA 4FEZA 5K4XA 2X16A 1GVQA 1LOSA 4XQ6A 5TIMA 3BGGA 4CNPA 2QUVA 3ZR4A 1THFD 5KMYA 1AG1O 3USBA 1FWNA 1TJPA 2X30A 2V5BA 2QCGA 1XBYA 3A23A 4CNOA 2E09A 4WXYA 2X1TA 3RF9A 1WV2A 2IQTA 1G4TA 4O11A 3L2IA 4JX4A 4RV8A 1TMHA 4OV4A 4ADSA 3L0KA 2FB2A 4HPXA 3C2FA 2GQAA 2B7PA 5HINA 3W88A 3QRHA 1GVOA 3NGJA 3W7OA 3ZFHA 2DZXA 2CLOA 1VLWA 1SPQA 1TRIA 3TW6A 3BO9A 3JR2A 4Z1BA 4K7VA 1FDJA 3MI2A 4O1AA 3W1TA 2W6RA 4OGZA 1LORA 4DO6A 1F2JA 2XN0A 4OT7A 4UR8A 3EKLA 2Y61A 5CZTA 1TPH1 3W7DA 1X7FA 4IGHA 4O14A 1O95A 1KTNA 2OT0A 3M7WA 2UV8G 3ZWSA 2CLHA 2VEMA 5E93A 3PG8A 4MZ8A 3O6DA 4O10A 3B0PA 4OHQA 3W2KA 4EF9A 2VFFA 2X2GA 5H91A 1S5VA 3PUEA 4IMFA 1IXOA 3NQ2A 4MLJA 2I14A 1S5WA 3VE9A 3EWWA 1TREA 5EMUA 4CCEA 5CZJA 5BMXA 1L6WA 3PULA 4UR7A 3UWVA 2V81A 2VFDA 3B0VC 1ZAHA 2A21A 5AHNA 3TAKA 1K7EA 3PB2A 2ZA1A 2WSQA 3NM1A 3UWYA 1OYAA 4NXKA 5BNKA 2QJHA 1BKSA 2D73A 4RK8A 3MYPA 3STGA 4IX2A 3MI6A 3TNOA 3FA5A 3G1SA 2V30A 1FXPA 4K6AA 4EF8A 3NPXA 1D9EA 2JK2A 4ORMA 4FXRA 3IVTA 1TRDA 4BWLA 4UTMA 1RVGA 3ABRA 4LVAA 5I3GA 1JR1A 3VFLA 4MJZA 5F1VA 4LVDA 4A29A 2C13A 3KXQA 2C18A 5G4WA 3A22A 2YYUA 4PL1A 2O7QA 3LX9A 2FLIA 4DQWA 1WBHA 4AWTA 2C3ZA 2C15A 5D04C 3T7VA 4IMDA 4NJGA 1ZFJA 2Y6ZA 2C14A 4LUIA 2ATMA 3E9AA 3BARA 4GUIA 2A4AA 4LC6A 4A22A 1SZFA 2GUUA 1H1ZA 2QJIA 3DBPA 2V9DA 3TIMA 4GC4A 3E0IA 5KZDA 3MWAA 3S5NA 1U83A 3EEGA 4JTTA 1MSSA 1LLWA 1SZNA 2QCEA 1I2OA 5LNRA 1O4UA 3CU2A 3TQKA 3ABSA 5AYZA 3LCXA 1KM4A 4K39A 1FUYA 4KFOA 1GTEA 3T55A 3R12A 4QNWA 4HPJA 3IV3A 4UMCA 4M7TA 2CW6A 2ZZ2A 2RHGA 3C4UA 2FIQA 3C2RA 3TR2A 2EKCA 1YXYA 4JX5A 3UWUA 1KFEA 2X1RA 3O6CA 5F2LA 3NQCA 4YXGA 4TR9A 5GVJA 3UNDA 1OVDA 3MP5A 8TIMA 4NNAA 4K38A 2OT1A 3ZS4A 2V2CA 4YL2A 2YGYA 2H8ZA 3I68A 3QC3A 2NV1A 3NQEA 1G6CA 2ZBTA 3W1LA 3B0UX 3C2EA 1FBAA 3LCIA 1I2RA 1W5QA 4ML9A 2CU0A 1PVNA 1YXCA 5K7JA 5KZEA 4MY1A 4O53A 1YPIA 4NUWA 3G1VA 5HR6A 1K8ZA 2ZZ1A 2ZRXA 1G7UA 1OYCA 3B06A 4JIPA 3EX3A 3OVRA 4HKPA 1KTCA 3FJ6A 2VEIA 1O94A 1YTDA 1PIIA 5HWNA 1W56A 5I3HA 3TMLA 5DCBA 3QH2A 4UFHA 1GZGA 3GZ3A 3LXBA 5LNWA 4YLWA 4PA8A 3P61A 3EWZA 2ATSA 3W84A 5AHMA 3TK7A 5K2ZA 2G96A 1OX6A 3GNNA 5C6MA 2VFGA 3QZEA 1M7PA 3OVQA 4QISA 3HO8A 3KVMA 3VE7A 4WXZA 5HNRA 1F6KA 5CZSA 3TCEA 2HSAA 4RZ5A 3R5EA 1MEWA 1L9WA 4IMCA 2F7FA 1IXNA 1FCUA 1O5KA 3FEMA 5U7SA 2JGYA 4JTHA 1YLVA 2A5HA 4LT9A 5HUPA 5DN1A 4DXVA 3L0GA 3LXAA 2FPVA 2ZRYA 3W7PA 4H3DA 1QNVA 4UCGA 1WQ5A 3NQ8A 3NPVA 1WYIA 3OHIA 3A21A 3NPUA 1QMLA 3NNTA 4UUIA 3P62A 1Z44A 3RNDA
chains in the Genus database with same CATH superfamily
2CITA 4GY1A 1Q7ZA 3BG9A 1M7OA 5C5YA 1JCYA 2J7BA 4AD3A 1E1FA 4GQGA 4JTJA 3QSTA 3NFUA 3RPMA 4H41A 1HKWA 1JXJA 2OX4A 4XTDA 1TQXA 4DLMA 1EJUC 4E0CA 1V7AA 1XW8A 1CB2A 3UWQA 1IR1A 1MNSA 3W74A 3NG3A 3CO4A 1QI5A 2EG6A 1I8JA 3KDOA 1JYVA 1C7SA 4IIGA 1UYQA 4YVXA 1S38A 2UY2A 5A6BA 1BXBA 5CC7A 2FHCA 2J47A 3TA9A 1W8SA 4HGXA 3N17A 1PKMA 2WV8A 1UUOA 1J18A 1Q13A 3TZFA 4Z2IA 3W73A 5AC6A 2E5DA 4AZIA 2OODA 4QG6A 1R3YA 3T44A 2W79A 2VX7A 2HDJA 1KFLA 3UR7A 1Z89A 3QC0A 4OZOA 5LNUA 3XINA 2JBMA 3CMJA 3SURA 4CD4A 4OFCA 4U2ZA 4GO9A 1EOKA 1AH4A 3OQ8A 1UP2A 4PYSA 4YJ5A 1Y65A 4O28A 1OFQA 1HKKA 4HYWA 3TYBA 2GGGA 2Z1WA 4ZQNA 1VRDA 3V16A 2V8ZA 4XZHA 2YW4A 1WO2A 4F66A 4R88A 1VPXA 3WQFA 1TTPA 3H70A 4KEZA 5G4HC 3EMZA 3W07A 3MKVA 1RQEA 1ME9A 3O3RA 2WZTA 3OO2A 3EOOA 3R6IA 1L2UA 4CLMA 1AQFA 3DHFA 1QI2A 3PZOA 3M7SA 1YX1A 4Q8QA 3GHSA 2E40A 1VPYA 5JXQA 2J78A 3MUXA 3EBVA 2G4FA 4LAOA 2ZXQA 3UGVA 5XINA 1DJYA 4K8HA 1RBLA 1V0NA 5DXYA 2ZKMX 4O18A 4N9BA 5DCEA 2ZDRA 1T5AA 2ISFA 1J8VA 4N0RA 2XM1A 3WLNA 1QNQA 3AYTA 4IIFA 1JPKA 2V5CA 8A3HA 1QRQA 3LRLA 4IQDA 1R3QA 4NJIA 4C6EA 1B1YA 3NQFA 1S5MA 4GXWA 1D8CA 1VBGA 4UQ9A 4JDBA 4PCNA 2ZOXA 3INPA 2G3NA 3BLDA 1EQCA 1KNWA 4UFIA 3SCOA 3BDKA 1JCJA 2Z7KA 3TDFA 1QAPA 2DU2A 1VHCA 4Y9PA 5DBTA 1S5TA 4CQ9A 3PR2A 4ZQPA 1EO5A 3LA4A 1OFOA 3AUJA 1RLDA 2F2KA 1ZCCA 2R1NA 1SSGA 1KRMA 2WC7A 3GXDA 2P0IA 3A3XA 5LGZA 3KBSA 9XIMA 3PJUA 2NLIA 2QMJA 2BX7A 1UWRA 1A0CA 4QP0A 4RLIA 1LUCA 3BAWA 3C8FA 1LJYA 3I4KA 4D6IA 2VQUA 3VK5A 4Q33A 4RZ4A 1H1YA 3UT0A 2WNNA 1J0IA 3QEZA 4WCJA 1GWJA 3MSDA 4Q4QA 1RQBA 2A2IA 3H6OA 5J5RA 1GQNA 1ISWA 3T05A 4RKAA 2C1IA 2A3BA 1Z8AA 4UZSA 2QLYA 5DY2A 1PZ0A 1OD0A 5FEXA 3WDJA 2RGMA 5I00A 3DG3A 4IGNA 1UWUA 2QDDA 4LBUA 3BAKA 3GKFA 5TF0A 4N2YA 1EBGA 3ITYA 1KCKA 4BI6A 4O1FA 5BXSA 3CUIA 4L61A 1J11A 3GU2A 5LA1A 1V3JA 4IXHA 3QVQA 4IICA 3CH9A 3V0TA 2WVVA 1D8WA 1DE5A 5I0DA 5AECA 3FAWA 4WSJA 3SCNA 3P8JA 5C9XA 4UOJA 4EVZA 3WQ5A 3EZ4A 4DZHA 1DJQA 4KWVA 1CNVA 3CPUA 1K6AA 4B5VA 1EX5A 4E8GA 4ZSUA 1WXJA 3H53A 4HNCA 3RIKA 4KWUA 3K30A 2J9ZA 1XYFA 3DIPA 2Z26A 4CNNA 1KGUA 1Y0EA 2C0HA 4YTQA 1IWPA 1PTGA 1SFJA 3AZSA 2OKTA 1N8FA 3ZXWA 4XAYA 1P1XA 4I3GA 4DM2A 3U8GA 1TA3A 4DXKA 3TH6A 1BYAA 5KTLA 3KVLA 1WE5A 4XB3A 5F2IA 3USZA 2VWTA 2X1UA 3B8SA 5FEPA 1GCYA 2WCAA 1BGAA 1BRLA 4GK8A 1U5JA 1RCOB 3TEVA 3BJFA 1K1DA 2XUCA 3UJ2A 3L68A 5LNVA 4B92A 3IJQA 4LWWA 3R10A 3NAVA 4XD3A 2ABAA 3TFXA 3ONBA 2EF9A 1LYXA 4RX0A 2EPMX 7CGTA 2CLIA 3S5SA 3PK7A 5I24A 2J9XA 2KAUC 3VKKA 1GUVA 2VKZG 4BQ5A 3DFTA 4JDYA 1P7TA 4FR1A 3WLHA 4BS0A 4ZXOA 4A3YA 3M6DA 1YMYA 1R3RA 2CLKA 3H2MA 5D03A 1BTCA 1OZMA 3DFHA 2JE8A 5J5DA 2VENA 5TAOA 3D5HA 1Z69A 1NELA 4D6FA 3DC0A 3G77A 3NQ6A 4ZO9A 5AN7A 5K3VA 1K7XA 4CCZA 3VU2A 1BYBA 2DSUA 4F9DA 4GI6A 3NVTA 1BTMA 2PAJA 1JNDA 2B31A 1JZ4A 7XIMA 2DY3A 4PUDA 4PUNA 4AIBA 1XH0A 1DJGA 2YCIX 1DV7A 3REQA 3VC6A 3BMXA 3QW3A 4MJMA 3CYJA 4AAJA 1OFPA 1V0LA 3CPGA 4MIMA 1K6WA 3UFYA 3PHAA 1AZ2A 3DESA 4GZIA 1C29A 3WQVA 4YCPA 3LHVA 5HWJA 5A69A 4NU7A 3GIQA 1KGXA 1SJCA 2A7RA 5GPRA 1R87A 1W1YA 3NPWA 1NFBA 4G56A 3T81A 4JGDA 1UZ4A 2BHUA 5A5WA 2ISDA 2XDFA 4I8DA 3BZJA 3R89A 4MWAC 2IPGA 3LHWA 1UD8A 1BLIA 4W4QA 3OTRA 4AD1A 4TMBA 3K8LA 3IK2A 4KEUA 1M65A 3W2NA 4HOZA 3TWAA 1V6TA 5I2UA 4GBUA 1Z48A 5C9ZA 3CUGA 4O4VA 4EACA 1K03A 3CL6A 4M82A 1MZHA 1UWAA 1V77A 4IPIA 3M0VA 4MM1A 1XM3A 2GSJA 4QRNA 3I4EA 4B5SA 1YTEA 3BMVA 1ZU8A 3RG6A 4WHBA 5DCDA 3TW9A 2ZQ0A 3NZQA 2QPUA 2FZNA 1XX1A 3T2PA 2ZUSA 1KM0A 1EPXA 2VT0A 3W7LA 1XKYA 4AEFA 3HGRA 5EFFA 6TIMA 4GKLA 1QJWA 1G4SA 4JFSA 4DELA 3AXMA 4GUJA 1F5ZA 4TU1A 3PJTA 3LTYA 2WK2A 2F6UA 4JTRA 4LQ1A 1J2WA 4GIRA 2QAPA 1GQKA 1EC8A 3HG5A 4U28A 4NILA 2XFYA 1GNXA 1QHOA 4QXIA 4WGXA 3W7QA 4NNCA 3UESA 2VGIA 2VP8A 3BAIA 3S47A 3PBVA 4E6MA 3MHUA 4FNUA 3B05A 4AZ6A 4DZAA 4YTUA 4F2TA 3GNDA 2X7VA 2QULA 4AZGA 3RM8A 3VGEA 2ZYFA 3G3MA 5D2YA 2J8FA 1KM3A 1TPVA 3GHTA 1JIBA 2ISSA 3OLIA 4TTUA 1K3UA 3QV9A 1R9YA 3BH4A 3HMCA 3ME3A 3ZWTA 1UWIA 3HA1A 5FSEC 3B9EA 3W3OA 3GDMA 5JBEA 2PGWA 4KCTA 2F6XA 3GG0A 1FWEC 2BGSA 3W00A 4ALDA 2PDJA 4MYXA 1V7YA 1VR6A 2O9TA 4D6DA 4HZ6A 1HO4A 4B9YA 1O12A 2F84A 1T7LA 5CC5A 3L4XA 3B3DA 3QYQA 4JQ3A 4LFYA 2CIPA 3WLJA 2AMGA 4UOZA 1NP0A 2FVKA 2OPJA 4NYUA 2PGEA 4ZTYA 4Z1CA 1MDLA 3AXHA 1GVFA 3ZJ7A 4W89A 1PS9A 1TMLA 2XSXA 2QJGA 4HNNA 4KPLA 1ISVA 1UC4A 2RGLA 3IIOA 2ZUWA 1ECEA 4JQ2A 2OOGA 1VFOA 2XJ7A 4S3CA 3LHUA 3I10A 4O8AA 1F05A 3AHYA 1EA0A 1EHNA 1Y5WA 2RAGA 3AYSA 1KTBA 4FXFA 1OF6A 2OR2A 3MMDA 5HUOA 1FCBA 1V3KA 1EC9A 1KQZA 3QM3A 2NV9A 2C8NA 3TUUA 2Z29A 1KM6A 4UTWC 5I3KA 5M2FX 3TAOA 1PIFA 4XBJA 1SM9A 4QIUA 2WNWA 3WH6A 3QR1A 4MNLA 1TCDA 2OTDA 3EYPA 2ALDA 1TJ2A 4I7VA 4CN4A 3TC7A 1W3IA 1C9WA 2E6FA 4LVFA 4J3VA 5LIXX 3BG3A 3DFSA 3B8DA 1ITUA 1S2VA 3GTFA 3N2XA 1KV5A 4HOWA 3CAWA 2NWRA 3FNDA 4W8BA 2Y70A 3AQUA 1DHPA 3GUWA 2DZWA 4CU8A 3E5PA 1BG9A 1P0DA 3RLVA 3MZNA 4GJ1A 4JHOA 4FNSA 2P1FA 4BQ3A 1SFLA 2BHYA 4P61A 4PEEA 4OWGA 2EPKX 5DMLA 8XIMA 3TTQA 3TTEA 4FXSA 3CMFA 4P7RA 2GDVA 1ZBCA 4INFA 1HTIA 3MCMA 2DORA 3BCFA 3WK1A 1E70M 3ZVIA 1TCMA 4PTNA 2HNEA 3TU9A 3H7VA 1G01A 2D69A 2EJAA 3GW3A 3JVAA 3NQ7A 1JZ2A 3COTA 4KGJA 3N14A 5FF7A 3W7NA 2EPLX 3PWAA 3R43A 1VYPX 2ZE0A 4WVXA 5CPMA 2PPGA 2PWUA 3R11A 4PUJA 3P84A 3LRMA 2D3NA 3WO8A 3RCMA 3VCNA 1K70A 1R9ZA 1UG6A 1GEHA 3PWGA 2XGZA 1KRBC 3O15A 4GPNA 1ZPTA 1DKWA 1EQPA 2WB5A 4QG9A 1NOUA 2VMFA 1PIGA 4DX3A 4LYRA 2JKPA 3E5BA 3M5YA 3WLRA 5MKGB 4CQBA 3PF3A 4W8LA 1AODA 4H7CA 2Q6ZA 4S3BA 3CQ0A 3VGFA 3K46A 3E0FA 3VIKA 3GC4A 3DFOA 4QEHA 3TTYA 3UZYA 5HQMA 5HANA 3STEA 2PWHA 5BXRA 1I2PA 1W2PA 2BB0A 4HQVA 4D1IA 3AAMA 4UTTC 4DM1A 4GD0A 1E6PA 3O16A 3H55A 1YW1A 4PCSA 2GDUA 2D2GA 2NUYA 3FA3A 1UR3M 1XL9A 1KXVA 2ZDSA 3FAXA 4C90A 4Z1YA 2EQDA 2PTZA 5MHBA 1GEQA 4H9YA 3KL5A 4JCLA 4WUIA 5HQLA 2B0MA 4AISA 1QPOA 4Q4PA 1OX4B 3A5FA 3QTPA 2GQ9A 4DY1A 3RR1A 3EDEA 3QBUA 3U6WA 4B3ZA 3HGSA 2FZBA 2OXNA 1ISYA 4LS2A 5D2TA 3MANA 4WGHA 4DPQA 2CZDA 2XM2A 2KZHA 3G3DA 3T2QA 1C93A 3WLLA 1E9LA 2NW0A 3LPPA 3ITGA 4MAVA 2VGGA 2XWEA 5A2AA 4UTUA 1T8QA 3N3TA 4PUEA 1PKNA 2BFGA 4GIAA 1Q6DA 1P1MA 1UCWA 1XCFA 2R24A 1KBLA 4O0ZA 2BXYA 2MANA 3JUGA 4L4OA 4RNHA 3S3GA 4QSHA 2YKKA 2ABBA 4DJFC 1V02A 3GW0A 2E5BA 2Q3RA 3BAJA 2E1DA 1F9CA 3T0BA 2FPTA 1XYCA 2ZA3A 4R5EA 1O6IA 3AALA 4UQCA 3V1PA 1GG0A 2HWGA 3UXKA 5BOEA 4GCXA 2ZWYA 4GVFA 2WM1A 4GZJA 3GXPA 1JYXA 3L4YA 2O0TA 2NLYA 1A5MC 1MQQA 3PPGA 2QNEA 3SN1A 3W6LA 3KDNA 1DIKA 4FLQA 4FK9A 3LHZA 4C6DA 1C8VA 1W32A 3W9ZA 1F74A 1FWTA 3CPRA 1UUMA 2D2OA 3FLUA 3HG3A 3FJLA 1OX5A 1J01A 3ARQA 5LHEA 5I79A 1RD5A 4HMNA 2VFHA 1V5XA 1S5NA 4F40A 3C0QA 4NF7A 2EEXA 2WYSA 4HCLA 1Q6LA 3NJ3A 2HVNA 3VNIA 1K8CA 2BG5A 4GUGA 4DO5A 3GB6A 4GXMA 1UD6A 3W1MA 3SCPA 1S2WA 4MNJA 1A47A 1DL3A 2E6DA 4M56A 2DZSA 4GJIA 2E77A 4GQQA 1JCNA 1EL3A 4IFOA 4YCOA 5LIYX 1MXDA 1UD5A 3PZMA 2EHHA 1Y7VA 3K4AA 4M6VA 3Q58A 1UMYA 2D0HA 1WDQA 1SUXA 4ICMA 2PLMA 5I06A 4L4LA 3HGOA 2GYIA 2BASA 2C16A 2PEVA 1F6PA 1JULA 4H8VA 1XP3A 1PKLA 3H21A 2FQIA 3N9KA 4AWUA 3PB0A 3R8HA 2BY0A 2JF7A 3AIBA 3WNOA 1UR2A 4CQCA 1UPPA 2GWGA 5CQ1A 4ZE5A 1XLJA 2J7DA 1T96A 2FZ9A 1H2JA 1P48A 3LCFA 3VIIA 4CQAA 5DX7A 3MSRA 1J0YA 5BCAA 5DXXA 4EXAA 3SM0A 4WQ6A 2VD8A 5A3HA 2X40A 2W61A 2X09A 4RE2A 4U33A 5CPTA 4ZOEA 4PTMA 5AVHA 3VCCA 2PWGA 3GFYA 4ZODA 3WFZA 1R30A 3WK0A 5LNSA 3ZSTA 1ZJHA 3LV6A 4CD8A 4L1GA 1X6NA 3VD3A 2PF8A 3OIXA 2ZUTA 4MY8A 1REQB 4X2RA 3BOXA 2HROA 1E4MM 3RMJA 1DJZA 3WH8A 5C8BB 2Y7DA 2ZRVA 4K36A 4S2BA 5FIPA 1TIWA 3BLPX 2ZUUA 3WF3A 3LV5A 3JZUA 1VFUA 3W70A 1PCWA 2A0NA 2RKXA 1PYMA 3RJXA 3QZ6A 2I17A 4DPPA 3CZ8A 1XICA 1Q6QA 3M07A 3QV8A 4Z0SA 3IRDA 3KVKA 5CJMA 1LDCA 2Z7GA 4K3ZA 5A8QA 3W38A 4M29A 1QVBA 3CLWA 3MI3A 5GNYA 3AIQA 2HBVA 1LRTA 3CWOX 3OHMB 1EUNA 2GSEA 4HPNA 4RDYA 5J04A 4E4PA 1H0GA 3IS4A 5CH9A 2ON3A 1E0WA 1H7PA 1Q7QA 3FGCB 2G41A 4IP7A 4D6HA 5CGTA 4M0XA 4LAZA 1KBKA 2OWWA 3BLIA 3UR8A 4F0LA 2Y89A 4ZO7A 2ZE3A 4F8XA 2CKSA 3LNMA 1OGGA 2WKGA 1A0DA 1HP5A 3E6EA 1SFTA 1VAHA 3GY1A 2OGYA 1BSLA 3QV7A 2J25A 1PB0A 3HQOA 4NJJA 3SJ3A 5C0QA 2AMXA 1M01A 3P81A 4GO8A 1VD6A 5AC4A 1KR0A 3MB9A 2YL8A 4JTSA 1AK5A 2YPIA 1MYRA 3VOCA 1TELA 3LENA 3RPDA 2Z28A 4O13A 4ZOCA 1U1JA 3GQYA 1KC7A 1HGWA 4Q7NA 4O54A 2NVDA 1CXFA 2XGBA 4X3ZA 2RDXA 4DXXA 3EWCA 4Q8NA 1R6WA 3CUJA 2G0WA 4Y7EA 1WPCA 4PUMA 2J8TA 4NZ3A 4PCFA 1HKMA 2C71A 2ZZ5A 3R0KA 3SY8A 2Y4SA 3IUHA 4ES4A 3W23A 1XIBA 4PCTA 1DE6A 3RRAA 5HMDA 4ZOAA 1SGJA 5FSDC 3FXYA 4R7OA 3LN3A 3L9CA 1M9HA 4JKMA 4LVGA 1W9PA 3BZGA 4PMJA 4L1XA 1XI3A 3V0SA 4HCDA 2FTYA 3S2MA 1IR2A 5AC7A 4BY3A 1MWOA 4A6GA 2ZA2A 4HMCA 4DJDA 3I6TA 1PTDA 5E6YA 4QHRA 1BWLA 4IUGA 5C9WA 3S1VA 3ES8A 1W54A 4PE8A 1E9IA 3NURA 5MKGA 1FQ0A 1UWTA 1P4CA 1EZWA 5T9CE 2YB1A 3ES7A 4JYFA 2Z2AA 1Y8BA 4RZBA 2VC9A 4EAMA 1KM1A 5BMWA 4UTFA 3FFSA 4R27A 3E0VA 2YL5A 4C1KA 1XLEA 3OYZA 3FHQA 2W66A 1ZSXA 2X42A 2AL2B 4QS6A 1S1RA 3KOZA 3WH7A 3O8AA 3N9SA 2WQDA 1OYBA 1IXPA 2EPOA 3D3AA 1GG1A 3AZRA 4MZYA 4DI9A 3SZ8A 2OWCA 4I7UA 4WDXA 1O5RA 3L2MA 2BDQA 3W83A 5CBIA 4YVVA 3W7EA 1QNSA 2QCLA 1OK6A 3RCYA 1RALA 1XH2A 3G0SA 1HUVA 2L5HA 1KCLA 1OX4A 1SW3A 4B90A 4FLOA 4DEFA 4CNTA 1VPQA 4OBTA 1VJIA 1G4PA 3VD5A 3WQ8A 2FTPA 1VBHA 4AH7A 3VZXA 3FX4A 4XO6A 4J35A 1FWFC 2XIQA 3WLTA 1W37A 1NQKA 4FEZA 1U30A 1LOSA 2CBIA 4DBUA 1E4NA 2QUVA 3OQEA 3ZR4A 1THFD 5KMYA 1MVYA 3USBA 1FWNA 1NIUA 4JN8A 1R85A 3A23A 2E09A 1TV3A 3R0DA 2IQTA 4XZNX 2ZC8A 4JX4A 1BAGA 1ENUA 4ZTXA 4S38A 4MDOA 1DXFA 3W88A 3APGA 3M0XA 1EYEA 1YE4A 1TRIA 3ZOAA 3TW6A 3JR2A 1XR2A 2XN0A 4UR8A 1CXLA 2Y61A 4ASTA 3W7DA 4IGHA 4O14A 3M7WA 3ZWSA 1KQYA 4FMVA 1LL4A 3B0PA 4OHQA 3Q4DA 4QE5A 4HTBA 5A6TC 2VR4A 2X2GA 5H91A 1S5VA 3L4ZA 3PUEA 4JHZA 4DUXA 3NQ2A 1RXOB 1S5WA 3VE9A 4J7RA 2E8ZA 5EMUA 3BAYA 3UCDA 5DRIA 1OM0A 3STPA 3E2SA 4UR7A 1PBGA 4S39A 2VFDA 2INEA 1XYZA 1ZAHA 2ACSA 3QTGA 2VUYA 2CERA 3NM1A 3UWYA 4EXQA 4EE9A 4NXKA 4RK8A 3K8MA 3STGA 3MUY1 4IX2A 2ZX5A 4QROA 4G6CA 1QBAA 3FA5A 3G1SA 1O68A 2WLZA 3NPXA 4E8CA 3QOKA 1XIEA 3ABRA 3GNRA 4ENLA 2FH8A 3CUXA 3I3BA 1KO0A 2C13A 4HZ8A 2QYGA 3RMEA 3LQLA 5E9AA 1A80A 2I9UA 5D04C 1TFVA 4NJGA 1UQZA 1Q85A 2E9BA 1JF6A 2Y6ZA 1AD4A 4JFUA 2ATMA 3W4RA 3WNMA 3E9AA 4C6FA 1MUCA 3AMDA 2A4AA 3SCSA 1IQ8A 1SZFA 3CGTA 2O92A 2QJIA 5I23A 3URNA 2V9DA 5DF0A 3E0IA 1X7IA 3UR2A 3S5NA 3KW3A 1IZCA 1B0IA 1UZDA 4JTTA 2PD9A 4HU4A 1MSSA 1SZNA 1WKDA 1JDEA 1I2OA 3ZT7A 4V1XA 3VGDA 4MG4A 1RVKA 1WCGA 5JIPA 3SQMA 1OCBA 3T55A 4AWEA 3IV3A 3BQ5A 1L6GA 3K8KA 1QK2A 2WWCA 1XLGA 3TR2A 4JX5A 3SADA 3IARA 4H04A 3AU2A 1BWVA 1KFEA 3SIMA 4MWAD 3E2RA 4C91A 1ONWA 2OT1A 4RL3A 1REQA 3I68A 1XD0A 1G6CA 4AD2A 3AJ7A 4U3AA 3C2EA 6ENLA 3WQWA 3DHPA 1R9XA 1VKFA 5K7JA 1ZP4A 3VO0A 5KZEA 4O53A 4NUWA 3PPHA 4WJXA 5HR6A 2ZZ1A 4QG8A 1TE6A 1DYSA 2ZRXA 1G7UA 3MPGA 2IXUA 3B8IA 4HKPA 1J10A 2VEIA 1W56A 3TMLA 1UP0A 1HGYA 3HU7A 4NAEB 2E9MA 3LXBA 1DWFM 4YLWA 4LXFA 2A3LA 3WNKA 5AHMA 4PMDA 3T07A 2G96A 4LB4A 3RR4A 3GNNA 4WKHA 5C6MA 1M7PA 3OVQA 4XX6A 4ATDA 3ONCA 3FGCA 1MEWA 1R8LA 5I3DA 2I16A 2F7FA 3SCRA 1O5KA 4LPCA 5I7GA 1QU4A 2BY2A 2XVGA 1YLVA 2F2HA 2WJFA 4QBXA 2PWEA 4PFHA 4DXVA 1LG2A 4H3DA 3SCVA 4UCGA 1PUDA 1WYIA 3OHIA 4D8LA 5EGRA 1AQ0A 3EDFA 3P62A 1Q8JA 3WF0A 3VKBA 3RNDA 4A8RA 3VIHA 2VL4A 2PDUA 4NSBA 4NZJA 4EPKA 5C2GA 5CKSA 5D32A 5H8PA 3SRKA 5C54A 2OQLA 2HNHA 3UA4A 3PAJA 1OT2A 5D37A 3TYUA 3LXCA 1W0MA 3LLXA 1CIUA 4FA3A 1TWDA 4D2JA 4JIEA 3D6NA 2IKIA 4NASA 4LYQA 4F2BA 4Y6GA 3N2TA 3ZT6A 2PDIA 2XISA 4JIQA 2J7EA 4FIQA 5DO8A 2MNRA 5I02A 4E2BA 3FV9A 3W2LA 6REQB 4R3UA 3CT7A 5AHEA 2VDHA 4LVBA 1EEPA 2J24A 3NQVA 1KM5A 2DVTA 3G8RA 1ZCOA 3W86A 3NEVA 3CIXA 2Y7GA 4M6UA 4DNHA 1HJXA 2GOUA 4LANA 3EXTA 4ZQRA 5LXEA 2ZZ3A 4IH3A 4B2DA 3PZUA 1D2KA 4H9TA 3STFA 3VYLA 3P67A 1JYWA 4OOUA 1I1XA 1Q6RA 3ABQA 3H2EA 3U4AA 4WD0A 4JPGA 3FJNA 1A4LA 2HCVA 3ARUA 1XGDA 3TJIA 4UFLA 3VKDA 1L6YA 3UXIA 2VELA 2YLLA 3KWXA 2OLSA 4QE1A 1V8EA 3WMSA 1T8XA 4Y9NA 3GR7A 2FHFA 5HMSA 3SSZA 3W7GA 1V03A 1TE1A 4AW7A 2GJXB 3I7QA 1VGAA 3WEZA 4H00A 1J0KA 1EEXA 1DXIA 1EWDA 5LIWX 4AHOA 3HPFA 4M1BA 4JX6A 1TR1A 1A5CA 4JYEA 2JIEA 1JXKA 2DV0A 2AL2A 4GYPC 1GONA 3UY8A 4Z08A 3QN3A 5DRCA 3ZT5A 2WSRA 2J7GA 5G1TA 1WZAA 4GNKB 1U1HA 2YFNA 5DQPA 1G69A 1CLVA 3L0NA 4N9DA 4HPHA 1W3JA 1UB3A 1M5WA 1RZMA 1GQLA 3AWNA 1FX6A 2BODX 1YDNA 4L6OA 3S1GA 3VKAA 3BICA 3O6YX 3AIUA 2WJZA 1LWIA 2H8XA 2OGJA 2V63A 5C2XA 2R91A 1VIWA 4Q8UA 1JUKA 3UBPC 2Z00A 1LBFA 3TMQA 4BI7A 3JZEA 1VH7A 1ZZMA 1UOKA 2V38A 4QEEA 2PRHA 1AJ0A 3N11A 4QDWA 5F4WA 4AMAA 4H83A 1FWGC 1A5KC 4PBEA 5HNTA 1NOWA 1XPYA 3NOEA 1M1BA 1K8XA 1UUQA 3TFCA 4PFMA 2JALA 3FSUA 3LB0A 4UTKA 4DWSC 1PX8A 2P8BA 4QLLA 1QK0A 1JVNA 3C0SA 1NFGA 1R5YA 2NUWA 1OCNA 1CW2A 1TG7A 1XLKA 2G3MA 3MHGA 1H3GA 4RUBA 1DJNA 2RFGA 3VZYA 1TPWA 4IXXA 3R1ZA 4XZLX 1VBUA 3VM5A 1US2A 3AMCA 2GVJA 3C6CA 4M7SA 4PMYA 4CD6A 4UFKA 1W9DM 1PZ3A 2OO0A 3W7HA 5E9XA 3GIPA 4U5IA 4C6PA 3PC0A 1WAWA 4RDWA 5M17A 2FPYA 3M0LA 2OOFA 1NF0A 3S2NA 5LZLA 1ITQA 1VHNA 3KBMA 3URBA 5BWAA 4JN6A 2PMQA 2GVLA 2ZZ6A 4W85A 3MO7A 1R0MA 3U9IA 1EZ2A 1YKWA 1GYNA 3BTNA 1FFRA 2C91A 3U4FA 3G6LA 5AYBA 1XYMA 5DT7A 4PL2A 4H6EA 5IFPA 1BYDA 2OZTA 3VC5A 3WG6A 3OIHA 3TE9A 5C55A 2D2JA 2O7SA 4AU0A 1H7OA 1NEYA 2E8YA 5LIUX 3MVTA 3JS3A 3VVGA 1R2SA 4I9AA 2YFOA 3RUBL 1ZBWA 2BXVA 4UB9A 1WDWA 3CV6A 3PBWA 1OFEA 2HPIA 1VQTA 2AQWA 3VAVA 3OGVA 1QDSA 1SO5A 4GJJA 1JD9A 1LTDA 3TJXA 1F3WA 2ONEA 5GNXA 3DI1A 1DWIM 2J79A 2VFEA 5TQLA 3WFAA 3PNZA 2VVNA 3F5JA 2Z1SA 3BPWA 3LG3A 4XKYB 3R25A 1AMKA 4XAZA 3GAYA 1TKKA 4WZHA 3M0ZA 2DFAA 4DAIA 3EB2A 1G4EA 2ZTKA 4J28A 1E1EA 5AKQA 3RM4A 1D3CA 3B0XA 3KX6A 4S1FA 2I5QA 4H4IA 2QV4A 3HFTA 4AXKA 3WBXA 2I1OA 3LM7A 5FJJA 3W6YA 1ONEA 4TUFA 2W4XA 4JNMA 3RDKA 1KWGA 3GDLA 3PWIA 3O7UA 4IL2A 2YZ5A 3W22A 1W9UA 3PJXA 1W3LA 5A2CA 3QPYA 4LBSA 2YLAA 4HHMA 2FJUB 2Y0FA 3M0JA 2C1GA 1TJ0A 2XTKA 2OMAA 3P8IA 1FP9A 4L7ZA 4MZ1A 1NDVA 4ATWA 2JQXA 4R53A 1LM1A 2PC8A 4Q4MA 1OFRA 1YIXA 4XD6A 2D0GA 4GIEA 4Q4RA 4K68A 2NXGA 4C60A 4NAEA 1I6NA 1EA9C 1EJTC 3PZTA 4FF7A 4B91A 1BFNA 4G7EB 1FHUA 3R58A 1IT7A 1XLMA 5FI8A 3TONA 1XDMA 3U7VA 1BVZA 1ZHAA 5HDRA 4JFVA 1UA7A 4YU1A 3G0UA 3HPSA 3AOFA 2WKJA 1V6VA 4HMDA 3NYZA 6CGTA 5FJTA 4RZ6A 2C19A 4CU7A 3SGZA 2CXEA 3PPFA 2CZ5A 3VXGA 4HSHA 3EX4A 3ENLA 3RM9A 2HE8A 2PTWA 4QAWA 1NDZA 1TV2A 1US3A 4JTLA 4J9JA 1QW7A 3TP4A 3GZAA 2TRSA 4B2DD 2R1PA 4QNEA 4NYYA 3N2CA 2PUZA 3AIEA 4NZ5A 4O4WA 5C2CA 1V6UA 2ZX9A 3HIJA 5K4ZA 4UNKA 1LLOA 1R3WA 5ABGA 1EF2A 2XZ9A 2PWFA 1K4HA 3KLKA 1A0EA 1GPFA 3E96A 3U5YA 5D8WA 3BVJA 5U4NA 5M3WA 1K4GA 1XSJA 3T4CA 3ID7A 3UXLA 1HO1A 1FCVA 4HMEA 4KETA 1I9CB 1C9DA 2QGYA 1LF1A 1XLDA 1UASA 3KOYA 3A4AA 3ZLFA 2BTMA 2VVSA 3NZRA 4J3WA 1PEZA 1XH1A 2V69A 3WUFA 3MUCA 2VCAA 3QGAC 3G1FA 3GD6A 5ECUA 2YIHA 1HFBA 4PH6A 2Q8ZA 4DN1A 1VCFA 1TSIA 2B81A 4MVAA 3CZKA 3F5KA 3SW6A 2P88A 4B5NA 1WX0A 4IP5A 1A5NC 1W3NA 1A53A 4O1DA 3GG1A 3M0HA 3RITA 2NX3A 1LROA 4EWJA 3QQ0A 1EP3A 3KRUA 1OGSA 4H7VA 3AHXA 2QJJA 3CHVA 3F2BA 4RCXA 1ADOA 2GJXA 3THDA 4JNZA 1YNPA 3GXTA 5JBDA 3LCGA 1PTAA 2FJKA 4LY4A 1J5TA 1LL7A 3URAA 3W28A 4IJBA 4U2YA 1OG0A 4LAUA 2YDQA 3CUHA 4HA1A 2V6AA 1CECA 3VM7A 1KA9F 3AUOA 4IIDA 1MRQA 3LPGA 5ABHA 2V2DA 4WKFA 1UP3A 1YPFA 3RK8A 2VXNA 3ZR6A 1JJKA 2FHBA 4MNKA 3W7KA 1QR7A 3LLDA 3TQPA 1HQTA 4GE8A 3L65A 3U5UA 1X6UA 1LLZA 5KINA 5D05A 4DZIA 5KZ6A 1BVNP 3TSDA 1OB0A 1X6LA 1OWQA 3LU2A 4LOCA 3UG8A 3PY2A 4AC1X 3T4WA 3ARXA 4QCFA 2ACQA 1A3WA 3EOEA 5EKYA 4O17A 3Q2DA 1TWIA 4AWSA 1O1ZA 5HAOA 5AC5A 2WO5A 4ZB2A 5E0CA 2Z2UA 2QIIA 3MW7A 1D7FA 1FDZA 5C9UA 3U2OA 4DO4A 4BQ4A 2C7FA 2V3DA 4ZMGA 4MB4A 3AU6A 3E0LA 2ZX6A 4JAWA 4ZGYA 2PRLA 2YOCA 4BR1A 3DFYA 5A6LA 3SUTA 3PZNA 3C3UA 2WVUA 4AXNA 4RW5A 1B3ZA 3I65A 3DZ1A 1ITXA 4PTVA 2GVYA 2VEKA 4AYSA 1B3YA 3HV8A 3GH4A 3VOFA 1JZ7A 4F0SA 4RR4A 4WDWA 2ZIDA 3CMGA 3UETA 2QDGA 2IMRA 3S9ZA 4IMEA 2DJLA 2EGZA 1WDPA 1S2AA 4DUVA 2CBVA 3CEUA 3LGGA 3LTSA 2NXHA 3OVGA 2HISA 3W71A 1K9DA 1TJ1A 4GA8A 2RJHA 5L6UA 1RA0A 3HG4A 7ODCA 2GUBA 1T99A 3DFQA 1E6SM 3BUVA 1X1OA 4H7ZA 1EFZA 1GKRA 1KFJA 1O5XA 5AC8A 4S3GA 4O52A 3E3HA 4XZMX 1U22A 3WSUA 1JFXA 1VS1A 1GZ1A 3CXOA 5C9RA 3GDRA 3CM4A 3VD9A 3WMLA 4C6BA 1H7RA 1JUBA 3DDMA 3DG7A 4KW2A 3IJIA 3PTQA 1IV8A 1MDRA 4E2OA 4GOAA 1X98A 2TMDA 2QUMA 4WY0B 2FGBA 4JS3A 5E1QA 1CZ1A 1T40A 4KT2A 4PMXA 4KERA 4BWLC 4TO8A 4Q3MA 3VNJA 3BW3A 3VNKA 3QV6A 4XKYA 3DCPA 3DU0A 1W2VA 1XKJA 4L4MA 2Y7EA 3M0KA 2YCJA 3WDRA 4MPKA 4W7UA 4NI3A 5DANA 3JRKA 3AMKA 3LHYA 1XFBA 3UD6A 4GISA 1TVPA 2QR6A 2WPGA 1LZOA 2GJPA 3OA5A 4FNQA 4A8IA 3NL2A 4JTGA 1AZ1A 3SRDA 4MADA 3W01A 1RJRA 1BVWA 5CPQA 2DIKA 3EKGA 3CS2A 2PSNA 4NZFA 4KRTA 1S2CA 4XD5A 2V0TA 4WY0F 3NM3A 2YSWA 1WNOA 4BEUA 3WDIA 1RK6A 5E0FA 4F0HA 4TOQA 2VR2A 1TIMA 2GGEA 1XGEA 3GS6A 5FL1A 2QVHA 5IBXC 2HVOA 3W2MA 4UQDA 1QWKA 1J6PA 1P6WA 1M03A 4C6NA 3GDBA 4LBRA 2QGHA 2DZBA 1A5LC 1XRSA 3E74A 4XZBA 3TQVA 3VNDA 1ME7A 1TB3A 2WBKA 5GJNA 3TYEA 4G7EA 1OC5A 2PTXA 1DP0A 5JVLA 2BNJA 3F03K 1HP4A 2J6XA 4BF9A 3LDVA 4QFUA 1X8FA 1QUMA 5B80A 1CI1A 4DYJA 1WOAA 4ML4A 2DVXA 5HQEA 3SIZA 3HFYA 3GKAA 3WLOA 4M3PA 3ANVA 2G37A 3LPFA 4E2VA 1BGGA 3S9YA 4LAMA 3AXKA 4P5UA 3CIVA 3NSNA 3GDTA 3N4AA 3S6OA 2YYTA 1WUFA 2UBPC 3SR7A 3CV1A 1H4PA 1NM9A 4Q6JA 3THQA 1NWUA 2VEPA 4WOQA 1HW6A 4JTIA 1HVQA 5GQBA 3FYYA 4EXBA 3LSCA 2QCFA 5FEWA 3BMWA 4MB1A 1V02E 3GC5A 3JU2A 4M1RA 2VYOA 4G1KA 5I3FA 4I8YA 2WVVB 3WH9A 5CBBA 1DHKA 3ALGA 4YWSA 1E55A 4IPPA 3BXWA 4M51A 4XVEA 3UYIA 5LGXA 1CXKA 1WKEA 1NAL1 3PJWA 2MUCA 1MW1A 4AB4A 2A85A 4O8RA 2VEFA 4XWUA 5I09A 2BLEA 1JAKA 3NQGA 1RCXB 3Q65A 2ZFAA 4HJFA 5HXMA 3QZAA 4X9YA 4FXJA 4BF5A 5K9CA 1OABA 2A1YA 3HB9A 1DTUA 2Z6IA 3UA3A 3KWSA 2YDRA 3L21A 3N6JA 3N12A 3S1XA 3N9RA 1MUMA 4NNBA 4LSBA 4D6JA 1KGWA 2DVUA 5JUVA 4DUWA 4ILSA 3WH5A 4F0MA 4UMAA 1TWZA 2FVLA 1GOMA 4H9XA 5EBAA 3WFLA 2WHJA 2XIOA 3CHFA 3UXDA 1VFSA 4IGSA 1YTKA 1E3ZA 3VIFA 5HPOA 3SRFA 2QMKA 4JIHA 3FS2A 3C2VA 4LCSA 4JTUA 3GXIA 1AW1A 1JZ3A 3TN6A 1LQAA 3K5XA 4MFDA 5CJNA 2G95A 3NL6A 1LWHA 1YDVA 3FOKA 3HPZA 1OGBA 2VGBA 2EG7A 3SAZA 1ZNNA 4JEJA 3QJAA 5TBOA 1O60A 1BSIA 4AUBA 4MSSA 4XBSA 2J77A 4GABA 1FWSA 4AZHA 3ABOA 5B7ZA 3VIJA 1FWAC 3GNOA 3OODA 5HOSA 1AVAA 4HIBA 3AS3A 1QWGA 5FKYA 1TZ7A 2PRMA 2VNCA 2W0UA 4ZB0A 1VF8A 2ZXDA 3QW4B 4D6EA 1I2QA 2Z1XA 2G50A 3TJ4A 4B3KA 4AZ7A 2Y85A 2ZX7A 3WN6A 5EB8A 2Z2BA 3S42A 2ZCGA 3OEXA 3UZ5A 2E6AA 4PB5A 3TLLA 1WA3A 3KVJA 1DIEA 4V27A 3IRSA 1W9XA 4M5PA 5CSSA 1MEIA 5CXPA 2WZIA 4UOQA 4R7JA 3U57A 4QJ4B 2FFCA 1MEHA 4K37A 1DXEA 1XINA 3W1PA 4WJ8A 4M8UA 4ORIA 1EYWA 3MYOA 4PMVA 3MV01 1MRAA 1F73A 3SEPA 4LGXA 1KR1A 3B8WA 1NTHA 3LGDA 1DPMA 3QKZA 1E6ZA 3L12A 5D9PA 2YXGA 1VB9A 3SECA 2PDNA 4YHGA 1ML1A 5KSWA 1GVSA 4HCHA 2BWGA 4GACA 4E4UA 4KRUA 1FHVA 1T6MA 3L23A 3N4FA 1PPIA 3LSBA 1E56A 3EPMA 2E28A 2D20A 5D30A 2CC0A 5IHRA 1XWYA 3LCLA 1EBHA 3KRZA 4ZOBA 1FWWA 4S3FA 3ARRA 4WOZA 4DLFA 2NQJA 4ZFCA 5JH2A 2SFPA 1H60A 2J75A 4PCPA 3EMQA 4MFEA 2JKEA 1VC4A 4L9XA 1P0NA 3RAOA 4NIRA 5MF5A 4Z2JA 1KFCA 3NEHA 4PB3A 1BF2A 2EBNA 3LHTA 2PODA 4HA3A 1OC7A 5HBFA 4NJKA 4N6FA 5A8GA 1P0KA 5K9XA 4EWND 4HNUA 4WY0A 1W1A1 3G6MA 3A3HA 1CDGA 3CC1A 2WMFA 1SQ7A 1VZWA 1ISXA 1PDZA 3C0LA 4ZEPA 3UW6A 4AVOA 4PBFA 3OGRA 2VI0A 3GO2A 3V18A 1N7KA 3IV8A 3BG5A 3W72A 1DQWA 1F76A 4CEUC 4LCQA 2HZGA 3NGFA 3W7JA 2ISVA 5A8OA 4F0RA 1I0BA 5FJIA 3P0XA 2V3FA 7TIMA 4HSNA 1A5BA 1V51A 4O57A 1NFPA 1H7WA 1E9ZB 3AISA 1IXQA 4D8ZA 4AX6A 1Z32X 2BVYA 4G7FA 4DIAA 1JCTA 2IKJA 4DBSA 4F0KA 1W17A 3QR0A 4DWSD 1SZRA 1SO3A 2J8GA 1BWKA 2VC7A 4IJRA 1BF6A 3GXMA 1I60A 4JTFA 5I6SA 2O9PA 1WOBA 2O9RA 3NQDA 3P5YA 2J6VA 4UTIA 1QOPA 1OCQA 4N42A 1KLYA 3NZPA 3ORWA 3VIPA 3KBNA 2D23A 1UPMB 1KM2A 1VIZA 3BK0A 4LW7A 4BHYA 1L2QA 2A7NA 5T9BG 1PHQA 4NQ1A 1NF7A 3RO6A 1XYBA 3VMOA 3P7YA 1SR9A 2HEJA 2UY4A 4Y9OA 4LY8A 2G3FA 3FK4A 2WSKA 4M6QA 1PV8A 1F3XA 1UR0A 4F79A 4P2VA 1XQKA 2VURA 2PDKA 1KW1A 2O56A 1ZALA 3WQGA 4AY7A 1T0OA 3EWXA 3R8RA 4HVXA 3DX5A 3GUGA 4JTAA 1E51A 2H9AA 5D2XA 3BV4A 2YCKX 3S5YA 4Q8VA 4IFKB 3P0WA 1L6SA 1Q3NA 1VENA 4IWWA 5K4XA 3CYVA 4XQ6A 3BGGA 2YCLB 2OYMA 2A3CA 2V5BA 1XBYA 4HBKA 4CNOA 3ZQ9A 4WXYA 3RF9A 4O11A 3L2IA 4MB3A 3L0KA 3GVQA 3UEQA 2XIMA 5HINA 3B9NA 1WKYA 4RDVA 3B0YA 2DZXA 1F3TA 2CLOA 2O4MA 3BO9A 4Z1BA 4O1AA 3CQJA 1XYAA 2W6RA 4OGZA 1XD1A 3AYVA 5D9MA 2BVWA 5CZTA 3T0CA 1X7FA 4XG1A 1O95A 2OT0A 2BXZA 4ZA0A 3VDCA 4PMZA 3PG8A 3GTNA 4O10A 1IE7C 5CEWA 3VDGA 4EF9A 3CO8A 4E8DA 2YXXA 3SCTA 3ARZA 2I14A 4J3ZA 1V3IA 3WLIA 2D0FA 3EWWA 3IJDA 2XH4A 1TREA 4FOKA 3GWQA 4CCEA 1XLCA 4F48A 5BMXA 3F4DA 3IPWA 2V81A 2PDXA 1AJZA 3U0HA 2P5NA 2XG9A 1CGVA 1HJQA 4I90A 3TAKA 1K7EA 3LBOA 4R9XA 5CZKA 3KHDA 2QJHA 2VC5A 2FMNA 3TNOA 4EF8A 4K6AA 4FXRA 3IVTA 4BWLA 2YBUA 3IAQA 4AIEA 4GVIA 3KM8A 3G2GA 4H2HA 4YTSA 5REQB 4OIFA 1CXHA 1UMLA 4GG9A 4Q6XA 3SN0A 2O7QA 4DQWA 1WBHA 2WMHA 4AWTA 2C15A 1XIHA 3E2VA 1ZFJA 4LUIA 1E71M 4HYRA 2DH2A 3BARA 4GUIA 4BKNA 3S6TA 1NY1A 1K9EA 4CN6A 4YHEA 3RILA 4GBDA 4GC4A 4PTDA 5EMMA 5KZDA 2QJNA 4CVWA 5T8GA 1E6QM 4DB7A 3EEGA 5BRQA 3TOPA 3RLGA 4UQAA 1QW8A 1BXCA 1XRVA 2PBGA 5CG0A 1O4UA 3TQKA 1YBQB 3ABSA 3LCXA 1KM4A 2EJ1A 3DGBA 2EKGA 4KFOA 3TWBA 1GTEA 3R12A 3J7HA 1T41A 4UMCA 4ZXLA 4M7TA 2ZZ2A 2VX4A 1WB0A 1ESWA 3AXXA 4H1ZA 2NQLA 4ERAA 4REQA 1O1HA 4OKDA 3UWUA 3ARSA 3UF9A 3NZGA 4YXGA 1RJQA 3LQGA 1TWWA 4IISA 4HU3A 1OVDA 4R9OA 1IEIA 2V2CA 2YGYA 5HJXA 1HL8A 4A35A 4IG2B 2WC3A 3NQEA 4AD5A 3W1LA 5LA2A 3IANA 3LCIA 1I2RA 4HN8A 2CBUA 4ML9A 1YXCA 3BURA 4AYGA 1YPIA 3VMNA 3G1VA 2ALRA 3DERA 3GHRA 1OYCA 4PRWA 4JIPA 5BWFA 3OVRA 1KTCA 3FJ6A 3AIRA 3EPOA 1YTDA 1PIIA 3KBWA 5EMYA 3O0FA 4S23A 4GFIA 3GZ3A 4PA8A 1TV4A 3CQHA 3P61A 4HOXA 2BOGX 3BV7A 3VKCA 1W1IE 3TK7A 4CGTA 3QZEA 1TUXA 4QISA 3KVMA 1JF5A 4US6A 3VE7A 5CZSA 3TCEA 4CKQA 2HSAA 3UCCA 1SJBA 2QQ6A 3AI0A 1XV8A 3FEMA 2JGYA 3CASA 4AX7A 1V93A 4LT9A 1FRBA 2IW0A 3QQWA 2NSOA 3WUEA 3UG5A 5DN1A 3PAOA 2ZRYA 3APYA 1QNVA 1C7TA 3NPUA 4RW3A 1QMLA 3K1GA 3NNTA 4UUIA 3ZZ1A 3WMBA 2BVTA 3VFCA 1ZB5A 2VZTA 4LF1A 1XBXA 2Q71A 3QOMA 3CHEA 2ADAA 4HPGA 2WC4A 1V3HA 3HPAA 2I5IA 3ERPA 1B3OA 2ZUMA 1JPDX 1RHCA 4NAFB 2EPHA 4GZ7A 1NP2A 3AS2A 2V68A 3UR5A 4GNVA 3WL0A 5FL0A 1Q2SA 1QTWA 1YNYA 3DOPA 2WBGA 4RXFA 2PZNA 2WW5A 1GORA 4PMQA 3U3HA 1TZ9A 4UQBA 1ONXA 1UZHA 4WEVX 3F7JA 1KKRA 2XVLA 3AC0A 2VGFA 2QF8A 3QFWA 1Q63A 2NV2A 4L1WA 1DJHA 1SR0A 1XBZA 2B7OA 3HJZA 1M04A 5KETA 2E67A 4WDTA 1M53A 1OJXA 4YYFA 3FA4A 4LV9A 4LNCA 2QXWA 5RUBA 1OQFA 1N82A 1GOXA 3WD4A 3TTOA 5FF0A 4NZ4A 1JCMP 1DORA 1FWCC 1M41A 5FAGA 1TZZA 3HBLA 2CLEA 2ZRUA 2JEQA 4IMGA 1ALDA 3ABXA 1AUSL 4KFPA 4MNMA 2OEMA 3N18A 3V5OA 2RDWA 3EWUA 3EWBX 1BYCA 2FGLA 3KEHA 4FB7A 4H9VA 3NOYA 3PNUA 4JTQA 3NDZA 4BJHA 3W87A 4Y8EA 3W76A 3G18A 1PZ1A 4W7VA 4X61A 4K7YA 5FD0A 3THCA 1N2VA 3V5FA 4IIBA 3UCQA 2OQHA 3CZEA 3OLGA 4GI9A 2PD5A 3PVFA 4UXDA 3ARPA 2GJNA 1G7VA 4FNRA 2VUNA 5IXEA 3UY7A 3LM3A 4XBKA 5CPSA 4KESA 4NZ1A 1E72M 4HNLA 3DHDA 3LUTA 1E0VA 1CTNA 4YMZA 4IFKA 2JF6A 5CLTA 5A6SA 1RPXA 4MWAB 1XS2A 4P7NA 4HP5A 4QDMA 3SFKA 4EPEC 4Z0JA 2YCLA 3B4YA 3KFTA 1E5JA 3WLSA 3W02A 3N04A 2WNZA 1XYLA 4ZE4A 2HXTA 3NXFA 1OFAA 2DGAA 4Y9AA 5BZAA 3WY1A 5AVNA 2XWDA 4BEQA 4A3UA 1XUZA 5FJRA 5HNNA 5HMFA 2XIJA 4L6DA 1V0KA 3TLQA 2W67A 1DJIA 1HF6A 2G3IA 2VDGA 3WMCA 2CLLA 3VD4A 1QFEA 4E4FA 5BYWA 2QCCA 1GW9A 2GZXA 3PM6A 3W7IA 2WMJA 4ZFMA 5AB3A 2VWSA 5AYXA 3CBWA 3VNLA 5A6JA 3CLMA 2FB3A 2E6YA 1LCOA 1Q5MA 1Q6OA 5AOUA 4S3JA 3W7MA 1HG3A 1SW7A 4CN1A 1K02A 4CCDA 4AEOA 2PDLA 4ZQOA 2ZVIA 3PUDA 3MMTA 1KD0A 1XGZA 1VEMA 4L64A 2X8RA 3OBAA 4KFNA 5CLWA 3PZQA 1Q66A 3M1ZA 4JEQA 2RDUA 1WXYA 2VR5A 3KOFA 5GJMA 4JTDA 4PRTA 4NHVA 2FYMA 2PLCA 2Y7FA 3VA8A 4L6HA 3GXNA 5CSRA 3NXLA 3VCRA 4K8EA 2PDQA 1V3LA 3TXZA 3DENA 3MWCA 2IPWA 3VIOA 4Y9MA 2GOKA 1KXQA 1TPB1 1L8PA 2NQZA 3L4TA 3LMYA 3NVDA 1CWYA 1XIMA 3S2CA 4F2UA 1H61A 5REQA 4L80A 4JTKA 1I1WA 3KOXA 1HZYA 4HTYA 3AS1A 4A2SA 3M47A 1XLBA 1NJJA 3XIMA 3UU0A 3U48A 2AGKA 3MCNA 2PDBA 3DGRA 1ZQ5A 4CD5A 4QITA 2PB1A 1XCXA 4EAYA 5A6KA 2D1ZA 3C3NA 3KCOA 1RP9A 3UPMA 2AAAA 2DT3A 1YQ2A 3N15A 1W5NA 1J5SA 3VDAA 3LMZA 2FMOA 3B8VA 2HV5A 5T26A 3W7CA 2OLAA 4JTEA 4PODA 3K2GA 1VFHA 1YBQA 3ATYA 1H50A 4O0KA 2G8ZA 1C8QA 1FWRA 4CUCA 4IIHA 3NO3A 3V75A 4LUYA 2AAMA 2IQDA 4FX6M 3B04A 2XFWA 1H0IA 3T0TA 4KWSA 4HD5A 4P8UA 2A6NA 1GPWA 4LB3A 1XLIA 4PBGA 4ADUA 3N1AA 1SFSA 3IIVA 4H2CA 3WBWA 1QO5A 3WJXA 2WSYA 3WQ4A 4EK7A 1AQMA 4Y96A 2BGNE 1UD2A 2D22A 4IG2A 5D2WA 4JQAA 3MBFA 2PCQA 1LL6A 4QAIA 3Q45A 4ZL1A 5FF4A 1GOIA 2GVEA 3CUZA 3RU6A 4JYDA 1Z41A 1FA2A 5A2BA 3A4WA 4S3EA 1UHVA 3MSGA 2P53A 3FW6A 3BW2A 4Z1DA 3G1RA 1H62A 2OCZA 4LUSB 3T6CA 1TYGA 1UC5A 2DQWA 1LRNA 2FDSA 2C0AA 5A8NA 4GUFA 4LF2A 1H5VA 4IQLA 2QPXA 4FOJA 3N19B 4IF2A 1SU5A 1OBAA 1GJPA 1JFHA 2FKPA 2Z1VA 4WLCA 3GU1A 4DO7A 3AZTA 1XIGA 1G5AA 1NU5A 3GAKA 3V4BA 4J4KA 4TXEA 4A4AA 2Z25A 1SMAA 1W3KA 3M43A 5KZMA 1NSJA 2QCDB 2P0OA 3ITXA 4N4PA 2YA0A 3UERA 3D0CA 1CYGA 3GFXA 4MF4A 1Q45A 5M1TA 3GFZA 3SGGA 4CNUA 4KIEA 1C91A 3MUZ1 4G2DA 1TPEA 3EXSA 4FO4A 1EP1A 1VFTA 4O1EA 4WR3A 2R1KA 3CWNA 5H8MA 2OZ8A 3RRXA 2XIIA 4JR5A 2ACRA 3DAQA 4NAFA 3O05A 2Q3OA 1U2YA 4KQNA 3S1WA 2G3JA 4HK7A 2CETA 1K9TA 4GQBA 2Z0IA 3MBDA 2IQ0A 3G1XA 4KWWA 3I7RA 4FAMA 1G67A 3VOIA 4F3HA 3BL3A 1BXNA 2ZZ7A 3DC8A 1J0HA 3W85A 3EDDA 2CLMA 2RJGA 2TPSA 3M0YA 1JPMA 3PSVA 3WELA 1JGIA 3BLFA 1QPQA 3F2DA 3KTSA 5E09A 4ZQCA 5L9FA 3OPSA 7PTDA 6XIAA 5LKYA 1YE6A 1QPRA 3TW7A 2C1HA 4JL2A 1DQUA 4HHHA 4ZBCA 1LBLA 3ITLA 1POKA 3GVRA 2XIBA 4MPQA 3BW4A 1PHWA 6TAAA 1IT0A 4NKCA 1Q6FA 8RUCA 4XZIA 3B03A 1DOSA 4J5NA 1CB7B 2P8CA 3DN5A 1GZJA 4LEFA 2E68A 3L5AA 4J3TA 2A79A 3LLFA 4X9SA 1Q65A 1EIXA 5K9DA 3LBCA 1Z7AA 4IQJA 4IPNB 5D2VA 1M3UA 4KCVA 4XK2A 1XCWA 3SUUA 4YTRA 1OT1A 1W1ZA 2LLEA 2ZUVA 4PTXA 1IIGA 1CGUA 2WMIB 1UBSA 3E12A 3P80A 2VQTA 2XHYA 3HTWA 4OJYA 4PC8A 3VILA 1EXBA 4AC7C 3W82A 3KCJA 4P8XA 4MKSA 1E0UA 4US5D 4PGLA 4UR9A 1MXGA 1PSCA 3MCOA 4U4MA 5DY3A 3TYCA 1ZUAX 1LOQA 4X0VA 1QHZA 1OSEA 3G0XA 4NX0A 3GVGA 4J2PA 4LUJA 3GTIA 3P14A 4NY2A 2GVGA 3TVAA 4JIIX 3BCDA 3QLDA 1XG3A 3ZJ6A 4O1CA 1JZ5A 5CC3A 3A13A 4E38A 4MUZA 1LRQA 4AY8A 1XIJA 1SO4A 5LYRA 3WZ0E 5EU9A 3C2OA 2EO7A 4JKLA 4PMOA 1C8YA 2D2HA 3KTCA 3A5VA 9RUBA 1KWKA 1IGWA 1J93A 1ICPA 1G0CA 2PURA 5FESA 1TTJA 1UKQA 1O66A 1XIIA 4Q7IA 3UP8A 4MWAA 1GJWA 1XISA 3CJPA 2GFTA 3OLDA 3UYCA 2DJXA 4H6QA 3LCWA 4LEQA 3UJEA 1D7KA 4H9UA 1TVNA 1W1TA 3CQKA 1TVLA 1ZAIA 4YN5A 3E02A 3HM7A 2IPFA 1WUEA 3MP3A 5EPDA 5IFTA 2TODA 1UR4A 5IDZA 1KXTA 1OD8A 3Q67A 3NYDA 2QIWA 4R33A 3LY0A 1IEWA 3SBFA 3FDKA 1A5AA 3UZZA 2HE5A 2OYLA 4Z2KA 2WM0A 4LYKA 3GR8A 4A8LA 5IRPA 1TTQA 3TCSA 5AHIA 4AF0B 3UWWA 1EJVC 4AZCB 1VYSX 4MUPA 2PC4A 2W62A 1QW9A 1XLHA 3F4NA 1CBGA 4H8UA 2TYSA 1UBPC 2ZXAA 2CFFA 3GYCA 1TPC1 1I4NA 3GYEA 1Z6KA 3WJYA 3A4JA 3ARYA 5M03A 5I07A 2NUXA 5BRPA 2D24A 3H7RA 4MB5A 4D71A 5G4EA 4BFAA 2V82A 2PF0A 1DIDA 1JRBA 4ZENA 4AG0A 5BXTA 2HRWA 2NQ5A 3TTSA 5JMUA 4J2MA 1PL9A 1XSKA 1DJXA 4IMAA 1FKWA 3WEMA 1EUAA 2AGTA 4YVPA 1A3XA 3QF0A 3AIVA 2R8WA 5ABFB 1EX1A 2J88A 1XJBA 1TMQA 4N9CA 4GC3A 3DYMA 3MUAA 1RR2A 4CU6A 1HKVA 4UTLA 3OVPA 1KKOA 1GGOA 1PE1A 4IL0A 5LIKX 4UMBA 4JCMA 2DUZA 3CZLA 4C5ZA