3AJXA

Crystal structure of 3-hexulose-6-phosphate synthase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
207
structure length
207
Chain Sequence
b'MKLQVAIDLLSTEAALELAGKVAEYVDIIELGTPLIKAEGLSVITAVKKAHPDKIVFADMKTMDAGELEADIAFKAGADLVTVLGSADDSTIAGAVKAAQAHNKGVVVDLIGIEDKATRAQEVRALGAKFVEMHAGLDEQAKPGFDLNGLLAAGEKARVPFSVAGGVKVATIPAVQKAGAEVAVAGGAIYGAADPAAAAKELRAAIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-hexulose-6-phosphate synthase
publication title Crystal structure of 3-hexulose-6-phosphate synthase, a member of the orotidine 5'-monophosphate decarboxylase suprafamily
pubmed doi rcsb
source organism Mycobacterium gastri
molecule tags Lyase
total genus 81
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.43: 3-hexulose-6-phosphate synthase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ajxA00
2ZZ5A 5K9CA 4LOCA 1EP3A 3M43A 4HIBA 1ZENA 4MY9A 5DBUA 3NQVA 4LVDA 3V1PA 3LX9A 2H6RA 4GUJA 1L6WA 2V2DA 3N3MA 2AAMA 3PBVA 1XBXA 4JTHA 2JBMA 1VPXA 1DHPA 4MLRA 1NAL1 3LB0A 1SO5A 3FLUA 3EX3A 2QCGA 4A21A 3NQ7A 5AC7A 3W7DA 3ZWTA 1I4NA 4QSHA 1YTEA 5TIMA 5G2IA 2JGYA 3GYEA 4O13A 3QSRA 4JTUA 5KITA 2QCHA 2GVLA 3OBKA 4A29A 2GVGA 3C2RA 4DXVA 2VFHA 5MHBA 2C6QA 1OX5A 4FX6M 1QPQA 3W87A 3ABOA 3QW3A 4OU1A 5EMUA 3TV8A 5HUPA 2ZRYA 3F4NA 2CLKA 3I68A 4JTEA 2DZXA 2G95A 4CCCA 1QOPA 1KTBA 4YMZA 1XXXA 3Q58A 3TA6A 3CEPA 1JR1A 2DZSA 1FDYA 1M6JA 3THAA 5AC6A 2C0AA 1WYIA 3QMTA 4AHQA 4HNVA 3EB2A 2V81A 2CZFA 2WJZA 1JUEA 5K4ZA 2ZRVA 1FCQA 3W1UA 1QPNA 4FNSA 1PHWA 3KRZA 2C18A 5E1QA 2EGZA 3W70A 4RV8A 2YFOA 3TSMA 1TPFA 2QJGA 2FDSA 3L0KA 2VFIA 3RF9A 3UXAA 3LBCA 2VFGA 1TTPA 5BW6A 1J2WA 1QPOA 4OE7A 1GTEA 4YL2A 5LNVA 1O60A 5KZEA 1F6KA 1QFEA 1LOLA 4NZFA 5HJLA 3UXDA 2YW3A 4WZHA 3LHWA 3TIMA 4ONVA 1L6SA 2KZHA 3NL2A 5AYXA 4XZ9A 3VE9A 1FX6A 2Z6IA 2NWSA 3PUDA 1LBLA 1A5BA 2Y70A 2RDTA 5HNRA 4ZQPA 3CWOX 2QKFA 1FBAA 4L4MA 3B06A 1KM5A 2H8XA 3CLMA 1F76A 2Y7GA 4LW7A 2QF7A 4YWIA 3W1TA 3W85A 5HR6A 1OFAA 1M5WA 4S2BA 4NXKA 3BGGA 2J9YA 4UC5A 3TW7A 4UFHA 1RQEA 4NJHA 5D2TA 2J9ZA 1VGAA 2A85A 3DAQA 3W7HA 3O6DA 3GDTA 3GLCA 3I7RA 2WNQA 2JKPA 3QF0A 1K3UA 4N6FA 1NF7A 3CC1A 4FNTA 4QNEA 1QDSA 2VEKA 1RVGA 4RX0A 2AGKA 2RH9A 1B4EA 5CZTA 5E0KA 1RZMA 1ZALA 2DZVA 4O1BA 1GWJA 1T0OA 4MZYA 2YPIA 4UTIA 2DORA 1UUMA 4LNYA 2QJIA 1X8FA 4RXGA 4LVFA 3B8DA 4JTKA 1H7WA 1ZAJA 3G8RA 1ZFJA 4GFSA 4DBDA 3C2VA 3DI1A 8TIMA 1O94A 4Q33A 4QAIA 1LORA 4DF0A 1H5YA 4AH7A 3C2EA 4O12A 3E0IA 5H2ZA 3W7NA 3O05A 4WY0F 1SO3A 3I7SA 1TMHA 1DJQA 3M5ZA 4JY8A 3MI2A 4N4PA 5F4XA 5CZ0A 1YDNA 4C1LA 2NX1A 3F4WA 3FKRA 4FEZA 4OWGA 5CPOA 3U2OA 4IMFA 1TPUA 4E2BA 3WK1A 4JICA 3KRSA 2BWGA 4PODA 5D05A 3O63A 3S5ZA 1G4EA 1DORA 2PRHA 3E12A 2E6FA 4K38A 4MKNA 1OJXA 4Z1CA 4O14A 3IVUA 4O11A 3G24A 5KZMA 3RLUA 1IIGA 3EXSA 4NU7A 1VZWA 2OT1A 3HPXA 1LZOA 3IVTA 4UTKA 2A0NA 2E77A 4JYDA 1VYRA 2QEZA 1AL7A 4LV4A 3HPZA 3UWVA 1X1OA 1VR6A 3LBMA 1WBJA 2V9DA 1W5NA 4JX6A 3TFXA 3G1HA 3C2FA 4AWUA 3KOFA 4KFOA 4YLWA 3GDLA 5G1TA 3P82A 1ZHAA 4UIOA 4R34A 4JNMA 5KTLA 3L0NA 1LDCA 4CNPA 1KFKA 1XUUA 1VCFA 3L66A 4MY1A 4ZQCA 2VFFA 2C13A 1PS9A 4MLJA 2Q8LA 5CPLA 1FCVA 2B7NA 1S3HA 2HS8A 4H6KA 3L5LA 4X2RA 2CZ5A 2J24A 1EPXA 4ORIA 1F05A 3LHUA 3G1YA 5HMSA 5DLCA 3TROA 3DHDA 4IPJA 2H3BA 4Q32A 1L2UA 1G7VA 1UCWA 4HSOA 4QIUA 1XBVA 3S5OA 1M7OA 3C3NA 2H90A 3NDOA 3W1MA 2ZTKA 2EPHA 2GQ8A 2C1HA 3M5YA 3M0ZA 3E02A 3DH7A 4W9TA 1W5PA 1YPIA 1X7FA 3QQ0A 4FNPA 3E96A 5FF4A 3CQ0A 3Q37A 4ZZ9A 1OFOA 2NLIA 2NX9A 1EA0A 2J6XA 3W2UA 4MY8A 4O17A 3GIYA 1SZGA 4PA8A 1R47A 2V2CA 3ZFHA 1ZNNA 4FO4A 2Y85A 4UFIA 5K9XA 4PC8A 1F2JA 1OYCA 4LS0A 1VCVA 4CCDA 3Q94A 2GQAA 5U4NA 4Z0SA 1P0KA 1SW7A 4JYFA 4ML9A 4AXKA 5EA9A 4H3DA 1KBIA 1FWSA 1DQWA 4FIRA 3NR0A 3W7OA 2WOQA 2Y89A 4DQWA 3A9IA 1UB3A 4IJBA 1V7YA 4UFMA 1TJRA 1L9WA 4JXCA 4GRSA 3OVQA 3LXBA 1P1XA 4LUIA 4NUWA 4AB4A 5AHIA 1JCXA 3NPVA 4K7YA 3QPYA 4TMBA 2C15A 3IIXA 3NL6A 5BMWA 3SECA 1Z41A 2DZPA 1VYPX 2A2IA 3WK0A 2ZZ6A 1KV5A 3TFCA 4OV4A 3TE9A 5KZDA 1ZAHA 2Z1BA 2ATMA 1BEUA 4CNNA 3UWZA 3PSVA 3KFTA 4XTIA 2EHHA 3DHFA 4MJMA 5HR7A 3W7IA 3GNNA 3A23A 4MJZA 3DXIA 4RR4A 1JCMP 1AMKA 1VS1A 2EAWA 4WD0A 2TSYA 1WV2A 4OQVA 5DCBA 4WQ6A 4GUFA 1FY6A 1OK6A 3RMJA 1W5QA 5FF3A 1G7UA 2OZ0A 1VH7A 4EWND 3WK3A 1DKWA 4IMDA 2TMDA 3MWAA 5CZSA 2JK2A 4FHAA 3FJLA 1JULA 3DGRA 5FEXA 3FFSA 3G1AA 2NX3A 3W1RA 4FX7A 2WSYA 4X9SA 3EWUA 3IRDA 3UQNA 1G4PA 1GZGA 4AAJA 2QCLA 3EEGA 1SZFA 3LLDA 4QJ1A 3KX6A 1DOSA 3CIXA 2A7NA 1TV8A 4M6PA 2GJLA 2FPYA 2FIQA 2YFNA 4J9JA 4EOUA 1H61A 1ICQA 1KM0A 1TTQA 3NQCA 3EWYA 1K8XA 3G1XA 4NNBA 5LGZA 1KA9F 3FEMA 2B7OA 3LCLA 3W1PA 1QOQA 3RLVA 5C6MA 1KM1A 4RZ6A 5HWMA 1F73A 2FTPA 1SZEA 3NQDA 3IEBA 4IMGA 4R7JA 3TXVA 1DVJA 2RHGA 1G69A 3SY5A 3S1WA 3UWQA 3R13A 3TJLA 4OHQA 3C6CA 4HSNA 1TSIA 2J9XA 3W7LA 5BNKA 4O16A 3CEUA 2ABBA 5FI8A 3HG4A 3AO0A 1UUOA 3M44A 4O1AA 2V5BA 3CPRA 3W71A 5G5IA 1H1YA 2Y7FA 3TSBA 2ZDRA 1GVRA 3SGUA 3GK0A 4JIPA 2V30A 1FXQA 4JTLA 3UPWA 2IQTA 1VC4A 4HNUA 5HWJA 4DBEA 4LVGA 3RU6A 3UNDA 1TCDA 5F2LA 3SJ3A 5D09A 4NVTA 4N9CA 2B4GA 3R5EA 2Y63A 1FUYA 4FNQA 4N9EA 1MEIA 5I3HA 2EKCA 3HB9A 3BG9A 3ZWSA 2I14A 3FYPA 4POCA 5F1UA 4KKXA 1GT8A 3VKJA 2DJXA 1OFEA 2X1RA 2XN1A 3CHVA 4UMAA 3TQ0A 2JKEA 1FWWA 1Y0EA 3STGA 3NQ6A 5C54A 3DFSA 2YYUA 5AOUA 3BARA 2E09A 3LCGA 4GBUA 3VE7A 3I65A 2ZYFA 3QZEA 2E5DA 2RFGA 3W23A 3ANYA 4O28A 3TDFA 1DQXA 2Y6ZA 3IV3A 5C5YA 2WPBA 3MMTA 1MEHA 2QCMA 1O95A 4S1FA 3UZ5A 4FB7A 2F84A 4FXRA 4NNCA 2ZZ1A 1WBHA 2D73A 5DY3A 1I2OA 2ABAA 3EX6A 4JX5A 3NA8A 1KFJA 3GDRA 3WJXA 2E5CA 1EIXA 3NEVA 2ZZ7A 2X30A 4O18A 3MP4A 1LTDA 1EWDA 1UBSA 1KTCA 1B57A 3W1XA 3V75A 4K36A 4O50A 4UTWA 1R2RA 5H91A 2LLEA 1I8JA 1FXPA 2X1SA 3QSTA 5DXYA 1ADOA 4PH6A 3M16A 1L6YA 1GVSA 1PE1A 3HPSA 2X1UA 3BK0A 4O57A 3WJYA 5G2HA 4GXMA 3W7KA 2XN2A 3M5XA 3W83A 3TQVA 1UASA 1H51A 1KM4A 4BI7A 2E6YA 4NJJA 4ADUA 2V2HA 4IOTA 1B3OA 1ZJIA 3HG3A 3M7WA 3TQKA 4M7SA 3BV4A 1SU5A 3LRMA 3GAKA 4NZJA 1D3GA 4LVAA 5F4SA 3W2MA 3NPUA 3C52A 1OYAA 3Q2DA 3W7EA 3P60A 4DO4A 3W7QA 1FDZA 3QH2A 3QM3A 4O8RA 4WOQA 1MXSA 3PG8A 5BRBA 4A2SA 5HINA 1OVDA 1THFD 4LV9A 1N55A 1W37A 3CU2A 1ME7A 1MZHA 2GJNA 1H62A 1KFBA 2B7PA 2C3ZA 3EXTA 4Y90A 2WSRA 2PURA 3BLEA 2ISVA 4JY9A 5K3VA 3LXCA 4N2YA 3UZJA 1OFBA 3P62A 1GOXA 2P1FA 1Q6LA 3CIWA 3E9AA 2NV2A 1G4TA 1ONRA 2BSLA 5EPDA 4BI6A 1P0NA 3HOJA 4Y8FA 2GPTA 3S8HA 3T78A 6ALDA 3PS7A 3BLIA 3S0CA 5CKSA 2W79A 5CZJA 3A24A 4XBSA 1W8SA 3K30A 3DFTA 3OVPA 3N73A 1K8YA 1XDLA 3PB0A 1YXDA 1RD5A 3QQ1A 4CCEA 2TPSA 5G4EA 1G6CA 3UWWA 4DPQA 3O6YX 1WQ5A 3S6DA 1RR2A 3W9ZA 5I3JA 2BLEA 2R91A 4ZQMA 2YZRA 3G3MA 2WNZA 3HBLA 1JQXA 1GPWA 4NNAA 4A22A 2BZNA 3TMLA 2WNNA 4O0ZA 4ORMA 3VCRA 4JTFA 3C0JA 2CFFA 1OABA 3LOTA 3QMSA 2G5WA 3W84A 3L2IA 3EWWA 2BXVA 1TQXA 3G1FA 4MOZA 4HT3A 3GB6A 4GUIA 4GUGA 3CWNA 3PF3A 1H50A 1KW1A 1S5TA 1T96A 3EKZA 3BG5A 3N14A 2YDAA 4RZ4A 1TRIA 1HG3A 3LHYA 3HQ1A 4MYXA 1QAPA 4ADTA 3KVLA 3LCHA 5F1VA 1TV5A 1LLWA 2VFDA 3SZ8A 1WOBA 3KHJA 3QYQA 5DBTA 4ZL1A 1PIIA 4FF7A 4K37A 2CLFA 3TCEA 3BW2A 3C4UA 3O07A 4B5NA 2A6NA 3EWBX 2P10A 2QCDA 5I3KA 4I9AA 5AYYA 3RK8A 3QMRA 3NL3A 2YYTA 3G1VA 4LTSA 3I7QA 3GXNA 3LCWA 2HS6A 3KVKA 3R12A 3O15A 1GG0A 1XBYA 3B4UA 2E68A 3L9CA 1QMLA 2OCZA 3LHTA 3BW3A 4HPJA 1YDOA 1XBZA 4TU1A 3FS2A 2BTMA 4ZVJA 3TNOA 2NXHA 1O5KA 4M7TA 4LRTA 1GQNA 3PBWA 4KWVA 5HULA 4BF9A 4PEKA 4Z1AA 1XC4A 3M47A 3W7PA 4EVZA 1X1ZA 3F1QA 5J5DA 3JR2A 4WY0B 4LUJA 1TTJA 4UTTC 4Z0JA 5DCEA 4U4MA 5D2VA 1HTIA 1ML1A 1N8FA 3HGJA 1J5TA 1QCWA 4JIQA 4Q4KA 3MYOA 3W6YA 3HMJG 1RQHA 1Q45A 1LBMA 2PRMA 5DN1A 1SFJA 3FIGA 1HUVA 2GOUA 1YYAA 3LM7A 2O7QA 1GEQA 2B0MA 4JD4A 2CWNA 1ME9A 2QCEA 3MBDA 1Q3NA 3UWYA 4UXDA 3WK2A 4JX4A 2HSAA 3O8AA 1JJKA 1JRBA 1AG1O 4JTSA 2PC4A 4IXXA 3UD6A 2QAFA 2TRSA 3W2KA 3S1VA 3NOEA 4ADSA 5LNRA 1PCKA 1OFQA 4DPPA 3PM6A 1TPEA 2DP3A 5IM51 2CLOA 4O54A 4OGZA 2YR1A 3W86A 1WA3A 1GYLA 1SR9A 2C19A 4JYEA 5AHEA 4TX9A 5KMYA 1GVFA 5F2IA 4O4VA 1KBJA 2V8ZA 1VHCA 3PULA 3DENA 4HKPA 1KFLA 3TXZA 1IXPA 3S1UA 3W22A 2ATSA 4OBTA 1KM3A 1U5JA 3P5ZA 3FJ6A 3UWUA 2FJKA 1W5MA 4UTMA 1JCNA 4RZ5A 4RCXA 2Q8ZA 5D32A 4K39A 3LRKA 4JDBA 4WY0A 3W74A 1PV8A 3A21A 5CPMA 3SIZA 3B0VC 4IWWA 1GYNA 1PHQA 3OVRA 4JTGA 3N19B 4O15A 4M6QA 4GNJA 2WQPA 2A5HA 3N9SA 5IBXC 1EUNA 5J5RA 5AC8A 3MBFA 3B04A 2YW4A 2R14A 5AFDA 1JUKA 1NFBA 2VENA 4JTIA 1QR7A 1E51A 2H3DA 4AWTA 5I3GA 3LI0A 4PL2A 1IGSA 1LP6A 3PUOA 3ZS4A 3DFOA 3MJYA 5LGXA 1GVOA 4AVFA 3VI2A 4ALDA 1FQ0A 1XCFA 4HN4A 3STCA 5SWUA 5D30A 2DZUA 2E6DA 4UMBA 3S5YA 3HF3A 3INPA 1NEYA 4WXYA 5GVJA 4LC8A 3MHGA 4Z08A 3LI1A 3GZ3A 3QC3A 1H60A 2FPTA 3LRLA 4H4IA 3O16A 5TBOA 1H1ZA 1M7PA 1W3TA 1B4KA 1VYSX 3ATYA 4MUZA 1AW5A 2ZRZA 4MVAA 5AN7A 4AEOA 5G4WA 2X2GA 5EKYA 4KWWA 5LSMA 4DF1A 3GXPA 3BO9A 3LTSA 3NQ8A 2HTMA 3NVTA 3LERA 1OX4B 2YX0A 5AYZA 3NZ1A 5D2WA 3OG3A 4UR7A 3LHVA 2RDWA 3NAVA 3NNTA 1FCBA 1OF8A 2CLLA 4JS3A 1SSGA 1QPRA 4A2RA 3IGXA 2VC6A 1PL9A 3PVFA 3NZRA 4R53A 1IXOA 4CQ8A 1EB3A 5FEWA 4UFJA 3B0PA 4NJIA 3L5MA 2QR6A 3HG2A 1AW1A 4TO8A 1DJNA 4GE8A 4TR9A 3TJXA 4IMCA 4R33A 3QPZA 4AF0B 4UNKA 4HHPA 3TX9A 1DBTA 5CPNA 1WDWA 2CLHA 3NXFA 1QO2A 3EWXA 3FKKA 4AWSA 3SR7A 4XQ6A 2ZA1A 5K9DA 3PBUA 4FXSA 1P5BA 3P84A 1TYGA 1YDVA 3LLFA 4HPXA 4O1CA 1IF2A 3VFLA 4AHOA 4ZQRA 3ZR4A 3G3DA 3IGSA 3KAOA 3USBA 3WFAA 1A5AA 4UFKA 3NL5A 2ZQ0A 1HFBA 1TB3A 1P4CA 1HO4A 4FNUA 5HWNA 1CI1A 3GNDA 3L65A 1KLYA 2C14A 4WOZA 4N9BA 2I1OA 1SPQA 3L67A 4DO5A 3PC0A 3M1ZA 6TIMA 2UV8G 2QCFA 1WAUA 3U6WA 3MI3A 1OX4A 4AHPA 2E6AA 2NWRA 2GVJA 3P5YA 4BWLC 1OK4A 2A1YA 3BVJA 1UJPA 2B7QA 1RQBA 5F4WA 2ZTJA 3BPWA 2VELA 1DV7A 1W31A 3I6RA 2ZA2A 2CLIA 4DF2A 1OHLA 1DL3A 3TC6A 3TSDA 2A7RA 3G1DA 4LC6A 3NQMA 3BG3A 3EXRA 5A5WA 2Q3RA 1ME8A 4JEQA 1LRQA 4DO6A 2Y61A 2Q3OA 4CLMA 4AF0A 4UTTA 4QQ3A 4UTLA 3DU0A 2NUWA 3DFPA 5AHFA 1W5OA 2E1DA 1XL9A 1TQJA 2Y7DA 1YXYA 4WJEA 5T26A 3ELFA 3A5FA 3A22A 4DELA 1TTIA 5DXXA 4I7WA 1KM6A 1VLWA 2Y88A 2PCQA 1GG1A 4N4QA 2CW6A 3P8JA 3YPIA 2Z6JA 2ISWA 4MYAA 1YADA 1W54A 3ABQA 1W3NA 4PFMA 4JN6A 1SFLA 3G1SA 5FF2A 4CQAA 7TIMA 3EKLA 1JCLA 3MW7A 4FX8A 1D9EA 3SI9A 4NJKA 1SW3A 3N34A 2FB3A 2VKZG 2ZZ2A 3H55A 3N9RA 4UFLA 1F7BA 4GJ1A 4NJGA 3MP3A 1R30A 1IXQA 2VFEA 1K8ZA 1LROA 2V0TA 4JDYA 3WJZA 3GDMA 3OIXA 5AB3A 1A53A 4TMCA 1EP1A 4C1KA 1IXNA 1EEPA 4I7UA 5DELA 1XM3A 3G8EA 1TRDA 4YXGA 1MEWA 3PG9A 2VEMA 3GX9A 1ICSA 1TPC1 3CTLA 3W75A 4LVBA 4XBKA 1EP2A 3H53A 3TUUA 2H8ZA 2FQIA 4P2VA 4E0CA 2WKJA 5I3FA 2V5LA 1A50A 3IIZA 4YCOA 1KFEA 3O6CA 3DZ1A 3NQ2A 2QDHA 3JS3A 3CM4A 3STEA 2VEIA 5IBXA 1GVQA 3LXAA 3M41A 3KVMA 4RLIA 5G1YA 4M19A 1TJPA 1K7FA 1WXJA 3B03A 3NQAA 3NQGA 1FWNA 3QRHA 3S5NA 1JRCA 1SUXA 2W6RA 2NUXA 3FOKA 5D04C 4K6AA 1YXCA 1C8VA 3QJAA 2ZFAA 5KINA 2QUTA 1SW0A 3GR8A 4A3UA 3EWZA 3E49A 1G67A 3RFAA 1T8XA 3TU9A 2WSQA 3NO5A 4NQ1A 5K2ZA 1TV7A 3KXQA 1XDMA 2Y7EA 3UPBA 5EBUA 5LNSA 5EL1A 1XFBA 4O10A 3S9YA 2YCEA 3MP5A 1AW2A 2ISSA 2BX7A 1LBFA 4PCFA 3W1QA 3CB8A 4UMCA 3NPXA 1WOAA 3W72A 4CQ9A 3GKAA 4UTJA 1TPB1 4LRSA 4K8HA 5AHMA 2QUUA 2FFCA 3T44A 3IIVA 4XTDA 2ZCGA 4RXFA 1JCYA 2X16A 3D0CA 3IIPA 4EF9A 2QCDB 1VRDA 4I7VA 1HO1A 5EYWA 3M9YA 4LS1A 1VJIA 1O5XA 2DU2A 4MFEA 4MIMA 4NT0A 2QCNA 2V82A 3M5VA 3MI6A 4UCGA 4BR1A 1W1ZA 2PE4A 3LV5A 4UNLA 1Q6RA 3BLFA 1I2QA 3N2XA 3G18A 4O53A 3IIOA 4P61A 3TKFA 3HIJA 3LV6A 4LY8A 2OMAA 1S5WA 1U83A 1GJPA 1D3HA 4JTTA 1JQVA 4NXSA 3W3OA 3T4CA 4EIVA 4UTUA 2DJLA 2QJHA 4WUIA 1K03A 3P7YA 3SFKA 1OF6A 2QDGA 4O1DA 3W1NA 1F74A 1K02A 1SZNA 2WV8A 1PCWA 1VHNA 3LGEA 1SSDA 4IUOA 5LZLA 4JGDA 1R46A 1LRTA 4YCPA 1VQTA 1YLVA 4K8EA 3FA5A 1OFDA 3A5VA 3O06A 2JGQA 1SQ7A 4ZMGA 3N2MA 2CZDA 3HG5A 4G1KA 4UUIA 1K7EA 3W2JA 3DKLA 4NX5A 3G22A 5L6UA 3ABSA 5CG7A 1S5VA 1CW2A 4LS2A 4JTJA 4M5PA 1OYBA 4WX2A 2ZBTA 2NXIA 3F03K 1MO0A 1A5SA 5FEPA 3ABRA 5D03A 1H7OA 2VEPA 2YSWA 1BWLA 2FB2A 2GUUA 1H7NA 1AL8A 3MO7A 1I45A 1FWTA 4BWLA 3L5AA 2JKAA 1QO5A 2YGYA 1TIMA 2NUYA 2HMCA 5AHLA 3WJSA 2F7FA 1F5ZA 3PWAA 5CSSA 3THQA 4DEFA 1A5CA 1EWEA 1NVMA 2NZLA 1JVNA 4O52A 1H7RA 5LHFA 1LOSA 3W1LA 1JUBA 4E2DA 2R8WA 2J27A 1EX5A 1W56A 3L0GA 1H63A 2C16A 2X1TA 4QM1A 2P0OA 3HJZA 1XI3A 1W3IA 2QUVA 3QW4B 5K4XA 3G0XA 3P8IA 1I2PA 3PAJA 3BGJA 5LHEA 3GDKA 1R2SA 5K7JA 4OT7A 1X6UA 3NYZA 4L4LA 5DY2A 1TPDA 2ZZ4A 4BFAA 1ZY9A 3T7VA 3DFNA 3G0SA 3IVSA 4XKYB 4MZ1A 4KFNA 2NV1A 4HNTA 3AJXA 1H7PA 5FEZA 2A7PA 1I2NA 1BTMA 1N7KA 3MUXA 3CT7A 3LCXA 3W76A 1LCOA 4TIMA 3MHFA 3PUEA 1ICPA 1BKSA 3NM3A 1LRNA 3PY2A 1TO3A 1QWGA 5TQLA 5E93A 4IXHA 4MZ8A 2OT0A 2OX1A 5C55A 1ZCOA 1V5XA 2PRLA 4U28A 3ATZA 4XUGA 1KV8A 1KLZA 3G0UA 4E38A 4UTWC 4X3ZA 1WX0A 3W2LA 3UY8A 3GKFA 3KRUA 3B0UX 2RDUA 1B9BA 1BWKA 3P80A 1G4SA 4AMAA 3SGZA 1RPXA 4MPQA 3NQEA 5LNWA 5LKYA 3TC7A 2Y62A 4IX2A 4KFPA 3IGUA 5L9FA 2ZRWA 5DCDA 3C2OA 5FF7A 4BK9A 5FF0A 2I9EA 5EY5A 3SW6A 1H7XA 3C8FA 3VNDA 2ZRXA 3EX1A 3W7GA 1W0MA 4D2JA 1SO4A 5F2GA 4PL1A 4XKYA 1Z42A 4IGHA 3TH6A 2J88A 4GC4A 1AK5A 3TMQA 4N9DA 3NGJA 3KVJA 4GWEA 4M6VA 3B05A 4PTNA 2CLMA 1XKYA 3W07A 4CNOA 2Z2UA 3DI0A 4O19A 3H54A 4MFDA 5AHNA 3TAOA 4LT9A 3TK7A 2TYSA 3NQFA 1ZAIA 2G96A 3NM1A 3S1XA 1IIHA 1QNVA 3W88A 4QISA 3R89A 5BOOA 2DZWA 1O4UA 3C61A 2ZRUA 1FWRA 3LDVA 3TR2A 1I2RA 3GVGA 1LYXA 3R8RA 4ZQOA 1OG0A 2GQ9A 2W0UA 1Z48A 3W2NA 3OHIA 5KSWA 3P67A 5BMXA 2ALDA 4O0KA 1TPVA 4HNNA 3GXTA 4RK8A 4Y6GA 2YXGA 4EF8A 1JCJA 2AQWA 4ZQNA 5LNUA 1KFCA 5D37A 2DZTA 5HUOA 1SO6A 2CZEA 3TW6A 1Z44A 5ABTA 3U8GA 3MYPA 3GAYA 2WO5A 1R2TA 1LLZA 1F6PA 5D38A 2Z0IA 1KTNA 4RJEA 2O7SA 4Z1BA 4O4WA 5HQEA 3C56A 4QNWA 3DKJA 3LCFA 1C9DA 2FPVA 3NPWA 3OA3A 4Y9AA 1LM1A 4WXZA 5FESA 4N02A 1OFRA 1FDJA 3DFQA 3W1AA 1OFPA 5D02A 3EX4A 1TPWA 3UY7A 3RNDA 3W7JA 3JRKA 4LU0A 5F2MA 3QEZA 4UTHA 5CGQA 3HGSA 4UR8A 3BW4A 3L68A 3PB2A 5C2XA 4FIQA 4IQLA 3WJWA 1C29A 4NX0A 2CLEA 2XFWA 2XN0A 3GR7A 2G97A 1FCUA 4Y96A 1J4EA 4K7VA 1T99A 3STFA 3P81A 2NXGA 1EUAA 2QAPA 1ALDA 3P74A 4GUHA 3T40A 3R2GA 4RKAA 3HGRA 3W7RA 4FNRA 1KM2A 4Z1DA 5I3IA 1LOQA 1CX9A 4IMEA 2A4AA 5CSRA 1HL2A 1TREA 1K7XA 3DBPA 3FYOA 1YTDA 3LTYA 2VOMA 3W7CA 3M6YA 3L21A 1Q6QA 3UYCA 3LTPA 1Q6OA 1NF0A 3T55A 5D2XA 3W7MA 2A6LA 5D33A 1PVNA 4S2CA 3QFEA 3P61A 3PBYA 1TPH1 4XWUA 4BI5A 4JR5A 4ICNA 1OX6A 4IX0A 2ZZ3A 1RV8A 2FLIA 3HO8A 2ZA3A 3LHZA 4X22A 3MHUA 3S42A 5G2WA 5D2YA 1VLIA 3PR2A 3HGOA 2R94A 2QCCA 2RKXA 4OV9A 4IPIA 5A8GA 3LCIA 3TAKA 2CU0A 1MSSA 3EX2A 4QITA 3W73A 2E5BA 1YPFA 3NG3A 2VXNA 3O1NA 3PSWA 2A21A 1VCGA 4N6EA 3SSJA 1GTHA 3OEXA 2OJPA 1YTKA 5U7SA 2EF9A 1NSJA 1XUZA 4LWWA
chains in the Genus database with same CATH superfamily
1J0KA 2Y0FA 1ZENA 1VFOA 3AIBA 1CPUA 2GDQA 2F2HA 5IDIA 3NQVA 2WKGA 4LVDA 3LX9A 5A6KA 4ZSTA 1YPXA 1L6WA 3BUVA 1UR8A 3NO1A 5CGMA 1XDJA 3VGEA 1UR1A 1B9ZA 1WPCA 4LH8A 2I5GA 1RJQA 3HTWA 1V6WA 1ISVA 1XPGA 1UR0A 4JOMA 4GHRA 1NAL1 3SCNA 3NQ7A 1G1YA 4HJFA 1YTEA 1HVQA 1X97A 3QSRA 4O13A 4LXFA 1I60A 2JF6A 1DYSA 2Z25A 1QW9A 2CIPA 4NAEB 3TOYA 4DXVA 3AU2A 2VFHA 1OX5A 4FX6M 1QPQA 3UG3A 3VFCA 3UG5A 3M0KA 2CHRA 2GSHA 4HPHA 4YMZA 1C8YA 4E8GA 3CEPA 1Q8JA 1VP5A 1A4MA 4GO9A 5AC6A 1V79A 3UA4A 3WDHA 2CZFA 1PHWA 3KRZA 4QGCA 3FVDA 1QK2A 2JF7A 2XH4A 1JI1A 3RF9A 5IFPA 1TTPA 1M3UA 1XLFA 1V0MA 1E56A 3D3AA 4LB3A 3WYZA 4NZFA 2YA2A 1B30A 1JL8A 3NL2A 3RGTA 2NWSA 3PUDA 1A5BA 3GU2A 4L4MA 2H8XA 4E3TA 1JI2A 4LW7A 4YWIA 4HZMA 1M5WA 3ZT6A 5FAJA 4JKKA 1ZJAA 5AYBA 3QBUA 4J28A 3W81A 4B5UA 5CZKA 4DJFD 2VC5A 3QF0A 4ERIA 3CC1A 3VIFA 1CYGA 3ZOAA 1ZALA 3BCDA 1T0OA 3U2EA 2YPIA 1W9BM 5I02A 1X39A 1S2WA 2DORA 1PEZA 1X8FA 1TA3B 2VC9A 1YE4A 1ZAJA 1IT0A 4GFSA 3C2VA 3DI1A 4HK5A 4QAIA 1AODA 4IZGA 2QPUA 1LORA 4DF0A 2QIWA 1A80A 4O12A 3E0IA 1TJ1A 3RO6A 1TWDA 1FFQA 4KGLA 2XGIA 4QP0A 3URNA 3M64A 1UZ1A 1J0IA 4DY1A 3ARUA 4OWGA 4H41A 3OIHA 3KLLA 1TPUA 4NSBA 3WK1A 2W66A 3KRSA 2BWGA 2G3IA 1R9XA 3VIHA 1DORA 3E12A 4MKNA 5I09A 5DT7A 4Z1CA 1BFNA 4O11A 1PKMA 2OKTA 1YX1A 4PYSA 1NM9A 2OT1A 3HPXA 4M29A 3IVTA 3WH5A 3FJ4A 1UA7A 3T0TA 1VYRA 1JPIA 1TV2A 1UZHA 4E2VA 1ZU8A 3PZNA 2IPWA 2Q01A 4LJ3A 2J77A 2VYOA 1VR6A 2XVGA 4KERA 4EAMA 1W5NA 3DHPA 3TFXA 4KFOA 3WLIA 3P82A 5FJTA 3UCQA 2XDFA 1L6FA 1UKTA 2CBUA 4CNPA 3EDEA 1ADDA 1KFKA 1QI5A 1HL8A 4MY1A 3G2GA 1TG7A 3MDWA 6ENLA 4OOZA 2JE8A 1JYVA 1PS9A 1NDWA 5CPLA 1FCVA 2HS8A 3VGFA 1ZZMA 1UROA 3IANA 1JAEA 1EPXA 3DBNA 4ORIA 4KEZA 3C2YA 4FMVA 5BXPA 1BF2A 2Z1SA 3R8HA 4GQQA 3AIUA 2DSWA 3I3DA 2EPHA 4D8ZA 4WJ8A 3M0ZA 4S3EA 4DM2A 2IQ0A 3EMZA 1W5PA 4F9JA 1QXLA 3ZJ6A 3CQ0A 3Q37A 4FALA 2J6XA 4F66A 4CKQA 4IUGA 3WL0A 3RPDA 2Z24A 4HU4A 1R47A 1S2UA 2V2CA 1HKIA 4FO4A 2Y85A 2QJMA 3HV8A 5K9XA 3Q94A 4D6EA 3CUZA 3A6OA 2CNCA 1UKQA 4AU0A 1JZ7A 3PANA 3U3HA 1LL7A 2B81A 4ML9A 4AXKA 5EA9A 4H3DA 1FWSA 1DQWA 3UF9A 1RALA 3BCFA 4MADA 4XO7A 1UJQA 4DQWA 1ISZA 1ZP4A 2HVMA 2XU2A 4R9XA 3MA8A 4UTFA 4ES4A 4PMVA 1SM9A 1Q7QA 2DSKA 5XIAA 1GJUA 3IIXA 5AY7A 4DJFA 2DH3A 4DO7A 2G41A 2PI6A 3EA1A 1VYPX 1VFUA 2VDGA 1CECA 1QNSA 2ZZ6A 1SR0A 3R7MA 3W01A 3SADA 1SMAA 4Y9PA 2Z1BA 2Z4GA 4CNNA 3UWZA 3MANA 4M80A 4J35A 3VNKA 2NT1A 1Y5XA 5A8PA 1RP9A 3ERPA 4MJZA 3DXIA 1J0YA 5TD4A 4WD0A 3B9AA 2TSYA 4Q4QA 4AUBA 4XZWA 4WQ6A 3WBAA 1EGMA 2FTWA 3B3DA 3RMJA 2OZ0A 1XWYA 2PDUA 1DWGM 5H6HA 2HVNA 4AXNA 3O0KA 3LPOA 5A8OA 2A3EA 2TMDA 3TJIA 5CZSA 3BJFA 4MTVA 1PZ1A 4RDWA 2NX3A 1QW7A 2WSYA 3WELA 4J2PA 4LUSA 1EJTC 3EWUA 1QK0A 3CH9A 3IRDA 4JHMA 3UQNA 4D6DA 2P88A 1KXHA 3LLDA 1W9XA 3KX6A 1OADA 3QR3A 3VIIA 1O5RA 1TV8A 2GJLA 4TUFA 1R7OA 4C1NB 4ECLA 3V16A 1KM0A 1TTQA 3A4XA 3NQCA 4ZEPA 5JU6A 3KHDA 4GBDA 3K1GA 2PTXA 3RUBL 5LGZA 3LBOA 3MS8A 3M0YA 2O56A 2B7OA 1QI3A 3BE7A 1QOQA 1QATA 1QI2A 4RZ6A 5HWMA 1F73A 1IEIA 2FTPA 3R25A 3TXVA 1EJVC 3L2MA 1D3CA 4RE3A 2GGHA 5ABEA 3S1WA 1H0IA 3UWQA 2WSKA 3W7LA 1IEXA 1XYCA 3CEUA 1O66A 4FI4A 3WD3A 4BQ3A 3M44A 4O1AA 3K5XA 4PUEA 4LYKA 4IPNB 4A8RA 1KGXA 3T07A 3CBWA 4GY7A 3WZ0E 3I10A 7ENLA 3SGUA 3GK0A 4DJDD 2HXTA 3OYXA 1KQZA 2Y5EA 4B91A 2FVKA 4HNUA 2F38A 2RUSA 3UNDA 2Z27A 3RU6A 1TCDA 3DN5A 5F2LA 3SJ3A 4B3LA 2E67A 5B7ZA 2Y63A 2ACSA 4FNQA 1VBUA 2ZC8A 1CXLA 3BG9A 1QBBA 3POHA 2I14A 3WNKA 4Q7IA 1E9YB 2DJXA 4UOZA 2OELA 2XN1A 3A9BA 4D72A 2JKEA 1QOXA 3STGA 1EJWC 2Z1KA 4V28A 5AOUA 3T6CA 2G8ZA 4ICCX 3AJ7A 3VE7A 1TR1A 3I65A 8XIAA 1S2VA 4IQJA 3OP2A 2DT2A 3V7PA 5PTDA 3TDFA 1W9UA 2Y6ZA 4IIEA 5HPCA 5C5YA 3GWQA 3O2LA 1O95A 4S1FA 1PZ0A 3AI0A 3UZ5A 4E8CA 3TYUA 4I5UA 3M6DA 2GUYA 1WBHA 1AQ0A 1KFJA 3LSBA 2E5CA 4L4OA 1TUXA 3MP4A 1UBSA 2BFGA 1B57A 3W1XA 3DFHA 3E2QA 2LLEA 4CCZA 1FXPA 3QSTA 5DXYA 4RDVA 1ADOA 2IKGA 1F3EA 2DEPA 2X1UA 1EXBA 2FGLA 4D6IA 4HQVA 2INFA 3M5XA 4H9MA 2BVTA 2Q8XA 2VP8A 1XYAA 3RILA 1K1DA 4BI7A 2E6YA 2VC7A 4JCLA 4JTRA 2V2HA 3CK5A 4IOTA 1ZJIA 2JALA 3HG3A 5T9CE 3BV4A 3LRMA 1E1FA 1D3GA 4LVAA 3E74A 2IPGA 2W3ZA 2V5CA 4R3UA 3UEQA 3P60A 4P8UA 2G50A 3CL6A 1TMQA 1CLKA 2CBVA 2QULA 3QM3A 5JBEA 1DQUA 1F3TA 2PLKA 3N3TA 3S2MA 4LV9A 2QZRA 5E0CA 1N55A 3IJ7A 1H62A 4CD5A 1KFBA 4L6OA 2WSRA 1B3YA 3KP1A 3SDOA 4JY9A 1T5AA 5K3VA 2QMKA 3P62A 1N82A 4IIFA 3CIWA 5CC6A 2NLYA 3CNYA 1ONRA 5EPDA 4OZOA 4XAZA 2VVNA 4BEUA 4XAFA 3HV9A 4XBSA 3T08A 4C6CA 3N73A 4KRZA 1K8YA 1YXDA 1MRAA 4CCEA 1FHUA 2XHYA 2J7DA 4DPQA 2O9OA 5CH9A 4HHLA 1V02E 4D9PA 2G3JA 5ABFB 5I3JA 2I16A 2BLEA 1FH7A 3AWNA 4JQ4A 1MUCA 4ZQMA 4AD2A 1C9WA 2DSUA 3VD7A 1RA0A 1E0UA 3NCOA 4ORMA 1EC8A 2F6KA 4AY8A 3LEPA 2CFFA 3LOTA 3L7RA 3TYCA 3N18A 3G1FA 3IJQA 4FR6A 1XICA 4GUGA 4HGXA 3CWNA 3KDNA 1YKWA 3S3GA 2PLCA 1VPQA 2BMBA 4HP5A 1M1BA 5A6MA 2X0HA 4EXAA 1HG3A 3QHNA 1AH3A 1DXFA 2W5FA 3N12A 2EPNA 4AISA 4KETA 4ADTA 3LCHA 1UW9A 2VFDA 4H7ZA 5A95A 3SZ8A 2XM1A 3ES8A 5DBTA 3REQA 1PIIA 1E0WA 3BW2A 1ZRQA 5E6YA 5AZ0A 3C4UA 3O07A 2XWEA 4RNFA 2A6NA 2YDSA 2QCDA 3R10A 4AIUA 4I9AA 3V5FA 3IK2A 3AMLA 3BLOA 3G1VA 4LTSA 2F8QA 3GXNA 3UESA 4DNMA 3KVKA 4DI9A 3O15A 1DXEA 1GG0A 2EPKX 4PBEA 3FV9A 3MSDA 2PDKA 1ITCA 4PMNA 4HPJA 1XD1A 1XBZA 4H9XA 1DJGA 1TX0A 3FS2A 4A35A 2RGMA 1O5KA 3OLDA 4OKDA 4BF9A 4PEKA 3W25A 4PBFA 4WY0B 4Z0JA 5D2VA 1ML1A 1A4LA 1TCMA 3OPSA 3HGJA 3ZJ8A 4GH3A 3W6YA 4YWSA 2I7GA 2OLAA 1M01A 4KIRA 4BF5A 3FIGA 3LM7A 1GEQA 3THDA 4IG2B 2GSJA 3D47A 4B4HA 3MBDA 4BCEA 3WK2A 5CJNA 4LY4A 2HSAA 2PCEA 3O8AA 1GOMA 4JTSA 4IXXA 5D9MA 2E9LA 3ECQA 5DANA 3W2KA 4KWOA 3GE7A 3CJPA 3PM6A 1TPEA 3WY1A 2P5NA 4IL2A 4X9YA 1XIBA 1GYLA 3TC3A 5KMYA 3CT2A 3PULA 1FKXA 3TXZA 5H8MA 4XSMA 1MZRA 1U5JA 2PDWA 2VJXA 2DZBA 3UWUA 1E73M 1R3RA 3GW0A 2PLJA 1W5MA 3TLQA 4UTMA 3D3FA 4RCXA 4C7GA 3LRKA 1K4GA 1KD0A 3EKGA 1XFCA 2YCIX 5CPMA 3SIZA 3VIGA 1BVNP 1J0ZA 1DJYA 1GYNA 1K9FA 1WUEA 1M04A 3N19B 4O15A 2D2GA 3ITCA 2GQ3A 4PUDA 5DRIA 3CASA 2OYLA 4OBSA 1IV8A 2WQPA 4YYCA 2BV9A 5EMMA 2R14A 3CZKA 1HJVA 4JTIA 2GVEA 3NEHA 1OBAA 1YBQA 4NILA 6TAAA 4PUMA 3RR4A 2WBKA 1LP6A 1QI4A 2WLZA 1LF1A 3HJEA 4YU1A 3BAXA 1JF5A 3DEQA 4OUIA 3GVWA 4XZBA 3WQ5A 2V3EA 4ALDA 4MNJA 2P8CA 2VDHA 2E6DA 4WRHA 3S5YA 1JXKA 1M65A 4AQLA 2WLYA 5FCZA 3AXIA 3PJTA 3ARYA 3GVRA 3IUIA 3K1DA 1IZJA 3LRLA 3CV1A 1J01A 1TE1A 3WUFA 2XIMA 6REQB 3B40A 3QTGA 3GNOA 3TR9A 1E4IA 1VYSX 4G1NA 2ZRZA 1H09A 4C6MA 5LSMA 2WCSA 4MWAA 1E1CB 1V4YA 3AYTA 3SAZA 3PN8A 4MNLA 3AHVA 2WVSA 1OX4B 2YX0A 1DPMA 4UR7A 3LHVA 3QKEA 3NNTA 1T8QA 5FJPA 1DWJM 1OF8A 1OZMA 5GQBA 4TX6A 3LSCA 4QCEA 1PDZA 1W2PA 1UKSA 2HBXA 3PVFA 4C6LA 3NZRA 4JIHA 1MWOA 3PTQA 3B0PA 3L5MA 2UY3A 1AW1A 1E0XA 1DJNA 4GE8A 4EWJA 4YIWA 3UZZA 2CXEA 4F2BA 7PTDA 1R3SA 4XQ6A 5LIWX 3NSNA 3R6IA 1IF2A 4AHOA 3KP0A 2Y8UA 1ENUA 3KAOA 3QZ6A 1R0MA 3WQFA 4TTUA 1KBBA 2OVLA 3NL5A 1TB3A 1P4CA 1VBRA 5HK4A 1HO4A 4FNUA 3MVTA 1CI1A 4N42A 3T81A 3PZVA 4WOZA 4N9BA 3HA1A 2VZOA 3W00A 3TP4A 4DO5A 3PC0A 3WKZA 2QCFA 2QQ6A 4P7NA 2OZ8A 3PZQA 1CTNA 4L6HA 2GVJA 3WQEA 1J96A 1ELSA 3BVJA 1UJPA 3DYPA 3RX4A 1XIHA 3VNMA 2A3HA 2HDJA 1CIUA 4UNIA 1DL3A 2A7RA 2DUZA 3G1DA 3AROA 1LLOA 3UZWA 4JFVA 4MAVA 3VIJA 4X0NA 1US0A 1E72M 4DO6A 2VD9A 3MY9A 2Q3OA 2J74A 4UTTA 2E3ZA 2DT3A 4H9ZA 2NUWA 1OC6A 3FX4A 3N11A 5BOEA 1JIBA 4WJEA 5T26A 4ZR8A 4M56A 1MVYA 4DELA 1TTIA 5HDRA 5DXXA 4LBUA 2HJPA 4EPDC 1U30A 1VLWA 4AIBA 3PZGA 3RCNA 2JQXA 3CZ8A 4L7ZA 2Z1WA 1A0DA 4CN1A 4W8AA 1BQGA 4S3DA 5I0DA 2ISWA 1YADA 3W4RA 1W3NA 1WKFA 1XLDA 4DBWA 3G1SA 2UWFA 3A3HA 7TIMA 3EZ4A 1JCLA 4JN7A 3KWXA 3APYA 1SW3A 2PWUA 3TTOA 2ZZ2A 1KGUA 3V1HA 4LAMA 1F7BA 4GJ1A 4IQEA 2V0TA 4XZMX 1HP4A 2G4JA 5EMLA 5D8WA 3GDMA 1A53A 1EP1A 1EEPA 4JPGA 2OZTA 2CESA 4NKCA 4YXGA 5ABGA 1TPC1 5C9XA 4P8WA 1LWHA 4LVBA 1XG4A 1Q65A 4TV5A 1A50A 1ISXA 3AMGA 1XW8A 2QDHA 1RBAA 3JS3A 2X05A 3TTYA 5CJMA 5IBXA 3EDKA 3ALGA 1WDPA 5G1YA 4M19A 1TJPA 4Q8TA 1XLEA 1DJHA 4DAFA 4LCSA 3NQAA 5JIWA 1FWNA 2PGEA 1SUXA 4ZO6A 3K4DA 4FLOA 4QE5A 2DFAA 4S3JA 2PS2A 3WQPA 1YXCA 3KTSA 4DJFC 3UP8A 3WF2A 3GR8A 3WNLA 4I9JA 3OU8A 1NP0A 4WEVX 2QT3A 1IT8A 2WZHA 1XDMA 5C9WA 1EH9A 1UWSA 3BAJA 1D7FA 2ZWYA 1AQFA 3S9YA 1NFGA 3MP5A 4BF7A 2JFEX 1AW2A 2BX7A 4UQAA 1KXQA 1XSKA 4PCFA 2ZXDA 1W1VA 1CDGA 3KE0A 4XO6A 4ATWA 2BOFX 2TAAA 3UZXA 4GQGA 3VZXA 4CQ9A 2FH8A 5HNNA 4PB5A 4K8HA 2QUUA 3T44A 4XTDA 3WDPP 4DLFA 4RXFA 3SURA 4RPQA 3WLKX 1IE7C 3E3HA 2QCDB 4US6A 4ZCWA 5A3HA 1FWGC 3OHMB 8CGTA 1XYFA 1UIPA 2KX9A 4J3TA 1UD8A 4ICMA 4UCGA 4OJYA 1NTHA 4HYVA 1X6NA 1Q5MA 4L1WA 4UQEA 1I2QA 3G18A 3IIOA 3TKFA 3LV6A 4LY8A 2OMAA 3OLEA 1EL3A 2D3NA 1GJPA 3N29A 1W1A1 1JQVA 2E4TA 3W3OA 5AVNA 3SFKA 3P7YA 1OF6A 4V15A 5E9AA 3UZYA 1PCWA 3LGEA 2O92A 2VZVA 5ECVA 1VQTA 5CJ5A 3EPMA 1OFDA 3O06A 3BAIA 1SQ7A 1UWIA 4NF7A 3HG5A 4PBGA 4CQBA 4KMQA 2V38A 1C91A 3DKLA 1CXEA 4NX5A 3G22A 5L6UA 1QU4A 1E9ZB 5JMUA 4KESA 1FH9A 3IRSA 1E71M 3NYDA 1IEVA 1S5VA 1Q63A 4JTJA 4F0KA 3VIKA 5C8BB 4LUTA 2RGLA 5FEPA 3ABRA 4DWSB 2FB2A 4O1EA 4A8IA 1DJXA 4LQ1A 4Z2HA 1FWTA 3GFXA 4NZ1A 3VMOA 2F7FA 5CSSA 3EA3A 4K1WA 4PMOA 6XIAA 1LOSA 2J27A 3AS1A 1H63A 2C16A 2P0OA 2DIJA 1VD6A 1I2PA 4H9VA 3GDKA 3WD1A 1AFSA 1P0DA 1JZ8A 4BQ5A 3FXGA 4RE0A 1TPDA 3UCDA 2D24A 2UY5A 2D22A 1BRLB 1KCKA 4J27A 3IVSA 3HN3A 2Q02A 1YBQB 2NV1A 3OGVA 1H7PA 3W6LA 1XQKA 3DCPA 1HT6A 4QDPA 4PULA 3MUXA 5REQB 1Q6GA 3LCXA 1LCOA 4TIMA 3HQPA 1XIIA 1S2AA 3DX5A 3NM3A 3PY2A 4IIGA 1UWQA 5E93A 2OT0A 2QXWA 4MM1A 1NELA 2OXNA 4MJ4A 4GY1A 5C55A 3S6TA 2WYSA 5DT5A 1Y65A 4DIAA 1EGZA 1PAMA 3M0XA 2QPSA 4E38A 4X3ZA 5CLWA 3GKFA 1MW2A 3B0UX 3IUHA 1BWKA 3BTNA 1RBLA 3SGZA 3VDHA 1RPXA 1B3WA 4TV6A 2EG8A 1KGWA 3ALFA 4MWAB 3SM0A 5L9FA 5DCDA 3C2OA 2XH7A 5EY5A 1D8CA 3SW6A 2V5KA 2YA1A 4PMDA 1V3LA 4KT2A 2DIKA 4XVEA 2XIIA 1P1MA 4RW3A 5F2GA 1V6UA 4U10A 3UGRA 3PAOA 4IGHA 5C9RA 3BSGA 4GC4A 2Q6ZA 4GZ7A 3MSYA 1JD7A 4PRTA 2BODX 3C0QA 2CLMA 3BV7A 1XKYA 4MNKA 4HBKA 3W07A 3H54A 4QLLA 3TAOA 4LT9A 3TK7A 3CAWA 3W88A 3MT1A 1O4UA 1Z8AA 3SRFA 1T40A 4QLKA 3LDVA 4GIYA 1X38A 2GJPA 2ZOXA 1BGAA 3LD5A 3QHOA 3VPLA 3O0FA 4CNTA 2J7HA 2ALDA 4O0KA 3OZYA 2F6UA 2E9BA 2F6XA 3GHRA 3VOJA 1DTUA 1KFCA 3O7UA 5H8UA 2CZEA 3FK4A 4XBJA 1Z44A 3GAYA 1R2TA 3ITOA 2YL9A 2UY2A 3S83A 3LNPA 3MMUA 3C56A 4KEMA 4QNWA 4H8UA 3LCFA 1C9DA 3NPWA 1EOMA 1LM1A 5FESA 1OFRA 4GXPA 3DFQA 1BWVA 3EX4A 1TPWA 3UY7A 3A4JA 2FKPA 1TZ9A 4LU0A 4F79A 4PCPA 4UTHA 4DVOA 3BW4A 5XINA 3BL3A 1AD4A 1C29A 2DQWA 4L5ZA 2XFWA 4PR4A 3RM8A 4L80A 4Y96A 1Q6FA 3GBEA 2NXGA 2QAPA 3KL5A 1WZLA 3B8SA 2DY3A 3TYZA 2WMGA 2VR4A 2Y24A 4GVFA 1QUMA 2PBGA 2G37A 3HGRA 2NSXA 4FNRA 1LOQA 5CC3A 3QVQA 4X63A 1J11A 4NG3A 1FTXA 1Q6QA 2FVMA 3OLGA 1NF0A 2HPIA 5I2UA 2VZUA 3QFEA 1YNQA 2PGWA 2IXUA 1XQLA 2X7WA 3GC5A 4XWUA 4BI5A 4ICNA 1UD4A 4IISA 1RV8A 3WDQA 4RV3A 2FLIA 3SBFA 4Z2GA 3DC8A 3S42A 5G2WA 2AL2B 3FDKA 5D2YA 1VLIA 3R11A 3HGOA 1H41A 2ZUSA 4OV9A 4HMCA 3LCIA 5GNYA 3QKZA 3GHTA 2E5BA 3ITVA 2W4XA 2VXNA 1B2YA 1T41A 3T8LA 1NSJA 4LWWA 4LOCA 4EX4A 1EP3A 4HIBA 3VK5A 4MY9A 5GPRA 1J10A 1KQYA 1FWCC 3WF3A 1JDCA 4AZ5A 2GGJA 1IR2A 1ZLPA 4KRUA 3LPPA 2H6RA 4Q4OA 3N3MA 4GKLA 3B9EA 3UVAA 1A5LC 2JBMA 1CGTA 1JDDA 1DJIA 1WXZA 1SO5A 3FLUA 3EX3A 4X2PA 3W7DA 3TYAA 4QSHA 2Z1XA 5TIMA 2JGYA 5KITA 5CAHA 4F0RA 1XH0A 4IPPA 2GVLA 4A29A 2GVGA 3C2RA 1EX1A 5MHBA 2C6QA 2ON3A 4TXEA 2FJUB 1QASA 2OYKA 5EMUA 4IP4A 2ZRYA 1K77A 3C86A 1A49A 2DZXA 4CCCA 1XG3A 3TLLA 1OSEA 1QOPA 1XXXA 4GD0A 4GVIA 5DEZA 3KL3A 2DPEA 1JR1A 1TELA 1V0NA 1M6JA 1WYIA 4AHQA 1GNXA 4HNVA 2GYIA 1W3KA 3LUTA 2WJZA 3NZPA 2ZRVA 7REQB 3FGCB 2C18A 3MSGA 1P7TA 1F61A 3W70A 3TSMA 1S39A 2QJGA 2FDSA 2J8TA 5A6TC 3AXHA 9CGTA 3UXAA 4AX6A 3GTNA 3LBCA 1Q6EA 2X0YA 1QPOA 1EDGA 1GTEA 3IS4A 2SFPA 5KZEA 1EJRC 3WUEA 3UXDA 4ZOEA 3BSHA 4WZHA 2D23A 1V93A 3FA3A 4ONVA 1L6SA 2KZHA 3AS3A 5AYXA 3T9PA 1EF2A 2Y70A 2RDTA 5GJNA 5HNRA 5BCAA 4D6JA 1FBAA 3B06A 2D2JA 5A2BA 4BJHA 4DJED 9RUBA 2Y4SA 3UERA 3W1TA 3W85A 3FY1A 4Y2WA 4F0SA 3PUGA 1P0BA 2HROA 2VQUA 3TW7A 4M1BA 4NJHA 4IIDA 1VENA 1VGAA 4ROPA 4UQBA 4FK9A 3W7HA 4DM1A 1E6ZA 2WNQA 3EPOA 3N04A 2V6AA 4N6FA 1NF7A 3TW9A 4FNTA 2VEKA 3IACA 1RVGA 3PHAA 3WUBA 2AGKA 2DZVA 4UTIA 5M1TA 1ODUA 1TWWA 4LNYA 4RXGA 3LK6A 1MW1A 4LVFA 4JTKA 2BY1A 1H7WA 3G8RA 1Q7MA 4DBDA 4B2DA 4PMZA 1EO5A 3PZMA 2WJEA 1ECQA 5DMYA 3CYVA 3VKBA 2YB4A 1NARA 2NQ5A 3BAKA 3WIJA 3W7NA 2A3BA 5CBIA 1TMHA 3M5ZA 1PIGA 2BY3A 4JY8A 1TR9A 4UOJA 5F4XA 5CZ0A 2NX1A 3F4WA 3GC2A 3U2OA 4KCUA 4J3VA 1HXJA 4U3CA 4MDPA 3ONCA 3GH4A 5A6AA 5D05A 4YTTA 1A5NC 2AQOA 4NI3A 3TYEA 2GL5A 1G4EA 4UBPC 5BWAA 3W28A 3AYVA 1DIEA 2VRJA 3G24A 5KZMA 3U0HA 4JIEA 3SB0A 3RLUA 4GKTA 4R5EA 2XIBA 5A8MA 1K9TA 2NSOA 3HU7A 2E77A 2QEZA 5D9PA 3LZ5A 4LV4A 3HPZA 1FWIC 3ZXWA 3G1HA 3C2FA 2DSVA 4GI4A 3BJTA 4NAFB 4GNVA 2AKZA 1L6GA 4AEFA 2VGFA 3L0NA 1XUUA 1VCFA 3PPCA 3QV8A 2P0IA 1DEDA 3LNMA 4I8DA 3GUWA 4B5WA 2ISDA 4H6KA 4X2RA 5CAKA 2J24A 4ZFMA 3UA3A 1F05A 1IWPA 4LUYA 3EOOA 3LHUA 2G3FA 5DLCA 1HJWA 4HK7A 3DHDA 4GYPC 4IQDA 1L2UA 3RJXA 3KM8A 1UCWA 4HSOA 3S5OA 1M7OA 3C3NA 3NDOA 2Z2BA 4HU3A 3W1MA 4L56A 3AMKA 7CGTA 5IXEA 2C1HA 2HK0A 3QFWA 4PCNA 1X7FA 3QQ0A 2QPXA 1OFOA 2NLIA 2CYGA 3BZJA 2VCAA 1L0PA 1CGXA 4O17A 1Q8AA 3TWBA 2R1NA 1UPPA 2YCJA 1ITXA 2OO6A 4IICA 1F2JA 1OYCA 3OBEA 2GQAA 1HKMA 3EDFA 2VTFA 1EJUC 2VMFA 3SFWA 1Z9AA 3B8UA 1TZZA 1S46A 4JYFA 3H2NA 1KBIA 3GYCA 4KWSA 1S2CA 2WOQA 2V3FA 1X1NA 4RE4A 5C2GA 1V7YA 1L9WA 1PZ3A 4GRSA 1S5MA 1QNQA 5D9OA 2XVPA 4LUIA 4NUWA 4AB4A 5AHIA 3NPVA 2GDVA 5A69A 5HA7A 4YTRA 1FP8A 2DZPA 1JZ4A 2OR2A 3CB3A 4C6BA 4CVWA 3N25A 1KV5A 3BANA 5KZDA 1Y8BA 1BLIA 2AOSA 8XIMA 4GIRA 4XTIA 2EHHA 3TN5A 3F2CA 1CEOA 3W7IA 1M03A 2OOFA 4A3HA 1AMKA 4HA3A 2X1IA 2INZA 4LGXA 5FF3A 1UIOA 3RPMA 1VH7A 3KTCA 3WK3A 3ANVA 1DKWA 4IMDA 4Z2KA 3UU0A 3MWAA 3ZLGA 2WMKA 2JK2A 5A6SA 3EPNA 3FJLA 2PDGA 3KUMA 2A79A 3F5LA 3U4AA 1GZGA 4AAJA 3MC5A 3ZIZA 2E9MA 1HIZA 3V5OA 4HYWA 2A7NA 5HNTA 1RCOB 4JKMA 3R94A 1VFLA 2VQTA 3VMNA 3WSUA 1CT5A 5D4YA 1VFTA 3FEMA 3W1PA 3VMPA 5M5DA 4XZLX 2VR2A 1ZUAX 3ZVHA 2VX6A 4R7JA 3CAVA 2RHGA 3MV01 1G69A 3SY5A 3R13A 4OHQA 4ZB2A 4DUWA 1TSIA 2D2HA 4GK8A 5BNKA 2GOKA 5FI8A 3UFYA 2V5BA 2PD9A 3W71A 4ROQA 3KCLA 2Y7FA 4AFYA 1EIBA 2WHKA 4WKHA 1KB3A 2ZDRA 1GVRA 4F0HA 4JIPA 1GJWA 4DBSA 1N8WA 2X2YA 2H9AA 1FXQA 3JVAA 3IJ8A 2QJJA 4XKMA 4X61A 3CV2A 5I24A 4LVGA 4PSRA 4NYYA 5D09A 3RJYA 3ARRA 3R43A 2PDXA 1GQIA 4N9CA 3R5EA 1FUYA 2X41A 4N9EA 2WZTA 3RLHA 3ZM8A 1VJZA 3GVQA 5F1UA 3T0AA 1OZQA 4MAZA 1P43A 1GT8A 3VKJA 1FA2A 1XIEA 4NRSA 5AKQA 2OX4A 3CHVA 4UMAA 1FWWA 1Y0EA 2OLSA 3NQ6A 3KBMA 4KIEA 3EB3A 3WENA 2XVNA 4G7EA 4NRRA 1ZSXA 3CV6A 4WSHA 1TJ0A 4GBUA 3SUWA 4LNCA 4CUCA 2CEQA 3VDAA 2RFGA 1NOUA 3ANYA 4O28A 1EJXC 1DQXA 2ZVRA 3IV3A 4V33A 3WMSA 3MMTA 1XPYA 4E4UA 2F84A 4NNCA 2VT0A 1XLKA 2NQHA 1I2OA 5T8GA 3FA4A 3C0LA 2WMJA 2ZZ7A 3FYYA 4H7CA 2X30A 2HWGA 5EBAA 1EWDA 5J8LA 2NT0A 3V75A 5H91A 4HPGA 4F2TA 3AXKA 4JHOA 3SCWA 4GYKA 1L6YA 1GVSA 3BMVA 4O57A 4XZIA 3WJYA 5BRPA 2R24A 4GZEA 2PTDA 3TQVA 3F4CA 1A5MC 4AC7C 1H51A 1KM4A 4NJJA 3OBAA 1W1IE 3M7WA 4M7SA 2G0WA 4NZJA 3UWEA 3C52A 1XGDA 5HJXA 3CWHA 3NZGA 3LS9A 3P14A 3QH2A 3OQ8A 3CHEA 4WOQA 1FWDC 1MXSA 2XJ7A 4MKSA 5HINA 2WJFA 3WFZA 1T7LA 1W37A 2GJNA 5AZ1A 2B7PA 3MTWA 4AYSA 4G2DA 3VO0A 3EXTA 1PDYA 4Y90A 1I6NA 1XSIA 1HZYA 3B97A 1QHZA 3BLEA 4Y9NA 1F07A 4N2YA 3UZJA 1GOXA 1Q6LA 1IGWA 3E9AA 4W4QA 2WVVB 2GJXA 4A3RA 2BSLA 3H2AA 4Q4MA 4BI6A 3HOJA 4Y8FA 2GPTA 5MKGB 3T78A 5LA0A 1KCXA 6ALDA 3PS7A 3BLIA 3S0CA 1E9IA 5CZJA 2YIHA 5ENLA 1FWFC 1XRSA 3HURA 1CXHA 3DFTA 3MJMA 3OVPA 2XIQA 3SQSA 4HA1A 3PPFA 2J75A 2TPSA 2PDLA 3VZZA 1W3JA 4IMAA 3UWWA 3O6YX 3SO7A 1V6XA 1RR2A 1UR2A 4U5IA 2WZEA 3PFMA 3ORWA 2R91A 1XGEA 2YZRA 2FDMA 1GPWA 1BF6A 1MMFA 3C0JA 5E09A 2BDQA 4PN2A 3E0VA 4MB1A 3KRBA 3W84A 1S38A 3EWWA 2QW5A 2J4GA 2BXVA 1TQXA 1XF0A 1JPMA 4XD6A 4GUIA 4KH2A 2WNWA 3U4FA 1QRQA 2PWDA 2FZNA 1KW1A 1C7TA 4K8GA 2NQLA 4QBXA 3EKZA 2EEXA 3CMJA 3W38A 4RZ4A 4LAUA 3NDYA 1MRQA 1EHAA 3LHYA 4MJ2A 3VINA 1R3VA 1CWYA 3E5BA 4GQRA 2PP0A 1BYAA 5HNUA 2EG7A 3I4EA 1WOBA 3QYQA 4ZL1A 1BYDA 1EBHA 1RJPA 3FAXA 1US2A 2ZUMA 5M03A 4B5NA 3VX1A 4IP7A 5I3KA 1CENA 4Q4SA 4MDOA 3VVGA 3CUIA 4JFUA 3QMRA 1HQTA 3NL3A 3SCRA 3I7QA 3LCWA 2D69A 2HS6A 3R12A 1OT1A 3B4UA 5JBDA 3L9CA 4XZHA 2OCZA 3LHTA 2PZ0A 3BW3A 4HJWA 4WSJA 1YDOA 4I9MA 3UJFA 3LZ3A 2ONEA 3R79A 4IHCA 4M7TA 1GQNA 3O6AA 2WC4A 1FHLA 3M47A 3ME3A 4EVZA 1B3ZA 5EU9A 1EF3A 1PYFA 4LUJA 3CUFA 1TTJA 3SN4A 3F4DA 5HQLA 1GOOA 4HNOA 1QCWA 4H83A 3MYOA 4RDYA 1RA5A 1AQHA 3P93A 2XISA 1Q45A 4ZO9A 1SFJA 4PMXA 1B5TA 3UETA 1EZ2A 3E6EA 2GOUA 1P6WA 1IEQA 2J7CA 1CXKA 2O7QA 2CWNA 2QCEA 3AXMA 4FXJA 4UXDA 3RM9A 4KRTA 3WQVA 1JJKA 1JRBA 1AG1O 1JG9A 2OZ3A 3DFYA 2PC4A 4QXIA 4NZ3A 3UBPC 5JXQA 1SMDA 5LNRA 4QG6A 2DP3A 4AD3A 4UQ9A 1GVIA 4HK6A 3WLOA 3W82A 2YR1A 4GISA 4U3AA 1WA3A 2C19A 2HZGA 1GVYA 2OEKA 4JYEA 1KBJA 4HKPA 4H6RA 1IXPA 2ATSA 4OBTA 1SJBA 2DQXA 2XIJA 3FJ6A 3BWWA 1IYXA 2C7FA 2J8GA 4QE4A 2Q8ZA 4K39A 4E8DA 4JDBA 3W74A 3A21A 2FHFA 3M0HA 3B0VC 4RPPA 3OYZA 1PHQA 4C6JA 3DYMA 4ZOBA 4EACA 2WBGA 4BQ2A 2A5HA 5C9UA 2HEJA 1BG9A 5AC8A 3B04A 3FDGA 1NFBA 3V18A 4PMRA 1E51A 2QNEA 2H3DA 2OU4A 4V1YA 3IJ6A 5I3GA 1T6MA 4C6EA 3MJYA 3L4ZA 3WEMA 5LGXA 4W7UA 3ZVHB 4WSKA 3AWOA 3VI2A 2DW7A 3GU1A 1FQ0A 2WMIA 1XCFA 4HN4A 2OB3A 2DZUA 3OJGA 3LM3A 4LC8A 2OEMA 2PUZA 3LI1A 1BTCA 3SCVA 1H60A 2XFYA 1R3TA 1V51A 2FPTA 2VX4A 3BAYA 5CPQA 3WLPA 2PDFA 3O16A 1W9VA 3OZPA 2NW0A 1M7PA 1EYWA 1B4KA 4MUZA 1AW5A 4MVAA 4U5KA 4AEOA 2H9AB 1GK8A 4KWWA 2C1GA 5FD0A 4NP7A 1GKPA 3GXPA 4L9XA 3BO9A 4S39A 3AZRA 5FACA 3NZ1A 3UYIA 1JYNA 3NAVA 1QBAA 3BLPX 1Q6CA 2CLLA 3ABZA 4JS3A 3PWGA 1SSGA 2WC3A 3ITXA 3UGVA 1PL9A 2CITA 9XIAA 3KBJA 1Z69A 3NFUA 4IL0A 4UFJA 4FXFA 2QR6A 3HG2A 1X96A 4G7EB 3B8TA 4TO8A 4IFKA 4R27A 3K4WA 3TJXA 3MUAA 4IMCA 4OFCA 4L61A 2YCLA 3VD3A 1XLMA 3BH4A 1UH3A 4GG9A 3EWXA 2V5DA 4H6EA 4AWSA 4H7VA 5K9DA 3PBUA 3MWCA 4FXSA 4Z17A 4DXKA 1P5BA 1UH4A 3LLFA 2CWXA 4ZQRA 3G3DA 3USBA 4WDUA 1QTWA 3ZZ1A 3GFZA 2AL1A 3GNDA 5H1WA 5J04A 1BKHA 1XX1A 1VFFA 1AH0A 2XG9A 3M1ZA 6TIMA 5A6JA 3S5SA 4W87A 3WF1A 2PAJA 1LUCA 5AVHA 4AHPA 2E6AA 1PB0A 1OK4A 5CXPA 2B7QA 1RQBA 1S2TA 5F4WA 2ZTJA 4QQUA 2OSYA 4L1GA 1DV7A 1W31A 3I6RA 2ZA2A 2CLIA 4DF2A 1H49A 3WX7A 4PUWA 4AIOA 4CGTA 1QVBA 3GO2A 3BG3A 3GXDA 1ME8A 1LRQA 2Y61A 4CLMA 4AF0A 3DU0A 5BROA 5AHFA 1W5OA 1XL9A 4YS1A 2V3DA 1UKPA 1ZL1A 2ZVIA 2Y7DA 3FXYA 3WNOA 3IAQA 4C5YA 3AYRA 1PPIA 5FA5A 1H4PA 1UWUA 1E40A 4OVXA 2Y88A 2DUXA 3P8JA 3WLQA 2BB0A 2Z6JA 4MYAA 1W54A 4JN6A 5FF2A 3I3BA 3EKLA 4N0RA 4FX8A 3SI9A 4A3QA 2VKZG 1K8CA 4U2YA 2PDYA 4W8BA 1IXQA 2VFEA 1LROA 4JDYA 3ZT5A 4ATLA 3Q45A 3NXLA 2QV4A 5AB3A 3WBEA 4C1KA 1OINA 3GH5A 5DELA 4I7UA 4LFYA 2OSXA 4CD4A 4KWUA 1R9ZA 2VEMA 1ZP3A 3GX9A 1N8IA 2PGFA 4GMEA 4HMNA 4XBKA 1EP2A 3M0MA 4PRWA 3TUUA 2FQIA 2YJQA 3F7JA 2WKJA 2QYGA 2CETA 2V5LA 4FOUA 3TN6A 5HMEA 4GIEA 3E2RA 3DZ1A 4D71A 3STEA 2VEIA 1GVQA 4QG9A 3LXAA 1E6XM 3M41A 3UW6A 4DJEC 3NVDA 4GX9A 4KCWA 4AD5A 1O6IA 1J0HA 2XUCA 3NQGA 4BA0A 3ZLHA 1JRCA 2W6RA 1W2VA 2NUXA 4P7OA 3UR7A 1KRCC 4QRNA 3NDZA 1X6LA 4K6AA 4DUOA 4V27A 4C7FA 1XIJA 5KINA 3G6MA 4A3UA 3S6OA 3PPHA 5A6LA 5BXRA 1G67A 3RFAA 1T8XA 2WSQA 4NQ1A 5K2ZA 3UPBA 3E38A 5EL1A 1XFBA 4O10A 1EKOA 2P3EA 3QN3A 1LBFA 4LBSA 1B3XA 2PDPA 4J40A 3CB8A 3W1QA 2BVYA 5DMMA 1WOAA 3W72A 3GKAA 4CQDA 5D9NA 4LRSA 5AHMA 3DECA 1RUSA 1FVPA 4GFIA 3TWAA 2ZCGA 3VX0A 1TIWA 1JCYA 3QY7A 3D0CA 3U7VA 1OC5A 4H8VA 2OGYA 4PTMA 2D2OA 3GG8A 2E7FA 3T2OA 1EC9A 3QR0A 1HO1A 4F4RA 1QPKA 5M17A 5I06A 4NT0A 3M5VA 2PPGA 3MI6A 1MQPA 5IRPA 4PMUA 2PE4A 1CGUA 3CUJA 3LV5A 5FJOA 3WLHA 4Q8MA 1Q6RA 3M7SA 1K6WA 1RH9A 3N2XA 1AMYA 2GK1A 2PB1A 1S5WA 3L4WA 1U83A 4HD5A 2J25A 3PJWA 4PMYA 1ZBWA 3PP7A 1KFWA 5BWFA 4WUIA 2QDGA 3W1NA 3QY6A 1K02A 4WHBA 1ONEA 3VYLA 4IUOA 5LZLA 4GO8A 3SCSA 3FA5A 1FWHC 1CCWB 1J2BA 4KEVA 4R85A 1K7EA 3RM4A 2XM2A 4LAOA 3MCMA 4UQCA 3POCA 3ABSA 3GS6A 1CW2A 4LS2A 2XGBA 2XZ7A 1JFHA 5LA2A 4WVXA 1OYBA 3W26A 4DAIA 4M81A 1A5SA 1BXNA 3PZOA 4B90A 1YNYA 1H7NA 1AL8A 3MO7A 1HX0A 2EKGA 2HISA 2JKAA 3XINA 2DGAA 5GJPA 3WJSA 1Q13A 1NOFA 3PWAA 3THQA 6PTDA 1A5CA 2NZLA 2VGBA 3CMGA 1SFSA 3UPMA 4O52A 1H7RA 3U48A 5LHFA 2R8WA 3H4WA 4YVXA 2RJGA 1AH4A 2QS8A 2X1TA 3EBVA 3H4GA 1XI3A 3P8IA 3BXWA 3PAJA 3BGJA 4H04A 1R2SA 4WLCA 1E55A 5K7JA 3BDKA 1VFHA 1A3HA 4OT7A 3TJ4A 3CHCA 4L4LA 1EBGA 4BFAA 3MQTA 1ZY9A 3T7VA 1BYBA 4XKYB 3IGHX 4R9OA 4KFNA 3VXGA 2KAUC 1AZ1A 2XFFA 5BXSA 1AVAA 1GZ1A 1WKDA 2YKKA 3HFTA 3BOXA 2A7PA 4ZFCA 4NY2A 3JU2A 1W6TA 3W76A 4ZB5A 1OEPA 4XSLA 3MHFA 3GD6A 1ICPA 1S5NA 1BSIA 4DRSA 1TO3A 2FFIA 5TQLA 1NWUA 3AIEA 4F3HA 4U28A 1EPVA 3ATZA 3TVAA 4XUGA 5BZAA 1KV8A 2OWXA 1XIGA 1XLGA 3BCJA 4J1OA 3KRUA 2CCRA 4EAYA 3P80A 3GNRA 4WCJA 4FA3A 3NQEA 5LNWA 2J7EA 3BZGA 2Y62A 3CZLA 4IX2A 2DT1A 2WW5A 2MUCA 1H0GA 4BK9A 2XYLA 1E6SM 4GPNA 1KXVA 1R8LA 1CZ1A 1REQA 9XIMA 1ZJHA 4EPEC 1E3XA 2YL6A 4PMQA 5HANA 4ACZA 2ZRXA 3EX1A 3L4VA 4AZCB 5A94A 2QMJA 3M0IA 1W0MA 2GWNA 4D2JA 1SO4A 3EDDA 3VDGA 1Z7AA 5EFFA 3VUPA 1Q2RA 1AK5A 1RK5A 3FJNA 3TOPA 1UBPC 4IFKB 3RRAA 4CNOA 2Z2UA 5AHNA 2YCLB 4QE1A 2TYSA 1ZAIA 4NL1A 2G96A 3VCCA 1IIHA 1QNVA 4HOWA 4B92A 4JN8A 5A6BD 1GOWA 4HOZA 1EJ7L 1O1ZA 1MYRA 5T9BG 3UXIA 5KSWA 2GQ9A 2GWGA 3OHIA 3OVGA 4PZVA 3SUSA 1KR1A 3EOLA 1TPVA 4HNNA 2YDQA 1SJCA 2YXGA 4EF8A 3URBA 1EQCA 3TYDA 5HUOA 2YOCA 1XYBA 3ZR5A 3W02A 1NWSA 4H2CA 3U8GA 3CZGA 2WO5A 4D8LA 5TNVA 3GW3A 1F6PA 1LUCB 3UCCA 4Z1BA 3GR4A 4O4WA 1KRAC 2VUYA 4HHHA 2FPVA 1UP2A 4WXZA 4UZUA 4P7QA 1FDJA 2WWCA 4NZ4A 2PWGA 2UY4A 3JRKA 4XD4A 1JYXA 3HGSA 1Z6KA 4KS0A 1RBOB 3L68A 3SQMA 4GOAA 4NX0A 3GR7A 3STFA 1ITUA 1F8IA 3ZQ9A 3AHXA 4MMWA 6A3HA 1E4NA 3R4IA 1G94A 3IJLA 3NO3A 4FPSA 2A4AA 5CSRA 1TREA 3KOYA 4WIWA 3DBPA 4F9DA 2VOMA 3H70A 1PX8A 5HJYA 4AC1X 2ESCA 3PJUA 3U5YA 5D2XA 4AD0A 5I00A 1PVNA 4S2CA 2OEJA 5KZ6A 3P61A 3UJRA 1E5JA 5LIXX 1OX6A 4IX0A 3KBVA 1VF8A 3E0WA 2POTA 4X22A 3PZUA 2VRQA 3MHUA 3NSMA 3OW1A 3PBMA 4QHRA 2D0HA 5FJJA 4HCLA 1O1HA 2R94A 4DNHA 1OIMA 2QCCA 2VO5A 4FS9A 4LCQA 3AIVA 2PDHA 3AYSA 1MSSA 1RXOB 3GUGA 5CLTA 1KNWA 3NG3A 2BBFA 2O9RA 3WLMA 2A21A 2PTZA 3AXXA 5CC5A 3N15A 3T1GA 3WQ8A 1XLAA 1EDTA 2Z00A 4N6EA 3SSJA 2OJPA 1YTKA 3ABXA 2WMFA 2ZZ5A 5K9CA 1F6YA 4XUYA 3VNIA 3M0VA 5DBUA 3T0CA 1P48A 2O55A 4EPKA 2W61A 4GUJA 4FZIA 2V2DA 4GC3A 4JFSA 2AAMA 3PBVA 3VKAA 4JHZA 2V67A 2JEPA 3DOPA 4JTHA 3ARQA 1XV8A 2GUBA 2WM0A 4LEQA 4IJCA 2J78A 3E1F1 2EQDA 2ACUA 2OQYA 3B0YA 4QSFA 1IEWA 3ZWTA 1I4NA 2CBJA 2BS9A 3GU9A 2ZUTA 1EZWA 4GGHA 3QY8A 1XYLA 4JTUA 1M68A 2ZX5A 4M6UA 4MWAE 1WKEA 3W87A 3ABOA 3QW3A 5CQ1A 4RW5A 3TV8A 5HUPA 3F4NA 4JTEA 3BOLA 2G95A 3B9NA 5CG0A 1KTBA 3EAUA 2DZSA 1F4AA 1X8CA 2C0AA 4C6FA 3QMTA 2XINA 3EB2A 3PTDA 4HCDA 1FCQA 5AYIA 1QPNA 4FNSA 2YFOA 1L8PA 1TPFA 3TQPA 4BEQA 3L0KA 3ZO9A 2VFIA 3N2BA 1UOKA 3W37A 2AMGA 2ADAA 4OE7A 1VAHA 4YL2A 1O60A 1F6KA 1DP0A 1LOLA 1GKQA 2YW3A 2E8YA 5E9XA 2VHLA 3TIMA 1V03A 4XZ9A 1IZCA 3KCJA 2Z6IA 4Y7EA 2HNEA 4ZQPA 3VGGA 4XV0A 1PX3A 1W8GA 2IUZA 1O12A 3EDJA 1F76A 4MG4A 5FJRA 1KBKA 1OFAA 4S2BA 5CSYA 1W1TA 4BY3A 1JGMA 2J9YA 4QR6A 4GX8A 5EMKA 2C91A 5D2TA 3PZTA 1DIOA 2J9ZA 3GTHA 2FMOA 4JCMA 3GLCA 3I7RA 1SJAA 5DMNA 1RPKA 3KOWA 2EPLX 4XD3A 4QNEA 2VWTA 3FHAA 4RX0A 1AJ2A 1XR2A 1B4EA 2RH9A 5CZTA 5E0KA 1RZMA 5EMYA 1GWJA 4MF4A 2J7BA 3LMYA 4MZYA 3CGTA 3M4HA 2IPFA 3H2MA 3HQNA 1FHDA 1IWBA 1RVKA 4QEEA 4JAWA 3RG6A 1H5VA 2W62A 2PWHA 4DJDA 8TIMA 1S3TC 1DWIM 2VZSA 4Q33A 1ZGDA 2C0HA 4F8XA 2HNHA 1H5YA 5H2ZA 1D8WA 5AC5A 2POZA 3I7SA 3VOFA 5I3DA 1DJQA 1V08A 1PJ9A 1YDNA 2ZX6A 1MFVA 4C1LA 4FEZA 3FKRA 5CPOA 3VDCA 3LMZA 4IMFA 2WSPA 3VDBA 1OG6A 4E2BA 4JICA 1DTNA 4PODA 5A8QA 1RLDA 3FCPA 3S5ZA 4KGJA 2NQ9A 1ZS2A 4K38A 3RITA 3W53A 1V6VA 4CQCA 3VKCA 3VOCA 4ERGA 2GGGA 4U2ZA 4GVHA 4NU7A 1QHPA 2MANA 5A2AA 4UTKA 2BHYA 2A0NA 1IHIA 1GONA 3S4TA 4MSSA 4J3SA 2CZVA 4RNJA 1UWAA 4PUNA 3VIMA 3UR2A 2J66A 2V9DA 4LYRA 5C7HA 5CBJA 3KOFA 4YLWA 3ZT7A 5G1TA 4ZGYA 4R34A 4JNMA 1V0LA 3LENA 4PGLA 4XAYA 3RPTA 3WN6A 4IFOA 4Q8UA 2IXVA 4ZQCA 1JDFA 2QVNA 1FFRA 2B7NA 1S3HA 1S1RA 3PBGA 4CEUC 4AG0A 3EMQA 4EPBC 2H3BA 1VFMA 1A5UA 3DERA 4QIUA 1XBVA 2V3GA 2H90A 4PEEA 2ZTKA 1HJSA 3M5YA 3E02A 3SRDA 3DH7A 3NGFA 1MUWA 1YPIA 4W9TA 4FNPA 4HYRA 1WKYA 2DUAA 3E96A 5FF4A 4ZZ9A 1XCXA 3HPAA 4D1IA 2NX9A 2VOTA 1KBLA 3SIMA 2R1MA 4MY8A 4X60A 4J7RA 3GIYA 1SZGA 2CLPA 4PA8A 1BG4A 1E0VA 1ZNNA 1NY1A 4UFIA 1A5KC 3ICJA 4PC8A 4Z0SA 1P0KA 4IJRA 3SJNA 3W7OA 4DZAA 3TTQA 5HPOA 4TVCA 3A9IA 3QC0A 5C0QA 2XH0A 3PZ9A 2WK2A 4LUSB 4B16A 1TJRA 3LPGA 4OECA 3LXBA 1WDSA 1P1XA 1S1PA 1VFSA 4K7YA 3QPYA 4ZENA 2C15A 1UQZA 1Y5WA 3SECA 2A2IA 3DG3A 2HCVA 3CUGA 3TFCA 3TE9A 4ATDA 1JDEA 1GW9A 3R0UA 1WP6A 1YMYA 3HMCA 3T0BA 1BEUA 4PMJA 3CHFA 4YTUA 3PSVA 4MJMA 1QWKA 2WM1A 1RJRA 2ACRA 3A23A 4PE8A 4RR4A 1JCMP 2GZXA 4P8VA 1VS1A 3ZVIA 1WV2A 1DE6A 5CSUA 5DCBA 4GUFA 1M41A 1O5QA 3E2VA 1OK6A 4FP1A 3ITLA 4EWND 2XH2A 1E9LA 3MUZ1 2D3LA 1WUFA 1JNEA 1DWHM 2Z1VA 1C93A 4G5DA 1TX2A 3DGRA 3EOUA 3FFSA 5FEXA 3PTKA 1F3WA 4FX7A 2Z26A 4AYGA 2PSNA 1G4PA 3N2CA 2QCLA 1SZFA 4QJ1A 1DOSA 3CIXA 4QG8A 3D6NA 3MZ2A 2FPYA 2FIQA 4J9JA 1H61A 4REQA 2PP1A 3N4EA 3EWYA 1G0CA 3G1XA 1Z3NA 4NNBA 4FLSA 4LALA 1ONWA 3WLJA 3LCLA 5C6MA 2WXDM 1Q66A 4B5SA 3MVIA 1GORA 1SZEA 3NQDA 1PZ2A 3IEBA 4IMGA 1N2VA 3VGBA 1W3HA 4I6KA 1JPDX 3I3EA 2HRWA 4RUBA 3C6CA 4HSNA 2BY0A 1UC5A 1BPLB 4W84A 2IMRA 4V1XA 3O3RA 3GH7A 3P0WA 4O16A 1LQ0A 3BURA 4GQBA 4XAGA 5G5IA 1SJDA 3W0KA 1H1YA 3TSBA 1JPKA 1U5VA 2EJ1A 2D0GA 2V30A 4KCTA 4JTLA 3UPWA 3D46A 1HN1A 1AJZA 5HWJA 3MZNA 3KS6A 4Q7BA 1JGIA 4NVTA 3RDKA 4DN1A 3WF0A 2B4GA 1FRBA 4AW7A 2EKCA 3MU7A 3ZWSA 4C1NA 4POCA 1OC7A 3WQGA 3ARSA 4NZ5A 1KWKA 2X1RA 4E5TA 3GY1A 3TQ0A 5DQPA 2CXGA 1U1UA 3SCUA 3AIWA 1J6OA 4KQNA 4AZ6A 3DFSA 1DHKA 2FVLA 4OTKA 4ZOAA 3KWSA 1ADSA 2E09A 3ZSSA 1HF6A 2FZBA 2ZC1A 1KO0A 4N7QA 1NDYA 2ZYFA 3MPGA 2NVCA 3QZEA 1RHCA 4GYPA 3GG0A 3IJ9A 4R7WA 5LIUX 1BD0A 3BJSA 2QCMA 2ZE3A 2WAGA 2ZXAA 3LQLA 4FXRA 3VM5A 2ZZ1A 4LSBA 2D73A 1FKWA 5DY3A 2CPUA 2ABAA 4JX5A 3NA8A 1NIUA 3GDRA 3WJXA 1EIXA 5M2FX 3NEVA 1KTCA 3EWCA 4UTWA 1PSCA 3T09A 1R3WA 1EFZA 1DE5A 1I8JA 1UZDA 3DUGA 5I5RA 4AZGA 3M16A 1PE1A 3BK0A 1FWBC 2ZE0A 3VU2A 2XN2A 3RX3A 3W83A 2Z29A 3A13A 4XD5A 2YZ5A 1V6YA 4M3PA 4AZIA 4HB7A 3TQKA 4GY0A 3WQCA 1SU5A 4OIFA 3GAKA 5C7VA 2ACQA 4K68A 5FL1A 1XJBA 3NPUA 3AMCA 1HP5A 3EEZA 1OYAA 1MFUA 3NSXA 3Q2DA 3W7EA 4DO4A 3KBSA 3W7QA 3BLLA 1E6NA 1XRFA 3GTXA 3PG8A 5BRBA 1OVDA 1THFD 3MMWA 3CU2A 1ME7A 3W29A 5JVLA 3URQA 1WDRA 1XLIA 2ALRA 2WVTA 1HKKA 2WPGA 1OFBA 4Z2JA 1FOBA 3S9IA 4F0LA 3ES7A 2NV2A 3VKKA 1MNSA 2WCGA 4JQ1A 3W27A 2V63A 1WCGA 2W79A 3A24A 4YVPA 2BVDA 1XHGA 1RK6A 2ZWZA 5DO8A 3IK4A 3PB0A 2PTYA 4H00A 3REQB 1RD5A 3QYSA 3VILA 4Q8WA 1NQKA 3UJSA 3DG7A 3S6DA 4HMEA 3W9ZA 2DSZA 3K8MA 1Q7ZA 2PDIA 3G3MA 1XH2A 3HBLA 1JQXA 3MCOA 1TV4A 5M3WA 4NNAA 4A22A 2BZNA 3TMLA 2WNNA 3RYSA 1NFPA 3AZTA 1OABA 1NDVA 4R7OA 3QMSA 2G5WA 3L2IA 1K70A 3WMLA 2YBVA 3AOFA 4HT3A 4RZBA 5JQ9A 1CXIA 3GB6A 3PF3A 3TN4A 3B9DA 1UP0A 3KBWA 3ARPA 5LIKX 4DZIA 1S5TA 5H8PA 3ZMRA 2C1IA 1T96A 2ZUVA 3BG5A 3N14A